GenomeNet

Database: RefSeq
Entry: NC_036025
LinkDB: NC_036025
Original site: NC_036025 
LOCUS       NC_036025            1745387 bp    DNA     linear   CON 23-OCT-2017
DEFINITION  Kluyveromyces marxianus DMKU3-1042 DNA, complete genome, chromosome
            1.
ACCESSION   NC_036025
VERSION     NC_036025.1
DBLINK      BioProject: PRJNA264644
            BioSample: SAMD00067077
            Assembly: GCF_001417885.1
KEYWORDS    RefSeq.
SOURCE      Kluyveromyces marxianus DMKU3-1042
  ORGANISM  Kluyveromyces marxianus DMKU3-1042
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1
  AUTHORS   Lertwattanasakul,N., Kosaka,T., Hosoyama,A., Suzuki,Y.,
            Rodrussamee,N., Matsutani,M., Murata,M., Fujimoto,N., Suprayogi,
            Tsuchikane,K., Limtong,S., Fujita,N. and Yamada,M.
  TITLE     Genetic basis of the highly efficient yeast Kluyveromyces
            marxianus: complete genome sequence and transcriptome analyses
  JOURNAL   Biotechnol Biofuels 8, 47 (2015)
   PUBMED   25834639
  REMARK    DOI:10.1186/s13068-015-0227-x
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1745387)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1745387)
  AUTHORS   Yamada,M. and Kosaka,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2011) Contact:Mamoru Yamada Yamaguchi University;
            1677-1 Yoshida, Yamaguchi, Yamaguchi 753-8515, Japan URL
            :http://ds22.cc.yamaguchi-u.ac.jp/~jo-sei08/index.html
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP012213.
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps and the
            genomic and proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: SPS phrap v. 0.990329
            Assembly Name         :: Kmar_1.0
            Genome Coverage       :: 8.4x
            Sequencing Technology :: Sanger ABI3730
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1745387
                     /organism="Kluyveromyces marxianus DMKU3-1042"
                     /mol_type="genomic DNA"
                     /strain="DMKU3-1042"
                     /db_xref="taxon:1003335"
                     /chromosome="1"
     gene            <4051..>8025
                     /gene="TY2B-GR2"
                     /locus_tag="KLMA_10001"
                     /db_xref="GeneID:34713686"
     mRNA            <4051..>8025
                     /gene="TY2B-GR2"
                     /locus_tag="KLMA_10001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817806.1"
                     /db_xref="GeneID:34713686"
     CDS             4051..8025
                     /gene="TY2B-GR2"
                     /locus_tag="KLMA_10001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673541.1"
                     /db_xref="GeneID:34713686"
                     /translation="MLDGGATVSVIYDKKLIHNFTSQSNQILVDVQQNEVAVKGEGNL
                     ELKFKGKRISLPAIYAPSTHTNIISVEDLTKSQAYLDLRRNCLLSKNGKTIAPTHKFA
                     GLRWLSRKNAIELPNQTQSVYAITPRSVRSAPDKFSLTSIHNMFGHMNINYIRESFRK
                     GLIQGVKEDDVDWTGVSSFQCQYCMEGKAKRNNHYVNARKDYTKEYLPFEYLHTDVFG
                     PVRVQRTRTTPRYFIAFIDEVTKYIWTFPLLHKTAEEVAPTFKEVVMLIYTQFNTRVK
                     TIQMDKGSEYLNTKVQKFLRERGIVSRETTVADSKANGAIERQHYTLLNDCRTFLRQA
                     NLRPRLWYHAVVYSTVMRNSLLNRSIGTSPRNRAGMSGLSFRDILPFGQPVIVHLPNP
                     KSKLQARGVLGYALHPSTRSYGYIIVVGKKKKIPIDTRNYRVLNYPPGATISEDEVQY
                     MIDRMENNDAESQGDIESNFEPNYTDMEQPIHHTADYFPNTTASNIETDQYNNDSFGL
                     HYGGDSVPPESSSSEDELFPTDESENDSDSSDQSFNDDGDPMSPPYSGGEEQLVPTAA
                     PIRRVPPMEPPSPVEDSPPPLSGTDLDDLFGESNINNYIPEDTDLLALNHESVPEPDT
                     AVPATTNIEQDNVLPLETNENSNPPNDSSDQSGDESGEQSGEESGEESVDNRLKSIPI
                     FNGNKHKDARIAEADLDSLYGGGDNTENNNGPTLEEVFRSIEEDPFMLTQKRPRSRAR
                     YRESNQDSCDSGSDYESSSDSDGSSDESPQKGRKIQRVNYVNAVQKPVSVIPLNMSLN
                     YSQAISRNRNEEEKDAFQKAYQKEIAQLTKMNTWNEELIDASTLPKKKILNSMFIFTT
                     KRDNSKKCRLVARGDQQAADTYDTELKANTVDNLALMTVLALTLDYNLTAFQLDISSA
                     YLYADLKEELYIRAPPHMNAKNKVLRLNKSLYGLKQSGANWYELIRSFLIKKCDLIED
                     RMWKCVFRDKEPLKLIICLFVDDMLVVGNDVKYIKKFISKLSKRFDTKIVNDGSHRPE
                     DGVNEYDILGIELEYKKKEYMKFGMQKSLEDKLPQLGIPLLPNAKIRKVPGVPGDYIF
                     SGKELKLNEREYKSKVKHLQRIVGLASYVGHKFRFDILYYVNILAQHQLYPSAKVLDR
                     AAQLCQYLWDTRDKKLVWHYSGPKENNVTAVSDAAFAGNQDFKSQSGTLYLRNNKPIA
                     AKSRKIKLTCISSTEAEIYAISESLPILRGLEHLVNKLQDIKATVKVKTDSQPSMAII
                     NGTDDSACLKKHIGSRAMRIRDECDDLGLTLEYIPTKENNADVLTKPLSVKLFKLLTE
                     DWIQ"
     gene            <8351..>8713
                     /locus_tag="KLMA_10002"
                     /db_xref="GeneID:34713687"
     mRNA            <8351..>8713
                     /locus_tag="KLMA_10002"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818917.1"
                     /db_xref="GeneID:34713687"
     CDS             8351..8713
                     /locus_tag="KLMA_10002"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673542.1"
                     /db_xref="GeneID:34713687"
                     /translation="MASNDIISTNVPSKVPTTDTEEYPVQHTRPNSEHSFSKFVLPSP
                     LHLVHPPHLSSLPSLFCMLPALYYTSLFPLFPISETSFFMFFSFYSCDVTFSCILLSF
                     FHLLFQLPVFLRIHFLLW"
     gene            <8963..>9364
                     /locus_tag="KLMA_10003"
                     /db_xref="GeneID:34713688"
     mRNA            <8963..>9364
                     /locus_tag="KLMA_10003"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820028.1"
                     /db_xref="GeneID:34713688"
     CDS             8963..9364
                     /locus_tag="KLMA_10003"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673543.1"
                     /db_xref="GeneID:34713688"
                     /translation="MFLLLPGCVSLPNPTLLTVFPFHSFLPLLQLLIFIFFLITSHGA
                     NIPTSPLSFSSLYSFPHNQSSVTRTIHNPKLSFPAPSYLPTTHSKLHLKPHCHLPSYP
                     DTPSYHVPPLSSLFHFLHHHFTRHEPTLFSP"
     gene            <10040..>10720
                     /gene="Nqo2"
                     /locus_tag="KLMA_10004"
                     /db_xref="GeneID:34713689"
     mRNA            <10040..>10720
                     /gene="Nqo2"
                     /locus_tag="KLMA_10004"
                     /product="ribosyldihydronicotinamide dehydrogenase
                     [quinone]"
                     /transcript_id="XM_022821139.1"
                     /db_xref="GeneID:34713689"
     CDS             10040..10720
                     /gene="Nqo2"
                     /locus_tag="KLMA_10004"
                     /codon_start=1
                     /product="ribosyldihydronicotinamide dehydrogenase
                     [quinone]"
                     /protein_id="XP_022673544.1"
                     /db_xref="GeneID:34713689"
                     /translation="MGKNVFIVFAHPERNSLNGCLLDVLVDQLTSQGDHVKVSDLYRM
                     NWKSEVDIADFPAYPADQKFNPELASKNHTANGTLTKDVVEEQQKLLWAHTILFVFPI
                     WWFNLPAILKGYIDRVFSNGFAYNYSEHPELSDPQVLKTKTVSGRNASLVVTLGGSPE
                     NAYKPGNPGDPNEVVSKLLSATLTSLEYSGINVIDPLYLYDANTQSEAKVKEFQTQAR
                     KFASDLPN"
     gene            complement(<10967..>12631)
                     /gene="BIO5"
                     /locus_tag="KLMA_10005"
                     /db_xref="GeneID:34713690"
     mRNA            complement(<10967..>12631)
                     /gene="BIO5"
                     /locus_tag="KLMA_10005"
                     /product="7-keto 8-aminopelargonic acid transporter"
                     /transcript_id="XM_022822192.1"
                     /db_xref="GeneID:34713690"
     CDS             complement(10967..12631)
                     /gene="BIO5"
                     /locus_tag="KLMA_10005"
                     /codon_start=1
                     /product="7-keto 8-aminopelargonic acid transporter"
                     /protein_id="XP_022673545.1"
                     /db_xref="GeneID:34713690"
                     /translation="MSVSDSSSSLGASQKAGKLAHNYSWWPLIGMSFSLTNSWLGVSS
                     SFVVGLSGAGQPAVVYGLIFAFVLTLMCGYSLSEFSRLLPNSAGTSFWTLKLLERSAV
                     GDVEELSVREKSSSALDISKLSQKEDETTDDKLLKLSTMDSNSCRSSFQKHMAIAVGL
                     INYFGCVFTTASIVSSLIYSIMGIHSILHPSFELKRWHTFLLYEILTIFLTAFNCNYR
                     GLPFLSSFGLAMSLFSYAITFILCLVSRSDTIAEQPWPKSEDIFYKFHNNTGWKSNGM
                     AFLVSLINPLWSFVGIDSATHMVDEVGHAAARVLVPKVIMTTIVIGFVTSFSYSIALF
                     YCVRDTSAVLESIAPAVTIYYQATGNRNLAVFMQASTIVAGLTCGVASGTWQSRMLWA
                     LSREMEAMRPEGTLSRLVTARFASIDSKNKVPLYAHLFSQVLVAIIGCIMLGSTKAFN
                     AIISAAVTLLIVSYAIPSVILLVRGRNRFIEKCEREAGDEAVKAPSKWGVIPHTMTVV
                     YALFCLVMLSFPYVKPVTVSNMNYVSVVYGAIAMIIGLVIVLFSSI"
     gene            complement(<12937..>13623)
                     /gene="BIO4"
                     /locus_tag="KLMA_10006"
                     /db_xref="GeneID:34713691"
     mRNA            complement(<12937..>13623)
                     /gene="BIO4"
                     /locus_tag="KLMA_10006"
                     /product="dethiobiotin synthetase"
                     /transcript_id="XM_022822303.1"
                     /db_xref="GeneID:34713691"
     CDS             complement(12937..13623)
                     /gene="BIO4"
                     /locus_tag="KLMA_10006"
                     /codon_start=1
                     /product="dethiobiotin synthetase"
                     /protein_id="XP_022673546.1"
                     /db_xref="GeneID:34713691"
                     /translation="MTKIIFVTGTGTDVGKTFISALLVHRLKADYWKPVQTGLECDTG
                     DTRTVSMFPTELTGWKPKLFPPRFQFKKPLSPYNAMEFESDIDIELEDFCIPSADDLQ
                     NDVLVVEGAGGLFVPITKKLEITTDLIRSLIERYPQHEISIVVVADSGLGTLNHTMLT
                     VEHLKHHGLDKNFSGCILNGTINAINAKTLRSFGVNILGEIERCETTQDLGTALKKMP
                     GLDSLYVDSK"
     gene            <14146..>15615
                     /gene="BIO3"
                     /locus_tag="KLMA_10007"
                     /db_xref="GeneID:34713692"
     mRNA            <14146..>15615
                     /gene="BIO3"
                     /locus_tag="KLMA_10007"
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /transcript_id="XM_022822414.1"
                     /db_xref="GeneID:34713692"
     CDS             14146..15615
                     /gene="BIO3"
                     /locus_tag="KLMA_10007"
                     /codon_start=1
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="XP_022673547.1"
                     /db_xref="GeneID:34713692"
                     /translation="MNDNKPKSNNVNDINALLAFDKAHIWHPYSSMNSNQIILPVLRA
                     KGCKLTLADEQETQLIDGISSWWCMIHGYSDERMNEALKTQIDDFSHVMFGGLTHLPA
                     IRLVQNLLKFIDHPQLDAVFFADSASVAVEVSLKMALQYQFSLNCPKKKKFISLKLGY
                     HGGTMGAMSVCDPVNSMHHFLFSDYVPQNIFVTEPPMVDMLCTSSLYGSFQLGDNYDD
                     ETNRKAIKDMEETMNSCHEEICAVILEPILQGAGGMRLYHPKYLIELKKLCLKFDIPL
                     IFDEIATGFGRTGEAFAFKHCDVYQKMIGTPASEIVDVFPDILCVGKALTGGYMTMSA
                     VITSKRIANVISAKDTATKGTFMHGPTFMANPLACAAANASLDILMEGNWKDMVARIE
                     AQLYRELYVELRNSHLYGKLIKNLRVVGAAGVIELFEPIDGAFVQKRQVIKGIFIRPF
                     GKLVYIMPPYIISGEELTILTTGIKQLLLEWSAYKIGNY"
     gene            <16479..>18323
                     /gene="ARN2"
                     /locus_tag="KLMA_10008"
                     /db_xref="GeneID:34713693"
     mRNA            <16479..>18323
                     /gene="ARN2"
                     /locus_tag="KLMA_10008"
                     /product="siderophore iron transporter ARN2"
                     /transcript_id="XM_022822525.1"
                     /db_xref="GeneID:34713693"
     CDS             16479..18323
                     /gene="ARN2"
                     /locus_tag="KLMA_10008"
                     /codon_start=1
                     /product="siderophore iron transporter ARN2"
                     /protein_id="XP_022673548.1"
                     /db_xref="GeneID:34713693"
                     /translation="MSDIREKDKQVGTAEEEGDFQEKALKEIPRNVYGHVDRLVSTRS
                     LVIRKAELMARQYERWYLQLLFLCCAFICTYGYSLGSTVRSSYMTFATNSYKTHSLLS
                     TISIINLVISAVSQLFFAGLSDVFGRISLLIISTIFYIVGTVIQSQAYDIQRYAAGSV
                     FYNVGVVGVMLQVTLFLSDNSSLKWRLLYAFVPAWPSIINVWVSGNIVDMNNPLLNWS
                     WGIGMWAFIGPLTTLPLFCCLLHMRYLASKTEEWQQLLKEKTFYEKNGLVQTLVQLFW
                     KLDIIGLMLFVVSTGCILVPLTIAGGVSNKWKTVKIVLPLVLGFALLPGMIYWESKCA
                     RNPFAPFKLIKDRGIWAPIAMNFMVCFVYQMACGYLYTILIVAMNQSYMAATRISTLY
                     AFSAGLFSPFFGFLVAKSRRLKFYMVIGCGMYFIIMGLFYHFRGGDNAAKGIIGAMTI
                     WGIATCMYNYPITTAAQSVTSHEHMATVTAFLLTVYRIGGAVASAISGAIWTNSLYSK
                     LLDNMGDEELASAAYQSPLTFITLHKWGTPTRQAMVEAYRAVQRYEVIVALAIVAPMF
                     IVTLCLRDPELVDDYGQKLEDGEFVNKHSDDKISEWLLDKLRWFRNKE"
     gene            complement(<19993..>21525)
                     /locus_tag="KLMA_10009"
                     /db_xref="GeneID:34713694"
     mRNA            complement(<19993..>21525)
                     /locus_tag="KLMA_10009"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822636.1"
                     /db_xref="GeneID:34713694"
     CDS             complement(19993..21525)
                     /locus_tag="KLMA_10009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673549.1"
                     /db_xref="GeneID:34713694"
                     /translation="MPRKKLNHQEQDSLLSESHKEWTSLLKEGVFIMVLCSAQLMTQA
                     GLAQSIVPLQIIGDSFGIKKPGQLSWFASSFSLTVGTFILIAGRLGDTFGHKKFFVMG
                     FLWFGLWSILAGFSVYADHIFFDCCRAFQGIGPAFTLPNAIAVIGRTYRPGRKQSVVF
                     SLFGACAPSGFVLGAVFSSLLSEFAWWPWTYWIMGITCFLLGISGYLIIPHHAPIHAN
                     EKSSLMERIDLAGSVTGVLGLVLFNFAWNQGPVVGWKTSYTYALLIVGSAFLVVFGFI
                     ESRAKYPLLPVHKLSTDTIFVMACIAAGWASFGIWVYYTWLLMTNLRHQNPLLSSAQF
                     VPVALSGLCAAMSTGYILARTSPSTVMIAAMIAFVVGSVLVATVPVSQIYWAQTFVSF
                     VVMPWGMDMSFPAATIILSNAMPASHQGLAASLVNTAINYSISIGLGVAGTIESQISH
                     GEPDLLKGYRGAYYMGIGFASLGAGVSVLYAIFNYANSKELSLKVMCRRPFPFLRQKV
                     SG"
     gene            complement(<22846..>24705)
                     /gene="ARN2"
                     /locus_tag="KLMA_10010"
                     /db_xref="GeneID:34713695"
     mRNA            complement(<22846..>24705)
                     /gene="ARN2"
                     /locus_tag="KLMA_10010"
                     /product="siderophore iron transporter ARN2"
                     /transcript_id="XM_022817807.1"
                     /db_xref="GeneID:34713695"
     CDS             complement(22846..24705)
                     /gene="ARN2"
                     /locus_tag="KLMA_10010"
                     /codon_start=1
                     /product="siderophore iron transporter ARN2"
                     /protein_id="XP_022673550.1"
                     /db_xref="GeneID:34713695"
                     /translation="MTKSKRSMTFEGEIFQIEELEGDGSKQNDLKQQTLINRRTADKM
                     KNTKSLVIRKTEIMAKQYDTWYLQGIFLISAFICSYGFALDSSIRDIYMTYAANSYNT
                     HSLLSTISIVNMMISAVGQVFFAGLSDVFGRLSLFIVAIVFYVVGTVIQSQAYDIQKY
                     CAGSVFYNVGLVGAMLQVTLFLSDNSSLKWRVLYNFVPAWPAVINMWVSGNIVKAADP
                     LKNWSWSIAMWAFIFPLSCIPLVVCILHMRWLAKKSEEWKELQQEKTFYQTHGMTKTI
                     VQLFWRLDVVGLILLTISVGCILVPLTIAGGVKSEWNTGKIISPLVIGVIMVPITVYW
                     ESRWATAPFAPFKLVKDRGIWAPICMYFLVCFVYQMAAGYLYTILLVGMNQTDLSATR
                     IMNIYSFVSAIYSPFFGFIVAKTRKLKFHMLIGSSLYFVVMGLFYRYRGGESSTAGVI
                     GAMVIWGFASCMYDYPVTVSAQSVTTHENMATVTALMSTTFSIGGAVASAVSGAIWTN
                     LLYPKLLKNLGNPDLAEMAYNSPLDFIVDYPWGTPIRKAMVEAYKYVQKYEVLIGLVF
                     CVPMMILTFCARDPELTDGYGQKLEDGEYVQKEQEDPISDWLKNCFKSLKRRH"
     gene            complement(<26431..>27972)
                     /gene="FEN2"
                     /locus_tag="KLMA_10011"
                     /db_xref="GeneID:34713696"
     mRNA            complement(<26431..>27972)
                     /gene="FEN2"
                     /locus_tag="KLMA_10011"
                     /product="probable transporter SEO1"
                     /transcript_id="XM_022817918.1"
                     /db_xref="GeneID:34713696"
     CDS             complement(26431..27972)
                     /gene="FEN2"
                     /locus_tag="KLMA_10011"
                     /codon_start=1
                     /product="probable transporter SEO1"
                     /protein_id="XP_022673551.1"
                     /db_xref="GeneID:34713696"
                     /translation="MSKMTIKKIESDSSEREKNIVNIDEVSSTSSREIEKRQENKIGT
                     KKFGVSFRWHEPGTSSKEKWLIFKLDVFILTYSCLAWFLKYLDQQNITNAYANGMKED
                     LKLNQNQLSWLNTYFSIGSIIGSIPAALLITKFRPNIYLPAVDFLWSVFVLLLYKCTK
                     VEQMYALRFFCGFAESSANPCIHFLLGSFYKKSELGRRSAFFIISGVISQAISSFIMN
                     GLNKSLDGKNGLPAWRWLFIIDFIIGIPIVIWGYFAIPQLPSQGAKAFYLNKWERERI
                     VERIEEDGRTQTDEKWSKSTLYRMIVAWQPWAFTLAYSFWQLTAASYSMQFFTLYLKA
                     KKTYTQTQINYIPDGISCVNLITMIASGIVIDIIGKRWQVCLFVGTLLTVAFAILRSS
                     NEGVKIRFFGYILTGVYGCFTPILSGWANIACKNDPKLRAFSLSVMIAIGTAAGTPFQ
                     QYVFPSSQAPFYRKTGGFSYSVAFTVLLTVGTGIGIPLIESRFEKTEKTEKNEEQPFP
                     LELEA"
     gene            <28792..>32619
                     /locus_tag="KLMA_10012"
                     /db_xref="GeneID:34713697"
     mRNA            <28792..>32619
                     /locus_tag="KLMA_10012"
                     /product="uncharacterized protein C11D3.14c"
                     /transcript_id="XM_022818029.1"
                     /db_xref="GeneID:34713697"
     CDS             28792..32619
                     /locus_tag="KLMA_10012"
                     /codon_start=1
                     /product="uncharacterized protein C11D3.14c"
                     /protein_id="XP_022673552.1"
                     /db_xref="GeneID:34713697"
                     /translation="MKDPKLQIAIDRGGTFTDVWAKIPGKEEIIFKLLSEDPSNYEDA
                     PTEGVRRVMEVFSGDQIPKGTKLDGSLIEWIRMGTTVGTNALLEKKGDKFLYVTTENL
                     GDVLEIGTQARPELFNLNVKKPTPLYTEILEVEERVTIENSSDDPNQTKICHDEKERV
                     FLTKSGIYIKVLKELNIRKTTEKLEEFYRKGYRNIAVCLAHSSIYDKHEQEIKHIAAE
                     IGYEYISLSSELATSMGLLQRGNSACINAYLTPTIQKYVKRFSDAFKNPPIIDFMKSD
                     GGLVKAEDLNGLNSILSGPAGGAVGFAKTSYDGKTPVLGFDMGGTSTDVCRFDHQLEV
                     IYENKIAGVDVVAPQLQIHTVAAGGGSVLKFENGLFHVGPESSSSNPGPACYRKGGPL
                     TITDANLVLKRLELDQFPRIFGPNANEPLDQNVTEIMFQELTDKVNYELKTNFTKHEV
                     AIGFLEVANEKMARSIREISEARGFSTNDHILAAFGEAGGQHCCAVARILGIKTVVQH
                     KYSSILSSYGMALAEKTNELKRPYDQKFLPETLQDCQKKLEEMSVECSACFTSGTYSE
                     DTVKPLVEKSVGLRFKGSNTIIQIFIKDESDYSSVVKSFLQTHKREFGFLPPLSTDVL
                     VNYIRVKSSLKADSDKCDYNYKAEVEQYRKNGLIKPVPSGQQSIYFGKHPTVTNLYHL
                     KDLKDGMVIEGPALLTTETQTLLVEEGCTAILTANYIVIEIGNNAEKGDLSTQKLGSI
                     EIDNPAMLSVFGNRFMGIAEQMGRTLQRTSISTSIKERLDFSCAIFSSDGGLVANAPH
                     IPVHLGSMQYAIEYQHKLWKGRLKPGDVLLSNHPEAGGTHLPDLTVITPVFDKNEVVF
                     YVASRGHHQDIGGIGITAMIPNSKELWQEGVSIKSFKVVKEGAFDEDGIRELFEIPAK
                     FTGSSATRNIENNISDLKAQVSANQRGINLLYDLIKEYGFPLVEYNMKSIRKNAENVV
                     RDFLRNQARINSNKIISAVDYFDDGTPIKVQIKIDGEKGEAFFDFEGTGEEVYGCMNS
                     PPSITYSCVIYVLRCLIDKDIPLNQGCLAPCTFNIPKGSILNPTEFVAVCGSTISGQR
                     ITDVILKAFGSCAASQGCANSFGFGTGGKDPLTGETQKGFTYAEAIGGGVGAGPWGCG
                     ADACNVHCTNTRTTDIEIIEARTPVIITEWKIRKGSGGKGRYYGGNGCVREIEARIPL
                     RVSILSERRVFAPYGLEGGEDGARGLNFWFRKKEDGSYAKTRIGSKEIFHVSTGDRVQ
                     INTPGGGGYGLPT"
     gene            <34715..>35272
                     /locus_tag="KLMA_10013"
                     /db_xref="GeneID:34713698"
     mRNA            <34715..>35272
                     /locus_tag="KLMA_10013"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818140.1"
                     /db_xref="GeneID:34713698"
     CDS             34715..35272
                     /locus_tag="KLMA_10013"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673553.1"
                     /db_xref="GeneID:34713698"
                     /translation="MLEQYDKRVQELESELEAQKEFKEKYQSLAKLYSQLRQEHLNVL
                     KKVKKLQDDLNDSRNEVSDLKKEAKSKGKGIDRSGMILKSLVESSIKSLQDPIASLDV
                     SDLATDLSNAFIDGDINTIVNILPEFVSLLLRCPQEMQTIAEDFLRCLSSAKQTDSVI
                     NANIAFQEKLKIRQYSYRYGDSDEV"
     gene            complement(<35333..>36112)
                     /gene="MATALPHA1"
                     /locus_tag="KLMA_10014"
                     /db_xref="GeneID:34713699"
     mRNA            complement(<35333..>36112)
                     /gene="MATALPHA1"
                     /locus_tag="KLMA_10014"
                     /product="mating-type protein ALPHA1"
                     /transcript_id="XM_022818251.1"
                     /db_xref="GeneID:34713699"
     CDS             complement(35333..36112)
                     /gene="MATALPHA1"
                     /locus_tag="KLMA_10014"
                     /codon_start=1
                     /product="mating-type protein ALPHA1"
                     /protein_id="XP_022673554.1"
                     /db_xref="GeneID:34713699"
                     /translation="MKSKAPTFKVTITKHNSTIKKSSKKKTTLSPKKIIQSSGYRKHE
                     GVNLYMSKSYPTSIPDPPQSLISYLKKKLTNVDANEIVGTLISSNELDSRPKKNKPKR
                     QINDFIAFRSYYSRILNGLVSQTELSSIISKHWTVDKQTRKMWEIIAQEYNCDRTNNN
                     FFEWLRNNYVINKDWLFEIIKFDDYMVLKSQKPYIENIYKTGHKQVLDFSSEVKESEG
                     NGNNQIDFFVDPIFLDYELSTENYDKFNLAFPDTQTLVNTI"
     gene            <36379..>37056
                     /gene="HMLALPHA2"
                     /locus_tag="KLMA_10015"
                     /db_xref="GeneID:34713700"
     mRNA            <36379..>37056
                     /gene="HMLALPHA2"
                     /locus_tag="KLMA_10015"
                     /product="mating-type protein ALPHA2"
                     /transcript_id="XM_022818362.1"
                     /db_xref="GeneID:34713700"
     CDS             36379..37056
                     /gene="HMLALPHA2"
                     /locus_tag="KLMA_10015"
                     /codon_start=1
                     /product="mating-type protein ALPHA2"
                     /protein_id="XP_022673555.1"
                     /db_xref="GeneID:34713700"
                     /translation="MSKIPVQSLLNPESPREHFYKTYEIEHKQSQLDRTIQNLLTEFK
                     RVFQLILLSREVFIQPNCVEIDDFVKKIRQTLIYERRGGEFNTIISKNVFNSVLCLLI
                     VLQEKQKISLLENNILSKVESFKERRSENTNTVEFRILSSEHLNPTLNKVGKKNRFPK
                     KSIKLLENWYECNRNSPYLTSNHLDYLECNTGLNKTQIKNWVANRRRKDKNSRVSLDI
                     KNIFRQQ"
     gene            complement(<37393..>40104)
                     /gene="HMLALPHA3"
                     /locus_tag="KLMA_10016"
                     /db_xref="GeneID:34713701"
     mRNA            complement(<37393..>40104)
                     /gene="HMLALPHA3"
                     /locus_tag="KLMA_10016"
                     /product="mating-type protein ALPHA3"
                     /transcript_id="XM_022818473.1"
                     /db_xref="GeneID:34713701"
     CDS             complement(37393..40104)
                     /gene="HMLALPHA3"
                     /locus_tag="KLMA_10016"
                     /codon_start=1
                     /product="mating-type protein ALPHA3"
                     /protein_id="XP_022673556.1"
                     /db_xref="GeneID:34713701"
                     /translation="MTQVDISKWIIHPKGSFEFEERKKRLREERQKKLQEVKRANIVH
                     NDPNFQHFKNWLLKNGGCGEYINIYEFDFQDDQNISDTFKETSENYLHPLETDPFSKY
                     NADIKTEPFLNEKISDSLEKQVEIFQSVNEKNIFREIKTKDNKLIEECKCIREQLLEI
                     IRECTGYIFVRGWSGYRVNTLIFKSYCKQDKGYQVLKPREKVKKQHDPDNLKQFSCSS
                     TFSIHFNIKRKTVKLSFCHKMKHDILPVTKIPSSLKQFISTNLCFTARECFESLKRTP
                     IYAEFVKSFDAKNIVKKIWKEVSESQWNLDIDSTTSAIKILKRFEDTGEVSILSCVND
                     DSETKTSLNKSKPLAFIYEKVLLQIKEEVREIVIDSTFSLSTDFRQYFVVVANFFGKG
                     VPVGFMATKTNYIDQLTVSWFLKNILKRLPNVRCINSDWSLAEIKGIKSLGYYNQICL
                     FHTLTAIRCRRTASKNSLIQTYSKQLFKDLFSFPWVDQKKFDLSIYDMKYLEKITESQ
                     ARSIIKVVRLAICDHILFHSIGKKQIFNKSDSDNLKIYKVYEYHLRRIYELVVERFSL
                     PCFFCYLFNQYYNFTSFCLMSRVGKPDFFSNLRTSMMCESYFNQLKSWNLSGSKNYRI
                     DTFVYILLHKDLQKIKGNVKTTTKFEQKYDSTNLVHQHNKNLPTWRKQWVIEWKSLSR
                     ERQRKDSQMLEKECEHYGTQLKNWLCSCDSSILSPSSSCLHLNFLYSVLYPNYHGFEL
                     QRFGKRGNGLPLIKHKSLEENYQPDKGSMLSLSDEIQTNSSFEYLTSSIEEEQAEKMI
                     LETEFTLSSDIADTTEDSEAERDLEIFKFFLSDEETKSVILQSPQFKSIIYEMTYVIK
                     RKKEEPNWRPKTNSPEKGFKHQAWIRSLKYHQLYIDVKTEGSMPLPI"
     gene            <41705..>41866
                     /locus_tag="KLMA_10017"
                     /db_xref="GeneID:34713702"
     mRNA            <41705..>41866
                     /locus_tag="KLMA_10017"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818584.1"
                     /db_xref="GeneID:34713702"
     CDS             41705..41866
                     /locus_tag="KLMA_10017"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673557.1"
                     /db_xref="GeneID:34713702"
                     /translation="MYFFWFYFLKYILIIVPNSSIFFIEKCLLSELKVDNYVDIGRIK
                     SLESILTLF"
     gene            complement(<42735..>43811)
                     /gene="CHA1"
                     /locus_tag="KLMA_10018"
                     /db_xref="GeneID:34713703"
     mRNA            complement(<42735..>43811)
                     /gene="CHA1"
                     /locus_tag="KLMA_10018"
                     /product="catabolic L-serine/threonine dehydratase"
                     /transcript_id="XM_022818695.1"
                     /db_xref="GeneID:34713703"
     CDS             complement(42735..43811)
                     /gene="CHA1"
                     /locus_tag="KLMA_10018"
                     /codon_start=1
                     /product="catabolic L-serine/threonine dehydratase"
                     /protein_id="XP_022673558.1"
                     /db_xref="GeneID:34713703"
                     /translation="MNVLKINSSLFNKTPLLRHTFKKNSGPKILLKYEFLQPSGSFKS
                     RGIGHLISKRVEELYKRKPGIQGHVFASSGGNAGLAAAVASSELQIPCTVVVSKATRP
                     RLVEKIKSYGARVIVYGRHWKEADTYMRENLMKQVNTETHEPIYTHPFDNPLIWEGHS
                     YMVDEILNSLKNLNISADEVKGIVCSFGGGGLYNGIIKGLEKHNLAEQVPVVCAETKG
                     TDVLRASLIADKLVEFAEIKSCATSLGTANISSVAFENVKKYSSKSAVVSDKDVIETC
                     LQFSKDTNIVTEPGCGATLYFGYNPHRLQEILGTKFKEDDYVILIGCGGSSTNLKELQ
                     ELSRSFNTHIPLPQTQPNDVLYGS"
     gene            complement(<44249..>44524)
                     /locus_tag="KLMA_10019"
                     /db_xref="GeneID:34713704"
     mRNA            complement(<44249..>44524)
                     /locus_tag="KLMA_10019"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818806.1"
                     /db_xref="GeneID:34713704"
     CDS             complement(44249..44524)
                     /locus_tag="KLMA_10019"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673559.1"
                     /db_xref="GeneID:34713704"
                     /translation="MFASILVISIDLDNAMKLLLLREFMIYHYSESLYLLIHYLLFTF
                     FNFFSFFRHMHMRDAVFILYFPYDRFYVNKTKTFFLWFMCFLFLAVF"
     gene            <44653..>46137
                     /gene="VAC17"
                     /locus_tag="KLMA_10020"
                     /db_xref="GeneID:34713705"
     mRNA            <44653..>46137
                     /gene="VAC17"
                     /locus_tag="KLMA_10020"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818918.1"
                     /db_xref="GeneID:34713705"
     CDS             44653..46137
                     /gene="VAC17"
                     /locus_tag="KLMA_10020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673560.1"
                     /db_xref="GeneID:34713705"
                     /translation="MQRRSTHAGEGDLLERHYQSKQGPNRSHTMNGMRHVAERLVLRC
                     HEAIMQLELSIQQNMCEYDPNNRDGFIQIQEYYSFLARLTSLKLRAEHVQGSLHHEEK
                     DPNDVCVEYETLENLIYEFQDITLSLNEFARTHGSPAKSARSQSSKESSIMPLRPLRI
                     VERNRDSVELTAAIMQTVKEENEEKLRLGRKLPFLSPKKTVKFMDRDLNDLVQIERLK
                     RSSSLPGSPIPETLIESELTLKENRTLRMAKSYDVGLNDKKKTANFEFFKNKNRLSLS
                     VFDEIDTDASDEETVISVSPPAMSNYLLKTGEQKVTNTLRRYNSHESILSMKVPQKNT
                     LALYMKQTSPFVWQKNLIVSKATISSNTCNSTAAPTIESPCLSKDLLTQLIEPSPNAQ
                     RSSRKSWFESAKTMNLASSFFNKWFTSGNLVTKEIGNPNTTSPSRVRSIIKNKQPLAS
                     NNHSSSIVIGPNGTRFIRGLNDPLVTCTISYDELQDALNTEFKF"
     gene            complement(<46185..>49025)
                     /gene="MRC1"
                     /locus_tag="KLMA_10021"
                     /db_xref="GeneID:34713706"
     mRNA            complement(<46185..>49025)
                     /gene="MRC1"
                     /locus_tag="KLMA_10021"
                     /product="mediator of replication checkpoint protein 1"
                     /transcript_id="XM_022819029.1"
                     /db_xref="GeneID:34713706"
     CDS             complement(46185..49025)
                     /gene="MRC1"
                     /locus_tag="KLMA_10021"
                     /codon_start=1
                     /product="mediator of replication checkpoint protein 1"
                     /protein_id="XP_022673561.1"
                     /db_xref="GeneID:34713706"
                     /translation="MDLLDNLDISLNKRTKSYQKENDKDVEAELEINKPVLNVEKLVD
                     RVKNRLEGGNSNKFTALRTKELDNLASIDDNIYEGEQIDDEYLSMHNAPKSPRASTQT
                     QVIETESTSQTQIIQPGPAVTYNAQTNTQLQETQIYTQVIEKEYKNGYRNSMSTKTPL
                     NTNSIDLQNLRDNQTFPAEKSAPSSSFQFKLGRDPAYSLLSNTTGITENVHTTEVIPT
                     QLDTQNADTSSEREEQQKQEEKQEKQEENNEENISKKNIPIETIPLMITNKKYSPQQF
                     IDAFDESDSSSECKTSDYGNNVQDNKPISNHVEGSNDISIATKIRNENVTIKARNQTV
                     IELNSSSESEDDFNSISTKAALLVIKAKRSKNKKASTTSTPTPKTDSLKELFTSLKVK
                     NRKQILEHRKELSDKKGISIEAIENEKIQVEKLLEQELERNRRIKMKEKREREKSKTA
                     NQLSNTSEINESDVPESDVMESDISLLEDDVAQSSDPEDINDMNTEDGNIIDKKKIVN
                     PIIQDDEDEEENGKGASDSADHMNASTNGIGINLGHYGDNLDFTSAQERETDIEDEPI
                     PKLMIHSKRSSPGNRKLLLGELSSSSEESSDSYTSLNDEEKKELLLKAKLKRREEAKL
                     AKKRKAELKSSGINKIFEMEAEESEDEWHGVGGADGENSDDYDSELDDMLDDISRNKF
                     DTAAIRQKLAAENKELDEKMINKILHDIKTGGFRKRGKGALDLELSDDEDEFLREFRE
                     RRREEMRRKILANPDGLPNNEKSKAFFESMIEETDKTNVHTQPNHDQVEDNKKKLIIS
                     EEFVQSSLSFLSAKDDEINEFKLTRTTKGELEDLESLKQVSSIKVMESPDSRRKRTYS
                     DDVDEASVDFKLPSIIKSFSSNADINDKFKTGVKTVTVSKSYKVAAGSKSAVTFLRKK
                     RKLRAPKAHDSKKSLNRKSTSSLFDSNADSFS"
     gene            complement(<49405..>50364)
                     /gene="KRR1"
                     /locus_tag="KLMA_10022"
                     /db_xref="GeneID:34713707"
     mRNA            complement(<49405..>50364)
                     /gene="KRR1"
                     /locus_tag="KLMA_10022"
                     /product="ribosomal RNA assembly protein KRR1"
                     /transcript_id="XM_022819140.1"
                     /db_xref="GeneID:34713707"
     CDS             complement(49405..50364)
                     /gene="KRR1"
                     /locus_tag="KLMA_10022"
                     /codon_start=1
                     /product="ribosomal RNA assembly protein KRR1"
                     /protein_id="XP_022673562.1"
                     /db_xref="GeneID:34713707"
                     /translation="MVSTHNKDKPWDRDDIDKWHIEEFKPEDNKSGQPFAEESSFMTL
                     FPKYREVYLKSVWKDVTRALDAHHIACELNLVEGSMTVKTTRKTYDPAIILKARDLIK
                     LLARSVPFPQAVKILQDDVACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLT
                     KCYILVQGNTVSVMGPFKGLKEVRRVVEDCMRNIHPIYHIKELMIKRELAKKPELAEE
                     DWSRFLPMFKKRNVARKKPKKIKEKRVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEV
                     KKLQERREQQAVKHAEKESERAKNYIAPKEEEYKSTISKTDNK"
     gene            <50788..>51132
                     /locus_tag="KLMA_10023"
                     /db_xref="GeneID:34713708"
     mRNA            <50788..>51132
                     /locus_tag="KLMA_10023"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819251.1"
                     /db_xref="GeneID:34713708"
     CDS             50788..51132
                     /locus_tag="KLMA_10023"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673563.1"
                     /db_xref="GeneID:34713708"
                     /translation="MAKKNEKVKVPRREGTTTSNRLKINKKNVSKNSGKMNKKQNQLQ
                     IKQLDKLDLEITDINSVVKTKLNPVSSLESQKMKLHYKEDKKIVEDHDKVKKATEKNI
                     EDQLELISGFSL"
     gene            complement(<51662..>51910)
                     /gene="MOS1"
                     /locus_tag="KLMA_10024"
                     /db_xref="GeneID:34713709"
     mRNA            complement(<51662..>51910)
                     /gene="MOS1"
                     /locus_tag="KLMA_10024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819362.1"
                     /db_xref="GeneID:34713709"
     CDS             complement(51662..51910)
                     /gene="MOS1"
                     /locus_tag="KLMA_10024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673564.1"
                     /db_xref="GeneID:34713709"
                     /translation="MSEQIQTTNSVPSILDKRWDVVLSNVVAKTALGAGVGIVTSVLF
                     FKRRAFPVWIGIGFGLGRGYAEGDAIFRTNAGLRKVNA"
     gene            <52735..>54873
                     /gene="PRD1"
                     /locus_tag="KLMA_10025"
                     /db_xref="GeneID:34713710"
     mRNA            <52735..>54873
                     /gene="PRD1"
                     /locus_tag="KLMA_10025"
                     /product="saccharolysin"
                     /transcript_id="XM_022819473.1"
                     /db_xref="GeneID:34713710"
     CDS             52735..54873
                     /gene="PRD1"
                     /locus_tag="KLMA_10025"
                     /codon_start=1
                     /product="saccharolysin"
                     /protein_id="XP_022673565.1"
                     /db_xref="GeneID:34713710"
                     /translation="MRRILCKLGYIFATSTVRRPNSAFAQPQVTLARTIMTKTDFVVP
                     QAAPSWNFTPTQVIDKTNEAITSSNEFLDKLESITEPSVENFVKPYIDHENTISPLFN
                     QLTFLQHVSADKELRDASTKATELIENFGIESSLRFKLFKQFNAVWKQLKDDAIFKEK
                     SFEIYKFVEKCHKDFLRAGLDLPEEERNKVKEIKKKISNNSLLYSKNLGEQNGFIAFT
                     KDELEGVSEDVIKQFNTFEENGETKYKVTFKYPDIFPVLKYAKNPETRKRAFAGDQNK
                     VPENESLFLETLQLRNELAELLKYDTYANYNLDIKMAKKQETVLSFLTDLKEQLKPLG
                     QKEVESLKKLKEEECSEIGIPFDGKYYIWDNRYYDTQYLKKNFQIDEEKIAEYFPLDS
                     TIQGMLKIYETVLKLKFNEEENTDAWHPDVKKLSVWKMDDEVPEFVGWIYFDLHPREG
                     KYGHAANFGISSSYVKSDGSRSYPVTALVCNFSKPTKEKPALLKHSEITTFFHELGHG
                     IHDLVGGNAIGRFNGPGATPWDFVEAPSQMLEFWTWNKSELKSLSKHFETGEKIPDGL
                     LDSLVRTKHVNGALFALRQLHFGLFDMKVHTTKDFSKLDVTELWNNLREEVCLIDNGD
                     MMTKGFNSFGHIMSDSYSAGYYGYMWAEVFASDMYYTRFIKDPLNSEAGVQYRDIILK
                     RGGLYEIEDNLTEFLGRKPNNKAFLKELGL"
     gene            complement(<54890..>55483)
                     /locus_tag="KLMA_10026"
                     /db_xref="GeneID:34713711"
     mRNA            complement(<54890..>55483)
                     /locus_tag="KLMA_10026"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819584.1"
                     /db_xref="GeneID:34713711"
     CDS             complement(54890..55483)
                     /locus_tag="KLMA_10026"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673566.1"
                     /db_xref="GeneID:34713711"
                     /translation="MLGNDDTEKLLDATKKIKSLLPEKEVQEEEKTSISIEDWLIDSL
                     TSLSSFFDDLYLLRSFGIISDNNILYKKLNKGDLGSKVWLVSLILSVRRSLTHLMKLI
                     KLKWRLRKEDANIAHTYSPGFRKLLKERIAVEGDIISSKIRSLFMDLIQDLLYMLIVM
                     IDIFKVNLSKRLRSILEFISSAATVLKFVTTSYQVCS"
     gene            <57380..>58390
                     /locus_tag="KLMA_10027"
                     /db_xref="GeneID:34713712"
     mRNA            <57380..>58390
                     /locus_tag="KLMA_10027"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819695.1"
                     /db_xref="GeneID:34713712"
     CDS             57380..58390
                     /locus_tag="KLMA_10027"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673567.1"
                     /db_xref="GeneID:34713712"
                     /translation="MALAGKRSHLLVLREHTNNNSSTKSKLGKDVSIGGQSDGRFILS
                     RKRVKLNSERCKVSAEYSSPIDSDDDRNDTGYSSVDFDSMIHPSRKPELNFPDPSALA
                     QLVNCSASGSDNFNSRTKFKCENLANVASNTTSNESATEIRIQAADSNPNDTAVFSST
                     ASTANYLTTAVPRPLSRHSSCVVPQSDLLARERCFDYIVQSIDEVWARYCDTTSSAEN
                     QLYPYGYASPVSESDISGNESDSGYKSNTDTETDNEHRKVSNLPDSKELQSLKDRLTK
                     AKHALEQTVDSLQFQDCMLFWNRWDMIKYNAVEMMEEEDDDELVESVIEELEEGRWYN
                     ES"
     gene            complement(<58854..>59954)
                     /locus_tag="KLMA_10028"
                     /db_xref="GeneID:34713713"
     mRNA            complement(<58854..>59954)
                     /locus_tag="KLMA_10028"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819806.1"
                     /db_xref="GeneID:34713713"
     CDS             complement(58854..59954)
                     /locus_tag="KLMA_10028"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673568.1"
                     /db_xref="GeneID:34713713"
                     /translation="MDREVIQQDTAIFMAQILLEYVKQYIEGNDICIASIKEIQSKND
                     AIMESELLLETIVVENGGEYIIFEYIQMIENNSELELDSESIEILQSMIRKVVFSDFD
                     FVKVWLPKFFYQVPHSYNTGKILQDDFLGELLRNFDPNMMLIFVNICSPKFKEVETSK
                     LLKLIKIIIENNMNKGSSETIANILFTSLRQLSSFLPEIRNELCKDPPMALLESLKLC
                     INTDHEFITTYYLKQISPIVPNINNLTVLRDLIFDLGLSDINLSLSHIFNHTESWFGI
                     REDGLFWVLLDLKERREMDSHRLRAIDDIILMIIDFTKGRIDVLWNENLKVILPKMLM
                     SSLENNTNLKYMNSIYTTMKITAIMNDCSYNI"
     gene            <60536..>61507
                     /gene="KAR4"
                     /locus_tag="KLMA_10029"
                     /db_xref="GeneID:34713714"
     mRNA            <60536..>61507
                     /gene="KAR4"
                     /locus_tag="KLMA_10029"
                     /product="karyogamy protein KAR4"
                     /transcript_id="XM_022819917.1"
                     /db_xref="GeneID:34713714"
     CDS             60536..61507
                     /gene="KAR4"
                     /locus_tag="KLMA_10029"
                     /codon_start=1
                     /product="karyogamy protein KAR4"
                     /protein_id="XP_022673569.1"
                     /db_xref="GeneID:34713714"
                     /translation="MSAVLEEIYQKSSSDKKTIAKKHHSFKSANEFHTNDYSNNYIHT
                     QSPPQSHIRNIENTVDGYPKLQKLFNLKEKQIMQHATKPFGCRVEVDEIVPKLNEWIQ
                     KDNITFDVVMVGCLTENQFIYPLLMQLPINRLISKPGFLFVWGSAQKINELSRLLNNE
                     VWAKKFRRSEELVFVPVNKSSPFYPGLEADDESLFDKMQWHCWMCITGTVRRATDGHL
                     IHCNIDTDLAIETKNNKVGPIPSQLYKVTENFSTATRRLHIIPARTGSETPIRMRHGW
                     VIMGPDVLLDNFDANEYKSEIERVGSNLPKESTVETLRPKSPAPGKN"
     gene            complement(<61697..>63214)
                     /locus_tag="KLMA_10030"
                     /db_xref="GeneID:34713715"
     mRNA            complement(<61697..>63214)
                     /locus_tag="KLMA_10030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820029.1"
                     /db_xref="GeneID:34713715"
     CDS             complement(61697..63214)
                     /locus_tag="KLMA_10030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673570.1"
                     /db_xref="GeneID:34713715"
                     /translation="MSKNSFDSIEFRQTPPAEAPEPISSKYGVKTTASPAIKNAPLPA
                     EGPSSKQFSNLLLIALIVIVPFYVTRKVGGGLKCFLFFGLLFFFPILMTFWTVASTYS
                     PRLNEKCKLPGRPIEYYLTFHDDSLKEKYHGRKIPMETFHELFFANKVSFNFDALEVM
                     EYRHDWAQFSFTLSLFKFFLLGMIPEVIMHTRSQDEEQVRDHYDRGDDFYSWFLGSRM
                     IYTSGLISDIEKEESLEQLQENKLKVVCDKIDLKPGEYMLDLGCGWGTLVSYASKVYG
                     AKVTGITLGRNQTKWGNDKLKLQGIKPEQSRVLCMDYRDTPLATEDGKKYDKITCLEM
                     AEHVGIRKFGGFLQQVYNMLDDDGIFYLQYAGLRKSWQYEDLIWGLFMNKYIFPGADA
                     STPLDFVVSKLEASGFEVVSIDNIGVHYSATLWRWYRNWIGHKDDVVNKYGVKWYRIW
                     EYFLAYSTIISRQGSATCYQIVLRKNLNAYHRINYVPKQKGLLTPVREGIEQWFK"
     gene            <64045..>66552
                     /gene="SPB1"
                     /locus_tag="KLMA_10031"
                     /db_xref="GeneID:34713716"
     mRNA            <64045..>66552
                     /gene="SPB1"
                     /locus_tag="KLMA_10031"
                     /product="adoMet-dependent rRNA methyltransferase SPB1"
                     /transcript_id="XM_022820140.1"
                     /db_xref="GeneID:34713716"
     CDS             64045..66552
                     /gene="SPB1"
                     /locus_tag="KLMA_10031"
                     /codon_start=1
                     /product="adoMet-dependent rRNA methyltransferase SPB1"
                     /protein_id="XP_022673571.1"
                     /db_xref="GeneID:34713716"
                     /translation="MGKKTQKKNSKGRLDKYYYLAKEKGYRARSSFKIIQINEKYGHF
                     LEKSKVVIDLCAAPGSWCQVASNLCPVNSLIIGVDIVPMKPMPNVITFQSDITTEDCR
                     SKLRGYMKTWKADTVLHDGAPNVGLSWAQDAFTQSHLTLQALKLAVENLVVGGTFVTK
                     IFRSKDYNKLIWVFQQLFEKVEATKPPASRNVSAEIFVVCKNFKAPKKLDPRLLDPKE
                     VFEELPDGPQNMEAKVFNPEKKVRKRGGYEEGDYLLYHETALMDFVKTEDPITMLGEF
                     NKFLVDEDDHEWKIVKKLKQTTKEFLACIEDLKVLGKKDFKMILKWRKAARELLGLDQ
                     DEEKEEIEETPLTEEEQIEKELQNLQEKQRLAIKREKRKKNEMKQKEIVRMQLNMINP
                     VDIGIEAAELGRESIFNLKSAEKTGILDKLAKGKRRMIFDKEELAEDNDIHIDENAPL
                     EDRDELAEADELESQLDGMYRNYKERKAERDAKFRAKQAREAGEADNWEGFKETPSDE
                     ELEDGEKDYVNDDDDSELSDSDDDEAINQLIAKLKSRENGSKLSSKARALFSDSLFEG
                     VEPDLPGTNGGVADSESVGDIKQLTKKRKLNPTEPQQQDSSSSSDDDSDFEIIPNNEE
                     KEVDSDYDSEEEERRTNKEKHSKEIDIATVEAMTLAHQLALGHKTKHDLVEEGFNRYS
                     FRDTENLPEWFIEEEKQHSKINKPITKEAAIAIKEKLKALNARPIKKVAEAKARKKHR
                     AVARLEKLKKKAGLINDDSDKSEKDKAEEISKLMKKVTKKAKQRPKVTVVVASGKNRG
                     LSGRPKGIKGKYKMVDGVLKNEQRALKRIAKKHHKKK"
     gene            complement(<66632..>67906)
                     /gene="PBN1"
                     /locus_tag="KLMA_10032"
                     /db_xref="GeneID:34713717"
     mRNA            complement(<66632..>67906)
                     /gene="PBN1"
                     /locus_tag="KLMA_10032"
                     /product="protein PBN1"
                     /transcript_id="XM_022820251.1"
                     /db_xref="GeneID:34713717"
     CDS             complement(66632..67906)
                     /gene="PBN1"
                     /locus_tag="KLMA_10032"
                     /codon_start=1
                     /product="protein PBN1"
                     /protein_id="XP_022673572.1"
                     /db_xref="GeneID:34713717"
                     /translation="MSLIGFDSEGVVAKKRRVTVLFPKDGQDIPERVLREDGTLILDG
                     HSGEVQDRVTLQIERSNGTAASSQHFRVTWKRNAGVDVTPLKGQLAQGFNVFVEKKQN
                     NDNIRSRFIDTPLGSFFHSGKFDNSVLDEFLPKSFNNLLFNYSSSHDIDLYVKDNTVE
                     VNIYHNLSETEHLNVDDSESGIVKTEAGFFHVDTQDDVDISLSGLRCTFEMGSGKLNK
                     CQKTLLFYKPIHLDKSSNVNVTINVLEPINLHPVIQIDLSSFRPIHNCEYYAYLNLPK
                     QLFVDKFQSSPVFLFGEQDLELPEYKLSGYGSTSLFTLKPGELNDIPLHSRYIKPEAD
                     ASEYFVASFAPHVFYACDGNQGLEKGNPFYQNDLRYDSFFTPDTKFYHLNSTSLAVSI
                     PKLNSDNNLSIHIITLSVVVLSFLYLIRRLFK"
     gene            <69837..>71243
                     /gene="LRE1"
                     /locus_tag="KLMA_10033"
                     /db_xref="GeneID:34713718"
     mRNA            <69837..>71243
                     /gene="LRE1"
                     /locus_tag="KLMA_10033"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820362.1"
                     /db_xref="GeneID:34713718"
     CDS             69837..71243
                     /gene="LRE1"
                     /locus_tag="KLMA_10033"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673573.1"
                     /db_xref="GeneID:34713718"
                     /translation="MLSVPTFPPDPTSGVAPLKSRGHRHKRSFAVSGDFDFLRKDPMI
                     KGSNSINNDPPSRIDLNNLPSYSKHMPGNDPITIPVSLSEVGSMHHDELSFNSTANSM
                     LNSQTAADQVFTSPRFFITEEPKFTGGFKDVPDAIINLDDALKTRPRSFKSHRRTESA
                     PADLQLSFNLDRKLRLTEEQVAEEEEENYNTTIIQVEDASNSSSESLSGKNSPKLAPP
                     SHPTLMSPLRARCPSPVTSRDSPSKLSGYNTLKINKQKERYYNYYTKQIPSNGSGSST
                     VGNQTSSMSISSESSISNRQLSTPNTPVSMNYGNSRKITPRTKPFKYETQVYDIRQDA
                     QNGNMPRRSTVSTIESNDTSSSRHHNSSSLSSSSPFPPLTQDLLLGQPGDSVDLSHVD
                     EINDEHITIIPPNSAERETPKHKSRLRYTKHSSSRSMSDQTRTLQVKSNPSSDLTIKE
                     RKHGKFNIISSLFSRPKR"
     gene            complement(<71978..>72361)
                     /gene="QCR7"
                     /locus_tag="KLMA_10034"
                     /db_xref="GeneID:34713719"
     mRNA            complement(<71978..>72361)
                     /gene="QCR7"
                     /locus_tag="KLMA_10034"
                     /product="cytochrome b-c1 complex subunit 7"
                     /transcript_id="XM_022820473.1"
                     /db_xref="GeneID:34713719"
     CDS             complement(71978..72361)
                     /gene="QCR7"
                     /locus_tag="KLMA_10034"
                     /codon_start=1
                     /product="cytochrome b-c1 complex subunit 7"
                     /protein_id="XP_022673574.1"
                     /db_xref="GeneID:34713719"
                     /translation="MPQTFTSIVKIGDYILKTPALAKVVVPIAHQFINLSGYRKMGLR
                     FDDLIEEENDIAQTALRRLPADESYARIYRIVNAHQLALTHHLLPKEKYLKAEDDVPY
                     LTPYLLEAEAFAKEKEELDNLEVAK"
     gene            complement(<72857..>73840)
                     /gene="APA2"
                     /locus_tag="KLMA_10035"
                     /db_xref="GeneID:34713720"
     mRNA            complement(<72857..>73840)
                     /gene="APA2"
                     /locus_tag="KLMA_10035"
                     /product="5',5'''-P-1,P-4-tetraphosphate phosphorylase 2"
                     /transcript_id="XM_022820584.1"
                     /db_xref="GeneID:34713720"
     CDS             complement(72857..73840)
                     /gene="APA2"
                     /locus_tag="KLMA_10035"
                     /codon_start=1
                     /product="5',5'''-P-1,P-4-tetraphosphate phosphorylase 2"
                     /protein_id="XP_022673575.1"
                     /db_xref="GeneID:34713720"
                     /translation="MLPNNLREIVESTYKKAVDDGHIKFTESSSKKVKDPETGMTYQV
                     TYAPSLQHKPEREPESEESKDKVKEDPFAKPEPELTVLDNCLDDYRLVLNKYPVTPNH
                     LILVTKEYLLQTSPLSPKDLLATYKLLDQLDDEDEMLRHLAFYNCGPDSGSSQDHKHL
                     QILPLPYKFVPFQDKICSGKEHFIPNAKTEPLQDSKVSFAHYVVPLPQDPSAVDEELL
                     AMTFVSLLQRTLSSFQDWEGTRETAGKPVIPAYNVLMTKEWLCLVPRSKAFASEPSRI
                     GFNATGYAGLVLVKWEESWDAVNKDPTLLNKLLLECAFPSTAGIKPTEYHY"
     gene            <75034..>76128
                     /gene="CAB1"
                     /locus_tag="KLMA_10036"
                     /db_xref="GeneID:34713721"
     mRNA            <75034..>76128
                     /gene="CAB1"
                     /locus_tag="KLMA_10036"
                     /product="pantothenate kinase"
                     /transcript_id="XM_022820695.1"
                     /db_xref="GeneID:34713721"
     CDS             75034..76128
                     /gene="CAB1"
                     /locus_tag="KLMA_10036"
                     /codon_start=1
                     /product="pantothenate kinase"
                     /protein_id="XP_022673576.1"
                     /db_xref="GeneID:34713721"
                     /translation="MTSDILLSHSQLANTSKEDVQDSCSTFTIAVDIGGSLAKVVFMP
                     PNSSRLMFRTLETERIDEFMQLLHDIIQQYHDGLYEQTLLVATGGGSYKFYDLMVKQF
                     PTVIGIERSDEMDCLIKGLDFFIHEIPNEIFTYNDLEGENAVEPSHNCNSIYPYMLVN
                     IGSGVSILKVDSPKTFSRVGGSSLGGGTLWGLLSLITGAKSFDEMLSWAHKGDNTNVD
                     MLVGDIYGTAYDKLGLKSTHIASSFGKVFQNRSHVAHENTRYPSPSTTSTDIIQSDNK
                     FNNADISKSLLYAVSNNIGQIAYLQAKIHHVKNIYFGGSYIRGHYTTMNTLSYAINFW
                     SEGEKQAFFLKHEGYLGAMGAYLLAQRQKT"
     gene            complement(<76231..>77286)
                     /gene="KRE28"
                     /locus_tag="KLMA_10037"
                     /db_xref="GeneID:34713722"
     mRNA            complement(<76231..>77286)
                     /gene="KRE28"
                     /locus_tag="KLMA_10037"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820806.1"
                     /db_xref="GeneID:34713722"
     CDS             complement(76231..77286)
                     /gene="KRE28"
                     /locus_tag="KLMA_10037"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673577.1"
                     /db_xref="GeneID:34713722"
                     /translation="MGKHHSEYYSEVEKFETQVTHVTEQVLHEQDRLRNSTLREFNQT
                     VLQLVADYEMFELEGQCDPSKMTFYVEQLEIWTNSLKQLHLELESVDNFLRYVIPNDQ
                     SLSTLANFDEDKITSLQDEVCELRDVNIVQQDKEIESLKQQIIEKSNENLTINEKVKE
                     TCLDVSQDIDQCWKLLEQIEDYERRTPSREFDASKDPTFSTYNQWKWNQLAESELKSL
                     EEQLSTLEVTKEKLGSLLAKRATLNPSSDLMEMFTTYQLLNELWEKKIISTLFPDIKN
                     LAIYPQSGKIHFSVGVVEVIIVMEKDVINSISLFSYELPYDQIESIKEGILYKIENQK
                     SLFNVLITVSDHIINSL"
     gene            complement(<77995..>79431)
                     /gene="RBA50"
                     /locus_tag="KLMA_10038"
                     /db_xref="GeneID:34713723"
     mRNA            complement(<77995..>79431)
                     /gene="RBA50"
                     /locus_tag="KLMA_10038"
                     /product="RNA polymerase II-associated protein RBA50"
                     /transcript_id="XM_022820917.1"
                     /db_xref="GeneID:34713723"
     CDS             complement(77995..79431)
                     /gene="RBA50"
                     /locus_tag="KLMA_10038"
                     /codon_start=1
                     /product="RNA polymerase II-associated protein RBA50"
                     /protein_id="XP_022673578.1"
                     /db_xref="GeneID:34713723"
                     /translation="MDLFGDIVERETIAPDAISAEMPTTGFPKLHQPTKVSSWKERLM
                     EKRKNKQKNTASGSRESPVSRQTGGTTATSKDSETLSEAERIHLQNLALLQNMTPEQF
                     ENERQELLDSLNPAVLKSLIARVNKKMEAMSVNDNDANGDGSNSSRRSEIPQYAEIEG
                     PGTWIGGSYENKDLPKLDDKAVDEALGIRSTIDADEVASEIKRDVNDPSNVNDIGKSI
                     EDDFDDVETAFKDEDDMAPQEYQFIQSIDHMSNKDLLADVHFIKAKNNKQDENKSEYE
                     PLDINDPNFNEELHRKFFPDLPQEPEKLKWMQQVNTEAMGDGVLHDVSACRFDFKGNM
                     VPPNRKLETTNDGLHHHSEDPELAGYTIPELAHLAMSKFPAQRCIAIQTLGRILFKLG
                     KQSYSQLVPEVDAETYKEEGGSKQIINKIYFMFWDLVKDCQVIDALQLAADESKTPNL
                     SVRNYAIDALWLWKQGSGDPRAVSKEQK"
     gene            complement(<79856..>80083)
                     /locus_tag="KLMA_10039"
                     /db_xref="GeneID:34713724"
     mRNA            complement(<79856..>80083)
                     /locus_tag="KLMA_10039"
                     /product="protein SNA2"
                     /transcript_id="XM_022821028.1"
                     /db_xref="GeneID:34713724"
     CDS             complement(79856..80083)
                     /locus_tag="KLMA_10039"
                     /codon_start=1
                     /product="protein SNA2"
                     /protein_id="XP_022673579.1"
                     /db_xref="GeneID:34713724"
                     /translation="MHARDWFLVFIAIFLPPVAVWIKRGFFTKDFLINVLLFLLGFFP
                     GLIHALYVISKHPYEPSGNVLPRSQGYGSLS"
     gene            <82792..>82995
                     /locus_tag="KLMA_10040"
                     /db_xref="GeneID:34713725"
     mRNA            <82792..>82995
                     /locus_tag="KLMA_10040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821140.1"
                     /db_xref="GeneID:34713725"
     CDS             82792..82995
                     /locus_tag="KLMA_10040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673580.1"
                     /db_xref="GeneID:34713725"
                     /translation="MQFKNIVAIAAVATVASAKTKSNATNGTNATNGSNGTTSVSTGA
                     AAANAMGAGVFGAAVAAGVAFLF"
     gene            complement(<83730..>84068)
                     /locus_tag="KLMA_10041"
                     /db_xref="GeneID:34713726"
     mRNA            complement(<83730..>84068)
                     /locus_tag="KLMA_10041"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821251.1"
                     /db_xref="GeneID:34713726"
     CDS             complement(83730..84068)
                     /locus_tag="KLMA_10041"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673581.1"
                     /db_xref="GeneID:34713726"
                     /translation="MSGSRCVSHGGKQEKRGAAHSDRRKIGRRKKQKKKKKKNNNNNN
                     NNNNNNNNNNNNNNNNNNKRTEPICANRCNNEGFWFERTGKIVTNGTLINKTSGRRRN
                     GRSNSKHILY"
     gene            <84664..>86154
                     /gene="SPS1"
                     /locus_tag="KLMA_10043"
                     /db_xref="GeneID:34713727"
     mRNA            <84664..>86154
                     /gene="SPS1"
                     /locus_tag="KLMA_10043"
                     /product="sporulation-specific protein 1"
                     /transcript_id="XM_022821362.1"
                     /db_xref="GeneID:34713727"
     CDS             84664..86154
                     /gene="SPS1"
                     /locus_tag="KLMA_10043"
                     /codon_start=1
                     /product="sporulation-specific protein 1"
                     /protein_id="XP_022673582.1"
                     /db_xref="GeneID:34713727"
                     /translation="MLSLKDFQLLQCVGKGNFGDVYLAHYLGSNNIDSFENGTDPIIP
                     KNVPLAIKCINLEHSNEPIDLLLKEIYFLSTLNCPYITHYYGTFTGDCNLYIVMEYCS
                     NGSLLNMLRYFSRLSEQTTCFIISQVCIALDYLHEKRLIHRDLKAANILLNDVGEVRL
                     ADLGVTGQLKFNSTRNGGKNLNTFVGTPFWMAPEIIKNQSYDGKCDIWSLGITTIELL
                     NGKPPMSHLDSMKALMRVTKLNADNILRSMDISPLAKDFIRSCLQQDPNQRPTCKQLL
                     QHKWLKRCQVTSISEEITVMKTNQMISKDKQKPCKPRFPLSDKVYKTNLPDQLQSWRF
                     ESTSDSKNDKEDDNDMREIPHLYNENDNQKNGNGGISPLAKQQLRTPTTLTPTSALSP
                     SSMAISPKTNLSTPATETENYGSDNLSPEKDKDELMADGQNIDYWKHVLLYSLKKVKQ
                     RAINEPTKETIRSLTRYMEDLERNFPGISEALVQEISTRVRKITVV"
     gene            <86899..>88161
                     /gene="SPS22"
                     /locus_tag="KLMA_10044"
                     /db_xref="GeneID:34713728"
     mRNA            <86899..>88161
                     /gene="SPS22"
                     /locus_tag="KLMA_10044"
                     /product="cell wall mannoprotein PST1"
                     /transcript_id="XM_022821473.1"
                     /db_xref="GeneID:34713728"
     CDS             86899..88161
                     /gene="SPS22"
                     /locus_tag="KLMA_10044"
                     /codon_start=1
                     /product="cell wall mannoprotein PST1"
                     /protein_id="XP_022673583.1"
                     /db_xref="GeneID:34713728"
                     /translation="MLVAALANALDIEVSGYDQEVVLSGQDNSKNNSNSPLCKKDQHT
                     IENQNDLYLLTNECSNIEGSISFQNYVESHIDLGDLKSIKGNFVLEENNMVNSIQGGS
                     LEKIGGTFKLFDLTSLSAVSFPQLRDLNVVHWRIVPILSSVTMDSRLQSIKSLIISDS
                     SLTTLRGFDNIIKLETFNVNNNRYLESISTKIKYISKQLSVSANAEDLDLDMSDLIWA
                     NNVTVRDANEINLGSLQYVNQSLEFIENKVEELELSELKTVGGTLGIIDNKKLSKTNF
                     NNVSQISGGLMIANNDALTKIDFFSNLKLIGGAIQFKGNIKDTDFPNLRLVKGSAVIQ
                     SSSDELDCSKWVTPNSGSSIIRGGKIECEAKGKKSSASVRQDGTVLDSVTEEKAEVKD
                     KETNGSTTMGINFALLVVAIIGTIRMIS"
     gene            <88550..>90490
                     /gene="URC2"
                     /locus_tag="KLMA_10045"
                     /db_xref="GeneID:34713729"
     mRNA            <88550..>90490
                     /gene="URC2"
                     /locus_tag="KLMA_10045"
                     /product="uracil catabolism protein 2"
                     /transcript_id="XM_022821584.1"
                     /db_xref="GeneID:34713729"
     CDS             88550..90490
                     /gene="URC2"
                     /locus_tag="KLMA_10045"
                     /codon_start=1
                     /product="uracil catabolism protein 2"
                     /protein_id="XP_022673584.1"
                     /db_xref="GeneID:34713729"
                     /translation="MVEEDRKLKKSTRPRKKRKIYSCESCRKFKTRCDFEPSEGKCYR
                     CRMLNLECSLTNDPELTTKFPQVAINNSAKPRIDDLEARVDDMDKKLDIILSKLGEVT
                     SLLNMNTTTTRENTVDHSLTVGFSNATNSLKLQEPPLNLIRDIDSRLFPVKNGNSKSA
                     SIEKAKRPYVVARLAFWDYFKQHEELCLELSHQFLIKSHFWIIPGGLKEIDKEYVQQH
                     CFITSVFTIIAMGFDENDKYEKEQEALYPLVEHLLTNTLTMFEKLTDHDIEALLYCCM
                     YRFTRKSKRYRQLSFNPLVLCNFAINSFLNIADFHKLKERVILEETYDSTDLFHLRIL
                     NSLTACKLQLSIGFSIFTYQDPFIKELNNLIAKFPQANFRDDIKLSEINLSDVVNAIF
                     LNFKDYFRNFSTVFKQGGNRDRNDESLLVFPELDYWLKNWEELLSKDNGGILWFSYDF
                     FYIMICRSFITEFYQPTLASNVEFLEAVLTTMKHYCISLLNGFLKLPSSLIKGAPIIT
                     TNQVVYACLTLCDYLHKFSSTERQQTLNLCTKIYWHLNAIGEKRNEATENVAVIIKSL
                     IDTSKQKLNSSYKQSKEVQTTPAFLRMDQSPTESVSHNNFSIPDVNRFNTFEDFFQDF
                     FDNLQPTAQHMFSTRRSSTTSK"
     gene            complement(<90632..>91054)
                     /gene="FPR2"
                     /locus_tag="KLMA_10046"
                     /db_xref="GeneID:34713730"
     mRNA            complement(<90632..>91054)
                     /gene="FPR2"
                     /locus_tag="KLMA_10046"
                     /product="FK506-binding protein 2"
                     /transcript_id="XM_022821695.1"
                     /db_xref="GeneID:34713730"
     CDS             complement(90632..91054)
                     /gene="FPR2"
                     /locus_tag="KLMA_10046"
                     /codon_start=1
                     /product="FK506-binding protein 2"
                     /protein_id="XP_022673585.1"
                     /db_xref="GeneID:34713730"
                     /translation="MKLFLQSIILCFCALIAVAEKLTQLEVGVTKEPAECPIKASKGD
                     VVSVHYTGRLRDSGEVFDSSYSRGVPIQFQLGYGQVISGWDQGILGMCVGEGRKLQIP
                     SELGYGSRGAGNVIPPNADLVFETELVDIKRENSNDEL"
     gene            complement(<91345..>93507)
                     /gene="EMC1"
                     /locus_tag="KLMA_10047"
                     /db_xref="GeneID:34713731"
     mRNA            complement(<91345..>93507)
                     /gene="EMC1"
                     /locus_tag="KLMA_10047"
                     /product="DUF1620 super family"
                     /transcript_id="XM_022821806.1"
                     /db_xref="GeneID:34713731"
     CDS             complement(91345..93507)
                     /gene="EMC1"
                     /locus_tag="KLMA_10047"
                     /codon_start=1
                     /product="DUF1620 super family"
                     /protein_id="XP_022673586.1"
                     /db_xref="GeneID:34713731"
                     /translation="MIGALFLFWVFFTHLASAVFDDEAFQVDWHIDNLGEISCIEKVN
                     NTFVVVGKTNSNSLIISLLNSTSGKALERFTFEDYSEVAKLQDEELFFPFSQTVGSKG
                     SLRDVLGSDASGISCQKPDISSVQFQEGTLRIADVIYDLPDNFYQLEYLNVDPESSTV
                     EILVATTDKHYQFSKFENGEVIIQWERDESLSDVVAYAVYNEVNHGLDLIKDEIDHEQ
                     ELDLLEAYKFRVATNWERLKAYLILKRFNVGRMLSDLVKEKDAAAQFDLDVQFGLTKQ
                     LVVASRSGTITSLDMRSGERLWSIDSGIENIRALHFVKENDLIVVSDLKIYSIDLTDH
                     KYPIRTEKEAPTGYYFESSYESPLIKLVNESDRSFTIVRELSPLVSDSSLVHFEEKKI
                     SAFLLKDGDKKPTWERSLKSNEYIAGHSIREDGASASLGVILGNRTVLYKYLNPNVAA
                     YLVANEIDKSIYLDVIDTITGQSLYSTRHNEKVDLNSPINIVVGEHWCVYSYFSLEPI
                     PEQKIAVVEFYESSTPDVRLSTPGKSVDSLTGFFKPAAITKSYFYPQVINSLALSKTK
                     FGITTRSLLLQLDDGSVTYLPRFVINARRKKAEEMQDKDSEEFMAMPYEPTILIDDHF
                     IVSHVRQIIPAKNAKLLSVATNLESTSMICSIGIDIFCTRISPSSQFDKLAPTFEKSK
                     VLITIAVLLVMCFILRPMVDHRKVKTKWMVKNLDITTI"
     gene            complement(<93842..>95002)
                     /gene="MGR1"
                     /locus_tag="KLMA_10048"
                     /db_xref="GeneID:34713732"
     mRNA            complement(<93842..>95002)
                     /gene="MGR1"
                     /locus_tag="KLMA_10048"
                     /product="mitochondrial inner membrane i-AAA protease
                     complex subunit MGR1"
                     /transcript_id="XM_022821917.1"
                     /db_xref="GeneID:34713732"
     CDS             complement(93842..95002)
                     /gene="MGR1"
                     /locus_tag="KLMA_10048"
                     /codon_start=1
                     /product="mitochondrial inner membrane i-AAA protease
                     complex subunit MGR1"
                     /protein_id="XP_022673587.1"
                     /db_xref="GeneID:34713732"
                     /translation="MALYTKGKSSEESERSVKDPKFYTRPSLGLKLWGPLVPSSDNTT
                     GLWSLVAIQTGLSIFLMQRFRKLGKKWVKRDIADFPSLNRFSTTHGDMYMTRHIPVQF
                     GGTHSFNIRVGTRTGFWYSDKFRSMRRLVYLLSGTLILSQSMLEVSRLTLLKYDPWVE
                     EAKSVREKQFFNDIVRFYHEGVDSTKFKAKDELSGQTISLNLPEVKQTIAVARAQAQA
                     ENLVTKWFGPLDYKPQSFTEFLDKLEYYLNMTDFLNNLRRQKKLDEVDKELEKLSLEN
                     KRNRQRIHNIATHAPARAMKTNNNAQGVMGIRRVLLHHDTESSNDISLSEIWAIYNPW
                     TNLALDTALSIKFFPSVIFNEDYLEHQKRTNDSEQVDSMEQKNNTTDGKDLE"
     gene            complement(<95455..>97017)
                     /gene="PDI1"
                     /locus_tag="KLMA_10049"
                     /db_xref="GeneID:34713733"
     mRNA            complement(<95455..>97017)
                     /gene="PDI1"
                     /locus_tag="KLMA_10049"
                     /product="protein disulfide-isomerase"
                     /transcript_id="XM_022822028.1"
                     /db_xref="GeneID:34713733"
     CDS             complement(95455..97017)
                     /gene="PDI1"
                     /locus_tag="KLMA_10049"
                     /codon_start=1
                     /product="protein disulfide-isomerase"
                     /protein_id="XP_022673588.1"
                     /db_xref="GeneID:34713733"
                     /translation="MLFGKTIKLGLATLMAVNAAAQEEATAPEDSAVIKLTSETFEDF
                     IKEHPLVLAEFYAPWCGHCKHLAPEYVKAADELEDKDIPLAQIDCTENQQLCQEQGIP
                     GYPSLKVFRNGNSKPAGEYQGPREAKAIVNYMLKQSEPAVRVIEDEKEFKELVVKNLD
                     NVLVVDGNVPKFNETFYQIADNLRDDYSFIQHGSDGKLRVYLPKETEPIVYDGDKYDA
                     EAVSSWIAVEAFPYFGDVNGETYQAYMAAKIPLAYFFYTTPEEREEYEPHFVALAKKY
                     RGKVNFAGLDASKFGRHAENLNHKQQFPLFAIHDTVKDLKYGLPQLSDEDFAALEKPL
                     KLATKDIEKFVKDFLDEAVDPIVKSEEIPEKQEQYTFKIVGKNHDEIVRDPKKDVLVK
                     YYAPWCGHCKRLAPIYENMAEFVHEAEELKDKVLIANIDATANDVQNVEIPGFPAIYL
                     WPAGEKSEPIPFEGPRTIEAFLTFIKENGTHGVDGVSLYEEYVIALEKKKQEEEAADE
                     ADDEDELDQDEL"
     gene            complement(<97460..>98632)
                     /gene="GRH1"
                     /locus_tag="KLMA_10050"
                     /db_xref="GeneID:34713734"
     mRNA            complement(<97460..>98632)
                     /gene="GRH1"
                     /locus_tag="KLMA_10050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822139.1"
                     /db_xref="GeneID:34713734"
     CDS             complement(97460..98632)
                     /gene="GRH1"
                     /locus_tag="KLMA_10050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673589.1"
                     /db_xref="GeneID:34713734"
                     /translation="MFRIAKNLVKTLEESVTGTVGDKPVDSYFHSVPPQLFPIKENDA
                     RYSQQADSLYGLRVVQVSETQLQLNSFFDYIIGFNNEPIPLVEESQAVYPDYRKIISL
                     FNEHCGNSIKLHVWSGKGGVYREEYLYVSPKNTVSEIPLDDTGSQSLATSQMFEPLGF
                     KVQWSPLVAATFSYHVLQLNIENGPAALAGLIPDQDYIIACQDGLLATGGEHLLQDIV
                     RSRANHSLVLYVYNKGVDCVRPVTVQIGPDGRLGCNVGYGFLHRIPAPVQRFDSESNQ
                     EATQSPDLQTFKQDPNIIQPLIQPTIASLPTGSAKPNVNPAIPGLRRQAQHHHHRAAN
                     AANAASATVMMADYFQEGKDQSPKVSSATATPPPPPPQSNPVQTEESTDSANNNEE"
     gene            <99985..>101430
                     /gene="GLK1"
                     /locus_tag="KLMA_10051"
                     /db_xref="GeneID:34713735"
     mRNA            <99985..>101430
                     /gene="GLK1"
                     /locus_tag="KLMA_10051"
                     /product="glucokinase-1"
                     /transcript_id="XM_022822193.1"
                     /db_xref="GeneID:34713735"
     CDS             99985..101430
                     /gene="GLK1"
                     /locus_tag="KLMA_10051"
                     /codon_start=1
                     /product="glucokinase-1"
                     /protein_id="XP_022673590.1"
                     /db_xref="GeneID:34713735"
                     /translation="MSDPKLTKAVDEICNQFVIGKSKIAQLTQYFIECMEKGLEPIED
                     DISTDKGLPMIPTFVTDKPTGQERGTIMLAADLGGTNFRVCSVELLGDHEFKIEQEKS
                     KIPSSFLQNDPHITSKDLFQHLALVTHQFLNKYHKDQVQNYKWKMGFTFSYPVDQTSL
                     KSGNLIRWTKGFQISDTVGKDVVQLFQQELNDIGLSNVHVVALTNDTTGTLLAHCYTS
                     SDEARAISEPVIGCIFGTGTNGCYMEKLDNIHKLDPKIREELKAKGKTHMCINTEWGS
                     FDNELRHLPTTEYDIEIDKKYSANPGYHLFEKRVSGLYLGELLRNILLDMEKKSLIDL
                     KDSKLSKEPFSLTTETLSDIEVDTFEDGLPTTKDALSKAINWDTTFEQRVVVQKIVRA
                     ISRRAAYLSAVPIAAILIKTNALNKAYHSQVEVGCDGSVVEYYPGFRSMMRHALALSP
                     IGAEGERDVHIRIAKDGSGVGAALCALTADY"
     gene            <102034..>104184
                     /gene="GID7"
                     /locus_tag="KLMA_10052"
                     /db_xref="GeneID:34713736"
     mRNA            <102034..>104184
                     /gene="GID7"
                     /locus_tag="KLMA_10052"
                     /product="glucose-induced degradation protein 7"
                     /transcript_id="XM_022822204.1"
                     /db_xref="GeneID:34713736"
     CDS             102034..104184
                     /gene="GID7"
                     /locus_tag="KLMA_10052"
                     /codon_start=1
                     /product="glucose-induced degradation protein 7"
                     /protein_id="XP_022673591.1"
                     /db_xref="GeneID:34713736"
                     /translation="MAVQTAGSDESQSNGSLSSAPTSHESFIPQYTKKPLSQLDIDGP
                     QQPFDKVQLTKLLIDALQQIGYSETAATLQKESGGILIESTHVKALFTAIKEGKYQDC
                     SLDLLLRLPIFLESLEISGDLSHVALPPMHRKSNEILDHFLTEYEKLTFVMKRLSELK
                     DVDIIKLTICVEMLVSIQTLSFTEILGSDRRLALELLRSVIRPTISIWDSLLTLQTMK
                     YDPEAQAPPTTSGSEQNSPFSYFQPDQLLSQLSTLIACGQSSDDPFVTRDTTAEHISK
                     FINPNDLVPRGRLMQLLKQAIQYQRSRDLLSFHVDDESGENNEKSAVSFNLLQDNVTK
                     STQFQFENIKTLNRNNDEIWFLQFSSDGRFLASASPSKQYERKIIIYDVKKNFEIYAV
                     CSETRQSVLYLKFSPDNTKLIACSINSAVKIYDLNQLSQPTYDGYLCEYDQLKPIASV
                     FVTFPTTPESSVHSTVTPTGSTETMRLWCADWFHNPELKDFIALGSPDSDVIIYDLKT
                     ATIFARISMTMGEDLQTSFPHVHDIKISKDDNDLIVMNNENYIDIFDISTLRYCIRDN
                     TTFMTPRKRRLFVGKRMTGMQFPDTSQYPSDPFLSSLLLVSIQNQELQLWDYQRDILI
                     QKYIGQIQSHFIIRSCFGYHSNFIASGSEDGKIYIWDRFYGNIIGVIPAHLDDAPLSK
                     SKICNIVAWNPQDQTMFASGGDDGLVKVWRVSAI"
     gene            complement(<104177..>105667)
                     /gene="ATG22"
                     /locus_tag="KLMA_10053"
                     /db_xref="GeneID:34713737"
     mRNA            complement(<104177..>105667)
                     /gene="ATG22"
                     /locus_tag="KLMA_10053"
                     /product="autophagy-related protein 22"
                     /transcript_id="XM_022822215.1"
                     /db_xref="GeneID:34713737"
     CDS             complement(104177..105667)
                     /gene="ATG22"
                     /locus_tag="KLMA_10053"
                     /codon_start=1
                     /product="autophagy-related protein 22"
                     /protein_id="XP_022673592.1"
                     /db_xref="GeneID:34713737"
                     /translation="MSYESVPGADSRVGFEQANRNIKGWYYYCFSSEPFIVSAVSTYV
                     PLLLEQFARINGVKLHDHNAACEATDDKCVLPIFNGKWFIDTSSFALYTFSLSVFFQA
                     LLVVSVSGIVDKCYSISFKKRVLLVFGTIGAFSTWLVGTLKSDQYYTLAFLAVLGNCC
                     YGVINVVGNSLLPVLVSCLEGTEDQAEVDIKTSVISGRGAFYGYFGALVVQISSLTLV
                     RLSKNHDNLQIAILFVGIWWLIWQIPIAVLLQDVPFEAPQEASTFEWSNTGKYMTYGW
                     KSLWESLKHAKLLKDVVIFLVGWFIISDSLTTINSTAILFAKTELKMTATNLIILSML
                     TMIMAMVGAVYIPRLLSEYLRLPLQRVLILIILWSSVIPLYGMSGFVFESIGLKHKFE
                     MYFLAVWYGLSLGGLAAVSRSLFSLLVPRGKESTFFSLFNVTDKGSSIVGPLLIGLIT
                     DKTHNIRYAFYLLFFLLMASLPIFRELDVERGKRESRELSNMTTTI"
     gene            complement(<106066..>107544)
                     /gene="SRO9"
                     /locus_tag="KLMA_10054"
                     /db_xref="GeneID:34713738"
     mRNA            complement(<106066..>107544)
                     /gene="SRO9"
                     /locus_tag="KLMA_10054"
                     /product="RNA-binding protein SRO9"
                     /transcript_id="XM_022822226.1"
                     /db_xref="GeneID:34713738"
     CDS             complement(106066..107544)
                     /gene="SRO9"
                     /locus_tag="KLMA_10054"
                     /codon_start=1
                     /product="RNA-binding protein SRO9"
                     /protein_id="XP_022673593.1"
                     /db_xref="GeneID:34713738"
                     /translation="MSGSVVSESAMVEAVNEQREESAPVVEQTEQSEQSQQSESVEAN
                     EAESEAEVKPKLVLAPLPKKSPWEETGSAEIKPLDLSKVVAAKNKKATSMGKSRSKGT
                     PSLTGKEKWIPLDVDIVVKDKIPDVNANGNGNVNGASNGKGKKLKNKAKKDKPKNAKK
                     GKGKESGKAKSSDAEGEKKSAKKSERPSSKNAVTDTRETSAPAEKTKENEKDADENES
                     KNVDSTTEADASSDANPEGAEKAKNGASAKKGDRPHRRFTANSKPFFPRNQNYHNHHN
                     HHNHHHSHPHQHMNHTNNHNHHHGAKSHRARQYVPVMYQQQNYTPSYVLVNELVRQIQ
                     YYFSIENLSKDNFLKSQMNAQGYVPLALISRFHRMLNLSYGDVGLILAALRELKNSTE
                     SNVNIAKLTSPFEDVQGNPLFQYALSSKVWTIDSESLQNAKSYETVELVGDELELFKI
                     EPINPIIDSPKQQEQQEQQEQQEQQEQQEQPIAQDAQETTQD"
     gene            <108032..>109117
                     /locus_tag="KLMA_10055"
                     /db_xref="GeneID:34713739"
     mRNA            <108032..>109117
                     /locus_tag="KLMA_10055"
                     /product="ribonuclease H family protein"
                     /transcript_id="XM_022822237.1"
                     /db_xref="GeneID:34713739"
     CDS             108032..109117
                     /locus_tag="KLMA_10055"
                     /codon_start=1
                     /product="ribonuclease H family protein"
                     /protein_id="XP_022673594.1"
                     /db_xref="GeneID:34713739"
                     /translation="MTDTGDRTDGTLYKDKGKKLGAHFGSHFSGIDHNVYMPDKLAEK
                     LVDHYLTDVGRGFKDVLVSQKQAKEDQIALQTLSLDSDESSSSDESEATSSSIPIEPE
                     IRCYPGRPEWKICENMIRNINLRKVILFCVDLEAYERNTKIVTEIGVTIYDPRENLAH
                     SVLPLMRSYHYCIEEAWDLRNGRFVDDAKENFIFGDSILMPLDDVVNEVQFLVDKYLI
                     PHNKEEHTWKRALVGHGVEGDIYWLESLNINLPKNVQRFDTLEFCDSMYSNHPSLKRL
                     LNLCHIPTAYLHNAGNDSYYTLQLLLSMCDIGTRIKLRLDDWRYVRAKLDELYEQEQA
                     EKQLKRASRNKQSEKNRANRIRSSARN"
     gene            <109443..>110609
                     /locus_tag="KLMA_10056"
                     /db_xref="GeneID:34713740"
     mRNA            <109443..>110609
                     /locus_tag="KLMA_10056"
                     /product="DnaQ-like exonuclease domain-containing protein"
                     /transcript_id="XM_022822248.1"
                     /db_xref="GeneID:34713740"
     CDS             109443..110609
                     /locus_tag="KLMA_10056"
                     /codon_start=1
                     /product="DnaQ-like exonuclease domain-containing protein"
                     /protein_id="XP_022673595.1"
                     /db_xref="GeneID:34713740"
                     /translation="MSFGKSFRPGPRINNNQNKRDYNSMSSSKKLFGPVGKAIQAYQS
                     ALKTLKPVQPIKTNYSGVKVSPVVNKELHKYVQDYLNDFAKQSTKINAESNRRLKEKI
                     DALSPSAQDDKEIIQKITASHIPKVSLLPGSSKWTEFSRVLTSVQTRNVICMSIDIEA
                     WEKNPKIITEIGISIWDPRIESGQYSISSPSFDNHHILINESLALRNTQFMPDHKHQY
                     LMGKSKIMSMKQCQVFIQELIDEYMIPDADAPESEPGYERAFVGHGFSGDLKWLQSLN
                     LRIPENIPVFDTMKIFQSMYGSTGSGLGKALRLLQIPHAYMHNAGNDAYYTLRLLLHM
                     CDIEKRKLLGLDDIEKVQNTIEQWRSHDSGGNPAGSSKRRRKNVATEFQGSVHY"
     gene            <111915..>113117
                     /locus_tag="KLMA_10057"
                     /db_xref="GeneID:34713741"
     mRNA            <111915..>113117
                     /locus_tag="KLMA_10057"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822259.1"
                     /db_xref="GeneID:34713741"
     CDS             111915..113117
                     /locus_tag="KLMA_10057"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673596.1"
                     /db_xref="GeneID:34713741"
                     /translation="MVSFSKLGSLALLSGAALVSAATYHVDVDYKEYLDVYYHYRDDN
                     SGVSVVADATGLTVTVDSDSTSESDCQVLQSGMLVYSKDGESDKTLVTWDQYEVFHLV
                     YNGQEVTYDNVNVQSCGAVAPEDMIVSHSGSSSAGITAADITTTVTAVDSVPSKVMTL
                     DQITDAAILTQLAPCSKVVDGSTSYCPINTVYGNSVVTVTKENVVTSYTTYCPLSEVV
                     LSAKPTTVIKTITSCKNNACTATTSAVTTEKLVQVTQGVSAAKTTNEAGEDVTSTYVS
                     TTAAPSHSTSYTTLSGGAASPASAAPSPAASTAAAASGTTSAVTTSGSSPASGSPASG
                     SSPASSGTVTTTAGAAGATGSGILQVGASSAAPSSAGEISVYEGEANFFSVNKYAVAA
                     LAVGAAMI"
     gene            complement(<113326..>113649)
                     /gene="GRX2"
                     /locus_tag="KLMA_10058"
                     /db_xref="GeneID:34713742"
     mRNA            complement(<113326..>113649)
                     /gene="GRX2"
                     /locus_tag="KLMA_10058"
                     /product="glutaredoxin-1"
                     /transcript_id="XM_022822270.1"
                     /db_xref="GeneID:34713742"
     CDS             complement(113326..113649)
                     /gene="GRX2"
                     /locus_tag="KLMA_10058"
                     /codon_start=1
                     /product="glutaredoxin-1"
                     /protein_id="XP_022673597.1"
                     /db_xref="GeneID:34713742"
                     /translation="MAPVSTVSRVQGLINSSKIFVAAKTYCPYCQATLKTLFDDKKVN
                     KDIATVLQLNELDDGAEIQDALLEISGQRTVPNIYINGKHIGGNSDLQELNSSGELDK
                     LLAAL"
     gene            <114943..>115941
                     /gene="LSB5"
                     /locus_tag="KLMA_10059"
                     /db_xref="GeneID:34713743"
     mRNA            <114943..>115941
                     /gene="LSB5"
                     /locus_tag="KLMA_10059"
                     /product="LAS seventeen-binding protein 5"
                     /transcript_id="XM_022822281.1"
                     /db_xref="GeneID:34713743"
     CDS             114943..115941
                     /gene="LSB5"
                     /locus_tag="KLMA_10059"
                     /codon_start=1
                     /product="LAS seventeen-binding protein 5"
                     /protein_id="XP_022673598.1"
                     /db_xref="GeneID:34713743"
                     /translation="MGLFTDHPCTSVTESINKAIIQDNYTLEVELGTILQLIRTGDVE
                     TNQTEAARAIRKRLKHGDIQQQSRALDLMNLFVSQLIHLPVFYSDFRLNKVLLDMSSG
                     SGKYPKQISRKCTSYLIAWYHYLSRHQEVDGFDTLYSLCVKTYNNRNRRMKVMAKSYK
                     KKNKSMPGFMNDTADRRSVIADERYGIPRINLEKETPKIKLLISDSLETAVSLSNTLL
                     ALPSNTKSTDSEECTAKFVQARAMRRKVLRYLQLITEGELLGALLHANEELVNSLMAF
                     DELAGEEDMASLNRDDDSDLESSSEEEEEEAEEEEQESITSIQSNDPFSDNHKIKA"
     gene            complement(<116011..>116442)
                     /gene="MXR2"
                     /locus_tag="KLMA_10060"
                     /db_xref="GeneID:34713744"
     mRNA            complement(<116011..>116442)
                     /gene="MXR2"
                     /locus_tag="KLMA_10060"
                     /product="selR super family"
                     /transcript_id="XM_022822292.1"
                     /db_xref="GeneID:34713744"
     CDS             complement(116011..116442)
                     /gene="MXR2"
                     /locus_tag="KLMA_10060"
                     /codon_start=1
                     /product="selR super family"
                     /protein_id="XP_022673599.1"
                     /db_xref="GeneID:34713744"
                     /translation="MTTFAKQFARTMSKWTPVNPNLSAEQLRVLRDKGTERPNTGKFL
                     HNKETGVYTCANCDQPIYESKTKFDSGCGWPAFYDAIPGSLTFTKDESYGMVRIEICC
                     SKCGGHMGHVFEGEGWQKLLNLPTDQRHCVNSCSLNFKKET"
     gene            <116837..>116977
                     /locus_tag="KLMA_10061"
                     /db_xref="GeneID:34713745"
     mRNA            <116837..>116977
                     /locus_tag="KLMA_10061"
                     /product="DUF3128 super family"
                     /transcript_id="XM_022822304.1"
                     /db_xref="GeneID:34713745"
     CDS             116837..116977
                     /locus_tag="KLMA_10061"
                     /codon_start=1
                     /product="DUF3128 super family"
                     /protein_id="XP_022673600.1"
                     /db_xref="GeneID:34713745"
                     /translation="MKEFEKFKFCVLHSKDPVKVQEWYKDQWQKNQERRGTSDDIWKE
                     RV"
     gene            <117345..>118244
                     /gene="STE50"
                     /locus_tag="KLMA_10062"
                     /db_xref="GeneID:34713746"
     mRNA            <117345..>118244
                     /gene="STE50"
                     /locus_tag="KLMA_10062"
                     /product="protein STE50"
                     /transcript_id="XM_022822315.1"
                     /db_xref="GeneID:34713746"
     CDS             117345..118244
                     /gene="STE50"
                     /locus_tag="KLMA_10062"
                     /codon_start=1
                     /product="protein STE50"
                     /protein_id="XP_022673601.1"
                     /db_xref="GeneID:34713746"
                     /translation="MSGTNEWSTEEVCKKLKAELELDDAETYILDRIRENKITGSTLS
                     EITLADCKELCPDNVSAVRLKTCINKFVDAEEQAPEQELVLTMKGLHQTLNEKLQEFQ
                     SNYAQLRLDLLEIVKRNTVSGIGMASSQSNQVPQQGPQSSSQDYFDRTPHHHSSHTPS
                     SPKFRSNSNPGVTSQAGGTRNVSSPHTSTTPGSAGGPPGGAPAAPSSEPMKQLRASKE
                     DSCEKVLRNAMKRHNLNEADWRQHVLVICYGDQERVLELDEKPVQIFKSLKQQGLHPA
                     IMLRQKGDFEEVGEMAATPGGRL"
     gene            complement(<118415..>119392)
                     /gene="RRP7"
                     /locus_tag="KLMA_10063"
                     /db_xref="GeneID:34713747"
     mRNA            complement(<118415..>119392)
                     /gene="RRP7"
                     /locus_tag="KLMA_10063"
                     /product="ribosomal RNA-processing protein 7"
                     /transcript_id="XM_022822326.1"
                     /db_xref="GeneID:34713747"
     CDS             complement(118415..119392)
                     /gene="RRP7"
                     /locus_tag="KLMA_10063"
                     /codon_start=1
                     /product="ribosomal RNA-processing protein 7"
                     /protein_id="XP_022673602.1"
                     /db_xref="GeneID:34713747"
                     /translation="MNRNSTDEQYFPRKRASIEGIEPVVVGVVICLSVMAPVQMQNGF
                     LVVPFLLPEVKSLKEKTSKAHHYMFVRKHQSKLDNEQHCLFLVNLPLLTKFENLKKNF
                     QEICRKYEMVSHVQGLLYHDEFGLHDVDLSSLTSSLMSVDDPSEKRFTPRNTSLLQFV
                     DKQSMENCWEALRKYSSNKKQEHIVWEFESPSIETFTAFYRPLPLEYLKADIHEHMAL
                     FEQREQQAQEEVQSSIVDEDGFTLVVGKNTKSLNSIRKKILNRNPLLKHEKPKKMPNM
                     VDKKAKKDFYRFQVRERKKQEINELLSKFKQDQERIKEMKNKRRFNPYT"
     gene            complement(<119565..>119951)
                     /gene="ACN9"
                     /locus_tag="KLMA_10064"
                     /db_xref="GeneID:34713748"
     mRNA            complement(<119565..>119951)
                     /gene="ACN9"
                     /locus_tag="KLMA_10064"
                     /product="acetate non-utilizing protein 9"
                     /transcript_id="XM_022822337.1"
                     /db_xref="GeneID:34713748"
     CDS             complement(119565..119951)
                     /gene="ACN9"
                     /locus_tag="KLMA_10064"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="acetate non-utilizing protein 9"
                     /protein_id="XP_022673603.1"
                     /db_xref="GeneID:34713748"
                     /translation="MQVNPILRQAVKRAVRPRRPASKRPHQPLLPPLQLYRRILREHK
                     NLPPMQRELGDQYVKSEFKLHKNTDNPLYIVGFLASWQDYLHMISRGQWTEGTLSADL
                     LEKMSPEQVTQLYELMKEAEQLKSEN"
     gene            complement(<120238..>122646)
                     /gene="HIS4"
                     /locus_tag="KLMA_10065"
                     /db_xref="GeneID:34713749"
     mRNA            complement(<120238..>122646)
                     /gene="HIS4"
                     /locus_tag="KLMA_10065"
                     /product="histidine biosynthesis trifunctional protein"
                     /transcript_id="XM_022822348.1"
                     /db_xref="GeneID:34713749"
     CDS             complement(120238..122646)
                     /gene="HIS4"
                     /locus_tag="KLMA_10065"
                     /codon_start=1
                     /product="histidine biosynthesis trifunctional protein"
                     /protein_id="XP_022673604.1"
                     /db_xref="GeneID:34713749"
                     /translation="MLPLVPLLDATKALNEKPFIGLSKLLVLDGLTLTKEEIQDFTDK
                     QEAFGQRVSVLVGKNKFSDDDLISLLNNGISTLFVEDLEYANHLLEIGIPDIRLSLFK
                     ENAFRVKFGQVQEVSWSQLVKVSEITKQSFTNAILKGLKTDRSDGLYTTLVVDENERS
                     LGLVYSSKESIAQAVESQTGVYFSRSRNEIWRKGATSGNVQQLLSIDLDCDGDALKFV
                     VRQGGSGSFCHLNTQSCFGDFKNGLYGLQKLLQDRLVNAPEGSYTKRLFNDPDLLDAK
                     IKEEAEEVTEAKEKKDIAWECADLFYFTLVKLVASGVSLEDVENNLNMKHLKVTRRKG
                     DAKPKFIKKEEPITETPYETSEEEKIFLNVVSSSNKAAVEQAVTRPIQKTAEIMNLVK
                     PIIDNVVKNGDKALIELTAKFDGVDLKSPVLEAPFPPEYLEGLTDELREALDLSIENV
                     RKFHAAQMQTETLEVETQPGVVCSRFPRPIEKVGLYIPGGTAILPSTALMLGVPAQVA
                     GCKEIVFASPPRKSDGRVSPEVVYVASKVGASKIVLAGGAQAVAAMAYGTETVPKVDK
                     ILGPGNQFVTAAKMHIQNDTQALCSIDMPAGPSEVLVICDEEADVDYVASDLLSQAEH
                     GIDSQVILVGVSLSETKIEALQNAVHEQAMKLPRVDIVRKCIAHSSIILCESYEDAFK
                     MSNQYAPEHLILQISNAQDYVKLVDHAGSVFVGAYTPESCGDYSSGTNHTLPTYGYAR
                     QYSGVNTSTFQKFITSQSVSPTGLENIGRAVMSIAAVEGLDAHRNAVKIRMTKLGLLP
                     PNFE"
     gene            complement(<122991..>124223)
                     /gene="BIK1"
                     /locus_tag="KLMA_10066"
                     /db_xref="GeneID:34713750"
     mRNA            complement(<122991..>124223)
                     /gene="BIK1"
                     /locus_tag="KLMA_10066"
                     /product="cytoskeleton-associated family protein"
                     /transcript_id="XM_022822359.1"
                     /db_xref="GeneID:34713750"
     CDS             complement(122991..124223)
                     /gene="BIK1"
                     /locus_tag="KLMA_10066"
                     /codon_start=1
                     /product="cytoskeleton-associated family protein"
                     /protein_id="XP_022673605.1"
                     /db_xref="GeneID:34713750"
                     /translation="MNREEYIGLVVEIPNIGRGQIRYIGSVEMKEGIFAGIDLYSGNG
                     KNDGTFKGRKYFQTTFPRSGLFIQWEKVANLIPQQCNGGSNGRTLHSLSPTPVRGMGN
                     PILNQGSEHSQQRKTSVTELGPSFRASTENSSKLIDTDRMEAELFQYKRVVEDQRIVL
                     EEIQAAIDEYETKLESTEREKLTLQRQLEHERASHERQKQFYENEHDQLLTVIDELQN
                     EINRNAAILSEIMEREKNMDVDVRNEPTNYDNSQNMIDSSVIDDLKAQLHDLQQYKNQ
                     SELYKTKWEKEKEQLKLHNQSLSKEYQSVSNELLECQKKLHTGENKQNSLEKELDEAR
                     KTIDSLQSQLQVMQKKQEQQSVMQIDDNMETLPLYNPNVEQKGSISLATAGRSLWCAL
                     CEKDGHESVDCPYDDKFF"
     gene            complement(<124812..>125903)
                     /gene="PRY2"
                     /locus_tag="KLMA_10067"
                     /db_xref="GeneID:34713751"
     mRNA            complement(<124812..>125903)
                     /gene="PRY2"
                     /locus_tag="KLMA_10067"
                     /product="SCP super family"
                     /transcript_id="XM_022822370.1"
                     /db_xref="GeneID:34713751"
     CDS             complement(124812..125903)
                     /gene="PRY2"
                     /locus_tag="KLMA_10067"
                     /codon_start=1
                     /product="SCP super family"
                     /protein_id="XP_022673606.1"
                     /db_xref="GeneID:34713751"
                     /translation="MKFNSVILTSFLTASALARSVVTLDETFDAVSVRVTKPPASSST
                     STADDTTSTEASAVTSAPSSDTSSVVNTESALYSNSSSAAITSSSSSLSSIVTTTSGS
                     KLQTILTQSVVAKSSSSSSTTAQTSKSSTTTSSTTTSKSSTTTSATTTSKSSTTTSAT
                     TTSKSSTTTSATTTSKSSTTTSATKTSIAQSETTAEAISASDRAAVLDTHNSLRARHQ
                     DTGSLVWNDDLAAYAYNYAQSLKGGDSDPCNYVLKHSGGQYGENLAAGTNSSPADLVN
                     LWYDEIKYYDYNNVTGIEHDGHEVGHFTQLVWASSTDLGCSVERCTNGAVYLICEYSP
                     AGNIYVVGEGVTDHYMLYEQNVKPLKSTQ"
     gene            <129119..>130696
                     /locus_tag="KLMA_10068"
                     /db_xref="GeneID:34713752"
     mRNA            <129119..>130696
                     /locus_tag="KLMA_10068"
                     /product="SH3 super family"
                     /transcript_id="XM_022822381.1"
                     /db_xref="GeneID:34713752"
     CDS             129119..130696
                     /locus_tag="KLMA_10068"
                     /codon_start=1
                     /product="SH3 super family"
                     /protein_id="XP_022673607.1"
                     /db_xref="GeneID:34713752"
                     /translation="MDTVTETLLITETAMDKLVVQNDATVINTIFVDEYFQQSKSLPF
                     ALTTVSTATATVVNKNVGTATITGRVTTTISDQLSTSSTSASSTHSANSSNLNHTSSQ
                     MSKSSNMPTSTAAARATSSALVSPIAIPGFGNSSKSSNGTILGLAIGLPIALFIIGLA
                     CLLGMFYYKRKNGITDLEKEVKTSKRDRFLSKIYGAKDPNIGEKNSSDYGKENDEDEY
                     FDSAMNSKVAYRLSKPYISPPTLIKTPQKVAFPTNPYRKTKDINEETYSTSSLNQVQF
                     PKPLASPFKKWTYESPLSRWFLTKSTLIQDKMQTVKTPTMHLKQLNILARVNKSKITV
                     DDEMPYTEASPMLPTVPTSPYDSIQPLPTGIRYESTLVPVNETEFSGGGQNIKPQVLE
                     TNNKFVYPPVVKLDNKIKSKPLPKPPSFVKSLDPELRRHSNHSAAEKHDLGSARRSTI
                     EEQAKLFQVVKDYQAVLMDEIHIKRGEIVRVLARHTDGWCLVERHDAAKSGSLDGPSY
                     LNEDRGIVPGLCLQECT"
     gene            complement(<131011..>131601)
                     /gene="HBN1"
                     /locus_tag="KLMA_10069"
                     /db_xref="GeneID:34713753"
     mRNA            complement(<131011..>131601)
                     /gene="HBN1"
                     /locus_tag="KLMA_10069"
                     /product="putative nitroreductase HBN1"
                     /transcript_id="XM_022822392.1"
                     /db_xref="GeneID:34713753"
     CDS             complement(131011..131601)
                     /gene="HBN1"
                     /locus_tag="KLMA_10069"
                     /codon_start=1
                     /product="putative nitroreductase HBN1"
                     /protein_id="XP_022673608.1"
                     /db_xref="GeneID:34713753"
                     /translation="MSSAASQQFLKAIAARRTIYSLKPELPSGVSIDDVQAVVQAIIK
                     DTPTSFNSQSNRALILTGEAHKKVWASVTDAVEGEAGKKRPASIRDEAYGSIIFFSDD
                     KTVEQLKANFPAWAGAFPSFADQSSGAAQISAWTALELLGLGGHLQHYNGYVKAALPE
                     GAAPQEWNVTAQLVFGAPAAPAGEKTFIENPVKVLN"
     gene            complement(<132354..>132944)
                     /gene="HBN1"
                     /locus_tag="KLMA_10070"
                     /db_xref="GeneID:34713754"
     mRNA            complement(<132354..>132944)
                     /gene="HBN1"
                     /locus_tag="KLMA_10070"
                     /product="nitroreductase-like family 4"
                     /transcript_id="XM_022822403.1"
                     /db_xref="GeneID:34713754"
     CDS             complement(132354..132944)
                     /gene="HBN1"
                     /locus_tag="KLMA_10070"
                     /codon_start=1
                     /product="nitroreductase-like family 4"
                     /protein_id="XP_022673609.1"
                     /db_xref="GeneID:34713754"
                     /translation="MSSVTSQQFLKAIAARRSIYSLTPELPDGISINDVQSVVEAIIK
                     HTPTSHNSQGNRAIIITGEAHRKMWSSVVDAIEGDTGKKSPTSIRDEAYGSIVFFIDD
                     KTLEQLKNNSPVWASVFPSLADQSSGAAQISAWTALELLGFGGHLQHYNGYINAALPE
                     GTVPEGWKVKAQLVFGAPTAPPREKTFIENPVKVLK"
     gene            complement(<133706..>135562)
                     /gene="GNP1"
                     /locus_tag="KLMA_10071"
                     /db_xref="GeneID:34713755"
     mRNA            complement(<133706..>135562)
                     /gene="GNP1"
                     /locus_tag="KLMA_10071"
                     /product="high-affinity glutamine permease"
                     /transcript_id="XM_022822415.1"
                     /db_xref="GeneID:34713755"
     CDS             complement(133706..135562)
                     /gene="GNP1"
                     /locus_tag="KLMA_10071"
                     /codon_start=1
                     /product="high-affinity glutamine permease"
                     /protein_id="XP_022673610.1"
                     /db_xref="GeneID:34713755"
                     /translation="MSNSGPSDKDFASHEMSDLKLSNKSDIIINDSIANNEGDAEYYE
                     KTFANSDDYNYESKGSSWRRFKDSFKRADRINQDILGSADLELNPSHSLVAENANLKQ
                     NIKGRHVLMMSLATGIGTGLLVGNGKTLYTGGPAGLTIGYAIMGSCLYSIIQAAGEMA
                     VAYPTLVGNFNNYPSFLVDPALCFATSIIYCLQWLCVFPLEIISASLTIKYWTTSVNP
                     NVFCAIFYCLIIFINLCGSAGYAEADFFFNTCKVLMFIGFFILGIIINCGGAGNDGYI
                     GAKYWHNPGAFNGHTSIDRFKAVVSTLVTAAFAFGASESVALTASEQSNPRKAIPSAA
                     KQVLYRIIAIFLGSIILIGFLVPYNSTELMGSGSSSVHASPYVIAVASHGVKVVPHFI
                     NAVILLSVLSVGNFAFYSSSRILLCLSEIGYAPKQLQYVDRMGRPLYAMIIGAIFGCI
                     CFVSASPKEEQVFTWLLAISGLSQLFTWMAICISHIRFRKALTVQNRTAGELGFRSQV
                     GVWGSWYGVIMMFLILIGQFWVALFPIGGKKGADANNFFQNYLALPVFLVLYLGYKTY
                     YKDWRLVIPAEEVDLVSHRKLFDEDVLKQEDEEYKLRLKHASFWAKMQDFWC"
     gene            <137703..>137984
                     /gene="SMT3"
                     /locus_tag="KLMA_10072"
                     /db_xref="GeneID:34713756"
     mRNA            <137703..>137984
                     /gene="SMT3"
                     /locus_tag="KLMA_10072"
                     /product="ubiquitin-like protein SMT3"
                     /transcript_id="XM_022822426.1"
                     /db_xref="GeneID:34713756"
     CDS             137703..137984
                     /gene="SMT3"
                     /locus_tag="KLMA_10072"
                     /codon_start=1
                     /product="ubiquitin-like protein SMT3"
                     /protein_id="XP_022673611.1"
                     /db_xref="GeneID:34713756"
                     /translation="MSEEQEQKPDVKSETHINLKVSDGSSEIFFKIKKTTPLKRLMEA
                     FAKRQGKEIESLRFLYDGVRVLPDQTPEELDMDDNDIIEAHREQIGGSI"
     gene            <139054..>142395
                     /gene="GIN4"
                     /locus_tag="KLMA_10073"
                     /db_xref="GeneID:34713757"
     mRNA            <139054..>142395
                     /gene="GIN4"
                     /locus_tag="KLMA_10073"
                     /product="serine/threonine-protein kinase GIN4"
                     /transcript_id="XM_022822437.1"
                     /db_xref="GeneID:34713757"
     CDS             139054..142395
                     /gene="GIN4"
                     /locus_tag="KLMA_10073"
                     /codon_start=1
                     /product="serine/threonine-protein kinase GIN4"
                     /protein_id="XP_022673612.1"
                     /db_xref="GeneID:34713757"
                     /translation="MNGNGITTLKGDKIGPWKLGSTLGIGSTGKVVMASNESTGQQAA
                     VKIISKSIFNAQGSTIIGGTDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLY
                     MVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLD
                     HKYNVKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYA
                     LLTGRLPFDEEDGNIRNLLLKVQSGKYEMPGDDEISHEAQDLIAKILTVDPEQRIKTR
                     EILKHPLLKKYPSIKDSKSIRNLPREDTYLNPLSLEGGNERVDENILQNLVVLWHGRN
                     KDEITAKLKEPGPNLEKTFYALLHRFKHDNYQEQLKQQELQKKSSISSNSLMYVGYSP
                     SPNKLGSPVSTPKKKRSSIIVASSSHKRPVSIQKLSSQNSSPVKNGSIGKRLSKSFSS
                     NKRISVLVSNSSSPTPSSHKRISRLNDGSAPPVPKEMLRDYKRQSKRQSKRFSLLPNM
                     KRGSITTKLIATYAKLSEDNEWEYIEKETKRTSQDFATLMDEIFEHEKYEQIRKEKEE
                     LERKVREQREREEREQRERERAELEEQQRRREEELSRAQRQQELQEQMEQEIIKLKAE
                     YGATERKKPNNRSSSAPMESNGDARKRDSTFEVKNDIKNLINTRNFSLQTRPVSRLDP
                     GILANENRMSNRIDEEDISKEQTILETIRRSKFLGSQFNLNVELEKAKKELKARERQE
                     QIRKYSEQNEQPYEIQELPRNAKGVATLRDDEAEPRKLSEVKVPQFTRRSKHFSASNK
                     RFSVLSMYSTKNSFTNLVDHLKNDAYLESTLPDVHEYPTSNGNQEPEFMFEAVEEQEE
                     PSKLYEISENDNLLRSSENDTKSDTPKEISNPKPKDVNLPSLPPLQNSHNRLDEDGAM
                     GLGIYQTNEDSEKSPKPDLDDEQVDENTKRETVQEERKKQELKENKAPLNDVMKKNNE
                     RKPLEEITPKVQNKRKISFFRKFSQGAEKKVGPANFDCELKASVSAPKMFKALDRLLK
                     EWTDYGLKQVKSVPSQSVIYGKLTSDNILSLRSTGFMIAISEGEGNGSVIRFTKKTGS
                     TKTFNRLVNEIEKILEKEKVLIFSS"
     gene            complement(<142549..>143604)
                     /locus_tag="KLMA_10074"
                     /db_xref="GeneID:34713758"
     mRNA            complement(<142549..>143604)
                     /locus_tag="KLMA_10074"
                     /product="putative NADPH dehydrogenase C23G7.10c"
                     /transcript_id="XM_022822448.1"
                     /db_xref="GeneID:34713758"
     CDS             complement(142549..143604)
                     /locus_tag="KLMA_10074"
                     /codon_start=1
                     /product="putative NADPH dehydrogenase C23G7.10c"
                     /protein_id="XP_022673613.1"
                     /db_xref="GeneID:34713758"
                     /translation="MCTYSSEKFEANKYHLVHYGSICSSGPGFVIVESSAINPIGSSS
                     ANDLGLFTEEQAETHRENIVDWAHLHNIKIGVQLGHAGRKASMVSPLDGHLGLYLSRE
                     DGGWSDQLVAPSAVPFDEKSGVVPRELSVEEIEEIIKQYGVSAKLAVEKAGYDFVEIH
                     AGYGYLPCQFFTPTANKRTDDYGGSFENRTRFLLEIIDEVRANIPETVPIFVRLCADE
                     NVEDAESWKLEDTLKLVPVLAEHGVDVIDVCSGGLNSKEFNWGNPRFLPPKEIAHKIK
                     QNCPKNLLVASTGGVQDGKLANDLLENGIIDLLLIGRVYLKNSGVVWGLADDLGIQLE
                     QAKQKAWIFDSEGHMKK"
     gene            <144163..>146127
                     /gene="GMC1"
                     /locus_tag="KLMA_10075"
                     /db_xref="GeneID:34713759"
     mRNA            <144163..>146127
                     /gene="GMC1"
                     /locus_tag="KLMA_10075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822459.1"
                     /db_xref="GeneID:34713759"
     CDS             144163..146127
                     /gene="GMC1"
                     /locus_tag="KLMA_10075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673614.1"
                     /db_xref="GeneID:34713759"
                     /translation="MEFPNWWCVFGLLLAWLLSDTCEGKEVIFDISRHGDGRTIVING
                     NSELVKPVLRLRNGERLNLKLENHLDEPTGVHFHGMLLENYVGEGKGEGEDGQADPAV
                     LGDGVPGVTQYEVGAGYAYWQNMSVAQDTCGTFWYHSHYAVQYGEGLRGPVVVECEKF
                     DSHESRVASEYGLGDRERAQERIITLSDWYKRSHDSIMYDSLQVDGYSDPRVDGSLFN
                     GKQDAGQVVSFPADADYLRLRVLNVANSNTQVLHIANHKLIVIEIDGVLVKPVELSTL
                     TLATGQRYTVLVGRDEKSRSSQIVHGCNKMMGYITKTHILRYESPGESPGESQGESQG
                     ESQGEIVEATTTSIKRLPGFSRDELYKVYEPIDWELLPDPESSENGRKISLDYEESSS
                     EATLQKYGTSMYLVNGHTMGDFMNPEGTTTPLLLSRGGENASPKASPAAQPIDVGFGA
                     TVDIAINSIDHMRHPWHLHGHHFQVISMGESHDGPLHWDDTESVAYKKYAQDMEYWRS
                     GSRVPMTRDSINIPGRSYAVIRFATDSPGLWMLHCHVDWHMVKGLGVVLQEGLDKLPM
                     DIVRVTEPFLMSAGQTQPEEDQEDQEDQEDQDQDQDQDQDQGQTQPAPSSPPAPPGPK
                     GQSSTSKTKVLAIYGTVMLLVDVLLYKLFV"
     gene            <147309..>149813
                     /locus_tag="KLMA_10076"
                     /db_xref="GeneID:34713760"
     mRNA            <147309..>149813
                     /locus_tag="KLMA_10076"
                     /product="protein PSP1"
                     /transcript_id="XM_022822470.1"
                     /db_xref="GeneID:34713760"
     CDS             147309..149813
                     /locus_tag="KLMA_10076"
                     /codon_start=1
                     /product="protein PSP1"
                     /protein_id="XP_022673615.1"
                     /db_xref="GeneID:34713760"
                     /translation="MMNELPQVSSTTSLSDNPQLRQYYDRFLFKNSSGKSLSDLPAKA
                     REQAREQARSNLHTEGGFVDGQGQGQGLGPETGGLQMNNNNNNHNHNHNHNNNNSNSN
                     SNNTTGIDFINGFRNPMYQTATSPVSSSGSHRMNISFSDAMGGMPGAPLPGPGSASMF
                     QFSNAPMAPGPPPSAFGMVPLSESSHGHGRGSVQMDYSVMGSTSPQQQQQQQQQQQQQ
                     PVMSFQGSASSAFAQGNIGPSLHSRNNSVVSNSSISPSSYYATLNQTVSPSSQLSPLN
                     SAGGSSYGAGTVTPSNFPFSQDPTNFIVDAHANGRRSSYVADALIHGHMAGSPTSASN
                     MGNKNNANNGNGNKHNKNANNNTNTDNTQQRFFGQQRQTHSSSVSAGGGTGYQPTRNI
                     HQMKHHSVSSGSSGPISSNVTQNSIQQQPLQPVPSSSSSSSQNGTTNTQSVTAGLPAQ
                     GTFPLDNGLLLKDNHIVSSPSLSQLYKDCGENFFASKQSFEFIDTIKDLIAGKSGDEV
                     RSKKIQKFLGFLKSCNLNYNPQSDAFVSTGKHRRSSTSSYLHYRPLVLVALKNGKLEL
                     LSLPQNTNLSLARNDLIIIDGDRGKDLAVCVEPVVDLELALFINFLKKKIHFDSLITS
                     RNQHYPAEKFIDALMNNANGSQDDLNSKLYDVIELTQLIIPSKQILRFATPWECSTNL
                     HSKFQDELKALHIAQLKLKTLNSNNSANGKPSLNIKILNSEFQFDRKKLTFYYICQER
                     NDFRELIKELFKFYKTRIWLCAIPNNLEIDTKYYDNEKKEWAMYEDMMKHFQQEELID
                     NNLPPQTGFIVAPSLNKIQLDNFQIGVYKELVNSMF"
     gene            complement(<150535..>151140)
                     /gene="TFS1"
                     /locus_tag="KLMA_10077"
                     /db_xref="GeneID:34713761"
     mRNA            complement(<150535..>151140)
                     /gene="TFS1"
                     /locus_tag="KLMA_10077"
                     /product="carboxypeptidase Y inhibitor"
                     /transcript_id="XM_022822481.1"
                     /db_xref="GeneID:34713761"
     CDS             complement(150535..151140)
                     /gene="TFS1"
                     /locus_tag="KLMA_10077"
                     /codon_start=1
                     /product="carboxypeptidase Y inhibitor"
                     /protein_id="XP_022673616.1"
                     /db_xref="GeneID:34713761"
                     /translation="MFASINSAKAIQESLVSHGVVSKVLPSFSSDGSGSLIIQYQSKH
                     PVALGNTLSISNTQEKPELKLLSADADNAKIDTSALYTLCMTDPDAPSSSDNKWSEYC
                     HYLETNLKLSPSAESPMALDLSSSSGDVLVPYMGPAPPKGTGPHRYVWILAQQSPDKA
                     PGEIKDRPNWGFGKPGAGFQHYAEQFNLTPVAVNFFYAENK"
     gene            <152189..>153022
                     /gene="LPP1"
                     /locus_tag="KLMA_10078"
                     /db_xref="GeneID:34713762"
     mRNA            <152189..>153022
                     /gene="LPP1"
                     /locus_tag="KLMA_10078"
                     /product="lipid phosphate phosphatase 1"
                     /transcript_id="XM_022822492.1"
                     /db_xref="GeneID:34713762"
     CDS             152189..153022
                     /gene="LPP1"
                     /locus_tag="KLMA_10078"
                     /codon_start=1
                     /product="lipid phosphate phosphatase 1"
                     /protein_id="XP_022673617.1"
                     /db_xref="GeneID:34713762"
                     /translation="MAGNTTVREYWRYFRQFVPYYLLAFVTLAHFVYTEVTWVPNMDK
                     SFIIDTESISKSYVERELVTSELCLALTVLVPMCVCLAYCSSKTTDWKRSNVSRNFER
                     AAWMQPSPHRFHCAMVLMWACIGVTAMLTNVLKFSIGNLRPDFVERCIPIQTATTRTP
                     VRVSDTCSQPDLALLIEGMKSTPSGHSSMITCSCFFAWVWIHDHVTHISLSRKSILWL
                     PLLALGVMVSRVVDHRHHWYDVVFGCVLGLLTVAAIYYGVPQKNPSSSSSQSDPDSLP
                     T"
     gene            <153947..>155101
                     /gene="SAM2"
                     /locus_tag="KLMA_10079"
                     /db_xref="GeneID:34713763"
     mRNA            <153947..>155101
                     /gene="SAM2"
                     /locus_tag="KLMA_10079"
                     /product="S-adenosylmethionine synthetase 2"
                     /transcript_id="XM_022822503.1"
                     /db_xref="GeneID:34713763"
     CDS             153947..155101
                     /gene="SAM2"
                     /locus_tag="KLMA_10079"
                     /codon_start=1
                     /product="S-adenosylmethionine synthetase 2"
                     /protein_id="XP_022673618.1"
                     /db_xref="GeneID:34713763"
                     /translation="MGNNNTFLFTSESVGEGHPDKICDQVSDAILDACLREDPLSKVA
                     CETAAKTGMIMVFGEITTRANLDYQKIVRDTIKQIGYDSSEKGFDYKTCNVLVAIEQQ
                     SPDIAQGLHYEQALEELGAGDQGIMFGYATDETPEHLPLTILLAHKLNMAMADARRDG
                     SLPWIRPDTKTQVTIEYKEDHGRWIPLRIDTIVISAQHAEEISTADLRQSLRTEIIDK
                     VCPAEMLDENTKYYIQPSGRFVIGGPQGDAGLTGRKIIVDAYGGASAVGGGAFSGKDY
                     SKVDRSAAYAARWVAKSLVHAGICKRVQVQFSYAIGIAEPLSLHVDTYGTATIPDEEV
                     IEIIKKNFDLRPGVLVKELDLARPIYLPTASYGHFTNQEYPWEKPKALKL"
     gene            complement(<155343..>156422)
                     /gene="VTA1"
                     /locus_tag="KLMA_10080"
                     /db_xref="GeneID:34713764"
     mRNA            complement(<155343..>156422)
                     /gene="VTA1"
                     /locus_tag="KLMA_10080"
                     /product="vacuolar protein sorting-associated protein
                     VTA1"
                     /transcript_id="XM_022822514.1"
                     /db_xref="GeneID:34713764"
     CDS             complement(155343..156422)
                     /gene="VTA1"
                     /locus_tag="KLMA_10080"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein
                     VTA1"
                     /protein_id="XP_022673619.1"
                     /db_xref="GeneID:34713764"
                     /translation="MGNAVQYGRVLKLARELAGLPVISYYLKLYAAEIILDEKERDEE
                     ATQTVVSILDEVEEFRNSADDEGTKLLLHDKEKALAFAMNLAMSIYNGILVQIQNQQV
                     DSEIRKGLWCCIDLFQCCKHLWGDSMDEVVRKQCDKRIKYAKYYLMKLKKGELGSSPE
                     VLPEGMQESSPSVPLEDMPDPSGFPLVPGEIKDRYTEPKATTPDLTDGNQPEEEGDMP
                     TFVDDEEEAPTFQEEPEEPEELEQPEDPEETTFQKEPSVPLEPTPEPTPEPSPKVASK
                     ATPKETPEPAPEPTPEPLPRVKATPPAPSKISTLKEIMSREEIVHKAQKSAKYAISAL
                     NYDDIATAKKELKAALQALEELPSQ"
     gene            <156675..>159056
                     /gene="SWI6"
                     /locus_tag="KLMA_10081"
                     /db_xref="GeneID:34713765"
     mRNA            <156675..>159056
                     /gene="SWI6"
                     /locus_tag="KLMA_10081"
                     /product="regulatory protein SWI6"
                     /transcript_id="XM_022822526.1"
                     /db_xref="GeneID:34713765"
     CDS             156675..159056
                     /gene="SWI6"
                     /locus_tag="KLMA_10081"
                     /codon_start=1
                     /product="regulatory protein SWI6"
                     /protein_id="XP_022673620.1"
                     /db_xref="GeneID:34713765"
                     /translation="MSRPIFKAYKGEKISFEQRLQDGYVCLDPFIPLLSNLSSLKYHG
                     DDPLFENLDDMITSQFNILIDTDRSGTRWITLQKAHELWDLLRMQDDLNTGGSSIKRD
                     EDTNGHAQDDEGRESTGGSTTDATSKNGNGSQKNENANSSAPLSQQQEQQQQQQEKNQ
                     EPPQKQQQQQQQVSGSSGNNAGNDNVSSTQGTSRDSSTPSVPIDANVKGDQTDQIASG
                     TDEKAYNSPTTGKHDLGEHIDSPTKRHQTQSVSVIPVFKHDLPTVSTLQKTLPSITNY
                     TAEERVKLETLLQRILFPETSPEDAVTSSNGYPVIDLGQQLQELDAQFPNVKLNLNIP
                     IDEHGNTALHWLCSIANLDLLKQHIMYGSDRRIGDKSGESVLVKSVKSVNNYDSGTFE
                     ALLDYLYPCIVLVDEMDRTVLHHIVITSGMPGCNAAAKYYLDILMGWVVKKQSRSKES
                     ECALLEDINLQWVITRLLNARDSNGDTCLNIAARLGNVAIVEALLDYGADPSIANNSG
                     LCPLDFGAGTQPRFQANSKAQMSTPTKINEAVPDPMAESATLITNIKSLLSKISDDYE
                     DEVKQHNSRMSELLETLNNKREVLAKARDRLAKAKQVQDEYNLLSDRLNNVENTIAEE
                     DQNFQLASRELGLSLDDVQAEGLNSSDIIFDADEPFRISYVNTKFEEKIKNDYNNDFE
                     LFLKHCDLSKFAREIYESIPDTTEIPHPRVLKARIKAYTRNESHLESTLQTIKNKQRN
                     LESKFRKVLSLCLKIDEEKVDSMLDGLLQAISNEDPEDIDTEEVNNFLESAAE"
     gene            complement(<159251..>160855)
                     /gene="PLM2"
                     /locus_tag="KLMA_10082"
                     /db_xref="GeneID:34713766"
     mRNA            complement(<159251..>160855)
                     /gene="PLM2"
                     /locus_tag="KLMA_10082"
                     /product="protein PLM2"
                     /transcript_id="XM_022822537.1"
                     /db_xref="GeneID:34713766"
     CDS             complement(159251..160855)
                     /gene="PLM2"
                     /locus_tag="KLMA_10082"
                     /codon_start=1
                     /product="protein PLM2"
                     /protein_id="XP_022673621.1"
                     /db_xref="GeneID:34713766"
                     /translation="MDSQFPPSSPIASSHQYDLQNPFYQPEKDADGVHSSPTLRLFKN
                     KDETKKEPRKDYPTPHPSSTTGRSSSPVRGLVDEIASSDYEIERQLETELKKVNLIDI
                     TLDPRDSSRLCIGRKKSVCDIHLPRAKNISRQHAFISYISESNEIKLECNGTNGLVVS
                     FPRKLSHVLIKRLKSSNVYELVTNDKVGNGVAVTSEEKELLKSTYLTSFVLLKGESVI
                     MPYMKDTIIDFRRCEGRLRLQDVTTDEEDAANATETEDEAERTEVHLGDLNDNENKFV
                     FHSGDSKKTIIPLKEIERSPPTPKCKVPSVSPIAIRNSTLSNPSNVEKTEEKTEEKTE
                     EKPTMTPYSSFTLKTPTAPKKVETIKLLESNSTPINRKSGEISDENRRRKLNTPSPKK
                     KLKKKSRKQNTHEELSSEDILAGLTAKGIDYRELQHVLANHLAFSNIQQVPLFQLQDV
                     NSTISNLSRTQLRAILNDEQCIGVIYRTGKDAAGKPLDEEYYYDMENDPDNDRRQLVA
                     SLKGGRSGLRSCRRVHKQYFWKKPAK"
     gene            <161379..>162275
                     /gene="RpL37a"
                     /locus_tag="KLMA_10083"
                     /db_xref="GeneID:34713767"
     mRNA            join(<161379..161426,162036..>162275)
                     /gene="RpL37a"
                     /locus_tag="KLMA_10083"
                     /product="ribosomal 60S subunit protein L37"
                     /transcript_id="XM_022822548.1"
                     /db_xref="GeneID:34713767"
     CDS             join(161379..161426,162036..162275)
                     /gene="RpL37a"
                     /locus_tag="KLMA_10083"
                     /codon_start=1
                     /product="ribosomal 60S subunit protein L37"
                     /protein_id="XP_022673622.1"
                     /db_xref="GeneID:34713767"
                     /translation="MFWAFARIGLSKLFKTRHNKSHTLCKRCGRSSYHVQKSTCSSCG
                     YPAAKMRSYNWATKAKRRRTTGTGRMRYLKHVSRRFKNGFQSGTEAKPQSA"
     gene            complement(<162524..>164533)
                     /gene="LCD1"
                     /locus_tag="KLMA_10084"
                     /db_xref="GeneID:34713768"
     mRNA            complement(<162524..>164533)
                     /gene="LCD1"
                     /locus_tag="KLMA_10084"
                     /product="DNA damage checkpoint protein LCD1"
                     /transcript_id="XM_022822559.1"
                     /db_xref="GeneID:34713768"
     CDS             complement(162524..164533)
                     /gene="LCD1"
                     /locus_tag="KLMA_10084"
                     /codon_start=1
                     /product="DNA damage checkpoint protein LCD1"
                     /protein_id="XP_022673623.1"
                     /db_xref="GeneID:34713768"
                     /translation="MADLWDDDDDDDILELGNRPPMSQVALVVQNKNTSQDSKDVDEI
                     LKAKGEVGVLRQKIGMLEKMMREHDENQRKIQHDLKSSHEEEVRKLKIELQRLEDEKK
                     FMIVEQKHLFTPRNSSKSSGSSETDTSIQFPNESKRRKIEPSKEYVSLGQNFKMKDDG
                     SLFFDSLMDFRLPGAQHTVFQCLDHICTYKADLSLSTEIETIKSRSPLGPSIRSLIFK
                     WKSVYSLDQLVDKTLEILAIAIKAICVEEETKYAIPFLIALMHNVISFRHSATSINSL
                     KEIFQFITDFIISDPKFLKQPLHDNPLESDVSPDVFQYAMLDQLCMMYAFDVLETCIT
                     ILLNCSEEEQLLLLEDDIISENLTKCCSLCLSISYKPILPLIVNVTEILLGVIEMKSH
                     NKKWENRWSSLSSKLLHTWEKPISCNSSNLNFAGLNRCSTSNDNHWMLDKIVNDNEVR
                     YLPMIIENDFEALSPSALENQEYWTIQIQVNIAVIMHELAKRYQGILFSVDFLQKSFS
                     LFSYQHSLLLTVFLNRDHINDVKRQQLLTILLKLINFCWFSITDECKKSLRLDELTIS
                     LWRIVYGSPASMDDIAPEWVSLINPLKNLELEEQKQLLDDAYDEDNLPGFMISEELDL
                     KRDSALSKFTINNSWAFKETAKHILESITTLDEADSLYVAMVGEV"
     gene            <165297..>166055
                     /gene="EMG1"
                     /locus_tag="KLMA_10085"
                     /db_xref="GeneID:34713769"
     mRNA            <165297..>166055
                     /gene="EMG1"
                     /locus_tag="KLMA_10085"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822570.1"
                     /db_xref="GeneID:34713769"
     CDS             165297..166055
                     /gene="EMG1"
                     /locus_tag="KLMA_10085"
                     /note="essential for mitotic growth 1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673624.1"
                     /db_xref="GeneID:34713769"
                     /translation="MVEDSKVRDALKNGEKKVLPASLVPQAPPVLTSKDKTTKRLIVV
                     LSQASLETYKISSSGPGGDKYVLLNCDDHQGLLKKMGRDISEARPDITHQCLLTLLDS
                     PVNKAGKLQVYIQTSRGVLIELNPTVRIPRTFKRFSGLMVQLLHKLSIRSVNSEEKLL
                     KVIKNPISDHLPTKCRKVTLSFDAPVIRVQDYVEKLDEDESICVFVGAMARGKDNFAD
                     EFVDEKIGLSNYPLSASVACSKFCHGCEDVWNIM"
     gene            <166524..>168455
                     /gene="PRM1"
                     /locus_tag="KLMA_10086"
                     /db_xref="GeneID:34713770"
     mRNA            <166524..>168455
                     /gene="PRM1"
                     /locus_tag="KLMA_10086"
                     /product="plasma membrane fusion protein PRM1"
                     /transcript_id="XM_022822581.1"
                     /db_xref="GeneID:34713770"
     CDS             166524..168455
                     /gene="PRM1"
                     /locus_tag="KLMA_10086"
                     /codon_start=1
                     /product="plasma membrane fusion protein PRM1"
                     /protein_id="XP_022673625.1"
                     /db_xref="GeneID:34713770"
                     /translation="MNHIYLHLNERLSQIWCNQYTVIILIMMIKIILFTRMLSNGFDN
                     IKDYTLSNCESIDYYYSKFVDSTPHYMGKMGNYLIEKSMQETVSLSLKLISLLVTVSE
                     NVIDFMIDLWLGTWVCLGVSAIDASVDVATNTTESILNLVNGTVKSVANDLDDGLDGL
                     SKIINKILSAVNDIKNFFTGNDNESDVDKQFKHVNLTVNRLRTLSIPNSINEKLEKLA
                     GETPDFDTVKNKTKKAVAIPFNYVRKEIKTINSSKLVGNPQYLTVPPIDTNGTKICSA
                     NKPKIEEFFNALSDLFSACMIAILIIFLCAAVGFVVYTAWSEWRQWRRLEIFRDEFHH
                     QNIMLRNPFDDNADEKALERVDILETYQMVFHRYQSGFGRWISRRMSSNVQRQRRIQW
                     LVTYATTPTALTLLAMGLCGVLMCCIQYIIIAIVSNKLHGKDSTNALKEVSSSLNGTM
                     NQGMTTWSNSANLYINDTESHINTQAFGWIQNTTATLNGTVTDLLDDIDSVIAKAFNG
                     TILYKPMDSVMKCVIGNKLETISKALDWVHDTAHVTLPRVNNTQIYDAINNEMANGTT
                     TNATVSTPNSKSNSNSNSMLDDLHANLVNSATKLLAQYKKSVTIELIVSLVFLALYAV
                     QIPIAAVILALQARKRALE"
     gene            <170664..>174038
                     /gene="SKG3"
                     /locus_tag="KLMA_10088"
                     /db_xref="GeneID:34713771"
     mRNA            <170664..>174038
                     /gene="SKG3"
                     /locus_tag="KLMA_10088"
                     /product="PH-like super family protein"
                     /transcript_id="XM_022822592.1"
                     /db_xref="GeneID:34713771"
     CDS             170664..174038
                     /gene="SKG3"
                     /locus_tag="KLMA_10088"
                     /codon_start=1
                     /product="PH-like super family protein"
                     /protein_id="XP_022673626.1"
                     /db_xref="GeneID:34713771"
                     /translation="MKRIFSDKLQSSPTLSSAATFLAPPRNLFSDSSSTVGSDKASGK
                     TDSRSRSSSFGRIFSNSSDSGKNGSGLSSKQQPSLPKEQTMNTLSPELIPIVTLLSAQ
                     SHRRYHEGVFLILKDLNSDGSPAQRVWKEVYGVLIGTQLALWDARELSNNENDVSKLM
                     DATLKPTYINFTDAQLRMLDPSDTTLQVEKSSRKNIENTIVVSTTLKNRFFLQFSDKD
                     SFHTWVSAFRLSAFEFTLLQEAYTGAFLSTRGAKLSDIKVILADTKFDYEDWVSVRFG
                     AGMPWKRCYAVISQPTKRSKSGKKKYLGQINFYENDKKTKKTKAMATVTDAYAVYAIY
                     PQSPVLIDTSTMIKLEGVITFSKNDTPKDTDIFVMPEKHYAVPGYDTIIRFLIPTMNA
                     FNLYGRPKRLIANKDDPESLLFALPTLPHIHYLQVDDVLPLTKQASSNQWKLQDWRRN
                     LKELLSKKQSSGYTGCGSTAGLAGALQSPAIGSAELFDRSPNSPVFMPVPLLSTTPTE
                     SRFEPQVTSPLRLNSTTPSPTDSVPVNANGKSALTNNNASGETSNGQQIPLNDYAVPS
                     IKNDAVSPMDSSPLASLNNTRSFSTPLEQNPVFSNSEPRTFTENRNKTRVVSSNEMDN
                     PNYTSFAQPKPFTTTSSLSKTPNNAPGADSQKPGNGLSNGNARLSDLSQIYDNYRSQK
                     PGSFTSPSQNSNEPDASFDSHNSIVVKDASSAYNEYTGSPKVKKFDISNVGAASSDDV
                     LEDFYQLSKQISALSINSEANKVKEEAKKEEDFDFSGKETSYAVASDNVFDPDYMEEN
                     DMLDMESRYTKDDFKNNASTDSLNHDRFYEAHDSVQNSSQMPYNDMASPPSTANSYNS
                     NVNERPENNIEKKQAAIPRSKPVPLHSQLMGQSGSGSGSGANANANANVNVNPVYGGS
                     PAARGAPQTNRRGPQPYPSAQAVHSRPHNAMPKSTSPQRAPVPSENGAMGMQYPRGPN
                     PQQQMPAPQGFQKRAPYSYGAQKTPGSQQRIAPQMMGAPMGAPMGPQPGMTQHRPQGA
                     AGKPMPMQNRYGNSRPAPQQQPLPHQQQYVYSQPQVESYQQYPPNQPYPQKYPVPNDK
                     PRQALNQQYNKPKPSSRGGFSQFMPPQQSNANPYAH"
     gene            <174452..>176524
                     /gene="MDL1"
                     /locus_tag="KLMA_10089"
                     /db_xref="GeneID:34713772"
     mRNA            <174452..>176524
                     /gene="MDL1"
                     /locus_tag="KLMA_10089"
                     /product="ATP-dependent permease MDL1"
                     /transcript_id="XM_022822603.1"
                     /db_xref="GeneID:34713772"
     CDS             174452..176524
                     /gene="MDL1"
                     /locus_tag="KLMA_10089"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="ATP-dependent permease MDL1"
                     /protein_id="XP_022673627.1"
                     /db_xref="GeneID:34713772"
                     /translation="MLPLLFSSRYGTQGLQLGLKRAKTLYTPVINVRWRVHPSFGQSR
                     SFSQCKLLWQEEPKSDRPTLKDRVKELRLSPNDSKASGWQDIKRLFLLAKPETKSMLV
                     ALLLIIVSSAVSMAVPSVIGKLMDIAKDEHEQTGEEKEETKIFGLSSNQFYAALGGIF
                     VIGALANVGRIVILKVTGERLVARLRTRTMKAALQQDATFLDHNRVGDLISRLSSDAG
                     IVSKSVTQNLSDGTRAVIQGFVGFGMMSYISWKLTCVMMLLAPPLGVMALVYGKRIRN
                     LSRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKEIHRYADEVRRVFDVGFKEALTSG
                     AFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSSFMMYAVYTGSSLFGLSSFYSE
                     LMKGAGAAARVFELNDRKPLIHPTIGKDPITLENKPIQFNHVKFSYPTRPEHQIFQDL
                     TFTINPGEHVCIVGPSGGGKSTVASLLLRYYDVNSGEIKIGNDNIKTFNLRKYRRLLG
                     VVQQEPMLFSGTILENILYAVPKELTKNETLIGRAIGQANCTKFLSNFPDGLQTTVGP
                     RGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLLLRSLKGKTTI
                     SIAHRVSTIQHSSRVIVLNKQGTVAETGPFDKLIAIPDSNLNKLLSKEQDTEEDEPSD
                     SEPAKEKQ"
     gene            <177111..>178589
                     /gene="MET2"
                     /locus_tag="KLMA_10090"
                     /db_xref="GeneID:34713773"
     mRNA            <177111..>178589
                     /gene="MET2"
                     /locus_tag="KLMA_10090"
                     /product="homoserine O-acetyltransferase"
                     /transcript_id="XM_022822614.1"
                     /db_xref="GeneID:34713773"
     CDS             177111..178589
                     /gene="MET2"
                     /locus_tag="KLMA_10090"
                     /codon_start=1
                     /product="homoserine O-acetyltransferase"
                     /protein_id="XP_022673628.1"
                     /db_xref="GeneID:34713773"
                     /translation="MTTVHSALKELDQEELAKSNPFIKLVHGQTIVEVPELELECGIT
                     ISNFPIAYKTWGYLNEAKDNVLVICHALTGSSDVADWWGPLLGTGLAFDPSKFFVICL
                     NSMGSPYGSFSPLSIDASTGERYGPEFPLCTVRDDVRAHKIVLDSLGVSSIACVIGGS
                     MGGMVALEWSAIYGSEYVKNLVALATSARHSAWCISWSEAQRQSIYSDPKYMDGYYSL
                     DEPPTVGLSAARMSALLTYRSRNSFENKFSRSIPSLQQQQKSGRLDAQTQSQSQSQLT
                     SKKLQDLNKEIHNDGNRSRYPLLSERKPSVSSISSSCSSRESCHSLSSSTSVSSLSKS
                     KSPKQVKPAQTYFSAQSYLRYQGEKFVKRFDANCYISITRKLDTHDLARDRNEEDIAN
                     VLESFKQPALIIGISSDGLFTYSEQEFLAAHIPNARLEKINSPEGHDAFLLEFKLINK
                     LIKDFLAKNCKELVESEGRLWQDNVEVVTNSVFGEAEEVTNW"
     gene            complement(<178952..>182647)
                     /gene="ATG26"
                     /locus_tag="KLMA_10091"
                     /db_xref="GeneID:34713774"
     mRNA            complement(<178952..>182647)
                     /gene="ATG26"
                     /locus_tag="KLMA_10091"
                     /product="sterol 3-beta-glucosyltransferase"
                     /transcript_id="XM_022822625.1"
                     /db_xref="GeneID:34713774"
     CDS             complement(178952..182647)
                     /gene="ATG26"
                     /locus_tag="KLMA_10091"
                     /codon_start=1
                     /product="sterol 3-beta-glucosyltransferase"
                     /protein_id="XP_022673629.1"
                     /db_xref="GeneID:34713774"
                     /translation="MPEESSPERSRSPSRFSKSMFIAPKAFVRKSLSPVDHIYHSVAD
                     LRFSSSNSETLESTLQAINKKMDSIDVSGGAVTGGGGGNEVSDDVAQPQCMAKSFAGF
                     LATASMYAGMDELREEEEESNSSDEVELLNDAATTILDASSQADRTLFDFSIEMNQDA
                     LSQPSTASKSRKDLVREKLLKKFIPDEDEHYVEEFPCWLLRDIMIQGHIYLTNKHLFF
                     FAFIPNFENDFHLSGSLQFVSGSSLGKSHRYWVVLKGRTLTFHGSSTDLYFPLLAIDI
                     KDIQYAKISAREAHYAKFEIKVKNDVIELRADSFHSARHWVSSIKKQIFASQHSDTNT
                     ITVKIPLQNIVDLDENAILDQSGTLRIKALENTSGYAIDEYFFVFFQGSARKMKNKIN
                     SLLKDLELSGSQILIDFKKVESATDLSNSGKNADSKKNSSDLLVDSVEDAGSVMDNDM
                     AASTAPLSAPISELPTSDTGHVSSAYPKRVKKRIKSMASSLRLTSPNKLERLEDDIII
                     EHYSPGIIHDPSVEVEVEPDKDSKSIISRFTPKKFQNIPTMWAADPVHFNVKNDAYFP
                     LDDKYAADANDSEHSDKRFKFHFSFDNTVTLLASYHGYLNRNMPVYGKIYISDKNICF
                     RSLLPGVNTKMVLPLEDIENCSKETGFRFGYFGLVIVIQGHEELFLEFSNKNARDDCE
                     FVLMKTMDINGHTNTERKKNARLDSIHKISEAANLKLLEEKISEQGYDIPLIVEKNPY
                     FTTTIKPNKSYKFGLLTIGSRGDVQPYIALAKGLMAEGHTVVLLTHLEFKDWIESYGI
                     EFREISGNPAELISLMVQHGSMNVGLLRDASANFTGWIGSLLQSAWEGAQGIDILIES
                     PSAMAGIHIAEALEIPYFRAFTMPWTRTRAYPHAFIVPDQKRGGSYNYFTHVLFENIF
                     WKGISGKVNEWREKTLNLPKTNLFTMQQNRVPFLYNVSPTIYPPSIDFNEWIKVTGYW
                     FLDEKLSYDPPPAFVSFLKKARELKKKIVYIGFGSIVVNDPQKMTDTIVDAVLEADVF
                     CVLNKGWSNRFGDKDAKAIDKELPACIYNSGDVPHDWLFTQIDASVHHGGSGTTGASL
                     RAGLPTIIKPFFGDQFFYASRIEDIGAGVALKKLNKTSLAKALTEVTTNTRIIRRAKH
                     IGELISKEHGVETAISCIYSELGYARSLIKKKSETSSYENLASTEDFSTDHSDSDARR
                     IPTEQEELSEPSTEESGASNDGSWLLV"
     gene            complement(<183443..>184681)
                     /gene="ISC1"
                     /locus_tag="KLMA_10092"
                     /db_xref="GeneID:34713775"
     mRNA            complement(<183443..>184681)
                     /gene="ISC1"
                     /locus_tag="KLMA_10092"
                     /product="inositol phosphosphingolipids phospholipase C"
                     /transcript_id="XM_022822637.1"
                     /db_xref="GeneID:34713775"
     CDS             complement(183443..184681)
                     /gene="ISC1"
                     /locus_tag="KLMA_10092"
                     /codon_start=1
                     /product="inositol phosphosphingolipids phospholipase C"
                     /protein_id="XP_022673630.1"
                     /db_xref="GeneID:34713775"
                     /translation="MYGLKSGSGWDSSGNGSCDGVEEYDVVALQEIWCDEDWSYIVQK
                     CKNRYPYYRRFKSGMITGPGLAILSKIPIESTFLYRFPINGRPSAFWRGDWYVGKSIS
                     ITLLERTAPQYAPIAILNSHMHAPYALNGDAAYECHRACQAWDFSKLVNLYKKAGYSV
                     VVVGDLNSRPGSLPHQLLTLEAGQVDSWEQKFGAQPLVHIASLSPVDQIKHAGTTCDS
                     TLNTWRAHRGADEACRLDYALIDSTTLCTIDAKVTFTEVIPNIGSFSDHFGYACVLQL
                     KERSEYSENSLSLQPNTSYMTTDQIQSRLEVYDGLLKCIDDYMITAQWQKLWRGSHFW
                     ASVVLVVLSMVVTTFTSNIAGWSSILWILFAVIVTASGVIDGLISLLFGNKEIRVLQE
                     VYEEVTDAKRFLLHRIENQQ"
     gene            <185356..>186015
                     /gene="SPC25"
                     /locus_tag="KLMA_10093"
                     /db_xref="GeneID:34713776"
     mRNA            <185356..>186015
                     /gene="SPC25"
                     /locus_tag="KLMA_10093"
                     /product="probable kinetochore protein SPC25"
                     /transcript_id="XM_022822648.1"
                     /db_xref="GeneID:34713776"
     CDS             185356..186015
                     /gene="SPC25"
                     /locus_tag="KLMA_10093"
                     /codon_start=1
                     /product="probable kinetochore protein SPC25"
                     /protein_id="XP_022673631.1"
                     /db_xref="GeneID:34713776"
                     /translation="MGIDEFSDLKSKMDGFQTKMDKFLEKSREELSVKTERYWGGETE
                     KLRLIETLRGKLEELETRRVDLREDFESSQREANEANAQSKAYHTKLEKLKEERDFLR
                     KEVEKLEVLLHEQARDLEREKESRELQSGRDEAEVEAFEKLLGLSISASVQDVITFTF
                     TGDSNCWISLDVSGDGYKIAASQPQLPHVAEKDLVDQLSATDDLRVFLKSARSLLLSV
                     S"
     gene            <186443..>187486
                     /gene="PER1"
                     /locus_tag="KLMA_10094"
                     /db_xref="GeneID:34713777"
     mRNA            <186443..>187486
                     /gene="PER1"
                     /locus_tag="KLMA_10094"
                     /product="protein PER1"
                     /transcript_id="XM_022822659.1"
                     /db_xref="GeneID:34713777"
     CDS             186443..187486
                     /gene="PER1"
                     /locus_tag="KLMA_10094"
                     /codon_start=1
                     /product="protein PER1"
                     /protein_id="XP_022673632.1"
                     /db_xref="GeneID:34713777"
                     /translation="MLSQWKLWVCCALLTLSFRVSRASPGDQLDEFDDCVDACAVAKH
                     CPDAEAIEEDNPFKNDQFADLGLCYKLLLWDCNSDCDYQCQHVITNMRIQNGEEIYQF
                     HGKWPFKRAFGTQEFYSTIFSIGNFVPHYKGFKLCRRALRKIPRSDQSRKMLVNYLLV
                     SVAGMLAWTSSSIFHTRDLIITEKLDYFFAGFTVLTGFHAIFYRSMRLDLHHKTGTCF
                     SVLVILIFLAHILRLYLDWSYTYNMRFNVFFGILQHMLLVALALLNFQRVRSLRSDLI
                     HDLVLVPIGLVVFTSLAMSCELFDFFSYNFQIDSHAIWHGLTIFPSFYLYPFFLKDYI
                     FLKSKTVVNIKEV"
     gene            <187947..>189635
                     /gene="BOR1"
                     /locus_tag="KLMA_10095"
                     /db_xref="GeneID:34713778"
     mRNA            <187947..>189635
                     /gene="BOR1"
                     /locus_tag="KLMA_10095"
                     /product="boron transporter 1"
                     /transcript_id="XM_022822670.1"
                     /db_xref="GeneID:34713778"
     CDS             187947..189635
                     /gene="BOR1"
                     /locus_tag="KLMA_10095"
                     /codon_start=1
                     /product="boron transporter 1"
                     /protein_id="XP_022673633.1"
                     /db_xref="GeneID:34713778"
                     /translation="MVVHRRDSAVYSPSGSHPECIPMEIRETTSQKSKESDVEVQFTE
                     TKNGRFPPLFSGLVHDVKDRLPQYLSDWKDSYDYRVIPSVLETYFNNLLPALAFAQDL
                     FDRTDNSYGVNEILLSSALAGLVFGIFGGQPLCIVGVTGPISIFNYTIYEIIKPLKIA
                     YFGFMFWVYIWSMILHFLLTAINSVCLLEYVTSFPCDIFGLFINVVYIQKGIQILIRQ
                     FNDKHGNEDLAAGYASIMLALLMTIFGVAFKFFRLTPLLNSRLRYFISDYSTALSVIF
                     WSAFIHFGGLLDSVTFRRLPISKAFLPTLHKGSRTTWLAYESISVGHVFLALPFGLIL
                     TILFYFDHNVSSLMAQRKAYKLKKASTFHYDFALLGLTTGISGILGIPAPNGLIPQAP
                     LHTESLLVYDNDGKVVRCAEQRFTNTVQGLMILCTMCRPFLVCLGLIPQAVLSGLFFI
                     MGIQGIIGNVIIARIWWLFTDQEKKKDSNALNHVSLRSLLKFLSLSLAGFAAEFAITN
                     TKGAIGFPIVLLLTVLLSLLFPKIFPYAELAILDGPVCEDFTLKNILPRNLMKY"
     gene            <189944..>190330
                     /locus_tag="KLMA_10096"
                     /db_xref="GeneID:34713779"
     mRNA            <189944..>190330
                     /locus_tag="KLMA_10096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822681.1"
                     /db_xref="GeneID:34713779"
     CDS             189944..190330
                     /locus_tag="KLMA_10096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673634.1"
                     /db_xref="GeneID:34713779"
                     /translation="MIPPPVDPALLREHAYADTGNLEIVLNPKTFTDFGGFKSIEKYG
                     LGYFNYMFALDKRVTEVSIKDILRCHIYKHFNFYFVILVMLTLMWLLSLTIYAESLKE
                     KISFDLGRSRSHKKKSGEISYDHVQV"
     gene            complement(<190482..>191531)
                     /gene="GOR1"
                     /locus_tag="KLMA_10097"
                     /db_xref="GeneID:34713780"
     mRNA            complement(<190482..>191531)
                     /gene="GOR1"
                     /locus_tag="KLMA_10097"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822692.1"
                     /db_xref="GeneID:34713780"
     CDS             complement(190482..191531)
                     /gene="GOR1"
                     /locus_tag="KLMA_10097"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673635.1"
                     /db_xref="GeneID:34713780"
                     /translation="MSKPVVLRLGGVKYAQKAWEELGKIAQVVTVDPSTTRAQFLKQC
                     QDPESPISKTQIITRNVQSLKQTGRFDAELAKALPASVVAVCHNGAGYDQIDPAPLIE
                     RKVQISNVPELVNNSTADTHVFLMLGALRNFEHGRRLMYEGQWPSHPTAAGAPVGHDP
                     EGKVVGVLGLGGIGRAIVERLKPFGFKKFIYHNRNKLPSDLENGCEYVSFDELLSQSD
                     VISINIPLNPKTRHIINKEAIEKMKDGVVIVNTARGAVIDEAALIEALKSGKVRSAGF
                     DVYEHEPQVPQELLDLPNAIGVPHMGTHSVETIQKMEEFVVENVRNIINTGKVLTPIP
                     ELKGETWIEDAKPLV"
     gene            <192400..>196581
                     /gene="TAF2"
                     /locus_tag="KLMA_10098"
                     /db_xref="GeneID:34713781"
     mRNA            <192400..>196581
                     /gene="TAF2"
                     /locus_tag="KLMA_10098"
                     /product="transcription initiation factor TFIID subunit 2"
                     /transcript_id="XM_022822703.1"
                     /db_xref="GeneID:34713781"
     CDS             192400..196581
                     /gene="TAF2"
                     /locus_tag="KLMA_10098"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 2"
                     /protein_id="XP_022673636.1"
                     /db_xref="GeneID:34713781"
                     /translation="MVQMKSTPKTPGSYPATEQQFGPQFKVAHQRVQIDVDLSKNCIV
                     GTTEMIIMPLTPHLEYIALDCKNMRIKDIIFENRRLDNFVHDDPYKKLSDSYLNNLED
                     DVLYNNNGIEQSHLLRKKFSEFNHNPEGSSKSQLLIKVPSSVKIMPHDVNTLAAYLGN
                     SVGAPNITPSLKNTPSTFPGDTIYTPLTLRVDYELDHPHTGVCFDTVSSEPHLWNAYT
                     TNSELNSSVSHWLPCIDSLDEKCTWELEISVPKRVKDIGTTKVVGARNLRKRSRRDKR
                     SNMSSGAVDDDDDEDEEEDEEDEEEEDGAAYNEFMNSEITVVCSEMATKKVTAHPMDM
                     AKKTVSFQIFTPVAPHHIGWAVGAFQVLELPSILHADEDDDIDELKMHQQEQALADDT
                     RDEIPIFVYTLPTPDMDEKTVLNSTLVCQEIMDFYSKEFGSYPFTSYSLVFLPTLTAE
                     YMDFTSATFFNSRILYPPDVIDLIFPTTNTLAWGLANQWSGVNITPLELNDLWCVIGM
                     AGYMVSQLIRKLMGLNEYKYRIKMAAEAIVEQDWEKQPIGSYFDSASLPVSTISNDLS
                     FIKLKAPMVLFILDRRMTKTERSFGMSRVLPKIYLQAMSGELTNNSLSSAHFQRVCER
                     VNKNRLETFFKQWVYGSGVPIFRITQRFNKKRMAVEMGIRQVQMQELGVGKIVGEENF
                     HSSAMEYLRDQEKYPTQVFTGSMTIRIHEADGTPYEHIVELKDVFTKLDIQYNTKYKR
                     LKRRRKVNKVTKEAKDEVKEDMNDEDNGNEDIVLINCMGDVLTSKDDCNKWSLTDPIT
                     TSEGDDLQQQNEAFEWIRIDADFEWICKVHINQPDYMFASQLQQDRDVEAQIESVRFF
                     EDLIINSSSNSLVYSSILTRTAMDPKYFHGVRVAACRALSKFVIKNNEPTEFTGGPRH
                     LIKIFRELFCYNDSNIPKNNDFSDYQKYMLQKSIPKFLALVRNDEGVCPSFVKQFLLD
                     VVRYNDNSGNIYNDTFYVSQLLESLVNCTLSDVIDENHVQEVMNEIQRFYNLDQWMPS
                     YQHLIATTIKTQRLKLSVHGLYHYDNFSQLLSSTILDNQGDERSTVCHSRDGKQDAVL
                     EDFKILLVIGGIKNKEVLKYFFENLCFHPDPYIRTKLVDVFIGAIDLISAKFHISDLE
                     DDIEYMINEICPSEPDMASGSIVVEDFTKEIAQRKETQMRSSIHGMISLIRRRFKDYQ
                     PLRTILWDVLHSPLLNVYQRKRLFDAANVIYQLYDAYNITLPTPRDKKLICKNIGNNH
                     VVIKREGILKVHIAPLKLKSEAKTTPTTIKISFSKKTSHKAAAPTATTAAAITSSPAP
                     KPKAKPSSVAGKITKVGSLPLRFVKISTATNSVHVSAVPHNPNVSIVKSTRRILSVKL
                     KLPPNSEQKKEHQKN"
     gene            <196904..>198604
                     /gene="SLP1"
                     /locus_tag="KLMA_10099"
                     /db_xref="GeneID:34713782"
     mRNA            <196904..>198604
                     /gene="SLP1"
                     /locus_tag="KLMA_10099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822714.1"
                     /db_xref="GeneID:34713782"
     CDS             196904..198604
                     /gene="SLP1"
                     /locus_tag="KLMA_10099"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673637.1"
                     /db_xref="GeneID:34713782"
                     /translation="MKYILCLLLLFIGRNLAEQAVNTDSKLDVLENSFKLQSVATPAK
                     NGSNISIPSSHRVSPSISSETLSSQIDSRPEFLSFNEWNKEKLRQKKAVHQDRPQRLK
                     FDNSNSGEVMRDELDMDFEIFNEEEPEGKVYKDKFNYASVDCAATVIKTNSEAQGATS
                     ILFENKDKSLLNPCSVSNKFVVIELCEDILVESIVMANFEFFSSTFKTVRFSVAERFP
                     VPKNGWKVLGEFEAENVRNTQEFKIPNPMIWARYLRIEVLSHYGDEFYCPITLIRAHG
                     IAMIDEFKMEVQNSGAELEEMIPIDHVSAIEKEKCMIPKSFATNNMSINFDLDFNYQC
                     LASLKHMDFDEFFAGHRNNENITRIKETSASMPINTEESIFKNIMKRLSGLETNMTMS
                     ILYIEEQSKLLSRSFDELELSYAQKFEALINVFNETMNMNLENLNQFASQLRESSLKI
                     VEEQKLTTDKFLTTTMKKVDDLETAYRQQSRVLYLILFGLITLIIYISLTRESYFEDH
                     MVDDGWYSEGSSLTKLKKNIKRSVSENSHGLSFEVSTYSPISSDSDFDDDDSVIISNK
                     "
     gene            complement(<198837..>200402)
                     /gene="CCN1"
                     /locus_tag="KLMA_10100"
                     /db_xref="GeneID:34713783"
     mRNA            complement(<198837..>200402)
                     /gene="CCN1"
                     /locus_tag="KLMA_10100"
                     /product="G1/S-specific cyclin CLN1"
                     /transcript_id="XM_022822725.1"
                     /db_xref="GeneID:34713783"
     CDS             complement(198837..200402)
                     /gene="CCN1"
                     /locus_tag="KLMA_10100"
                     /codon_start=1
                     /product="G1/S-specific cyclin CLN1"
                     /protein_id="XP_022673638.1"
                     /db_xref="GeneID:34713783"
                     /translation="MPPIKHRMIYKERTNMLLNERPRISYGPPRSRPRARPYHPLLAQ
                     LESNACEASIKDYERELLVYFQELQQYDCPSAKMIDNQPELEWYMRPYLLDFLVDLHS
                     ALRLSEPVLFLAIQIMDRYSSKRIVHKKHYQLVTTTSLWIAAKFEDKKSRTPSLRQLV
                     AACSNIYDSYMFVQMESHILNTLNWEVRTCFTTFDAIQLCFRETEMIWPCKDVSMLQI
                     FSIFFAELSCYDKHYMEFSSSVRAASAIVLASVLLQDTSFQKHISDLLLDFSGLNCDD
                     TFFSNPCRVNKESNDDDNDESNDMDDLFSVICAPLLKIDENTHIDIRRCCLLYLNDIF
                     RPITSNKELPRALRAKYEKTCLQDYITSYTTNNIDTYLQLCKLTQALLNPIYDRRKLL
                     DQINFVTDLMVGLELQRKTPVYEDHSIAAYKDTNSNVTSELQSEILEVDSNDSTYSSS
                     SCNLNTSSSSAENRSPWTPASVFSATRSLSNVSSFDHEIDVVDSTIKKDNHSVSLPTP
                     LRNCISLEFEPSI"
     gene            <203014..>206484
                     /gene="TOF1"
                     /locus_tag="KLMA_10101"
                     /db_xref="GeneID:34713784"
     mRNA            <203014..>206484
                     /gene="TOF1"
                     /locus_tag="KLMA_10101"
                     /product="topoisomerase 1-associated factor 1"
                     /transcript_id="XM_022822736.1"
                     /db_xref="GeneID:34713784"
     CDS             203014..206484
                     /gene="TOF1"
                     /locus_tag="KLMA_10101"
                     /codon_start=1
                     /product="topoisomerase 1-associated factor 1"
                     /protein_id="XP_022673639.1"
                     /db_xref="GeneID:34713784"
                     /translation="MTEEPSSNLATEDGPNILDQKTYEDVSYTIIKARIGMLATAIGG
                     PDHSSDSANPPYKIGDDCLACIKDLIRWFKLVDDKQKKWDVEMATAEFKILQNDLIPI
                     MLDWETKSSSAARKSKKTGEDISVFFPNKAYYDRIALGCLQLMVLMTWPLIITDQSSY
                     NQVNYYYELKKHQLLYKHAILSTENGKVLKAAIRLALNVMQRDRLDRTSRDDSLIRMV
                     LHFIKNIVAIEPGEVTISSVKRLKKPLTAEEMLPTNIRQDDISINSVIDAFDKNKVFG
                     FLLTISSSLTESVDEEFVNLPLLELMFFMTKDINPERLFKSSKKKYDVNVNHEISESN
                     LSNSGKQLSELLAKEHEKKINVIKNTSSRHSRFGGLLSIRTPQNTRLTVASNSVNMND
                     DAALQEIDSRKKWNKSIRMRLDVIEGLSSTFLNTEGSTAHITIENLQKLKEFLSNFVD
                     SSFNLLLRKVTDHFTSEIQDQLSLHKIEYMLFISWFIKFQRIRCLFEKDTSPDYVAGV
                     LLDECYIMFMKYMRESYDHKNWPVIHAGMLLFTEYLNFLLSLDDSWQNDIYAVIGKLL
                     GENMLQLLSALPKSASSHSSQYIKSCINMTHVVLKTFDRFNEKSSLAVESKRKRKVNL
                     KHLTIEKFAKEHDIDYEEAFELLEEQFKKVTINFDRVFRGYLNEATLSMYIKYLQSFK
                     EIEVPVLSRILKFLQRVFVDAKEEILLYRIDFLILCKEILGPQGLPLASDIRHQFSRF
                     IEYFLHRFRKKLMKMPSLYVSILFPMIHDSQIAYYMKNGTMKPTTAKYDIVVPSVFVN
                     IEDEDAIPDKVLKDMHIGILVSSLIDDGYEELVDSLLSNLLSILERLKQQSSDSALTD
                     QPQKITYNVDHNEIKRALHQQADFRRLLIITGFAIPDENNDECYFSRTNDINEIHESI
                     DTIKKYKSLPFESSSGKPASYYLSYAQSSDDHYDNYGSEVENDDYFQELETMERRIAG
                     RELTKGKAKSKSTIKKVGSKKRRRSSHSESLSDDSRDIPSTKSTIVSKEYIYDSDDDD
                     PRFSTIFFENEKYLRQLLDKNKGALSSEQYERFTQFCQERLENDGVVRSDFSDLFDNS
                     LSMNVNGMHEGLKEHTSLSEEQQNDVETQQIIDSNDLSSDEYNSESENDEDDIPVRKR
                     SRAQLSFDNV"
     gene            complement(<206533..>207930)
                     /gene="AVT2"
                     /locus_tag="KLMA_10102"
                     /db_xref="GeneID:34713785"
     mRNA            complement(<206533..>207930)
                     /gene="AVT2"
                     /locus_tag="KLMA_10102"
                     /product="vacuolar amino acid transporter 2"
                     /transcript_id="XM_022817808.1"
                     /db_xref="GeneID:34713785"
     CDS             complement(206533..207930)
                     /gene="AVT2"
                     /locus_tag="KLMA_10102"
                     /codon_start=1
                     /product="vacuolar amino acid transporter 2"
                     /protein_id="XP_022673640.1"
                     /db_xref="GeneID:34713785"
                     /translation="MTSIADNFYSKLSRNEEESIHPDEAFQLELTSFDDATKKASLGN
                     EDQSFDIGQEDPLTEDIYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGG
                     LIATLFMSYLVDWTIRLIIVNLKLTGRTTYQSSVEAAMGKWGGVVILITNGLFAFGGC
                     IGFCIIIGDSIPHVLAAFFPSHAHIFHRNIIITLVTVFISYPLSLNRDISKLSKTSMI
                     ALIGLVVIVIIIVIKAPLTSSEYKGSFQIHHYFITPRIFQGISVISFALVCHHNSSFI
                     FFSLRNPSLKRFNQLTHVSLILSCAICLTTAYSGFLNFKDKTQGNILNNFPADDNVIN
                     FARLLLGLNMLTTFPLEIFVLRDVVRDIMYYSNERTEPKKLSLKMHVIITSFLVFTIM
                     CIALLTSNLGALLEIIGATTASLMAYILPPLTNIVITGKSKSLKEKLPYFGCIAFGFI
                     IMFVSTSQTIMEAFS"
     gene            complement(<208209..>210287)
                     /gene="SEC2"
                     /locus_tag="KLMA_10103"
                     /db_xref="GeneID:34713786"
     mRNA            complement(<208209..>210287)
                     /gene="SEC2"
                     /locus_tag="KLMA_10103"
                     /product="rab guanine nucleotide exchange factor SEC2"
                     /transcript_id="XM_022817819.1"
                     /db_xref="GeneID:34713786"
     CDS             complement(208209..210287)
                     /gene="SEC2"
                     /locus_tag="KLMA_10103"
                     /codon_start=1
                     /product="rab guanine nucleotide exchange factor SEC2"
                     /protein_id="XP_022673641.1"
                     /db_xref="GeneID:34713786"
                     /translation="MSEQEESKRISLQVTSLSTQLIESIDKQSQLEEQLVTAKKTIAS
                     QQHAIDSYNELKQNYETLKQEYEKDREKFRKQEVICADAEKKVSSLNQEIEDLTASLF
                     DEANNMVADARKEKNSVEILNAKLKEQLKEKDLLLDTLSMQLKNLKNVLYKLENDHSS
                     KNVSISDSAMSSSTSIERSTTNQTSTYENLQAAPSGLLFSPLIQALRYDVPLYTEYLK
                     FLAVLPECETIHQTSSDSKLIKRLVNYEILPVLRLDNASGIGWLTKRNLMNLMMEGLV
                     SIEPISGVNETYRSGYASPTVTDTPNSESNESHLFSRPLNSPPVAMLDPCAFCGENRN
                     DILEHGRLYVFKTYQKQEDGKTEVQNQLPVCHYCLIKLRQVCEIFAFLRSLKSGAWNL
                     EKVTLASIKDGNLTNYFEVLKTSKSKSKSKRLSIFQGFKSSQTSTPVTENLHQFADKN
                     GLPTTNIQRSWARLSQLRASLHWSHIGVWSLDEAYAADITPASEANKIKDGEEHGLGI
                     TSEQIPIPLTPEGDETFDFEAANSSTKSTGAVSANNSSDIQEDTTEIIEKEVQEISDV
                     ESSSVFKESQGEKVKGELELTDVSAHGDKTESHQQTEEQKLNSAPDVTPVPEDLSDIK
                     ESVDQSPETRDSSEEPNEVLDAYGSPSVKTSRSTDSVRENNPKNKSSPSSDDISEDED
                     HFNDAKEEVD"
     gene            complement(<210531..>216110)
                     /gene="BNI1"
                     /locus_tag="KLMA_10104"
                     /db_xref="GeneID:34713787"
     mRNA            complement(<210531..>216110)
                     /gene="BNI1"
                     /locus_tag="KLMA_10104"
                     /product="FH2 super family"
                     /transcript_id="XM_022817830.1"
                     /db_xref="GeneID:34713787"
     CDS             complement(210531..216110)
                     /gene="BNI1"
                     /locus_tag="KLMA_10104"
                     /codon_start=1
                     /product="FH2 super family"
                     /protein_id="XP_022673642.1"
                     /db_xref="GeneID:34713787"
                     /translation="MQRSHTSRGANGSEQTLPRTASTSQSSGIFSNLKKLATGGNHGS
                     NPQANQSRKELISSPKRVFTTASLEAATPISSNKPLNKNNTLNTHNISHYTMEPETHS
                     RSHSASLLTSPTKYSYSRRSSQLTRSSTNRSMLSSSAASVSSNSTTVLNKFLTNDGTL
                     KLERPENVEEIDGLFMDLLIKRNVFDTVSPQDQKDMLNYPIEKKWLMVKQDLQSEFKR
                     LKNTKPRYSNNENSHTVKRNGSATKLNTQYEHMLQTNNSETSLNSPSHSPPEYYVRQI
                     ISKKIKNKELNDLWVSLRTEPLDWVISFLDAQGQIAIANLIITSMHQDTTDNMNAVHD
                     LQFLERETSLFKCLRVLLNIRECLEEAVKSTLITNALVEGLLSTRISTRRLATETLIY
                     LVAKDEDLKTRTMGLDTFPLVMESLNHEMPITQNIHIKAKIASEQSAGFKPQLYQVSK
                     ILQQWFYVLEHTLDGRGKMGSLVGASEEYKNTNGENSIFEYLVESIVLINQLCLRSED
                     VKKRHMMRTQLKTLGLNRILQKMQLLDYPPLTTVLLQFEDAAIDDYNILLESQKSTEN
                     VNMDDPVSILQRLSSSLKGTEAESYLLSVLQNLFLSSNKLTREGDDPSKCVQQLKLID
                     SLISNVAITTIDSESNFNVAIQRLYDAMQTDEIARRAILESRELTKKLEEVKAERDYL
                     NEKISKAENGLVGQLQEELAERDLILSKTQRVTEQLQSELEELKKKHLLEKHEHELEL
                     RKMLTMVNSKNADYSDSNNKPKSDPKPLNPERKTAIQNVLQKSLQKTEQDLLNESRRL
                     GTAVGSKSRLKLLRSKMEDIENEARELEMTNFAEFKPKQTVKDKQKIKAEQKSKLAEL
                     RKKLALIQNESNDITKFNIEQRVNELFKDKKLAALDRLKDLEQKYNGFHIDFSEDPEL
                     KELLNDNSETASLDPKIAQQKLEEMNTIISELNALKKEMENKVKSNSTELSEASSNSS
                     TSSSSSSSSAEDLLQSGDSQNSDVVSNGSSFLESLTQKYGTGHQPANSISTNNIGRET
                     RYPGSGYHRKSFFDRLKHTSVNPASSTDNPPLFLSELKSKIKVAEEIPNSTANSADRS
                     SEKSPGNDTELNSKPSSEPVDNEDIPNGLQTPVSQTIIEPSSLSKDAPSPPPLPAFLG
                     GKTSSTPSIAPTAVVPPPPPPPPPPPPMPPSLSSPLSVSAGSGGAPPPPPPPPPPFPS
                     ATTPKSTTIESPLLPQSPSLFERYPRPKKKLKQLHWEKIDNTGDSIWKNAQAEKVADD
                     LYERGVLSQLEKAFAAREVKSLKGKSKDSDEKITFLSRDVSQQFGINLHMYSNISVKD
                     VVAKVLKCDREFLSTPSVIEFLSKPTIIEVTNNLARNFTPYSTDWEGITSVEEARPPE
                     KDPTELQRADQIYLELMFNLQSYWGSRMRALTMITTYEKDYSDLVTKLRSIDKAVQAI
                     QASNSLRHVFDVILAVGNYMNDSSKQAQGFKLSTLQRLSFIKDEKNSMTFLNYVEKII
                     RDNYPEYSHFVEELEPIFNVTKISIEQLVADCREFSQSIKNVERSIEIGNLSDPSKFH
                     PWDRVLNKVVPVLPEARKKADLLNDEVKLSLLEFENLMKKFGEDANDKFSKNSFFQKF
                     ADFITDFKKAKTFNLKIEEEERAYERRKKLIEDQQRKQQESAQGDSSDGTNSFNAANN
                     DDRDVMDKLLNKLKNAGPAKGDPSSARKRALARKRLMEGKGGSSVLDNITADPTVESV
                     IEENAPFTTSPVARKFSQSPNIEPASNSKQDPADRARNLLLELRGTDDKIDSSTNIPK
                     AKDRLRDWKNRDKEKDKNKDVTSDSDSAPTRLQFHESADTLSDPEPAQSTTGPAATQT
                     SSSSEEEFTDAQTDDAL"
     gene            complement(<217793..>219535)
                     /gene="CAN1"
                     /locus_tag="KLMA_10106"
                     /db_xref="GeneID:34713788"
     mRNA            complement(<217793..>219535)
                     /gene="CAN1"
                     /locus_tag="KLMA_10106"
                     /product="arginine permease"
                     /transcript_id="XM_022817841.1"
                     /db_xref="GeneID:34713788"
     CDS             complement(217793..219535)
                     /gene="CAN1"
                     /locus_tag="KLMA_10106"
                     /codon_start=1
                     /product="arginine permease"
                     /protein_id="XP_022673643.1"
                     /db_xref="GeneID:34713788"
                     /translation="MTTVAQQIELEELEALHSSLSQANTRSHVNITHSKSADTIGYSK
                     ENNIALDTIDDDSSHILDPESAVGNAEVKRALKPRHISMIALGGTIGTGLFVSIAGPL
                     WNAGPVGSLISFMFIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAIGAANGYM
                     YWFSWAITFALELSIVGQIIQYWTHAVPLEAWIAIFWVILVTFNMFPVKWYGEFEFWV
                     ASIKVLAIIGFLIYSLCMVCGAGKGGAIGFRYWRNPGPWGNGMISKDLNEKRFLGWVS
                     SLISAAFTYQGTELVGITAGESKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYN
                     DPKLDSSSGGSYVAQSPFMIAILNCKTPVLPDIFNAVILTTIISAGNSNIYVGSRIMF
                     GLSKNNLAPKFFSKTTKQGVPFVAVIFTAMFGFLAYLNVSNNAQTVFNWLLNITAIAG
                     FFAWLLISISHIRFMQALKYRGISRDDLPFKAKFMPFGAYYGAFFIGLIIIIQGFTAF
                     APSFDVSSFFAAYISVFLFIAVWVVFQCIYRGKLYRSLDEVDIDTDRRDIDAIIWEDD
                     EPKNLWEKFWAVAA"
     gene            <222145..>223878
                     /gene="LYP1"
                     /locus_tag="KLMA_10107"
                     /db_xref="GeneID:34713789"
     mRNA            <222145..>223878
                     /gene="LYP1"
                     /locus_tag="KLMA_10107"
                     /product="lysine-specific permease"
                     /transcript_id="XM_022817852.1"
                     /db_xref="GeneID:34713789"
     CDS             222145..223878
                     /gene="LYP1"
                     /locus_tag="KLMA_10107"
                     /codon_start=1
                     /product="lysine-specific permease"
                     /protein_id="XP_022673644.1"
                     /db_xref="GeneID:34713789"
                     /translation="MAFPSNKMSGKTPASMTKSIKDVFTSDSGSLTKRSKIGQDSIEL
                     SDLQVPHDLYDQGERDEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIATPLS
                     LSGPVGSLIAYIFMGTVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMY
                     WFNWAITYAVEISVLGQIINYWTDAVPLAAWIGIFWVLITLANFFPVKWYGEFEFWVA
                     SVKVIAIIGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGTGEIAKDINEARFLGWVGS
                     LINASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILIFYIGSLFFVGLLVPYNS
                     PQLQSDTAVIASSPFVISIKTAGTKVLPDIFNAIVLVTIISAANSNVYVGSRVLYSLA
                     LTGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATDDNANTAFNWLINISTLAGLCA
                     WFFISLAHIRFMQCLKSRGISRDSLPFKAKLMPYGAYYATFFVALIVFIQGYTAFAPR
                     FSTKSFFTSYISLILLVVLFIGCQLYYRCRFFTKLEDIDIDSDRREIDAIIWEDDEPK
                     NLWEKFWAVLS"
     gene            <224642..>227539
                     /gene="PIK1"
                     /locus_tag="KLMA_10108"
                     /db_xref="GeneID:34713790"
     mRNA            <224642..>227539
                     /gene="PIK1"
                     /locus_tag="KLMA_10108"
                     /product="phosphatidylinositol 4-kinase PIK1"
                     /transcript_id="XM_022817863.1"
                     /db_xref="GeneID:34713790"
     CDS             224642..227539
                     /gene="PIK1"
                     /locus_tag="KLMA_10108"
                     /codon_start=1
                     /product="phosphatidylinositol 4-kinase PIK1"
                     /protein_id="XP_022673645.1"
                     /db_xref="GeneID:34713790"
                     /translation="MSSDQGTGNTMQSSDDRNSDILLKYINSSNFTLYNNIEYLTKHA
                     DNIGIHFYLCEKLLTFPHKELQFYIPQLVQILLTVETESLALEEIILRLSSENPHFAL
                     ISFWQLQALLGDLAHDPTSYSFQVARRVLNHLQFILFNTTRKNDNEKINENIAPALVL
                     CSTIAAGFAFPQLVEQTKPLIKSQGKRQKSYVFKLAKHAIKNMTKNLTMKNTMANSSS
                     ARKASSDSATNVDVDIVDASKTKEDYTFKKKRKNSVSTLSFDMVDDVGDKLFEEHISN
                     SIKLPKRRDTSYIHAIYKNKEAETDDYTNSMPDLRARSASSASMPELKGKNSMDAIRE
                     SQTNSAESSEKRGQVIDVSQLSTTKKIKLLKVNYFYCCTQFAIALESISQRLVQVPPE
                     ARLSALRAELSILNRDLPAEVDIPELLPPSKNGKLHKLVKISANEAQVLNSAEKVPYL
                     LFIEFLRDSFDFDPTTPENIHILNKNPRNNYIFDLSYTKQNNVPYKVDSPTYAPLSSS
                     NQEMDLADVSMVKLTNQTEAETYRHELMIKNAKVVPVIPQDSHERTSDLDFVSNLEEA
                     TEKLTDIRLHRDSPDDLATQMRVSAMMLAQLDQSPQQLSDSANQIRAKIIASMQEMQD
                     KFGYRDLESIHGMAGERKLENDFKTGGLTSSNDKSSTSYLGEDWNTKKEKIRKSSQFG
                     HLPNWDLCSVISKSGDDLRQEAFACQLIQAMATIWAKEKVGVWVKKMKILITSSTTGL
                     VETITNAMSVHSIKKSLTTHMIEEGVLDEKGDIASLSDHFSRVYGDKNGFKFKHAQDN
                     FACSLAAYSIICYLLQIKDRHNGNIMIDNEGHVVHIDFGFMLSNSPGSVGFEAAPFKL
                     TYEYVELMGGADSETYKKFVELCKAAFKALRKYAEHIVSLCEIMQKDSLQPCFQAGDQ
                     TSAQLRQRFHLELSDEECDDFVENFLIGKSLGSIYTRLYDHFQLLSQGIYS"
     gene            <227843..>229027
                     /gene="TAM41"
                     /locus_tag="KLMA_10109"
                     /db_xref="GeneID:34713791"
     mRNA            <227843..>229027
                     /gene="TAM41"
                     /locus_tag="KLMA_10109"
                     /product="mitochondrial import protein MMP37"
                     /transcript_id="XM_022817874.1"
                     /db_xref="GeneID:34713791"
     CDS             227843..229027
                     /gene="TAM41"
                     /locus_tag="KLMA_10109"
                     /codon_start=1
                     /product="mitochondrial import protein MMP37"
                     /protein_id="XP_022673646.1"
                     /db_xref="GeneID:34713791"
                     /translation="MLRTKVVRSVRHIPANKSVNELVRFQSGNNGVLKQSRIASQEVI
                     HPSQHKFRSRTIGSANDGGECELKNKDDDLYLLEKGLRKTDERASKFTNYLYKINRLP
                     PNYGSNQMIAIEQSLENELRSILGHFKSPIRYAFGYGSGVFRQAGYSKSDEKPQIDMI
                     FGVTHPDHFHSLNMRQNPHHYSSLRYFGSEFVSRFQEVGAGVYFNPFVNINGHDVKYG
                     VVSIERLLRDLATWDSFYLAGRLQKPVKVLKNDLRVQYWNQLNLKAAATIAKHQLTKK
                     YKGEPFSEFEFYKEITSLSYLGDIRYKLGGENPKKIDNIVEKNLENFKLYYKPIYNDV
                     MLNNSTYLPQNFTLDNATEQLTERISRGSTIQTAKGVVSAGLVKSIRYAWAKKLKAMK
                     SN"
     gene            complement(<229137..>230012)
                     /gene="IST1"
                     /locus_tag="KLMA_10110"
                     /db_xref="GeneID:34713792"
     mRNA            complement(<229137..>230012)
                     /gene="IST1"
                     /locus_tag="KLMA_10110"
                     /product="vacuolar protein sorting-associated protein
                     IST1"
                     /transcript_id="XM_022817885.1"
                     /db_xref="GeneID:34713792"
     CDS             complement(229137..230012)
                     /gene="IST1"
                     /locus_tag="KLMA_10110"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein
                     IST1"
                     /protein_id="XP_022673647.1"
                     /db_xref="GeneID:34713792"
                     /translation="MSHQQHGVMKLKALLTMSIQRLRYAQEKQQALAKQSRRNVAKLL
                     SDGKEQKAHYRVEGLINDDIHIELLEILELYCELLHARVAILNTIHDEITLIESHTDD
                     GINEAVRALVYASLYTPEIRELGQIKDSLGVKFGIGFLKAILDEKIGVPQKVLQKCSP
                     ALPKQDLVELYLREIAKTYDVPYSALEESDDLEQSLDEAKDEYSSEGVSEDDSGADSE
                     DGKPILAVNNDELGDDKHPIVIKKPRQNSETLDKKLKIPSEMVKDVKVSHGKNKTVSN
                     DSIDELRKRFEALRR"
     gene            complement(<230244..>233330)
                     /gene="TFC4"
                     /locus_tag="KLMA_10111"
                     /db_xref="GeneID:34713793"
     mRNA            complement(<230244..>233330)
                     /gene="TFC4"
                     /locus_tag="KLMA_10111"
                     /product="transcription factor TFIIIC subunit"
                     /transcript_id="XM_022817896.1"
                     /db_xref="GeneID:34713793"
     CDS             complement(230244..233330)
                     /gene="TFC4"
                     /locus_tag="KLMA_10111"
                     /codon_start=1
                     /product="transcription factor TFIIIC subunit"
                     /protein_id="XP_022673648.1"
                     /db_xref="GeneID:34713793"
                     /translation="MSHGQDDEEQFYEELEQYREIIEREKQDGIDEEEEDGRKESDDE
                     YNDENFDLLAEFSDYGEFSDDGYDEQEFMDAIRDANNFKRRKGKKSGSSRHESAPKQR
                     RERPLDPEVAQLLSEANEAYVRNDIQVAEQLYNKVIKADAKNFAAYKTLGDIYHLQGR
                     LNDCCNSWFLAAHLNSSDWEFWKMVAELSAELSHVRQAIYCYTRAIRINNEEWECIYN
                     RALLYKEIGQLGRAFDGFQKLYAYDPLDANILRELAVIYVEYNRVSEAIELYTRVFND
                     NVARRNAFILASESAVDSENESDNESDVPDEDLNITQEELELYSGVPLKQIAKKHRCI
                     PFDWSSLNILAELFIKQNSELNGIKTIKRCARWIQHRETQTFWEDVYDDSEFDNRRFN
                     NAKFQSLTEREKAKSYFLPIDIRIRLGLLRLNNKNVSEAMQQFQFLYEEKFDEIADLY
                     FEVGVQLVKLDRYQEAIDFLSPLTQLSEYDTIELYKPLSKCFRELDQLENARDAFEKL
                     VQFDPNDLEHKLSLAEVYHSLGDDEEFDRLLHEVVEERKRQAKEETPEVSNETETGKK
                     TRPRLAIAPLEEELPSEEIRSATLGTGKPLLEDHNYNKMPIKKKKTPEEIEREKKERE
                     KKIRSNVLNKYGQLKIYKHGMEVADSTKTTLWIDTASDLIDIFSSIKNFFVKSRSKKF
                     VGIIKRSRKFNKVIDYRIEKLSKLSQGENLMDGLPLLEEKITTSSTTELRGLTYDQWF
                     ELFMELALTIARFQSATDGLSIIETAMEVNVFSQHPGRVKMMKFVKLAIILNLKDEQE
                     IVENLRGLLNQFQFNRKVFQLFMFSVSEGQTALRILSSTVQQKFFLRQLKAFDSIRFG
                     QHVNGQASITNNVSNPGKKTCTYLNYIYAMLLYSSRGFMPALQYLKRLEIEIGNDPML
                     DLMIGLSHLHRSMQRLTGNRHFQILQGFKYLYQYHELRYASYTDIEKQEADYNIGRAF
                     HLLGLFTPAVKYYNKVLNDFEDSKLKKHAAYNLILIYNESENFEFSNVLMDRYLSI"
     gene            <233755..>234801
                     /gene="UFD1"
                     /locus_tag="KLMA_10112"
                     /db_xref="GeneID:34713794"
     mRNA            <233755..>234801
                     /gene="UFD1"
                     /locus_tag="KLMA_10112"
                     /product="ubiquitin fusion degradation protein 1"
                     /transcript_id="XM_022817907.1"
                     /db_xref="GeneID:34713794"
     CDS             233755..234801
                     /gene="UFD1"
                     /locus_tag="KLMA_10112"
                     /codon_start=1
                     /product="ubiquitin fusion degradation protein 1"
                     /protein_id="XP_022673649.1"
                     /db_xref="GeneID:34713794"
                     /translation="MFSGFGGFASGYANIPQKLEEFFRCYPIAMMNDNIRKDNANYGG
                     KIFLPPSALNKLTMLNIRYPMLFELKSQESGKVTHGGVLEFVAEEGRVYLPQWMMETL
                     QIQPGSILQVSSTDVPLGQFVKLEPQSVDFLDISDPKAVLERVLRNFSTLTVNDIIEI
                     SYNNKIYRIKILEVKPESSSKSICVIETDLVTDFAPPVGYVEPDYKAQQKNQTKVPKP
                     DAAMNGFGSMSKRINYADMLDPVKQNENFLGEGKKLSGKSIKQKEEDLKEIKISLDGK
                     PAPLNLPEGQLFFGFPYVPPVTETDNNDEKTPSKLFQGEGKSLRQSFKRKDRGAHQGS
                     KNKAPKSPEVIEID"
     gene            complement(<234841..>238431)
                     /locus_tag="KLMA_10113"
                     /db_xref="GeneID:34713795"
     mRNA            complement(<234841..>238431)
                     /locus_tag="KLMA_10113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817919.1"
                     /db_xref="GeneID:34713795"
     CDS             complement(234841..238431)
                     /locus_tag="KLMA_10113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673650.1"
                     /db_xref="GeneID:34713795"
                     /translation="MKVKEALNQSYAVFQYYFPCDKVLAKRIFKSTVHSTVALIFCLI
                     PKVRDRLGNEPAMLPLISVMVHPGRRVSGTIQGAIYCTTGLIFGLAFSLLGRFLAQRC
                     LGSSWKVLEEKEQFATNYNGYQAALAILAIFEVIMLFFHGWMRAVSHHYFGIVFPLFL
                     VVHFAFLSPLNDTAAVIAKSFSTPFYLGIALSLFWNLTLFPEFGSTYLGNTTIEALNE
                     IHHSINNAINFFLSIDESCKTLYAADTVSSARLLKMKDNISKKVNTCNAVMEECIYEI
                     SYSYMSPSELKPITSRFKDLSTYVSAVINACQLEFMLLGHKHNGHDLLNIGTEKEIHH
                     ADADKLTRVLIKLRVHVFNLHKTLSDCFYLIKVILARDFDVHFEKVRVPKAFAKDDFP
                     HFDSKNDIPTDFDTEKYINELIKALVEFDLSFREELSNIEEDLLQPNDEMFLLASFLM
                     NFKEITNTVISIMKTAQDIHYKRIDRESKGWIRGKSIWFMAFHKNRSIVNWIYGTQRA
                     TRSGTENESLNGGNSMKFEPETVPLRPNKQEEKVLPQQASTYMTMNEIQGREPMLPTM
                     SNNPMSEIKKQQSIEIVKEKSVGWFKANMLKADKTYKSCKNYFRFGFQVAVALMLSSL
                     PMFVPEARHWYIDIHGAWVGFVCILCLEPSVGGTFWVFFLRGVGVIVGAAWGYLSYVA
                     GNHQKDPYLEVIVSIFGAVPGFYFLLGSPYIKAAIIQIISIYIVMLASVIPGSVKGSI
                     LQNFAKRCLAVGYGGGTALLVQVTLFPITARDQLNAEIAFSVGCVAEMELLYAAGIEG
                     ETLHITLTDQKYDRFKELSEATKAALGRATAFKGLTRQEPRLKGEYTELENVFTQIIF
                     ILKQIVERLDNSVLLRRQYGSAISEELNHVVYPYRRQFVASMVDVLRAVQEALINKTP
                     LPQYLPSSRIAHRRLINKVRETLKIRYGAQLRASNRPNSMEGSKIKITRDSDSMSSED
                     SDEDLGLVMKTKDDHTSKERAFILKEKFLSWSASSSASEEIIEYVEELVELTKILVGV
                     NEFKYGFLSRPLYEDWAAEAVVGFADFVNQTQTTHPPPTTGTELDNDAVAEDEALSLE
                     EDAVSSRSSYLGPEQPMALPDDSHISRTLARMASNTNEATKRRASSTWRRRAFSIGSG
                     IGTDDLNKITKVHTLGDSDSGYYDDNMSSDDGDSDDELPLALKRIVSRKK"
     gene            complement(<238823..>239836)
                     /gene="PDR17"
                     /locus_tag="KLMA_10114"
                     /db_xref="GeneID:34713796"
     mRNA            complement(<238823..>239836)
                     /gene="PDR17"
                     /locus_tag="KLMA_10114"
                     /product="phosphatidylinositol transfer protein PDR17"
                     /transcript_id="XM_022817930.1"
                     /db_xref="GeneID:34713796"
     CDS             complement(238823..239836)
                     /gene="PDR17"
                     /locus_tag="KLMA_10114"
                     /codon_start=1
                     /product="phosphatidylinositol transfer protein PDR17"
                     /protein_id="XP_022673651.1"
                     /db_xref="GeneID:34713796"
                     /translation="MRLFHRKGNEVTWKPDDFIPVNKFISQPPERYTKPQPQDNLDSE
                     QRTIYQSILNHFLDPLLYLPVNGLAKQVNDSNSYSKLSDYERFWLSKECILRYLRATK
                     WNKERTLKRIHETLLWRRQFGLDNYNFIEETARLVADENITGKMLLLGYDRCRQLVLI
                     LKNYKQNTEPSYTQVKQLVWFLEAACILTPKGTEAWSFVIDLHRYSDNNNNVLSQYEH
                     PPLSLTKQVLNIVQDHYPERLYKCLVFNVPTSMWTFLKIIHPLINTVPRKKILYDTPV
                     DHHIESDQLSSEYGGKLNFVYDHTVYWPNLVETVTARKREQLQKFNEMGQTPGTSEYE
                     LRS"
     gene            complement(<240066..>240881)
                     /gene="CWC23"
                     /locus_tag="KLMA_10115"
                     /db_xref="GeneID:34713797"
     mRNA            complement(<240066..>240881)
                     /gene="CWC23"
                     /locus_tag="KLMA_10115"
                     /product="pre-mRNA-splicing factor CWC23"
                     /transcript_id="XM_022817941.1"
                     /db_xref="GeneID:34713797"
     CDS             complement(240066..240881)
                     /gene="CWC23"
                     /locus_tag="KLMA_10115"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CWC23"
                     /protein_id="XP_022673652.1"
                     /db_xref="GeneID:34713797"
                     /translation="MDLAEVKSKKLDLYRTLGFDINDKDALEATDLSQVTKQFRKLSL
                     IYHPDKSNLKDSEDVRNRWDLLQTAYQILIKHKSEYDAWFSQTFLRGNKELLAKLEFA
                     ENSQKESDGTSYTQIEPIQQYGQTLRKLLHFKITPIDWRNPQFSEVHDSSHKFAETCL
                     FRIKLVKRTEFSSADELNKWFKSIDLPLDLEYHSENNDQRENDLVIYASARDVPTTLN
                     IIKTLKDKKSYHPDILEIKPAVDFEHFSFSEKEELNPGLQSVIFNSPDKPIVL"
     gene            complement(<241127..>242017)
                     /gene="YIF1"
                     /locus_tag="KLMA_10116"
                     /db_xref="GeneID:34713798"
     mRNA            complement(<241127..>242017)
                     /gene="YIF1"
                     /locus_tag="KLMA_10116"
                     /product="protein transport protein YIF1"
                     /transcript_id="XM_022817952.1"
                     /db_xref="GeneID:34713798"
     CDS             complement(241127..242017)
                     /gene="YIF1"
                     /locus_tag="KLMA_10116"
                     /codon_start=1
                     /product="protein transport protein YIF1"
                     /protein_id="XP_022673653.1"
                     /db_xref="GeneID:34713798"
                     /translation="MSYNPYYSEFGSENNVAAGRHKHPQQEVAGAAHTTAQQPQTQPN
                     GSFFPTASTNMAFQFGQTAFNQFVGQENISHLHETVSKATGATNSSISHYFQVSNSYV
                     FHKLKIITVPFLQKNWQRIPDSSNSFQPPRVDVNSPDLYIPVMGLVTYILAWNLGQGL
                     NGSFDPENLYFKLSSTLAFFFLDLIILRLGLYLLVSNTTSPVTSLVELTCYVGYKFVP
                     LIFSMFFPASFVWLNRLAKLSLFGAFGVFLLRSIKFNLFVDMGNNTDFSFKKGTVKKV
                     NYFLFFYGFFWQSVLMWLMG"
     gene            <242488..>249045
                     /gene="POL2"
                     /locus_tag="KLMA_10117"
                     /db_xref="GeneID:34713799"
     mRNA            <242488..>249045
                     /gene="POL2"
                     /locus_tag="KLMA_10117"
                     /product="DNA polymerase epsilon catalytic subunit A"
                     /transcript_id="XM_022817963.1"
                     /db_xref="GeneID:34713799"
     CDS             242488..249045
                     /gene="POL2"
                     /locus_tag="KLMA_10117"
                     /codon_start=1
                     /product="DNA polymerase epsilon catalytic subunit A"
                     /protein_id="XP_022673654.1"
                     /db_xref="GeneID:34713799"
                     /translation="MSGFKGSTTAKFVGKGNEYPSQAHSFAQAAQQLLDSSKVDAIDE
                     MMGFPRFVPSPTLSDVKVGWLSNMHPTIVSQDLIEEGNNARSATVAGVSGVDFYFIDE
                     EGGSFKTTVRYDPYFFVTCADETRVHDVEEYLKKLLEYCIKKVDLVTKDDLAMNNHLV
                     GLKKHLLKLSFSNNNQLFEARRLLRPILAINENDNEKKDIYNAGPDSNNRDVKTLIED
                     IREYDVPYHVRVSIDKNIRVGKWYKVSAHGLTELEDKVTFADPVVLAFDIETTKAPLK
                     FPDAAIDQIMMISYMIDGEGFLITNREIISEDIEDFEYTPKEEYKGQFTIFNESDEMA
                     LIQRFFEHIRDVRPTVISTFNGDFFDWPFVENRARFHGLNMFDEIGFARDSEGEYKSS
                     YCTHMDCFRWVKRDSYLPQGSQGLKAVTQAKLGYNPLELDPELMTPYAYEKPQVLSEY
                     SVSDAVATYYLYMKYVHPFIFSLCTIIPLNPDEVLRKGTGTLCEMLLMVQAYNSGVLL
                     PNKHTDPIERFYDGHLLESETYVGGHVESLEAGVFRSDLENDFKIDPTVIDILLEDLP
                     NALKFCVEVENNSNMAEVVNFEEIKQAIEEKLIDLKINNKRKELPLIYHVDVASMYPN
                     IMTTNRLQPDSMKDEKDCASCDFNRPGKSCDRRLKWAWRGEFFPAKMDEYSMVKRALQ
                     NELFPNKNPKSKKQFLTFEELSYADQVSHIKKRLTDYSRKVYHRVKVTETIEREAIVC
                     QRENPFYVNTVRSFRDRRYEFKGLAKVWKGKLSKIDPSDSHAKDEARKMIVLYDSLQL
                     AHKVILNSFYGYVMRKGSRWYSMEMAGITCLTGANIIQMARSLVERIGRPLELDTDGI
                     WCILPKSFPENFELKLKNGKKLFVSYPCSMLNYKVHQQYTNHQYQDLVDPIRHKYETK
                     SDNSIFFEVDGPYKAMILPTSKEEGKGIKKRYAVFNEDGSLAELKGFELKRRGELQLI
                     KNFQSDIFKLFLEGKTLEECYAAVATVANRWLDVLDSKGAMLETEDLIELICENKSMS
                     KTLKEYQGQKSTSITTAKRLGEFLGEAMIKDAGLQCKFIISSKPHNAPVTERAIPVAI
                     FSSDLHIKRTFLRRWLLDSSLNDFDPRAIIDWDYYRERLASVIQKIITIPAALQDIKN
                     PVPRVEHPDWLKKRIAVSEDKFKQSSINRFFKPTKALPEVRDIEDIFDSAVKNTPHIA
                     KVTSKRKSRRRNAEAIFDEESLVLPTEKPSMVEDYVGWLQYQKIKWKIDHIDRKKREK
                     LFGRNSRASDRSALGNLIRKHVESYADKSWEILQCKSSNEPSTVEVYALIDKKIQVLK
                     IVIPKTIFIHFKTNVFPSGGIENCEVEKSNAQLPNVKEMNLENSSQLFKLTMSEETYQ
                     REITKASSVLKDENVLGIYESSVSNKERIIMQLGTSVQFGSEKMGALGKGLQNGFDLK
                     NLHPIESDKYLQRFNLEVAYLLNFVTDIGYEFYFLFKGCDSPIDVFVLKPSVHAQEIS
                     NQAIENIYYEAHDKKFDKFDKFYDLVKIKKDVSFNIHNYVKPQILIKDLSKSLQTLKE
                     EKGSYTILILQSPYCEKTEKLLQPLQSFPVIHISMQETHLPALKWQGQLMKKAVNHIL
                     SLGSWVSNLIALSKYSNIPICNLKVDNLEYIIDVMYARQLTKNNIVLWWNDKSPLPDH
                     GGLERNFDPRKAEIMSDLAFPVMNNPGIYDNVVFEISVYNSVVNTVLTSSMLNEAEGT
                     DLAQNISSNDESLGFVEDSFSDSALLVLRGLLKELWDQALGDNITADSLVHAFIGWVY
                     NPDSKLFDYALRYHVHTLTQKAMLQLINEFKVAGSTLIFADRNKLLIKTQKQSVENSY
                     AYGQYLVKSIRSKPIFAYLDLKIERYWDVLLWMDKFNYGGRACLKIEDKDTQSFQAYS
                     HWHIKDFLPLVYQQEFDDWLVVILDNMVKTKEAFYEQNELTQRLTQLPPNRINGNQND
                     HESDSLSGFTKKFYKALINRIGKLYKTQQEYILDPNFGDDYKTPILPGSHLNVKNPLL
                     ELVKYLSHILLLSPVHVLEGRALRKELLKIFEMREFDRIAEFKDPSTSFIIPSFICEH
                     CSFISDIDICKESKSRVFACQNCDRPLNKNLIEEHVIARLQSQITSYITQDVKCMKCH
                     KVKTDAMSPYCQCSGKWELIVSKDQFLSQLQIFKNVADGYEFTTLKTTLEEIL"
     gene            <249261..>250685
                     /gene="ORC5"
                     /locus_tag="KLMA_10118"
                     /db_xref="GeneID:34713800"
     mRNA            <249261..>250685
                     /gene="ORC5"
                     /locus_tag="KLMA_10118"
                     /product="origin recognition complex subunit 5"
                     /transcript_id="XM_022817974.1"
                     /db_xref="GeneID:34713800"
     CDS             249261..250685
                     /gene="ORC5"
                     /locus_tag="KLMA_10118"
                     /codon_start=1
                     /product="origin recognition complex subunit 5"
                     /protein_id="XP_022673655.1"
                     /db_xref="GeneID:34713800"
                     /translation="MVCPVVKYRDDQLEFLEAYVSADPSLSPPVLFVEGPRGTGKTKT
                     LRAFFDANMDILSIHVNSKDLIYCKSMCQRLAISLEQKLKERYPEVHIHDVDPFEAED
                     VYLLQKFMNKLFIQYHITEKAVSIYVILDGLDDISQINLETPAQFIALPGCIVPQSKI
                     HLRVIMSFSKSSFLANYATYNIPTIYFPKYKPSEIEYILKQNPGFTDDPLLIEKLDQI
                     GCENNHTVRKEIFGHYVHFLTESLIVYTGHDPKVLGEILGNKWPHFVDNLTEENVRNT
                     VQLYKTNLELFTKPNESLLSSTIRESKQMIANSANESLSYSSHSLCFMAKYLLIAAYL
                     ASYLNHRYDSKVFSKKSHLRGGRSSYGRRSKLAHNPRYLQPSAFPLERMLSIFQSIYP
                     VRISKELSPDFFQRDSHMKANVEVYENVSDLMTSQLLVGLNLHKLGYLHEKLKFRVNV
                     SWDYILLVADSVDFDIAEYFSDIE"
     gene            <250925..>251872
                     /locus_tag="KLMA_10119"
                     /db_xref="GeneID:34713801"
     mRNA            <250925..>251872
                     /locus_tag="KLMA_10119"
                     /product="GYF super family"
                     /transcript_id="XM_022817985.1"
                     /db_xref="GeneID:34713801"
     CDS             250925..251872
                     /locus_tag="KLMA_10119"
                     /codon_start=1
                     /product="GYF super family"
                     /protein_id="XP_022673656.1"
                     /db_xref="GeneID:34713801"
                     /translation="MNTTGGETNESVANNNLPDILNQSDAGSDNYDDRIEDSEYDSKD
                     NGEGSSDDEGMDELVIKKANEIRNVADESDIHQTEDESSDDEGNDSLSELNGDNGVKL
                     EAFNMDEEDNVTGKDAENEFKQEDQWLNDYNSKASIKRAKEAHDSSTLNQKRKKTAPL
                     YRLEEALEQVFYFIPADKTVQESLHMYQQLRKRLQKQQKDLLSYVVNAIQSILVLVNV
                     LEQKGIKEVMKLDKRAIELLYNEENIMGSIIGNDSSKKWSFKWVTDLTTIHEPFSDHE
                     MQSWKDNYFNSNVLVKRFMDNDEPKNWYHIDCMHFQNTK"
     gene            complement(<251951..>252448)
                     /locus_tag="KLMA_10120"
                     /db_xref="GeneID:34713802"
     mRNA            complement(<251951..>252448)
                     /locus_tag="KLMA_10120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817996.1"
                     /db_xref="GeneID:34713802"
     CDS             complement(251951..252448)
                     /locus_tag="KLMA_10120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673657.1"
                     /db_xref="GeneID:34713802"
                     /translation="MDLDGILELEQQYYEEGYEEGRRENLKHNLLEGKQYGLQVGFQR
                     FHLLGMIYGICDILIGKIDDSSLQKNAKLIKQLIDNIHMDNSQENVAVYERSIFKIRN
                     KFRLVLMCLQKTLLQGSTQERLTLENVETLSKKVAGEIQGYVEERDNALSHTEVMVQD
                     QTTDW"
     gene            complement(<252732..>252950)
                     /gene="ATX1"
                     /locus_tag="KLMA_10121"
                     /db_xref="GeneID:34713803"
     mRNA            complement(<252732..>252950)
                     /gene="ATX1"
                     /locus_tag="KLMA_10121"
                     /product="metal homeostasis factor ATX1"
                     /transcript_id="XM_022818007.1"
                     /db_xref="GeneID:34713803"
     CDS             complement(252732..252950)
                     /gene="ATX1"
                     /locus_tag="KLMA_10121"
                     /codon_start=1
                     /product="metal homeostasis factor ATX1"
                     /protein_id="XP_022673658.1"
                     /db_xref="GeneID:34713803"
                     /translation="MSTNHYQFNVKMSCSGCSGAVERALSRLQPEVSKTDISLEKQTV
                     DVYTTLPYETVLEKIKKTGKEVVSGTTL"
     gene            complement(<253353..>255395)
                     /gene="DSL1"
                     /locus_tag="KLMA_10122"
                     /db_xref="GeneID:34713804"
     mRNA            complement(<253353..>255395)
                     /gene="DSL1"
                     /locus_tag="KLMA_10122"
                     /product="protein transport protein DSL1"
                     /transcript_id="XM_022818018.1"
                     /db_xref="GeneID:34713804"
     CDS             complement(253353..255395)
                     /gene="DSL1"
                     /locus_tag="KLMA_10122"
                     /codon_start=1
                     /product="protein transport protein DSL1"
                     /protein_id="XP_022673659.1"
                     /db_xref="GeneID:34713804"
                     /translation="MVSMALDGNLKELLNDTSRLFEAIESDPQFKVSNTTDSKPDEAK
                     IEEVLEADSELTKELARLNQLKILSDLIKEFNTNYEFNELENCYYSLQNLHKKLQEVN
                     ISGESFMFQQSVARYVDDLHLKLLNRLREFLSKFWSFSQEEVSFRKTIEIDSNLLQFD
                     ELINMFENTFLNQKTIDQSNWFIASTNLDSSKEQEITVLQDILDEYVKLNPLISMLKR
                     FAFGEDCTLLVPDDKTLRLKAEKCSPLKRVQSYELLVDFIRNDLSKHSLESIMTQFGN
                     ILLLELLKIIRKNPELLSNDKEATTKVLSNIHEGLKNIANDSNWFYDESDLNRILKDE
                     NIYTVLKVESMMQNLILKIRSIPDENYNKLIKVPVNSGSNEHSNTDSKKKASDEDEWE
                     WDDDKENEEPDGWAEELDLDIDDIPLEVSAFTETAIEIFESYENECNEIGRAKLESIY
                     NYKFNLLQTSFFAMATSKVDDWTQLFKDMKYITNGNPRLTQLVELSTRNVEINLNFIK
                     KKIYKIICDQLKQLREHERNPDWSITLSQLLPYIEDSALPTLYKLEDNNITASIVAFI
                     VHDVVIDQILNWNVISEQSSENLSEFIKLLLGSLQIPRLNLIDVYRHSREKLAAVSKI
                     LTAHLKDILEMLYEGEFFLFETDEIVQWIVLLFADTPSRRDCINEIRKVREEADTE"
     gene            complement(<256162..>259719)
                     /gene="SIP3"
                     /locus_tag="KLMA_10123"
                     /db_xref="GeneID:34713805"
     mRNA            complement(<256162..>259719)
                     /gene="SIP3"
                     /locus_tag="KLMA_10123"
                     /product="protein SIP3"
                     /transcript_id="XM_022818030.1"
                     /db_xref="GeneID:34713805"
     CDS             complement(256162..259719)
                     /gene="SIP3"
                     /locus_tag="KLMA_10123"
                     /codon_start=1
                     /product="protein SIP3"
                     /protein_id="XP_022673660.1"
                     /db_xref="GeneID:34713805"
                     /translation="MTSDTVQERGNKLSKLTALGLREAALDSPVFRTSVNHFHTQVLE
                     LENWIQENTNLSKNAGLVQTRRDEESLINRLLPPLSFLNNGLVENQTYTPSMVNEFQE
                     ALNTFSSSISTLMYGNPETYLTTYLDILIKVVKPYKEARENFDYYQGRYDSLNKNYHD
                     IKVSSLISADSIREKAMELYDIRNLYKNASFDLIWNIGKIQMKLDDLISKMIELTIPS
                     TSQKETSKKYRINISHELEHEYSQYRKWTDTITNCVENYNDELHKAKLEINKSFESHY
                     SPPEDLKTYDISTINSNLLKPEEIPQEFKKSGWLFVKTKARTSGKVTWLKRWCFLENG
                     MFGMLMPSPSKLYVEESDKFGILLITCNYNPQEDRRYCFDLKIMNTEDSSSLQDIIIT
                     MQAETLKDLSEWMNLFNYAKKEALKLDKDSPEVTTLLSRVSPTFVEFACSSTTQIDFQ
                     TTSISEHKTHSLLNIIQANPNKVNDFGVFQDPTFRFPVMTQMTKLAVIARAFVIDQGI
                     TNAISANIWGISSSYPPPSTKPTFEVKFMSSMSDWNPIVYPSYYPEKYKSGDLLFRSV
                     FNGFIKYENTDKELFLFKETCIFYPNENKRYPSTMFVTSNTLYFYVNFLGFISLSSYP
                     FRSIISVSVVQDKNTKSNPVVEIELKHKRKIAIEVFYSDPYCLCEKILTNLENNLKNS
                     EARADQLIKKLEKKDHMFTKTAVQNTQNLMPELSLLRVLNVDKMNLRQRQQQFQLEHD
                     AYFKMDFNAPSRALMHLAFGDKSTVFHECTFLSRSKVERDAVGPWIIDPETKKVVRKM
                     RISLKLARPFVSANTVSFSASSPYSYMDILQSINKTSENFYYEVDQSTGYFSLPFTKL
                     FHVNTKYVIINHRKDDYISTSQKDTTTSCTLYTYYNVVFVNKTTLETVSSLNFIDSLI
                     KVMVLSILRNESRILKHVLSSYVGKLGNSSKIVKSMRLGGQIGVSEHQNAPYKDYLKQ
                     SASNQVVYSKMLVFKLVLKWLILFWSKLCINAIRFFFSMVYGLMTNLMMLNKLVVGML
                     LISIVLNLSLSKRATFEYWAFKKAEKYADSVIDMKSMNMERSVSLDQLSILTKELTYK
                     TDVLESFISENAKNKPSYQKIRNEMALKRNELLVELSLLNNIEKELIGNDFKMFLIKE
                     IEKCNTVRTNYKDAIINNTELQKYCFTCEDQLKYFTDLL"
     gene            complement(<260026..>261210)
                     /gene="TGL2"
                     /locus_tag="KLMA_10124"
                     /db_xref="GeneID:34713806"
     mRNA            complement(<260026..>261210)
                     /gene="TGL2"
                     /locus_tag="KLMA_10124"
                     /product="lipase 2"
                     /transcript_id="XM_022818041.1"
                     /db_xref="GeneID:34713806"
     CDS             complement(260026..261210)
                     /gene="TGL2"
                     /locus_tag="KLMA_10124"
                     /codon_start=1
                     /product="lipase 2"
                     /protein_id="XP_022673661.1"
                     /db_xref="GeneID:34713806"
                     /translation="MLEMGLPLSGVAWLSQFHSLLPSEFSSCLNTNISPKELITSLGH
                     KKGSSNVKEEFIRELPPLDQYKAPKYPIVLCHGLSGFDKLILIPSVYQLTKMIKASIL
                     SNHSDSFMEDSSDDDYKDEAFLHVDYWIGIREALEAKGCTVITAKVPSFGSIEERAKA
                     LNNFIDTELGRMKRNLSKSDVYNTKGESSSSFTEDDKIKVNLIAHSMGGLDCRYLITN
                     IPNKNFKVSSLTTISTPHHGSEMADYVVNLFNDITDNFDLKVKKKLLPPAFYQLTTSY
                     CSYFNNVTPDDPEVSYFSYGACFHPRWYNMFYMPWNIINNLSGGVPNDGMVSIESARW
                     GNYLGTLENVDHSDLINWKNRIQKQLQYRIQDAVKTPQIPDIDILHFYLKITEDLAKL
                     GF"
     gene            complement(<261455..>262876)
                     /gene="COQ6"
                     /locus_tag="KLMA_10125"
                     /db_xref="GeneID:34713807"
     mRNA            complement(<261455..>262876)
                     /gene="COQ6"
                     /locus_tag="KLMA_10125"
                     /product="ubiquinone biosynthesis monooxygenase COQ6"
                     /transcript_id="XM_022818052.1"
                     /db_xref="GeneID:34713807"
     CDS             complement(261455..262876)
                     /gene="COQ6"
                     /locus_tag="KLMA_10125"
                     /codon_start=1
                     /product="ubiquinone biosynthesis monooxygenase COQ6"
                     /protein_id="XP_022673662.1"
                     /db_xref="GeneID:34713807"
                     /translation="MMIPKQLFYRSFSSSSFRLNAKLCDVLIVGGGPAGLTLAAAIKQ
                     SPHLSDLSTVLVDAGDLKGKIANFYHDPPKTFTNRVVSLTPQSKEFLEGTVGVSLMEN
                     RIQPFDGLYVTDGCSDGTLEMERDSMGNMVEILNIQSSLLEKLRVTNPAALDILDKTK
                     VQNIENENPDDPQSWPVVTLDNGDQYKTRLLIGADGFNSPVRHFSKIESRGWFYERFG
                     VVATLKLEYPPFKIRGWQRFLPTGPVAHLPLPDTNATMVWSTTEPLSRLLLSLEDDVF
                     VALVNASFVLEDADLQYYYNALENKTITGPELIEDVEYRINEKFNSFKDDSLIDEKYP
                     PKVIDVLDKSRARFPLKLSHADTYVAERIALVGDAAHTTHPLAGQGLNMGQGDVESLV
                     KALENARTRGLDIGSLLALEPYWADRYPTNNMLLGVVDKLHKLYSTDFGPIVGLRTFG
                     LNLVNNLQPLKDLMMGKVSGPMN"
     gene            <263781..>266174
                     /gene="FOL1"
                     /locus_tag="KLMA_10126"
                     /db_xref="GeneID:34713808"
     mRNA            <263781..>266174
                     /gene="FOL1"
                     /locus_tag="KLMA_10126"
                     /product="folic acid synthesis protein FOL1"
                     /transcript_id="XM_022818063.1"
                     /db_xref="GeneID:34713808"
     CDS             263781..266174
                     /gene="FOL1"
                     /locus_tag="KLMA_10126"
                     /codon_start=1
                     /product="folic acid synthesis protein FOL1"
                     /protein_id="XP_022673663.1"
                     /db_xref="GeneID:34713808"
                     /translation="MAKQGVIPVAKRWKFHDHVHIEKLKVKAVVGPDSWDQLKPQNLN
                     ISLHMATDFSKSSRLDDLKYSLNYAVISKDIGDYIKKNSKRNFKDLVSIGKTIVDYTK
                     KTYPGIIDLKVEVQSKEGNIRSNDIRGIVHSSDEETNEVLIADFKMLTLIGVFTFERM
                     KRQFVDFTIRLPVEDGSDVPPYNTIISQITDYVEKSNFKTVEALVETVSQVILTQNEY
                     FIERPKLPISVKVIKLNAISETDGVGVSCSHCYDDFRSSGPVVMEQAEKNETLTNFDL
                     PVNTFSLDKDSWKSAVLAFGSNVGDRFKNIVDAMNLLNAHEQVKIISTSSLFESNPMY
                     FKDQTSFLNGCVKIKTRLLPDELLKLCKKIEYDELRRIKHFDNGPRTIDLDIVIYYDS
                     TGQDVTVNTEVLTIPHPRLIERSFVLEPLCELVSPTQIHPITAETFHDHLNQLYQNEN
                     SEDLLWKVVPTGDKFLKFRTEWQRDLLTDVRVPVSKSNGYLMGIVNVTPDSFSDGSAE
                     YDNLSAVMSRIDTMVSEALELHDMIILDIGGCSTRPGSIQASEEEELSRTIPIIDAVT
                     TSKTLPLDKIVLSIDTYRSAVAEAAILAGVGIINDISGGTFDPKILQVVGKYPNVAYV
                     LSHIRGTIESMSTQTSYLTTDDSVDEFILDKKSDSDKDEILFIRTIGREVCSKFEELF
                     KNNIFRWQLFLDPGIGFAKVGKQNLDIIKHLQLLKNYSCIKQNEYYSLVNLPVLLGPS
                     RKKFIGDITNIPVAKDRDFVTGAILSSALANGCDIVRVHDVRNNSKVLKLANELYRD"
     gene            complement(<266434..>266907)
                     /gene="GIS2"
                     /locus_tag="KLMA_10127"
                     /db_xref="GeneID:34713809"
     mRNA            complement(<266434..>266907)
                     /gene="GIS2"
                     /locus_tag="KLMA_10127"
                     /product="zinc finger protein GIS2"
                     /transcript_id="XM_022818074.1"
                     /db_xref="GeneID:34713809"
     CDS             complement(266434..266907)
                     /gene="GIS2"
                     /locus_tag="KLMA_10127"
                     /codon_start=1
                     /product="zinc finger protein GIS2"
                     /protein_id="XP_022673664.1"
                     /db_xref="GeneID:34713809"
                     /translation="MSGKACYICGKLGHLAGDCDSEKLCYNCNKPGHVQSECPVPKTV
                     EFKQCYNCGETGHVKTECTVQKCYNCEGFGHISRDCDQPKKFRQNGERSASKVSCYKC
                     GGPNHMAKDCLKSAPTCYNCGQAGHMSKDCENDENEKVCYNCNGVGHIAKECPSY"
     gene            complement(<267193..>268299)
                     /gene="RTC4"
                     /locus_tag="KLMA_10128"
                     /db_xref="GeneID:34713810"
     mRNA            complement(<267193..>268299)
                     /gene="RTC4"
                     /locus_tag="KLMA_10128"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818085.1"
                     /db_xref="GeneID:34713810"
     CDS             complement(267193..268299)
                     /gene="RTC4"
                     /locus_tag="KLMA_10128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673665.1"
                     /db_xref="GeneID:34713810"
                     /translation="MSVMSSPVDISSQQCIIINSSSPSTTASEKKRKPPATYGGAGTK
                     RLRKTEDVCPYEISDDEYDGENRTVERSIQNDVDLEVTFSDVSEPESDSLLLEGEGPT
                     SKPLELTDDESVKESSSETKDFFDNDSGVKKMSLDLINAYRIKSTKTLPEFKRSRSLV
                     KTDSHSTKAVYRKALNVRRQSMEKYKLPPVLFLEELQARASIHLSKCESILSGKMSSL
                     YYTMAKQVAKNSKRQVITKEDLTDLNIMKFTAGYFGSRRQAIVGMLIMEKYGSELKKH
                     KNPVVTFWGPFDFSQYVLAPEILSHLCMEDFNLKNIEDAWDILQATIDFGIKVADSDP
                     LEIYEIELEEQELQNLNLGKEYSSMTYRKDPRQS"
     gene            <268996..>270315
                     /gene="TEX1"
                     /locus_tag="KLMA_10129"
                     /db_xref="GeneID:34713811"
     mRNA            <268996..>270315
                     /gene="TEX1"
                     /locus_tag="KLMA_10129"
                     /product="protein TEX1"
                     /transcript_id="XM_022818096.1"
                     /db_xref="GeneID:34713811"
     CDS             268996..270315
                     /gene="TEX1"
                     /locus_tag="KLMA_10129"
                     /codon_start=1
                     /product="protein TEX1"
                     /protein_id="XP_022673666.1"
                     /db_xref="GeneID:34713811"
                     /translation="MSRFGYNGLKSFEVSYLDEPQLKNHYSSLLESCCKDKKVLKDYH
                     AIAVKDSRSARYSLNEIISLDSHPAARYLAWSRIDGSLSVMRPPISADRTQDYVLVGS
                     VKKDVHGEGKIVYSISWNPNELQFATVGNTPTVKIWNVVDNTLRVLKEFKTNFKAKNF
                     INEYDPLGKFLAVVTKANELYVFDVESGYESFVSYCPENELDDEIHSMCWSNDSKSII
                     LAYRSGFIRGLSVASNALEMKWERRNNMKTISFLTMDPLGRSVLVGTHNDCCIWSLPD
                     LIPLKQSIKTENRITGIDISFDGSIIAIVSKAKDSNDAFLNLYWYNDLSPLYNAVVKN
                     SSQSSIKWSRSCLTFFTTGALDKMTLVDLRSSRSKTSFPHDDPKRSEVPKKPERTNRS
                     LRDSKSRSNKDKDSRQQSHRRDTDKFNDRSFDRPSSGSKFRKSNDRW"
     gene            complement(<270514..>271305)
                     /gene="MRPL17"
                     /locus_tag="KLMA_10130"
                     /db_xref="GeneID:34713812"
     mRNA            complement(<270514..>271305)
                     /gene="MRPL17"
                     /locus_tag="KLMA_10130"
                     /product="54S ribosomal protein L17"
                     /transcript_id="XM_022818107.1"
                     /db_xref="GeneID:34713812"
     CDS             complement(270514..271305)
                     /gene="MRPL17"
                     /locus_tag="KLMA_10130"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="54S ribosomal protein L17"
                     /protein_id="XP_022673667.1"
                     /db_xref="GeneID:34713812"
                     /translation="MSVKTATNSIPKAIKASLVLSRIPIVTPELNALESKYFQYQSEL
                     ERRLMWTFPSYFYFKKGTLTERRFQSAQKGVISKQPGVWFPKGVPDVKHNRERSQKQE
                     IVLPKDTSESSLNSDVSRPIVPNSRITKADEKNDISSLERKLDRTLYLLVKDGKENWV
                     LPNFPVEAVNSEEKKALHETAEIGLRRIGGEDINTWTVSNTPAGVIQSDKDLQFLFKS
                     HIVAGEFKLKDKRSIKDFAWLTKDEIKTKVNEEYFKEIQYLLADN"
     gene            complement(<271611..>273434)
                     /gene="NRD1"
                     /locus_tag="KLMA_10131"
                     /db_xref="GeneID:34713813"
     mRNA            complement(<271611..>273434)
                     /gene="NRD1"
                     /locus_tag="KLMA_10131"
                     /product="protein NRD1"
                     /transcript_id="XM_022818118.1"
                     /db_xref="GeneID:34713813"
     CDS             complement(271611..273434)
                     /gene="NRD1"
                     /locus_tag="KLMA_10131"
                     /codon_start=1
                     /product="protein NRD1"
                     /protein_id="XP_022673668.1"
                     /db_xref="GeneID:34713813"
                     /translation="MANNTEHEDFVATLESFKELKTGISGSRIRKLTDYTIAHVKDVE
                     TLLSFVINYSRECTPTHKLGSLYIIDSTVRALLSKSDNEDSDGNGEENYYAKGIKILN
                     ANILSLLIDGIENSDATHLEKIQELVNIWEKNNVFDRKSLETAKSRLNELISGNNVVS
                     SSASSTYSSKQRSASNTNAKASSLSDRATQILNNIPKFENLPVVHVPSDLLSDDSLVQ
                     MSCLKQFLGTLQVELAKHQKLVRVSKPSSNVSKGNNRPTQYIGRDSRNDRSRSPPRNK
                     NERTRQQSNSSSHNNRQQQQQSSKELQGNNHHLYPDEKNIPSNPHYRPKPVSFDPTIP
                     RDHVKVYSRTLFVGGVPQNFKEHDIARMLRQFGEVQSVILNNARKHAFVKVYSRAEAE
                     RIMAHFTGGGNPTHGLRIRWAVGFGPRDCCDYQYGFSIIPLARLTEIDYKWSQSAEWG
                     GTGGQPIQTNMVYEEPDIIVGEGVSSKAISQKMPTDKGVLGPKSGKVGQPAVIPQPSM
                     PFSSLSPPPPAVAQQAPVPQVGPVQQQYYNQPNTYQQGPTPAMLYGQNQIMSPPQQQQ
                     QQPQQQSQHQNQPQESSQSPQNFDPTAQLNTLMNILNQTSK"
     gene            <274084..>277974
                     /gene="RAD50"
                     /locus_tag="KLMA_10132"
                     /db_xref="GeneID:34713814"
     mRNA            <274084..>277974
                     /gene="RAD50"
                     /locus_tag="KLMA_10132"
                     /product="DNA repair protein RAD50"
                     /transcript_id="XM_022818129.1"
                     /db_xref="GeneID:34713814"
     CDS             274084..277974
                     /gene="RAD50"
                     /locus_tag="KLMA_10132"
                     /codon_start=1
                     /product="DNA repair protein RAD50"
                     /protein_id="XP_022673669.1"
                     /db_xref="GeneID:34713814"
                     /translation="MSAIYKLSIQGIRSFDSNDRETIEFGKPLTLIVGTNGSGKTTII
                     ECLKYATTGDLPPNSKNGAFIHDPKITGEKDIRAQVKLAFVNAKGVNMIVTRNIQLLA
                     KKNANTFKTLEGQLVAINRGERTTLSTRATELDQQIPLYLGVPKAILDYVIFCHQEDS
                     LWPLSEPSILKKRFDEIFQAMKFTKALDNLKTIKKDMAIDIKLLKQSVEHLKTDRDRS
                     KATKMNVSQLENKVEEYLLEVKDIEKKLEAITSQSDELFSSNQQFQEVISRSESLQRS
                     KSSLSEQIQRLQSSIEIIPKSKSDLQNMLSNFEGILKDIDSKLKGHFEERERIVSFLE
                     KERTSQQRVIRLQGELCSKKEQYEHSKMKKEELLTELSNTYNIPKQNVTSEVSTMLKM
                     ANERLNTIQYKNQKEEADIEEQLLTSRNSLAKKEQQLSYISSDMKKLQNQISKLSNRS
                     KDLNVNETELHVQKENLKSYEAKLRNWDSENVIESLMNEIKSKNQDILSLEDQLEAIQ
                     LRINKVNQHSDLFAKHSLLKGNLSAKLKDIKKMEEEIMHEARNLNVSLRIDDDLPESF
                     KLVYNDMKEELSKCKMECDTATKFSIQSENQMKNLENQIQVLNSTTSNLELKIKAVLP
                     EDINIEDYDEELKDSEESYKIALENLKMHRTTLEFNLKALEVAEKENCCYLCQRHFEN
                     KESSSRLIKNLQDRTDKNLQKALETTAEEVKIYLDDLKSCYDDVISYRNSIKEKNSLE
                     KKYIEVKKDHDEKSNIQRKCVLELQELQHKFSTISDKIQPCINKLVNFNEEKLRISLE
                     LNRVEEELSIYTSQEVLESIEELQQKQKYINDRLRTLRKDISDTQSQKEDKSREYNNL
                     LTLIREKNSDINRMETLLQERNGVIKELEANQDIIKSSEKESSILTEEVQNLKKEIKS
                     HTEVLDEMKKRNRNMELEARDKRDKIQNQITLVTDISKTIKDFEENDSKRLTQCTELL
                     EQHRNAILIKEKDLKDVETLINVDNQRLKDSDKEFKNIKLNIDLCDLKTQLESFDREL
                     SSLDVATAEKEREKYQEESLRLRSAYEKLSAENAGKLGEIKQLQNQIKTLTTQINTDY
                     KNVDELYQREWIKLQTKSLVTDDIDTYSRALDSAIMRYHSLKMKDINRIIDELWKRTY
                     SGTDVDTIKIKTDEVSNVRGKTFNYRVVMYKQDAELDMRGRCSAGQKVLAAIIIRLAL
                     SETFGVNCGVIALDEPTTNLDEENIESLARSLGNIIEVRRHQTNFQLIVITHDEKFLN
                     YMNASSYTDHFYKVKRDDRQKSLIEWVDINKVSS"
     gene            complement(<278005..>279555)
                     /gene="MPA43"
                     /locus_tag="KLMA_10133"
                     /db_xref="GeneID:34713815"
     mRNA            complement(<278005..>279555)
                     /gene="MPA43"
                     /locus_tag="KLMA_10133"
                     /product="protein MPA43"
                     /transcript_id="XM_022818141.1"
                     /db_xref="GeneID:34713815"
     CDS             complement(278005..279555)
                     /gene="MPA43"
                     /locus_tag="KLMA_10133"
                     /codon_start=1
                     /product="protein MPA43"
                     /protein_id="XP_022673670.1"
                     /db_xref="GeneID:34713815"
                     /translation="MRTVGIGIDLGSSSFRIGVFDSETDELIEQESHKVGYLYYKDNI
                     FTQSTHDIIKAIDVTFARLKLSNFNVRSIGVAATCSMVVGKQDGNNLIPTHIYEDFKT
                     DNCQDVLFWMHSAARKETMYLNKTVDNRVLSFFGGKFFPEMAIPKLLMLSKIKLRNEL
                     TVIDLHRWLLWIVCLKLDYDVNLPVNVVNSNGIGHDGELFGWKSDFYDKLNLDGIFIG
                     NNNAIDSKISIGDSCIDCYSSWFPTIKKETLNNALFAIAGTSTCFLYATDKTERFFNG
                     IWGPFKDILFNRDHHQSIDPFSVYESGISKTGLLLEQLLLEHPVSKSTEGDILGLIEK
                     EIQLIEKKENTSIHTLVNELYYEEDAACNESPFIKQNKNGISRQPYNDDFRDITLKYI
                     VIVETLAFQIADVIQVFRDNNLHINTFVIVGSQAKNKRMLSVLKSLCKNLELWSTQGN
                     EDKIGVKGAYLLGKSRSNNESLIHSLASSSEKLTRIDVSLKISAKTTSLLEQKYLIYK
                     SLVNTKMR"
     gene            complement(<279762..>281000)
                     /gene="RPA49"
                     /locus_tag="KLMA_10134"
                     /db_xref="GeneID:34713816"
     mRNA            complement(<279762..>281000)
                     /gene="RPA49"
                     /locus_tag="KLMA_10134"
                     /product="DNA-directed RNA polymerase I subunit RPA49"
                     /transcript_id="XM_022818152.1"
                     /db_xref="GeneID:34713816"
     CDS             complement(279762..281000)
                     /gene="RPA49"
                     /locus_tag="KLMA_10134"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I subunit RPA49"
                     /protein_id="XP_022673671.1"
                     /db_xref="GeneID:34713816"
                     /translation="MGSKRNFTEVGVSSYQEEPSVAVGSFFKGFQAPNDTLFELYKNK
                     KDSDKFVLHGENERLEYEGKVDEDFAASSQYVVGVYDASTKSVELYKAPMFSTKVISK
                     STKNLMGPAIKQSDVRASIMRNALGEAFGTKKAKKAIADMERNRIDSDKLVDSAIDIV
                     DSVKAASKDLPTQEQLKETVSSDRPTPVANLDATDVEQIYPLYNIIPKNEWAFIRVGP
                     IMKEKDAEKRLEYFPHTKFQYIVKKLPTLTQASQMQKLQLLYYLSLLVGVYDNRRVNN
                     KTKLLERINNPPDVLLDGILQRFTISKPGQYGKSKDRSFFIDPQREDKILCYILTIIM
                     HLDNFIVEVPPLAQQLNLKPSRLVNLFKILGATVKGATVSQAEAFGIPKSSAATYKIA
                     TLRVPFKLPEMTRRGRGPRR"
     gene            <281490..>281972
                     /locus_tag="KLMA_10135"
                     /db_xref="GeneID:34713817"
     mRNA            <281490..>281972
                     /locus_tag="KLMA_10135"
                     /product="diphthamide biosynthesis protein 4"
                     /transcript_id="XM_022818163.1"
                     /db_xref="GeneID:34713817"
     CDS             281490..281972
                     /locus_tag="KLMA_10135"
                     /codon_start=1
                     /product="diphthamide biosynthesis protein 4"
                     /protein_id="XP_022673672.1"
                     /db_xref="GeneID:34713817"
                     /translation="MQQTLYEILGLESDANNNDIRKAYKAMLLETHPDKSGVNNDSKT
                     LDITVNAIQHAFRTLIDEKSRKIYDEQLAESFKKQGFHNTGEGLDTYSLDSFNYEEES
                     GFFTMSCPRCQMTEGFQLTEDILEEYAISHDNNGYFVLVQCSACSLWLKVLFDIADEE
                     "
     gene            complement(<282060..>284015)
                     /locus_tag="KLMA_10136"
                     /db_xref="GeneID:34713818"
     mRNA            complement(<282060..>284015)
                     /locus_tag="KLMA_10136"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818174.1"
                     /db_xref="GeneID:34713818"
     CDS             complement(282060..284015)
                     /locus_tag="KLMA_10136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673673.1"
                     /db_xref="GeneID:34713818"
                     /translation="MENTDSDLEREIQAQNKTQSEQENDIDVNSELLASYKPIRDSYT
                     NEANSFIGGSAVISRSESTKKRQGSSRSLFEEEPEFVEDDEQNEEAKILDDVRPQKKI
                     FTFSLPFGGKNPLPVSPLNSLKALWSNDQTVFIEDDDESKINDNNNINNNNKYNNDTE
                     NTLAKKLDREEIKLKLKRQESITSIEERFLFANNKKMQNVRSKAVKNALKPDTLINVF
                     KSLSTSEPIDMTDDGYSMSRLETVWDEISGDIVILGGYRGSILRNAETKKRVWIPIKA
                     GFNIKKINLLLGPEDEDELRASETIIPDGMLTHIGPVDIARRLIKRLAMNPNVNIEDF
                     GYDWRLSLDITASQLREKLQALYDKQKVKVGTYVIAHSMGGLLAHKVLQDATHLIRGI
                     IYVGAPSQCPNILGPLRYGDEVILNKSILKAETNFFMRSSFYFLPIDGRCFVNRKTFE
                     RYDLDYFDPEVWKEYGLSPLVNKDREEKTKDNDTLKESLKMAFFSPVKMIRSSSNFSK
                     EESDDEFQTSFEDSYRYLTKILQRTKKFMDQLQYDPSKKYPPLAIVYGDKVPTVRGAK
                     VQNRDEIKKGYYQDFYYGAGDGVVHHKWLLPETRGFPVVAKVSSEMPHVSLMTDFEAI
                     AKAFISILDAEQETHRKTYFMIMKNDT"
     gene            <284504..>286750
                     /locus_tag="KLMA_10137"
                     /db_xref="GeneID:34713819"
     mRNA            <284504..>286750
                     /locus_tag="KLMA_10137"
                     /product="cysteinyl-tRNA synthetase"
                     /transcript_id="XM_022818185.1"
                     /db_xref="GeneID:34713819"
     CDS             284504..286750
                     /locus_tag="KLMA_10137"
                     /codon_start=1
                     /product="cysteinyl-tRNA synthetase"
                     /protein_id="XP_022673674.1"
                     /db_xref="GeneID:34713819"
                     /translation="MSAPKTIQPKWFRPEQEKPAAVLKLYNTLTRNKEVFVTESNTKY
                     LTWYSCGPTVYDASHMGHARNYVSIDINRRILQDYFGYDINFVQNVTDIDDKIIIRAR
                     QTFLFEEYLKKHQGKITETAISDVEASLFEFIEKNLKQNFSDISKYESWYSGLDLEKE
                     KASNPKFSMYSTSVNNAILALKFKNEETFFAQAKDVLMPYLDKRLGSTLNDPEIFRKL
                     PSYWEKRFDEDMAALNVLPPTITTRVSEYVPEIIEFVERIIGNGYAYPTTDGSVYFDT
                     AKFDSAENHDYAKCQPWNKGQLDLILDGEGSLSDFSVKNGKKSPNDFALWKASKPGEP
                     EWDSPWGKGRPGWHIECSVMASDIHGSVIDIHSGGIDLAFPHHDNELAQSEACFDNKQ
                     WINYFLHTGHLHIEGQKMSKSLKNFITIDEALKKYSARQLRLAFASVQWNNQLDFKES
                     LLNEVKSLETSFTNFFRNVRALNNDYKHSLAENKIISKKLSSDEKNLLQDLKNVQNKV
                     HVSFCDNLSTPQVLKHLNELLTVSNTYIAKVGADLKIEPLLAVTRYISKILGVIGFEV
                     RSDGLGWLDVNKGESSTSGSKEDIAMPYVKCLSNFRDEVRQLAMNKASSTEYLKITDR
                     LRDEDLLKLNVAIDDRQGQASLVKFLSDKEKDEMLKVIEERAKREAEKAAKKAEQQKL
                     KEAKEKERFEKAKISPQEMFKTDQYSAWDEEGLPTKDKDGNEVTKSMLKKLKKQWLAQ
                     KKLHEEFF"
     gene            <287059..>287989
                     /gene="VPS75"
                     /locus_tag="KLMA_10138"
                     /db_xref="GeneID:34713820"
     mRNA            join(<287059..287081,287185..>287989)
                     /gene="VPS75"
                     /locus_tag="KLMA_10138"
                     /product="vacuolar protein sorting-associated protein 75"
                     /transcript_id="XM_022818196.1"
                     /db_xref="GeneID:34713820"
     CDS             join(287059..287081,287185..287989)
                     /gene="VPS75"
                     /locus_tag="KLMA_10138"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 75"
                     /protein_id="XP_022673675.1"
                     /db_xref="GeneID:34713820"
                     /translation="MSNSSSVSDAFKGLAECEDEMELVENKVELYKIKLTTPVFEKRD
                     KLLNDIPFFWNIVLSQHSDFANYIRASDFKYIEAIKSVRVRPLVLEDETASPRDFKIT
                     FDFNEIDGDLPSQSVTKVFKIEKDISKIQVRKHRTPEDDELDAELGFLTSEPVNVEWP
                     KSYEKITPHLIADKTTPEGKKNYRTGMKTFFAWFKWTGLKPGKEFPNGDSLANLFNEE
                     LYPYCVKYYTEAQRDVIDESEADTDEEDSDQPLKLDLNGSESEEESETGPPQKKVKV"
     gene            complement(<288000..>288551)
                     /gene="CWC25"
                     /locus_tag="KLMA_10139"
                     /db_xref="GeneID:34713821"
     mRNA            complement(<288000..>288551)
                     /gene="CWC25"
                     /locus_tag="KLMA_10139"
                     /product="pre-mRNA-splicing factor CWC25"
                     /transcript_id="XM_022818207.1"
                     /db_xref="GeneID:34713821"
     CDS             complement(288000..288551)
                     /gene="CWC25"
                     /locus_tag="KLMA_10139"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CWC25"
                     /protein_id="XP_022673676.1"
                     /db_xref="GeneID:34713821"
                     /translation="MSDLNLLKSWNPKLLKNRKKVWEAQQELLEENKKIKERQKEIQK
                     ERQLEHYNNLSRDEERGKTNKKKTGLEWMYEDAKSQIADDEDFLLGKKVITDSLINQA
                     NIHDDKHQEEPKKEKKRRHYNGFQDIENKETSNHNNDLAGEDPMAKFTAAKKRQLKDI
                     YTKQNREGLAYTKSRYNNKTYRR"
     gene            complement(<288923..>289249)
                     /gene="SUI1"
                     /locus_tag="KLMA_10140"
                     /db_xref="GeneID:34713822"
     mRNA            complement(<288923..>289249)
                     /gene="SUI1"
                     /locus_tag="KLMA_10140"
                     /product="eukaryotic translation initiation factor eIF-1"
                     /transcript_id="XM_022818218.1"
                     /db_xref="GeneID:34713822"
     CDS             complement(288923..289249)
                     /gene="SUI1"
                     /locus_tag="KLMA_10140"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-1"
                     /protein_id="XP_022673677.1"
                     /db_xref="GeneID:34713822"
                     /translation="MSIENLKSFDPFADTGDDETTSANYIHIRIQQRNGRKTLTTVQG
                     VPEEYDLKRILKVLKKDFACNGNIVKDEEMGEVIQLQGDQRAKVSEFMITQLGMQKKN
                     IKIHGF"
     gene            <290215..>292332
                     /gene="SLA2"
                     /locus_tag="KLMA_10141"
                     /db_xref="GeneID:34713823"
     mRNA            <290215..>292332
                     /gene="SLA2"
                     /locus_tag="KLMA_10141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818229.1"
                     /db_xref="GeneID:34713823"
     CDS             290215..292332
                     /gene="SLA2"
                     /locus_tag="KLMA_10141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673678.1"
                     /db_xref="GeneID:34713823"
                     /translation="MSREEQALEKSIKKALGGADVAPKRKHVRACIVYTWDHKSAKTF
                     FDLLKVQRYSTDELQLFKTLVLLHKVLQEGHPSALVEGIRNIDWIESMGRIFAVESGG
                     GNSYSSSKFRYVGDEYGRLIGEYVYFLVRKLQFHKSHKGFNGTFEYEEYVSLVSVSDP
                     NEGYATISDLMDLQDFADGLQKLIFASISSNRGGGGFLGFSNTLDSKTAVLVPLVTET
                     YGIYKFVTSMLKALHKQMDDYDALSELFDRYSEQCTRLSEFYFDCDTVQALKNLITIP
                     KLPSDPLSRILDDQDEAEVKDVVFERESGNSTPSVPSRSATQENLRKESPVRANSVAE
                     VKSEAKNAGQTTSKLVPVATGIMVPTVTGVQPGTFQAVPAVNELWNTNVVAAPTGGVQ
                     TVNPVVSQPTNPLVMQPTNPLVMQPTNPLGIQQTNALVMQPTNPFQIQQQQQQQQQQQ
                     QQQQQLQQQQQQQQLQQQQQQYALELERQRQAQEQQQQQEMQKELLIQQKTQSLQNDL
                     VNLKQQYERDQIMLEQYDKRVQELESELEAQKEFKEKYQSLAKLYSQLRQEHLNVLKK
                     VKKLQDDLNDSRNEVSDLKKEAKSKGKGIDRSGMILKSLVESSIKSLQDPIASLDVSD
                     LATDLSNAFIDGDINTIVNILPEFVSLLLRCPQEMQTIAEDFLRCLSSAKQTDSVINA
                     NIAFQEKLKIRQYSYRYGDSDEV"
     gene            complement(<292355..>292996)
                     /gene="MATA1"
                     /locus_tag="KLMA_10142"
                     /db_xref="GeneID:34713824"
     mRNA            complement(<292355..>292996)
                     /gene="MATA1"
                     /locus_tag="KLMA_10142"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818240.1"
                     /db_xref="GeneID:34713824"
     CDS             complement(292355..292996)
                     /gene="MATA1"
                     /locus_tag="KLMA_10142"
                     /note="homeodomain"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673679.1"
                     /db_xref="GeneID:34713824"
                     /translation="MDGHDKKNPILLLKELCQEAQGLAGVQLKEDGFSSPFKTFSIPF
                     PEEAVKKCSNKALLLQLYHQYSTSLETILNKCPLEDLKVDPQMVADAFNNQFLRTIQL
                     LPVENNLKIKEQNPSDSSGKEDSKNDTVEEDSPSPDNQNSRTAKKFFLEPEAKDLLEK
                     VFKVKKCPNTSERLFIAQKLGLTASQVRIWFTNKRMRTKSKQKKVKPIAGPIK"
     gene            <293862..>294626
                     /gene="MATA2"
                     /locus_tag="KLMA_10143"
                     /db_xref="GeneID:34713825"
     mRNA            <293862..>294626
                     /gene="MATA2"
                     /locus_tag="KLMA_10143"
                     /product="mating-type protein A2"
                     /transcript_id="XM_022818252.1"
                     /db_xref="GeneID:34713825"
     CDS             293862..294626
                     /gene="MATA2"
                     /locus_tag="KLMA_10143"
                     /codon_start=1
                     /product="mating-type protein A2"
                     /protein_id="XP_022673680.1"
                     /db_xref="GeneID:34713825"
                     /translation="MSNSTLRRTTFFKLSTKEEACSSNKAVQSNNNSIEFPNLKRNGK
                     AFTCSSNEKTSKKFTRPRNQFVLMRTLFNRCVTTHILEHFNQTKIQKNMFSVTSKITS
                     ELWNESPSELKVYFLLLATLEENWHKNKHYCSWDKQSSQTLSMEPIENSHIFSRLAIS
                     LSMGVGSAVSSYSAKDLCLFPKTRTKKKRVASPTLLPNQRFNSKFNSKLSQDTKTKSP
                     KSLVRLKSTKLPTQSGKVFKKRYQNENRVIEDLFLV"
     gene            complement(<294677..>298795)
                     /gene="LAA1"
                     /locus_tag="KLMA_10144"
                     /db_xref="GeneID:34713826"
     mRNA            complement(<294677..>298795)
                     /gene="LAA1"
                     /locus_tag="KLMA_10144"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818263.1"
                     /db_xref="GeneID:34713826"
     CDS             complement(294677..298795)
                     /gene="LAA1"
                     /locus_tag="KLMA_10144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673681.1"
                     /db_xref="GeneID:34713826"
                     /translation="MTEVYVSLFENLDSSENKRESLISWTTDSLSSKAGNASFIVDDV
                     VKFMKKLVVSEGTDIEQYESKVLAYQLSHVITLCLKELYTEEPSKVYDISTLAANILA
                     ERFEEVVDDPSLKKKFKKHKSTHVYSVVKDYALTLLCSLYENFSHDLKSLSPLVLSVL
                     FKDLKKCLDKSKYFNSNYIISLMRLFQAISSLSSEIVVETQYVQKFMKLSKEVISDVK
                     EGKYDYPVDFITAIIESFPCYFCGSQFLSVHKSDILKTLYYKLSEYINYSCGVSPLRI
                     PLAKTLAEILHFYVKSDVIKMENVLEFYGNIISEMNDRVAVVAVIHSVHQFLCVNLCD
                     ETDFNFSVETELLGGDGYLVFLDSFFPHLKFNREVRDHDYIEACNIMHKQVLPFLSDG
                     ARGEIIRKVLNNTSYYFSPERVDRTLLYMDFISLLLEDSPSSVRTDDDLISKIISEFT
                     VLCSSKLLPLRIKAVECLKRFIMNIPYIIRKMVEDIIDKLSVQFELEKGFNFAENHGL
                     ALLLASIIVPEDEGFISPDLIIKVTGFAIGTLKSNSLSTKPLLYEKELLCWILLTGCL
                     CYQDSEYTKIHSSQLFIFWRNILTHTAVFHNDEELLKNIEIRNHSLSCMISFLRSNEL
                     NEDVAKQIFYLMSKCMNFKHSLVFENKLLSESVSRYEHRIYQVFLLICPLVHKDVSTS
                     ALLPAIRNFSNPVSAGKNVDLNLFEKNIIKSGGIDVSKDSILTVLCDKNSGDIGLSTL
                     VVPCVSCSMCSLSLFEELCLKAIPRSRSFDYSHIILDIGAPPPLNVALVDVSLELFSL
                     CFPYTNTSVQRSLLETLNSNLLTNKHIPSRRAIIKANILFSLHLTLNEIQKAALALDP
                     KIAELLMIIMEECSFADDDHLYDIKSRIASFICAAVKRSGNQEFGVDTVNILINRIVE
                     KEEPILRGMNFNMVCEIFKDDPTSGNLNVIMDIVEQFLKDKHPVIHTSGLNSLIILLM
                     RRYYNDKLKIGKVMDILFNMVFSNDYEPGSVSGFGNSYNSEFNMLLGVGNALKALTEV
                     IGPDLRNIRVKFKAVLSSLNMCPCSDVQAVSLKISELVSMFKMETLFNFKMSMLIVRS
                     LILSFLKRGMPRSGFKVSVEYLLEMGNYEDVVLNRLVFTSFLVFPKYRSLRKYIYGWL
                     KHENRLNVLLKIPDMSPYALQFLLEVYRDLIGKDEDLSSILKICYTASVSNIPSLQVS
                     GLELVKKILDVYEDVVDPEDESSYLLEQYTALITGVVNPLFSRPSYPEVICCAFDICA
                     VSLSNRVVSYLVDGLLEVAENKPILKIGASEFPLNKKQLQVKLSILRAWANTKGDFVK
                     EYLNVLVPLWIITIREHYSPEIVDSLCAQDPSIINNFDLEGFVFVMFGEILP"
     gene            complement(<299066..>301042)
                     /locus_tag="KLMA_10145"
                     /db_xref="GeneID:34713827"
     mRNA            complement(<299066..>301042)
                     /locus_tag="KLMA_10145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818274.1"
                     /db_xref="GeneID:34713827"
     CDS             complement(299066..301042)
                     /locus_tag="KLMA_10145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673682.1"
                     /db_xref="GeneID:34713827"
                     /translation="MIPSTLPTEIPNVSVLATEPLTNELQPVRHKVKHACGSCKERKV
                     RCDGQCPCKSCVKFGVKCEYVSNNRSKKRSNKDTLQPIKVVSPVKTKKTKLNNNTRKE
                     KVDFKGVLQKLYPQVDFSSDSLTTDSLIALLKSRNNPNIPSVPSNFDRPLILPPKQIA
                     LNLISKTWDSACLLFRFYHRPTFINVVESFYTVSDNSMSKDQVRMLPLIYSVIAVGAL
                     FSKTYSPEQDNKQVVDFFQDEGHKYFVEAKSLLDPINSQDIESLQAIFMLTIFLQCNA
                     NLSSGYSYIGLALRSAIKHNFHRKTSLQNLNVLQQETIKRLFWTIYKTDIYMNCILGL
                     PNSLDGSLIDQEFPMDIDDDKIFFDKVLPQPKGKLSSVGMNNEHTKLILIMNHTHNIL
                     YPMSLEVTSISHKEINKLESQLSNWLTCLPYQLKPNFVPTNEQEGTYLKPNRYLHLDF
                     LHAKIMIYRPFIHYIVLEVEKFPNFEFQIHMADKCINTARKVIRLAVEMDEQKLLNAV
                     YWFSIHTIFFSVACLLYFLHQTKLKQSTVPDSQIEKDCRDGFNLLLRLKNVSHASSKT
                     FEVLNSLFEKLNQKSVDLSDKVLKNIIAKQQQHEYEQFSKLSDLFIDNDIEDVVFEEQ
                     EPVYSTTDTVGTDSVEVDNDFINKILSQFCNDII"
     gene            <304412..>306955
                     /locus_tag="KLMA_10146"
                     /db_xref="GeneID:34713828"
     mRNA            <304412..>306955
                     /locus_tag="KLMA_10146"
                     /product="cd12148 domain-containing protein"
                     /transcript_id="XM_022818285.1"
                     /db_xref="GeneID:34713828"
     CDS             304412..306955
                     /locus_tag="KLMA_10146"
                     /codon_start=1
                     /product="cd12148 domain-containing protein"
                     /protein_id="XP_022673683.1"
                     /db_xref="GeneID:34713828"
                     /translation="MEAQIEKEEHHEAIGSNNSSQLVTPKFSPVSMSNVNSTETLENL
                     HSCRAQVCDRCRKLKKKCYGTGPSCTNCLVTNNPCSVTTTLKRKRKPKPTKLSPIEVE
                     NIKLRLKLQEMENLLKENSSHHAEAMHDSRHSLVKIEDLNSCSLSSSQLNSSNNSVLH
                     SPVSNDDNGTINSYHSKDSRSHSQSELDNDYDTKYNIDCSASLQNNGKIRKRKIQNVI
                     SSNFKYLIKTRSLKVDLSMMSSMTKVLLPNEDNYNGPAIIEEYSIVDNFLQQDFIKIL
                     KEQKSNISHYLKRFFTEINVLFPIILEKDYMLMKAEELMQSVGVRNFNTNVINDEHNL
                     CIVYKVILISMFYIKDSSVRNGYLKTVKHLLSRFECLDPINTLKCYLLTHLYAQMSNN
                     KPLLVRTNGMISSLAINLRINKFKECNELKRELWYICYCFDFFCNDPNNLDYSLNRYF
                     NDMELVDEVSSQISDENTVDSCEAMRMIHDHSILREMGNSKFLLQVIDVKRAIYSNEI
                     TVYAGIKQLLNLSELRKLSHLDDLQNELKESVMAFKKENYQYDFHICFPVLYYMDALI
                     CLENSYIKSLMSKVENKVSSRNATISRHLKSLFNYIDTFLRLWTTNIETYDHIPLISV
                     NKLLHYGTFIHWYVTEDDSENQRTKKKSKVNPEVEEKVINMLKMIEDLLLRHTFVDEN
                     LKNTKDVITNLIQQLEESKSSDNEEEKEMYSKDFKPFRKITIGDISDDITVSLPLDNK
                     IDTLNQTVEPCELLNDVSDDKSYEQIPLSSYTKLTSNQDVEEQLNNYVSGFTFESSKD
                     NINSVGLVLRSQESETSNRILRHNENSEFFNMTDTVDLKRIHLSTNDFF"
     gene            <307584..>307979
                     /locus_tag="KLMA_10147"
                     /db_xref="GeneID:34713829"
     mRNA            <307584..>307979
                     /locus_tag="KLMA_10147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818296.1"
                     /db_xref="GeneID:34713829"
     CDS             307584..307979
                     /locus_tag="KLMA_10147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673684.1"
                     /db_xref="GeneID:34713829"
                     /translation="MVTTTTTFVQNKVAKNYTAHLVPCKVRQTGPTTEFNDQFILDEE
                     LIEPTQQGKSVTYIRGRKIVGDELRFEDSSCFVVKTSQDGLGNNLVEPVFNVAKIVNY
                     EREGNEERLINELTKFEELRHLESLIHTP"
     gene            <308169..>309170
                     /locus_tag="KLMA_10148"
                     /db_xref="GeneID:34713830"
     mRNA            <308169..>309170
                     /locus_tag="KLMA_10148"
                     /product="F-box-like family protein"
                     /transcript_id="XM_022818307.1"
                     /db_xref="GeneID:34713830"
     CDS             308169..309170
                     /locus_tag="KLMA_10148"
                     /note="cyclin-like"
                     /codon_start=1
                     /product="F-box-like family protein"
                     /protein_id="XP_022673685.1"
                     /db_xref="GeneID:34713830"
                     /translation="MATLKRTGDNDLILKKSKVSKVYLNSEFKKDFGWFLQTIPHEVL
                     VTILNQISNKEKISLATTCKTVRHILMPYIFANVKCPWEQLLDEPNWPLDPSIQHLIE
                     SLRITTSCSKNEWTYPFQKLFSNSEINKLRNLRSLHINSSGSTSFFKYCDVAENLKEL
                     SVTTTKERSLFSLEHVRPFKNLEYLNVSNFQIDDFVEDGALCPKLESLRLNNCSWEYP
                     FEIENFGRNKIRSLSLEYSNSFIISERFRDFLTHPGFTSLESLEITNTETNLKLTISL
                     EIMKLIKNIPTLRVLKLKGNIYNETLNNFTKIDVENCMNYIALDNVKVFYCSFFSKG"
     gene            complement(<309223..>311574)
                     /gene="RCY1"
                     /locus_tag="KLMA_10149"
                     /db_xref="GeneID:34713831"
     mRNA            complement(<309223..>311574)
                     /gene="RCY1"
                     /locus_tag="KLMA_10149"
                     /product="recyclin-1"
                     /transcript_id="XM_022818318.1"
                     /db_xref="GeneID:34713831"
     CDS             complement(309223..311574)
                     /gene="RCY1"
                     /locus_tag="KLMA_10149"
                     /codon_start=1
                     /product="recyclin-1"
                     /protein_id="XP_022673686.1"
                     /db_xref="GeneID:34713831"
                     /translation="MESLITFSDVLKVSNVVRNIAFSLNPADYISFRQINKKVYHDHL
                     TGATDKNYWLHRVKCLGLEPEPGYRLPSDVKVNAANIGVTCTKFDPRDPKVAYKLFYR
                     LLHPFVKRLYHNDVANFFPEEYNEPLTQAKIIKVLEKYINSYSNDWPYHRKVQENLKI
                     FKELFTTSVIRELDLNFDKKNFSYCSQFVEVLLLLDHEVSAVDFFKSKNEFPESIKLP
                     EELFDENDELRYDQLELALDTFTQFLNEKISITDQLFQDRYPVIVLYTENFVQDHLIP
                     YFQIQISSSNTPDAKNKRLMSLPTIYSKLSSHFVKKLRDNVNAGTSYQRFVSDFIQLY
                     LEPEIQKFFDTMVQDFTTTTEDLLKDYEEQSQRKQKAKDEALFESLKNSNMTNEELLD
                     GKTNFLKSFTKIFKINNNTLKSQAEQDLEVSYTLQKMNNKLQNITSLVSLDLCYKIIQ
                     ACREHMEKIYLFKDVEVFETVVKLKCQEMYKILMFLLSEKHIKLGFETALQLLKDYDA
                     NETKLASLSPNGTFDDDNKVEPLVQFTELINIGDIILQMLSIFYNNELIAKGIIDKNK
                     DIFNDVVHTKKVFETMLDDYVANGLNIGIDKLMDQVEFTFNTMQFPDDFNPDPKDASR
                     REIAPSKCAIANVELLSEHCFLLTGATDKGTIDVFQQEIGERFFDEVVKNIKKHLISE
                     DGAVFLIADLNYYHDFISKKLKQKNITPFFLGLKSVGQLYLISGKDSKELGKLICDVG
                     KFQGVFTQEEIYELVQRRTDWFKVRKDVEKVMYGLGVSDCVIC"
     gene            <311807..>312916
                     /locus_tag="KLMA_10150"
                     /db_xref="GeneID:34713832"
     mRNA            <311807..>312916
                     /locus_tag="KLMA_10150"
                     /product="pre-mRNA-splicing factor sap114"
                     /transcript_id="XM_022818329.1"
                     /db_xref="GeneID:34713832"
     CDS             311807..312916
                     /locus_tag="KLMA_10150"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor sap114"
                     /protein_id="XP_022673687.1"
                     /db_xref="GeneID:34713832"
                     /translation="MTDLSNDDIPDWIEVPEDESTKLDILNTVEYVHRNGTAFEAKLN
                     SDKTKFVLPGNKYYDYYSFILERKRSSQNAESTDGKETENRPLEPYPFVFSTYRNDVG
                     KKDLDLIKATAHFCAINSGVDYLEKLRAKYSSDSRFAFLRHDHSLNPVLTEFINQYEQ
                     ISAGEYGPLADIKGPIKKILLFRAFQRAQSQEFQDELKYEMRETSKRLRIRFSAYQWN
                     KFELVERITFSEEDEKEGLPSSVDFEHLKRTKLTQDISIFKERKEDKTTTKRKRKNMV
                     IKKAGETRLQHEKYQNNFNEQNIKCPITGKLIPESQFDEHLRTLLSDPQYKEEKEKYE
                     SKHRLTNLTTTEVYENIKKLVSEESSVSNKKQKTK"
     gene            <313766..>315493
                     /gene="ECM25"
                     /locus_tag="KLMA_10151"
                     /db_xref="GeneID:34713833"
     mRNA            <313766..>315493
                     /gene="ECM25"
                     /locus_tag="KLMA_10151"
                     /product="protein ECM25"
                     /transcript_id="XM_022818340.1"
                     /db_xref="GeneID:34713833"
     CDS             313766..315493
                     /gene="ECM25"
                     /locus_tag="KLMA_10151"
                     /codon_start=1
                     /product="protein ECM25"
                     /protein_id="XP_022673688.1"
                     /db_xref="GeneID:34713833"
                     /translation="MVKSIDVNVNSIFYKSYSVDLESDSPVYVFDSTYLPAFSLVQDK
                     EVYELLIDGLMDKVLTKLPKEPFTLVVFSSGFTSNEISWVYGIKLYSKLPKEMRYLIQ
                     KTLIVHESFFAKTVLQVLKNAMRIKGLNNKDSSTDGIIHVQSVTDLANYLDITLLRIS
                     LNVYLYDYQFNEKIEVPEQFRVKPNSIAYRQYRQLIFDKIFKRLKAEGPKSELVFQKP
                     GSYKRINILLDVIERNHYVDLSQWDIYSLGSVFLHFLKNKSKPLIPLDLIPLPLEDDL
                     NYTKKTFNAIIEYNGYYDLLRAIFPLFITFLDNNETTKHTLKTLSKSLTPTLCKEKVS
                     IKSSDKLAIGTRFIRNLLLHFYSIIDELDSKSAPTLPARIISERPINPPALPKPRKSS
                     PTRYPVSSSSSARSRSISSASYSKETPPSSAKSSSIELIGEKCTQTIGEKPILEPPST
                     FILESRNDSASSLASSQSVTKYNLRSPSKPLAKEAIKDNNSDTEDDEILGLQDLLEQL
                     TIEKNDKIKSFDKELKKKKLLQQKSANSTKFSNEGYGDITKGSKVSKLAALYEERLQG
                     LQALNDLTK"
     gene            <315809..>319906
                     /gene="BUD5"
                     /locus_tag="KLMA_10152"
                     /db_xref="GeneID:34713834"
     mRNA            <315809..>319906
                     /gene="BUD5"
                     /locus_tag="KLMA_10152"
                     /product="rasGEF super family"
                     /transcript_id="XM_022818351.1"
                     /db_xref="GeneID:34713834"
     CDS             315809..319906
                     /gene="BUD5"
                     /locus_tag="KLMA_10152"
                     /codon_start=1
                     /product="rasGEF super family"
                     /protein_id="XP_022673689.1"
                     /db_xref="GeneID:34713834"
                     /translation="MSYNTTPLFGRQETINKEDETDLEVSPTKPLDLRASIIRAQNRS
                     SSNTIRFSTIAQRLTEEGKHASVQSSNTYTSNDTFLTARSEEFRSQNELHSHQGHPFS
                     AFTKSKEALTDLNSTPVVQNDQFIDNVTPKANNQVSSSPSVHGHNSNNHIVGLGLSHD
                     GHQYQNSDHDPNGTIISDTDDGNTTQEFTFDSYGKSAHNGILLSAGETIDTPTSTISR
                     AKEENEPVLQGSTKNVGPEEKDEENLAYLFIIAVHSFNVSSLENKEDAAICISFEKDD
                     AAFVHSVDESGWGEVTLIKNMQRGWVPFNYFADAVKQEKPSKDKDELEVFIETRKPLE
                     QLLSASAKFILNPQNRKLEHSNHYSFDINYINRIRDGVKTLLLETDCVSRSNDFVQKK
                     PMIKKMRKRLLAEWYNLMIKADSYKNTTSTTKIQTLVSLTFAILRKAFLFYEIWWVER
                     RSYELEKQNLNRGLNQLQRPSTTAINNKPEYYSSVTKSTTRKELPNLKTPPSASTRLK
                     EIHDILFTYFGLILGRLDMIEHSPANCEILESIVHQIILLLRELLYISQACSSIIQEK
                     YNSQYENNLDYNLDPLLSLVSELVSCVKVFVTQTIKEKYDDNNNILLLDDIYYYTDEG
                     EHMILIIAQMTRLISNAVSGCNNYLKLIGDFQLSDERKYPAFYEIRISPEQFIKKCSN
                     NMVKKLNKNPDQFHSFLEENRNKIIESPSFSKKLARFSTIRSGNQSNILSPGGSQMLL
                     DYMPDKKSFFGDPQFELFTPDQNNSDDSYQINDTEAMKEEILTDKEDRLIGISFRALV
                     FMVTDEMRKFDEKLLFTFLLNYKSFGTSEELLECLILRFDTKGQSTKYALGEKNGTFS
                     SLASRVRSRRRQVCKVINIWIESYWDYERDYKLIPTMINFFNEEVSQHLPIEAKILIE
                     TAAKLAAYTPKYMEKHLDGISQLVPRNVNPVKKTNSMISVASSTTSSHSSSTTATIDE
                     QFIERYELTKLPHSSHSTISLPVPILSLGSSSLLTRRNLSDIERIVLNYRDMVGFPNG
                     SISTKTFVSNYSLVQLIKEWMKLVANSKKQSSPRSFIHNDLNLSELNPLEVAKQLSLI
                     ESSTFIRITPSEILKGKYSSKNIDLSDSPNVNCLITLTNLLSNYVLESILTPGITLKK
                     RAARLNAWLRIALSALYFRNFNTLASIMTTLQSYVISRLSMIWNILSDEDVELYDYLS
                     KIIHPNNNYKVYRKKLDHLISESSSSNGVISTKSLLPTVPFFNLFLQDLTFIDEGNPK
                     FRNPDSFRPHKLVNIDKYFKITGIVALLQFFQVGYDMDSKISHVRKRDSFLSLTGTID
                     IDSKSIKPVPELQEFILFEFWRVNTLYIKDSDRAYALSLELLPRN"
     gene            complement(<320189..>322582)
                     /gene="ACO2a"
                     /locus_tag="KLMA_10153"
                     /db_xref="GeneID:34713835"
     mRNA            complement(<320189..>322582)
                     /gene="ACO2a"
                     /locus_tag="KLMA_10153"
                     /product="probable aconitate hydratase 2"
                     /transcript_id="XM_022818363.1"
                     /db_xref="GeneID:34713835"
     CDS             complement(320189..322582)
                     /gene="ACO2a"
                     /locus_tag="KLMA_10153"
                     /codon_start=1
                     /product="probable aconitate hydratase 2"
                     /protein_id="XP_022673690.1"
                     /db_xref="GeneID:34713835"
                     /translation="MLAARRSTRSISLARVRRTLSTVNEDAFLRAPAELQSRVPPYAK
                     LISKLQTVKSILNDAPLTLAEKILYSHLCDPHESLVSSSLADIRGQQYLKLNPDRVAM
                     QDASAQMALLQFMTTGLPETAVPGSIHCDHLIVGKEGETKDLASSIATNHEVFDFLQS
                     CASKYGIQFWGPGSGIIHQIVLENFSAPGLMMLGTDSHTPNAGGLGAIAIGVGGSDAV
                     DALTGTPWELKAPKVLGVKLTGKMNGWTSPKDVITKLAGILTVRGGTGYIVEYFGEGV
                     QTLSCTGMATICNMGAEIGATTSTFPYQEAHKRYLQATNRSFIASAADQALHQFGFLK
                     ADEGAEYDKVVEINLSELEPHVNGPFTPDLSTPISQFGEKTLKEDWPQRISAGLIGSC
                     TNSSYQDMTRAADLVRQAAQAGLKPKIPFFVTPGSEQIRATLERDGLIDTFEKNGAIV
                     LANACGPCIGQWDRQDVSKNSKEFNSIFTSFNRNFRARNDGNRNTMNFLTSPEMVTAM
                     IYSGDAQFNPMKDSIKLDDGNEFKFAPPKGEELPHDGFIAGRKEFYPVNDPKPDPSIE
                     VKVSPDSDRLQLLDPFPAWNGKELKTTVLLKVEGKCTTDHISAAGVWLKYKGHLENIS
                     NNTLIGAQNKETGEVNKAYDLDGTAYGIPELMIKWKEEKRPWVVVAEHNYGEGSAREH
                     AALSPRFLGGEIILVKSFARIHETNLKKQGMLPLTFADESDYDRISSGDVLETLDLAD
                     MIAKNGDNGGTLDVKVTKPSGESFIIKTKHTMSKDQVEFFKAGSAINYIGNIRRSST"
     gene            <324107..>326863
                     /gene="PHO87"
                     /locus_tag="KLMA_10155"
                     /db_xref="GeneID:34713836"
     mRNA            <324107..>326863
                     /gene="PHO87"
                     /locus_tag="KLMA_10155"
                     /product="inorganic phosphate transporter PHO87"
                     /transcript_id="XM_022818374.1"
                     /db_xref="GeneID:34713836"
     CDS             324107..326863
                     /gene="PHO87"
                     /locus_tag="KLMA_10155"
                     /codon_start=1
                     /product="inorganic phosphate transporter PHO87"
                     /protein_id="XP_022673691.1"
                     /db_xref="GeneID:34713836"
                     /translation="MKFSHSLKYNAVPEWQDYYIDYSHLKKLIYSLQQQELDQLEGLG
                     NETTGESGSKIGGKLGALKFWKKGSSSSAGGVLDEEGQVGKNFNGDDDANVETIELGE
                     YHANRKQGRSSSGGNGNGRKLKFGFDFDKRSSVSSERTVFNSQDVFLAKLTDEKHKID
                     DFYKRLEAKLYSKFETLTKDLEKAGFANLQNHVYREAMESQSLSAVATRTKSNETGFS
                     GLSRRLSGHSQTARLDSNGMIDDFIDDDEEEEEEEEEEEETRDNTALLNYSDYNLKSQ
                     KKAILKKNVIDLYVDLAQLKSFIELNRIGFSKITKKFDKVLGCNVKQELIESGEFFKD
                     AHIFLPETISQLDNKISHLISYYAVITDQEDDIETVKDELRSYLRDFIVWERNTVWKD
                     LLGLESQQNDFTSVGRPAVNGEISNLENNTHLEYYSYTLPNPISFKWFTIEKLSIPKL
                     FFTTRALKIYIIIVFTIILLAVKTFNDEAQHRCMALVECVALLWATEAIPLFVTAIFV
                     PLLVVLFRVLKDDSGHVMHAVDASSYILGKMWSSTIMVLLAGFTLAAALSKYNIAKVL
                     ASYLLTAAGTKPRNVLIVVMGVVFFLSMWISNVASPVLTYSLIQTVLRTLTSETPFAK
                     ALILGVALSANVGGMASPISSPQNVIAMDYLKPYGIGWGNFFAVALPVSIVSIFLIWL
                     LMIFTFKINTTTLKPYKPIKEKFTLKQYYIMVVTVVTIILWCVLSKIESAFGAAGEVA
                     VIPIVLFFGTGLLTTQDINNFPWSIVILAMGGIALGAAVSSSGLLATIAGALQKRVMD
                     YSTYAVLCIFGIVMLVVGTFVSHTVSAIIILPLVQEIGDSLPSKKAAPILVFGCTLLA
                     SCGMGLASSGFPNVTAISMMDEVGNRYLSVNNFITRGIPASLLAFVVVITIGYGIMST
                     VLHG"
     gene            <327271..>331002
                     /gene="UBP12"
                     /locus_tag="KLMA_10156"
                     /db_xref="GeneID:34713837"
     mRNA            <327271..>331002
                     /gene="UBP12"
                     /locus_tag="KLMA_10156"
                     /product="ubiquitin carboxyl-terminal hydrolase 12"
                     /transcript_id="XM_022818385.1"
                     /db_xref="GeneID:34713837"
     CDS             327271..331002
                     /gene="UBP12"
                     /locus_tag="KLMA_10156"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 12"
                     /protein_id="XP_022673692.1"
                     /db_xref="GeneID:34713837"
                     /translation="MTSEKRSYVADSDCMQFSTQETSPDESTSGENSNGNTIPALTDE
                     NPTDISSSISSSLPSVLYDAIPPLQDQRSIVANMWARFSNEKKEGDVVYIIPESWLSL
                     FQDPLVTDYRAVPPLNIASIVVDYDHFILQDYSRQPYTAVPAKIFNLLQQWYGLTPDS
                     KPLPAYIVIDKKKQLVVEYDRPRFRIHHLTTNENSSQYSISMRNAAEAKLSNMFTLSS
                     LATTKDVVQRAIDLFLSKEPQFDKESYYFRVWYINDDGNNVKTSNILQNSYTISPSTF
                     LELTYKHKITKNMFTRRLKDLNSHVINLAIEVKRKSGTQHWPSNFFHYFPLQSSPGIT
                     GLANLGNTCYMNSALQCLLHIQDLNEYFLYGGYEDEINNDNPLGYKGHVAHAFGHLVQ
                     SLFSPSYGINSFFAPRNFKNTIGHYNQLFAGFGQQDSQEFLAFILDGLHEDLNRVIKK
                     PYLEKPELPEGSPVDENKIIELANETWDYVKKRNDSVIMDLFVGLYKSTLICPNCQHV
                     SVTFDPYNDLTLPLPIENYWTCKVLIFPQNSPPCTLEIELLKNSTYQELKEYIAKQAS
                     MNADDLIGCEIFNHQFYNNYESNMEAEYLPISELISENDTVVFYELIRNPDDIVVPIF
                     NTRIEDGYKTPRLFGYPFFIALSKDEQYSYGSIRKKIERCYQNFSGGFSEFPILSKVS
                     ENYGLDSLPLLSKKFPKEELDIVTKELEFINPEISPDNFFKIMLLKNEALHNHTTRTP
                     RFNNASLKNSNSPAGKIWTPTSVSSINYNNSEEITQFLPEVVKTAYYYSEIKNDTGMD
                     DSDEVVDNNDESSIDSETKSTSDESMTTSTEVLNGLSHLEMSSLVESHTALICEWNTG
                     KDQEVFDLEYGVNWNSPAVLDNIALTKAREERSEKEQTQITLDSCLRLFSQPEVLSSA
                     DSWYCPKCKEHTQASKQIELWNTPDILLIHLKRFENQRSFSDKIDATVHFPIEGLDMS
                     PYLSYQNEISNDIYDLIAVDNHYGGLGGGHYTAYCRNFVDGKWYYFDDSRVTETSPEN
                     SVAGSAYLLFYKRRSSTVKVEKNEKLRDIIETSRKSFEQKQAELHKKVDALYEIAHSD
                     TEDDTESALEDEAVMQNKTVEERITIENEEWEAGKRSNSVELPGNRLIENDAKLQSDE
                     DVNEEFDETILEEANGQELNDELVNEAKISEPELSLKDNKFQLEYNVSSLEVGENIST
                     LDSHDSSRRKLRLLEKVYVPESPNKDSSKGSSPEEQKLT"
     gene            complement(<331126..>332133)
                     /gene="RBK1"
                     /locus_tag="KLMA_10157"
                     /db_xref="GeneID:34713838"
     mRNA            complement(<331126..>332133)
                     /gene="RBK1"
                     /locus_tag="KLMA_10157"
                     /product="probable ribokinase"
                     /transcript_id="XM_022818396.1"
                     /db_xref="GeneID:34713838"
     CDS             complement(331126..332133)
                     /gene="RBK1"
                     /locus_tag="KLMA_10157"
                     /codon_start=1
                     /product="probable ribokinase"
                     /protein_id="XP_022673693.1"
                     /db_xref="GeneID:34713838"
                     /translation="MGITVVGSLNYDLVTYTERIPVAGETFNAESFETHSGGKGLNQA
                     IALAKLVKPYSDDDSRSVQVRMVGHVGSDSFGKQLLDKLREHKIDTKHVDQVQGESTG
                     VAVIVVEKSTGQNRILITAGANSHTVYSNEQLEKIFSNKDKEFVVFQHEIPNPQVIMD
                     WLKHNRPNYEVVYNPSPFHKLEKKVWRNVDLLIVNEIEAMQIIESLDTEDIVSHFKSK
                     ITKESYASGYLEIAQHFQSQLISQDHSAVVIITLGEQGCVFCSKHCPEGGYLPSIKVE
                     KVVDTTAAGDTFLGAVVSQLHDNQTLEDSIKFATTASSITITKKGAAETIPVYSDISK
                     I"
     gene            <332562..>333854
                     /gene="RRP43"
                     /locus_tag="KLMA_10158"
                     /db_xref="GeneID:34713839"
     mRNA            <332562..>333854
                     /gene="RRP43"
                     /locus_tag="KLMA_10158"
                     /product="exosome complex component RRP43"
                     /transcript_id="XM_022818407.1"
                     /db_xref="GeneID:34713839"
     CDS             332562..333854
                     /gene="RRP43"
                     /locus_tag="KLMA_10158"
                     /codon_start=1
                     /product="exosome complex component RRP43"
                     /protein_id="XP_022673694.1"
                     /db_xref="GeneID:34713839"
                     /translation="MLLKASNLKVLEKKKKIFNSSHLIASNMKGRIINRVSEAQLQSI
                     PAMSDADSIEVHPVVFPPEVLARILPDLSLQRHLSLETRPCSRRFEEFREIKLSDGNI
                     FRYSGNASNNGSNDVIGSNVLRAGKTFIMTSITGGIIEETLSAGSNDIGEEELIEIAT
                     EENKLSENATVFPVVEVHRGRVGGPTDEEMITSEKLHKTLLHSGLLKKKALAVSCGIR
                     RTDENGNVSIIYDDEALEEDKKINESINRKWSYVLYAKIQVFSRSGPIFDLCWNSLIS
                     ALKSVKLPRAFLDERAADLKIAVRTRGRSMTIRETYDILCDPKKYLPLELNESQLAFG
                     SNFGIVDIDPLAELDHEEESNADKMEVTDKKSVLLADIETEAEETSIQSTLTFITSKD
                     GMMKNATVIGGGSKITPSMIRRCITLSKQRADDIQSKI"
     gene            complement(<334147..>335208)
                     /gene="FEN1"
                     /locus_tag="KLMA_10159"
                     /db_xref="GeneID:34713840"
     mRNA            complement(<334147..>335208)
                     /gene="FEN1"
                     /locus_tag="KLMA_10159"
                     /product="elongation of fatty acids protein 2"
                     /transcript_id="XM_022818418.1"
                     /db_xref="GeneID:34713840"
     CDS             complement(334147..335208)
                     /gene="FEN1"
                     /locus_tag="KLMA_10159"
                     /codon_start=1
                     /product="elongation of fatty acids protein 2"
                     /protein_id="XP_022673695.1"
                     /db_xref="GeneID:34713840"
                     /translation="MESFLKSNQYAAGLVEKYPVILDYVPTVDRPFFNVSLWTHFDAA
                     VSKATDGKFIPSQFTFVAGELPLSELFPVMGMIGTYYLVIFGGRAVLKNTEPLKLNFL
                     FQLHNLFLTTLSLTLLVLMVEQLVPMIAKHGLYYAICNQGAWTQPMVTLYYMNYITKY
                     IEFIDTIFLVLKHKKLTFLHTYHHGATALLCYTQLVGTTAISWVPISLNLGVHVVMYW
                     YYFLAARGIRVWWKEWVTRFQIIQFIIDIGFIYFAVWQKVATDYFPTLPHCGECVGST
                     TATFSGCAIISSYLFLFIAFYIEVYRRQGTKKSKVIKRVKGGVAAKVNEYVNVDVKNV
                     NTPSPSPAPRKRNTRSRKA"
     gene            complement(<335811..>340286)
                     /gene="SNT1"
                     /locus_tag="KLMA_10160"
                     /db_xref="GeneID:34713841"
     mRNA            complement(<335811..>340286)
                     /gene="SNT1"
                     /locus_tag="KLMA_10160"
                     /product="probable DNA-binding protein SNT1"
                     /transcript_id="XM_022818429.1"
                     /db_xref="GeneID:34713841"
     CDS             complement(335811..340286)
                     /gene="SNT1"
                     /locus_tag="KLMA_10160"
                     /codon_start=1
                     /product="probable DNA-binding protein SNT1"
                     /protein_id="XP_022673696.1"
                     /db_xref="GeneID:34713841"
                     /translation="MPPHHRLGEKKRYHYGGGPSGRYGSFSSGQEGSGSGSSGSRHSR
                     YDPNATVRGPHSSRPSSRFNPNVSVTDTKRGSTDGNASNANGSRNGPSNSTHGNGVTN
                     ANTSAGVSPSASNSTSISPSTSHNHNTITNPVNASSTSNNTNSNSNHHVNSNAPASAS
                     SSSRWAGSHSRYNPQAGVSVTNNTPALSTSSAQGGPATAPSASTSGSPYYPSNTLNGS
                     SKYSYVSGRSQRPRSSFDTFPPNASADLYDNSTKHAFSGAKTAMSGSSASIPGGNNLN
                     NSLGSNSRNSYWGNRGSRSGGKYHSGSRYNGFRKYPFDYGFHDMPDIPKSKKSFDTSS
                     HPSKSSLINSVPQTTRKVEEQVSHNHKRIDISAEEYTGDSDTRSYSSFQEKTDGQDEG
                     SELDDESQMYDMNNNGTPTTDRKQESFSLLENKDNKAKNTAQKEEGRESRQQSPHTVM
                     NDDSNVMLDVSDNTKKSDKIDEEYDDEPKKTSVVDNDVPTSINNNDEKEDSHVTEKDD
                     FDEEDAEKLLENSLQNLTGPLAEKQHIPPQDYISKAEPYPTPIHPIEECIFPMQEPQM
                     KLWMLKNKPRADRIKNQKYLLKKPVQYLFEYPFFTKAWIIHEQAVKPVVIKNLAEIKR
                     YEYLRKLQLKDQFFKLENEWTKKCERMSKLSETLHRTDSEEDHKKHTNDNKVQENTNG
                     ETDRRPTSSRRRNRADFVDDNDIENVLLQIDPDYKHHQLAATIPPMIINPVEKFACLF
                     KDVNNLVTDKDKWASRVLSDGIDTFTPYEHELFIEGYLSYPKKFGKISHYMGNLRTPE
                     ECVLHYYRTKKTSKYKKLLLEKHKKRKASIGRRKKEKDKTEAKRKEDDEKETKKSETE
                     PSETATSTVEKNLSAEETEKAPALAPKIESPPLVKPIEEVPPSQPVPVAASVSVNENS
                     TLNTNVTEGETETEVKKESDTESENEVTTDGDSVLKQQLVDAEESLRETATPQTVIHQ
                     QSLPHHDEVIAEGSQVVENVTANVVGQDNDSEKAISSSNDLDKAGSHPKVDGDSEGVL
                     KHPLSEQQLANHTEQPMKKKIKQSDINHKSSYWSVQESKMFPELVKEFGSNWTAISQK
                     LGTKSTTMVKNYFQRKAGQNGWYALVEMGNNNHNHNQSNSGLSTTATSDQVNKPVAIA
                     PAPGNVGNIATSAPSTGSGQGLINMPRSSNLPFGTANNERSNMGLNELPSVTQQQQQQ
                     QQQQQQQPQHQPQQPPVGYFSDNGLPAIHSPAFTLTRNEDSFSNLPTPTQGLPVQHMP
                     AISSFNTHNMLPKLNAGTIHSEPQMQLPVQKNIATGSDSTMNKPQGASVHFPHNIVGN
                     TGNSVTQSYTVAPSRRSSIRSLLNDGEDSKPTRSATPPNITPTVSSTTLPALRPMSTT
                     SAMPLQSIAPSRSTEPVASKVIVQELSHTKTYTNANLTHNAVPQNIAPIQNTQLLPVP
                     SVSSINFANDPLAALAAVASSTEAFGLVPAAPPNNQHQHHQSIKQNNTDSNGHIH"
     gene            <341781..>343280
                     /gene="CDC6"
                     /locus_tag="KLMA_10161"
                     /db_xref="GeneID:34713842"
     mRNA            <341781..>343280
                     /gene="CDC6"
                     /locus_tag="KLMA_10161"
                     /product="cell division control protein 6"
                     /transcript_id="XM_022818440.1"
                     /db_xref="GeneID:34713842"
     CDS             341781..343280
                     /gene="CDC6"
                     /locus_tag="KLMA_10161"
                     /codon_start=1
                     /product="cell division control protein 6"
                     /protein_id="XP_022673697.1"
                     /db_xref="GeneID:34713842"
                     /translation="MFKGLTTPPASPEKQQRKYIGVGVRQPFEAVSSSVTNIDTTEEA
                     HEDLKPKRLAFGSEPLTSKTKSLLQQSSVATCENSWLVTRESEYRDIIEFLQGSIGMK
                     DSNENSLYITGPPGTGKTAQLDIILRDKFQEIVLGPARATLPKHDSDLTNVSYFETQP
                     DVFQPVAVAKINCIALAKPETIFQKLITEFTNTRSPAFHTGASSTVKTLEEFCRSKPS
                     THFVMILDEMDKLINGNGSGASKTKTILDLFLLAKEPSINVTVIGIANSIDLKDRFLN
                     GLNLQKELLPKVIHFRPYNSDQMFEIVKQKLSVFPQCFELFQPMAIRFATTKCSGSTG
                     DLRRLFDLLRSSVQLFELDSLKSNAVSNVGSKRKVTIAHVAKAVSKFMGSATTRARIG
                     PLNIQHKIVLCSLVHRERFDLHQCICTIDEAYDYYVKLLRRTEVMKPLSKTEFLESCN
                     SLQTCGVVIIDFSRKRNIQSGSQKTIKSSVIEAELQEEISKIELLKRLL"
     gene            <343742..>344419
                     /gene="VPS60"
                     /locus_tag="KLMA_10162"
                     /db_xref="GeneID:34713843"
     mRNA            <343742..>344419
                     /gene="VPS60"
                     /locus_tag="KLMA_10162"
                     /product="vacuolar protein-sorting-associated protein 60"
                     /transcript_id="XM_022818451.1"
                     /db_xref="GeneID:34713843"
     CDS             343742..344419
                     /gene="VPS60"
                     /locus_tag="KLMA_10162"
                     /codon_start=1
                     /product="vacuolar protein-sorting-associated protein 60"
                     /protein_id="XP_022673698.1"
                     /db_xref="GeneID:34713843"
                     /translation="MNRIFGYGNRKTHEQMMLDSSKAIDQAQSGLAGRVSQLDTQISQ
                     LNFQLSTLQKKISNTKSTMGQKPLRQRALKLLNKRKQLEAMRDQLDSQSWSMSQVQMT
                     TDNLKNTMVTVNALKQTNQALKQQYSKINIDKIQDMQDEMMDLIEQGDELQEVLAMQN
                     QDIDDISESELDAELEALGEEDLMEDLDLNDAEANGELPSYLNNAMPQFVDDEPIEDK
                     PALETAN"
     gene            complement(<344580..>345563)
                     /gene="COQ3"
                     /locus_tag="KLMA_10163"
                     /db_xref="GeneID:34713844"
     mRNA            complement(<344580..>345563)
                     /gene="COQ3"
                     /locus_tag="KLMA_10163"
                     /product="hexaprenyldihydroxybenzoate methyltransferase"
                     /transcript_id="XM_022818462.1"
                     /db_xref="GeneID:34713844"
     CDS             complement(344580..345563)
                     /gene="COQ3"
                     /locus_tag="KLMA_10163"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="hexaprenyldihydroxybenzoate methyltransferase"
                     /protein_id="XP_022673699.1"
                     /db_xref="GeneID:34713844"
                     /translation="MFRKPGLLTSVRRLYSDIPKYNTDFISSSNNAASKSSQSTNNLN
                     SPKTASTSTSDDEIHHFQQLAPTWWDTWGSQRILHKMNLARLDFIQRILRNEIKIENK
                     DVYIPGFNHREHLPAYVSKAIEKDIFKEVNSLLAQKKFDALDIGCGGGILSESLARLP
                     FVQSVTGIDLTPECIEVAKEHALKDPSIKDKIFYKLLPLEKVHGQYDIVTMFEMLEHV
                     NEPSEILSQAWKKLKPDGIMFLSTINRDPISWFTTIFMGEHILKVVPKGTHHLDKYIN
                     SSEIEEWFQQNVAEKYQILETKGTMYLPVNGWIEHDCANVGNYFMAIKKVK"
     gene            <345827..>347974
                     /gene="VPS72"
                     /locus_tag="KLMA_10164"
                     /db_xref="GeneID:34713845"
     mRNA            <345827..>347974
                     /gene="VPS72"
                     /locus_tag="KLMA_10164"
                     /product="vacuolar protein sorting-associated protein 72"
                     /transcript_id="XM_022818474.1"
                     /db_xref="GeneID:34713845"
     CDS             345827..347974
                     /gene="VPS72"
                     /locus_tag="KLMA_10164"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 72"
                     /protein_id="XP_022673700.1"
                     /db_xref="GeneID:34713845"
                     /translation="MSSDSEHEELLIATRSRRANAGNKMQKLLQMELEEAQKRTGALD
                     DDEINLLFQEDEEDEEFTLGSKKREEDEDMFSDSGDESSGASDAEAGEHELQRQERQK
                     RKLSQKKKNHVPVIKRAKTTGTQKTYKSPSDEINAESLLAVSRRTSKRSAVVANKLKV
                     YESLTKAEKRRKLIQEKLRKQREKQNIRPLTQEERLKIAEETEKFNISSLNKYKEQEI
                     SKKQTRMAMQLREKMKFKDGEKIIRWISTQWEVSPLVEIEDRVYWEQYTAKRDKTKKK
                     YVRRKKAQIEADKSRESSTSKEGTPIKQEEDQTSENTVQESLENNDEQVNVTDTQTVT
                     NDSIKNTSAGESDNNDKPEDIPSFNPTTKAEVVEVEEKKSINPAYVHTEESSTVDNSN
                     IIPNSSDSNEMKNDKTEVAAEELLEDQSKSLPEDSYTELPKKENETEISFSTKPDPLK
                     EARMNDMNSSNTSESIKHISFAEEDQISVINSEDPPILVQTSTEVFDKSETSSSVEQN
                     ILEEENNEPEIKYEGPVQRVGKNFLILYTFPDGPFTPYPKDFKKVILGDDWLLPSKAR
                     PDEVKTITKITIAEEQEPLQCILTPDTSILDKFPRFGEFDKKTLRTVKMDTTKKDKIE
                     IKTEAPTGVFLPNGIRKNCLITNKECKYFDPKNGVPYSDVEAIKTIQQLQEYYDEEGE
                     ALNPRFKWFGFGRGGIFLDVLQRPAKGVPEGFI"
     gene            complement(<347987..>350107)
                     /gene="HMI1"
                     /locus_tag="KLMA_10165"
                     /db_xref="GeneID:34713846"
     mRNA            complement(<347987..>350107)
                     /gene="HMI1"
                     /locus_tag="KLMA_10165"
                     /product="ATP-dependent DNA helicase HMI1"
                     /transcript_id="XM_022818485.1"
                     /db_xref="GeneID:34713846"
     CDS             complement(347987..350107)
                     /gene="HMI1"
                     /locus_tag="KLMA_10165"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase HMI1"
                     /protein_id="XP_022673701.1"
                     /db_xref="GeneID:34713846"
                     /translation="MKHPTESQKAIIDFPYIPGSTVKVVAGPGSGKTYTLLCKIRELI
                     VTEKLKPSEIIVLSLTNKAVDNIIENLLKVFHKYNDGKYTEDEVDEIISQIGIYTIHG
                     LSNRIVTENIGIVNIIEENGWRGLVKLVPKEFWTKNNIKSASDRLIIKKLENILTKYH
                     INKKDEDGTIEKLAALMKQSNVLTNDDLIKIASELLENPVNSDSHSFTNFVLNDAKII
                     IIDEFQDLHPGIFTLLEKVIGKKQLLLFGDTNQSIYEFLGSNKEVMSRLENMRPPHMR
                     YTKFIYDNFRCTPEITTAANEVVKQSLPLDAIDSAVTKDPSGLKPTQLELEGLLDEMD
                     FLVSEICQLVCSSAKLSDIGILTRTNAHSQAVVEHLSSFGIPVQKLNSQPDWMSDQRI
                     RFLIDILQLVTSITEELDQPNALPTSSTTKSDFSVIVTLAAIKGFGSKMLRDIHRAAI
                     ASNLSIWQYLNTVPSSDWKLPPSATKKVQEYIEVISPLIDNPSILSEKEPHVIVKRCS
                     EVISHLDISVFSDKTIPGYKAFEDNLKEFYSVMKISILSKPIDQSLTSWFLQSFHDQS
                     IIYHTHQKSQEQQFNSLGSVNVSTIHSSKGLEFPIVFVMGRHDYGKYDIEKKLLYVAM
                     TRARNHLYLVNVNNNAIKSSENYNRSLMNNQNFWDYYNRDMKRTVVLSPVENMMKYNH
                     LQSKYGLMARNMHTMVKAIKRICK"
     gene            complement(<350339..>352120)
                     /gene="VPS52"
                     /locus_tag="KLMA_10166"
                     /db_xref="GeneID:34713847"
     mRNA            complement(<350339..>352120)
                     /gene="VPS52"
                     /locus_tag="KLMA_10166"
                     /product="vacuolar protein sorting-associated protein 52"
                     /transcript_id="XM_022818496.1"
                     /db_xref="GeneID:34713847"
     CDS             complement(350339..352120)
                     /gene="VPS52"
                     /locus_tag="KLMA_10166"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 52"
                     /protein_id="XP_022673702.1"
                     /db_xref="GeneID:34713847"
                     /translation="MDSLCDILGFKEASPPNGEESLNNKTEDDVYESYVKSSSNKEYY
                     LHPGLLKELDDLVSKEEKLRTSTEVLIPNLKTYFVDFHNNLNALTKDLDFVKGKSSEL
                     SSLLKSNSSRLKDISPIVNDLIISPEVIDQVLRGKIDHKWLDCIDYLNDKQEIYHKYL
                     EETDKEKPQDFDHLNEVLQILKAVCVERSKKFIVIRIKRLRDGHPVPAQRIQEELLQV
                     KEIYQMIHKTKPELALGLREAYLNTMKWYYKTYFSRYIRSLTILQYVQIDSNFGLGHG
                     LSNTSVSGSYANYLFSGGRSLFASQVTSRNDITDDTINDYFQISKRLDLITQEDKTVM
                     VSQIAENNPVANYLEVGFKNLNLAILDNCTAEFLFLNEFFRLPTDEGDGIRKLLLEVF
                     QPTFDNALEFTHHLIDNTYDIFGVLISIRVAHRLQFEAQSRQTPCIDDYLDGQLILLW
                     PKFQKLVDFQCEQLRSVAITTNTAHIRGSENHSDPLVTPHELTVQFSKFLLSLLKLSL
                     THKELLDERSEPLFHSINRIRDDFETIMTKCSKKSKNAEKFLTTNYMYLYNSLQQSFL
                     KSDSEREPLILSETKVHLSQLIEAYSK"
     gene            complement(<352417..>353382)
                     /gene="RFC4"
                     /locus_tag="KLMA_10167"
                     /db_xref="GeneID:34713848"
     mRNA            complement(<352417..>353382)
                     /gene="RFC4"
                     /locus_tag="KLMA_10167"
                     /product="replication factor C subunit 4"
                     /transcript_id="XM_022818507.1"
                     /db_xref="GeneID:34713848"
     CDS             complement(352417..353382)
                     /gene="RFC4"
                     /locus_tag="KLMA_10167"
                     /codon_start=1
                     /product="replication factor C subunit 4"
                     /protein_id="XP_022673703.1"
                     /db_xref="GeneID:34713848"
                     /translation="MSYATKLELPWVEKYRPHLLKDIVGNEDTVQRLQTIAADGNMPH
                     MIISGLPGIGKTTSIHCLAHELLGDSYSQAVLELNASDDRGIEVVRNQIKQFAQKKCT
                     LPPGKHKIIILDEADSMTSGAQQALRRTMELYSNTTRFAFACNQSNKIIEPLQSRCAI
                     LRYSKLTDEQVLKRLLEIIKMENVQYTNDGLEAIIFTAEGDMRQAINNLQSTVAGFGL
                     VNGDNVFQIVDSPHPLIVKRMLLSNSLDESLQYLKDLWTKGYSAVDIVTTCFRVMKNL
                     EEVKESVRLEMIKEIGFTHMRILEGVSTRLQLSGMLAKIQKLKSQ"
     gene            <353861..>354739
                     /gene="TRM10"
                     /locus_tag="KLMA_10168"
                     /db_xref="GeneID:34713849"
     mRNA            <353861..>354739
                     /gene="TRM10"
                     /locus_tag="KLMA_10168"
                     /product="tRNA (guanine-N(1)-)-methyltransferase"
                     /transcript_id="XM_022818518.1"
                     /db_xref="GeneID:34713849"
     CDS             353861..354739
                     /gene="TRM10"
                     /locus_tag="KLMA_10168"
                     /codon_start=1
                     /product="tRNA (guanine-N(1)-)-methyltransferase"
                     /protein_id="XP_022673704.1"
                     /db_xref="GeneID:34713849"
                     /translation="MSESDAKCKEDATTEVPVKEEDSNPIIRAPQFPPPPEGISKSQW
                     KKICRKKRFEETKAEYALIRKEKKAKARQARREKLQEYLDKGEEIPEDLKRPPKVNLN
                     QKDSGISIILDCAFDDLMNDREVVSLSTQITRAYSSNKRENHYAKIKVTSFDKRLKQR
                     FDNELSNCNYSNWKNFTFDSDPTLPTENVVYLTADTDEKLETLEPGTTYIVGGIVDKN
                     RHKNLCLNKAKELNIPTRRLPIDEFISLAGRKVLTTSHMVQLMLRYFDNKDWKEAFES
                     VLPPRKLGDKSGSSEE"
     gene            <355208..>356128
                     /locus_tag="KLMA_10169"
                     /db_xref="GeneID:34713850"
     mRNA            <355208..>356128
                     /locus_tag="KLMA_10169"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818529.1"
                     /db_xref="GeneID:34713850"
     CDS             355208..356128
                     /locus_tag="KLMA_10169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673705.1"
                     /db_xref="GeneID:34713850"
                     /translation="MQPVPIVLNSQTVSGIAGSVSIACWIIVFVPQIYENFYRKSAEG
                     LSLMFVVLWLAGDIFNLLGAMLQHLLPTMIILAAYYTIADIILLVQCLFYGQDGPVDP
                     VHLSPANPINENVLQDVFHEHDPLLGDERHRERHDYVDTSSSVSVITSTAGNKNSDST
                     FKRYLLKIMIVSSVILAGFLSWYISYIRNPPKQHEPELDLQMNWLAQSFGYLSAVLYL
                     GSRVPQILLNFKRKSCEGISFLFFLFACLGNTTFIISVLSISFSPRYLLVNSSWLIGS
                     SGTLIMDFIIFIQFFVYNGNSKNSQEFITV"
     gene            <356541..>358424
                     /locus_tag="KLMA_10170"
                     /db_xref="GeneID:34713851"
     mRNA            <356541..>358424
                     /locus_tag="KLMA_10170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818540.1"
                     /db_xref="GeneID:34713851"
     CDS             356541..358424
                     /locus_tag="KLMA_10170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673706.1"
                     /db_xref="GeneID:34713851"
                     /translation="MKGSETIRLNRPPELSEYTINDDNSTSSSSDDDHDTIPQTMERT
                     VSHGLHGFTNMLGFSRSKSSSSINEHRGWNIFKKEKTTSTSNSSIHGESQNSGSENIQ
                     KEQSWWRKSVHRSRPSTVPNSNINLFDESISAEENMILSANHKLETMLHDSFENVVDN
                     SASPTKNLDEDSDYSDDSQLDSLREASRIIKERLNVVSENDSPVTPPNEPVMQVHFKP
                     PVNETSIYDYIYESPNAKNTKNIDLMTVDSNSVTFGKFQRIASCLKDSDDYLEADQSI
                     IAVCDYILTLAKENKEKLFNLQSGISTAKEEEKTVDLSELDELTSKLEEIKSKYDACN
                     EQLDGLVTENDGLKSKLKEVIEFNNICKQFFVEYKGQIAQLYQQVNNETSKNETLKEM
                     QERIAKEYESEKNRNVELAESLALSQEVLQDMEKRYLETVNKISDPQSLQNISVLEAE
                     NAALKETIEKITKGNNRIVKDYQRERKKVLDLRKQKDSTGKYIDGMLLFQNHCIQFLT
                     QFIMSFKAVIEPSDFMLIEQQLFHVSSFSPLSQKSLEFRSDKELLAQLHAFETGTTDL
                     FQNLINNTLVQAVKKFTIEQNSNSFLTSQLRILRKESTEKDQYIQTILHDTNNLKLKL
                     RKE"
     gene            <358762..>361158
                     /locus_tag="KLMA_10171"
                     /db_xref="GeneID:34713852"
     mRNA            <358762..>361158
                     /locus_tag="KLMA_10171"
                     /product="transcriptional regulator CRT10 family protein"
                     /transcript_id="XM_022818551.1"
                     /db_xref="GeneID:34713852"
     CDS             358762..361158
                     /locus_tag="KLMA_10171"
                     /codon_start=1
                     /product="transcriptional regulator CRT10 family protein"
                     /protein_id="XP_022673707.1"
                     /db_xref="GeneID:34713852"
                     /translation="MQLEDDDIRRLKLFTLLNGYYLRESYSVLNRESCDPQVDKTELI
                     WCKAQFGKDYTPEQIENLHQIKQFELDLSKGTNKEFIDSIIEQGSDAEPIWGTGCIDD
                     PGDSLLPPSLRLNYLEKSIYKINERNDDPFDMIMILENRYGLMINSSGYIKVIDLCRL
                     NSVEGTLCKEPTVCTHIRKMFPPTQSSFSLSFVQRLTSFMGLKVIAFGNSVGDIVFYE
                     ESYLAFEYPPILENSILHLKLDEGYARISTCDGIGLSSNLTVLSNEETLTIIYFDTFF
                     ENPIIKTYKFEDKLNYVDFLRPAEAGFFLVIKKDSGVRHVLHFSLENLQQGKILCEAI
                     DSLSEKRTKEQNNLHMVVSKDDFLSVPDFEFLTLSFNAPRNEHFIHKIYQNSLILESL
                     PLYPSESNNLGFGACIAQIEVPVPNYSLIYENDDLLIDNPIHLRYTTYRRNMFHYEDI
                     YANKKLLKTSQLDYEDCYVSRRAHGNGNSKVFKPESSTGICTDSSVKPSNSEYLATLS
                     LQLKAQYKRIDEIRHKLKGHSEFQIDSEPFPYNRLDQLRAVHLHKSVFYGSADIASIQ
                     HLQCCNSSLKEALKMYIKDLSSNGEEKDHELDSYVNAVIKKYLQIKDNTRFRNNGPKY
                     DSIISDDNFVIEANDELSIRMYGTNPLILNAFTPSILCSNLNCVDLRSKKILMCHINE
                     LHCMVTATSSGLISIYRLTEWRGVYAFRFEKLLNVIKIQDVCLDSDDEGRTSFCETQR
                     RFANHDQTFVNSCNKCRLVIENPDIHALNYTYHHDSLSASLYVSTPTKLVKYTIAASP
                     "
     gene            <361476..>363893
                     /gene="MPS1"
                     /locus_tag="KLMA_10172"
                     /db_xref="GeneID:34713853"
     mRNA            <361476..>363893
                     /gene="MPS1"
                     /locus_tag="KLMA_10172"
                     /product="serine/threonine-protein kinase MPS1"
                     /transcript_id="XM_022818562.1"
                     /db_xref="GeneID:34713853"
     CDS             361476..363893
                     /gene="MPS1"
                     /locus_tag="KLMA_10172"
                     /codon_start=1
                     /product="serine/threonine-protein kinase MPS1"
                     /protein_id="XP_022673708.1"
                     /db_xref="GeneID:34713853"
                     /translation="MFDSEAIVQPNKSSFQTSDLQYDESRYEDAKTGLEEATNSNYLS
                     LHGPLHQRNSTHGYNNHTEEHSQSTVFTMVHHKQYQPSMTTMNTNVKNIDNNLSSSNN
                     TRENNQNNKASSRYKEEHSQTSNKFKILQHNMKEELHNTSASKSSNKRNRRFITSRLS
                     SLGPAKRNLSTCFNTDSPGGSRIENSEINSSTVNEESNLSQLDNENSHLSSSSATGYK
                     HREHNIFLEAHKRNSTPTYDENKDPSLPQQPIMNYNNIDFGDLNPYQYLKQHNLPSGE
                     LPFISKVYFERQKEENRKTVLRKASSGTQALKREFTTQNMRSQTARQPRRKPNLTVDR
                     SVSYDPLSSPLLNTNKEVFQEHDINNLPNKREALKPLDVNGPSSSQESKRTKYNTQFS
                     SQEHHEPFFSHRKAPSPQESASNKKKVDLREPPKSTVEVVPLKPESNNVSVFSDNARR
                     DHLNRNNDSNRDDYSSRKKPMYVVPTITVNGTSYEKVELLGKGGSGKVYKVKSSDHKV
                     YALKRVSFDEFDETSIEGFKGEIELLKMLENEQRVVRLIDYQMGQGVLFLLMECGEHD
                     LSQVLTQRSKEPFDMEFVRYHFQEMMKCVKVVHDADIVHSDLKPANFVFVKGMLKIID
                     FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTKNDSEQAKWKVGKPSDIWSCG
                     CILYQMVYGKPPYGSFQGNNRLYAIMSPDVKIPYPEKDSYGAVIPRTVIETIKSCLER
                     NPISRVTVDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNDRVEELSEDVWN
                     KLAEFKL"
     gene            complement(<364072..>365247)
                     /gene="ARP2"
                     /locus_tag="KLMA_10173"
                     /db_xref="GeneID:34713854"
     mRNA            complement(<364072..>365247)
                     /gene="ARP2"
                     /locus_tag="KLMA_10173"
                     /product="actin-related protein 2"
                     /transcript_id="XM_022818573.1"
                     /db_xref="GeneID:34713854"
     CDS             complement(364072..365247)
                     /gene="ARP2"
                     /locus_tag="KLMA_10173"
                     /codon_start=1
                     /product="actin-related protein 2"
                     /protein_id="XP_022673709.1"
                     /db_xref="GeneID:34713854"
                     /translation="MDPHTPIVLDQGTGFLKIGRAGENFPDFTFPSIVGRPILRAEER
                     GHVSTPLKDIMIGDEASAVRSYLQISYPMENGIIRNWADMELLWDYAFFDQMKLPTTS
                     GGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSGVVVDSGD
                     GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQMKEK
                     LCYVSYDLDLDTKLARETTTLVESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPG
                     VGELLFNTIQSADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPT
                     RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWHEIGPAAMSKFGPR"
     gene            complement(<365652..>366785)
                     /locus_tag="KLMA_10174"
                     /db_xref="GeneID:34713855"
     mRNA            complement(<365652..>366785)
                     /locus_tag="KLMA_10174"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818585.1"
                     /db_xref="GeneID:34713855"
     CDS             complement(365652..366785)
                     /locus_tag="KLMA_10174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673710.1"
                     /db_xref="GeneID:34713855"
                     /translation="MFLPQKSLLRVPGDGLFKGIAALKRPMIVKASPQLCLPIALCNQ
                     KHTRNAFHTSAYPLVLQKTSFHKPVGSLLTNRLSLRLCLRQGSRKFHSAPRRQFLGGR
                     DPFNSGDRHYKFSFSFDTWGLVVAGIVLIVTTSIFLMVLPYLFVVLFPFIIAAIAFYG
                     IKSYVLKLEFSKIRDALSRSSMKLSAATRKQLLYKEISPHMESLKEMLDKKASKVPPG
                     FFDSFKDQMDNYDLHKADRFLEFLSSRIDESLCKNENNIRSIILGKDSVYRPDMVKLF
                     EESHKIMTLYGTGNDSYELHIFKLMLEDDSVEAKPIGLVLVVAAVKQENFEMLGPMFK
                     FLNVKDTQEASPMVIAVKNIDFIPKIGFITDIGETGRGGTDHN"
     gene            complement(<367230..>368675)
                     /gene="APM4"
                     /locus_tag="KLMA_10175"
                     /db_xref="GeneID:34713856"
     mRNA            complement(<367230..>368675)
                     /gene="APM4"
                     /locus_tag="KLMA_10175"
                     /product="AP-2 complex subunit mu"
                     /transcript_id="XM_022818596.1"
                     /db_xref="GeneID:34713856"
     CDS             complement(367230..368675)
                     /gene="APM4"
                     /locus_tag="KLMA_10175"
                     /codon_start=1
                     /product="AP-2 complex subunit mu"
                     /protein_id="XP_022673711.1"
                     /db_xref="GeneID:34713856"
                     /translation="MINALFVFSANGELLVCKLIKDHIKRSISDVFKTQVINDPHVRS
                     PILTLGSTTFHHIIREGANSLPMWLVAVSRGNVDSSMIWEYLNKLYQLMEVYGINDED
                     VLREEFMVLYEILDITLENGIPQTTDLAQIVPRVSKKPVNDANASFKPSDIDDFLSNS
                     NILRSSRLIKRASSSMALSTLPECPWRPDGLRYKKNEVYLDINENISLLVGKDGSIIK
                     SYVEGSVDCVSHLSGMPVCELGLNDSYQSNSSNNFTDSDTEQSLMEMMVEYDVKNKKA
                     IPNAAAKSVPLQDCQFHQCVQLARYETDHVIRFVPPDGSFQLMKYRVADNINIPFSVL
                     PSVEIVNQSTVYYKITLRSLFPSNVIAKDVTMKIPVPQTTLKCDFYVSGGRCQYDSTE
                     KCIVWKYSKYNGSTESTITAKAIIPSTSHDLADLLRWSRPPISLKFEIVMFSNSGLVV
                     KHLKCQEPQLNYQPVKWIKYISHSGAYEIRY"
     gene            <369370..>370851
                     /gene="PRS5"
                     /locus_tag="KLMA_10176"
                     /db_xref="GeneID:34713857"
     mRNA            <369370..>370851
                     /gene="PRS5"
                     /locus_tag="KLMA_10176"
                     /product="ribose-phosphate pyrophosphokinase 5"
                     /transcript_id="XM_022818607.1"
                     /db_xref="GeneID:34713857"
     CDS             369370..370851
                     /gene="PRS5"
                     /locus_tag="KLMA_10176"
                     /codon_start=1
                     /product="ribose-phosphate pyrophosphokinase 5"
                     /protein_id="XP_022673712.1"
                     /db_xref="GeneID:34713857"
                     /translation="MNNIVVFGGSSHPDLVDKICEKLGIHKSQVKLGKFSNGETSISI
                     EESVREKDVYVIQSGCGHVNDNFMELLILINACKTADASRVTAVMPYFSYSRQPDIPY
                     TAKGAPLISKPKEKYTFESHPGTPVERKPVDRKRAEKKPLQKQQQQQEQQELQQELQQ
                     QQQQQQTEEHQEEPASVLKQQEIALPSPLPIRPAELRPCSSASSRIPMIPNGKAEHPS
                     EQDDTSNADTLFNASNSSYKLWVAQAGTLIANLLMTSGADHVITMDLHDSQFQGFFDI
                     PVDNLYCKPITQTYIQHHIPDYKDAVIVSPDAGGAKRAAKIADVLELSFAMIHKERRS
                     QLLKGPPGATLTSGGGIPVSSKPLIGSLDMKHNPSMGSNKYVNTTMLVGDVRNKACII
                     VDDLVDTSYTLTRAAKLLKDQGATKIYALITHGIFSGDALNRIDQSVIDKLIVTNSIP
                     QDETIKALGRDRVEVLDVSSIFAEAIRRIHNGESISILFEHGW"
     gene            complement(<371100..>372962)
                     /gene="RTK1"
                     /locus_tag="KLMA_10177"
                     /db_xref="GeneID:34713858"
     mRNA            complement(<371100..>372962)
                     /gene="RTK1"
                     /locus_tag="KLMA_10177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818618.1"
                     /db_xref="GeneID:34713858"
     CDS             complement(371100..372962)
                     /gene="RTK1"
                     /locus_tag="KLMA_10177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673713.1"
                     /db_xref="GeneID:34713858"
                     /translation="MPENQLSAQSSHEIHSVKSESSSGTFFSKGRIRNKSKNALGRLF
                     RNGNGSSANTPGIGNSNDSGSEGSVASEKYVTAPVAEEVSPPGLSNVKRGNHLHNPNN
                     YHHHSGGSSNSQPHPSRQDLHQHDERKLGAHRVEQPSKEGSPVTSSALTSSQSHPVLS
                     QHRTNDSGKPGLRSQHSTVTLDTSPQPNQHPAEYLQRQIEQFKLQPPPKLSSAGDNSS
                     NGSAAGGKVHHKKSLRLKRFFKLHEQNADHHHGHQGAQKPMDKLPQSNATAVVTDRKT
                     TKLTLYDADDAHELIQKYGIPGKLLGEGVSGSVSVVKGSDNTMFAVKKFRPRAAKESL
                     LDYSKKVTSEFCVGSFLHHHNVIETLDMLQEGEDFLVVMEYCPYDFFTLVMSDLMGKH
                     EIACYFKQICNGVAYLHSQGLAHRDLKLDNCVVNAQGILKLIDFGSATIFHYKYEDKI
                     VKAKGIVGSDPYLAPELLINQYYDPRPVDVWSIAVMFYCMTLRRFPWKKPSEDVVSFK
                     LFAQKPDDENDHSKGPYRILKLLPRHSRPLIGRMLELNPHKRILMPEVLTDHWFQNIQ
                     FCDVDNQGNLIQLPTNHKHHLVTEEELKELNEKREKEAEERRKAEELKQNTTHE"
     gene            complement(<373571..>375796)
                     /gene="MAM3"
                     /locus_tag="KLMA_10178"
                     /db_xref="GeneID:34713859"
     mRNA            complement(<373571..>375796)
                     /gene="MAM3"
                     /locus_tag="KLMA_10178"
                     /product="protein MAM3"
                     /transcript_id="XM_022818629.1"
                     /db_xref="GeneID:34713859"
     CDS             complement(373571..375796)
                     /gene="MAM3"
                     /locus_tag="KLMA_10178"
                     /codon_start=1
                     /product="protein MAM3"
                     /protein_id="XP_022673714.1"
                     /db_xref="GeneID:34713859"
                     /translation="MALVRHTALLLMVPRIFALPIFRRSVVSVLQKEQPPVEDEAAFT
                     TFLVISIMLVLLGGIFAGLTLGLMGQDEVYLRVMQNSGTPKEKYHANRVLDLLGKGKH
                     WVLVTLLLSNVITNETLPIVLDRILGGGWQAVVMSTVSIVIFGEIIPQSICVRFGLQV
                     GSLFSPFVLFLMYAMYPVAYPIALLLDWMLGEDHGTMYKKSGLKTLVHLHRTMGMERL
                     TMDEVTIISAVLDLKEKKVSEIMTPIDAVFTLSADKILDEKTVEDIFNSGFSRIPIYL
                     PGQPTNFIGMLLVRVLISYDPDDCLPVSHFPLATLPETAPQTSCLNILNYFQEGKSHM
                     CVVSRDPGSSVGAIGLVTLEDVIEELIGEEIVDESDVFVDIHQRIMRDQPGPLSKRHI
                     TSYLHALYTRKPSESEPLINTSSRDSKSSAIIAGGAAGPGPSNTQDQDQGQGQGQSQS
                     QGKGHGQGQSQTTNYLTLGATTNFQPANPAANPLDVKKPFVTIKRQNYGGMSKTPPRT
                     SPELPSDSPMPKSPSPSRNGAASNQKSGANSGVDPNASPFSSAAKNTDHAAKNDKQDQ
                     HSVSPRSHDRLITTIPAKTKNDHPTVISSSYKSTKNGIVESIITVKGVSKTIIEPASD
                     WDDSKNVTINETGNIEEVNSEVSSLNSNQTKSNSNSDRHSHGHGHGHVNANANANGNV
                     NGNGSKNNHAGTPLSSSSRRGSRFSLWSSKSSSHHDDSTAPAPPSKSQESFLLESRSK
                     H"
     gene            <378475..>379641
                     /gene="GPD1"
                     /locus_tag="KLMA_10179"
                     /db_xref="GeneID:34713860"
     mRNA            <378475..>379641
                     /gene="GPD1"
                     /locus_tag="KLMA_10179"
                     /product="glycerol-3-phosphate dehydrogenase [NAD+] 1"
                     /transcript_id="XM_022818640.1"
                     /db_xref="GeneID:34713860"
     CDS             378475..379641
                     /gene="GPD1"
                     /locus_tag="KLMA_10179"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase [NAD+] 1"
                     /protein_id="XP_022673715.1"
                     /db_xref="GeneID:34713860"
                     /translation="MSPASDRLKQTSSILSKSVEPKADSPFKVTVIGSGNWGTTIAKV
                     VAENCALRPNLFVKRVDMWVFEEQIDGEKLTEIINTRHENVKYLPGIKLPNNLVANPD
                     IVDAAKDADILVFNIPHQFLPKVCSQLKGKIKPQARAISCLKGFDVGKDGVKLLSTYI
                     KDTLNIECGALSGANLAPEVAKENWSETTVAYQIPEDYKGAGKDVDHSLLKALFHRPY
                     FHVNVIHDVAGISVAGALKNVIALGCGYVEGLGWGNNASAAIQRVGLSEMITFGRMFF
                     PECRVETFYKESAGVADLITTCAGGRNVRVAKHMAITGKSALEAEKELLNGQSAQGII
                     TTKEVHEWLETCGKINEFPLFEAIYQITYGNASMEQIPEMIEELECIDYNVKKH"
     gene            <381233..>382495
                     /gene="ARG1"
                     /locus_tag="KLMA_10180"
                     /db_xref="GeneID:34713861"
     mRNA            <381233..>382495
                     /gene="ARG1"
                     /locus_tag="KLMA_10180"
                     /product="argininosuccinate synthase"
                     /transcript_id="XM_022818651.1"
                     /db_xref="GeneID:34713861"
     CDS             381233..382495
                     /gene="ARG1"
                     /locus_tag="KLMA_10180"
                     /codon_start=1
                     /product="argininosuccinate synthase"
                     /protein_id="XP_022673716.1"
                     /db_xref="GeneID:34713861"
                     /translation="MSKGKVCLAYSGGLDTSVILAWLLEQGYEVVAFMANVGQEEDFE
                     AAEKKALLVGATKFVLVDCREEFVKDVLFPAVQVNAVYEDVYLLGTSLARPVIAKAQI
                     DVAKQEGCFAVAHGCTGKGNDQIRFELGFYALKPDVKVIAPWRDPSFFNRFAGRKDLL
                     AYAAEKNIPVVQTASKPWSTDENLAHISYEAGILEDPDQTPPKDMWKLITDPQDAPDQ
                     PQDLDIVFEKGLPVKLTYKDAESGKEITATTPLDIFLTAAKLARANGVGRIDIVENRY
                     INLKSRGCYEQAPLSVLRRAHVDLEGLTLDKEVRHLRDQFVTPTYSRLLYNGSYFTPE
                     CEYVRSMIQPSQNTVNGTVRLSLYKGNIIVLGRYSTTENLYNADESSMDMLTGFEPTD
                     TTGFIAIQAIRVKKYGQSKADKGEELTL"
     gene            <383542..>385554
                     /locus_tag="KLMA_10181"
                     /db_xref="GeneID:34713862"
     mRNA            <383542..>385554
                     /locus_tag="KLMA_10181"
                     /product="probable dipeptidyl-peptidase 3"
                     /transcript_id="XM_022818662.1"
                     /db_xref="GeneID:34713862"
     CDS             383542..385554
                     /locus_tag="KLMA_10181"
                     /codon_start=1
                     /product="probable dipeptidyl-peptidase 3"
                     /protein_id="XP_022673717.1"
                     /db_xref="GeneID:34713862"
                     /translation="MAFADREAPIQMLSAKKYFENLTSKEQHYAHYMSKASHAGSRIT
                     MRQVSPYSEKIFDTVMGIHKGLKEYPKDEETAQYLEYVTQFLSNLGEFKSFGDVKFIP
                     RCPKSTFEKLGQLANVPVDSSLLDEIYHDGDASALLGFPSQGHTTGYYRGPEKVTPED
                     MVLLKKIFADFDIMPENLTIEKLSHKLFEVHVASASTAHAKGYPDRIEEEGIEVLFKF
                     GEHSTEMEKIAQYLAKAKEYAANETQEKMLEHYVNYFKTGDSKLHKESQKVWVKDLSP
                     QVETNIGFIETYREPSGIIGEYESLVAIQNKERTEKFTELVNKAPAYINLLPWDPAFE
                     KPKFQPPDFTSIEVLTFTGSGIPAGINIPNYDDVRLNVGFKNVSLGNILNSKTSNDKW
                     TFVQGDDVETMSKYQSDSFEVQVGIHELLGHGSGKLLCELDDGTFNFNKSSPPIGLDG
                     KPVTTYYKKGETWGSKFGAIAGAYEECRAESIAMYLITNRQLLETFGFKTKEEQDKII
                     YTGFLQMCRAGLLALEFWDPASKKWGQPHMQARFSIMKTLLRYSSDKNFVKLAYTQDD
                     YSDLHIELDGSLIETVGHAAIEDYLTHLHIYKSSGDVENGAAYFKDRSDVDEELAKFR
                     DVVLAKKLPRKQFIQANTVIDGDKVIVKEYEESPIGMIQSFVERDL"
     gene            <385961..>386824
                     /gene="GPM3"
                     /locus_tag="KLMA_10182"
                     /db_xref="GeneID:34713863"
     mRNA            <385961..>386824
                     /gene="GPM3"
                     /locus_tag="KLMA_10182"
                     /product="phosphoglycerate mutase 3"
                     /transcript_id="XM_022818673.1"
                     /db_xref="GeneID:34713863"
     CDS             385961..386824
                     /gene="GPM3"
                     /locus_tag="KLMA_10182"
                     /codon_start=1
                     /product="phosphoglycerate mutase 3"
                     /protein_id="XP_022673718.1"
                     /db_xref="GeneID:34713863"
                     /translation="MRLYALRHGQSEVNSKNIFGGWIDVHLTEKGLKQAKNSAVLIKE
                     HCEKNGLELPKVGYTSRLVRTEETMREILKEFGKDPEFHIVSGPEPPKVEHLDNGKFE
                     VYQSWRLNERHYGSWQGQSKHKMMEEVGAEQYMYIRRDYFGKPPQADLTKEMVQNFDQ
                     GDTGYEFKEPNRHEKYLQEELSHDDLPNGESLYDVVQRVNPLLEKLILPNLKKFGDGI
                     IVGHGSTVRSLLKILEGVSDSDIKDVNIPNAIPLVIELDEDFKFVRKYYLDPESAKVN
                     AELVRKEGLKE"
     gene            complement(<387151..>389007)
                     /gene="RPN4"
                     /locus_tag="KLMA_10183"
                     /db_xref="GeneID:34713864"
     mRNA            complement(<387151..>389007)
                     /gene="RPN4"
                     /locus_tag="KLMA_10183"
                     /product="zinc finger protein"
                     /transcript_id="XM_022818684.1"
                     /db_xref="GeneID:34713864"
     CDS             complement(387151..389007)
                     /gene="RPN4"
                     /locus_tag="KLMA_10183"
                     /note="C2H2-type"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_022673719.1"
                     /db_xref="GeneID:34713864"
                     /translation="MSAADFELRRTLTDVLDDEMRIMSANPLDLDMAFGENHHDSFPQ
                     LTRSQVNSFYGTSSFNFGSMAGQGQGQGQGQGQGQGQSQGLNLSQSQAPVSLQGGFEQ
                     NSFDEDVAKDVAKDVSKEDAGSGLLSGSMFNKYADPNLTTLDKKHSSGESGNNGGSAA
                     IVKQINLNLTPVQPTISLNTITPNPFLNSLNRFANTSQQGDGSTANYFTGAGSGLSNS
                     RLNNGCGFNLQTRINRENVFEDEFYDESFADLDNMYEDDEKLNAQTALLDDQNVSGYH
                     WTVDQDALSRFDQEFNFDDDISDEEEDDDEQYEYHGFGNKTLPDNDANATIVDDFVSG
                     KNSIKANEDSLFMDTQRSKDSQIKTLMQGEDNLSIPSTSLVNPQEQYQNQNQDDHEQE
                     EEEDEDEDDAMFSEDEEDPLYEPALVSPRRKPSMVVSDPNGTSKQRQLLASGARKASS
                     VTPQTSTATTTTTTTITTTTSSQKVPTVVSSITTRNKGHQRGKSVDSSTALDSHNHQT
                     ISHSHNRNASHSNTDEHFCMAINPVTKEPCMKKFSRPYDLIRHQNTIHASKKKIFRCL
                     ICIHELGSEGYQRTFSRNDALSRHVKVKHNLQGSEAQRVIQYAKDNVEYQTS"
     gene            <390397..>391626
                     /gene="och1"
                     /locus_tag="KLMA_10184"
                     /db_xref="GeneID:34713865"
     mRNA            <390397..>391626
                     /gene="och1"
                     /locus_tag="KLMA_10184"
                     /product="initiation-specific
                     alpha-1,6-mannosyltransferase"
                     /transcript_id="XM_022818696.1"
                     /db_xref="GeneID:34713865"
     CDS             390397..391626
                     /gene="och1"
                     /locus_tag="KLMA_10184"
                     /codon_start=1
                     /product="initiation-specific
                     alpha-1,6-mannosyltransferase"
                     /protein_id="XP_022673720.1"
                     /db_xref="GeneID:34713865"
                     /translation="MRHVRSRTALALGAVLITVFVFLSQHHTILKPINVGSQQPANRP
                     TVPADWSPGSLRDRLLQAYKPDPESTGIPKDIWQSWKSKDNLDKNFQENVRLWSAQQG
                     FTHHFLDDEEVDSFVRSEFKQFPEIIAAWDILPRKILKADYFRYLILLANGGFYSDID
                     TSPTLDLNQWLTEAPLASLMTANSFPKNNIGVIIGIEEEMDLATWRGLLNRRINLCQW
                     TFASRKGHPLFVDIVAKIADLALHYYDSNTNVITFPMGYKNLFNMQPAYNMSEGSPNW
                     YEGIIEWTGPASFTDSFFETTNMWYIENFKDHLQGTGDEVLCNSENVCIIDPNKPLNL
                     VSKLNFYPIGDNLQGFKPHLHPIGWENLTLLEYPLLYGEVAFLPKHFFNSLYTTDDKK
                     GYIHHAFTGTWKWSKDP"
     gene            complement(<391816..>395346)
                     /gene="OSH2"
                     /locus_tag="KLMA_10185"
                     /db_xref="GeneID:34713866"
     mRNA            complement(<391816..>395346)
                     /gene="OSH2"
                     /locus_tag="KLMA_10185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818707.1"
                     /db_xref="GeneID:34713866"
     CDS             complement(391816..395346)
                     /gene="OSH2"
                     /locus_tag="KLMA_10185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673721.1"
                     /db_xref="GeneID:34713866"
                     /translation="MSPVALIKEIVENWTKKNAENPDLFLDINKQDQDGNTPLHLAAF
                     QSRGDVVTLLMAHPDINDCILNDAHLQPIEMCKNLNIVQMMQVARANYVAEIAQEFRQ
                     AFNNRDIDHLNSILANPRNQELLDINGMEPETGDTVLHEFVKKRDILLCRWILDHGGD
                     PFKRDSRGKLPIDLLRKVSSKDQSDKKNAIDLELKRMLEKAAREQSVIDVTNNLHEPP
                     SYKGYLRKWTNFAQGYKLRWFILSSDGILSYYKDQADTSNACRGSLNMSTCYLHLDSS
                     EKLKFEIIGGSNGTIRWHLKGNHPIETNKWVWAIQSAIRFAKDREIMVKNGHTPNNAG
                     SHEKGLENGAPASMHSLHSYENRVQHCRNGSSASSISSAELIELNSNLTESGKNFVSK
                     VKNSRNTASNSSPLDSIADDQTMSIASGQDTKTDSAKYKVDRSPSANSQEFEGEQDFD
                     HEDEEYDDEAEDEEMLEELEEGDEDVKAVYGPYAQQIGILQRTISIELSSLIELINEN
                     NSSEDYIQTARKSLEFIVKNFSDLNQMSQTRDKKLIKMLSKQRDINNLWIKSVKDLEL
                     ELLEKGEKLVSLDVERKNLKKLLQKKLSEVHTGDLKSDSNLGGEKYIDSAQPLQEIVE
                     FIENQESDADIDSEADEFFDAEDIDEEEEDETKPLVEENDDSKGNKSVVATDLSTNNA
                     FINPAAKESISNEGNNVKSLEQTTLDSKTLDSTTVDSNAPLSEVGKVDSKTTNIVSLP
                     LVANELQSSKAKQLLEEGTFLGYEDGLRQRLTLGKDNRPHVSLWSVLKSMVGKDMTRM
                     TLPVSFNEPTSLLQRVTEDLEYADLLNEAASFDDSTLRLLYVSIFTVSSYASTVKRVA
                     KPFNPLLGETFEYARPDKSYRFFTEQVSHHPPISATWTESPKWDFFGESYVDSKFNGR
                     SFDFKHLGLWYMTLRPDCGDKPELYTYKKPNNQVVGILLGNPQVDNYGDVKIVNHTTG
                     DYSLIHFKARGWRSSNAYEVKGEVYNAKGGKEWIFGGHWNESVSAKKVLKPNSPEEMQ
                     LDELKRSKTNSTNSNSTKPKYDGTRFNVWHVNERPDLPFNLTKFAVTLNAPQPHLLPW
                     LPPTDTRLRPDQRAMEEGLYDQAASEKHRVEEKQRAAKKKRDEKHIQYKQRWFTKEIH
                     PVTKKEYWKFNGEYWRLRREHKLANEGDIF"
     gene            complement(<396076..>398172)
                     /gene="YAT1"
                     /locus_tag="KLMA_10186"
                     /db_xref="GeneID:34713867"
     mRNA            complement(<396076..>398172)
                     /gene="YAT1"
                     /locus_tag="KLMA_10186"
                     /product="putative mitochondrial carnitine
                     O-acetyltransferase"
                     /transcript_id="XM_022818718.1"
                     /db_xref="GeneID:34713867"
     CDS             complement(396076..398172)
                     /gene="YAT1"
                     /locus_tag="KLMA_10186"
                     /codon_start=1
                     /product="putative mitochondrial carnitine
                     O-acetyltransferase"
                     /protein_id="XP_022673722.1"
                     /db_xref="GeneID:34713867"
                     /translation="MPSIRDAGTQVLPRLPIPPLEDTLKRYLARLQPLQDRRSFERTQ
                     QAVENSQEVLRILDKELREYDEQLAQREPMSSYIEQFWFDSYLEYDESVVLNLNPYFQ
                     LADDPTMNNVPKVSTRFSHFNRQVKRTSKLVVSMLKFVKAIRTGTLPTDNVRGKPMTM
                     DQYWKLFGSARIPPSSNEPTPSCHLQTDPTSHHVVVMYKSQFYWFDVLDINNEPIFQQ
                     PEELEWNLYSIIMDGEQREETDQNLQALCPMGVFTTENRSVWSNVRDYISKADDPTNA
                     RNLKIIDSALFVICLDNSDLEDERDWIKSMICGTSKIDLNDNDESKIKPSLGLQTGTC
                     TNRWYDKLQLIVDRSGRAGINFEHTGVDGHTVLRMTMDIYTDSIVNFAQGITRNVPKV
                     FEDAEETTTSHRQAKLSYMSKQANLITIPRKLEWSVDSFILSSLHFAETRVSDLISQI
                     EFEYLDFKQFGAAHIKSQFKCSPDAFLQMCFQTAYYALYARFETTYEPAMTKFFQNGR
                     TEAIRTVSEQSKTFVKSFFDSTVPNPIKLKNLQEACAQHSTVTKECSMGLGQDRHLYA
                     LYCIWKKVFANNPNIPLPELFQDAGWSKINTNVLSTSNCGNPCLKNFGFGPVCSNGFG
                     IGYIIRNDSLSVVVSSRHRQTARFVELMQRFLLEIDRMSHKGESSSTTTMGTLQSDNM
                     KYLLSGYDYFDVSVTG"
     gene            <398439..>400946
                     /gene="CDC15"
                     /locus_tag="KLMA_10187"
                     /db_xref="GeneID:34713868"
     mRNA            <398439..>400946
                     /gene="CDC15"
                     /locus_tag="KLMA_10187"
                     /product="cell division control protein 15"
                     /transcript_id="XM_022818729.1"
                     /db_xref="GeneID:34713868"
     CDS             398439..400946
                     /gene="CDC15"
                     /locus_tag="KLMA_10187"
                     /codon_start=1
                     /product="cell division control protein 15"
                     /protein_id="XP_022673723.1"
                     /db_xref="GeneID:34713868"
                     /translation="MTNFSAESLWMTTNGDKKKSVDKEKFKGRYQDGMDGSIVHGTYA
                     LKQVIGRGAYGVVYRAVKRGSSKPVAIKQIEFEDESELNEHMLEIDLLKNLRHENIVE
                     YRGFIQKAHELYIILEYCSRGSLRDLLKQGPLLEEDTVNYVRQTLQGLQYLHEQGVIH
                     RDIKAANLLLTEDGVVKLADFGVSTRINRMAMTYAGSPNWMAPEVMTGQGASTVSDIW
                     SLGATVVELLTGNPPFHNLVNESACYAIVNEEYIPPLTLSAGCQEFLSQCFQKNMFKR
                     ATAPELLQHPWLQQENFQKQRSKINLAEYIEKDDKWDADFVLDSDTDMTPSPTKVTEK
                     LRKLQGEDFRTLSVDELFIDHSLDAITAQLLQSLLELQAETTKNKRKNDNFNAIKNRA
                     YEIFKYDKQFNHSSLKEKFVDTGGVSLLISLQFESLLSTFFDKSIKLLIQCGILFHMN
                     TLRDSRLVVLVSYGYRALTSPEIWNEWCLKHKKKISECINTELGSTKYIEAEKLLIHV
                     SLLKDFPLDISRLMLYAKKYKHLQHCIYTCLNNSIKRSISNIPTSNMIHGKLVYEKSN
                     FPSHVMEWLLEMIPVLKKRAIEPFVELCFHVCHLNNKSIAELMRDGQFFSLTKSLLQS
                     SNNNCLPWCLNLCSEYAKDLKQDNIGTMLDIGMSSLTVGHCLHNSIEIILNCVNVAQL
                     NHLEISLSADNIIIGDCSIPLQNLVESFYQDNGRYDKFITKFTKLCSLPIGSQICIGV
                     FEQERFVGRIYELFDRFKTSLIIQIDLLKFLKVLVIQINDKNKMSQPDKRKKLLKFLS
                     HNWNTTDSVTPIKQTQQRVGADSVLIQQLCQDIENLI"
     gene            <401150..>402361
                     /gene="KIN3"
                     /locus_tag="KLMA_10188"
                     /db_xref="GeneID:34713869"
     mRNA            <401150..>402361
                     /gene="KIN3"
                     /locus_tag="KLMA_10188"
                     /product="serine/threonine-protein kinase KIN3"
                     /transcript_id="XM_022818740.1"
                     /db_xref="GeneID:34713869"
     CDS             401150..402361
                     /gene="KIN3"
                     /locus_tag="KLMA_10188"
                     /codon_start=1
                     /product="serine/threonine-protein kinase KIN3"
                     /protein_id="XP_022673724.1"
                     /db_xref="GeneID:34713869"
                     /translation="MNRNERQPSYRLLEEIGRGSFGSVRKVVRETDNKVLVRKEIRYG
                     HMNSKERQQLIAECSILSQLKHDNIVEFFHWDHDATSNTLFLYMEYCSKGDLSQMIKY
                     YKRQRKYVPESNVWRIMVQILMALFKCHYGRDLPKLQTVHDEIEEPSKSKGNVVIHRD
                     LKPGNVFLTGYDDEFNQNASNVDYGKVIIKLGDFGLAKSLQSSIEFATTYVGTPYYMS
                     PEVLRDQPYSPLSDIWSLGCILYEICALHVPFQAKTYTELQSKIKSGLYEPLPQFYSS
                     SLKEMISKCIQVDFTRRPSTWTLLNDIQCRITRKALDLEKFERHLLNYEHELTQIGEM
                     LEQHATEMKRDFNTAVEQRVREILNGNTKTNSSPGPGGAPMITGAGHVNMNMPMRTPF
                     RNPANINRNYR"
     gene            complement(<402447..>403364)
                     /gene="ADE1"
                     /locus_tag="KLMA_10189"
                     /db_xref="GeneID:34713870"
     mRNA            complement(<402447..>403364)
                     /gene="ADE1"
                     /locus_tag="KLMA_10189"
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase"
                     /transcript_id="XM_022818751.1"
                     /db_xref="GeneID:34713870"
     CDS             complement(402447..403364)
                     /gene="ADE1"
                     /locus_tag="KLMA_10189"
                     /codon_start=1
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase"
                     /protein_id="XP_022673725.1"
                     /db_xref="GeneID:34713870"
                     /translation="MTTETNLDGILPLVARGKVRDIYQVDDQTLLFVATDRISAYDVI
                     MKNAIPEKGILLTKLSEFWFNFLKDDVRNHLKPLGAGKTIFDYLPSKLSEEKYKSQLE
                     GRSLLVQKHKLIPLEVIVRGFITGSAWKEYKQKGTVHGLPQPEGLLESQEFPKPIFTP
                     STKAEQGEHDENISPEQAAQLVGQELCDRIEVLAIKLYTKCKEFAKSRGIIIADTKFE
                     FGIDESTNEIILVDEVLTPDSSRFWSGKNYEVGKSQDSYDKQFLRNWLTENKLAGVDG
                     VEMPQDIAERTRAKYIEAFEQITGEKWSN"
     gene            <405041..>407200
                     /gene="BUD14"
                     /locus_tag="KLMA_10190"
                     /db_xref="GeneID:34713871"
     mRNA            <405041..>407200
                     /gene="BUD14"
                     /locus_tag="KLMA_10190"
                     /product="bud site selection protein 14"
                     /transcript_id="XM_022818762.1"
                     /db_xref="GeneID:34713871"
     CDS             405041..407200
                     /gene="BUD14"
                     /locus_tag="KLMA_10190"
                     /codon_start=1
                     /product="bud site selection protein 14"
                     /protein_id="XP_022673726.1"
                     /db_xref="GeneID:34713871"
                     /translation="MELEYARMTGLTGLGGSTEGHEKPRPDLSILTDPTLVEDYEEIM
                     KSMPRTKKDEELHSVNASVVITPTEARAGNGLGNVLGNGLRETTSEDEKDEKGQQLEL
                     EQPVEVTHHNEDAKLQEDEEGVDAGDVDNSFSSLHANDQQDSDYAYSDSDFEDNLEER
                     LRSLDTTYARKEVDDRDHDASSAGVDLDAKTQMTRRLDAEPQMHDVSSDYDEDEDEEE
                     EEDGLTLGLTGNNSDEDEDDDFQPLKPPQELDPNKLYALYPFQGPDPSHCQLEQDESC
                     TLLNDQDAYWWLVKRCSDGKIGFAPAELLETFPERLARLNCWKNENMSSQSISHINEE
                     STSSTDFTDREKGSQGSQGSHRSVSPPLNSYSKTNKSVSFNNVVSYAERYIEEVERHS
                     EEENELLEDGKEDDNDSGEINGNEVVNTSETDKSQPGNLTSFIKHVDEVHQTHLNDQG
                     LDDVSEVVSDAAFNVHEMAPLMVQKNRPATRSPPAEAEKTTDLRQVFQAPIMPVAASK
                     GSSAQMSNSNSNCSISTIGEYSPSSSEFTNDSPQLPNEDEFKSNKASDQIPSSRAIQD
                     ISRIVGSPENVSSPGSVYSEQGQEHEREDEEAVPDISHPRSMTHSYKTSISTLTAADS
                     SSVEEDNINNSSVGTSNTNNNTNHNESTNNISTVPSSTASSYMDHQHSSPSFSDLTLH
                     TNTPSTRDFHPMINTLYNPIFSKIDIMMEKIERAISQ"
     gene            <407542..>410208
                     /gene="KAP104"
                     /locus_tag="KLMA_10191"
                     /db_xref="GeneID:34713872"
     mRNA            <407542..>410208
                     /gene="KAP104"
                     /locus_tag="KLMA_10191"
                     /product="importin subunit beta-2"
                     /transcript_id="XM_022818773.1"
                     /db_xref="GeneID:34713872"
     CDS             407542..410208
                     /gene="KAP104"
                     /locus_tag="KLMA_10191"
                     /codon_start=1
                     /product="importin subunit beta-2"
                     /protein_id="XP_022673727.1"
                     /db_xref="GeneID:34713872"
                     /translation="MQWSPDNEGLSQLCLILQHAVSADHNERQQALDALETFKLQPQF
                     ANYLCYILLHLEEMDQLRGTAGILLKNCILGGNVVDLEYVKSEIVRGLCLDNNFIVKI
                     TGIVIAALYSTYYRQHREDPQGLITLGQLIELARDNNEGSMKALSKMMEDGAQFFQLE
                     WANHQTPIGELISTFLYLMTEGKTPVVRAESINCLNNIIPLQCQELLVKLDDLLKNIF
                     SLASTESSHLVRQNLCQCLTLILEFRPDKLMAHLPGIIQFMGHIIVNTNRDNDDEEKV
                     ALEACEFLLALVSNANVPDHLIQPYVKEFVPLLLNNMVYSNDEIIVLEASNEDDAESE
                     DKDEDIKPVSAKIQKKNGENDEQNEDDDTDEDGEVDNEWSLRKCAASVLDLLTGLFPK
                     EVIESALPLLREHLTSNSWFVREATTLALGAMAEGGMKYFDSQLPALIPFLVEQLKSP
                     WFPVRRMTCWTLSRFSTWILDDHTEFLIPVIEPIMQTLLDKKKDVQEAAITAIATFIE
                     NCDSDIVSTILYEPLLNKFDECFKFYKKKNLIILYDAVSRLSEKCDLEEQALNKLLPH
                     LLSKWSALDDNDKELWPLLECLSYVSTSLGTKFAPMAMEVYQRAFSILCRCVELEQKS
                     QTDPTIVVPEKDFIITSLDLIDGLVQGLGYDSKALLFPNHDMTMFAVLLQTLQDHNHE
                     VRQSAYALLGDISYFYEKQLFTEDLTKSFVEAIGNELIQNAENQEAVSTVNNAVWCLG
                     LIAHKIDLGPHIIEISRIVLDLFCSTQLILQSSVMENLCITIASLAHFHPEVFTQLPF
                     ATETQWNKWCRLASELTDPEEKTVSYAGFIKIMNLVDFNTQGMPSDKTWELFFHGLQQ
                     DVDISIMSDDLYALAMRLPDHWNQLLLGSGMF"
     gene            <410841..>412439
                     /gene="DAL1"
                     /locus_tag="KLMA_10192"
                     /db_xref="GeneID:34713873"
     mRNA            <410841..>412439
                     /gene="DAL1"
                     /locus_tag="KLMA_10192"
                     /product="allantoinase"
                     /transcript_id="XM_022818784.1"
                     /db_xref="GeneID:34713873"
     CDS             410841..412439
                     /gene="DAL1"
                     /locus_tag="KLMA_10192"
                     /codon_start=1
                     /product="allantoinase"
                     /protein_id="XP_022673728.1"
                     /db_xref="GeneID:34713873"
                     /translation="MPRAIASNHVALYGEIVPGTIIYDVDSGKILDIICGKVASRNHL
                     AGLGWEVDTYEIVSPYLIMPGLVDSHVHLNEPGRTEWEGFETGTKAAVSGGVTTVIDM
                     PLNAIPPTVNVENFKLKLAAAEGQLWCDVGFWGGLVPDNLKDLKPLIDAGVRGFKGFL
                     IDSGVDEFPAIDKKYIQDALDLLQGEKTMIMFHAELQATEPGHEHSIVDYNGDIMADE
                     SDNALSRVKSLSAVEPKYGQVSELIQHHNIHPNDAEITPLEAAKVEISDDSLANVDPR
                     AYKNFLLSRPDHFETNAIALVIHCLEKAVQKYGIANMPLLHIVHLASMEAVPILQNAK
                     EKGYPITAETCFHYLSLAAENIPESKTFYKCCPPIRSEENRQSLWKALREGILTSVVS
                     DHSPCTPELKNLAKGDFFSAWGGIASVGLGLPLLYTHGASIQEIISWCCENTSKQVGL
                     DHMKGYLKPGYDADFVVFDMYSTQTISNEKVFFKNKLTAYDGTNLKGIVKYTYVRGNL
                     MFQYGGAGHNKTPLGRTILERRSS"
     gene            complement(<412519..>413148)
                     /gene="ERP3"
                     /locus_tag="KLMA_10194"
                     /db_xref="GeneID:34713874"
     mRNA            complement(<412519..>413148)
                     /gene="ERP3"
                     /locus_tag="KLMA_10194"
                     /product="protein ERP3"
                     /transcript_id="XM_022818795.1"
                     /db_xref="GeneID:34713874"
     CDS             complement(412519..413148)
                     /gene="ERP3"
                     /locus_tag="KLMA_10194"
                     /codon_start=1
                     /product="protein ERP3"
                     /protein_id="XP_022673729.1"
                     /db_xref="GeneID:34713874"
                     /translation="MRLLLLILYLVSGSSASPITLQLAPNEKECVYVDIAGEACHISY
                     YFAVQEGEYNAFNVEYELWSPENKDSPINAQKDKVQGEWTFAAVYPGEYALCVIGDNY
                     TKIVDLDIVKICADEPDKPKDSRLNIDYIGYSQAPSVEDSVNLIERQLQVLERNLKFY
                     KSRSERNNYTVRSIRSRIGTISMWIIILVPLLALLQIILMKYVMVKFGS"
     gene            <413444..>414883
                     /gene="CDC7"
                     /locus_tag="KLMA_10195"
                     /db_xref="GeneID:34713875"
     mRNA            <413444..>414883
                     /gene="CDC7"
                     /locus_tag="KLMA_10195"
                     /product="cell division control protein 7"
                     /transcript_id="XM_022818807.1"
                     /db_xref="GeneID:34713875"
     CDS             413444..414883
                     /gene="CDC7"
                     /locus_tag="KLMA_10195"
                     /codon_start=1
                     /product="cell division control protein 7"
                     /protein_id="XP_022673730.1"
                     /db_xref="GeneID:34713875"
                     /translation="MDDIPEEIIQEMDDLYEKVPELSSRYNLLDKIGEGTFSSVYKAQ
                     DLTGVSSKLYPDHFWDKENKYVAIKRIYVTSSPNRIENELKLLELLSNSNNVAPLCDA
                     LRYHDQVVVVLPWYPHEEFRHFYRDMPIKGIKKYMFELLSALKYVHSYGIIHRDVKPT
                     NFLYNPILGRGVLVDFGLAEENQDLYLPDLNHRVYVNDQGEKVCACASPYANTKNTSH
                     LPLISIQNGQLNVRGADELSVTQSENLMKAELSKGYPKHETRRHRRANRAGTRGFRAP
                     EVLMKCSFQTQKIDIWSVGVILLSFISRRFPIFQSMDDIDAFLEICCICGIKRMQEVA
                     KFHGLGLDMTKIPGFHSDGYQGGIQGFVKALLEKEVECGTLPEYSIAFETLDYLTHCG
                     RQLTPSLGPEEEGNTDTPVTEEMVKYKQTVWDDHFWCFDLLLKCFELNPYKRPSASDL
                     LEHLWFRELNEDLMDKDQRREDHFTGIVN"
     gene            complement(<415058..>416092)
                     /gene="TSC13"
                     /locus_tag="KLMA_10196"
                     /db_xref="GeneID:34713876"
     mRNA            complement(<415058..>416092)
                     /gene="TSC13"
                     /locus_tag="KLMA_10196"
                     /product="enoyl reductase TSC13"
                     /transcript_id="XM_022818818.1"
                     /db_xref="GeneID:34713876"
     CDS             complement(415058..416092)
                     /gene="TSC13"
                     /locus_tag="KLMA_10196"
                     /codon_start=1
                     /product="enoyl reductase TSC13"
                     /protein_id="XP_022673731.1"
                     /db_xref="GeneID:34713876"
                     /translation="MTQKQAAKQASRQAAKLASKQNAVAKENSKHLQIKSRSKTLKDV
                     TIDLPADNTLTYDSILTKVSAENGNISVKRLRLTYLKEGKHIVISNAEIKEKDKKRVF
                     DTTTEWYVKDLGPQISWRLVFVIEYLGPILIHSLMFYLSSKPEFRNNYHSTKVPYNEF
                     FNSFVYRLIMLHYLKREFETIFIHTFSNDTMPLFNLFKNSFHYWVLNGLISLGYFGYG
                     FPLDNQTLFKIYDTVHLSDFRVLAGLFAISEALNFYVHLRLRRWGDEMKKNGVTKRIP
                     LETGLFKIFVAPNYTFESYAWIWFTLLFKLNLFSVLFLLVSVVQMYLWAQKKNAKYGT
                     KRAFLIPYVF"
     gene            <418867..>421650
                     /gene="FLO5"
                     /locus_tag="KLMA_10197"
                     /db_xref="GeneID:34713877"
     mRNA            <418867..>421650
                     /gene="FLO5"
                     /locus_tag="KLMA_10197"
                     /product="flocculation protein FLO5"
                     /transcript_id="XM_022818829.1"
                     /db_xref="GeneID:34713877"
     CDS             418867..421650
                     /gene="FLO5"
                     /locus_tag="KLMA_10197"
                     /codon_start=1
                     /product="flocculation protein FLO5"
                     /protein_id="XP_022673732.1"
                     /db_xref="GeneID:34713877"
                     /translation="MQLVHLASLINGQSQNVDTGTILGCAPKADSLTKGFSVSYYHYP
                     MTENATAPGCFNLNNIFETDGYQHGGYETIDGGLIGTSSGVTNLTFSSDTTCSSGCCK
                     VGTGKLPPNYNYEQQLTLSNFSMLITGYFLASKSGSYEFIVDDVDDVTYLTVGAGKAF
                     GCCEIGSTVSNPSGFDLTLTYPDKENTATANLIGGYYYPIRVLFINRLDVGRLIVSFK
                     DPDGVTHNTFDDYIFMAPDGAECPVPVVTTTEAWTFSSTSTETTITTVTGSDGMPTTE
                     NLIVIKTPEVHTATTEFTPWTGSFTTTQSTEILTTTGSDGNPTVETIFYVKTPEAETS
                     TTEYTPWTGTFTSTSTDLVTFTGPDGNPTVETIFHVKTPEVQTATTEYTPWTGTITTT
                     STEIVTTMASNGIPTVKTIFHVSTPEIDSVTTEYTPWNGTYTTTQSTEVFTTTGSNGI
                     PTIKTIFHVETPEVYSATTEFTPWTGTYTTTQSTEFVMITGSNGIPTVKTIFHVGTPE
                     AQTATTEYTPWTETFTTTSTEIVTTTGSDGKPTIETIFHVKTPENGLVTTDYTPWTGS
                     YTATSTEIITTTGSDGKPTVETFFHVKTPELGLATTDYTPWTGTYTTTSTEIVTTTGS
                     DGKSTIETIVHIKNPENGLATTDYTPWTGSYTTTSTEIITTTGSDGKSTIETIVHIKN
                     PENGLATTDYTPWTGSYTTTSTEIVTTTGSDGKSTIETVFHVKTPENGLVTTEYTPWT
                     GSYTTTSTGVITFTGSDGKPTVETIFHVKTPENGLATTDYTPWTGTFTTTSTEIITTT
                     GSDGKPTIETIFHVKTPQNGLVTTEYTPWTGSYTTTSTDISTFTGSDGKSTVETIFHV
                     NTPLNEPQNPMTATNEFKTTPSTSPANSPSIAIVSSSVSESFSIRTLESAFEGKANKL
                     PVANLIAILLTFL"
     gene            <422800..>423783
                     /gene="NOP1"
                     /locus_tag="KLMA_10199"
                     /db_xref="GeneID:34713878"
     mRNA            <422800..>423783
                     /gene="NOP1"
                     /locus_tag="KLMA_10199"
                     /product="rRNA 2'-O-methyltransferase fibrillarin"
                     /transcript_id="XM_022818840.1"
                     /db_xref="GeneID:34713878"
     CDS             422800..423783
                     /gene="NOP1"
                     /locus_tag="KLMA_10199"
                     /codon_start=1
                     /product="rRNA 2'-O-methyltransferase fibrillarin"
                     /protein_id="XP_022673733.1"
                     /db_xref="GeneID:34713878"
                     /translation="MAFQAGSRGGSRGGFGGRGGSRGGSRGGFGGGRGGSRGGFGGGR
                     GGARGGSRGGRGGARGGARGGARGGSRGGARGGARGGARGGAKVVIEPHKHAGVFIAR
                     GKEDLLVTKNIAPGESVYGEKRISVEEPSKEEGVPPTKVEYRVWNPFRSKLAAGIMGG
                     LDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGLVYAVEFSHRPGRELISMAKKRPN
                     VIPIIEDARHPQKYRMLIGMVDAVFADVAQPDQARIIALNSHMFLKDQGGVVISIKAN
                     CIDSTVDAETVFAREVQKLREEKIKPLEQLTLEPYERDHCIVIGRYMRSGL"
     gene            <424426..>426264
                     /gene="SLX5"
                     /locus_tag="KLMA_10201"
                     /db_xref="GeneID:34713879"
     mRNA            <424426..>426264
                     /gene="SLX5"
                     /locus_tag="KLMA_10201"
                     /product="e3 ubiquitin-protein ligase complex SLX5-SLX8
                     subunit SLX5"
                     /transcript_id="XM_022818851.1"
                     /db_xref="GeneID:34713879"
     CDS             424426..426264
                     /gene="SLX5"
                     /locus_tag="KLMA_10201"
                     /codon_start=1
                     /product="e3 ubiquitin-protein ligase complex SLX5-SLX8
                     subunit SLX5"
                     /protein_id="XP_022673734.1"
                     /db_xref="GeneID:34713879"
                     /translation="MAEQGCLIEIESDPELDAQIIQEYAPTRLVPDRRLNRPRDSLSR
                     FVAAPREATNDSNTNAINNDNSGNRQTGETQNVEDADEVEITGEVSLRPDGPINDEAE
                     YINLDNYQNHPNGTIVVDHREGDDDLMLISEHITEPRRPVYLQLPAGQTLQVDASFNE
                     LPVGRSFQNQTYNSYLNPNRLRRLRRSTQSATALFLPAQNDSDDDSENDADYIPQDII
                     NDRNQANMRRHLREQRERQMRIERMQRVADGTVEALHPNLRTLFYESRNLSEFREGLA
                     TFNFPPARLEQLMDQYRDFRARAMQHWANGRRMTRSMASPNRRSARRRGMAQYGGLNG
                     DSRDSNLYQEMLFGLEDEDENYYNSSHEDGTNFTGGPQALQRIISNTVNRRLGNLPFG
                     LYEDGDDAANTELIIRMIQEREERDASLRTKKLNENTKSHQQRYIDKANQLPEGYSAS
                     FSTTPMMKMTLEKEGKEEQVLVTDDVAAKTYIDIPVCALCGVELGVGIPDDFKGIAES
                     DKGVSFEALQSRYKIHCPYQTLARPTQVDRDLSRRTYISSCGHTFCGRCQVRIKNARD
                     ISAKDKNKMKYTRGPSHPDNYGPKICPAEGCCSKLRNKGIMREVYF"
     gene            <426620..>427735
                     /locus_tag="KLMA_10202"
                     /db_xref="GeneID:34713880"
     mRNA            <426620..>427735
                     /locus_tag="KLMA_10202"
                     /product="uncharacterized protein C12G12.12"
                     /transcript_id="XM_022818862.1"
                     /db_xref="GeneID:34713880"
     CDS             426620..427735
                     /locus_tag="KLMA_10202"
                     /codon_start=1
                     /product="uncharacterized protein C12G12.12"
                     /protein_id="XP_022673735.1"
                     /db_xref="GeneID:34713880"
                     /translation="MRSHLVLAVALSLIVTGCINSIATKFQDNQCVRNCNGEGSPVLF
                     EQPVLQTLQMFVGETSLLFVMLWQKFGVKRDGYELVSGSDNSNKVKLTTRRSYALSLP
                     AICDICGTTLMNLALTMIPVSIYQMTRGVLILFVALFSIVFLKHKISRFEWLSLFIVV
                     FGVFLVGYSGQTGVTIDVSLITGILLIVLAQVCTASQFVIEEHIMSKWIVTPSTLVAY
                     EGMYGAGITLGAMCLASITVVRGHPDSSFNIVSSLHDMFANSSVLYSSIIIMTSIACF
                     NFFGITLTNSMNATVRSTIDTCRTLLVWLVSLSLGWESFKFIQFVGFAMLVLGTLLFN
                     GAITVDKNKLPKWLAKDYPDDQDHRIINVVDEEVERF"
     gene            complement(<427896..>428249)
                     /locus_tag="KLMA_10203"
                     /db_xref="GeneID:34713881"
     mRNA            complement(<427896..>428249)
                     /locus_tag="KLMA_10203"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818873.1"
                     /db_xref="GeneID:34713881"
     CDS             complement(427896..428249)
                     /locus_tag="KLMA_10203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673736.1"
                     /db_xref="GeneID:34713881"
                     /translation="MSAAEYYGGDSKQTYNRPSGPPPPGAASGAGAGDHDKGFFNAPN
                     AGYQQQAPPQYHYQNPPQQQQYYQQGQQQQGYYGQQQQQPIYVQQPAPTNNNGDCLTA
                     CLAGMCLCCTLDMLF"
     gene            complement(<430457..>434227)
                     /locus_tag="KLMA_10204"
                     /db_xref="GeneID:34713882"
     mRNA            complement(<430457..>434227)
                     /locus_tag="KLMA_10204"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818884.1"
                     /db_xref="GeneID:34713882"
     CDS             complement(430457..434227)
                     /locus_tag="KLMA_10204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673737.1"
                     /db_xref="GeneID:34713882"
                     /translation="MFENDLSFVAPTRVSLNVKELNIHAKNATIVNNVSFSLDSGKLM
                     AIIGGSGSGKTTMLNVLAGKTNSSITYDGTVLFTSSKDSIKSDDSSEIIVAYLTQHDA
                     LAANLTCRETLRIAADLKLQLTKQERYVLVEELIAELGLRDCADTHVGDAHHKGLSGG
                     EKRRLSIAVQMIANPSVLFLDEPTTGLDSYSAYLLIKTLKKLCNNGGRTIIMSIHQPR
                     SDILFALDQVCLLSKGFPMYCGPVPEMIDYFSSLGYDVPEQCNPADYFIDICSIDNRS
                     SQSLQNSEKRWSSFATEWQKKSSEVLTNDSEKDITVLNVDPTPPSVSTWQQIWVLTKR
                     NLLLNSRDKMTLIAVQLEPVIVGVVVGWVFYKPDMNSQLGLRSIAGALYIVGSIQGYL
                     LLLLETYRLSEIDVKVYDRERAEGCVSAFSFLMARRLSNLIHEDILIPLIFATITYFM
                     FGLQADAKKFFTYYGLTLVSHQTSVSVAYMAVAISRDFSKAGLVGNLTFTLQSMACGF
                     FVNAKKMPVYVRWTKYIAYLFYTFSALMSNTFSDFGCQISAGVKKCVGNEYIDTFGIP
                     KNWISVPTIIVFCWAIGFYVVGLAFFHFKTVDVTLAKQVTRSNKSEEDESDKESTDLS
                     EDSIELEEKSLPLTNSDHSEISITLQDISLSVEQIKLFQLKDKKLTTHVHKDILCYVN
                     ADFKPNTINAVMGPSGSGKTSLLNLISDRVYSNVFTKFKKDGKILFNGRPVTQNMFKS
                     ICSYVSQDDSHLLPNLTVYETLKYAALLRLSHFKEDLVEDRVNTLINDLGLRNCANNL
                     VGNELIKGISGGEKRRVSIGIQLLTNPSILLLDEPTSGLDSFTSSTIIELLKKLCNQG
                     KTIILTIHQPRAELFADFGNVLLLAKGGRVAYNGEPLAMVEYFKGRGFTCPPLTNIAD
                     YLLDVISVNIQNDINEATSKERVNALLENWSMINSAAVKNTSPTITHHEFLELFSQHI
                     RHHASSIVAYRVCLSRQFKVITRNLDSCFARLAQVPGMAAILTIYFAPLKNNYTGVTD
                     RLGLTQQFTSLYFCGMLVNLAVYPAERDNFYQEYHDNVYGIGPFLSAYMTLEFPMAIA
                     SALIFSALTVMGTGLPRTAEMLFISMYCSFVVTTCGEAWGIVVNTLFDRPGFVVNVVS
                     IILSISSIMSGILSLQMPKFWKGLNYTSPVHYTSMILINYAFPDHLKFNCRDGGRNPD
                     GSCIFSNGKDVIENFGLHVNTSVYMGALICVWVIYRAIPYFVLKIYLELFKR"
     gene            <434488..>435090
                     /gene="PAC10"
                     /locus_tag="KLMA_10206"
                     /db_xref="GeneID:34713883"
     mRNA            <434488..>435090
                     /gene="PAC10"
                     /locus_tag="KLMA_10206"
                     /product="prefoldin subunit 3"
                     /transcript_id="XM_022818895.1"
                     /db_xref="GeneID:34713883"
     CDS             434488..435090
                     /gene="PAC10"
                     /locus_tag="KLMA_10206"
                     /codon_start=1
                     /product="prefoldin subunit 3"
                     /protein_id="XP_022673738.1"
                     /db_xref="GeneID:34713883"
                     /translation="MDTLFSSTKTNPRGIPEAPFVEKVEQYVKNPEDFDMCFSKFQEH
                     LSKYKYMQESKLATIKQLKGKIPDIENTLNMCQLLKEKREAVPDEDEDEDEEEGLLIN
                     YQLNDTLFSKASVDPKDPNLKVGLWLGADVMLEYPLDEAIELLNQKLADAKQNLDVSQ
                     QDVEFLRENITTMEVNCARLYNWDVQRRQMQKKEGAGSAA"
     gene            complement(<435153..>435989)
                     /locus_tag="KLMA_10207"
                     /db_xref="GeneID:34713884"
     mRNA            complement(<435153..>435989)
                     /locus_tag="KLMA_10207"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818906.1"
                     /db_xref="GeneID:34713884"
     CDS             complement(435153..435989)
                     /locus_tag="KLMA_10207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673739.1"
                     /db_xref="GeneID:34713884"
                     /translation="MSSSNNVGVEIPTGLVLFPITKLMMIWCVGIALIASLFNMKYLF
                     LLQYKPFITDFKQLWRFVTFQIGSLNESDVAIMTLIWYQYRSLERLFGSRKYFNMIIL
                     SWIYTSIAIFLLSNVLNTLLPGVWWNEYTNGPLPILLCLAHFYKQYTPRLYEFKIILN
                     QPFLTNSNVIKWKLTDQFYVNALLFLAMINQGFTGLVTGFVSWICGILIDNGLLPGMD
                     SFQVAPFKDSWCRSPSTLNRATATLNNNMTWDDATEEEAEEPQDEPQRNMRVRFLDTF
                     RR"
     gene            <436268..>437965
                     /gene="PEX8"
                     /locus_tag="KLMA_10208"
                     /db_xref="GeneID:34713885"
     mRNA            <436268..>437965
                     /gene="PEX8"
                     /locus_tag="KLMA_10208"
                     /product="peroxisomal biogenesis factor 8"
                     /transcript_id="XM_022818919.1"
                     /db_xref="GeneID:34713885"
     CDS             436268..437965
                     /gene="PEX8"
                     /locus_tag="KLMA_10208"
                     /codon_start=1
                     /product="peroxisomal biogenesis factor 8"
                     /protein_id="XP_022673740.1"
                     /db_xref="GeneID:34713885"
                     /translation="MDDIESIRYLITALKNPSNENNATAESQILNNIVYFTPRLRDVQ
                     VVSQLIQVFFQWKPRWLTIWDIFKASSSIMQWKLEISEPQINIHTFVSLWKQEIGSYR
                     ALNCFQISIVAGLVSSHSQLNTLQKQLYIDDSGIAEKELHDLKYRHFLPYWKQQLIIA
                     RGNPHQTDDLCVLYSMIHSKLDNDLPHDIIFSNLFDILVDYIKNANMEYSGRNAFAYQ
                     HINLLCKTCADSIPHLHNHSELLMGKMITLHDITKKLTAKASLSKKGNYTAKYYTNCL
                     FIVVLLLSGYRPDPSNVSIMTFTLYYISFILQDFGLDGFSAYQSLIHSLCNVTSQDLK
                     IFDSILTGMVSQVSFDMENKVYHSMMLFILEYLQLNMSLLEIPDAQYLTERIEPLIGP
                     LLSSTDIKLRESAHLVWLELYNNDSWKPDIVEFKLKRIRVYLRDCFQGCQKSFMTKEQ
                     LLLVWKSMLPIIRHLSNYDINLVRDLIHSTYLNIINSENLEMKSIGIECLVEQLYNVP
                     EKYLWDWLNTCKQLIEGQPPVMRDILFTKLWEFVSHAHNELAIRWWYDAVVPTLSRF"
     gene            complement(<438029..>439807)
                     /gene="DBP9"
                     /locus_tag="KLMA_10209"
                     /db_xref="GeneID:34713886"
     mRNA            complement(<438029..>439807)
                     /gene="DBP9"
                     /locus_tag="KLMA_10209"
                     /product="ATP-dependent RNA helicase DBP9"
                     /transcript_id="XM_022818930.1"
                     /db_xref="GeneID:34713886"
     CDS             complement(438029..439807)
                     /gene="DBP9"
                     /locus_tag="KLMA_10209"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DBP9"
                     /protein_id="XP_022673741.1"
                     /db_xref="GeneID:34713886"
                     /translation="MSQTSAQQGYIDDSTSFDTFHLDSRLLQAIRSIGFKHPTLIQSS
                     AIPLAIQEKRDIIAKASTGSGKTLAYLIPVIQTILDYKKTEDNEEGATLGVILVPTRE
                     LAQQVLEVVEKLIVFCSQEIKCLNLSSGNLSGNLLKSLLTENPEILIATPAKLVDLLD
                     NQDVNIDNLKFLVIDEVDLVLTFGYQEDLTKISERLPLRKSLQTFLMSATLNDDIEEL
                     KKQFCRSPAILKLNDDEISKDQTKLIQYYVKVGEFDKFLLCYVIFKLGLIKGKTLIFV
                     NNIDRGYRLKLVLEQFGIKSCILNSELPANSRQHIVEEFNKNVYQLLIATDDTEYIKE
                     EDEDLEVDDASEENTNEEKTATSTEGSKKQKKQKLNVEKDKEYGVSRGVDFKNVACVL
                     NFDLPTTAKSYVHRIGRTARAGKSGISISFVVPLKEYGKHKPSMVKSAKKDEKILSRI
                     IKQQAKLGFELQPYRFDIKQVEGFRYRMEDGFRAVTQVAIREARIKELKQELLASEKL
                     KRHFEENPHDLESLRHDKELHPARVQQHLKRVPDYLLPENARQDKQKIGFVPFHKNSS
                     RKHGKVGKRRGNFQKKGKSDPLKSFK"
     gene            complement(<440330..>442633)
                     /gene="YSH1"
                     /locus_tag="KLMA_10210"
                     /db_xref="GeneID:34713887"
     mRNA            complement(<440330..>442633)
                     /gene="YSH1"
                     /locus_tag="KLMA_10210"
                     /product="endoribonuclease YSH1"
                     /transcript_id="XM_022818941.1"
                     /db_xref="GeneID:34713887"
     CDS             complement(440330..442633)
                     /gene="YSH1"
                     /locus_tag="KLMA_10210"
                     /codon_start=1
                     /product="endoribonuclease YSH1"
                     /protein_id="XP_022673742.1"
                     /db_xref="GeneID:34713887"
                     /translation="MTQLENEFPNKDSLRFFSLGGSNEVGRSCHILQYKGKTIMLDAG
                     IHPAHQGIASLPFYDEFDLSTVDLLLISHFHLDHAASLPYVMQRTNFNGRVFMTHPTK
                     AIYRWLLNDFVKVTSIGDSLGSDSKNDNLYSDEDLAESFDRIETIDYHSTIEVNGIKF
                     TAFHAGHVLGAAMFQIEIAGVRVLFTGDYSREVDRHLNSAEVPPQPSDVMIVESTFGT
                     ATHEPRQNRERKLTQLIHSVVAKGGRVLLPVFALGRAQEIMLILDEYWQTHKEELGNG
                     QVPIFYASNLAKKCMSVFQTYVNMMNDDIRKKFKDSQTNPFIFKNIAYLKNLDEFQDF
                     GPSVMLASPGMLQNGLSRDILEKWCPDEKNLVLITGYSVEGTMAKYLLLEPDSIPSAY
                     NPDMTIPRRCQVDEITFAAHVDFRENLEFIELIGASNIILVHGESNPMGRLKSALLSN
                     FSSLKGTENEVHVYNPRNCVFVDIEFKDIKVAKAIGMIVDDLDEFVENKLKQETKITE
                     IKTEEEAEGQEQKQEQKLDASKEESERIVSGILVSDEKNFDLNLVSLSDLREHYQQLS
                     TTVLTERQTVHLDCKNELVYWHLCQMFGDIEVYIDEENVSLKNVNPEFKTRKIKKGEL
                     ELRIMGDVILNITDHVATLQWTQNVISDAVADSVMAILLSVESAPASVKMSSHASNHH
                     HGHDDHTSKIKKISRIFKEQFGESFSLQLNEEDSKAEIKGTIDLGKISAIINFSKMVV
                     EECNSNPLKGRIESLLKIGTDLVAPLC"
     gene            complement(<443273..>446968)
                     /locus_tag="KLMA_10211"
                     /db_xref="GeneID:34713888"
     mRNA            complement(<443273..>446968)
                     /locus_tag="KLMA_10211"
                     /product="cd12148 family transcription factor"
                     /transcript_id="XM_022818952.1"
                     /db_xref="GeneID:34713888"
     CDS             complement(443273..446968)
                     /locus_tag="KLMA_10211"
                     /codon_start=1
                     /product="cd12148 family transcription factor"
                     /protein_id="XP_022673743.1"
                     /db_xref="GeneID:34713888"
                     /translation="MGRPPKKVSLENIQRFQLELEMAGQDINQLLKDKKGRSRACLLC
                     QRRKQKCDHKLPSCTACLKAGVKCVQPARYGYDGSSSEHQRSTRESSPAGVNWDGVKK
                     SEDSHAVKIIPDTHSVHPKQGVITNRYGSNDPGSAVSDSSNEAKAVSSNNNNNDRFNF
                     GESDSSRLTQLANAAGHASTSPGVRTYSNGKDKKSKTKPSHKDGKDEYTLFLEKKLKY
                     LEKLVDMRPDSNSYKERLSKYKKIAHLLDNGEPDQDDITSILNLSEKSADAQATVSPA
                     QQQQQQQQPQQQQQSKRIQSPILPLPPKAAFLPLHQQSQKSQQPSGLVKPPHSHERVL
                     SSLASDSLESIDYSRCIFAKYNLKEFLSYDPAFEFDEQLSRAFLDTYFTRLQFKYPLL
                     DEQEIYTFHDDYINDNVHSYSTNEFHFSCGRMWLVFSIAAHLHKTTGKYQGLPPNRYF
                     STAIRHITKCGTNLTFVQQIEVLTLLILYIIRTDRDSIGLYEIIKDVTNICKNKLYLN
                     KWNPKDPFANKKLRLFWCVYLIERMICVAVGKPYTIAESEIDLPLFNKDSFYTREADM
                     KIHEHGVHFINQSLKLRRIESTFVEQLNIISQKTGTTSISSSVTNQKKLSTTEKSKLQ
                     AQLPQVKKFFQDLEIWRSNCSISRVRNFENETLKLYYYRSVRLLLQPYLELLEPQDRL
                     FKECQAAAGQICQLYKIFHQKTVFGHSTPAVHTVFVAGVTLIYCMWLARNWDDERRRK
                     LGDVSKHTRPLVSGLLFSTMDDLRACSVCLYVMAERSKFAIIFRDTFDQLMNATIGNL
                     IERCGPDSSELIYVTSSKRGETTPTLITIPDKNHDNDDSNKELDRKGMPPAMKRTFGE
                     FQESAHAGFVANSQIDIEEQMERKRKQGVLQKTSVPKSLSHLLVKLEDEEQKDDKPVD
                     KATKPSPKPKVSSTTASDVLTPPDQNSIGNKYIVKKPSNVTESDWEIFQQQAFLQQHQ
                     AQQNLQAYLSSLNGTIEQNAGHSLRKPNLADSQLINRTTVNQPSPAQQPSSLNAINEG
                     HMMFSNVEARPPIQTSNGSSPAGWQQGNAEILSRNQTGFAKSPNANLQPMSFSIDPSP
                     RPNDNGIIFNNGTHTMINNISTWTNDSVLDLMNNNNTYTEPVNGGVTNGNGGLQTSTT
                     SDGQKPYVIPNRDNNPGPFKFNPSINWRNSSFTNMNIRQQDGHQSQRLDNHQDQQQQP
                     NQQQIEAMLSVPVEEFWTVNDDYGFLA"
     gene            complement(<447545..>447952)
                     /locus_tag="KLMA_10212"
                     /db_xref="GeneID:34713889"
     mRNA            complement(<447545..>447952)
                     /locus_tag="KLMA_10212"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818963.1"
                     /db_xref="GeneID:34713889"
     CDS             complement(447545..447952)
                     /locus_tag="KLMA_10212"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673744.1"
                     /db_xref="GeneID:34713889"
                     /translation="MPPRPKFTAEMETEIEEKFLHGGRGPGGQKINKCNSKVQLRHIP
                     TGIVVDCQATRSREQNRKIAREKLALRIAQWHNGDQPIERELAKIQWEQQSKRAKERK
                     AKNKHKEAREKREEAARQQLEQEREILRSMLGS"
     gene            <448346..>449182
                     /locus_tag="KLMA_10213"
                     /db_xref="GeneID:34713890"
     mRNA            <448346..>449182
                     /locus_tag="KLMA_10213"
                     /product="DUF1640 domain-containing protein"
                     /transcript_id="XM_022818974.1"
                     /db_xref="GeneID:34713890"
     CDS             448346..449182
                     /locus_tag="KLMA_10213"
                     /codon_start=1
                     /product="DUF1640 domain-containing protein"
                     /protein_id="XP_022673745.1"
                     /db_xref="GeneID:34713890"
                     /translation="MIRPLFRKYACRLIHTSRPLFKYNALQPQQQFPHEDFVNKLPEQ
                     LISQGNGLKPTTAANQLDTLYLHNKLVHNGFTSEQGNVIIELLLEYLDYEFFATYNDK
                     FLRKMELENQSHLFNAAETELRYAIQNSRENSLNERTLELMQLDRDLSSFNDQLNELI
                     INLLTKDSKVEFNDHKIENTLLHRELNLRLKDCNNKIGTKINGHIKSEIENLRWQTTR
                     SGLFAILILVFFIMSGVSISKRISAENEKPVEVVLHTVDSEETDLQPLLSDKEEDEIS
                     QE"
     gene            complement(<449189..>450031)
                     /gene="ECI1"
                     /locus_tag="KLMA_10214"
                     /db_xref="GeneID:34713891"
     mRNA            complement(<449189..>450031)
                     /gene="ECI1"
                     /locus_tag="KLMA_10214"
                     /product="3,2-trans-enoyl-CoA isomerase"
                     /transcript_id="XM_022818985.1"
                     /db_xref="GeneID:34713891"
     CDS             complement(449189..450031)
                     /gene="ECI1"
                     /locus_tag="KLMA_10214"
                     /codon_start=1
                     /product="3,2-trans-enoyl-CoA isomerase"
                     /protein_id="XP_022673746.1"
                     /db_xref="GeneID:34713891"
                     /translation="MVSIVKSSRIDSRKQGPFLIIFLNDEKTLNSLEGNDYLYLAHLL
                     IENDKDADTSFTVIQSSGRFFSSGANFSSIVTENGKKNKDGELPKWAAAFLSRNTYVT
                     TAFINHSKPLICCLNGPAVGLSAAIVMLCDIVYVMNNKVYLQFPFAKIGLVTEGAVAV
                     TLPLKIGYARAQNVLFFNKRVTYDMLENTVSVKNYELDDWQQFNARVLEDLGKDVKNI
                     NMASIIGMKALIKETWKGHLLQANVSEVTDAMPFWIEGIPQSNFNKLLKKAESRKNKL
                     KPKL"
     gene            <450571..>451383
                     /gene="NNT1"
                     /locus_tag="KLMA_10215"
                     /db_xref="GeneID:34713892"
     mRNA            <450571..>451383
                     /gene="NNT1"
                     /locus_tag="KLMA_10215"
                     /product="putative nicotinamide N-methyltransferase"
                     /transcript_id="XM_022818996.1"
                     /db_xref="GeneID:34713892"
     CDS             450571..451383
                     /gene="NNT1"
                     /locus_tag="KLMA_10215"
                     /codon_start=1
                     /product="putative nicotinamide N-methyltransferase"
                     /protein_id="XP_022673747.1"
                     /db_xref="GeneID:34713892"
                     /translation="MSDTESFFDGDLFAEPSDYYKPPPEPHFATYVRETVPETSENQS
                     KEVKLRLVGSSPLWGHLLWNAGIYTAKHLDLHPEQVQGKYVLELGAAGALPSVIAGLL
                     GAEKVVSTDYPDADLISNIQYNVDHNIYGGEELSQDEETRSKQIAERKVVVEGYIWGN
                     EYEPIVKHLPDGQKKFDLIILSDLVFNHTEHQKLFKTTKDLLKDDGKALVVFSPHRPW
                     LLKEDLAFFDNCREFGLKSELIELTHWKPMFDEDEETVEIRSSIYAYYLTHC"
     gene            complement(<451779..>453449)
                     /gene="CTS1"
                     /locus_tag="KLMA_10216"
                     /db_xref="GeneID:34713893"
     mRNA            complement(<451779..>453449)
                     /gene="CTS1"
                     /locus_tag="KLMA_10216"
                     /product="endochitinase"
                     /transcript_id="XM_022819007.1"
                     /db_xref="GeneID:34713893"
     CDS             complement(451779..453449)
                     /gene="CTS1"
                     /locus_tag="KLMA_10216"
                     /codon_start=1
                     /product="endochitinase"
                     /protein_id="XP_022673748.1"
                     /db_xref="GeneID:34713893"
                     /translation="MFPLRFVLFAILQLIFVSAFDANSKQNVAVYWGQASAGSQESLG
                     TYCQSDNVDIVLLSFLYSFPDNLAVNFASACTDTFEDGLLHCSSIAADIKTCQDKGKK
                     VLLSMGGAIGSYGFTDDKQAEDFATTLWNTFGEGSADGVERPFDSAVVDGFDFDIENN
                     NPKGYAALATKLRTLFSKGTKDYYISAAPQCFYPDASVGDALANADIDFAFIQFYNNY
                     CNVDKQFNWDTWTDFAQNTSPNKDIKLYLGLPGSATGAGSGYISDLGLVESTVKKISE
                     SPNFGGIMLWDASQGFTNTVDGKPYVEQMKDILNKDAVSNSAAPSSASQATSSTSTSS
                     SSSSSSSSTTTTSTSTSVSSSTAAPTTTTASSSSSSSSFSSTLTLTSAITTTLSKSTL
                     SVSTTTSNTKTSETKPETKTLQPTTPTTTSISTPAPTSSSVSTTKATTTLQPTTTQQP
                     TTTQQPTTTQQPTTTQPSQTAQPSGSWAENRAKELNQQFSEGKMNGKDTCFDGEISCD
                     SVGKIAICNYGEWVHTECAAGTTCFAYSDDSVVSISCNFSYLKADWTL"
     gene            <454826..>457015
                     /gene="LAS17"
                     /locus_tag="KLMA_10217"
                     /db_xref="GeneID:34713894"
     mRNA            <454826..>457015
                     /gene="LAS17"
                     /locus_tag="KLMA_10217"
                     /product="proline-rich protein LAS17"
                     /transcript_id="XM_022819018.1"
                     /db_xref="GeneID:34713894"
     CDS             454826..457015
                     /gene="LAS17"
                     /locus_tag="KLMA_10217"
                     /codon_start=1
                     /product="proline-rich protein LAS17"
                     /protein_id="XP_022673749.1"
                     /db_xref="GeneID:34713894"
                     /translation="MGGLNSAEKEKIKHALPKAANKIIDVAVARLYIAYPDPEKWVYT
                     GLSGAIVLVDDIVGNTFFLKLVDIHGHGGVLWDQELYVNFQYNQDRTFFHTFELEKCY
                     AGLLFTDTNEASHFLKRVQKREKYGSKKTLANKNAIALEDQIKKEEKANVIHGPRGES
                     LISDQRTRYRYEPDKFTSKSNSNNGSRDYENDNDDEEDEESYSESSVSAAPSYISKKP
                     PPPPVEKHRTIPSYTYENIPSAPEASPPPAPPAAAPPTPSAQAPAPPAPPAPPAPPAP
                     PASSAPAPPAFGMSRQASTTDSASPAANSPMTNHHQVHSVPPPLPPDQYKPLEQPQQQ
                     QQFQNNVPPARGYPTQQNNGYNNNVNQHPFGVPPPPPPPGGGPGALPPRNNNNMIPGR
                     RGPVPPPPPRRAGASAVAGRGAVPPPPPPPAGGSIGSQNNRAGRGPPPPPPPRRGPAP
                     PPPPSRGPSHSTSPYSHPLPPNQPSPSPIPQQQQHAYPPPPPPHQQQHQAYAPPQPQQ
                     QAYAPPPPPPPPQPQQQYPYQQQQQQQQQAYAPPPPPPPQQQPQSQSYDRAAHALPPQ
                     PANNAPAAPPPPPMFSQPQQANTSGAPPPPPPPPQMNGAAPPAPPPPAFNQQQQQQSS
                     NFVETTGDSGRDALLASIRGAGGVHALRKVDKSQLEKPSPLLQKNGGDIGGSSAPAQY
                     PAGAGSAPQPGAQAGAPASLADALAAALNQRKNKVGRGEDDSDKDDW"
     gene            complement(<457126..>458181)
                     /locus_tag="KLMA_10218"
                     /db_xref="GeneID:34713895"
     mRNA            complement(<457126..>458181)
                     /locus_tag="KLMA_10218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819030.1"
                     /db_xref="GeneID:34713895"
     CDS             complement(457126..458181)
                     /locus_tag="KLMA_10218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673750.1"
                     /db_xref="GeneID:34713895"
                     /translation="MPSLTDDVRKLKTEFPYATVESLTSIPKKTNLKDSTALKELSKL
                     SQLIKSNATKLGIISTPDKIFNNEDSFRKQLKDFMDVVFYLLSLVPLFHDSYYADYFV
                     EKVDHEIVSLILSVHKLSDELVEIVNSGDQYKDEEVDLSKDDKLAKFIKERLISIGML
                     WSQCDNLDLLSRQGNLGLLNQYMSSSVKILQDSIEELSEWLEDPVVNSDPFGMDDNFS
                     EDEEASVEGSNSEEVSDEMISFVNTLLQKSKLLKLLLGSLSKSIEIKKDTATTASSLS
                     ELNQLHKSIVSNSDIVISSTLMNTDYATDPEIETAMLAIQNDVKKVTKIVTSLNKADD
                     SKLKWIKVWSNKWDSLN"
     gene            <459961..>461139
                     /gene="SER1"
                     /locus_tag="KLMA_10220"
                     /db_xref="GeneID:34713896"
     mRNA            <459961..>461139
                     /gene="SER1"
                     /locus_tag="KLMA_10220"
                     /product="phosphoserine aminotransferase"
                     /transcript_id="XM_022819041.1"
                     /db_xref="GeneID:34713896"
     CDS             459961..461139
                     /gene="SER1"
                     /locus_tag="KLMA_10220"
                     /codon_start=1
                     /product="phosphoserine aminotransferase"
                     /protein_id="XP_022673751.1"
                     /db_xref="GeneID:34713896"
                     /translation="MDRPQSNYFGAGPAQLPLPVLQQAAKDLINFQNEGLGIGEISHR
                     SKKAKNVITDTKAHLKELFGVPDTHEVFFLQGGGTTGFSSVAANMSAAYLGKTGKVGT
                     AAYLVTGSWSEKSAQECERLGVPTEVIFNVKKETGKYTTIPDVSTWASKLDAEKHSYV
                     YFCENETVHGVEWPAQLPAELVNSKIPIVADLSSDVLSRKIDISNYSLILAGAQKNIG
                     LAGLTIYIIKKDLLDDMSKVSPAQLREHQLPVAPIATDYPTVVKNDSAYNTIPIFTLH
                     IIDLVLKGLMEKGGLAKQQEENEEKARILYTALDKFPDFYNLPVDKKYRSKMNVVFTL
                     KKDGLEDKFIEEAASLNLTGLKGHRSVGGFRASLYNAVELSSVKLLAEFVTKFAEDNQ
                     "
     gene            complement(<461148..>462350)
                     /gene="MEC3"
                     /locus_tag="KLMA_10221"
                     /db_xref="GeneID:34713897"
     mRNA            complement(<461148..>462350)
                     /gene="MEC3"
                     /locus_tag="KLMA_10221"
                     /product="DNA damage checkpoint control protein MEC3"
                     /transcript_id="XM_022819052.1"
                     /db_xref="GeneID:34713897"
     CDS             complement(461148..462350)
                     /gene="MEC3"
                     /locus_tag="KLMA_10221"
                     /codon_start=1
                     /product="DNA damage checkpoint control protein MEC3"
                     /protein_id="XP_022673752.1"
                     /db_xref="GeneID:34713897"
                     /translation="MKLKISIQSGTEDYSLFRTTLTTVSKLRKTCILRFTSSRLVIIS
                     TPTSSGSVMDHGQIWCTIPRDVFDTYVVNSIREDNKVAMECPCDTIVGILRKFDKCDS
                     NQLTIKLVRLVTVDVDNDMATANKNADNTLCGLSFSFQDTKDERTIQHNIKVGVKLLY
                     NAQDEKIVEPTVSYVGILMLQLPSHISEWGTGFSSFFKRIERYSSLNSLKIHGEQVGE
                     KGSIKVIVDEFDWKLNITWKGPLDAMLNDMESDEIGAGGEDERENINNNFNNTNATTT
                     SANNGLLFQENASPNNQDDMQIEDSEVVSSRIYERTNSPDSISRDTTTSPISTQNKIK
                     AHEVIIRARDWKVCSKLYESFEEVVLVISHDDSCVFHCSLERGIDRDDNNKEKGQIIY
                     YISKCKSL"
     gene            <462851..>464479
                     /gene="GUF1"
                     /locus_tag="KLMA_10222"
                     /db_xref="GeneID:34713898"
     mRNA            <462851..>464479
                     /gene="GUF1"
                     /locus_tag="KLMA_10222"
                     /product="GTP-binding protein GUF1"
                     /transcript_id="XM_022819063.1"
                     /db_xref="GeneID:34713898"
     CDS             462851..464479
                     /gene="GUF1"
                     /locus_tag="KLMA_10222"
                     /codon_start=1
                     /product="GTP-binding protein GUF1"
                     /protein_id="XP_022673753.1"
                     /db_xref="GeneID:34713898"
                     /translation="MFYQDPRTKLDYLLHLVDTPGHVDFRAEVSRSYASCGGALLLVD
                     ASQGVQAQTVANFYLAYSMDLKLIPVINKIDLDIADIKQAEEQVENMFELPKEDCIKV
                     SAKTGLNVEQLLPAIIDRIPPPQGKIEKPLRALLVDSWYDSYLGVVLLVHIVDGTVKK
                     GDKIITAANGLKYEVKECGIMYPDRVATNSLKSGQVGYLVPGMKESKNAKIGDTLMHQ
                     GKESITEVLPGFEEPKPMVFVGAFPADGAEFKALDDDISRLVLNDRSVSLQRETSNAL
                     GQGWRLGFLGSLHASVFTERLEKEYGSKLIITQPTVPFLIKYKDGTQKIITNPDDFPD
                     LSTRKSNLEALEEPFVEAIMTLPQEYLGKVIQLCDDSHGIQKEITYLDMTGQAMLRYE
                     LPLSYLVDDFFGKLKSVSRGYASLDYEDIGYKPSDIVKLELLVNGKSVDALAQVMHRD
                     QTEHIGKEWVKKFKKFIKSQLFEVVIQAKANNKIIARETIKARRKDVLSKLHASDVSR
                     RKKLLAKQKQGKKNMKTVGNIQINQDAFQSFLRR"
     gene            <464736..>465413
                     /gene="PET18"
                     /locus_tag="KLMA_10223"
                     /db_xref="GeneID:34713899"
     mRNA            <464736..>465413
                     /gene="PET18"
                     /locus_tag="KLMA_10223"
                     /product="protein PET18"
                     /transcript_id="XM_022819074.1"
                     /db_xref="GeneID:34713899"
     CDS             464736..465413
                     /gene="PET18"
                     /locus_tag="KLMA_10223"
                     /codon_start=1
                     /product="protein PET18"
                     /protein_id="XP_022673754.1"
                     /db_xref="GeneID:34713899"
                     /translation="MQGTTPSSILWTMLTTDRLLQENKELVDLVAKHTLPLQLCNGTL
                     SDDVLYIYSAQDQKFFITSLRLIALYTSKAPTEKALLRLCKQIGFLMDQENDYFGNCM
                     KLTEREPLKQYVHKTLPKVQNYLDFLNDMPSSRNYQQWVTHMWCAEYVYWRWAHDLPR
                     AENLEWKHQEWIRLHDGDHFEEWCQFLASEVNKYSYEEVSGIFKETLKLEKGFFDACE
                     EAAKATK"
     gene            complement(<465967..>467037)
                     /gene="GCD7"
                     /locus_tag="KLMA_10224"
                     /db_xref="GeneID:34713900"
     mRNA            complement(<465967..>467037)
                     /gene="GCD7"
                     /locus_tag="KLMA_10224"
                     /product="translation initiation factor eIF-2B subunit
                     beta"
                     /transcript_id="XM_022819085.1"
                     /db_xref="GeneID:34713900"
     CDS             complement(465967..467037)
                     /gene="GCD7"
                     /locus_tag="KLMA_10224"
                     /codon_start=1
                     /product="translation initiation factor eIF-2B subunit
                     beta"
                     /protein_id="XP_022673755.1"
                     /db_xref="GeneID:34713900"
                     /translation="MSDINVVIDSFIDRLKRKQVVGSYQAALETLQILMRYVSAIRWT
                     SMDDLIVQIKKFGNSLEKAHPYEYTCGNVVRRVLSMIRDEIEEEQNTAEPMISSMFNL
                     LQKPMTDSKVKKTQDTRVDVRQTIVQSIRDLIDEIKNIDDGIQQIAIELIHDKEILLT
                     PTPDSKTVLRFLLKARERHNRNFTVLVTEGFPNNTTVAHEFAKKLSEHDIETIIIPDS
                     AVFALMSRVGKVILGAKTVFTNGGTISSTAGVSSVCECAREFRTPVFAVAGLYKLSPL
                     YPFDVAKMVEIGGSQHVLPTTENDRVGTVALETINPIADYIPPENIDIFITNIGGFAP
                     SFIYRVVWDNYKQEDVSFEDKI"
     gene            complement(<468044..>468688)
                     /gene="GSP1"
                     /locus_tag="KLMA_10225"
                     /db_xref="GeneID:34713901"
     mRNA            complement(<468044..>468688)
                     /gene="GSP1"
                     /locus_tag="KLMA_10225"
                     /product="GTP-binding nuclear protein GSP1/Ran"
                     /transcript_id="XM_022819096.1"
                     /db_xref="GeneID:34713901"
     CDS             complement(468044..468688)
                     /gene="GSP1"
                     /locus_tag="KLMA_10225"
                     /codon_start=1
                     /product="GTP-binding nuclear protein GSP1/Ran"
                     /protein_id="XP_022673756.1"
                     /db_xref="GeneID:34713901"
                     /translation="MSAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV
                     HPLAFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWH
                     RDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLW
                     LARKLAGNPQLDFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL"
     gene            complement(<469127..>469927)
                     /locus_tag="KLMA_10226"
                     /db_xref="GeneID:34713902"
     mRNA            complement(<469127..>469927)
                     /locus_tag="KLMA_10226"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819107.1"
                     /db_xref="GeneID:34713902"
     CDS             complement(469127..469927)
                     /locus_tag="KLMA_10226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673757.1"
                     /db_xref="GeneID:34713902"
                     /translation="MSRKFLSIDDAVAYINDELTKRGYLSDAKLKFGTPADKAEGSQD
                     QEEQLSRDKLTINVIHKLLQRVDTLQEKLKVQDEHLRKSQDQLLQRVKLAESEVAKLS
                     NTPEKQHRVTKVTKIQYRDKDTKPLEAKVRKLQLELEEQSLQLRQYADGDRPNITWGT
                     SLGPLLDADQLVNDKRPNMSPADMLSHKMSHVIDTNQRLSKDLKAAVGLISDINKTVY
                     TRFVLQIDPPSDGQAEEKAQDQDDLDDIANPTLKDLARDWKDIKSQLP"
     gene            complement(<470252..>470584)
                     /locus_tag="KLMA_10227"
                     /db_xref="GeneID:34713903"
     mRNA            complement(<470252..>470584)
                     /locus_tag="KLMA_10227"
                     /product="ATP synthase subunit H"
                     /transcript_id="XM_022819118.1"
                     /db_xref="GeneID:34713903"
     CDS             complement(470252..470584)
                     /locus_tag="KLMA_10227"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="ATP synthase subunit H"
                     /protein_id="XP_022673758.1"
                     /db_xref="GeneID:34713903"
                     /translation="MFRAVPLTLRASRGFSTGLVRRNVIQGLYLKELKSVHLKPVTAA
                     DAQGSVKPWTPPAAPKIPELELQSADALKEYASSEVETVKEATEQAAEVEEGDWLVLE
                     EIEDDHHH"
     gene            complement(<470800..>471399)
                     /gene="YHC1"
                     /locus_tag="KLMA_10228"
                     /db_xref="GeneID:34713904"
     mRNA            complement(<470800..>471399)
                     /gene="YHC1"
                     /locus_tag="KLMA_10228"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819129.1"
                     /db_xref="GeneID:34713904"
     CDS             complement(470800..471399)
                     /gene="YHC1"
                     /locus_tag="KLMA_10228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673759.1"
                     /db_xref="GeneID:34713904"
                     /translation="MVRFYCLYCKSYLTHDTASVRKSHLQGKNHIRLVADYYRNVSIN
                     EEKRQRKSTKKRKRLRKTPSNDEEQRIVQPVAIHCPTNKKKRMAERLKKRDVLEEFDV
                     LNEIYKGSPGYERIFKPENRVDVGHLLKVSKQPQRGNIHTNTTTGVSTKQNSNAQSQL
                     PPPRTLTSNNTYSTKFHDPSLLQQSINHTVKQIKRQTTA"
     gene            <471958..>473250
                     /gene="TUF1"
                     /locus_tag="KLMA_10229"
                     /db_xref="GeneID:34713905"
     mRNA            <471958..>473250
                     /gene="TUF1"
                     /locus_tag="KLMA_10229"
                     /product="elongation factor Tu"
                     /transcript_id="XM_022819141.1"
                     /db_xref="GeneID:34713905"
     CDS             471958..473250
                     /gene="TUF1"
                     /locus_tag="KLMA_10229"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="elongation factor Tu"
                     /protein_id="XP_022673760.1"
                     /db_xref="GeneID:34713905"
                     /translation="MSFLVPRFAVAKAFRPLSVGARAFSSSLRVSAAAFDRSKPHLNI
                     GTIGHVDHGKTTLTAAITKTLAERGGADFLDYSSIDKAPEERARGITISTAHVEYETE
                     KRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHI
                     VVFVNKVDTIDDPEMLELVEMEMRELLTQYGFDGDNTPVIMGSALCALEGKQPEIGEQ
                     AIMKLLDAVDEYIPTPARDLEKPFLMPVEDIFSISGRGTVVTGRVERGNLKKGEEIEI
                     VGHNTTPFKTTVTGIEMFRKELDQAMAGDNAGVLLRGVRRDQLKRGMVLAKPGTVKAH
                     TKFLASLYILTKEEGGRHSGFGENYRPQIYVRTADVTVVLKFPESVEDHSMQVMPGDN
                     VEMECELVHPTPLEAGQRFNIREGGKTVGTGLVTRILE"
     gene            <473706..>475520
                     /gene="ECM38"
                     /locus_tag="KLMA_10231"
                     /db_xref="GeneID:34713906"
     mRNA            <473706..>475520
                     /gene="ECM38"
                     /locus_tag="KLMA_10231"
                     /product="gamma-glutamyltransferase"
                     /transcript_id="XM_022819152.1"
                     /db_xref="GeneID:34713906"
     CDS             473706..475520
                     /gene="ECM38"
                     /locus_tag="KLMA_10231"
                     /codon_start=1
                     /product="gamma-glutamyltransferase"
                     /protein_id="XP_022673761.1"
                     /db_xref="GeneID:34713906"
                     /translation="MLFSTPYLWLLLLGSVDALSPHILAKQPDISIDIDRSPSLTPDQ
                     GLLKIGGKYAVASDLEICNNLTMNKIFLKYPGSNAVDAAVTVALCIGMVNFFNSGIGG
                     GGFSVISTKQEKVTYDFREMAPQLSNKTMFNDKEDYASIIGGLAIAVPGELAGLYKMW
                     EEHGSGKITWAEVLQPVIELGYEGWEIGEVLGASLGAYQHFLTMNYEDWKFVFNHDGT
                     IKKEGDWIRRPTLSKTLEVLAKNGSAAPFYDPKSYLVKSMVSKIQQHGGIITAEDFTQ
                     YSVRREKPLTTLIRHGWENMPDNDLTVLTSSGSSSGAALIAALKILDGFSSVTGGDYL
                     TEQTYQLVEAMKWLASARSRLGDYVHKDSLPSRIESILNDTWIKNAVNKIKENSQEGE
                     FRTLPHWKDYNPVYELNEPHGTAHFSVVDDQHNAVSLTTTVNLLFGSLVHDPVTGVIF
                     NNEMDDFSIPGRSNSFGLAPSAYNFIEPGKRPLSSMVPTIILNELGLPDMVVGASGGS
                     RISPSVLQVITRRYWYQMPLLEAIAYPRVHHQLLPDVLEVESIPMLGKSLIKQLEEMG
                     HFPKELPSRSVVNGICRVNAEWHAVSDYWRKRGIAAAI"
     gene            <475918..>479769
                     /gene="MSB1"
                     /locus_tag="KLMA_10232"
                     /db_xref="GeneID:34713907"
     mRNA            <475918..>479769
                     /gene="MSB1"
                     /locus_tag="KLMA_10232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819163.1"
                     /db_xref="GeneID:34713907"
     CDS             475918..479769
                     /gene="MSB1"
                     /locus_tag="KLMA_10232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673762.1"
                     /db_xref="GeneID:34713907"
                     /translation="MAEVKPLPQAPLRNQDRTDESMSTESNKETKGTVTKNDDDDDDE
                     FEFFHEFKRDKVRSPIHQITNELKIRGIDTEYLFLPFRPEQTNEKLLSFLNALFPLGN
                     GQPVADDKIPKILSKTDVWTLLQALKYIWCRLPKGEIIGWPAYIEFKNKEAEQNYSQK
                     SFLEIMPKCLDSPNHASIVYDFFDLIVTLASNSKKNKMSARKISKMCAIWAFQTSHYV
                     KASTSDASRKADVNGYKEGLKDWVPASEAMFHLLLAFIRSFVPTDSSKVKLPKSLRNI
                     LFDNAYPPKTADTFNHDTVLTVPLVTLTTTKFSRKPWQLIERCNELMSFDEPENFVTR
                     EDYALLKSLFKKKDNTGGISSKMSKESKRLMKCMSTKHSTFQAGWGKRKNLSVPNSKV
                     IKDSLSISRVDIDDYFIWAWLSTLSYEQTTQKRRLFGRSLILEFEFDGFKKWLILEES
                     DAMLVNKTYETDTMADSSNSVGSDEMKNKFLEQVEKAKVDGENPNSVTENVKNDAAVN
                     AKKPVHQLQEPVPVVEVKSKPLPIPQNIVSQDHKATKASQYTVAAPKSHSEIMSNMVL
                     DSSQPSEPSKEDRSSAVATNQMHMQARENRAVAPQEIPQGRSSPVRQRTTPPPHIYQN
                     PEPMPPKPRTPVQSQSVQPENVPTENDANEKPVPIFTSPYSKSNTEKLASNPSFGTYR
                     PQYRDLSPTPTPLSMSQNPSLAESVVRQSSSTYDENSIRELPVETYGKPTRRNPSESH
                     AINQAPSSNAKETEIGSKPAKDNVSSAEPPGDKDMADLTSMVDDMTLEMIIADPGDAV
                     KDLDASVRTTEEKFETLTMFDKYKMQAEEGKPLSERLNTSEVSVVTPLDLPSNTALPP
                     KRVQVGDEIAKSAIGRNAISEKNLPSVPKPVPVDVARNDQVKSPDVYPVESRSHYLDP
                     NSNINDRGSQSASPNRVQNSPNQQYVYGSPNGSAEPVVETRGRVMEHTQAQANFAPTY
                     TNQRSPIPPQEQARRVSPRIYQENIPSVSPTRQQASRSPDRYGYDYPSEGYAYSEPNY
                     GVPVPEAQSYREQRAPNPSQNVNYGSPYATQREQSERPNDGRQRLDPRAHNQRHLSPE
                     GQRYNQHPPTGHVASHSPQPMGYPGQPVSNRTFMSPTPNQNMPPQSGHPYQGHPSNRG
                     ALSYDPRRAQAGAVPQSIPQGAPYHGPHHVPPNSMPQGVPQGVPQGMGGAPYGPQRYR
                     NQSPTPHQQIYTSPPPMQQAQFRSPGNRGRQVQHQSPVAPQHAFAPDAPVKNKLHSGN
                     IAKNTNRKKLYADIRNGNFGI"
     gene            complement(479967..480038)
                     /locus_tag="KLMA_R101"
                     /db_xref="GeneID:34718616"
     tRNA            complement(479967..480038)
                     /locus_tag="KLMA_R101"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:34718616"
     gene            <480769..>481272
                     /locus_tag="KLMA_10233"
                     /db_xref="GeneID:34713908"
     mRNA            <480769..>481272
                     /locus_tag="KLMA_10233"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819174.1"
                     /db_xref="GeneID:34713908"
     CDS             480769..481272
                     /locus_tag="KLMA_10233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673763.1"
                     /db_xref="GeneID:34713908"
                     /translation="MSEPDSSVAPSNEDSADPKQEEKVEVEQKPDTTTNDSVEDPASK
                     LESKKPDTQLHEEQEQEQKKEEPKKASHWRAGSLKVKSFTGYALNLRCWKNADKQETV
                     ETEENDQQLEPEPEADPGTEPEPEAETETPSQAEDQQQKQPPKTEAENNQPHSDSEGS
                     ESQQQQV"
     gene            <483319..>484614
                     /locus_tag="KLMA_10234"
                     /db_xref="GeneID:34713909"
     mRNA            <483319..>484614
                     /locus_tag="KLMA_10234"
                     /product="glucan 1,3-beta-glucosidase"
                     /transcript_id="XM_022819185.1"
                     /db_xref="GeneID:34713909"
     CDS             483319..484614
                     /locus_tag="KLMA_10234"
                     /codon_start=1
                     /product="glucan 1,3-beta-glucosidase"
                     /protein_id="XP_022673764.1"
                     /db_xref="GeneID:34713909"
                     /translation="MMLSINQALSVLLFLVSVCFATPLPLSKRYLDYDSYKVKGVNIG
                     GWLVLEPFITPSLFEAFRTNNDNDDGIPVDEYHYCQQLGKDEATKRLTQHYSTWITED
                     DFAEMAKTGLNMVRIPIGYWAFDLLDDDPYVTGVQEGFLDQAIGWASKYNLKVWVDLH
                     GAPGSQNGFDNSGLRDQIKFQEDQNTQLLKNVLMHIIEKYSGENYTDTVIGVEVLNEP
                     LGPNIDMNKLKDLNNWAYDYLRNQVKGDQVLVIHDAFQAPQYWNDQLTLSDGNYGVLV
                     DHHHYQVFSPGELSRSMDDHISVACQQGWDSVFEGHWNLVGEWSAALTDCAKWLNGVG
                     VGYRYDGSFNKNGDTSYYIGSCEGSQDITTWSEDKKNNYRKYIEAQLDAYEMRNGWIY
                     WCWKTESTLEWDYKNLVQNGLFPQPLDDRQFPNQCHYGG"
     gene            <485779..>486390
                     /locus_tag="KLMA_10235"
                     /db_xref="GeneID:34713910"
     mRNA            <485779..>486390
                     /locus_tag="KLMA_10235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819196.1"
                     /db_xref="GeneID:34713910"
     CDS             485779..486390
                     /locus_tag="KLMA_10235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673765.1"
                     /db_xref="GeneID:34713910"
                     /translation="MASEDQPPKVPDGWKAVFDKEYKTWFYVNLKTNESQWEEPKGTT
                     WPHIDSQRPAGPPPPPTYDKATGQSARTGQPYPGQQYPQQPYPQQPYGQAPYGQVPYG
                     QPGYGQPGYGQPYGQPAYGQPAYGQRAYGQQPYAPQQKASGGSKYGGAMMGGLAGMGT
                     GLLAGSLLTSAMQPDVYVEENNYYDGGDGGGDYGGGDFDGGDF"
     gene            <486853..>491745
                     /gene="ULS1"
                     /locus_tag="KLMA_10236"
                     /db_xref="GeneID:34713911"
     mRNA            <486853..>491745
                     /gene="ULS1"
                     /locus_tag="KLMA_10236"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819207.1"
                     /db_xref="GeneID:34713911"
     CDS             486853..491745
                     /gene="ULS1"
                     /locus_tag="KLMA_10236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673766.1"
                     /db_xref="GeneID:34713911"
                     /translation="MSESDEVPIVNLTLEDEGDSETPESGKETPKPSRGLKRSLSGTE
                     MIPELQMGAKQFKSEEGLTELTSSFSPSGSASNVIVLSSEDEEEEKDRNKKSMNDNNS
                     QRVETDNRANEKRNQDQRDALATMKRARDQMRKLHSMIEVLTNKLARRKDFEDTIQLK
                     YRSLQQLYGEHPTIPSQKNLLSDLRQQLLSAQQRTAATRTKLYAIRDQLAATEHNIAE
                     LHEELERKSDQYETTMIPELVAVPKDVITNRKSHDLFVGTIYKVKELLRETSRPEGNK
                     NHISQLCDRLLSFESDIYHMRPTSAFIKAAIYHVLTELTAQGIKMPYVFQRFKELNLY
                     DEELSRVNDTVSNETKFKRNMEQLYSLADKLNRPDAEKNQIKHYANIVQNGYLNHSKQ
                     IINHSGHYNRIVHAMLRLEQLGVRIPFVMEEMKRLKYDINKAIDSVQVFEELRRLKAR
                     LLEEPSQSQKVEKLLTDLDILKSFITYSLEGDGTFDPTLIKKLYQLMVRLERLNINLP
                     LTAEALHKLGLSWHDFVDTEYFLMSIQKMESRLRNQSSRPREELNTIFHSLGCLTSFI
                     KEYEAIELNGDSKTPQFNTDEICHAAHILYSSGIMLVYCNEVLDKLGFTWRYYPEFSI
                     KAIETAKDLLQNDETKTIHEKGNILTLLQTLEKGIERSADKAIFHEMKIESFKLSLST
                     LKKSGCKITSVELTFQAIIDGSYLKALQTHSSNGDDGYFKTEPTDLTNSPVIKAQSQS
                     LDEDLYVSGQSSVKKSSEPPSTSSINSMRDEIEEAIINLSTNLSLNKKSQDTMVSALS
                     NILSFFKISMEFRANTVPSMWKSTVQMSIDVLDLFSYLNSIPKSLERLNELGFVIPEQ
                     YIDDDELAIIGRNTIKEEDFVTYDSDNDENIDDVIQNYNSRMDQSLRMTNIYNASDAS
                     SLRDLLEGLKEIETEVEGEEMTPNELTVNLLKHQRQGLRWLLSMEKSSKKGGLLADDM
                     GLGKTVQSLALIVSNKPEPESKVKTTLVVAPVSVLRVWKDEAAVKIKRDANLKVIIYG
                     GGENNINKFKTWEDIAQYDIVLVSYQTLASELKKHWPASWKTDGKQPDIHAVDIKLMN
                     QIKKKSEYFSPFYRNESEFYRIILDEAQNIKNKKTQAARACCTISSTYRWALSGTPIQ
                     NNIDELYSLLKYLRIPPYNKEAKFHADIGVVLNMKKAHDYNDSERKRAMKKVQVLLRA
                     IMLRRTKTSQIDGKPILELPEKKILEVSDKLEGEEEKFYQALEGKSKEKAKIMLESKQ
                     RQGAYSSILTLLLRLRQACLHSELVKIGESKAESAKIIHGKDFEKDWKPLFFTAKRMT
                     QDSAVVNTINVCLDEMTCPFCMEQMDLNSMAILSACGHCLCTQCVESFVDNGKLEPNA
                     AFGPKGTNSVNIPCLVCKKMNNDKQIVSYQLYDQVANLGYSIENLKSEYDNVVGEQKR
                     RLKNGYKIDYENLSESKKVEMCLDIIKKVVDSNDDEKIVIFSQFTIFFEILGYFIKKK
                     LNLNFLTYDGSMSSSQRGACIETFFQDKQYRIMLISMKAGNSGLTLTCANHVILADPF
                     WNPFVEDQAMDRCHRISQEREVYVHRLLIKSSVEDRIVELQNKKKVLVNLAMDPTQIR
                     EVNKLGRRELGFLFGLNALE"
     gene            <492217..>492942
                     /gene="HRI1"
                     /locus_tag="KLMA_10237"
                     /db_xref="GeneID:34713912"
     mRNA            <492217..>492942
                     /gene="HRI1"
                     /locus_tag="KLMA_10237"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819218.1"
                     /db_xref="GeneID:34713912"
     CDS             492217..492942
                     /gene="HRI1"
                     /locus_tag="KLMA_10237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673767.1"
                     /db_xref="GeneID:34713912"
                     /translation="MVSLTKRVLFEIIPNGPNETTITLSSTTNKGHYVSLRPFVNGEG
                     KEFPFEWAFGGTSDTLEVRKIDERSNGLDFNFKFDTNVKLEIPETHRGVIKTVFKTWD
                     AGLVEETGSVFPFGPDGAEVKFRELWQPIDPTRLEFVELSHGNDVDPNATSIALHTDN
                     SEYEGLVVIVGNWVQGILFKKGENTLKGVNLVRSQIDANKSVKDLFKFGPDAAKFPTE
                     LLLKEGSKTTSNGVEWSVIESNL"
     gene            <493414..>494091
                     /locus_tag="KLMA_10238"
                     /db_xref="GeneID:34713913"
     mRNA            <493414..>494091
                     /locus_tag="KLMA_10238"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819229.1"
                     /db_xref="GeneID:34713913"
     CDS             493414..494091
                     /locus_tag="KLMA_10238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673768.1"
                     /db_xref="GeneID:34713913"
                     /translation="MEPVFSNRVSIQWGDEAPKEDTSTWILTAPDGKFVDARISLESN
                     VPQWLITGKEVEIPTKEGYEFSIQFVHELDSVHGQNSEHSADTGHFKTLADKSRLEEG
                     EMYNVDRKQVMKYKEVWRSIDSLHSTPEHLVATSVSNGLKASEIQSFIWELPEDSKGN
                     ARGRLIKIGRFSQGIVEYNGSYQCIRIFDNSVVYQYGSNLEEIFGQFMRGLSTRNVQF
                     PWKRVYP"
     gene            494506..494577
                     /locus_tag="KLMA_R102"
                     /db_xref="GeneID:34718617"
     tRNA            494506..494577
                     /locus_tag="KLMA_R102"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:34718617"
     gene            complement(<494720..>495397)
                     /locus_tag="KLMA_10239"
                     /db_xref="GeneID:34713914"
     mRNA            complement(<494720..>495397)
                     /locus_tag="KLMA_10239"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819240.1"
                     /db_xref="GeneID:34713914"
     CDS             complement(494720..495397)
                     /locus_tag="KLMA_10239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673769.1"
                     /db_xref="GeneID:34713914"
                     /translation="MELPALVHCAEHDPNEGIFVDYCYNTVGSFSSTASTLRLRTGKN
                     CMKIEYHDENGDGFSSPTENTIYEKKEASLTYNKNANSQNSRTDSNISNVVSLLNYQA
                     SELLDQRQTLTTKWRLEFSLAVQKFQFAVTELFDTSSTGFEFITVSVKLPRNDPKKWY
                     HYITHSTYQQILTFFHFHDLSNVHRLNKNAVSCDQQRILEEVWILDGNESEGRGMIHN
                     LESLMWV"
     gene            <496084..>496491
                     /gene="ERV14"
                     /locus_tag="KLMA_10240"
                     /db_xref="GeneID:34713915"
     mRNA            <496084..>496491
                     /gene="ERV14"
                     /locus_tag="KLMA_10240"
                     /product="ER-derived vesicles protein ERV14"
                     /transcript_id="XM_022819252.1"
                     /db_xref="GeneID:34713915"
     CDS             496084..496491
                     /gene="ERV14"
                     /locus_tag="KLMA_10240"
                     /codon_start=1
                     /product="ER-derived vesicles protein ERV14"
                     /protein_id="XP_022673770.1"
                     /db_xref="GeneID:34713915"
                     /translation="MGVWLFIFAVVANCVNLFAQVHFTILYADLEADYINPIELCSKV
                     NKLILPEAVLQGVISILFLLNGYWFVFLINLGVLAYNVNKFYNKQQLLDATEIFRTLG
                     KHKRESFIKLAFYLFLFFFYLYRMIMALIAASE"
     gene            complement(<496910..>497773)
                     /locus_tag="KLMA_10241"
                     /db_xref="GeneID:34713916"
     mRNA            complement(<496910..>497773)
                     /locus_tag="KLMA_10241"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819263.1"
                     /db_xref="GeneID:34713916"
     CDS             complement(496910..497773)
                     /locus_tag="KLMA_10241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673771.1"
                     /db_xref="GeneID:34713916"
                     /translation="MSVRETDELRQRHLKLLYRLRGSASRTIDYDVVIEQEQEQEQEQ
                     QQQQQEPEREPELDPVYEQEQDEMPELGDDAPDLGNFQADEYGSDDHVMLPEQPVEVD
                     LARFEHMTLPQLSTPLTSMATIDVLRRLLETVLQSTIEDRISQFRRAGSARLKLKLKL
                     EIKILQRFLQQCVQDLSTLSDLNLSNNDLVYRLKQISLLKNSLSQSLLQVRSSATTYE
                     EPQLAVAQNQVVLDNFKRINELIMLQRNPDEESSNRNLPPDTAKIDPNSKSGLLSELR
                     KLNEGIQNITN"
     gene            <500357..>502258
                     /gene="NGR1"
                     /locus_tag="KLMA_10242"
                     /db_xref="GeneID:34713917"
     mRNA            <500357..>502258
                     /gene="NGR1"
                     /locus_tag="KLMA_10242"
                     /product="RNA recognition motif domain-containing protein"
                     /transcript_id="XM_022819274.1"
                     /db_xref="GeneID:34713917"
     CDS             500357..502258
                     /gene="NGR1"
                     /locus_tag="KLMA_10242"
                     /codon_start=1
                     /product="RNA recognition motif domain-containing protein"
                     /protein_id="XP_022673772.1"
                     /db_xref="GeneID:34713917"
                     /translation="MPVIPAPPSTTLQSSNELPRTLWMGDLDPGFDELIIVSIWMSLG
                     KSVKVKLIKSKTNALIPINTASNSNSNSASSSALEINGVSFIDPNKTNLHHAGYCFVE
                     FESFEDAQQGLSLNATPIPNIPCNTTSSKRTNDDGKRKFRLNWANGATLHSTIVPTPE
                     FSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANESERRN
                     ALIGMNGVQFQGRQLRVAYATPRNNVPQQHLSNNISQGQPQSQAQSQSQSQQNQNQNQ
                     NKHHHQAQAQAQSQSQSQSQAQAQALARAHAQAVAQAQAQAQAQAQAHYHAQQQAQQA
                     QTQAQHQQLLHLHQLTQQQQQQQQQQQQQQQQQQQQQHLRQSQLQFHNQQMASQQHPN
                     NNSTSTNQVINPMLNQTAPMLLDTANVIVSLQMPSASNNSDGLDRMNTGSTSVTTSTT
                     SAPTPAITSNSTGIGSPTISSISNSINNNASHSNVSIFNEHSPISSTTTTATATSTYT
                     GNGNTNAFNNHYQHYHNNNNNNNNITPPSTTVFVGGLNPNVNELQLFNLFKAFGTITD
                     IKVPPGKQCGFVTFNQRVEAEAAINGVQGFVLMGSPIRLSWGRLNPATSTPPSENNSA
                     ALSSSFLYV"
     gene            <502771..>503601
                     /gene="MET8"
                     /locus_tag="KLMA_10243"
                     /db_xref="GeneID:34713918"
     mRNA            <502771..>503601
                     /gene="MET8"
                     /locus_tag="KLMA_10243"
                     /product="siroheme biosynthesis protein MET8"
                     /transcript_id="XM_022819285.1"
                     /db_xref="GeneID:34713918"
     CDS             502771..503601
                     /gene="MET8"
                     /locus_tag="KLMA_10243"
                     /codon_start=1
                     /product="siroheme biosynthesis protein MET8"
                     /protein_id="XP_022673773.1"
                     /db_xref="GeneID:34713918"
                     /translation="MLQLSHKLEGKHVLLVGCGEVGYTRVLKLLPTKCKLTIVSPEIH
                     PKLATLVDNEKYEVGQIYKYLARPFKEDDLVMYGNNQAQSIEDLEKPCGFHMVFTCLP
                     DLELSRNIYQMTKLKLGTGTLCNVADQPPLCDFYFGANLRLGDEKYGLSIMISSEGMS
                     PRFTALFKKELMKTYGEWPVKECVEKLNDVREQVRKISEEYVSAFDDDRAQLIKFRME
                     WLKALTDKFGTQCYRLDVKKVIALFQSMIKSKEVNLDKIPEETLIDDETQNLGQLSIA
                     "
     gene            complement(<504155..>505588)
                     /gene="OLE1"
                     /locus_tag="KLMA_10244"
                     /db_xref="GeneID:34713919"
     mRNA            complement(<504155..>505588)
                     /gene="OLE1"
                     /locus_tag="KLMA_10244"
                     /product="acyl-CoA desaturase 1"
                     /transcript_id="XM_022819296.1"
                     /db_xref="GeneID:34713919"
     CDS             complement(504155..505588)
                     /gene="OLE1"
                     /locus_tag="KLMA_10244"
                     /codon_start=1
                     /product="acyl-CoA desaturase 1"
                     /protein_id="XP_022673774.1"
                     /db_xref="GeneID:34713919"
                     /translation="MEQVDLVSANMLAAGANKKSVRVVNGLGKLMGSKDMVNVDFEAD
                     SNMDYLLEQDKKDKEKYKNRKHISEMPWTVNNWHLHLNWLNLTLVVFIPLVGLYYALS
                     GRVPLKLEVLIFAMIYYCFGGVSITAGYHRLWAHRSYSAHWPLRLFFAVFGAASIEGS
                     IKWWGHSHRIHHRYTDTVRDPYDARRGLWYSHMGWMLLKPNPKHRARADIADLVDDWI
                     VRWQHRNFIPIMIFSAFILPAMFCHYMWNDFWGGLVYAGILRASAIQQATFCINSLAH
                     YLGDQPFDDRRTPRDNWITALVTFGEGYHNFHHEFPTDYRNAIKWYQYDPTKVIIYMT
                     SLFGLSYDLKKFSQNAIQQGLVQQQQKKLDRARSKLNWGSPLSQLPVWEKSEFLEHLK
                     ENSGLVVISGIVHDVSGYITEHPGGETLLQASLGKDATKAFNGGVYLHSNAAHNILAT
                     MRVAVVKDNVDQAAKFAARRGEVYEKK"
     gene            <507498..>509033
                     /gene="SDS23"
                     /locus_tag="KLMA_10245"
                     /db_xref="GeneID:34713920"
     mRNA            <507498..>509033
                     /gene="SDS23"
                     /locus_tag="KLMA_10245"
                     /product="protein SDS23"
                     /transcript_id="XM_022819307.1"
                     /db_xref="GeneID:34713920"
     CDS             507498..509033
                     /gene="SDS23"
                     /locus_tag="KLMA_10245"
                     /codon_start=1
                     /product="protein SDS23"
                     /protein_id="XP_022673775.1"
                     /db_xref="GeneID:34713920"
                     /translation="MQSSSSSASSSRHVSIVELLSTPPNANTNNSLASGPSNGNLSAG
                     TNGIAPNISLTSASNPSLINNSNSNPNMSPGLNGNDIDSISSGISSTSATSLASLHQQ
                     AAAAGVENSLPEYQQQQQQQQQQANAFMSPSPALSALDSHTVSRTNSESSFDTQLSRI
                     HTTKWQLIPLSQLIEQNKLIFINGSMSVEEAFNTLVKHNLTSLPVEKFPDDMDCLTFD
                     YNDLNSYLLLVLNKITVNNAEVTRQCQLGQPVPVGEIVKLTPKNPFYKLPEQENLSTA
                     MMILGSGVHRVAITNQENTKIKGILSQRRLIKYLWDNARSFQNLEHLFQKTLKDLKIG
                     VLDTHAKPTTRQSRIISIQGDELLIMALFKMHTERISSIAVIDHQGNLLGNISVTDVK
                     HITRTSQYPLLQNTCLHFISVILDKRGIEMGKDSFPIFHVYPTSSLARTIAKLVATKA
                     HRLWIVQPSGDTPVDSEKDKRSGKLIGVVSLTDILGLLARHQTEFKQVDPLTARRQRG
                     SIV"
     gene            <509500..>510054
                     /locus_tag="KLMA_10246"
                     /db_xref="GeneID:34713921"
     mRNA            <509500..>510054
                     /locus_tag="KLMA_10246"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819318.1"
                     /db_xref="GeneID:34713921"
     CDS             509500..510054
                     /locus_tag="KLMA_10246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673776.1"
                     /db_xref="GeneID:34713921"
                     /translation="MSRQVPKSLLQRQARRLSPATQAPQPTLSALVSQFTLSDNFDDT
                     TLEDQYEQLKPLLDDITYSNVPFDKWTSNNLNVLKHHLDTKAHLPWKSLPMQEKRVWY
                     LLGYGTWGPRRDFNKLKPNDIQWDQKATVAAPNSTKKLKTVNPIVLCSEDRIQWDKKK
                     RRLDPLTISVGAFASIITLIALTV"
     gene            complement(<510316..>510813)
                     /gene="UBC2"
                     /locus_tag="KLMA_10247"
                     /db_xref="GeneID:34713922"
     mRNA            complement(<510316..>510813)
                     /gene="UBC2"
                     /locus_tag="KLMA_10247"
                     /product="ubiquitin-conjugating enzyme E2 2"
                     /transcript_id="XM_022819329.1"
                     /db_xref="GeneID:34713922"
     CDS             complement(510316..510813)
                     /gene="UBC2"
                     /locus_tag="KLMA_10247"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 2"
                     /protein_id="XP_022673777.1"
                     /db_xref="GeneID:34713922"
                     /translation="MSTPARRRLMRDFKRMKEDSPPGVSASPLPDNVMIWNAMIIGPA
                     DTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDV
                     ASILTSIQSLFNDPNPASPANVEAATLFQDHKSQYVKRVKETVEKSWEDDMEDMADED
                     DEDDN"
     gene            complement(<511466..>512875)
                     /gene="PKP2"
                     /locus_tag="KLMA_10248"
                     /db_xref="GeneID:34713923"
     mRNA            complement(<511466..>512875)
                     /gene="PKP2"
                     /locus_tag="KLMA_10248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819340.1"
                     /db_xref="GeneID:34713923"
     CDS             complement(511466..512875)
                     /gene="PKP2"
                     /locus_tag="KLMA_10248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673778.1"
                     /db_xref="GeneID:34713923"
                     /translation="MSKRSIKKVLDVSQMPDFSRYSPTKSINELAPYISKTLSAYPSE
                     SKYINQQHYYHNENVLVEKYLPKQPHPMSLKQLAQYYDDSSKLTRQKILNSGKFVKEE
                     LCVRIAHKINRLQNLPFNLVNNFHFNQVYESYYNIFERFRKFPEIKDEETNLQFAKFL
                     HAILSDFNSLNLPHLIMGALESCILDLYPQDKMDQLISELLRARISRRLIVEEHLSMT
                     SNYLSGRKENMLVLGDIFQKCSAKAYLHDARTMCEAYMKNMYFDGIKMPQLILHGDTD
                     LEFYFLPSHLKFLLGEILRNKYEATVKETIRLGLDEAPPIVVTIIENDQSYLFRISDR
                     AGGVPYPDKLIWSFGKSQELATQSLANFHHLPGLQRESLYDSSSQVMERYTQTSLDHM
                     TETNLKKGRFKFEKPLIDLLQRSPRYKLGIGLALCKVYAEYWNGDLTVHSIQGYGTDT
                     VLKLGNLMTNTDRLQLDRV"
     gene            <512959..>514998
                     /gene="HPC2"
                     /locus_tag="KLMA_10249"
                     /db_xref="GeneID:34713924"
     mRNA            join(<512959..512971,513404..>514998)
                     /gene="HPC2"
                     /locus_tag="KLMA_10249"
                     /product="cylicin-2"
                     /transcript_id="XM_022819351.1"
                     /db_xref="GeneID:34713924"
     CDS             join(512959..512971,513404..514998)
                     /gene="HPC2"
                     /locus_tag="KLMA_10249"
                     /codon_start=1
                     /product="cylicin-2"
                     /protein_id="XP_022673779.1"
                     /db_xref="GeneID:34713924"
                     /translation="MNPNLSGTKSEDAKDAPAANAVPESVIEAPESRAPSSNSNSSLN
                     SEQPPTKKMKLVPNIAEELAKNRSPPLSKSHNNIKKQISISSLLSDPQPPKPIIRSPT
                     VILPSQRPGTSNISESSKNDILIARTNSPVNVQLDRSQSSLQSSSDSGDKDKILNKLA
                     PNIDAVLSSRPGSEAGSDSQQAQQPQSVAKTATNTTNDTNSASGNEVKATSNSKSSTT
                     TDQKSKAKVKEETPSKATKQGSKNGKGSASKSNKNSKATAKGKKDSKAKPEAKNKNDP
                     KVKSESPKPNSESSSETPNNNTPEVVTNDSKVKSETTDSETAESKKEKSKKKKTETPR
                     KLVPAPPIKSPKLSSVEVDGKPIVILDIPLHDVSSNEYLDENGQVVFNVYNMIQEKYG
                     GQISKTKRNLIVDLNDDVEAAEDNEGEDGAEVEHDAEDDDDDDDDDEEDDEEDGAAID
                     STKNKDSSSSPKKKRPHPLKGKSRIGKYDIEDPFIDDSELLWEEQRAATRDGFFVYFG
                     PLIEKGQYASFQRVDGTMKKGGIKNPK"
     gene            complement(<515100..>517214)
                     /gene="YBP1"
                     /locus_tag="KLMA_10250"
                     /db_xref="GeneID:34713925"
     mRNA            complement(<515100..>517214)
                     /gene="YBP1"
                     /locus_tag="KLMA_10250"
                     /product="YAP1-binding protein 1"
                     /transcript_id="XM_022819363.1"
                     /db_xref="GeneID:34713925"
     CDS             complement(515100..517214)
                     /gene="YBP1"
                     /locus_tag="KLMA_10250"
                     /codon_start=1
                     /product="YAP1-binding protein 1"
                     /protein_id="XP_022673780.1"
                     /db_xref="GeneID:34713925"
                     /translation="MTLPEERFEELKDKLLTAFVEEKDDMITLVTIIDLYCEEINAKG
                     SLEQKVDFLKFLLGLLQQNKDVVYEIGWDLPKILINFIHWANRSAGSLEVSKQLLCAT
                     MKCFNEVALFGNAKECFFAGCELMKSIKINDESLIRLILEEEPLAAESEGEDENESES
                     EEGNHGDADDDEKKKKEKKKSTKDSNLSEESDLLRDLEAGVQYYGRQPQELIAELRFH
                     AIIELIGSTLKRVVTLYPSKFLGEAVSSLVLFISHNNSEMDDALFALRRIYSFIRGYI
                     PPSSPPNANEEVSEEDLKSIKDAEEVLQRKLICNLLTISAAQLLKEKTLNANVRYHNS
                     IHPGSDMEVISDYSNMILDMIFRYYQLAISFDIDVAKEFQRLCIDESKRIYRSLPKNE
                     DIKSEEELKEITNLSYQLAYTYEIEKVANVKEILLHPAGICMLYTLSGENNLPEPDIK
                     LSVEDAIYLYLRFCTPPMLSSIFENKALQDAARMWVLYALTNSSVTESMESLKNIPSY
                     LVSLFLQVELFRASHQISDSVRKLEFSVITRVLCLMPEDFAFSFIKDTLLSCPYEQAK
                     CCVLAILKDMMIRGKRIQSENKADDIVNDMEKLRIQDKPPLPARPYILINEDRIATLH
                     SIAILSINDCVISPESTKLRTLLTYLNFFITFQKKWDQDLLKEICDKVNEQILTQDKS
                     SDEIRTQYPLIEHAVESISAKF"
     gene            <517486..>518073
                     /gene="ATG12"
                     /locus_tag="KLMA_10251"
                     /db_xref="GeneID:34713926"
     mRNA            <517486..>518073
                     /gene="ATG12"
                     /locus_tag="KLMA_10251"
                     /product="autophagy-related protein 12"
                     /transcript_id="XM_022819374.1"
                     /db_xref="GeneID:34713926"
     CDS             517486..518073
                     /gene="ATG12"
                     /locus_tag="KLMA_10251"
                     /codon_start=1
                     /product="autophagy-related protein 12"
                     /protein_id="XP_022673781.1"
                     /db_xref="GeneID:34713926"
                     /translation="MNSGVLLSESETDTSETSERQSGLLSAQGSIKGKLEEFSAKLDR
                     LRLDDENSEEEHALKSQSVSVNSEGNISRSASASASASASASAKLRNSQSPVQEYTSD
                     TNPETDASFRVKIRLRPIGSIPQIQPRVCQISSHQNFSALVKFLCKRLKRNHVHCYIN
                     NAFAPSLNQTIGDLWSQFKTNDELIVSYCETVAFG"
     gene            <518329..>518940
                     /gene="DUO1"
                     /locus_tag="KLMA_10252"
                     /db_xref="GeneID:34713927"
     mRNA            <518329..>518940
                     /gene="DUO1"
                     /locus_tag="KLMA_10252"
                     /product="DASH complex subunit DUO1"
                     /transcript_id="XM_022819385.1"
                     /db_xref="GeneID:34713927"
     CDS             518329..518940
                     /gene="DUO1"
                     /locus_tag="KLMA_10252"
                     /codon_start=1
                     /product="DASH complex subunit DUO1"
                     /protein_id="XP_022673782.1"
                     /db_xref="GeneID:34713927"
                     /translation="MSEHKVDVTTISKMIPQIFDQMRSQTTSTNFVSTTASLSTQSLL
                     KEQEELDKIIPVIQNLNAKIKECKEGDMERIKETCRAMNIILDKFINIQSQASYVNKL
                     MRNEEYLDYVASGKSEEEYLLEKQKELEELDKKVKQASAMHAPTMQPPSSSIPRVSDS
                     RRVNKPVLRNGRSGLFSQNSRRGGSGPSATTGGNTVRRKVSRP"
     gene            complement(<519130..>522657)
                     /gene="PYC2"
                     /locus_tag="KLMA_10253"
                     /db_xref="GeneID:34713928"
     mRNA            complement(<519130..>522657)
                     /gene="PYC2"
                     /locus_tag="KLMA_10253"
                     /product="pyruvate carboxylase 2"
                     /transcript_id="XM_022819396.1"
                     /db_xref="GeneID:34713928"
     CDS             complement(519130..522657)
                     /gene="PYC2"
                     /locus_tag="KLMA_10253"
                     /codon_start=1
                     /product="pyruvate carboxylase 2"
                     /protein_id="XP_022673783.1"
                     /db_xref="GeneID:34713928"
                     /translation="MSTQNDLAGLRDNSNLLGEKNKILVANRGEIPIRIFRTAHELSM
                     KTVAIYSHEDRLSMHRLKADEAYVIGEPGKYTPVGAYLAIDEIIKIAQLHGVSFIHPG
                     YGFLSENSEFAKKVADSGITWVGPPADVIDAVGDKVSARNLAERADVPVVPGTPGPIE
                     TVEEAVEFVEKYGYPVIIKAAFGGGGRGMRVVREGDDIADAFQRAKSEAVTAFGNGTC
                     FVERFLDKPKHIEVQLLADHYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPESVRNAI
                     LTDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIVAAQI
                     QIAAGASLEQLGLLQDRITTRGFAIQCRITTEDPSKNFQPDTGRIDVYRSAGGNGVRL
                     DGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTL
                     LTHPVFKSGDYWTTFIDDTPQLFEMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKL
                     KTHPTIPHLHKADGSILDVSAKPPAGWRDVLLQHGPEEFAKQVRKFKGTLLMDTTWRD
                     AHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGATFDVSMRFLHEDPWERLRTL
                     RKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLTV
                     GVDAVKKAGGVVEATICYSGDMLAPGKKYNLDYYLDIVEQVVKRGTHILGIKDMAGTL
                     KPSAAKLLIGSIRTKYPDLPIHVHTHDSAGTGVASMAACAFAGADVVDVATNSMSGMT
                     SQPSVNALLAALDGEIDCNVNVSYISQLDAYWAEMRLLYSCFEADLKGPDPEVYVHEI
                     PGGQLTNLLFQAQQLGLGEQWAETKRAYREANLLLGDVVKVTPTSKVVGDLAQFMVTN
                     KLTSDDVKRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRRKLTKRPGLE
                     LAPFDLEGIKEDLTNRFGDIDDCDVASYNMYPKVYEDFRKIREKYGDLSVLPTKNFLS
                     PPSIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVADRSQKVE
                     TISKPKADAHDPFQIGSPMAGVVVEVKVHKGSLISKGQPVAVLSAMKMEMVISSPSDG
                     QVKEVLVKDGENVDASDLLVVLEEAPAKE"
     gene            complement(<524186..>524566)
                     /gene="SOH1"
                     /locus_tag="KLMA_10255"
                     /db_xref="GeneID:34713929"
     mRNA            complement(<524186..>524566)
                     /gene="SOH1"
                     /locus_tag="KLMA_10255"
                     /product="mediator of RNA polymerase II transcription
                     subunit 31"
                     /transcript_id="XM_022819407.1"
                     /db_xref="GeneID:34713929"
     CDS             complement(524186..524566)
                     /gene="SOH1"
                     /locus_tag="KLMA_10255"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 31"
                     /protein_id="XP_022673784.1"
                     /db_xref="GeneID:34713929"
                     /translation="MSEQTSTEPQPQLEDNELPTRFEIELEFIQSLANIPYVTYLLTQ
                     LQLWKDPKFKRYLKYLEYWYEPEYAQCIVYPNSLFMLKLLNTLFEGSTINDNNVLEGC
                     EHIPRILQSQGTQWMNEMVERWRE"
     gene            complement(524849..524971)
                     /locus_tag="KLMA_R103"
                     /db_xref="GeneID:34718618"
     tRNA            complement(join(524849..524886,524938..524971))
                     /locus_tag="KLMA_R103"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718618"
     gene            <525417..>526862
                     /gene="RRN11"
                     /locus_tag="KLMA_10256"
                     /db_xref="GeneID:34713930"
     mRNA            <525417..>526862
                     /gene="RRN11"
                     /locus_tag="KLMA_10256"
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN11"
                     /transcript_id="XM_022819418.1"
                     /db_xref="GeneID:34713930"
     CDS             525417..526862
                     /gene="RRN11"
                     /locus_tag="KLMA_10256"
                     /codon_start=1
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN11"
                     /protein_id="XP_022673785.1"
                     /db_xref="GeneID:34713930"
                     /translation="MFQLPIINRSSRNRKRRRIRYQYINTLQKRYDQIYNAKPENQSS
                     VGMLTPENSESESTELDKTRRRKKRLQSVLGNALDSSDEEMGEDDNNLDEISNPEMQF
                     FENYTKPESTYEVWNFDANKRAPINKQRISYNTVKKLEKAADKVVTKGLNYQTKKSNM
                     YFQALKHGYDIHSKPELMRQKSMHLAHLNQLLHINLLRQNWNVAYRCFSLLIRFEEVD
                     VRSLWAIGSELLKVVQGPESNESYLEWFSQVFSSRMQFNQGTNYSLDPVFRSGSRTHA
                     PVFVLSWLWTRLFDATSSKITSDKQGSLQSLIDRIGEMVLSPPYIEDAEVWFIFGLTH
                     LVMASELSYAFRQKADTILGSRADIARNNVIQHINTAKNCLQTCKSIGKYKFPEKEIE
                     QQLLQLERSLYSDDLNEDSSDDDSGNYAQDDEHDDNSDDQMISNENFGYSVTNKELLD
                     TQTYQMADFGSESESDVFGNERPITFGYESD"
     gene            complement(<526992..>528572)
                     /gene="HRD1"
                     /locus_tag="KLMA_10257"
                     /db_xref="GeneID:34713931"
     mRNA            complement(<526992..>528572)
                     /gene="HRD1"
                     /locus_tag="KLMA_10257"
                     /product="ERAD-associated E3 ubiquitin-protein ligase
                     HRD1"
                     /transcript_id="XM_022819429.1"
                     /db_xref="GeneID:34713931"
     CDS             complement(526992..528572)
                     /gene="HRD1"
                     /locus_tag="KLMA_10257"
                     /codon_start=1
                     /product="ERAD-associated E3 ubiquitin-protein ligase
                     HRD1"
                     /protein_id="XP_022673786.1"
                     /db_xref="GeneID:34713931"
                     /translation="MLLTQKFVSFVVVSYIGAIWSLYTCITTSYSFLDAICMITEGSH
                     ALICGNFVLLHIILLSRWFVRFLFGELRLIEYEHILERISYVVLHFIMTYSGATDGHI
                     LSLILNCALLVFCKTLHWILRDRMDFTFQATAVHTRISSLICSKYMLSLLIILTMDGL
                     LSLYYLSFFKQSSSVTEGIILFSEHLIISAEMVKILLLTGLNFLEIYTIKQRSRSHRI
                     VEPVENDGIGQGIDLDEEDEDNLIGIEGKFIYEKLFEIITNTLQILIKFVASFLLSRP
                     MTTISAFWDTAMTFKSARVLWKSWKGSKSLDASLKDATDSQIENGMFDLCIVCMEDFV
                     SSSERKNEGKKVKILPCGHALHLSCLKNWIARSPTCPICRVPIFDQAGNIVPYPADQS
                     STENNPANTDDSQERNNSMEVESDNTISNNTDEGITSTSHLTSPENITVATTRRSSLV
                     LPVESSNENTHTFRIVTESGKQLEGSISLKNNMDLNQQSITVPQNLFEEQDASQLKRK
                     VAELESMIEDLSKKVKRE"
     gene            <529008..>529499
                     /locus_tag="KLMA_10258"
                     /db_xref="GeneID:34713932"
     mRNA            <529008..>529499
                     /locus_tag="KLMA_10258"
                     /product="OPA3-like protein"
                     /transcript_id="XM_022819440.1"
                     /db_xref="GeneID:34713932"
     CDS             529008..529499
                     /locus_tag="KLMA_10258"
                     /codon_start=1
                     /product="OPA3-like protein"
                     /protein_id="XP_022673787.1"
                     /db_xref="GeneID:34713932"
                     /translation="MSGIAIKLGALLVRQITRPMANVLKRQAKNHAAFNEICIMLAQK
                     MHVTDVILRSKLTPTKFRQPIRPLNDAKAVENGATLLSEAFVFTVTGSVVVWETLRQR
                     QKELDRREQVSKDISTLQSEIEELRSTITAQNDELHSLRESIRQELATMKNRKHSKAP
                     NTE"
     gene            complement(<529809..>530207)
                     /gene="HTZ1"
                     /locus_tag="KLMA_10259"
                     /db_xref="GeneID:34713933"
     mRNA            complement(<529809..>530207)
                     /gene="HTZ1"
                     /locus_tag="KLMA_10259"
                     /product="histone H2A.Z"
                     /transcript_id="XM_022819451.1"
                     /db_xref="GeneID:34713933"
     CDS             complement(529809..530207)
                     /gene="HTZ1"
                     /locus_tag="KLMA_10259"
                     /codon_start=1
                     /product="histone H2A.Z"
                     /protein_id="XP_022673788.1"
                     /db_xref="GeneID:34713933"
                     /translation="MSGKVHGGKGKSGAKDGGSLRSQSHSARAGLQFPVGRVKRYLKK
                     NAAGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDEL
                     DSLIRATIASGGVLPHINKALLLKVEKKHK"
     gene            <531686..>533644
                     /gene="PLB"
                     /locus_tag="KLMA_10260"
                     /db_xref="GeneID:34713934"
     mRNA            <531686..>533644
                     /gene="PLB"
                     /locus_tag="KLMA_10260"
                     /product="lysophospholipase"
                     /transcript_id="XM_022819462.1"
                     /db_xref="GeneID:34713934"
     CDS             531686..533644
                     /gene="PLB"
                     /locus_tag="KLMA_10260"
                     /codon_start=1
                     /product="lysophospholipase"
                     /protein_id="XP_022673789.1"
                     /db_xref="GeneID:34713934"
                     /translation="MRAIRSSNLLIIAWLFALKLSIAQAWSPSNGYKPSKVDCDDNIN
                     LVRDASSVSDNESDWLKKRNQVTLPALKDFLKRGFKNFTSDTSLIDNLLSDESKAPKI
                     AVACSGGGYRAMLSGAGMLSAMDNRTDGANEHGLGGLLQSATYLAGLSGGNWLVGTLA
                     YNNWTSVQAIVNNMTQDDSIWDISHSIVTPGGFNIFESISRWDDISDAVEDKKDAGYN
                     TSITDIWGRALSYGFFPSLKDGGVGYTIDSLRDSDVFKNAEMPFPISLAVGRYPGTSV
                     INLNATNFEFNPFEMGSWDYTLHSFTDIKYVGTNVSNGRPKEKGQCVAGYDNTGFVLG
                     TSSSLFNQFLLQLNTTKLPKFLFNMIQDFLTDLSEDSDDISIWAPNPFRDVKNIPANY
                     SQSISEGDTLYLVDGGEDGQNIPLSPLLQTERDVDVIFALDNSADTEEFWPNGFSLTQ
                     TYERQFGMQGKGIAFPYVPDNNTFVNLGLNKRPTFFGCDAKNLTNLEFIPPLIVYMPN
                     TRESYNSNTSTFKMSYSTSERLHMIKNGFEAVTRNNFTQDSNFMGCVSCAILRRKQES
                     SNQTLPDGCNACFKQYCWDGTVNSTTPEKSSTAGSSSQSASASASAASSQSTSTSSST
                     KKNDGPINDPKSALSLLIGGIATALMTI"
     gene            complement(<534144..>535226)
                     /gene="TAF4"
                     /locus_tag="KLMA_10261"
                     /db_xref="GeneID:34713935"
     mRNA            complement(<534144..>535226)
                     /gene="TAF4"
                     /locus_tag="KLMA_10261"
                     /product="transcription initiation factor TFIID subunit 4"
                     /transcript_id="XM_022819474.1"
                     /db_xref="GeneID:34713935"
     CDS             complement(534144..535226)
                     /gene="TAF4"
                     /locus_tag="KLMA_10261"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 4"
                     /protein_id="XP_022673790.1"
                     /db_xref="GeneID:34713935"
                     /translation="MAKSPKRKNSESDNGVSNKRSKSFEFGKIENGLEPSGSDFGGDL
                     PTPFDTMVTEQPLALPKASSPSMNLGSPRNTPSSTTTGAKTEKTSTTTKEHGKKGGND
                     GTGKPQQSDPDKLSDALLSAGVDIREEEALLSSTVARTKAAGSVASNQLPPHPPFLHP
                     KNVADFMKRVALEQNFNQDFNKNADILGLMSTACELYMRDIITNSLILSIHRRKGIKL
                     NTGRRSEVSRSLRDLALRQKAHEERRVQRRIALGLEKQKADTRLDSEETQHRASNATA
                     NLMIAGGSKKKYSWLTAGSKSSSTDLKNQGNVSSAVAARGEMGIKYREAREEPGIVMR
                     DLLLALENRRVGVNNVIAKGYARIRD"
     gene            <535877..>536974
                     /gene="RCL1"
                     /locus_tag="KLMA_10262"
                     /db_xref="GeneID:34713936"
     mRNA            <535877..>536974
                     /gene="RCL1"
                     /locus_tag="KLMA_10262"
                     /product="RNA 3'-terminal phosphate cyclase-like protein"
                     /transcript_id="XM_022819485.1"
                     /db_xref="GeneID:34713936"
     CDS             535877..536974
                     /gene="RCL1"
                     /locus_tag="KLMA_10262"
                     /codon_start=1
                     /product="RNA 3'-terminal phosphate cyclase-like protein"
                     /protein_id="XP_022673791.1"
                     /db_xref="GeneID:34713936"
                     /translation="MSAGSRYITFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGL
                     KDYEVSFLRLMEAVTNGSSIEISYTGTTVIYRPGIITGGSYTHQCPNSKPVGYFVEPM
                     LYLAPFSKKKFSIMFRGITSSHNDAGIDGIKWGLMPVLEKFGVRECALHTLKRGSPPL
                     GGGEVHLVVDSLIAQPITMHALDRTLISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSV
                     GCEVNITADVWRGENSGKSPGWGLTLVAENKQGWRIFSEAIGDAGDVPEDIGATVAYQ
                     LLEEISKSGVVGRNQLPLAIIFMVIGKEDIGRLRITKDQIDERLIWLLRDIKNVFGTE
                     VFLKQVDDDNTNDMIATIKGIGFTNTSKKIA"
     gene            complement(<537103..>538647)
                     /gene="MVP1"
                     /locus_tag="KLMA_10263"
                     /db_xref="GeneID:34713937"
     mRNA            complement(<537103..>538647)
                     /gene="MVP1"
                     /locus_tag="KLMA_10263"
                     /product="sorting nexin MVP1"
                     /transcript_id="XM_022819496.1"
                     /db_xref="GeneID:34713937"
     CDS             complement(537103..538647)
                     /gene="MVP1"
                     /locus_tag="KLMA_10263"
                     /codon_start=1
                     /product="sorting nexin MVP1"
                     /protein_id="XP_022673792.1"
                     /db_xref="GeneID:34713937"
                     /translation="MDFETDPWRVDSPEVNVSETVWQPINNSSNGNMKPFSSSSLQEE
                     ANKRLNDDYTGTGLFNNNLNVSNDKPAIGSELYAGDSVWENTGFKAVNQDPDVQGLTH
                     FQATDTPQYAANDEYRSWVESIRKTYSPLSDDIVVVEEIPEREGLVFKHTNYSIKHLI
                     PLPGTDPSEDRTVVRRYSDFDWLQDVLLRKYPFRMIPELPPKKIGSQNADPLFLAKRR
                     KGLSRFINLVMKHPILKKDDLVLTFLTVPTDLSSWRKQAQYDTSEEFMDKRISGYFMK
                     LWRKEFSEQWNKTDEKIDSVLDTWVKVTVLVERYEKRMKQVGHERRLMSNILGKIPEA
                     TQILYPQSSDTVLQINEGVELLAGHLNACADVIDQENREVEEGLSVRFKVFIDVIIAL
                     KGLFERYKMMAGNNIPQLQRRVEINQEKLTTLEGNPNVKGAEYDRVKQSIARDKRGII
                     EQMNRSWLIRECILQEFTIFQETQFLITDCLQRWIEINLRHSNQNVDNWEKICQKLSD
                     MPIERR"
     gene            complement(<538921..>539823)
                     /gene="MDM12"
                     /locus_tag="KLMA_10265"
                     /db_xref="GeneID:34713938"
     mRNA            complement(<538921..>539823)
                     /gene="MDM12"
                     /locus_tag="KLMA_10265"
                     /product="mitochondrial distribution and morphology
                     protein 12"
                     /transcript_id="XM_022819507.1"
                     /db_xref="GeneID:34713938"
     CDS             complement(538921..539823)
                     /gene="MDM12"
                     /locus_tag="KLMA_10265"
                     /codon_start=1
                     /product="mitochondrial distribution and morphology
                     protein 12"
                     /protein_id="XP_022673793.1"
                     /db_xref="GeneID:34713938"
                     /translation="MSVDINWDSIREDEGVNEGVKDFLNSRLQEFALPSYVSNLKVTN
                     FELGSIPPNVTLKQMDDPLDEFYNYLLQMGDISEETSKDRNTDIQLLVELDYKGDMSI
                     ELSADLVLNYPSPQFMTLPVKLRISDIGMHCLCLLAYMKKQLFISFLCDVSDPLLEMN
                     KLQVDPSGPNFMGKRALERISLIRNIKIHTELGEQDQAQGSVLRSVGKLEEFLVDLFR
                     NLIRREAAWPSWIDLDFTPSDEEADEQEEQKEMQDEDGKTDSPQDDIGIPQSSVPISP
                     KTSSADSAFSTSLPSSRDSNSRSQ"
     gene            <540054..>540641
                     /gene="COQ10"
                     /locus_tag="KLMA_10266"
                     /db_xref="GeneID:34713939"
     mRNA            <540054..>540641
                     /gene="COQ10"
                     /locus_tag="KLMA_10266"
                     /product="coenzyme Q-binding protein COQ10"
                     /transcript_id="XM_022819518.1"
                     /db_xref="GeneID:34713939"
     CDS             540054..540641
                     /gene="COQ10"
                     /locus_tag="KLMA_10266"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="coenzyme Q-binding protein COQ10"
                     /protein_id="XP_022673794.1"
                     /db_xref="GeneID:34713939"
                     /translation="MLVSSYAIPSRLGTRSLLRRSFFNISSTASANDEQHYILRRKIR
                     GTPQEVYEVVSEVSKYHEFIPYCVESFVNARDEMKRPIEAGLRVGFRQYDEKFICKVE
                     CKDISTLVKTVSAESLSHNLFHVLNSKWTIKAHPGRTDYTEVELLLRYQFKSKLYSSV
                     ASLFAKSVTELILKAFDRRVYQLKRDNSMSIKNTK"
     gene            complement(<540875..>541648)
                     /gene="AIM34"
                     /locus_tag="KLMA_10267"
                     /db_xref="GeneID:34713940"
     mRNA            complement(<540875..>541648)
                     /gene="AIM34"
                     /locus_tag="KLMA_10267"
                     /product="SAP super family"
                     /transcript_id="XM_022819529.1"
                     /db_xref="GeneID:34713940"
     CDS             complement(540875..541648)
                     /gene="AIM34"
                     /locus_tag="KLMA_10267"
                     /codon_start=1
                     /product="SAP super family"
                     /protein_id="XP_022673795.1"
                     /db_xref="GeneID:34713940"
                     /translation="MSLRKVRSLPSLRVLCEASNPLIKPVAPALPYQIRQVHNTKKNE
                     HSPLLTNDSHSAFTRMSLKTLKNECRSRGLKVSGRKSELVDRILLFEGRGSKKIHTSS
                     VSRAKNDSSHIDAMKIPDVAKLEAEANSKNRDYIVKIPTLVNNASAEPKTKIEKEYEQ
                     KLKSADKKPLVENVGTVTTPDTDHVIQTPSFGDKVQVVNPEEEALENDSQKLDNKQQQ
                     QQSYDEELTSRDKWFLWGFAGAVTAWWSLKSKPKDKSKK"
     gene            complement(<542471..>542935)
                     /gene="MIC17"
                     /locus_tag="KLMA_10268"
                     /db_xref="GeneID:34713941"
     mRNA            complement(<542471..>542935)
                     /gene="MIC17"
                     /locus_tag="KLMA_10268"
                     /product="mitochondrial intermembrane space cysteine
                     motif-containing protein MIC17"
                     /transcript_id="XM_022819540.1"
                     /db_xref="GeneID:34713941"
     CDS             complement(542471..542935)
                     /gene="MIC17"
                     /locus_tag="KLMA_10268"
                     /codon_start=1
                     /product="mitochondrial intermembrane space cysteine
                     motif-containing protein MIC17"
                     /protein_id="XP_022673796.1"
                     /db_xref="GeneID:34713941"
                     /translation="MARSRGSARPVSRPQTRSASTVAAPAHAPAHAPAPQANAYSHPQ
                     AAAQPKQPGMFAQMASTAAGVAVGSAVGHTIGAGLTGLFSGSSSAPAEQQQQQQVAAP
                     AQADAFQNQQATHCDVDARNFTRCLEDNGGNMQICDYYLQQLKACQEAARQY"
     gene            complement(<543554..>545857)
                     /gene="TOP1"
                     /locus_tag="KLMA_10269"
                     /db_xref="GeneID:34713942"
     mRNA            complement(<543554..>545857)
                     /gene="TOP1"
                     /locus_tag="KLMA_10269"
                     /product="DNA topoisomerase 1"
                     /transcript_id="XM_022819551.1"
                     /db_xref="GeneID:34713942"
     CDS             complement(543554..545857)
                     /gene="TOP1"
                     /locus_tag="KLMA_10269"
                     /codon_start=1
                     /product="DNA topoisomerase 1"
                     /protein_id="XP_022673797.1"
                     /db_xref="GeneID:34713942"
                     /translation="MSIKLKDDSSSEDEESTLVTVSKHKKSSKKITKSVKRESSDEDD
                     DILHAARKKQKRLKKDLKDTKTRNSHENGKSSHKTKKKTSKTIKKESENIDDEDKTLA
                     DVASQSQLSSSTKASSVDIKESSEDFKWWENNDKEDDSIKWTTLRHNGVIFPPEYQPL
                     PSHVKLYYDGKPVDLPPQAEEVAGFFAAMLETDHVKLPIFQKNFMHDFLEVLKENGGT
                     RNNVEIKDFEKLDFTKIAEYFQVQKEQKKQLSPQEKKQLKLEKEEFEKPYKFCEIDGR
                     IEQVGNFRIEPPGLFRGRGAHPKNGKLKRRVYPEDVVLNLDKNAPIPEPPKGHKWGEI
                     RHDNTVQWLSMWRENITNSFKYVRFAANSTLKGISDFKKFEKARMLKDHIDKVRADYK
                     AKLKSPKTLDRQMAVATYLIDVFALRAGGEKSEDEADTVGCCSLRYEHVTLKPPNTVI
                     FDFLGKDSIRYYQEVEVDAQVFKNLKIFKRPPSGPGHQLFDRLDPSILNKHLQNYMPG
                     LTAKVFRTYNASKTMQDQLDLIPNEGTVAEKMLRYNAANRTVAILCNHQRTVTKGHAT
                     SVQKATERIEELEWQKVRYKRAILQLDKSERKKDPNYFKEIDDLSKEEELTIHKRIIE
                     REREKYKRKFERENEKRKFDKEEALPDSQLMEWLAKVDDLEKQYQRESDTGIIEVRES
                     LKNVEKLKQQVERLEKRITNASLQLKDKEDNSTVALGTSKINYIDPRLSVAFCKKFDV
                     PIEKVFTKTLREKFRWAIESADENWRF"
     gene            <547509..>549623
                     /gene="CDC5"
                     /locus_tag="KLMA_10270"
                     /db_xref="GeneID:34713943"
     mRNA            <547509..>549623
                     /gene="CDC5"
                     /locus_tag="KLMA_10270"
                     /product="cell cycle serine/threonine-protein kinase
                     CDC5/MSD2"
                     /transcript_id="XM_022819562.1"
                     /db_xref="GeneID:34713943"
     CDS             547509..549623
                     /gene="CDC5"
                     /locus_tag="KLMA_10270"
                     /codon_start=1
                     /product="cell cycle serine/threonine-protein kinase
                     CDC5/MSD2"
                     /protein_id="XP_022673798.1"
                     /db_xref="GeneID:34713943"
                     /translation="MSAPPLQIINDKQLNARSHNIHTPIKAKRAVAELHLADRAAAVS
                     VKPSHHHNDANNRQPPQKKKKEKLSSLCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQ
                     MKDDKGKIFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKHPNIVQFTDCFEDDTNVYI
                     LLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAIRYMHSRRVIHRDLKLGNIFFDK
                     DNNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTGKHTGHSYEVDIWSIGVMLY
                     ALLFGKPPFQAKEVETIYERIKCRDFSFPADKPVSSDAKNLISHILQLNPAARPSLYE
                     ITDSVWFRNTFPPKLPANISKETPNFDHLSFNESLVNLKHCMLNSGLLKSTQPHSSDG
                     NKNPIEFVRTELEEERNRAVLPQSLSPGGTKNKYKEVIDLDGHRKFNEMAHQNRLKRA
                     GENLFFKPELVATSTNMIKSEMSLKILASECHMTLRGIKSAEIDKRQSNYPSPDASIQ
                     DPIVVTKWVDYSNKHGFAYQLSTDDIGVLFNNGTTVLKLADAEEFWYINYDAKEGWVA
                     SHYKLESKPIELTRHLEVVDFFANYMNSNLSRISTLVRETYHKDDVFLRRYTRYKQFV
                     MFELSDGTFQFNFKDHNKFALSHGGKLLTFISPDRKTVTLQLSRVLLDGYVNGFPSID
                     IFEKLELMKEGLRDKASVLSIH"
     gene            complement(<550414..>550779)
                     /gene="RPB11"
                     /locus_tag="KLMA_10271"
                     /db_xref="GeneID:34713944"
     mRNA            complement(<550414..>550779)
                     /gene="RPB11"
                     /locus_tag="KLMA_10271"
                     /product="DNA-directed RNA polymerase II subunit RPB11"
                     /transcript_id="XM_022819573.1"
                     /db_xref="GeneID:34713944"
     CDS             complement(550414..550779)
                     /gene="RPB11"
                     /locus_tag="KLMA_10271"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB11"
                     /protein_id="XP_022673799.1"
                     /db_xref="GeneID:34713944"
                     /translation="MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGN
                     LIRAELLEDEGVLFAAYKVEHPLFARFKMRIQTTEGYDPKDALKNACNSIINKLAQLQ
                     ANFETEWNLQTLATEDYGI"
     gene            <551407..>555876
                     /gene="SIN3"
                     /locus_tag="KLMA_10272"
                     /db_xref="GeneID:34713945"
     mRNA            <551407..>555876
                     /gene="SIN3"
                     /locus_tag="KLMA_10272"
                     /product="transcriptional regulatory protein SIN3"
                     /transcript_id="XM_022819585.1"
                     /db_xref="GeneID:34713945"
     CDS             551407..555876
                     /gene="SIN3"
                     /locus_tag="KLMA_10272"
                     /codon_start=1
                     /product="transcriptional regulatory protein SIN3"
                     /protein_id="XP_022673800.1"
                     /db_xref="GeneID:34713945"
                     /translation="MSGSWNHSDGTQTPGSVNGSISGEGAANRLPQLAPPAVNIQIKP
                     DIEQQQQHHHVTLPSISTISSANGGGNSVVGAQHGHTHGHTHTHSHSQTQSHVQEALP
                     GVSASTESSNSVGLHESTAGGNGASIVTKNNIPNSTTSIQSLVQPPEQMPQQSQAQAH
                     QPQQPIIQTHASEMEQSMGAGQDSSYRPLNVKDALSYLEQVKFQFNTRPDVYNHFLDI
                     MKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTFLPHGYKIECSSNPDDPIKVTTPF
                     GTTGEVSAGPPLQQPGQATPQGQQPQQQPQQLGSIGSMKMEDQNVERQQQQQQQQQQH
                     NLPQIGGSNQGQPPQLQEQSKNQQHTLLSQQPTQPQQSSPPQQMQPQAQPQAQVQQAL
                     PQTQPVAQQLVNQNFSATNAAIISGMPGQQKAGEVEFSHAISYVNKIKTRFADQPDIY
                     KQFLEILQTYQREQKPINEVYAQVTVLFQQNPDLLDDFKKFLPDSSVAPQQNIQSSPQ
                     ENQQNVLSSQPYIPQGHPIQGQGYYGQPGIVMQQTNLPPLGNFSASGQASPAETNHML
                     PSMHQHISGGQVLPQHVVTQGMSNQEIPVSDMRSTMNGAYNQMEYMQAAAGYQQQMDG
                     MQYMEAPMARPEIDLDPSLVPVVPEPIQPPEDAVALSDEVTFFDRVKRFIGNKQVYAE
                     FLKILNLYSHDLLSTSELVSKVEFYLENSKELFDWFKSFVGYEEKPKNIENIVHEKHR
                     LDLDLCEACGPSYKRLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRK
                     NQYEDTLFKIEEERHEYDFYIESNLRTIQTLETIANKIANMTQEEKNNFKLPPGLGHT
                     SLTIYKKVIRKVYDKDRGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVW
                     RELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHPLTPKPKSQ
                     LDFDINDHDVLFDILDLIFTFLHANATYSNPDKVKLQQFFKVFISLFFSIPVEEVEEA
                     VKKRFSMAEQENAEEETNPNEPEKSNKRSLQEEDSLTLREILRRNKNARSSTSEENGS
                     NSSTKANEKDETEIIAEEAAKPWLLGSLVDEANSSGVVGNRHLFNLFANTTIYVFFRH
                     LNTMYERLSEVKVIDKDVTEEIQNRKVVQFASDLNLVSTQLSDMGLDFKGTKAYDELL
                     RLSKRLIVGDLDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIISDPKNSMVL
                     ILFEQDRLKKDTTAKEQILYRLKVRNTIGESENMFRIEFNNKNSHTCIQYVAVDDLTL
                     KEPQNMKEKWDYYVTSYSLSHPTEGVAEDQISQPFLEKIVEKEAEYIDEEEPNKRYSP
                     EGISESKLKVKIHPETYQLSFEPGSSDVFTRKSVNSFPEPREANTADKMRNFLDGSNG
                     WKKNISSADAELAEAKTKDLKENGVFKIDEIKTDKAEESNGVINAEESKTIDK"
     gene            complement(<555960..>557087)
                     /gene="PFA4"
                     /locus_tag="KLMA_10273"
                     /db_xref="GeneID:34713946"
     mRNA            complement(<555960..>557087)
                     /gene="PFA4"
                     /locus_tag="KLMA_10273"
                     /product="palmitoyltransferase PFA4"
                     /transcript_id="XM_022819596.1"
                     /db_xref="GeneID:34713946"
     CDS             complement(555960..557087)
                     /gene="PFA4"
                     /locus_tag="KLMA_10273"
                     /codon_start=1
                     /product="palmitoyltransferase PFA4"
                     /protein_id="XP_022673801.1"
                     /db_xref="GeneID:34713946"
                     /translation="MAVKLKYQWLGIAIPTFLISFIGYVAHYFVLLNFASTSKQVIFQ
                     FCLTMIWISYYLAIKTNPGKPPINYRPSETEWHNYCKKCNNFKPPRCHHCKTCKQCVL
                     SMDHHCPWTMNCVGHNNFPHFVRFLFWVIVTTSYLLTLLIKRVCQLWYMRHMPYTQTY
                     ITEIVALCITTPMDAFVLITISILFIRCIYNQGFKGMTQIESWEMDRLESLHYKKSLL
                     PLLVDTLKGKMPQVQKNRHQEINNLLSKRYVPFENIVNFPYDINVWTNLINIMGPWYM
                     WLWPFAKPATDGVSFMKNELSEFESDSSIEDILLSLPWPPDGTRHILTTESGVVETIV
                     DGGEQAMRERYTDPRDKLKRTSWYNDWGEELSDFGVDTEVE"
     gene            <557595..>559370
                     /gene="KU70"
                     /locus_tag="KLMA_10274"
                     /db_xref="GeneID:34713947"
     mRNA            <557595..>559370
                     /gene="KU70"
                     /locus_tag="KLMA_10274"
                     /product="ATP-dependent DNA helicase II subunit 1"
                     /transcript_id="XM_022819607.1"
                     /db_xref="GeneID:34713947"
     CDS             557595..559370
                     /gene="KU70"
                     /locus_tag="KLMA_10274"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase II subunit 1"
                     /protein_id="XP_022673802.1"
                     /db_xref="GeneID:34713947"
                     /translation="MSDQKPDFLKSQLSKDSNVGNKDQEKWKRYEAHEGIAFCIELTS
                     SMYLPSEDLNGQIQLMEILDSLNELMSELVIVMPNTAIGCYFYNCAHPKAENNVYELI
                     PLRDVNFQNMKKVNDLLDDIKSSRLTLEEEIPIADKANPAELSPALIMIREKFLEPVD
                     GQKQLTNKKIFIFTDNDKPSEFQDVESRSRLRKVIDDLYDYHINFVTFFIGSKVKPFD
                     DTTFADILRWGSKVNDTKNWLYSHGPNTKPINASTIKSKVKRTKEINRVKFRCPLILD
                     ERADFVVSVSGYTIISHEIPASKYKLIYDNGTVKQEAYSRREYLDAETGEVVPNDELA
                     KTFSFGDEIIELSEEENSQIQNIYGNYDSFLKLIGFRSTEECLCFYNNIDAPSLVVPN
                     EEQYKGSIKTLTSLYRTLKKKEKSAVIWGKLRPNSMASMFVLTPSSNEDFNQAFYLYR
                     IPFIDEVRKLPTLSSYPELLESDDYQVLSRVTETLVNFFNLKNGYKPSDYHSPALQRH
                     FTVLREYLLQIESKETKDQDEDDETLLKVKQIHERIAASAQSDDPKQQRLVKYLKLWN
                     SYYNRYNNLEIESKPKQNKRSKFNI"
     gene            complement(<559399..>560982)
                     /gene="NGL2"
                     /locus_tag="KLMA_10275"
                     /db_xref="GeneID:34713948"
     mRNA            complement(<559399..>560982)
                     /gene="NGL2"
                     /locus_tag="KLMA_10275"
                     /product="RNA exonuclease NGL2"
                     /transcript_id="XM_022819618.1"
                     /db_xref="GeneID:34713948"
     CDS             complement(559399..560982)
                     /gene="NGL2"
                     /locus_tag="KLMA_10275"
                     /codon_start=1
                     /product="RNA exonuclease NGL2"
                     /protein_id="XP_022673803.1"
                     /db_xref="GeneID:34713948"
                     /translation="MAQKPIMAIDEHNTLEPSNSDVTELISSTNDLSLDNNVSHAKEN
                     DANSEGKSKTKGKSKKRKPKVDITPEYIAEMRAKRQAEKQAKRDALIAQGIDPDVPPD
                     LRFIKRPMLKIPRSESLDGDSKLFPISFMTYNCLAQALIRRKLFPTSGNAVKWFKRSQ
                     VLLNEFKYYNSDVLCLQEIDTVQYKSFWKHEFEKLGYMSQFHFNPSKNHGVLIAYKQD
                     MFEMTDRMLIDHDKIATGDIEPRTTTKNIGLILALKFSKKVLERFPETNVSGILVGTT
                     HLFWHPFGTYERTRQCYVILQKMKEFQNRVNILQNNNDGDLSHWPSFFCGDFNSQPFD
                     TPYLSITSKPVKYEGRAKTVIECSTSYTFSKLRDGDEGEEEEGGNVEKFGKNQPETPV
                     PDTFNPTPEQAALCEKMKNLHNGLDMRAISMYSIAYKYVHPENSGLDNERNEPEISNW
                     AHSWRGLLDYIFFVTSWDGSNCVTVDDLSEFELNNGIKVLELLRIPPGKEMTEHGQPH
                     EGEYPSDHLCMIAKLGIAM"
     gene            <561509..>561763
                     /gene="MRPL33"
                     /locus_tag="KLMA_10276"
                     /db_xref="GeneID:34713949"
     mRNA            <561509..>561763
                     /gene="MRPL33"
                     /locus_tag="KLMA_10276"
                     /product="54S ribosomal protein L33"
                     /transcript_id="XM_022819629.1"
                     /db_xref="GeneID:34713949"
     CDS             561509..561763
                     /gene="MRPL33"
                     /locus_tag="KLMA_10276"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="54S ribosomal protein L33"
                     /protein_id="XP_022673804.1"
                     /db_xref="GeneID:34713949"
                     /translation="MVFYRITLRRSVIGTPKKTRAVVESLGLRKRGSIVYQPAIPSIA
                     GAVAQIKELVNVELSDKPISKAEQREMRKSNPGFTVEKRV"
     gene            complement(<561930..>562706)
                     /locus_tag="KLMA_10277"
                     /db_xref="GeneID:34713950"
     mRNA            complement(<561930..>562706)
                     /locus_tag="KLMA_10277"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819640.1"
                     /db_xref="GeneID:34713950"
     CDS             complement(561930..562706)
                     /locus_tag="KLMA_10277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673805.1"
                     /db_xref="GeneID:34713950"
                     /translation="MTEGRRLSNRSSIRNTTQLLSDNSNKSKGARSKFRKTPGSQSPV
                     KQHSSSYAPLREGQNMLDNKDNSSFQKQMNRITEPPSKNINYECPKINVKVGFQNQQG
                     SRTVYKLEAPLPNQKTITISSTITRLMRKHHDRSETLKIMNDDKYTYDTLSNLPVVLN
                     EYISQRMYAQQTMPQKPVSRRLYNRVDQLLAQENQFLSANDSTDLSFDGKAMDKNDIF
                     RIVDSFSVAFDDDDEDGDYEDDQYSNKMKNVLPREVTGVF"
     gene            complement(<563155..>566133)
                     /gene="DSS1"
                     /locus_tag="KLMA_10278"
                     /db_xref="GeneID:34713951"
     mRNA            complement(<563155..>566133)
                     /gene="DSS1"
                     /locus_tag="KLMA_10278"
                     /product="exoribonuclease II"
                     /transcript_id="XM_022819651.1"
                     /db_xref="GeneID:34713951"
     CDS             complement(563155..566133)
                     /gene="DSS1"
                     /locus_tag="KLMA_10278"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="exoribonuclease II"
                     /protein_id="XP_022673806.1"
                     /db_xref="GeneID:34713951"
                     /translation="MSQVYLLRPSLVTVLAVQRRLFHRSVVVRRAQQEPNPPPIAPEE
                     TQSQEDEVVLFSQDKDILPEVEVKPFQRIKEDSNLRFSKRIIQPSLEWYKKTEDVNAK
                     QDGHNYQKPLSLMQSDIPSTVLFQESIKWLAKGSYQIEQKENKADQIDPSKISFHIKP
                     SSILSSTLMCGDLCVIKNRPFELVVCVGTPSESMDGRFTFAKADGTIKYARKEHVVVR
                     FPNIFKTSNLNLLQRETQHGYTPIGTTKNDKDITFIIPTLARRMLISNITFSISNKAN
                     EQLPVVKKKLELLHRYLQSGIGSWQIPFLKLVELCTHLDLSQDIDKAVSKALHKSGLD
                     SKSLYSLADSHFKLTSNIPQSVDCSLFLAVYWAILHQQGTQMWGEVTVHKGLFFPSAV
                     TILPLGSQYLHYHNTIHKLRQFDGKRISKIAELINSNNLALINEKFPYIIPLLRDYAA
                     GNLQYNETITSLIASLFRKLDKYKDHNVSRDSCFDLLKQINPAEPPNPLLVNQELQLP
                     NNNERVKLEQKIYDLTVPPNFQSQENNRIEYENLVCYCIDSPEAHEIDDAVSITKLGA
                     SKYRLYIHVADPASLFPESMDTNITSQSPVLDIAYQRAFTTYLPDKVFPMLPVSFARK
                     SDLGAFGKPTRAMTFSIECELSQNGNIRLLNDSLKIELSIVHKSKRTTYDKVDSVLGK
                     KSESVQSQEQQDLFSLFKIAKALRKKRIQEGGAVVFENSSNGLVRLTTDDNSDLTVVS
                     FEDQKESKSTILVSELMILANTIAASYFKEAKIPGIFRAYRKLNLVDEAASLYEWMET
                     KTKNNEIFSQADITKIANFMTNSFYSSTSIPHSMIGSQQYLTVTSPLRRFPDMINHIQ
                     LHRHLRNLPLFYSQSDLDGMAWHIMTRDVTLKNASHKAQSFWTLKYLKDTIKDPSKNF
                     WSIRVTHLPEDGYVRCVIKDKSFATGKLKLNLNQKPLLVGDTVSACRISRIECLDGNL
                     EFELTPKSKTKRLTSQATKL"
     gene            <567762..>569318
                     /gene="NDI1"
                     /locus_tag="KLMA_10279"
                     /db_xref="GeneID:34713952"
     mRNA            <567762..>569318
                     /gene="NDI1"
                     /locus_tag="KLMA_10279"
                     /product="rotenone-insensitive NADH-ubiquinone
                     oxidoreductase"
                     /transcript_id="XM_022819662.1"
                     /db_xref="GeneID:34713952"
     CDS             567762..569318
                     /gene="NDI1"
                     /locus_tag="KLMA_10279"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="rotenone-insensitive NADH-ubiquinone
                     oxidoreductase"
                     /protein_id="XP_022673807.1"
                     /db_xref="GeneID:34713952"
                     /translation="MLSFSQTRNLAVRRLGSLGVAARYASTATVKPSHDSDVPSGSSS
                     FTTTKVIENHTDNKPNVVILGSGWGAISFLQHIDAKKYNVSIVSPRNYFLFTPLLPST
                     PVGTVDEKSIIEPVVSFAMKKKGNVSYYEAEATSINPDRNTVTIKSVSTVSQLYQPEK
                     HLGLTQEDTAEIKYDYLLTAVGAEPNTFGIPGVEEYGNFLKEIPHSLQIRKRFLSNIE
                     KANLLPKGDPERKRLLTIVVVGGGPTGVETAGELQDYVDQDLKRFMPSIAEEVQIHLV
                     EALPNVLNMFEKKLTSYAQDVLSKTNINLMLRTAVGKVEKDHLIAKTKDAEGNVTEKT
                     VPYGTLIWATGNKARPIITDLFKKIPEQNASTRALNVDEHLLVKGTNNIFAIGDNAFA
                     GLPPTAQVAHQQAEYLAKVFDKMSKIPGFQQELATRKEKIDLLFEENGFKTFKYVHLG
                     ALAYLGAEKAIANITYGKRSFYTGGGLITFYIWRVLYVSMILSARSRFKVISDWLKLA
                     FFKRDCFKEL"
     gene            complement(<569825..>570661)
                     /gene="GTR1"
                     /locus_tag="KLMA_10280"
                     /db_xref="GeneID:34713953"
     mRNA            complement(<569825..>570661)
                     /gene="GTR1"
                     /locus_tag="KLMA_10280"
                     /product="GTP-binding protein GTR1"
                     /transcript_id="XM_022819673.1"
                     /db_xref="GeneID:34713953"
     CDS             complement(569825..570661)
                     /gene="GTR1"
                     /locus_tag="KLMA_10280"
                     /codon_start=1
                     /product="GTP-binding protein GTR1"
                     /protein_id="XP_022673808.1"
                     /db_xref="GeneID:34713953"
                     /translation="MRSIIFSNYSAFDTRRLGATIDVEHSHLRFLGNMTLNLWDCGGQ
                     DVFMENYFTQQKDHIFQMVQVLIHVFDVESKDVLKDVDIFTRALKQLKKYSPDAKIFV
                     LVHKMDLVQLDKRTELFEIMMKKLKQASAEYGFNDLIGFPTSIWDESLYKAWSQIVCS
                     LIPNMNIYNNNLKRLKELMDAKEIVLFEKTTFLVISSSNTTTGELLDPKRFEKISNIM
                     KNFKHSTTKLKSSFNTLVLSDLIYVTELSSNMMCFIVLNNNNYPKEFVLQNLHQAQTY
                     FQ"
     gene            <571038..>571589
                     /gene="PTH1"
                     /locus_tag="KLMA_10281"
                     /db_xref="GeneID:34713954"
     mRNA            <571038..>571589
                     /gene="PTH1"
                     /locus_tag="KLMA_10281"
                     /product="peptidyl-tRNA hydrolase"
                     /transcript_id="XM_022819684.1"
                     /db_xref="GeneID:34713954"
     CDS             571038..571589
                     /gene="PTH1"
                     /locus_tag="KLMA_10281"
                     /codon_start=1
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="XP_022673809.1"
                     /db_xref="GeneID:34713954"
                     /translation="MQRLLCLSALGNPEPMYENTRHNAGMIMLRMIKNELCRNLPLKQ
                     STVSPHIEYCHDPKLNLVMLFNRTQYMNLSGHAFIPAWRKLPHDTFHVVLHDELNIPT
                     GKVQFRKPGTSFRGHNGLRDIIKMKGNDDFHKLGIGIDRPNSKDPKVVADYVLSKFTH
                     QEILQLELEAFPRSLEHIRKLLP"
     gene            571790..571871
                     /locus_tag="KLMA_R104"
                     /db_xref="GeneID:34718619"
     tRNA            571790..571871
                     /locus_tag="KLMA_R104"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:34718619"
     gene            complement(<572067..>572891)
                     /gene="PNO1"
                     /locus_tag="KLMA_10282"
                     /db_xref="GeneID:34713955"
     mRNA            complement(<572067..>572891)
                     /gene="PNO1"
                     /locus_tag="KLMA_10282"
                     /product="pre-rRNA-processing protein PNO1"
                     /transcript_id="XM_022819696.1"
                     /db_xref="GeneID:34713955"
     CDS             complement(572067..572891)
                     /gene="PNO1"
                     /locus_tag="KLMA_10282"
                     /codon_start=1
                     /product="pre-rRNA-processing protein PNO1"
                     /protein_id="XP_022673810.1"
                     /db_xref="GeneID:34713955"
                     /translation="MVAPTAVKKDEQTVERTSATPTASRIVGTDNTQPIEEDDDDDVL
                     IDQDGDAVLDDEENEDKKKQKKEDAGVVLDAEGKPRFTSAANSGQTKVKLESRKVPVP
                     PHRMTPLKNNWAKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIK
                     AFTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIEN
                     ATRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPPGKVYGNLRTVASRLKERY"
     gene            <573489..>575243
                     /gene="MDM32"
                     /locus_tag="KLMA_10283"
                     /db_xref="GeneID:34713956"
     mRNA            <573489..>575243
                     /gene="MDM32"
                     /locus_tag="KLMA_10283"
                     /product="mitochondrial distribution and morphology
                     protein 32"
                     /transcript_id="XM_022819707.1"
                     /db_xref="GeneID:34713956"
     CDS             573489..575243
                     /gene="MDM32"
                     /locus_tag="KLMA_10283"
                     /codon_start=1
                     /product="mitochondrial distribution and morphology
                     protein 32"
                     /protein_id="XP_022673811.1"
                     /db_xref="GeneID:34713956"
                     /translation="MLPILSRITARRFAMRAHSKVKIPTPMQVRVQPLGYSSNRFLRN
                     YSTEKHDMEEFNKSTDYLHIQNILLQKEKELLTKHTMLKEATGFYDRFKINTKWFLIR
                     GNRPFSFDEISTIFSWLIISQIIWIVLGTTTFVSLVLFTFNTVFAKEIVGKMVGKTLN
                     KYIDGCDVEFQDALVPEWKKGCISFRSVNVRTTPDGVSDASGEHLAFDLTFNQMDITL
                     SVTKWLTGHGLINELTVLGMHGDVVLNEMNEQRLQDWFTNPKYHLGRVKVCDSCINLR
                     DGGQDYRISIYNMDLNRLRLEWCVADFFNANVVTGAINHSLFTIHKRQHKLAYLQDLE
                     KDLSPWKRITRLRLDRISVKDLGLDKSKAFNWIEDGSVEVIADLMLPNVNDIEEMDDE
                     NSNKYLVMDLKFKLKDLKAKLPDTEPTLSNGETVISFDELKPIVDYINNQRVIFGSVS
                     TAENVDPDWNNIAPISIKRQKSYPDTTVIPTTINWPDGEDSVQVNKEIIKYHDQPTNK
                     SNELVLKCRIVKNINELHNVALFRESGVYDVLAMELCVDLMKIVEEWEFKKRNNWMKL
                     WGSTLASQLVVFGLGAMV"
     gene            complement(<575372..>575905)
                     /gene="SPP2"
                     /locus_tag="KLMA_10284"
                     /db_xref="GeneID:34713957"
     mRNA            complement(<575372..>575905)
                     /gene="SPP2"
                     /locus_tag="KLMA_10284"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819718.1"
                     /db_xref="GeneID:34713957"
     CDS             complement(575372..575905)
                     /gene="SPP2"
                     /locus_tag="KLMA_10284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673812.1"
                     /db_xref="GeneID:34713957"
                     /translation="MSGISISLKSNNKVKKKQSAKKKKGSLFGTDENDGKVKDHKITE
                     LEDSESQNDKVRAITPPEPLRSALFPTKKPSNHQTENDPSTQIYLNSLPRHKMPEKTE
                     EEEYEEVPVEGFGAALLRGMGWDPSEENNDDLKKPNLPHEKPRPELVGIGAKVTTSNN
                     SLKDNNFMPIIKVKKNP"
     gene            <576096..>577337
                     /gene="SHE9"
                     /locus_tag="KLMA_10285"
                     /db_xref="GeneID:34713958"
     mRNA            <576096..>577337
                     /gene="SHE9"
                     /locus_tag="KLMA_10285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819729.1"
                     /db_xref="GeneID:34713958"
     CDS             576096..577337
                     /gene="SHE9"
                     /locus_tag="KLMA_10285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673813.1"
                     /db_xref="GeneID:34713958"
                     /translation="MIMRPVARLYYPCYGLSRNKLVRLYSTGPNSKSSLLNVWKQKLG
                     EYWDNSQIKMNDTLGKLRGYSMNLKIQLDKAQKSIQDANEKLARMENDSHDSNLNFNA
                     EGKIKDLPSERERHRKKWARKMELYLDSLQETIFTATRALNDVTGYSSIQTLRNTIEL
                     LEKELKDTKKLVNEAKDQYDTAIKARSESQKEVNELLQRKHSWTPSDLERFTQLYKDD
                     AENLQLQEQAKERLGELEAKEEEISTNLYRAILTRYHEEQIWSDKIRRTSTWGTFILM
                     GVNILFFFVFQLLLEPWKRRRLVGSFEDKVKKALDDHQKEQTLAISEISGNIDSLMDG
                     KLQEKPITPIPQQTEDKTAPPELYKILQDLKVWLTIQLTTTYNKLLDLLPNPTFTFTK
                     GYFYSYSTLILTVGMVFGHYI"
     gene            <577732..>579018
                     /gene="RPT3"
                     /locus_tag="KLMA_10286"
                     /db_xref="GeneID:34713959"
     mRNA            <577732..>579018
                     /gene="RPT3"
                     /locus_tag="KLMA_10286"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819740.1"
                     /db_xref="GeneID:34713959"
     CDS             577732..579018
                     /gene="RPT3"
                     /locus_tag="KLMA_10286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673814.1"
                     /db_xref="GeneID:34713959"
                     /translation="MEELGILTPQSAGTDDSNVKNNVFTYGSLLSQLNKDSFSVANDS
                     SDVYLKLKKLEKEYELLKLQEEYIKDEQRHLKRELLRAQEEVKRIQSVPLVIGQFLEP
                     IDQNTGIVSSTTGMSYVVRILSTLDRELLKPSTSVALHRHSNALVDILPPDSDSSISI
                     MGSNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGVLLYGPPGTG
                     KTMLVKAVANATEASFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDS
                     IATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRL
                     DRKIEFPSLRDRRERRLIFGTIAAKMSLAPEADLDSLIIRNDPLSGALIAAIMQEAGL
                     RAVRKNRYVILQSDLEEAYASQVKSGSDVDKFDFYK"
     gene            complement(<579135..>580652)
                     /gene="SMP3"
                     /locus_tag="KLMA_10289"
                     /db_xref="GeneID:34713960"
     mRNA            complement(<579135..>580652)
                     /gene="SMP3"
                     /locus_tag="KLMA_10289"
                     /product="GPI mannosyltransferase 4"
                     /transcript_id="XM_022819751.1"
                     /db_xref="GeneID:34713960"
     CDS             complement(579135..580652)
                     /gene="SMP3"
                     /locus_tag="KLMA_10289"
                     /codon_start=1
                     /product="GPI mannosyltransferase 4"
                     /protein_id="XP_022673815.1"
                     /db_xref="GeneID:34713960"
                     /translation="MRLKTYEYIGLLIGLFIALEPSYIHPDEHFQTLEPILQWWSGYK
                     GTIAWEFLPENASRSITILKLYYTPMLWLNDYLFHLKPVGLLYLYRIQNYLLYTVIAS
                     LFLEFCEVSITHKTKAKFFIRTSYVTWVFQSHTFSNSLETILLLLLLFVCQYCIYEVR
                     SGKSPSFITSFWIGALISIGIFNRMTFPAFLVLPLLSVFYHCFISHWLPLAFSVISAS
                     VVSAIIIFFDTKAYNPVNGEWIIAPWNNLVYNMNVDNIAQHGLHPRYTHLLVNLPLLC
                     GPVLILLLSKRYILKLPALSALSGVLILSLFKHQELRFLVPIVPAICASINLESFDTF
                     IQGEVILTIWFIFNIVMGLLLGVFHQAGIISLISQFSSHDIPVHVWWKTYSPPTWIYA
                     NYNLTVSTTNFVDNIEYVENVNWNVTSNHVVDLKGSDVELLNETLTNFIKFTDSIQLI
                     LPNTVMEQLEPLRKEWNFTVDRETSQHLDLDHIDFPRWKTMKPGLKLLNVSHIIS"
     gene            <581115..>583973
                     /gene="SXM1"
                     /locus_tag="KLMA_10290"
                     /db_xref="GeneID:34713961"
     mRNA            <581115..>583973
                     /gene="SXM1"
                     /locus_tag="KLMA_10290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819762.1"
                     /db_xref="GeneID:34713961"
     CDS             581115..583973
                     /gene="SXM1"
                     /locus_tag="KLMA_10290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673816.1"
                     /db_xref="GeneID:34713961"
                     /translation="MVNEQLVLQLFGQTVSSDASSIKSAEQQLYELHKEPGFLSFLLS
                     ATSNDQLQMPLRMSCAIYMKNMIQRSWNSRKTFVISQEEKEAVKPGLINSLIVNYENN
                     HIRPHITDSIGAILKWSDDWVFTDQVVELLQSGKQEYIYPALLLIFEVCINHRWDMYG
                     NRQYIDNFVDTVFPVMEQIAGQLVNQEDHKSNEMLYLILKSFKYGCLNNFPNYFTNID
                     KLNSWIQLHLFLCSKPLPAETLALDLADRSLDKRVKVNKWAFGNLYKFISKYSRTTKA
                     IKQEMVDYVFQNIVPTILQEYFKVIELWATNKESMWLSESALYYLIQFLEKCAIETNL
                     WAMIHPHFESIVNHVIFPCLCASEASVELFKEDPEEYTRRYFDINKESSTADVAATDF
                     IFVIGHKRIEEVSKLLPLINQVFVQYQQNDNMQAAFQEEGALRMLSTLSTFLNSDANM
                     SLDLETIFSHFVLPLLNDKKHPFLVARAAETISIHQSPFSDMGILSQIFEGVYGNFMH
                     NECLPIQIVSADALKTLVISNPDIHSHIKNQAPQIMERLLKLSKEFEIDTLNEVMEAF
                     VERFAEELTPFANDLAQNLVEQFMQLGQSLIQNSSSGNNISDQDQEFQASGMLQTMTT
                     MVMSMNKVCLVDKFLPVVKFIVVNAQIIFLTEIVDLMDALALSSKSLYNEFTPGVWEM
                     VHDVLDSFQTYALDYFESYKIFFETVINFGFTQDQTYLPAFLRILTEVMNSGIDYDIQ
                     VAVELLVSYAVALKDIPLFDKFCDVAVDEEIGLEDSVVVKMFTASLYSKPLETLQICE
                     SKGVTLGMLNKWISTNSRTVFSIKVQMLGIMSMFQLPELPSCANGFVKPLTNKLVKLA
                     QDLPEAMKRRAKIENGEYEDDEADDNEGLEFYEEMDDDFNDSPLDDVDVFKQLHNFFV
                     TLQQYNPDRYQAVMQSLDSEAQDTLKTILEFVAYNPQS"
     gene            complement(<584289..>584753)
                     /gene="NCB2"
                     /locus_tag="KLMA_10292"
                     /db_xref="GeneID:34713962"
     mRNA            complement(<584289..>584753)
                     /gene="NCB2"
                     /locus_tag="KLMA_10292"
                     /product="negative cofactor 2 complex subunit beta"
                     /transcript_id="XM_022819773.1"
                     /db_xref="GeneID:34713962"
     CDS             complement(584289..584753)
                     /gene="NCB2"
                     /locus_tag="KLMA_10292"
                     /codon_start=1
                     /product="negative cofactor 2 complex subunit beta"
                     /protein_id="XP_022673817.1"
                     /db_xref="GeneID:34713962"
                     /translation="MVGEVDDVTLPKATVQKIISEVLDSDLTFSKEAREIIIECGVEF
                     IMMLAGSASEIADKELKKTIAPDHVIKSLQDLEFDEFIPPLEEILHQHKENQKIRERR
                     DAKFKKSGLSEEELLRQQEELFRQSRSRLQQTSSVSDVSGNEPETGLKTEEF"
     gene            <585771..>587651
                     /gene="UTP5"
                     /locus_tag="KLMA_10293"
                     /db_xref="GeneID:34713963"
     mRNA            <585771..>587651
                     /gene="UTP5"
                     /locus_tag="KLMA_10293"
                     /product="U3 small nucleolar RNA-associated protein 5"
                     /transcript_id="XM_022819784.1"
                     /db_xref="GeneID:34713963"
     CDS             585771..587651
                     /gene="UTP5"
                     /locus_tag="KLMA_10293"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 5"
                     /protein_id="XP_022673818.1"
                     /db_xref="GeneID:34713963"
                     /translation="MATDSPVVLSQYDPSGQYLAYVSTALDKQRVSVEPTSISKSSLV
                     NENFLYLEGQGVYCTSIQWITFNETLLVVLGLSQGEIWLYSPLTNEVVTKLSTGSTFP
                     VLDFQHSENSNTKAWCVTGDDTIIQFDMVSQSVSSKFKLDECKDLKKVCVVSDERILV
                     ASHQIFLVDTKTKKLVQQYPGHISPVSFLQLTADASAFLSGSQDDRFLNVYELETGKT
                     KSVLAAHSNIQNVSISKSWSHVSAITEDGDIAIFEEPLVTVNTGNKRRAGKISKQSNK
                     SITLLRANSSTRLKIFQSYVTEDTVNFSWLENATIPYFDQLRLEDLSEPITTISKPLP
                     SLNSQQTRNKENSDISSAKIYKEGNATVTSGDNFKHVESIIKSLDQAEGEDVAESLQD
                     KLNIISPPSKKPKEKRRANAGTSAVVLGQALKSNDHALLESVLNTRDEKIIQATITRL
                     SPQLATVLLERLAERIARQTHRQGSLNVWVKWCLIIHGGYLVTIPNLLSSLSSLHSTL
                     KRRADLLPKLMALDARISHSLDQLYSKRAVQYGKSQDQLLEEVNGNAYELDEEEEEED
                     VEYIEELDDAGLIDDGEDDSMDSDDEEDSASEEPAYTEEGFQDDDEMKIDVEEGYSDE
                     EV"
     gene            <588583..>589230
                     /gene="HPT1"
                     /locus_tag="KLMA_10294"
                     /db_xref="GeneID:34713964"
     mRNA            <588583..>589230
                     /gene="HPT1"
                     /locus_tag="KLMA_10294"
                     /product="hypoxanthine-guanine phosphoribosyltransferase"
                     /transcript_id="XM_022819795.1"
                     /db_xref="GeneID:34713964"
     CDS             588583..589230
                     /gene="HPT1"
                     /locus_tag="KLMA_10294"
                     /codon_start=1
                     /product="hypoxanthine-guanine phosphoribosyltransferase"
                     /protein_id="XP_022673819.1"
                     /db_xref="GeneID:34713964"
                     /translation="MSAEDKQYISYNNVHQLCQESAERVKKFKPDIIIAIGGGGFIPA
                     RILRTFLKEPGVPTIRIFAIILSLYEDLYTVGSEAENVGITVQRTQWIDYEQCKLDLV
                     GKNVLIVDEVDDTRTTLHYALNELEKDSEQQAKAKGIDLEKQPEMRTKFGIFVLHDKV
                     KQKKADLPEEILNDDTRYIAGRRVPDKWFAYPWESTDIVYHTKMAMEQGNDVFLP"
     gene            complement(<589358..>590782)
                     /gene="MCH2"
                     /locus_tag="KLMA_10295"
                     /db_xref="GeneID:34713965"
     mRNA            complement(<589358..>590782)
                     /gene="MCH2"
                     /locus_tag="KLMA_10295"
                     /product="probable transporter MCH2"
                     /transcript_id="XM_022819807.1"
                     /db_xref="GeneID:34713965"
     CDS             complement(589358..590782)
                     /gene="MCH2"
                     /locus_tag="KLMA_10295"
                     /codon_start=1
                     /product="probable transporter MCH2"
                     /protein_id="XP_022673820.1"
                     /db_xref="GeneID:34713965"
                     /translation="MKSGNCEIVKSEPSISSKESLNLIDSEDDYNKIPVPDGGYGWVV
                     VFSSFIFNFCTYGATAGYSAYLSYYMSSDKYQTGSDLDYAAIGGLSFGVGLVLAPLIN
                     FMLIKTSVKKVLLLGIVVQNGSVLLAAYSTKLWQVYLTQGVGISFGIGAICFPNTNIV
                     APWFREKRSLALGISAGGAGLGGIVFNLSMQKIIDGQNVRWALLAQCIICSVLSAIAL
                     ILVKTRKDEIEKYAVVQYKIIEWEMFKYPVVWLLLLWVCLTMLGYVIQVFSLYSFTVS
                     LGYSSHQGSVVSSMISLGALVGRPMVGFLSDKFGPVTTAMFCHLIVGILCYAMWIPCR
                     KYGNVIVFALLEGMLMGTIWPILTSIITRLVGLPKLESVYSAVWIFIGSCSIVSPVIG
                     LELKKNHYKKGENAYLYTAIYAGTAYICAAVSLCFIRGLLVARDKISEKEKTGDDDGE
                     LHFRPSLKETIQGIFTWRKLYRKV"
     gene            complement(<592191..>593219)
                     /locus_tag="KLMA_10296"
                     /db_xref="GeneID:34713966"
     mRNA            complement(<592191..>593219)
                     /locus_tag="KLMA_10296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819818.1"
                     /db_xref="GeneID:34713966"
     CDS             complement(592191..593219)
                     /locus_tag="KLMA_10296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673821.1"
                     /db_xref="GeneID:34713966"
                     /translation="MTSNPLQTIDVKQPENEAAAKLLDAARKQGFLFVDGHDFTQEEV
                     DKLFELSQKFFCSTPHDEKLQYFFNAVNNFGYTDYSSEQLDLSKGRDFKECYNFGAIN
                     FTEGTFNTPNPNAVVDPKQNETPKVLSDEYEFIITVLRKYHKVATEILRLVTIALGIE
                     NKTFFTDKMRPDQKNGCVMRFLHYPLIREDDLNPDSGLDPTIRAGAHTDYGALAMLMQ
                     KEGQQGLELQIDKNSEEWVKVPFVPSKYEGMAPPLVVNFGDMLSYWTNGILRSTNHRV
                     KFSPGETRTSDRYSIVFFVHPDAETTLDPVPSKIVQEARVGEEPPTLTALQYLRKRLD
                     ETYDWKKN"
     gene            <595326..>596342
                     /gene="URH1"
                     /locus_tag="KLMA_10297"
                     /db_xref="GeneID:34713967"
     mRNA            <595326..>596342
                     /gene="URH1"
                     /locus_tag="KLMA_10297"
                     /product="uridine nucleosidase"
                     /transcript_id="XM_022819829.1"
                     /db_xref="GeneID:34713967"
     CDS             595326..596342
                     /gene="URH1"
                     /locus_tag="KLMA_10297"
                     /codon_start=1
                     /product="uridine nucleosidase"
                     /protein_id="XP_022673822.1"
                     /db_xref="GeneID:34713967"
                     /translation="MTGSDVIPIWLDCDPGHDDAVAILLSCFHPSIRLLGISASYGNA
                     SPKHTLFNTLSLLTAFGKHNEIPVYKGAQFPWVRDVEYAPDIHGESGLDGTTLLPTPK
                     VSVADGDYLEAMEKAILENEGNISLVSTGTMTSVATLFKEKPYLKQHVKYISIMGGGI
                     SVGNRNDNNSAEFNIWADPDAANFVFQDDELNYKCILSPLDLTHKCIATTKVDQTILA
                     DGNSKLRKLFYELFLFFTKTYKNVQGFESGPPVHDPVTLMPLLLFYGQVDNEQLKFSF
                     KRYSLTVDLDTSSPDCGRTIVVEEHDVDSTKGVIVGLEMNVDFFWEQIFDALSAADDY
                     EDSL"
     gene            complement(<596508..>598052)
                     /gene="DIT2"
                     /locus_tag="KLMA_10298"
                     /db_xref="GeneID:34713968"
     mRNA            complement(<596508..>598052)
                     /gene="DIT2"
                     /locus_tag="KLMA_10298"
                     /product="cytochrome P450-DIT2"
                     /transcript_id="XM_022819840.1"
                     /db_xref="GeneID:34713968"
     CDS             complement(596508..598052)
                     /gene="DIT2"
                     /locus_tag="KLMA_10298"
                     /codon_start=1
                     /product="cytochrome P450-DIT2"
                     /protein_id="XP_022673823.1"
                     /db_xref="GeneID:34713968"
                     /translation="MSGLNILITTSIVVLILLLGFVCYPVGLPWALPTIPIYVSFLPI
                     LTNMDQIEIFERYIRDPMEKYGAVKIFFAARWNVMTSKPEFLSVMFKDEDTFAKSGNQ
                     EKIPYSVLAKYTGNNIISAHGKIWRLYRNVVQTQLNVFDSKPLIDNAQLFVKLLKSST
                     EESVDGKILLQPLVQRLTLANISQIALGFDIGTLRFDDNGRVLKSQLHEKLNQVKQQI
                     FKPLYLSFPMLDILPIPSRIKARRDVEDFRALLFDRVHKSLIKNYKYEQTNNAGAALV
                     KAWKLKSITDEQLKDNLVIILVAGHENPQLLLTTLFYLLGKYQDWQYEIRKELLTINS
                     EGEDILNSYKLSVFIYECIRLYPPLGQIINRKTTKQCQLGPGIVINKEIYCGYNNYGT
                     GTSPSTWGKTAKEFIPERWGADMEEVGNNWKRHKYNASMAAFHGGRRSCLGEKLAIMQ
                     MKYTLFYTLMSFHISLDENWKERVTPAGPITPMMLKIKLNPLKDDVESKCNTDCSSTE
                     ETLNEI"
     gene            <598843..>600432
                     /gene="DIT1"
                     /locus_tag="KLMA_10299"
                     /db_xref="GeneID:34713969"
     mRNA            <598843..>600432
                     /gene="DIT1"
                     /locus_tag="KLMA_10299"
                     /product="spore wall maturation protein DIT1"
                     /transcript_id="XM_022819851.1"
                     /db_xref="GeneID:34713969"
     CDS             598843..600432
                     /gene="DIT1"
                     /locus_tag="KLMA_10299"
                     /codon_start=1
                     /product="spore wall maturation protein DIT1"
                     /protein_id="XP_022673824.1"
                     /db_xref="GeneID:34713969"
                     /translation="MTNDNLPVIKEANHPYSDIEISHGKTKDDMSTYSKFLCLYTRHP
                     ETYELYCIQDKQSCQFTENWDSIVSLLKRHPAKVNSHGVRELLISAEESNAMTPFDDI
                     GIKVSEYQLANEKQVRGVITTVENENKFNDWFIYHILGKLEVGYSCEPIVENTMDYAE
                     LFTQYFEDNLKNAIEDDEWVSMKGREYFKERVEYFTNRYKRIECILPAFPCKSTNLNK
                     VHGPIPDKGEELAFANLIKATKDVGKFYPPGLKVWIVSDGHVFSDCIGTDDDVVDSYT
                     AHLHALYESIAEPGVDAIGFKGLKDLFFEGETAESFNSEWIDEIELPHYTGTKIAPDS
                     ELCRKILMKGCDTENGRLKKQLNIPEHPRLHLFRGFSKFMSEDLCLLPYFDGMSKKGF
                     KKIVAKVAFEMIKRNDAYSNLVELVFPHHLRLSIHAHTNSGPKFGIKIISNSQCKTIK
                     SLDCEEEPIFDDLLHIPTPWHNCVIKLEDTERFYLTKSKVVMDAISNGSYIGEWVKTD
                     VNTGIGGHYLLKRVKKVNKIN"
     gene            complement(<601061..>601513)
                     /gene="RPB7"
                     /locus_tag="KLMA_10300"
                     /db_xref="GeneID:34713970"
     mRNA            complement(<601061..>601513)
                     /gene="RPB7"
                     /locus_tag="KLMA_10300"
                     /product="DNA-directed RNA polymerase II subunit RPB7"
                     /transcript_id="XM_022819862.1"
                     /db_xref="GeneID:34713970"
     CDS             complement(601061..601513)
                     /gene="RPB7"
                     /locus_tag="KLMA_10300"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB7"
                     /protein_id="XP_022673825.1"
                     /db_xref="GeneID:34713970"
                     /translation="MKRYLKTKLLQEVEGTCTGKFGYILCVLDCENIEIERGRILPTD
                     GSAEFTVKYRAVVWKPFKGEVVDGIVSSCTNLGFEVEVGPLSVFVSPFLMPEDLTFNS
                     GSNPPSYQSSEQIITKGSRVRLKIVGARSEVNSIYAIGSIKEDYLGVI"
     gene            <602079..>602456
                     /gene="MRPL44"
                     /locus_tag="KLMA_10301"
                     /db_xref="GeneID:34713971"
     mRNA            join(<602079..602136,602218..>602456)
                     /gene="MRPL44"
                     /locus_tag="KLMA_10301"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819873.1"
                     /db_xref="GeneID:34713971"
     CDS             join(602079..602136,602218..602456)
                     /gene="MRPL44"
                     /locus_tag="KLMA_10301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673826.1"
                     /db_xref="GeneID:34713971"
                     /translation="MITKYFTKAVVKFNPFGKEAKTARLFLSAIPPAQRTSGLQLQNE
                     VLMAGSTVKPTVKVVFKDKTELQADPTNMNFTELSNYFDRHSRKLALKESIESQ"
     gene            <602847..>603884
                     /gene="RRP36"
                     /locus_tag="KLMA_10302"
                     /db_xref="GeneID:34713972"
     mRNA            <602847..>603884
                     /gene="RRP36"
                     /locus_tag="KLMA_10302"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819884.1"
                     /db_xref="GeneID:34713972"
     CDS             602847..603884
                     /gene="RRP36"
                     /locus_tag="KLMA_10302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673827.1"
                     /db_xref="GeneID:34713972"
                     /translation="MSFYFKNIKPELHSDEDDEDELTHAIRRNETSSDEGSDSEDELR
                     TISFGSLKKADDMMESEEKSKRKSKSNSRAKTATAGITKKNDALEKRRKKQAEEDMKR
                     EEHRQKLKEQQEREEEQKSAEIKMFTEESFDEDSESDSEGGFFEGDSADEYGDNRQSN
                     NNSKKKKGKGKHAPSEASSKKKVRTIRKIPGLEENKSKSIYQDIRFDKALGRPEDISK
                     VRQRYRFLDEYRQKEIKELETMLRDKKFLSKISEREKTEMEQQVRQMKSRLETVQVME
                     MEQKIVKDYEAEINKNNKNKFHLKESEKRKVIQKWKFEHMKGKQREKVMERKRKKRLG
                     KEFKQFEFHKR"
     gene            complement(<604001..>604372)
                     /gene="RDL2"
                     /locus_tag="KLMA_10303"
                     /db_xref="GeneID:34713973"
     mRNA            complement(<604001..>604372)
                     /gene="RDL2"
                     /locus_tag="KLMA_10303"
                     /product="putative thiosulfate sulfurtransferase FMP31"
                     /transcript_id="XM_022819895.1"
                     /db_xref="GeneID:34713973"
     CDS             complement(604001..604372)
                     /gene="RDL2"
                     /locus_tag="KLMA_10303"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="putative thiosulfate sulfurtransferase FMP31"
                     /protein_id="XP_022673828.1"
                     /db_xref="GeneID:34713973"
                     /translation="MSTLPAKVYQFEDIKKLITKPDPSKVLVDVREPNEVAEFALPHT
                     INLPLKTAPGALSLDKEEFENVFHIPKPSKDKELIFFCAAGIRAQAAEELARSYGYEK
                     TGVWPGSINEWLQKSPVSKKE"
     gene            complement(<604846..>605283)
                     /gene="RDL1"
                     /locus_tag="KLMA_10304"
                     /db_xref="GeneID:34713974"
     mRNA            complement(<604846..>605283)
                     /gene="RDL1"
                     /locus_tag="KLMA_10304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819906.1"
                     /db_xref="GeneID:34713974"
     CDS             complement(604846..605283)
                     /gene="RDL1"
                     /locus_tag="KLMA_10304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673829.1"
                     /db_xref="GeneID:34713974"
                     /translation="MTFWNRVIEAWKGESAPKKEEPHYENHGKKYDFDDMVELVKSKP
                     ENTLLIDVREPNEFSIVQIPGSFNMPYKSCPDALSYDEEEFESKFGFPKPGKDKELVF
                     FCAAGRRAEGAQAKAVSKGYTNSSIYPGSTNDWVSKHGDKIQF"
     gene            complement(<605529..>606221)
                     /locus_tag="KLMA_10305"
                     /db_xref="GeneID:34713975"
     mRNA            complement(<605529..>606221)
                     /locus_tag="KLMA_10305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819918.1"
                     /db_xref="GeneID:34713975"
     CDS             complement(605529..606221)
                     /locus_tag="KLMA_10305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673830.1"
                     /db_xref="GeneID:34713975"
                     /translation="MTADIPFYCTNNDDNVLRLFVIRHGQTDSNLNKILQGHKDTELN
                     ATGREQASKLGEYLSKERDIHFDKIYSSDLQRCQQTVDSMLQHFEDRDRIEIVTTDKL
                     RERCMGVIEGMYLRDAEAYAEKMGKPSFRDFGEDAHVFQERLSGVINDIVTKNAANKN
                     LAVVSHGGAIRQILRLLNYDEQNASKIIVFNTSVTIIDYNKADHQFAVRRVGNTQHLG
                     SGEFIVSDLNLR"
     gene            <606437..>608497
                     /gene="MRE11"
                     /locus_tag="KLMA_10306"
                     /db_xref="GeneID:34713976"
     mRNA            <606437..>608497
                     /gene="MRE11"
                     /locus_tag="KLMA_10306"
                     /product="double-strand break repair protein MRE11"
                     /transcript_id="XM_022819929.1"
                     /db_xref="GeneID:34713976"
     CDS             606437..608497
                     /gene="MRE11"
                     /locus_tag="KLMA_10306"
                     /codon_start=1
                     /product="double-strand break repair protein MRE11"
                     /protein_id="XP_022673831.1"
                     /db_xref="GeneID:34713976"
                     /translation="MEAIESLEKFPSDDTIRILITTDNHVGYNENDAIVGDDSWKTFH
                     EVMTTAQDYNVDMVLQSGDLFHVNKPSKKSIYQVMKTLRMCCMGDRPCELEFLSDPAE
                     CFRFNDFPGVNYEDPNLNISIPVFSISGNHDDASGDGLLSPMDILQVSGLVNHFGKVT
                     EADNIEITPLLFKKGVTKLALYGLASVRDERLFRTFKEGKVKFNIPDSRDDDDWFNLM
                     CVHQNHTGHTNTAFLPETFLPNFLDLVVWGHEHECIPHLVHNPIKDFDVLQPGSSVAT
                     SLCDAEAKPKQIFILELKNNEKPSLIPIPLKTVRPFIMKDISLRDFPQLKPLDKSSIS
                     QFLYDQIDEMIQEAVQSNNEENEDESGTVLPLIRLRVNYSGDIDSQVDYQVENPRRFS
                     NRFVGKVANANNVVQFYKKKSPSASKKKKLKYDSSDTSLISDQEVADLQVQTLVDDFL
                     HKMQLSLLPELGLNEAVRQFVEKDDKTALKTFIDTEVSHEVDILAQNKELINTDDDSN
                     LKQLLKEVKRTNTVTNTKKKSNRYSNVDNITSDDDYNMENEFPSESRNTAPTGASQSK
                     RSANSGRKTRSTNRKRGFESELDRSESESEVDEGVDNIQILSEGEEEAKTSNSDDEIV
                     AILDNPKSPTIQKARPTNTSKTNTKKMAAETSKQKSSTRGKGTRTPKSDALSELLARR
                     RSKQ"
     gene            <608871..>609713
                     /gene="PLP2"
                     /locus_tag="KLMA_10307"
                     /db_xref="GeneID:34713977"
     mRNA            <608871..>609713
                     /gene="PLP2"
                     /locus_tag="KLMA_10307"
                     /product="phosducin-like protein 2"
                     /transcript_id="XM_022819940.1"
                     /db_xref="GeneID:34713977"
     CDS             608871..609713
                     /gene="PLP2"
                     /locus_tag="KLMA_10307"
                     /codon_start=1
                     /product="phosducin-like protein 2"
                     /protein_id="XP_022673832.1"
                     /db_xref="GeneID:34713977"
                     /translation="MQNEPMFQVQVDETEDTEWNDILRAHGVIPERPPSPTAQLEEAL
                     EEALAKQHNNRLEGKDLSDLEDLEDDEDEDFLEFYKQKRLNEIRQLQQKAKFGSVYHI
                     SKPEYNKEITECSKGEKKSQYVDDNKDLEKEGVYVFVHLTCQAKIESRLLSSIFEKAA
                     VKFPQMKFVEIPGNRAIENYPDSNCPTLIVYYRGDVVKHLVTLLELGGKDTTLNDFEK
                     LMVDIGAVDEKDDRLIMNYEDDFTKEEKHLRYGKSGIRSGIMGKFNVGVGRNDDNDDD
                     DFFD"
     gene            complement(<609780..>611123)
                     /gene="UBP8"
                     /locus_tag="KLMA_10308"
                     /db_xref="GeneID:34713978"
     mRNA            complement(<609780..>611123)
                     /gene="UBP8"
                     /locus_tag="KLMA_10308"
                     /product="ubiquitin carboxyl-terminal hydrolase 8"
                     /transcript_id="XM_022819951.1"
                     /db_xref="GeneID:34713978"
     CDS             complement(609780..611123)
                     /gene="UBP8"
                     /locus_tag="KLMA_10308"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 8"
                     /protein_id="XP_022673833.1"
                     /db_xref="GeneID:34713978"
                     /translation="MVCPHMDQVVSNQKLGDAVLKECENVRYLIRHADYKSKTLGTMR
                     CADCGEVNCGSTFICLQCGFCGCWNNNHFLEHSQKVGHIFGVNSSNGLVFCFRCGDYM
                     ADLVTEIPASHWDSVMKRTELPASIRRDGLQGLVNLGSTCFMSSIIQTIMHNPYIVRE
                     LLSHKHYNICPLKSGSKCISCAFDEIASDFYGGGPVSATTSSVSKGFVNLLSSSWYLN
                     NHLVGSSQQDAHEYWQFLLNQIHTDHVRLFGSSKASDCKCISHRIFQGYLKNTLQCPQ
                     CGSAKTSIDPIMDLSLEIKNNLTLEDCLDHFQREETLNDFHWECETCKQNQGVIKQLT
                     LHKAPIVLVIQLKRFEHLLNGQSVKLNDRVQFPLHLNLKPHLFKTKDDEIIPNIAYDL
                     ISVVSHQGTVDQGHYTTVACNDNGQWFKFNDSVVTSVTEEQVLDQQAYLLFYSIR"
     gene            <611794..>612453
                     /gene="FSH2"
                     /locus_tag="KLMA_10309"
                     /db_xref="GeneID:34713979"
     mRNA            <611794..>612453
                     /gene="FSH2"
                     /locus_tag="KLMA_10309"
                     /product="family of serine hydrolases 2"
                     /transcript_id="XM_022819962.1"
                     /db_xref="GeneID:34713979"
     CDS             611794..612453
                     /gene="FSH2"
                     /locus_tag="KLMA_10309"
                     /codon_start=1
                     /product="family of serine hydrolases 2"
                     /protein_id="XP_022673834.1"
                     /db_xref="GeneID:34713979"
                     /translation="MVKKVLMLHGLAQSGPYFESKTKGFRRVLEPLGYEFYYPTAPTK
                     CSPADISTDIDDLGASSADDYHTWIVPDPVNNEYRLPDITRTFLREYILEHGPFDGII
                     GFSQGAAVAGYLLTDFNHLLDLTEEQQPTLKFCILFMGFRFKPDVYQEQYIKHPITVP
                     SMHVAGQLDTVVDVAKIHDLHAACAEGTGTYLEHSGGHFVPNSKGFVTKVAEWLQSLP
                     E"
     gene            <612718..>613497
                     /gene="FSH3"
                     /locus_tag="KLMA_10310"
                     /db_xref="GeneID:34713980"
     mRNA            <612718..>613497
                     /gene="FSH3"
                     /locus_tag="KLMA_10310"
                     /product="family of serine hydrolases 3"
                     /transcript_id="XM_022819973.1"
                     /db_xref="GeneID:34713980"
     CDS             612718..613497
                     /gene="FSH3"
                     /locus_tag="KLMA_10310"
                     /codon_start=1
                     /product="family of serine hydrolases 3"
                     /protein_id="XP_022673835.1"
                     /db_xref="GeneID:34713980"
                     /translation="MSQSQKILMLHGYAQSDVIFRAKTAGLRKQLAKKGFELFYPCGP
                     YQLHSKDFNDREVDSKDVQKSVDMYGWFLKDLETNSYTLKSELLDYLSTYIKEHGPFD
                     GIGGFSQGAGLAGYLSTDLQTILSLSNEEQPPLKFAMYFSGFKFEPEEFQSQYTEHPI
                     HIPTLHVMGELDSLVTEERSMKLYEACDPSTRTLLKYPGGHYIPNTRPFINNVLSWLQ
                     AHSGKTTDDKSHETSKKATTASSNDHLDNDLLDVIDSLGKI"
     gene            <614028..>615566
                     /gene="FMP42"
                     /locus_tag="KLMA_10311"
                     /db_xref="GeneID:34713981"
     mRNA            <614028..>615566
                     /gene="FMP42"
                     /locus_tag="KLMA_10311"
                     /product="protein FMP42"
                     /transcript_id="XM_022819984.1"
                     /db_xref="GeneID:34713981"
     CDS             614028..615566
                     /gene="FMP42"
                     /locus_tag="KLMA_10311"
                     /codon_start=1
                     /product="protein FMP42"
                     /protein_id="XP_022673836.1"
                     /db_xref="GeneID:34713981"
                     /translation="MTVKTVGGFDIRIVQVLCAIIWCFLSAGLIFGFAALKPVLVDQH
                     VYEELCYKDGLAANIPCTEQDLKLNRMFTIGAVVTNSIAFPVGWVLDHYGPRVCGLIG
                     SLFLFLGSGCYIATKHLTFLDPYLYGYILLAIGGPFVFISSFQLANTFPKYSGSILAV
                     ITGAFDCSSALFLFYRLYYQKVDSGLNLKRFFSLYLIVPTFITFCQLTFMPSKSYKTL
                     GAVHKLEIEGLDEDGNLPEGQDASLIIPDEGERESLLSGSAPLIQPVLSHGSRRKSVL
                     ENYVEAKLEKKTHGVFGVLHDETALNQIKSYWFILMLLFTVITMLRINYFVATVRSQE
                     EYLLQDPSLAATINSIFDVALPLGGVIAIPLVGILLDRVETYSVLFLATCLSIIIGIF
                     GLIPAFVPNLIGIFILVVFRPFYYTVVSDYCSKIFGFETFGTVYGLMICIAGFMNLSQ
                     TYLDKLTHTTFKMNPTPVNICLLSATIIISVTLLLYIRFQTKKRAKLMEEIQNSSTSP
                     YSST"
     gene            <615971..>616918
                     /locus_tag="KLMA_10312"
                     /db_xref="GeneID:34713982"
     mRNA            <615971..>616918
                     /locus_tag="KLMA_10312"
                     /product="transcriptional repressor Rfm1"
                     /transcript_id="XM_022819995.1"
                     /db_xref="GeneID:34713982"
     CDS             615971..616918
                     /locus_tag="KLMA_10312"
                     /codon_start=1
                     /product="transcriptional repressor Rfm1"
                     /protein_id="XP_022673837.1"
                     /db_xref="GeneID:34713982"
                     /translation="MSKSEETTAVDIGLNENLTSGKQVKLEKESGNDSKESKVNGNNS
                     ILESNNAHKLSANFDSYIYQIKERRQKLYDELKQLEREIIPREFESYNEYYLIKNFKV
                     GKSASGRVNVEGLRSRGNGGPYRRLKRTSRRGSPHGSRDSSRYSSDGNSDDEGNKSDP
                     ENREPHSNDVEYKPSSYKINREITASSIIEEDSTGPVRRSTRLTRKEKERQLSKEKLK
                     KKELENKEKERDSSVSDNEYQSCVIQHLYENLIQKIEKPVRRSDWLLPPKNRYIPEKN
                     QPVKHEPEQIKINELARNSRIKKVLSRFDGGLAGVRTNN"
     gene            complement(<617047..>618396)
                     /gene="ERG8"
                     /locus_tag="KLMA_10313"
                     /db_xref="GeneID:34713983"
     mRNA            complement(<617047..>618396)
                     /gene="ERG8"
                     /locus_tag="KLMA_10313"
                     /product="phosphomevalonate kinase"
                     /transcript_id="XM_022820006.1"
                     /db_xref="GeneID:34713983"
     CDS             complement(617047..618396)
                     /gene="ERG8"
                     /locus_tag="KLMA_10313"
                     /codon_start=1
                     /product="phosphomevalonate kinase"
                     /protein_id="XP_022673838.1"
                     /db_xref="GeneID:34713983"
                     /translation="MLQEHIRAFSAPGKALLAGGYLVLKPEYRSYVVALSARMHALVS
                     QEAAIEKSTTSIKVTVRSIQFNGDEWQYEIDSNSFYTPKEMNGRKNPFIERTLLTIFN
                     YFQPDLSENGDILIEIYSDPGYHSQADTELKTNEIKSFLFHKKTITEIPKTGLGSSAG
                     LVTVLITALVSCFKPSIDVSSSESMELIHNLAQVAHCQAQGKIGSGFDIAAAVYGSIT
                     YSRFDPSLIENLPSVIGGDYHSALKNLIDNTNWNVHAERVSLPPRLRLIMGDVNNGSN
                     TTKLVALVNQWYKENYPRSLDIYNAISQANLEFIESLRQLTLLCDKEREEYESLIETL
                     NSKGKVTHPLLEKIISAVSRIRENFRIITKESGADIEPEVQTHLLDAAVKLPGVLTGV
                     VPGAGGYDAICLITTDSCHIADETKNDPTFSKVTWLDLSQQDMGIIEEKANNYLNLR"
     gene            complement(<618675..>623159)
                     /locus_tag="KLMA_10314"
                     /db_xref="GeneID:34713984"
     mRNA            complement(<618675..>623159)
                     /locus_tag="KLMA_10314"
                     /product="silent chromatin protein ESC1"
                     /transcript_id="XM_022820017.1"
                     /db_xref="GeneID:34713984"
     CDS             complement(618675..623159)
                     /locus_tag="KLMA_10314"
                     /codon_start=1
                     /product="silent chromatin protein ESC1"
                     /protein_id="XP_022673839.1"
                     /db_xref="GeneID:34713984"
                     /translation="MSKRPLFIEFNDKGKGKSFRRPHSPFVSRGVHLSIRRRNAVQNS
                     NSLVQHSQGVRASSSVNNISLDANETVEMVQSLIERGRNLLKSVSAKEKSLQYDVEAE
                     LRKESLRLEYIDKSLGNDDSQIFGDLSDAIPAVKGPESVSVSTTKERESSSDDSIIIL
                     SDEDESMEETEQYANSFNDNDALGVLSDEPQDEEEDEEEEEEEEEEELFGSEGDEEIG
                     SPSPVSSEHSNRDENQLLSEYSDEEGYINEEDISSEGDQETSKPILYMQQPSQPRLDN
                     NYAMKEKSNENVELSEPDIKSYEEVVDDNVVEMTDNSEEEGIENEEEVANVEEFNAHS
                     DIENSVGKAEHQSDFIYNMNSIAKQALDRMNRHDIEDFETMHIESEDAHSEDAELSHE
                     QKHNSQYNSSDIEEQEQEQYSEDISEQSYSEEDTQNLRSDGVGELGEYSYHINSGNNE
                     YGLITDHDHSIVTGKNEEEQKEVDNLKSAAVLDSSVNIESESETKQSSSNLATVNEEK
                     QDSEVQETVTYAENSPPQKKAKYTLSFSETYSDTDSRISGAEEYRDGSTTEYHSAFSN
                     NPFENSEKVQEEDHILQNILDSLGLSAEGVNGGIQENQCEEDSSVDRNDVSNVISQEF
                     KKALPKNSSFDASNTINETVPIENIEDSSNSKHTSPVMINSEDQEGICSADSDVENES
                     ELPSKENSMPEERDVAIKIPLFVDEETIRLTTSPVRKIPTSGSEEIETSIDHNMTDRI
                     KLNRLSVNLECDLLDQRGASLTSVLSNNLQNSMALQSSPETLEPAFGTEVTKEQIGSK
                     PSASQTHNDGISAYDDTKELSNESNPFESSSVKDKSNIKTLPLLHPQATATQSYPFKV
                     LKHSEKRTELSDYVNLIIHGQESNESSVPTPIVTEPLERSISSGGTENSTIQVEEVVT
                     EVPSTDNIQKISTEPEVTLKSSPEIVHDAVIIEEVAFETEITENNTELNSDNQLPDGN
                     VTVQESTHYTSQSVQDITVEATGNNIVNDVWHIDDSNHVSTEIENADVQNIGFRNAKS
                     LSENSIQSSVQNLDEIEVLLSESPELSIHRKENDQANGTEQVAKFDNNIPHNNQNSDI
                     TSEITQQHGSTDADSSSGSRKSIAKLIISSPLKILSSLANGLTSVSNAASEFVSTVNS
                     VTLPYDDGSIDASPAENIEYISTVNEEDVQEEDVKEEDVKEEDVQDELADEELVDEEN
                     LEEEDIQEELADEELADEELVDEEDIKEEDIKEEDIQEENVEEENVQEENVEEENVQD
                     ELADEELVDEENLEEELVKEENVKGDDKQHLTSKKAEHNDYGSEISDIKGEITEKPQF
                     LEENVKIEQASEGTNMNHDDNHYENNETLAPTKKQASISKPKNNVNNEDNSRDSSNDV
                     FYSADNNEDVELSKIETSTRSDSKSSYNENNDMDSQLKTAKPEDTVTILAEEKPEKVS
                     DIQVTIQEELPKLERTPVKKRPRAVDTERKPSKKKRNKKKKQYRQRNSVMRNLRPRSK
                     "
     gene            <623373..>626576
                     /gene="TRS130"
                     /locus_tag="KLMA_10315"
                     /db_xref="GeneID:34713985"
     mRNA            <623373..>626576
                     /gene="TRS130"
                     /locus_tag="KLMA_10315"
                     /product="transport protein particle complex II subunit"
                     /transcript_id="XM_022820030.1"
                     /db_xref="GeneID:34713985"
     CDS             623373..626576
                     /gene="TRS130"
                     /locus_tag="KLMA_10315"
                     /codon_start=1
                     /product="transport protein particle complex II subunit"
                     /protein_id="XP_022673840.1"
                     /db_xref="GeneID:34713985"
                     /translation="MTESDETSIIPCVEISYFDPFHLFEGLRNELEQRLPLINLHWKS
                     KEGTLKTIPKLRVDFKASTGEKLVEEYVLKPFINCVIVSCESVEEYRSKIRPLIKNWL
                     PLQDDVYCTNIAILHSNKEVMDSNMFKSISLIEKFSKDFPSLKTIETKTVYKSNEERD
                     SFWSALINKLKQDLLEVFERRIQIYSLASKNETDPVKCVMLHENLLKIYLSFQLCDEA
                     SKEISSLESLLTDSKKFPVPLGELQSAVFNQDNFTVNTISTLLSKNELTFFRLHKCIV
                     RAQLELFIISSESRDSAEKLNTAFHNFIWKLYSHYKHDEKWLQFKYSLYDEFIYLSLF
                     DSIKSDFLKLMLCDLKNEQRECWIQLACSSMKYSIPLRDCYNPIIAKVDQELIESFRT
                     KDLFYSNLLEKTTALLKEYSVYTSKRQRVMDWLSIDVALVYFDRGNYQECMTILQSSY
                     DFYMESHWPVISTWLLEFYVECIKKSTDVEVIDVDGDLVPKSIVLSNSYLNLLTSKGD
                     AAGHWWDEFLNCNTENNDNLVYPLDNIFLVDIPRRVSPVAPNKYGIDISFSKKSISKD
                     INVSFAKLLMKNYSDEFLTFSSNDLTLTGDTSTYTLTSNNIVWCTFELVSLEIMVGTT
                     VFKKEFDSFETEDSLKLEPCQFAGSFNIDVHKFIEKIGECSYLKLCFENPEEVDSFTL
                     SITTSEDGVVFEGGQKHFVVKDLNVTRVPFSMLSTTSSKFTIKTLLSFTRDGEDFTES
                     SIHEIDCSLPLAVTVNDIYLEKKLLFDFSLKVLADEPIILCAAELSSTSPDMFTITNG
                     QSFSDQEVLNPCLNAPYQIYFQISKNSGKFSSSDSFNLSLKYLRLNQYLEVMLQTYLS
                     NKLNDVDYENLWKSYILPFLKFDLKAFEMSRKLTVIKKESMMKIRMNQEKSFAKQDRH
                     KSLLNELTSGISIDEIEINKRSLTESLEELVICVKPPAMEIFFSVTFSRVNPTVELEP
                     GVSSVFRVSITSLHDDWETKDEQVKAVFTVNNNSEWAVGGKRRFEVDSKQITVDVNLI
                     PLRRGYLNYPAVEITNLDGDSVGQIDYHDSNDKILIF"
     gene            complement(<626605..>627390)
                     /gene="HEM4"
                     /locus_tag="KLMA_10316"
                     /db_xref="GeneID:34713986"
     mRNA            complement(<626605..>627390)
                     /gene="HEM4"
                     /locus_tag="KLMA_10316"
                     /product="uroporphyrinogen-III synthase"
                     /transcript_id="XM_022820041.1"
                     /db_xref="GeneID:34713986"
     CDS             complement(626605..627390)
                     /gene="HEM4"
                     /locus_tag="KLMA_10316"
                     /codon_start=1
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="XP_022673841.1"
                     /db_xref="GeneID:34713986"
                     /translation="MSRIIFLKNKTTPTDPYETTFTDGGFEPVFVPLIRHFHVPDEAL
                     TLFRNRSYLTKLKYIIVTSQRTVECLNESILPKMTTEEQSLLKEKTIYTVGPATSEFL
                     RNSGFQNIRGGVEVGNGGLLADLIVKSHSEEEIDHFLFLVGEIRRDIIPKKLKANGYK
                     VNEIVTYKTENLLDNIDRFILHYKNDENNQAVMNKPSTWIVFFSPQGTEDIIEYLKEN
                     KGYKIASIGPTTEKYLLEKGLKPDTVSFKPSPIFLLNAINSYK"
     gene            complement(<627844..>629418)
                     /gene="GUA1"
                     /locus_tag="KLMA_10317"
                     /db_xref="GeneID:34713987"
     mRNA            complement(<627844..>629418)
                     /gene="GUA1"
                     /locus_tag="KLMA_10317"
                     /product="GMP synthase"
                     /transcript_id="XM_022820052.1"
                     /db_xref="GeneID:34713987"
     CDS             complement(627844..629418)
                     /gene="GUA1"
                     /locus_tag="KLMA_10317"
                     /note="glutamine-hydrolyzing"
                     /codon_start=1
                     /product="GMP synthase"
                     /protein_id="XP_022673842.1"
                     /db_xref="GeneID:34713987"
                     /translation="MAPVEVSNVFDTILVLDFGSQYSHLITRRLREFNVYAEMLPCTQ
                     KIADLGWTPKGVILSGGPYSVYEKDAPHVDKAVFDLNVPVLGICYGLQEIAWINNTEV
                     GRGEKREYGPSTLHVQDKQCPLFANVDNSTVWMSHHDKLHGLPTGFKITATSDNSPFC
                     GIAHEEKPIYGIQFHPEVTHSTQGKTLLRNFAVDICKASQSWNMENFIDTEIQRIRDL
                     VGPEAEVIGAVSGGVDSTVAAKLMDRAIGDRFHAIMVDNGVLRLNEAATVKKTLGEGL
                     GINLTVVDAADEFLDKLKGVTDPEKKRKIIGNTFIHVFEREALKIKPKSGKEIEFLLQ
                     GTLYPDVIESISFKGPSQTIKTHHNVGGLLENMKLKLIEPLRELFKDEVRELGELLGI
                     PHDLVWRHPFPGPGIAIRVLGEVTREQVAIARKADYIYIEEIRKAGLYNKISQAFACL
                     LPVKSVGVMGDQRTYEQVIALRAIETTDFMTADWFPFEHSFLKNVASRIVNEVDGVAR
                     VTYDITSKPPATVEWE"
     gene            <630562..>631695
                     /locus_tag="KLMA_10318"
                     /db_xref="GeneID:34713988"
     mRNA            <630562..>631695
                     /locus_tag="KLMA_10318"
                     /product="RNA recognition motif domain-containing protein"
                     /transcript_id="XM_022820063.1"
                     /db_xref="GeneID:34713988"
     CDS             630562..631695
                     /locus_tag="KLMA_10318"
                     /codon_start=1
                     /product="RNA recognition motif domain-containing protein"
                     /protein_id="XP_022673843.1"
                     /db_xref="GeneID:34713988"
                     /translation="MSERNTVHVSGFPAGTRANELAPQFESVGRLVRIDIPQLDHYKS
                     GPYAFVEYESFEDAENAIRACDGTPFQMNPSFMLRVQIARSKGRRDREPREFREPANY
                     RDRRRERDPRDNFSRDRMRSFRDQDDRRPRFDPRGDPRGDPRGHNARRGGPSRYNNAP
                     PRRYDERLGEPRPYEPVFGMPVPPPPPPERKLRDPYPNELAHFRRTGKGVPQLSSAHA
                     EESSGNASVSSPAPAPASATASASASTTSMDVAEASAAADTTATATQQEQGNESDGSN
                     YDPNEAVPVSEPVPTENTQEAPETAAAETAVAETAVAETPVLENPDAASNLEQTEHTT
                     APDTPPAETTTTQVSAESQIQSLPEPSAAPSETEKPTASEARD"
     gene            <632393..>634537
                     /gene="SKY1"
                     /locus_tag="KLMA_10319"
                     /db_xref="GeneID:34713989"
     mRNA            <632393..>634537
                     /gene="SKY1"
                     /locus_tag="KLMA_10319"
                     /product="serine/threonine-protein kinase SKY1"
                     /transcript_id="XM_022820074.1"
                     /db_xref="GeneID:34713989"
     CDS             632393..634537
                     /gene="SKY1"
                     /locus_tag="KLMA_10319"
                     /codon_start=1
                     /product="serine/threonine-protein kinase SKY1"
                     /protein_id="XP_022673844.1"
                     /db_xref="GeneID:34713989"
                     /translation="MGSSLNGFITKSSSASRHSNGSIFQREPVAKCNNTTRSNLSLAI
                     QTQMKNEEQVPIPIPGAQERQADKLNSGKRGPVFGLADDIVDGIEDDDDDDDDDYSSC
                     DEKNEESSKDYKPGGYHPAYKGETYKEGRYVLVRKLGWGHFSTVWLAKDTETGSHVAM
                     KIVRSDKVYTESAFDEIKLLQGVSPSENEGYGKHKGSAHILKLLDNFIHSSVNGDHVV
                     MVFEVLGENLLALIKKYEHKGIPVVYVKQIAKQLLLGLDYMHRKCGVIHTDIKPENVL
                     MELGDVETIVKIVEEMDYVKRVQRKMQRRASRAHLDQHSRQGSFTAITDNPSGSVSSS
                     STTARSRRSRRPTIITGSQPLPSPLGSSSFLELKAHVFASSFNNMSRQPSFGGKLGSS
                     LLQNGTIVTDYNNNSNSNNTNGNNKSNNNNSNKNSTHGIIDNNSDDDGDDKFATPQTN
                     PSVLQNGEKNISRLQNMINAEKREHDSSSELLANSFSSMELADQRNGDASSASNLESP
                     VIPSSDVIQVKIADLGNACWYDEHYTNAIQTREYRSPEVILECPWGASADIWSVACLI
                     FELLTGDFLFEPQNGHSYTKDDDHIAQIIELLGNIPEYLMTTGRAVRTFFNSRGELRN
                     ISRLKYWPLKSVLIEKYNMDPKEAEQISDFLLPMLEMDPRKRADAGGMINHPWLADAL
                     GMEDVTVPDRKLYHSGADIPGWYKEVQGHAKH"
     gene            complement(<636337..>637848)
                     /gene="GAS3"
                     /locus_tag="KLMA_10320"
                     /db_xref="GeneID:34713990"
     mRNA            complement(<636337..>637848)
                     /gene="GAS3"
                     /locus_tag="KLMA_10320"
                     /product="probable 1,3-beta-glucanosyltransferase GAS3"
                     /transcript_id="XM_022820085.1"
                     /db_xref="GeneID:34713990"
     CDS             complement(636337..637848)
                     /gene="GAS3"
                     /locus_tag="KLMA_10320"
                     /codon_start=1
                     /product="probable 1,3-beta-glucanosyltransferase GAS3"
                     /protein_id="XP_022673845.1"
                     /db_xref="GeneID:34713990"
                     /translation="MVLPTALLAALAATPFVGAILPIHTRGDRFILPSYPSNSTDENS
                     VFYIKGIDYQPGGSSSYDPSSGKDLLSDESICARDAFVFQQLGINTIRIYSLNPDVNH
                     DKCMTILNNAGIYVILDVNSGEYGESLNRADPSGSYKGFYLERVFKFIEAFKDYPNVL
                     GFFSGNEVINDDSNYASIDPPYIRAVQRDIKQYISKHSNRTIPVGYSAADNTDLRLAT
                     YDYLQCNALNGSRVDQNLDISRSDFFGLNTYEWCSGSSDWTSSGYDKLESGFKNGTIP
                     AIFSEFGCNKNSPRTFDEVSEGLYDGLLDTFSGGLVYEYSQEGNNYGLVKIDDDGNIE
                     YLKDFDNLKSQYQKVKLPDTKENNVTESKTSVCNASKIKSDNSQFGVNNFTIPEQPSD
                     IADMIKNGVQTNNTGKILTDYTPPTTLKYTIKDSNGSEVSATITYPSSNTINGISTST
                     SATSSATSETKSKSSATSSSAHSSSKSKGDAAGSVAVNTGLMAIVAGVISALL"
     gene            complement(<638866..>639975)
                     /gene="DNAJA1"
                     /locus_tag="KLMA_10321"
                     /db_xref="GeneID:34713991"
     mRNA            complement(<638866..>639975)
                     /gene="DNAJA1"
                     /locus_tag="KLMA_10321"
                     /product="dnaJ-related protein SCJ1"
                     /transcript_id="XM_022820096.1"
                     /db_xref="GeneID:34713991"
     CDS             complement(638866..639975)
                     /gene="DNAJA1"
                     /locus_tag="KLMA_10321"
                     /codon_start=1
                     /product="dnaJ-related protein SCJ1"
                     /protein_id="XP_022673846.1"
                     /db_xref="GeneID:34713991"
                     /translation="MVKLLSLLSFALLPFVLAQDYYAILGVDKQASEKEIKSAYRQLS
                     KKFHPDKNPGNEEAHHKFIEVGEAYDVLSDPEKRQIYDRHGAEALKNGRGGNGGGGPG
                     FHDPFDMFEQMFGGGMFNRGQRGKPRGQNLQVNHEVTLKDFYVGKEFEFSLNLNDVCD
                     VCKGSGSKDGKTNTCSDCGGSGFLVNVFRAGPIEQRVRQQCQKCQGKGQIIKHVCKKC
                     HGSKVVQTSKVFTATVEPGMERNYVHVLHGEAEKHPDVQPGDLYQLFSESEKGTMGYR
                     RRGDKLYRTEILSFKEALQGGWERKLEFLDSTKQVELSRPAGRTVQNGETEVIKNFGM
                     PIHDRPGSYGDLIIEYIVLLPGEWKASSSNIIDEL"
     gene            complement(<640434..>640979)
                     /gene="CAF20"
                     /locus_tag="KLMA_10322"
                     /db_xref="GeneID:34713992"
     mRNA            complement(<640434..>640979)
                     /gene="CAF20"
                     /locus_tag="KLMA_10322"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820107.1"
                     /db_xref="GeneID:34713992"
     CDS             complement(640434..640979)
                     /gene="CAF20"
                     /locus_tag="KLMA_10322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673847.1"
                     /db_xref="GeneID:34713992"
                     /translation="MSYERANKQSHSVQAANLQQYLVISPQLKMIRYTEEELLQLKPT
                     EPVKPNFDVDEFNSIIEKVKEIQGAHEEEFSHFSRRRSSHHHVKPKFKHLKPKITTDE
                     EGWSTLETAPAVRRKSTADEEEVSIPIAQETLKVKPNKHISSSRPADARDVVADKPTK
                     AFNAFAALGSDEEEEEDDDEE"
     gene            complement(<641136..>642782)
                     /gene="MTG2"
                     /locus_tag="KLMA_10323"
                     /db_xref="GeneID:34713993"
     mRNA            complement(<641136..>642782)
                     /gene="MTG2"
                     /locus_tag="KLMA_10323"
                     /product="GTPase MTG2"
                     /transcript_id="XM_022820118.1"
                     /db_xref="GeneID:34713993"
     CDS             complement(641136..642782)
                     /gene="MTG2"
                     /locus_tag="KLMA_10323"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="GTPase MTG2"
                     /protein_id="XP_022673848.1"
                     /db_xref="GeneID:34713993"
                     /translation="MLTRPAALRLLPSSKFCRYISDIPDNAPGAIDNEIWLQELANGR
                     KKSKRTPSVSQTEDLSIKHDKKAVATKSRGLQSKIKYEVISTPPDTPFIEIKSPLSNF
                     TKMSYLQKNKNVRVQQSNFVDLRIIKCRSGNGGDGCVSFFRDRGRAIGPPDGGDGGEG
                     GSVYIQAIEGINSLSKLKTTYIADNGLNGTSDQADGAKGKDVMITVPVGTVVTWCLDP
                     KIVREYVDQKIKENKGGSLRDILETSKIRLNCTGRFSIDQKPSHIQLFRKSYEAGKGW
                     IFKGKDEEYHLSKDWFQDLAKNVTEYDMDLEQSELETDRFPLLGLDLSKPTDKPICLL
                     KGGKGGLGNMHFLTNLIRNPRFSKEGRSGLEQYFMFELKSIADLGLVGLPNAGKSTIL
                     NRISNATPRVGHWEFTTLHPTVGTISLGIDKPKFTVADIPGIIKDASQDKGMGLEFLR
                     HIERSKGWVFVISLEKEEPLEDLFTLMNEVGGEEALATKNILVVCNKADIDEKSTFTK
                     YQTVLTFCQKNNWEVIPISALKGENIDALLVKMAQCAGKA"
     gene            complement(<643009..>643800)
                     /locus_tag="KLMA_10324"
                     /db_xref="GeneID:34713994"
     mRNA            complement(<643009..>643800)
                     /locus_tag="KLMA_10324"
                     /product="THO complex subunit THP2"
                     /transcript_id="XM_022820129.1"
                     /db_xref="GeneID:34713994"
     CDS             complement(643009..643800)
                     /locus_tag="KLMA_10324"
                     /codon_start=1
                     /product="THO complex subunit THP2"
                     /protein_id="XP_022673849.1"
                     /db_xref="GeneID:34713994"
                     /translation="MSNAYLDRLDEQEDQMNTTQSLALEVLDNLEELIKTAEDKSVED
                     DSTGLNVLETLRSKNKELLKSITMTRVLQLNATEKRAELLKNPDLTTSKLFLSPDDRN
                     HPDNLFNYFEEGKLLHETWMRHLSLISNLSDDLVVKLESHDDSNLVVTNKDPLPPVLK
                     NTIRKYEELGPEQQHIEDIRAALFQYLDDIKAGRAKYALENKYILNTSLQEITKEVSE
                     WSQRWTNIENTLFGDSPNSLKKLIQKADEIKELLSSDSIDSSPAV"
     gene            <644094..>645992
                     /gene="CDC23"
                     /locus_tag="KLMA_10325"
                     /db_xref="GeneID:34713995"
     mRNA            <644094..>645992
                     /gene="CDC23"
                     /locus_tag="KLMA_10325"
                     /product="anaphase-promoting complex subunit CDC23"
                     /transcript_id="XM_022820141.1"
                     /db_xref="GeneID:34713995"
     CDS             644094..645992
                     /gene="CDC23"
                     /locus_tag="KLMA_10325"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit CDC23"
                     /protein_id="XP_022673850.1"
                     /db_xref="GeneID:34713995"
                     /translation="MEQVVLEDAQSQLRQSSTDLSRWKLFQSAKWSSEALMGMCTLNE
                     EKPINAELSLVTDGDDESPLKKRQMLSSSGVLFDLGNIDKNADSMAECIPLVDKDFDL
                     YLLASSLFDCKEFDRCAFFLKDAKHAGLKFLYLYSRYLLWDKKVTESTEDVMIKDPEV
                     ISTDTSDSLKGSEFGRDSDSKNRTSSSFCNKDVDVGNGEKINLPKLYHEITEFLEESE
                     TQSKLETALLYYLLGIIQKKQGVPSSAMNSFLKSLKLYPYNWTCWCELLSCISRADES
                     ILLLKYLNDNFSMIKEDGIVHEHLMLRFFKLAIFKEFGGDFDKYIEELGDMMNLFPKF
                     SFLRAQYALINYKYMDYANAEIVFDELVSMDPYRLDDLDTYSNVLYVLQKPYKLAYLA
                     QYAANVDVYRPETCCIIANYFSSKQQHEKSILYFRRALMLDKSYTHAWILMGHEFIEM
                     KNSHAAIECYRRAADVNPRDFQAWYGLGQAYEVLDKHSFALYYFQKACSLKPLDKRMW
                     FASASCYEKLDKTMQAIKCFQRASQLSSEQDSAVLYRLAKLHEKNNDISVCKHYMIKC
                     VELDELKKSHVADEIGKAKLWLAKHEFKHRNYQEAYTYANGVNNGTSQEIEEARAILA
                     ECRKRVEL"
     gene            <646474..>653724
                     /gene="PRP8"
                     /locus_tag="KLMA_10326"
                     /db_xref="GeneID:34713996"
     mRNA            <646474..>653724
                     /gene="PRP8"
                     /locus_tag="KLMA_10326"
                     /product="pre-mRNA-splicing factor 8"
                     /transcript_id="XM_022820152.1"
                     /db_xref="GeneID:34713996"
     CDS             646474..653724
                     /gene="PRP8"
                     /locus_tag="KLMA_10326"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor 8"
                     /protein_id="XP_022673851.1"
                     /db_xref="GeneID:34713996"
                     /translation="MNGAPPPPPPPGFPGNGPNINISSKDTKARKIGTGTENQFLSQP
                     PPPPLTGLPGAHSLPPPPPPPPGLSPGIDIASSNSNHKFNLPPPPPPPPPPPTEPQNL
                     QNDDLNHDPSSNRPKKMKKRGNNKVSKASGLVHSHKIEMPPEHLRKIINDHMDMTSSR
                     FNSDKRAHLNALRYLPHAILKLLENMPQPWEQAKEVKVLYHTSGAITFVNEIPRVIEP
                     VYIAQWSTIWIAMRREKRDRQHFKRMRFPPFDDDEPPLHYSDNIEELEPPEAINLELD
                     SNDDETVKDWLYDTRPLENNSSLVNGTSYKHWKLSNEVICNLYRLAAPLIEATDLDRN
                     SQYLFDKRSFFTAKALNNSLPGGPKFEPLYPREEEEDYNEFNSIDNIIFRIPIRTEYQ
                     IAYPHIYAFRPRSVSTLWYHDPLSCLIKNEDSESLPVFFFHQSLNPIVTETIRHSLTE
                     AERNKNIQFRIPIDIMPLMDEEELVLPTTKDAMAIYNASHPYNKKSGKMVRAQDVALI
                     KKWYMQHPEEDYPNKVKSSYQRLLKNYVSNELHKDKHVPQKKIKLLKSLGNTKYFQQT
                     SIDWVEAGIQLCRQGHNMLNLLIHKKGLTYLHLDYNFNLKPTKTLTTKERKKARFGNA
                     FHLIREILKIIKLLVDAHVQYRIGNVDAFQLADGLYYILNHTGQLTGIYRYKYKVMHQ
                     IRTCKDLKHVVYYRFNKIIGKGPGCGFWQPAWRVWIFFLRGIIPILERWLGNLLTRQF
                     EGRSTDVVKTSTKQRLDAYYDLELRASVMNDILDMIPDGIKQNKARTILQHLSEAWRC
                     WKANIPWDVPGMPEPIKNIIERYVKAKADGWISQAHYNRERIKSGTHIEKTVLKKNLG
                     RLTRLWIKHEQDRQKEIEKAGPEVTPTEASAIFSAMVDWLDARNFSAIPFPPLTYKND
                     TKILVLALENLKEQYVSKVRLNAQEREELALIEEAYDNPHDTLNRVKKLLLTQRLFKP
                     VQISMMDHYQHISPVYNIDPLEKITDAYLDQYLWYEADRRQLFPNWIKPSDSEIPPLL
                     VYKWCQGINNLDEVWDINNGQSTVLFQTTLQQFSEKMDLTLVNRLLRLVVDPTIADYI
                     TAKNNVNIVFKDMNHINKYGLIRGLQFAPFVYQFYGLMIDILILGHERAHELAGSPSE
                     PSEFLQFGDKGIEKKNPIRLYSRYLDKIHILFHFEESESNELIQDYLMENPDPNFENA
                     VGYNNKKCWPRDARMRMIRHDVNLGRAVFWEISSRVPKSLVNITWENSFSSVYSKNNP
                     NLLFTMCGFEVRIIPKSRLDDVISHDEGVWDLVLNSTKERTAKAFLQVSQESIDEFRG
                     RIQSILMGAGSTTFTKIVGKWNTALIALFTYFREAIVTTEPLLDLLVKSETRIQNRVK
                     LGLNSKMPTRFPPAVFYTPKELGGLGMLSASHILIPASDLRWSKQTDTGITHFRAGMS
                     HEDEKMIPTIFRYITTWENEFLDSQRVWADYAIKRQESIKQNRRLAFEELEGSWDRGI
                     PRISTIFQKDRHTLAYDKGHRIRRQFKEFSVERSNAFWWTNNRHDGKLWNLNAYRTDV
                     IQALGGIETILEHTLFKGTGFQSWEGLFWEKASGFEDSMQFKKLTHAQRTGLSQIPNR
                     RFTLWWSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESVV
                     FDICQILDSQMDILQVESVNKESIHPRKSYKMNSSAADVTMTSVYKWKVSRPTLLHQQ
                     KDSFDATTTDKMWIDVQLRYGDYDSHDISRYVRAKFLDYTTDNVSMYPSPTGVMIGID
                     LAYNIYDAYGTWFEGLKPLIHNGMKTIMKANPALYVLRERIRKGLQIYQSQVQEPFLN
                     SSNYAELFSNDTKFFIDDTNVYRVTVHRTYEGNVATKPINGCVFILNPKTGELYLKII
                     HTSVWAGQSRLAQLAKWKTAEEVSALVRSLPKEDQPKQIIVTRKAMMDPMEVHMLDFP
                     NISIRPTELRLPFSSVLSVDKLNDVVSKATEPQMVLFNIYDDWLTRVSAYTAFSRLIL
                     LLRALKSNEEKARMVLLEDPTIPTKSNHLWPSFTDEQWISIETKMRDIILTEYGQKYH
                     VNIASLTQTEIKNLILGQNIRAPSVQRQKMAELESAKKQTEETDTSTAASAMKIKTVN
                     AQGEEITVVSSSNYETKTFSSKNEWRTSAISNSLLHLKLKNIFVAAEDFVDNKDVFVF
                     PRNLLKKFVTISDVNIQVAGYLYGKSLKDRENVKEIRTIVLVPQLGSSMHVRLSPPPV
                     KSRYLKGMELLGWIHTQKNDSKFMSPSEVISHSKTFSDHNKSALDLSINLIPGAVSII
                     GYTLKDDGFNWGLQSQGIMDPSPEGFDPSFSDNAQILLSERIMGNFLVPKSSLWNYAF
                     MGTSFSEELPYELKLDIPIEFYNELHRAPHFIQFSEMVGDNELEAEQESVFV"
     gene            <654069..>655172
                     /locus_tag="KLMA_10327"
                     /db_xref="GeneID:34713997"
     mRNA            <654069..>655172
                     /locus_tag="KLMA_10327"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820163.1"
                     /db_xref="GeneID:34713997"
     CDS             654069..655172
                     /locus_tag="KLMA_10327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673852.1"
                     /db_xref="GeneID:34713997"
                     /translation="MVRYKGKREAGPSSSKTRSAISKPRPNHTHITNRKVIPNREYQD
                     HQKKSHININKNKNKNILNSWDDKSQIATDGAPYEKEIYERITKLTRLGIPFDQVLSK
                     TGIEFERLKDIYDRLLLPVNVNDDLVLLSVRSHSAEQNSNLKAEKESYKRDNVDDMIN
                     NQKNAQIPLLLNNRGVYSKSPSPPNTDINQSEVNIIAKPSTDVLHLDKNDEQLSINFY
                     EQVSRNLMKLRLDFLKLKSALHDRVPKLDEFQKASLRKKKNLLISDIEKFYESMHMNE
                     DKSSGFNEDFIGLSDSALDKEDFEETNLPSISMNLSNKTNHPTSQKQGIDNTSDDPPE
                     IITDSVIKLKRSKPDQFTPYHSLNLSKSISPNI"
     gene            <655580..>660016
                     /gene="DNA2"
                     /locus_tag="KLMA_10328"
                     /db_xref="GeneID:34713998"
     mRNA            <655580..>660016
                     /gene="DNA2"
                     /locus_tag="KLMA_10328"
                     /product="DNA replication ATP-dependent helicase DNA2"
                     /transcript_id="XM_022820174.1"
                     /db_xref="GeneID:34713998"
     CDS             655580..660016
                     /gene="DNA2"
                     /locus_tag="KLMA_10328"
                     /codon_start=1
                     /product="DNA replication ATP-dependent helicase DNA2"
                     /protein_id="XP_022673853.1"
                     /db_xref="GeneID:34713998"
                     /translation="MVSTPKKKRTASIAISPLKVSSVNDIPLKTRAKKKSNKTYQFAP
                     LNNLSSGEPVLKSIPISKVRNADPALKAKGLSGKTRVQPQSKVKENNVLGSCKVHPDR
                     SPETRYSDGPSEEVIWRYSPRRLDEQIANHYDLADESDNDDSMNGADIRGQSSTPLIN
                     DKFKDLIGCDDINEEIPIGTHGRVAQGSPIKKAQREVTPIRDINEILNDLEGPKTLPP
                     SSPVGRENSVSDEASSKPSQVPILNNTSIKEANKNSFSIDQPGMRKSKSPVCINIDSD
                     ESDKAECKEVDEEEDDDSLIDILTQRFTKPSFKDMDDQSSQSQEDSLLELLEEEMEIS
                     HNNVTTNAQKQSQLQTRKRLERVEVVLEPQEESGEESVNPKSDQNVSPLEQEDEITRY
                     AKLAEFPYPQKGFQRLCIYDIKELKTPLQIILTCINQHKEKINIILREPWVRYKYEKG
                     MIIHLIAGENFPNKRLLSNDKDPKTGLENDNLLIVYPDVLLSATMIGTAMDCERRAVL
                     SARLNEPGEYSMAATLGNIIHSLIQELLRLKLLQPNQFISKGLALEVLDKIIKPFTTE
                     VNMCNESVDSAVKTITDEHLPFIIEFVNTNVTKENARSWVQVIGSKNKRKLSVSDIID
                     IEENIWSAKYGLKGYIDVTVETNVDNDGKRLLAPIEIKTGKWKSNAHEAQGLIYTLLL
                     QDRYDIPVNAHMMLYTKLKEFSLQPKVLNSLKHLLNLRNKLAKYLQVMNQEMSDWGGT
                     EHELPEMIQSSKCDQCFSKNSCMVLNKLSDKEQMPGLLKHEYSDLTRHLEGKLQLYRS
                     FYRKYDRLLMMEETSVVSLVKDTFLMSGEERELQTGYCVSELRLSNVQNLGQRYLYTF
                     TRDKQKRSSKSRISKDDNPSMESLSMLSSNIHQNDYVMISDNITGQLAVGTGHVVEIA
                     EDFIVVSCGRNILANNIHGDSFNRDTRQVVRSVLMNQSIQLQENTKLTSQRYRIDKNE
                     SATGLALARYNLLNLFLPEVLLESGSSLPASGEKSFLPAKQSLGGYSRGRNLIVELNE
                     PQWVKNVTKLPTISGDFNAQQQKAIERSLTCRDYNLILGMPGTGKTSVICELVSILVG
                     QGKSVLVTSYTNSAVDNIMMKLIKRVARSKMVRLGSKSKVHELIKPYCISELYNGENE
                     NMSGIIDGAQVVGVTCLGINDPWLQLRTGDFHYVILDEASQVSLPVAIGPLRFGYKFI
                     LVGDHYQLPPLVKNKFAQENGLQESLFERLCRTHPQSVVELQEQYRMNQEIMSLSNIL
                     IYEGKLRCGTNSVRDQRLEFPDDAVMCKMANETTLLHKLIDPNRPVVIFDHDAGWDEN
                     YGPEQCQEQNDHGQICNVGEARIVDQIVRKLLEYGIQDRQIGVMSMYKAQMSLLRTTF
                     EDTNIEVLTADQFQGRDKDCIVVSMVRSNPDQSSGVLLRDIRRMNVAMSRAKKKLIVV
                     CSWQCVSAIHSLKPFINHVVRNNWVLSRRDQENRASNPVVKN"
     gene            <664230..>666821
                     /locus_tag="KLMA_10329"
                     /db_xref="GeneID:34713999"
     mRNA            <664230..>666821
                     /locus_tag="KLMA_10329"
                     /product="RNA recognition motif domain-containing protein"
                     /transcript_id="XM_022820185.1"
                     /db_xref="GeneID:34713999"
     CDS             664230..666821
                     /locus_tag="KLMA_10329"
                     /codon_start=1
                     /product="RNA recognition motif domain-containing protein"
                     /protein_id="XP_022673854.1"
                     /db_xref="GeneID:34713999"
                     /translation="MTSPSRKNSDDKGRPLEEAGNLSSTEYFANTNVLTCRLKWVNPD
                     TFIMDPRKPQLLTNLNQLVHANKGVLVNPKEMENYQYFSDHKRLAHLQENWDTYLFER
                     GNAEVDSWYRDEELRETKANWFYDVVIQAQFKSYKDLQATTEGFKAELKEHGSGKKTE
                     GTESEGSGSGSASPSSSSQILACWSISENPHALNHPGNLYVRGIPKNLTKEDLVPIFA
                     KFGPIIVLKIILDPNTNESMGFGFVSYPLGSQASNCIKELNGNLMNGSPLFVNYHVER
                     KERERIHFDQWKQNEQEENSRFRGVFIGNLPIFTNENKLITPSAVVQKFRESLPDCEI
                     VSYYFPKSNSQSNVEYSESVRSQSLSPLNSKAAVCSSPPSPRPKSSDYLGQEQSIDEE
                     IESMSGEDSMSSPTSEGEDNIDMSTSPSPTKVRDSLSDALNEETCSSQNEDSPLKGYG
                     FIRFATHEMALKCIETFNEFQWYGHQLVVNKAVQKFHQHHYSYSNGSNNNLANANGGN
                     YQQHHNNNHYQNQHHHRSSSTSHTGHVGHISPHQSYYQQSHMPSMYSYRLSRRHSERS
                     ISSRQSNVLGFSPPPIAAVPLNDTQHSRVNSAHSRSMSRQNSFNNAPYGKDPHSPLSG
                     SQLSLPLPPLSQPIYTGVMPPNSPGFAGHPPPPPLQPLATQAIPVLTSSSTNSSTSPR
                     NNSIYGALNMPISYSATNPMFGTPLPIPRSDEQESNLYVKHLPLDWKDEDLVQYFEKF
                     GEIISAKIITVGGSVKEQDDQNLKNDELFGKSKGYGFVCFQNPLDASRAMYHTDGLKL
                     NSESTLFVSFAQRRSKSIDSSKNSMGNTANYNKKFLNAMYQQQQQQQQQYHPWMIPVP
                     LHYPPSH"
     gene            complement(<668435..>669892)
                     /gene="MGA1"
                     /locus_tag="KLMA_10330"
                     /db_xref="GeneID:34714000"
     mRNA            complement(<668435..>669892)
                     /gene="MGA1"
                     /locus_tag="KLMA_10330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820196.1"
                     /db_xref="GeneID:34714000"
     CDS             complement(668435..669892)
                     /gene="MGA1"
                     /locus_tag="KLMA_10330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673855.1"
                     /db_xref="GeneID:34714000"
                     /translation="MHNKTFIHQLHHILAQEELSEWIRWDEEDEYMFIIKPNAPNFSS
                     KVLKRFFKHGNVSSFVRQLHMYGFHKLLHPSPSSYSPSGNGSESNNNKNNNVPKSEVE
                     WKFTHHSQDFFKSATEVQLKRIHRKSNNIGKDGKRRNVLSPVCVSYLGPSQDPATAST
                     AAVTTAATSVPSVNTSSIPADISRKSSATMTQPMIPQSSISPVPSVTSGSPLSQLPHH
                     HHHHHHHQLPIPTQLPPSVLPATHMSHSLSSLGPTPTNGAPGGPGGSIPLPIPSSSPI
                     PRVIDAPYSSVSPYPSVSYNAGLGPSTNIHPPHAVFQYEQNMGILIRAMLQMCDALCA
                     DGSNIQEHLEKLKLFKLELMTTEANWNMLMSNGLSSAKSSVSTTSNSATNRFNSMDSL
                     ESQKNSIFSNPRFSKVQKMSLVGTTTPYAGTSGSLSHEYEKNNQNSNPTYNPASNQPQ
                     LHAQNQSLPQTQPQPQPQSQLQNRSLNNPRDNSKP"
     gene            complement(<673321..>674220)
                     /gene="SOL3"
                     /locus_tag="KLMA_10331"
                     /db_xref="GeneID:34714001"
     mRNA            complement(<673321..>674220)
                     /gene="SOL3"
                     /locus_tag="KLMA_10331"
                     /product="6-phosphogluconolactonase 3"
                     /transcript_id="XM_022820207.1"
                     /db_xref="GeneID:34714001"
     CDS             complement(673321..674220)
                     /gene="SOL3"
                     /locus_tag="KLMA_10331"
                     /codon_start=1
                     /product="6-phosphogluconolactonase 3"
                     /protein_id="XP_022673856.1"
                     /db_xref="GeneID:34714001"
                     /translation="MNKQQLLLKGIERKREKEKERQAQKPNKPLAFIMTVIHEYPETS
                     ALASAFGQFVIDEQNKALKNHDEFLVAISGGSLINVMRKALVDNETIASQIQWPKWHV
                     YFSDERLVPLDHADSNYGAFKKAVLDELTHKQIAGPTVYTINESLVQEGGSENEKIAQ
                     EYELLLPSKRPFDLILLGCGPDGHTCSLFPGPKHAYLLEETHRKVMWCHDSPKPPSDR
                     ITITLPVVLASETVAFVAEGSAKKPIMDEIFNTVNKTLPCTLVNLRRSDPSAGDTTPD
                     NAATHWFVSSDAIAGLRIETAAY"
     gene            complement(<674509..>675153)
                     /gene="CPD1"
                     /locus_tag="KLMA_10332"
                     /db_xref="GeneID:34714002"
     mRNA            complement(<674509..>675153)
                     /gene="CPD1"
                     /locus_tag="KLMA_10332"
                     /product="2',3'-cyclic-nucleotide 3'-phosphodiesterase"
                     /transcript_id="XM_022820218.1"
                     /db_xref="GeneID:34714002"
     CDS             complement(674509..675153)
                     /gene="CPD1"
                     /locus_tag="KLMA_10332"
                     /codon_start=1
                     /product="2',3'-cyclic-nucleotide 3'-phosphodiesterase"
                     /protein_id="XP_022673857.1"
                     /db_xref="GeneID:34714002"
                     /translation="MGISLWLCPYGHSSEYETFKTLIGSLQTLFPNAPLFEPHVTVCS
                     GLSCENMEEVHKVLEMAHHAINAVKSKVDEAHPLVEFDRFIIGKHYFEKCRLECKPNS
                     MLYSLAKLIRAMFVGELDIDTWLFEEFHPHMSLAYSDIYPMDQAMIRLIRQRIEDLFD
                     VGMEEASESHRRDQSTYYLQNTLKGWSFPLTFKVVKCEGPVEEWEVLSEVTVHA"
     gene            <675569..>677248
                     /gene="TDS4"
                     /locus_tag="KLMA_10333"
                     /db_xref="GeneID:34714003"
     mRNA            <675569..>677248
                     /gene="TDS4"
                     /locus_tag="KLMA_10333"
                     /product="transcription factor IIIB 70 kDa subunit"
                     /transcript_id="XM_022820229.1"
                     /db_xref="GeneID:34714003"
     CDS             675569..677248
                     /gene="TDS4"
                     /locus_tag="KLMA_10333"
                     /codon_start=1
                     /product="transcription factor IIIB 70 kDa subunit"
                     /protein_id="XP_022673858.1"
                     /db_xref="GeneID:34714003"
                     /translation="MASVATRKCKNCGSTDFGRDISNTTNELICKECGLVTEENSIVS
                     EVTFGETSNGAAVIQGSFVSANQAHPSFMSHSGQNALMSRETTLNNARRKLKAVSYAL
                     NIPEYVTDAAFQWYKLALSHNFVQGRKSQNVIAACLYIACRKERTHHMLIDFSSRLQV
                     SVYSIGATFLKLAKKLHIVNLPLADPSLFIQHFAEKLELGDRKIKVIKDAVKLAQTMS
                     RDWMYEGRRPAGIAGACLLLACRMNNLRRTHSEIVAISHVAEETLQQRLNEFKNTTSA
                     KMSVKEFRNDETELKDGERSKDAKPPSFEKNRLKEKKIKDSLDTNEMLETSEEALSKN
                     PILTQVLGAQELSSKEVLYYLKQLSERRKTEFSRIKATHGIDGKDLPSEENNEDENEK
                     KRTIDDIDGYSLEKDPYRPKNLHLLPTTASLLSKVSDHPENLEDVDDAELDSHLLDEE
                     ASKLKERIWIDINGDYLLEQESKRLKQEADLASGNTSLRKKRTKRAKKQNTDAASIVK
                     VQMDGLPLDVSLDETTAVEVAAAGSVNNILQKNSFSKKINYDAIDGLFGQK"
     gene            <677876..>680191
                     /gene="SDA1"
                     /locus_tag="KLMA_10334"
                     /db_xref="GeneID:34714004"
     mRNA            <677876..>680191
                     /gene="SDA1"
                     /locus_tag="KLMA_10334"
                     /product="protein SDA1"
                     /transcript_id="XM_022820240.1"
                     /db_xref="GeneID:34714004"
     CDS             677876..680191
                     /gene="SDA1"
                     /locus_tag="KLMA_10334"
                     /codon_start=1
                     /product="protein SDA1"
                     /protein_id="XP_022673859.1"
                     /db_xref="GeneID:34714004"
                     /translation="MAKRSRAALLPSNIILLQNLVKRDPESYREEFLQQYAHYQSLRD
                     IFMLNSVNNESSDESAMDEFMGAIGFVAQVCSCYPRETANFPNELKQLVLDHHKALPF
                     EVKEKIITSLTMLRNKNVISPETLIQTMFPLLIAYSSPSNSMVQNSHAKELRSLIYNT
                     LVQLMKSCNTNGKNQKLNKSTHALCFNLLEQPDSQGIWASKLTRELWRRGIWDDSRSV
                     EIMTQAALHNDVKIAYSGVLFFLDADKEREEAFEENDDEDQVDMTALKHKFSINKKSS
                     KRGKKLEQALKVVKKKSNKGVPQNNFLNFSAIHLLRDPQGFAEKLFERHLSGKNSNRF
                     DFEQKTAIMLLLSRLTGTHKLMVLGLYSYFLKYLTPKQKDVTKILSAAAQSCHDLVPP
                     ETIEVMVRKIANEFVSDGVSNEVATVGLNTIREILSRAPLAIDETLLQDLTEYKGSKA
                     KSVAMAAKGLISLYREVAPEMLKRKDRGKVASMSIQEDKRSGRESKRVKFGVESTVDG
                     IEGIELLAKWKREHADEDEEDDEAAWEVERNGDLSDASDVDGEWVTIESDKEYEVDLE
                     DSDAEEEESSGKGKKRSIDDVEEQEEEEEEDSDLELSGDEAESKENAEAGTDADADAD
                     AEAESAAPVSAEEAFRELASSRILTPADFVKLQQLRTEAGVSKLMGVKNEETVEHYAL
                     MGPAKHKKQTKEERLASVKEGREDREKYGSKRGKRDSTMRSTTNKEKSRKKNFVMMIH
                     KRSVKGKQKMSLRDRQKVLRAHITKQKKKGL"
     gene            <681588..>682862
                     /gene="LSC2"
                     /locus_tag="KLMA_10336"
                     /db_xref="GeneID:34714005"
     mRNA            <681588..>682862
                     /gene="LSC2"
                     /locus_tag="KLMA_10336"
                     /product="succinyl-CoA ligase [ADP-forming] subunit beta"
                     /transcript_id="XM_022820252.1"
                     /db_xref="GeneID:34714005"
     CDS             681588..682862
                     /gene="LSC2"
                     /locus_tag="KLMA_10336"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="succinyl-CoA ligase [ADP-forming] subunit beta"
                     /protein_id="XP_022673860.1"
                     /db_xref="GeneID:34714005"
                     /translation="MLAQSYKLRSCLQRSSAIVRQQVRNLSIHEYRSAELLRQYGVGT
                     PSGAAAHTVEEATKIAEQLGGKNLVVKAQALTGGRGKGHFDNGMQSGIHMIDSVQEAA
                     DVSSKMLGYNLITKQSGAKGKLVSGVYIVEKVDAKHESYLSILMDRKTKKPLIICSSE
                     GGMNIEDVAKTNPDAIKKFYVQDSVGLTEETAAEIAASLGFSKEAEADAKDAVLKLYK
                     IFKEKDATQIEINPLSEVVGQDKKVMCMDAKFGFDDNASFRQQEVYSWRDLTQEDPDE
                     VIAKKSDLNFVKLKGNIGCLVNGAGLAMATMDVIKLYGGDPANFLDCGGGATPETIET
                     AFKLILSNENVDAIFVNIFGGIVRCDFVAQGLVAATKNLSVKVPIVARLQGTNLTEGR
                     RIIAESGLKIYSFDELDPAAQKVVELTNAAAQ"
     gene            complement(<683266..>683682)
                     /gene="FMP43"
                     /locus_tag="KLMA_10338"
                     /db_xref="GeneID:34714006"
     mRNA            complement(<683266..>683682)
                     /gene="FMP43"
                     /locus_tag="KLMA_10338"
                     /product="UPF0041 protein FMP43"
                     /transcript_id="XM_022820263.1"
                     /db_xref="GeneID:34714006"
     CDS             complement(683266..683682)
                     /gene="FMP43"
                     /locus_tag="KLMA_10338"
                     /codon_start=1
                     /product="UPF0041 protein FMP43"
                     /protein_id="XP_022673861.1"
                     /db_xref="GeneID:34714006"
                     /translation="MSSAAGNAFKRFWNSETGPKTVHFWAPTLKWSLVFAGLSDMKRP
                     VEKLSGTQNLSLLATGVIWTRWSFVIKPKNYLLASVNFFLGGTAGYQLGRIINYRVKE
                     GDSPREVVDYIINGPKKGIAEQATEKLAEVAPAAVE"
     gene            <685326..>687059
                     /gene="YAP1801"
                     /locus_tag="KLMA_10339"
                     /db_xref="GeneID:34714007"
     mRNA            <685326..>687059
                     /gene="YAP1801"
                     /locus_tag="KLMA_10339"
                     /product="clathrin coat assembly protein AP180A"
                     /transcript_id="XM_022820274.1"
                     /db_xref="GeneID:34714007"
     CDS             685326..687059
                     /gene="YAP1801"
                     /locus_tag="KLMA_10339"
                     /codon_start=1
                     /product="clathrin coat assembly protein AP180A"
                     /protein_id="XP_022673862.1"
                     /db_xref="GeneID:34714007"
                     /translation="MTTYYKVVKGATKVKMAPPKNKYTDPILLGTANEHDFSEIVNAL
                     YERINDSAWTVVFKSLAVAHLMIRDGDKDVALQYFSKHLDFFELRGLARSFPAKSGDV
                     QALERYRQYLRVRSEEFGKIKKDYVRASNSNLKKFDGNHSSKTLEHVESLELQIGALI
                     KNRYSQYDLNNDLIMYSFKMLVQDLLALYNALNEGIITLLESFFELTRANAERTLKLY
                     KRFVQLTENVVRYLKSAKAVGLKIPVIKHITTKLISLLEDHLREDSENKGNTFSKDDQ
                     TQVQSELERIRQQRITLENQLKHQSVQQIQPTGYNPFVTSPMSLASPQFDTQPAQVAN
                     TSNPFQQYQQQPQIPQQTGFNPFMQDMQQQQQQQQQQQQQQQLEQQRLQQQQLEQQML
                     QQQQLEQQRLQQQQLEQQQQQQQLEQQRLQQQQLQQQQQLQQQQQQQQQQQQYQLSPQ
                     LQNNMTAQLQPANTGHMMQLNASTTAPMPIVASQTGPNNPFSFENVQRQQLQRQQTNP
                     FSVQNYSQISNNPFSTSTTPQIQQNTRPNTFGGLELMPTVPVFPQTQLQQGFQNAANQ
                     RSQNEPNLIDI"
     gene            <688044..>690980
                     /gene="PFK1"
                     /locus_tag="KLMA_10341"
                     /db_xref="GeneID:34714008"
     mRNA            <688044..>690980
                     /gene="PFK1"
                     /locus_tag="KLMA_10341"
                     /product="6-phosphofructokinase subunit alpha"
                     /transcript_id="XM_022820285.1"
                     /db_xref="GeneID:34714008"
     CDS             688044..690980
                     /gene="PFK1"
                     /locus_tag="KLMA_10341"
                     /codon_start=1
                     /product="6-phosphofructokinase subunit alpha"
                     /protein_id="XP_022673863.1"
                     /db_xref="GeneID:34714008"
                     /translation="MSVSNTIYGVAFRSLSTSDEQLYRKTARFYHSLGFQTVKLYDNF
                     KNHDDSHLIVGTSKNSVKECWLESFKLSQVDAEGFRVPQQEASNQDQSDGVMIKLRMV
                     ESEPAVQKADVIVYYTVSLEEVAKFGESLDAHTVKLVDPLGNTILVTDEVSGKKLNAA
                     EFIEPKDTSDEHKITIDLGDKDQKKKKIAVMTSGGDSQGMNAAVRAVVRTGIYYGCDV
                     YAVYEGYEGLVKGGDLLKKMEWQDVRGWLSEGGTLIGTARSKEFRERWGRKQAAANLI
                     EQGIDALVVVGGDGSLTGADLFRSEWPSLVDELVKEGKFTKEQVAPYHNLTIVGMVGS
                     IDNDMSGTDSTIGAYSALERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLGLMSGIA
                     TAADYIFIPERAAPHGKWQDELKRVCQRHREKGRRNNTVIVAEGAVDDQLNPITAEQI
                     KDVLVELGLDTKITTLGHVQRGGTAVAHDRWLATMQGADAVKAILEMTPETPSPLIGI
                     LENKVIRMPLVESVKLTKEVATAIEAKDFDKAISLRDTEFIELYDNFISTTVNDDGSQ
                     LLPEGERLNIAIVHVGAPSAALNAATRAATLYCLAHGHKPYAIMNGFSGLIQTGQVKE
                     LSWIDVEDWHNLGGSEIGTNRSVAAEDMGTIAYYFQKHKFDGIIIMGGFEGFKSLKQL
                     RDGREEYPIFNIPMCLIPATVSNNVPGTEYSLGADTCLNALVKYTDAIKQSAAASRRR
                     VFVVEVQGGHSGYVASFTGLVTGAVSVYTPEKKIDLQSIKEDLALLKESFRNDQGETR
                     NGKILIRNEMASTVYTTELLADLITEQSNNRFAVKTAIPGHVQQGGFPSSKDRVVASR
                     FAVKCVKFIEQWNKKNTEAENMDYKILRFNYVNGVKEFTVPNEDASAAVICVNGSKIS
                     FKPIAEIWEKETDVKLRKGHDIHWEEYNEIGDILSGRSMLRRKLQEESEQGSSTGNST
                     PLPASA"
     gene            complement(<692501..>693721)
                     /gene="LCB3"
                     /locus_tag="KLMA_10342"
                     /db_xref="GeneID:34714009"
     mRNA            complement(<692501..>693721)
                     /gene="LCB3"
                     /locus_tag="KLMA_10342"
                     /product="dihydrosphingosine 1-phosphate phosphatase LCB3"
                     /transcript_id="XM_022820296.1"
                     /db_xref="GeneID:34714009"
     CDS             complement(692501..693721)
                     /gene="LCB3"
                     /locus_tag="KLMA_10342"
                     /codon_start=1
                     /product="dihydrosphingosine 1-phosphate phosphatase LCB3"
                     /protein_id="XP_022673864.1"
                     /db_xref="GeneID:34714009"
                     /translation="MTEARQTRQRIFSFSHLNVFDGKHPCSDPGNHDPDHFKPHMSKF
                     RFACRQKLLEVIEMTHAEGIILWIQEHLRNKPTDVFFASTAIMGSHTFYVVMLPIPRW
                     TGFSAATRDLVYILGYSIYLSGHLKDYWCLPRPKSPPVHRITLSDYTTKEYGAPSSHT
                     ANATGVSMLILWYISQIKLDDESNRGIFYLLAAVYFFILTFGRLYCGMHGILDLSSGI
                     VIGIVCCALRVYTHEYLHYDEFTIGSGLWYPLFSIVHGAILLKLHARPIDACPCIEDS
                     VAFIGVIMGLECSDWLYPRIFNTPSYEMPFNFARIGITGTIARIVIGVIAVLIWKELG
                     KKVIYWILTKLIGDDRPFTKEELQRQKEMDAVQEFTPLARIDVIGRSIIYAGIPATVV
                     LVCPVLYKYFGILD"
     gene            complement(<694149..>706325)
                     /gene="DYN1"
                     /locus_tag="KLMA_10343"
                     /db_xref="GeneID:34714010"
     mRNA            complement(<694149..>706325)
                     /gene="DYN1"
                     /locus_tag="KLMA_10343"
                     /product="dynein heavy chain"
                     /transcript_id="XM_022820307.1"
                     /db_xref="GeneID:34714010"
     CDS             complement(694149..706325)
                     /gene="DYN1"
                     /locus_tag="KLMA_10343"
                     /note="cytoplasmic"
                     /codon_start=1
                     /product="dynein heavy chain"
                     /protein_id="XP_022673865.1"
                     /db_xref="GeneID:34714010"
                     /translation="MIKEHDKVTETVLNFLHGVSVLFMKNSEEPSEFKDKYQEMLYEW
                     LHEGNMSESLFLVQDLENSSVSVVLTLDSSKLGKYNALMILKNQSVIEPEMPIESQLS
                     MIMLQQDSQFDTLKTLVDVGVNQIFNRILNSKENTSKIVPDSLLNTKRKIRDLSISLQ
                     NLDKGIQIPDIESSIHPIVKEIVNKGANAHNIGDFLSTEQLNDSSFLNELQKTSNQWI
                     KSVHSLLRLENNLYDGSALDEVDFWRSYYGALSEFEERLNSTEVDVTMSILASAKRYY
                     RSSSLSKDTGLNKIISESQDYYLFLNALGIPVISSASTLVDLSAAIDTFTDEFKRLRI
                     IQYPLEKAVKLVEKVSDDISAKIRELLPNLLLTSYEVFLSIVDEAVNILNKWDEKLKS
                     LTLLIRELMRKRSEKFIFLRFKCSTDSLKASILKISSFRSEHHKLLETIDAINRHVLL
                     ERLTVIYDSVKSVNPLTTDTSSWRQIEQSYYNKITILEDELINILHKELENCKTSKEM
                     FQIFEKYKPLMERDRVLNAVREYQHQLLFNVKSDILLLKDTVIKQKPNKVSNIGFDVQ
                     PIIQEIVWQKKILKKVHIFTSKLTAILGPEWDQTTVGSEISKECISIETTLDTNKKFE
                     TWINEAEKRSFILEQSIFKIVRSEFGYELKVNFDFSAGSLFKTVRNLLWQGYVVPSDL
                     IRTSRITRNMYPHAIISNEKVRTFLWILHEMTSLLFTKPLLHKCTNNIWQLLSNLINE
                     PWENILSGEASGEGERDNILIEFESAVDYLLEQFEYLRTVETEIKSYFKSLRQVPLTA
                     LDSNITDPLQKIADQVLSKNYGFYSQFFCSLNDGLKDLLIEKYTDLVHKSAVETMHQS
                     IVFSNTSFQLSPSFFSLKSHMVRRISSIANLLLKQHKIVDTRYANAETTSTFNDLLCD
                     LQPAIENFLLSIEDLRLSSAQCLNKWKSHEYLWSLTEEQFIVHFGQDIDACIHFMSSL
                     IKQRVETSSLSCTLDIGNQLFINQEKALLTCISKFDQWQQFGLKHLLSLYINLSVDIH
                     HSLSMAKKTVEESTLHFSSLKTVTDVIIYLDTLESELERTELQFLSLKDAQKLLIQTR
                     TKLPSDFIYCEQLKVDIDSLTDICAKKQSQIGQNRHLIANKVETETERLKIVSESLVS
                     DWEDKKPTSSSTSPSEALEMILSFEESINEITKQTQNLLKITKLLLIPVSLNIHLDDV
                     LTEVINYKSMWSSVDKLWNSLQTIVQEKWHSITLSKVKSELNELSNSSNSLPPVVLQY
                     SVFQNLLQSIQSILSTIPILMEMKAADLQTKHWRHIFDTFDRPDISTDTIQSVSFTLM
                     DVLSLNLSTNENDIHKIINQAKDEKVLASTLEEIKDRWKDVSIQIFLHESGQKLIRNW
                     SALFSSTTDDINTLLSMKNSQYYKIFEQEIYELETKLTEFSSILTCGLEIQRQWCYLY
                     GVLNSKSPLKNLLPTEASRFSNLTSDLNILFTTLIQSNSALDVISNPDYYHALKALAD
                     SLTKVRKSLHDFLESQRALFPRFYFIGNEDLLQLIGSTTDLAFLSNQMSKMFGAVGRV
                     EVLNNSIVSVCSIEGESLNLDNTIPIDPTIPTYQWMRNLDKEIKLTLARLVKSCLDTF
                     SLRAIPEIFKDYPFQIIWLCMLIEWTKSAQSATSIELQKLEEELSVTINEVSKQKKSQ
                     NARYQYIAVDSLISEMLNLRNITQDLRTTEDRDSSWNEVQKFYFNDNNNVLDRVTVVQ
                     GGITAQYGFEYIGVPETLVHTPTLQTFFATIQHALANNLGGSPFGPAGTGKTESVKYL
                     GKRLGRFVLVFNCDDTFDFRSMSRILFGIAQIGAWGCFDEFNRLTPEILSAVSSQIEE
                     IQSSMLSQSNSISILDRTGDLHPNTGIFITMNLGYSGRSQLPGNLKRMFRDFAMDSPQ
                     SLLILETLLNIMGFPDSKEIAKQLVAFFEELGAKTSNQPHYDFGLRALKAVIRNCNVS
                     LMKNSSDPTLDILLESVRNIITPKLLESDELIFEEIWSEHFPTFTASTAIPAFENIIK
                     QFCKEEMYVFNEEFYKKCEQLYEIQKSQQGIILVGEAGCGKTSVLKGTLEGVEELSAV
                     PNIIHTIDSKALSKEELYGHLDPVTFEWQDGVFTSILRDINEDYLGEYKSCNIWIIFD
                     SELDPIYAETLNSVLDDNKVFTLPNGERLKILENIHIIFEVENLAHATLATVSRCGML
                     WINSNMIQPEHVFSSCYKKHITSMSTSHKQIDQMKTNLLRVSSLILSDINLHNTIEES
                     QRISHIMGFDIRRISTTYSKLLCENIASQTSNIMNMAASQIDILFMRYIALALLWAFA
                     GDCTIADKIKFSSFIAKMLEPYGLSPLESPLLNYEISPKTGEFVLLDDVIEEVELESH
                     QVLSPELIIPTMDTYRHEQILFSLLRNHQPLILCGPPGSGKTMTLHSALKRSEDHDII
                     GMNFSKDTTVQSFLNTIEQHTAYKNSSEGLILQPLSFGKQLVVFCDEINLPQQDAYGS
                     QPIILFLRQLVEKNGFWSLKEKKWVSLKRIQIVAACNPATDAGRSKLTNRFTRHTSVL
                     MVDYPAKESLVQIYLTFFKAVLKLSPSNRNYANNFANASVDLYYRCKEQFVASEQVHY
                     IFSPRELTRWVRGVHQALQTTIKNDLDYILKIWAYEARRIFSDRLISDEEKDWFEYTL
                     LEIASSQFPLKNISDLVDRSITFCSWINMDYEETDISKIRAFVSERLKTFCEEVLNYD
                     VVLHDQMIRTMLNVDKVMKQVQGHAMIVAPTGSGKSTITKFVAWMNGIEVNTLNIHRN
                     FSLSEFDEFLRKLLIKCGVENRKCCLILDESSMIETSFVERLNTLLANSDIPGLFQAE
                     EFDALMSKIRTSPHLPGNVLDNEQSLYEWFTEEISKNLHVVMNISDPQSSSSTRIMTS
                     PALFNRCILTWMGEWSEETLSIVAGHFTEKLPFDQITPSDGSAGAQKDMWSIVAQIFC
                     ETFKEYHHQNGIKSPSPSLFLNSLRNLRSQYIKKLKTSDENQRFIRNGLTKLKETLLT
                     VKQLNKEMEEKKDILHKKEMEARKTLDQMLHDQNEAERKQEASIQIQKILNAQELEIS
                     KRRDIVMRDLETARPAILEAQSGVKNIKKQQLVELRTMHNPPEAVKTTLEAVCVLLGF
                     RIESWKDIQQTIRKDDFIARIVTFNTETMLPEELKDFIKNEYLSRVNFKYENVQRASQ
                     ACGPLYLWVVAQIQYSDVLLKVEPLQADLEVLETEIMRSRAKSLAADEMISELQNHIE
                     KSKESYSQIIRDIEVLKSEMNIVEAKVSKSVTLLDSLGSEKERWTLEIKQFAEVKKNL
                     LGDSILESLYTAYCYSHDYKMRMNLIDKWKSKLSSQDISFDHSFKNLVRNANPEAKAK
                     WIDSGLSDDDFAVETFFGVIDSESGKYPLIVDPEGNILDVLYGVYEDRLVATSFLDEN
                     FSKILKNTLRFGGVLLIQDGEFYDPFISRVLSQEFQEVGGRKTITLDDSNREVDVSKD
                     FRMIMYTRDKDWIIPDYIKTKCQLFNFTITKGNLESQTLQYILANELPELQHQRNMLL
                     EKSVSYKLKLHELEKKLLELLNTSNINILENDDLLQTLENLKRESQTTQSELSSINIE
                     MHQQKTALTEFTPLSVIAVKIFELMEWLRSKKHWFYDVDVKEFLVSFQHVFEEADQLT
                     GEMISRPAKICVSMLRLMFCAFGSMLSEDDRLLFATRLFELYMISEESINTVETWKRI
                     RSNIDYMTSAPELPDLFDNFKQGLIGGDPKDGLTQMILSFMKDSPWSLNDFFSKSSGS
                     KIVLVGAGKGVDGSLMIKKIAEQSNKDLTIIAMGSTESCIMAEETLGSCMDNGGWILL
                     QNIQMSFVWCNEVLPKYLKKISSNSHPDFQLFLTCSLQDSIHPTSQLLQYCTKITYEG
                     ESGVLHNIKKFWSSVTQNLPETGNVVYLKHLICWIHALILERVRVTSQNAEYHDLDLQ
                     LAINSVDSCVKKEIIDWHKLRFIVGKVIYSNRLDNNDELYAWIQHLTFSILHENSFKP
                     DSSIIADIGSPNPKHSTESITSWLHSLPWTLEQKDKWLSIPKQNLESKAFTDTVTCMQ
                     DLTAIDKLLQYN"
     gene            <706557..>707213
                     /gene="RHO4"
                     /locus_tag="KLMA_10344"
                     /db_xref="GeneID:34714011"
     mRNA            <706557..>707213
                     /gene="RHO4"
                     /locus_tag="KLMA_10344"
                     /product="GTP-binding protein RHO4"
                     /transcript_id="XM_022820318.1"
                     /db_xref="GeneID:34714011"
     CDS             706557..707213
                     /gene="RHO4"
                     /locus_tag="KLMA_10344"
                     /codon_start=1
                     /product="GTP-binding protein RHO4"
                     /protein_id="XP_022673866.1"
                     /db_xref="GeneID:34714011"
                     /translation="MVLEVDKFKRTFGDIPHYKKGDINGKAAQYHLKIVVVGDGAVGK
                     TSLLISYTQGKFPEDYIPTVFENYVTNLQGPNGKIVELALWDTAGQEEYSRLRPLSYT
                     DVDILMVCYAVNSKVSFYNVEEMWVPEVRHFCPGVPIMIVGLKSDLYAEDDISTFVDT
                     LEAEEMTKRIGAFLHLQCSSKSQQKVREVFDTAITAALYDELKPKEKIKRSRRKCVVL
                     "
     gene            <707535..>709271
                     /gene="TRM2"
                     /locus_tag="KLMA_10345"
                     /db_xref="GeneID:34714012"
     mRNA            <707535..>709271
                     /gene="TRM2"
                     /locus_tag="KLMA_10345"
                     /product="tRNA (uracil-5-)-methyltransferase"
                     /transcript_id="XM_022820329.1"
                     /db_xref="GeneID:34714012"
     CDS             707535..709271
                     /gene="TRM2"
                     /locus_tag="KLMA_10345"
                     /codon_start=1
                     /product="tRNA (uracil-5-)-methyltransferase"
                     /protein_id="XP_022673867.1"
                     /db_xref="GeneID:34714012"
                     /translation="MLSARVLFLRIPLRASSTIRRLHHNIMSAEIELKRVASQEIKPV
                     KVKQSKKGKIRKYKSKPLDPTSSLGVLQFEIDEILKEQNLTRENILTDVGGILNEARD
                     GPMHKLYHREVDNVEILRMSASGDGLALIPNPAEHDKKQIALIPFGVPGDIVKIKTFK
                     THPYYVECDLLQVYKPGDMRKDELIQCKYFGKCSGCQLQYLTYDDQLAFKKRTVVNAY
                     KFFAPRLMQENVVPEVGDTVQSPLEVGYRTKLTPHFDLPKWQKENGERPALGFGHKGR
                     PQWRGTAAGGSNSILDIEECIIGTKIINRGMANERARFEKEFSKYTKGATILLREHTK
                     VIDPETPVVEQLDEGSRDAEGNVSYLEIKDTENNKSLVKTCVTNTRQIVTEYINGYTF
                     QFSAGEFFQNNNSILTKVTDYVRKNLQIEGSKPEDPHYLVDAYCGSGLFSITSSKGVD
                     KVIGVEVSADSVAFAERNAKANGVENCKFIVGKAEKIFGSIDTPCDRTSVILDPPRKG
                     CDDIFLKQLAEYNPARIVYISCNVHSQARDVEYFLKETENGKHYKIESLRGFDFFPQT
                     HHVESVCVLTRS"
     gene            complement(<709414..>709920)
                     /locus_tag="KLMA_10346"
                     /db_xref="GeneID:34714013"
     mRNA            complement(<709414..>709920)
                     /locus_tag="KLMA_10346"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820340.1"
                     /db_xref="GeneID:34714013"
     CDS             complement(709414..709920)
                     /locus_tag="KLMA_10346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673868.1"
                     /db_xref="GeneID:34714013"
                     /translation="MNCWSVEEDLCFAGTTGLHLQQDELNYTYIQPSSVRDVRFRMSL
                     KKHISFIEWLRLRLDCPFGIRIHLKKTTVLQCRKINKWLKTQTRRMLRKQGREGASAG
                     EFDRIFTPEKTIQDDYLKHAPFSYMDVSTGSVNSGKTSNTVIYSPRYSPLFIPLAEQS
                     LRGRPRSA"
     gene            <712455..>713816
                     /gene="GLG1"
                     /locus_tag="KLMA_10347"
                     /db_xref="GeneID:34714014"
     mRNA            <712455..>713816
                     /gene="GLG1"
                     /locus_tag="KLMA_10347"
                     /product="glycogenin GT 8 family protein"
                     /transcript_id="XM_022820351.1"
                     /db_xref="GeneID:34714014"
     CDS             712455..713816
                     /gene="GLG1"
                     /locus_tag="KLMA_10347"
                     /codon_start=1
                     /product="glycogenin GT 8 family protein"
                     /protein_id="XP_022673869.1"
                     /db_xref="GeneID:34714014"
                     /translation="MLGVVTLLYSLDYLPGTLTLAYQLRKFMTEGSKDKELCLVLSSE
                     LLDEGQLSESAVKVLGELFDTIIEVEPVDLTDPIVKQNQANLMMLNNRSELAFTFMKL
                     HMWELTQYEKILYLDSDVLPLDSDIFRIFDHVTNQTSDQIAAVPDCGWPDLFNSGVMV
                     VKPDKGKYEELHDLAKRELSIDGADQGILNQFFNPMCHDGDKLTEWIRLPFFYNVTSP
                     GAGYQYTPALKFFANKLKLVHFIGKNKPWNYSQHGGRYNDKYRNQWWALYMELCQRYF
                     QSDLDIDIDNLCRHTANLGVSGAASQADYPEDTKPAWDPATEAPPKDLPAEAPNLKIV
                     NSYSWEEELVVVPDEEAEGPALAPDDIEDSLPRSQREPLVEPMVNVGSDGDMETETET
                     ELELGSRTESSSSNRASEPKPSAAPPRPDQYVPPRYEKPKPIFPWESDTEYKATRVFP
                     GDE"
     gene            <714671..>715861
                     /gene="TIF1"
                     /locus_tag="KLMA_10348"
                     /db_xref="GeneID:34714015"
     mRNA            <714671..>715861
                     /gene="TIF1"
                     /locus_tag="KLMA_10348"
                     /product="ATP-dependent RNA helicase eIF4A"
                     /transcript_id="XM_022820363.1"
                     /db_xref="GeneID:34714015"
     CDS             714671..715861
                     /gene="TIF1"
                     /locus_tag="KLMA_10348"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase eIF4A"
                     /protein_id="XP_022673870.1"
                     /db_xref="GeneID:34714015"
                     /translation="MSDGITDIDEGQIQSTYDKVVYSFDDLKLKEELLRGIFGYGFVE
                     PSAIQQRAILPIIEEKDVLAQAQSGTGKTGTFAIAALQNIDEKVKAPQALILAPTREL
                     ALQIQKVVMALAIHMDVKVHACIGGTSLQEDSEALRGGAQIVVGTPGRVYDMIDRRIF
                     KTDNIKMFILDEADEMLSTGFKEQIYNIFTMLPPTSQVVLLSATMPGDVLEVTTKFMK
                     DPVRILVKKDELTLEGIGQYYVNVEEEQYKYDCLTDLYDSISVTQAVIFCNTRRKVEE
                     LTERLRENNFTVSAIYSDLQQQQRDTIMKEFRSGSSRILIATDLLARGIDIQQVSLVI
                     NYDLPSNKENYIHRIGRGGRFGRKGIAINFVTNKDIGAMRELERFYSTQIEELPSSIN
                     ELFD"
     gene            <716215..>717027
                     /gene="UTP30"
                     /locus_tag="KLMA_10349"
                     /db_xref="GeneID:34714016"
     mRNA            <716215..>717027
                     /gene="UTP30"
                     /locus_tag="KLMA_10349"
                     /product="ribosome biogenesis protein UTP30"
                     /transcript_id="XM_022820374.1"
                     /db_xref="GeneID:34714016"
     CDS             716215..717027
                     /gene="UTP30"
                     /locus_tag="KLMA_10349"
                     /codon_start=1
                     /product="ribosome biogenesis protein UTP30"
                     /protein_id="XP_022673871.1"
                     /db_xref="GeneID:34714016"
                     /translation="MVLQLDSDGQATKALVALKKQCKSDPKLANDSSIHMIINTVRPV
                     GITNDHVPRIIPLHYSTMGSVRDTRILLICKDPSTLYRDALLKEKSTAELFKEIISVK
                     KLKQRFRGKKLKELYNEFDLVVADYRVHHLLPNILGATFYHSNRKLPFVVRMSKQVKE
                     KGQKMKEECDPKYIKAQVKSICKNAWFLPNKDNCLNIKIGEIDKHTEEEMIANAEDVI
                     NFLCDKTKKPQGGVIKDGKIASVFVKTSNSVSLPIWKQPEQEESDDEEELKL"
     gene            <717306..>718574
                     /gene="YUR1"
                     /locus_tag="KLMA_10350"
                     /db_xref="GeneID:34714017"
     mRNA            <717306..>718574
                     /gene="YUR1"
                     /locus_tag="KLMA_10350"
                     /product="probable mannosyltransferase YUR1"
                     /transcript_id="XM_022820385.1"
                     /db_xref="GeneID:34714017"
     CDS             717306..718574
                     /gene="YUR1"
                     /locus_tag="KLMA_10350"
                     /codon_start=1
                     /product="probable mannosyltransferase YUR1"
                     /protein_id="XP_022673872.1"
                     /db_xref="GeneID:34714017"
                     /translation="MLSVRRCAVAVSAVFSLLALLYLSQIGFSVIKETYAQSRWQKEL
                     YARSQKVLHDYDGVRRFNQSFGELKPASNSYLNDLAIPEDRDSIIYERENATILMLCR
                     NWEIEGVLQSMRSLEDRFNRRYKYDWTFLNDVPFDDYFIEATTAMASGKTQYGLIPPE
                     DWNRPEWIDEELFEERLQMLKDRKVIYGDSKSYRNMCRFNSGFFFRQKLLDQYDYYFR
                     VEPDVEYFCDFPYDPFKVMREKKKKYGFVISIFEYEDTVTTLWDTVEEFMELHPETLH
                     PNNSLDFLTDSSMVGEFLPVVASSSDYNLCHFWSNFEIGDLNFFRSEEYLKYFNYLDS
                     KGGFYYERWGDAPVHSIGAALLLDKNEIHHFDEIGYSHVPFNACPTSVSSRLVYRCQC
                     DPNDESNVSVHPNSCLMRWWKNGSGKTFIR"
     gene            complement(<718673..>719275)
                     /gene="RPB4"
                     /locus_tag="KLMA_10351"
                     /db_xref="GeneID:34714018"
     mRNA            complement(<718673..>719275)
                     /gene="RPB4"
                     /locus_tag="KLMA_10351"
                     /product="DNA-directed RNA polymerase II subunit RPB4"
                     /transcript_id="XM_022820396.1"
                     /db_xref="GeneID:34714018"
     CDS             complement(718673..719275)
                     /gene="RPB4"
                     /locus_tag="KLMA_10351"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB4"
                     /protein_id="XP_022673873.1"
                     /db_xref="GeneID:34714018"
                     /translation="MNTSTSTVQTKRRGLKKFVEEENAATLQLGEEFQLKQVNHQGQE
                     ENLVALNLSEARLIIKETLQARKKLFKSWSKNGISEQDVDMDDEDNVDVHTQTQEKEL
                     QDIDKLLEQTTGGHNQALKQTMIYLTNFSRFRDQETVTAVSQLLSSTGLHPFEVAQLG
                     SLSCEDADEAKTLIPSLGTKISDEDLERILKELSNLETLY"
     gene            <719729..>721894
                     /gene="YAK1"
                     /locus_tag="KLMA_10352"
                     /db_xref="GeneID:34714019"
     mRNA            <719729..>721894
                     /gene="YAK1"
                     /locus_tag="KLMA_10352"
                     /product="dual specificity protein kinase YAK1"
                     /transcript_id="XM_022820407.1"
                     /db_xref="GeneID:34714019"
     CDS             719729..721894
                     /gene="YAK1"
                     /locus_tag="KLMA_10352"
                     /codon_start=1
                     /product="dual specificity protein kinase YAK1"
                     /protein_id="XP_022673874.1"
                     /db_xref="GeneID:34714019"
                     /translation="MGDKNSLWNPAFMASEQGKSDQGQGQNQGQNQGRGQGQGQNQEQ
                     GSSQGNNRSGSIGMYGGSLTPQQQQQQQQQQQHQQQQQQAHQSPRQSIFRNPWQDMSG
                     MSESQVSQARKQSSFPLPTTYEEENSVDESSQQFRRRNSSLVIPPARAAGPDPFLYEK
                     QPAISYNEYQRRQSVAVTGGVVTSQSSPQQVTKPSQFRKPGASSAGVAVGVSGSSVYP
                     ATAGAFLMTHGSGGGTGSLPSSRPPSPIIIVPKFSRVQSRQDLNPIINSIPKYRRASL
                     SSKTISPLMALTKSLTTTYSLCNSDFAYQTSKNPKRVLTKPNEGKYNNGHDNVNSDYI
                     LYVNDVLGVEHNRKYLVLDLLGQGTFGQVVKCQNLITKEILAVKVVKSKSEYLNQSVT
                     EAKVLELLNRQIDPHNEHHFLRLHDTFVHKNHLCLVFELLSNNLYELLKLNEFHGLSM
                     TLIKTFAKQLLDSLCVLKDNKLIHCDLKPENILLVSNDRPDLKVIDFGSACEETRTIY
                     TYIQSRFYRAPEVLMGIPYSTGIDMWSFGCIIAELFLGIPIFPGNSEFDQVTRIVESL
                     GMPPAWMCDMGKNSKKYFHKMNTTVLKKFRMKTIDEYNLEFAANEEPGKRYVKHILFD
                     DIIRNARISKRISGNPAMVEREMKNRECLLHFLKGVLNLNPLERWTPQQAILHPFITE
                     EPFTGEWYPPGVVPKKSQGARHPSLQFDSVPLDKLQLGD"
     gene            complement(<722226..>722690)
                     /gene="TIM17"
                     /locus_tag="KLMA_10353"
                     /db_xref="GeneID:34714020"
     mRNA            complement(<722226..>722690)
                     /gene="TIM17"
                     /locus_tag="KLMA_10353"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM17"
                     /transcript_id="XM_022820418.1"
                     /db_xref="GeneID:34714020"
     CDS             complement(722226..722690)
                     /gene="TIM17"
                     /locus_tag="KLMA_10353"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM17"
                     /protein_id="XP_022673875.1"
                     /db_xref="GeneID:34714020"
                     /translation="MSADHSRDPCPIVILNDFGGAFAMGVIGGCVWHGIKGFRNSPLG
                     ERRVGAVSAIKARAPVVGGNFGVWGGLFSTFDCAVKAVRKREDPWNAIIAGFFTGGAL
                     AIRGGWKHTRNSAITCACLLGVIEGVGLMFQRYAAWQAKPMAPPLPEQPMQA"
     gene            complement(<723220..>723594)
                     /locus_tag="KLMA_10355"
                     /db_xref="GeneID:34714021"
     mRNA            complement(<723220..>723594)
                     /locus_tag="KLMA_10355"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820429.1"
                     /db_xref="GeneID:34714021"
     CDS             complement(723220..723594)
                     /locus_tag="KLMA_10355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673876.1"
                     /db_xref="GeneID:34714021"
                     /translation="MSKGLCNRIYTLQTLHLSIPNRRHKYNQYTHFPIIIMPNTKTYR
                     THRTHRTHSRSLPRRSIPHRLAPPSQQAKDDKNNNIPMATFQNENGNMNPFEPVPITF
                     YYVVFPHNESRDAGTNTNNNAH"
     gene            <724470..>725624
                     /gene="BIO2"
                     /locus_tag="KLMA_10356"
                     /db_xref="GeneID:34714022"
     mRNA            <724470..>725624
                     /gene="BIO2"
                     /locus_tag="KLMA_10356"
                     /product="biotin synthase"
                     /transcript_id="XM_022820440.1"
                     /db_xref="GeneID:34714022"
     CDS             724470..725624
                     /gene="BIO2"
                     /locus_tag="KLMA_10356"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="biotin synthase"
                     /protein_id="XP_022673877.1"
                     /db_xref="GeneID:34714022"
                     /translation="MYSVSARYFSSSVARYGAGAATAAAKVAAAPAASVDALKYAMSL
                     EQPQHEWSKEQLAEIYHTPLLELVHQAQLQHRKWHDPSKVQLCTLMNIKAGGCSEDCK
                     YCAQSSRYDTGVEAERMVSVEQVLQEAELAKKNGSTRFCLGAAWREMKGRKSAMKRIA
                     EMVTKVNEMGMETCVTLGMVDETQAKQLKDAGLTAYNHNIDTSREHYPKVISTRSYDD
                     RLQTIKNVQNAGIKACTGGILGLGESQEDHIMFVHTLANMNPHPESLPINRLVSIKGT
                     PMHDELKKLGSKKLEFEEILRTIALARITMPQAIIRLAAGRYTMKETEQFLCFMAGCN
                     AIFTGKKMLTTMCSGWEEDKAMLAKWGLTPMDSFSYGANESPKEELAASG"
     gene            complement(<725770..>726612)
                     /gene="SFH5"
                     /locus_tag="KLMA_10357"
                     /db_xref="GeneID:34714023"
     mRNA            complement(<725770..>726612)
                     /gene="SFH5"
                     /locus_tag="KLMA_10357"
                     /product="phosphatidylinositol transfer protein SFH5"
                     /transcript_id="XM_022820451.1"
                     /db_xref="GeneID:34714023"
     CDS             complement(725770..726612)
                     /gene="SFH5"
                     /locus_tag="KLMA_10357"
                     /codon_start=1
                     /product="phosphatidylinositol transfer protein SFH5"
                     /protein_id="XP_022673878.1"
                     /db_xref="GeneID:34714023"
                     /translation="MALNFENDEQKKCYETLRKEIESIVKEVEYDELYGQKLTPDDQF
                     YKEGVVDRLVFKFCKANQFQLEGSRAQLKKTLKWRKEFRPLHAAFKETPASSILDEVC
                     AVTNSDKNDANKKVITWNLYGLLVKHKEVFKDLDGFMRFRIGLMERGLQLLDFESDDN
                     HLMTQIHDYSNVSMWRLDADIKKCSRAVIETFQQYYPETLYAKFFVNVPYVMSWLYEV
                     IKMFVSEDTRKKFVVMSDGHQLKDHLAVVPKEFGGEEPLKSLSIANVEPNAYVKYLLD
                     KDSE"
     gene            complement(<727067..>728173)
                     /locus_tag="KLMA_10358"
                     /db_xref="GeneID:34714024"
     mRNA            complement(<727067..>728173)
                     /locus_tag="KLMA_10358"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820462.1"
                     /db_xref="GeneID:34714024"
     CDS             complement(727067..728173)
                     /locus_tag="KLMA_10358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673879.1"
                     /db_xref="GeneID:34714024"
                     /translation="MSDQVENLSKELDISIDIANAVNKSLKEIDLDPTLRTHTPIQSQ
                     SGCGDDNTAYRLWNHQYVEAGDSGMGIGGERAVGLDNVAAHNNHTNNNYNNGNNITDI
                     LEEWDFIGDRVRNTRRTSMEDIFKVRHYLNPRSSFSNSGTNSRCWVTIIRDVSEVACV
                     VALNSSLRAHNSKMVLCVVVPSSWDMVLPSIPFLTFVKLPEVKYADDNDLTLLTLWSH
                     LDYEFCCYLSPFIILQANIDEILLNEEIFEEIDNETCVFLTNDTYQHKNDIVFVLFKP
                     SVEIGTAMDEFLKVYSGDSAKLAQLRETDVFDALNTLFGEAWGVVGRELCHTPLDPSL
                     SSNASILNYKQLQPWTGDQSGICQVWWNMYKGNC"
     gene            <728812..>729924
                     /locus_tag="KLMA_10359"
                     /db_xref="GeneID:34714025"
     mRNA            <728812..>729924
                     /locus_tag="KLMA_10359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820474.1"
                     /db_xref="GeneID:34714025"
     CDS             728812..729924
                     /locus_tag="KLMA_10359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673880.1"
                     /db_xref="GeneID:34714025"
                     /translation="MLRRSFSILPRVLKSNGKSKDIAAVSKTIKYIAEDPTLKSILKT
                     STGEKDENAYVEDVVNILNSSLPDVDKHKKNMDVHYSVLMNKLRSMVDREIVYSNANV
                     SKRIKECTDADSLYNLLFEFQLDPVFRAKTTLKDYYHIINHPKFSSGKCRELLESLDL
                     LKQSRRDIQIMAIHKLSQSSANAAVVSPYLPMLIETYMSIPRFSQKLVLRILHKNGKI
                     QELLDAHSDEIHAIHKNHSQVVTIYQTLSRTAYKLPPHLVDESHELTPIQRLFCELVV
                     LLSEHSSANPKLSKYSVQLVKGSFENQLSRCNTDLHDHSINVNEYKFIRLMQEILDDC
                     MATQNLDPGFYQSCRYLTQSLRTIYTEESQLSLRLV"
     gene            <730061..>731470
                     /gene="TFA2"
                     /locus_tag="KLMA_10360"
                     /db_xref="GeneID:34714026"
     mRNA            join(<730061..730173,730549..>731470)
                     /gene="TFA2"
                     /locus_tag="KLMA_10360"
                     /product="transcription initiation factor IIE subunit
                     beta"
                     /transcript_id="XM_022820485.1"
                     /db_xref="GeneID:34714026"
     CDS             join(730061..730173,730549..731470)
                     /gene="TFA2"
                     /locus_tag="KLMA_10360"
                     /codon_start=1
                     /product="transcription initiation factor IIE subunit
                     beta"
                     /protein_id="XP_022673881.1"
                     /db_xref="GeneID:34714026"
                     /translation="MVLKLAVILTKHKLHQNQVVCSVASNHMREAQQDSRIGQTRESG
                     GFRHLGGESKAIVTKRIMSSDLLANLNAFKNKVKTAPALTTRKIVANKERDVKGSKNM
                     DVIELDDGGSDEKEMPLKKKSKNNNGVATGQLDSTHLSTKMLIATEYIQERGEAVPVD
                     QIESYLSLPKDNNVIPMLKGLQKFKFDPKRNTLQYVSIYDVHSAEELLSLLRSQATFK
                     GISCKELKDGWPQCFDTIDELEAKNRILVLRTKKDNSPRFVWYNNAGPLRQIDEEFVK
                     MWEDCKLPQRSELPRKLQDLGLKPASVDPATIKNEQSTRREVKKRKQRKGKVTNTHMA
                     GILRDYSDRV"
     gene            complement(<731572..>732147)
                     /gene="RPA34"
                     /locus_tag="KLMA_10361"
                     /db_xref="GeneID:34714027"
     mRNA            complement(<731572..>732147)
                     /gene="RPA34"
                     /locus_tag="KLMA_10361"
                     /product="DNA-directed RNA polymerase I subunit RPA34"
                     /transcript_id="XM_022820496.1"
                     /db_xref="GeneID:34714027"
     CDS             complement(731572..732147)
                     /gene="RPA34"
                     /locus_tag="KLMA_10361"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I subunit RPA34"
                     /protein_id="XP_022673882.1"
                     /db_xref="GeneID:34714027"
                     /translation="MAKGSKVVSKEYISDSESDNDGSSEVVDVFVPPENYKKCTHLKS
                     FVKAKNLKQKELWLIKVPKSLDVSKLKTLPIDFTGEAETDIELKGKKFAVREEIQQEA
                     SAAAGSSSSELTLLTPVDKTKLAIDGSVSKSFDKIFTISEAADIPSIDYSKVKVDRKD
                     VLKIKGLKTRHFASGYYADKDLKKVSKKRKA"
     gene            complement(<733388..>734755)
                     /gene="LAS1"
                     /locus_tag="KLMA_10362"
                     /db_xref="GeneID:34714028"
     mRNA            complement(<733388..>734755)
                     /gene="LAS1"
                     /locus_tag="KLMA_10362"
                     /product="protein LAS1"
                     /transcript_id="XM_022820507.1"
                     /db_xref="GeneID:34714028"
     CDS             complement(733388..734755)
                     /gene="LAS1"
                     /locus_tag="KLMA_10362"
                     /codon_start=1
                     /product="protein LAS1"
                     /protein_id="XP_022673883.1"
                     /db_xref="GeneID:34714028"
                     /translation="MRITPWKSRSELEQLKQWLFVDATVASKKRAIQRIDAYLTRGPY
                     LPHIIEYTVRLMQCQLNDDVEDEEDSNDRDVENLKWNYCMVLIRFVNGMLDPVQQGQF
                     AIPLHKLAENIGLPSWFVELRHLSTHERELPSLEMLRLCCKEAIQWTWDNYWNNDEWE
                     DEDDEDPEDEEDPEGNQDSQKKREKEEQIARLKALFKEYLDLKKPLREREYLWKRLGI
                     TRSAFGEQDLSQDRELVLLSDWLSQLKTMWKQDNKDTFVEFITLHCDETLLEICLNSL
                     ETFEVRGMEWLIDNYDKKIKNEETSIGDRFTNYKKLLKFLKRYCSLIDGRKLLSNGSF
                     GSLVEKYDNYLVIYILQQLLSGDSNSYSRKKKKSSELDAKRVMDRIAAHGVRDVELEL
                     FNTRKRPSSSSTAEPVPEDSPALDILQDLQNLKSQFKRVKQESKNITNWQEAPDWEPK
                     PFGVI"
     gene            <735212..>737176
                     /gene="OAF3"
                     /locus_tag="KLMA_10363"
                     /db_xref="GeneID:34714029"
     mRNA            <735212..>737176
                     /gene="OAF3"
                     /locus_tag="KLMA_10363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820518.1"
                     /db_xref="GeneID:34714029"
     CDS             735212..737176
                     /gene="OAF3"
                     /locus_tag="KLMA_10363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673884.1"
                     /db_xref="GeneID:34714029"
                     /translation="MLPSVTVRKRYRPTLVCLNCRRRKTKCDREKPACGNCVKIGETC
                     FYSEHAEENAVKKVKYTYVEDLGLPEIINMTPRGFKISVKRSAAWFNGLFSDIAVIER
                     DPYLTITDEVVDILFETMRNTFDRRKQDYVLTLPNSLKIITTYNSKPQPSEEMLFHQI
                     AKEFSAIRSAPVEDIYIPDQKEFWTRYYPHFTGMIHPLLPIFDLEELKSLIQKFFDHQ
                     TKEPGVLNEKAHESTILMTIYLIVNLYLMEFDSRNMTIQKNINLIKGKIMNYKWFQKT
                     TLFQIRTFLLLRFHNWCSYHDNDGSRTNANDGLMGLIMGHCNSLGTTWQLWTNIDKPE
                     FRIIWAAALHWDRKLALLTGSDPLNTRTMKVPELPDDYLVIKFLKCCIDDPNKLDYTL
                     AMDTLGRLTFEKEHRLLQWELRIVVLMAKLSLHHGKLNHSNTGIIAIIRVIEELITIW
                     NEYFETPLLPISYSRRIVELSMNKALVILPAIILRVQDPHKHEVIQLMNKLSTTYFNE
                     FPRFYHVFKRLFIYKLTFNLVSRQDSLNHLIMILKHERPEVLEKMGIFKDHADMTDED
                     LIKAWNNKYRHVETPCHFKVDIKCKEYQSNLYSSSYQNTIEKLEKTHTVKSDTIDVAQ
                     FLQQVFDLTEFDRFYDIDIDAFPKFENVLY"
     gene            complement(<737407..>739005)
                     /gene="DAS1"
                     /locus_tag="KLMA_10364"
                     /db_xref="GeneID:34714030"
     mRNA            complement(<737407..>739005)
                     /gene="DAS1"
                     /locus_tag="KLMA_10364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820529.1"
                     /db_xref="GeneID:34714030"
     CDS             complement(737407..739005)
                     /gene="DAS1"
                     /locus_tag="KLMA_10364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673885.1"
                     /db_xref="GeneID:34714030"
                     /translation="MNGVFPIERLPDELVKEIITHLPQRDRLNVCLVNKRISKLALNV
                     LYRRIYLNDSNVVESDAFNLAINWTYLYIPSNEAECWSRGVANSKLDLLIRTLSSNQD
                     LLNSVQWIRINWDLDKEKQAEVLRLLCSYSRSLVRLENVTDPDCNDIIANGIQSSRNV
                     TSLDTAPPNSMPEREVPRSYLPSLAKYLKQRISTNLSHMTLFMDPIQLFNNVYPLEFK
                     LQIYDLKLHWRTEYYPPDQLKTVRREPLLTKLSDIFDVRTLHVLTIISWNESLNKREL
                     EILVEFYEFVEIRDLSLISMRQNPAVLIELFKRLKNLKRLKTDFLHDFTPHPVSTDVF
                     LAILLNCRDLQFLDIRFENIDQQIISIEESRFKFIQNCHCDQCNHVFQDILYGKFFNS
                     SKDMVIRDLSDLIAKDIFTMMKYLSLLPYSKAFDTYPSVRTQPMNLADFVTKINECNR
                     HYKSMHRNTTPFEPITESDVIECCHAMVHHNKKTYTTILSNLKKLRYLTLNDIPSIIL
                     SEDGTRFPVPVFFNNGYQTNMKNC"
     gene            739778..740077
                     /locus_tag="KLMA_R105"
                     /db_xref="GeneID:34718620"
     tRNA            join(739778..739816,740028..740077)
                     /locus_tag="KLMA_R105"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34718620"
     gene            complement(<740278..>740838)
                     /gene="PAM17"
                     /locus_tag="KLMA_10365"
                     /db_xref="GeneID:34714031"
     mRNA            complement(<740278..>740838)
                     /gene="PAM17"
                     /locus_tag="KLMA_10365"
                     /product="presequence translocated-associated motor
                     subunit PAM17"
                     /transcript_id="XM_022820540.1"
                     /db_xref="GeneID:34714031"
     CDS             complement(740278..740838)
                     /gene="PAM17"
                     /locus_tag="KLMA_10365"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="presequence translocated-associated motor
                     subunit PAM17"
                     /protein_id="XP_022673886.1"
                     /db_xref="GeneID:34714031"
                     /translation="MLRLGLNLPNRMVGLNASSMVKRATKVRFNSTGSLNKMTWPEFF
                     QLRKKERVYNTVSSVLTAIVFVNGSWFYFSTLEIDPTQTILGFDPLMTISVGMIGFAG
                     VGWLLGPIFGSALFKVTSGSKLAQYQQKQLAFLAKIQKNRVNPQSQSFSNPVPDYYGE
                     KINSIQQYRQWLRDCHSYKRKASEFL"
     gene            <741376..>742299
                     /locus_tag="KLMA_10366"
                     /db_xref="GeneID:34714032"
     mRNA            <741376..>742299
                     /locus_tag="KLMA_10366"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820551.1"
                     /db_xref="GeneID:34714032"
     CDS             741376..742299
                     /locus_tag="KLMA_10366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673887.1"
                     /db_xref="GeneID:34714032"
                     /translation="MDLQSIVQTYLKSLEEFSRVGSDDVELTRIAIIELSRAQDLAWK
                     LEKHAQLAGQAATEDLPLPEVHGDIVETLSCVITDDNINEVSLAGEIAIRDVNWGVQG
                     GASRGDLYVSFSNVNALQVNERVLEKVHHVTGNVYKLNSAVDWSARDVRETSSLVAAY
                     RVTNLPQVQCPILVTPVWQFKETETISMVNLRPLISVNYTLLKVHINIGTDAHDILSR
                     PAGFYNKLEGTIQWDLPSLEEDMILILRYKGGKTSSVTTGSLKQPEVCVDFTASQLLT
                     QVKLEYGRTPSCGTNLPLNQMTISGNYKAQC"
     gene            complement(<742326..>742883)
                     /locus_tag="KLMA_10367"
                     /db_xref="GeneID:34714033"
     mRNA            complement(<742326..>742883)
                     /locus_tag="KLMA_10367"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820562.1"
                     /db_xref="GeneID:34714033"
     CDS             complement(742326..742883)
                     /locus_tag="KLMA_10367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673888.1"
                     /db_xref="GeneID:34714033"
                     /translation="MSFGVRRVSKQIARTSARSEEVLSDEAWMDYNVDIAEYHVVNDP
                     LVLSSSSDDDEQWEYEHEQEDPIRRIDRWMSSHTVAVRMQTPDIVSVEDEEDYYDDGD
                     SEGGSRVCLVVPYLSEKFVCLTEYQLELVRKLVVEMLPLLPRSSVGGPGGSNSGSSSS
                     TGISSGGGRAATRKNNKYRLPSVLI"
     gene            <743937..>744335
                     /gene="RIM1"
                     /locus_tag="KLMA_10368"
                     /db_xref="GeneID:34714034"
     mRNA            <743937..>744335
                     /gene="RIM1"
                     /locus_tag="KLMA_10368"
                     /product="single-stranded DNA-binding protein RIM1"
                     /transcript_id="XM_022820573.1"
                     /db_xref="GeneID:34714034"
     CDS             743937..744335
                     /gene="RIM1"
                     /locus_tag="KLMA_10368"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="single-stranded DNA-binding protein RIM1"
                     /protein_id="XP_022673889.1"
                     /db_xref="GeneID:34714034"
                     /translation="MFRLVQRRAFSATARANDFAKMSVIGRIGSDYQELTSSNDTQYL
                     KYSIACQPRKDGNTNWFNVTVFNPHHINFMTQYVKKGALVYVECDASNFTFEREDGSK
                     GHSLSLVQREINLLKNPRTAETEGEGEASA"
     gene            <744749..>745102
                     /gene="GON7"
                     /locus_tag="KLMA_10369"
                     /db_xref="GeneID:34714035"
     mRNA            <744749..>745102
                     /gene="GON7"
                     /locus_tag="KLMA_10369"
                     /product="protein GON7"
                     /transcript_id="XM_022820585.1"
                     /db_xref="GeneID:34714035"
     CDS             744749..745102
                     /gene="GON7"
                     /locus_tag="KLMA_10369"
                     /codon_start=1
                     /product="protein GON7"
                     /protein_id="XP_022673890.1"
                     /db_xref="GeneID:34714035"
                     /translation="MSLLPNATYTGPKASHDFKVDASNPRYLTTEGRTTGASDYVLKQ
                     GHQDVDKPSEPKKIDPNGTEYTPLSMLRMHLTGIQDDINEYLTEKINHVKKPRNLKQE
                     QEQEINALLDGSEDA"
     gene            <745331..>746647
                     /gene="FEN2"
                     /locus_tag="KLMA_10370"
                     /db_xref="GeneID:34714036"
     mRNA            <745331..>746647
                     /gene="FEN2"
                     /locus_tag="KLMA_10370"
                     /product="pantothenate transporter FEN2"
                     /transcript_id="XM_022820596.1"
                     /db_xref="GeneID:34714036"
     CDS             745331..746647
                     /gene="FEN2"
                     /locus_tag="KLMA_10370"
                     /codon_start=1
                     /product="pantothenate transporter FEN2"
                     /protein_id="XP_022673891.1"
                     /db_xref="GeneID:34714036"
                     /translation="MRKLFKVDLTVLSFVCLQYWINYVDRIGFTNAYVSGMKTDIGFK
                     SNQFNVANTCFTVGYLLGMIPHNLILLRIKPKIWLSFCTLVWGILTLSMCGIHSVWQC
                     YVIRFFQAWFESCTFSGTQLILGSWYTPSQLPIRTAIFTSSGLLGAMTSGFLQVAIHD
                     SLAGKNGMPGWKWLFIIDGLITIPIALYGLLFFPEPDADSREVTHKNSWILTGKHKQQ
                     IDSLDWSIFKRVCGRWHWWLFSFVWVLGGENISFASNSTFNIWLDTQGYSLADRNRLP
                     VAIYAVGIVSTISASLYVHKYSHFAKHWHVAIFISVAMFIVSLLMLTNPLNPRYVFAA
                     QYLGGISYTGQTLFFAWCNVVCRGDLQERAIVLASMNMFSGAVNAWWSLLFYSTSMAP
                     KFTKGCYALMATSISSGIVSLYIHYLQRRDTLDVSKYSDPEEQIKE"
     gene            <747278..>748507
                     /gene="MNN11"
                     /locus_tag="KLMA_10371"
                     /db_xref="GeneID:34714037"
     mRNA            <747278..>748507
                     /gene="MNN11"
                     /locus_tag="KLMA_10371"
                     /product="probable alpha-1,6-mannosyltransferase MNN11"
                     /transcript_id="XM_022820607.1"
                     /db_xref="GeneID:34714037"
     CDS             747278..748507
                     /gene="MNN11"
                     /locus_tag="KLMA_10371"
                     /codon_start=1
                     /product="probable alpha-1,6-mannosyltransferase MNN11"
                     /protein_id="XP_022673892.1"
                     /db_xref="GeneID:34714037"
                     /translation="MPFIPKNKNKWAKSFKIWTSSVRFHLQKRGRVSLLFVIALFLFL
                     SYGLSSLFSGQAHHRSKIPPVHGLYKSEVASSTPLIFPSVQYHDTLRSLGIESLFTLR
                     TDIDGNKQYIMKPDDPPMTEAERKELSEKNLRKFVKRNFYDHGKLVYKNRVNHPEVVI
                     VSLIDFEGYSVDHLVKTVQNKVDYAQRHNYGVYVRWAQEFIPQLQKQSVSESYEFIKP
                     LAIRAAMNAFPYAKYFWFVDQNGLIMDLDKSLQQHLLEPKILDAATLKSVPVIEGSNI
                     KTYKHFDSRNAKIIIPKTENGNLDTSSFVVTPSLQGKAFLDYINDPLVRNYPFPNKLS
                     STIGHMLEWHPSILQRTALVVPKTIASSYKPATSQEGSDSVYYKEGDFVITFAGCEIS
                     KSCEAELAKYYEKVKLE"
     gene            <749207..>751660
                     /locus_tag="KLMA_10372"
                     /db_xref="GeneID:34714038"
     mRNA            <749207..>751660
                     /locus_tag="KLMA_10372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820618.1"
                     /db_xref="GeneID:34714038"
     CDS             749207..751660
                     /locus_tag="KLMA_10372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673893.1"
                     /db_xref="GeneID:34714038"
                     /translation="MNSTRNVDQLHDEQYRVILPTLSSQFEQRDQQHSRLDPRSYRGK
                     HFKKLNALVPVLLRAHRNNLDDWKHLFSNQQLKQFYSVLLEGLLLVVFESSNSVVGLG
                     SNMEFLKCVLRTYEYLYAVSKEMPSSELDKDIASFQQHFMKNWNKVQSETLLFDQVRD
                     LLSHSHDIVAPPLFDEKDVIKRGYFKLSCQQLNYDNLWVELFHMKNGGVAIFEVNSQT
                     LPLCNIEQTHELLLRMSKSIDMGFYHDSLFQIGRTLLFPTIRAMDLRIAEESKSKVIL
                     HTKTGNNVALVLNPYDTISWTQYWSPLISSLCAELQQNKVLTDTKISLLGDLIAKPSD
                     DYMDSKGSRGLGISFNKPDSETNLKSELHRSKPLSPDFPSISQIESFDFKKLMELNDS
                     TDASTAGSSIKSPVAANLKRVEGPSSIQQLSPVIGSDTVDIDSIISEDSGIRSQTDNT
                     SPTVETSPVFSLSAETHRPQLTKRKSSSLLSLFKKDKSKNKKESTGSLLSLEDKVKPL
                     FRESSATSTPNLSMPELSTPSLPAAATMDTKCEIPSNITLFNDCILLDVSIKISYWRS
                     NKWQYISSGWAQLQVLNSNQDKYMFLVRDKSSNVKLCLTITDKWSISRTTAQDIQIRI
                     PATDVVCSVVNPTPTMLSVRCPQVESISNVLKHCKRKNIIPTSTNHMSSSATQSTLQS
                     NESSILSNGKSDSSFSRSSTASNDLSSSLCNTQSIPNSADYKSLLLLSKIKVRLHKYD
                     EQYGWKMCKTGLLNVYSREYNGSLVGCKFEIDESESIISSFIDLKRIGRTGIAAGENL
                     FEFKNQSTADETYNLLCAL"
     gene            complement(<751754..>752743)
                     /gene="ATP12"
                     /locus_tag="KLMA_10373"
                     /db_xref="GeneID:34714039"
     mRNA            complement(<751754..>752743)
                     /gene="ATP12"
                     /locus_tag="KLMA_10373"
                     /product="protein ATP12"
                     /transcript_id="XM_022820629.1"
                     /db_xref="GeneID:34714039"
     CDS             complement(751754..752743)
                     /gene="ATP12"
                     /locus_tag="KLMA_10373"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="protein ATP12"
                     /protein_id="XP_022673894.1"
                     /db_xref="GeneID:34714039"
                     /translation="MLRISRIPRVVSHVPFAQIRIRSYAKASPLGVDQSVENNLQTET
                     NRLSKTLTKFWEQVSLEETDDSVTVKLDSKPLRTPLGHPLSLPPSRKLLSVMLLNEWS
                     NLPSLSIKPHVLPLTSLVSRCIDLEMTNKPGADPELVAKIGGNREKLTQDLLRYLDTD
                     TLLVFSPAKEYEGALRKAQNEMYIPFIAGVEKFLTKFSTDGKPVKLQILDADLHGLRG
                     NAQKEETARAAKAYLDSLSLWDLAIFEKTVLTTKSFICGLLLLLNKSGNVTDIPELKC
                     SMEDIARAATLETIYQVERWGEVEDTHDVDKRDVRRNIHAAAIVAYEIPSKSK"
     gene            <753025..>753366
                     /gene="PFD1"
                     /locus_tag="KLMA_10374"
                     /db_xref="GeneID:34714040"
     mRNA            <753025..>753366
                     /gene="PFD1"
                     /locus_tag="KLMA_10374"
                     /product="prefoldin subunit 1"
                     /transcript_id="XM_022820640.1"
                     /db_xref="GeneID:34714040"
     CDS             753025..753366
                     /gene="PFD1"
                     /locus_tag="KLMA_10374"
                     /codon_start=1
                     /product="prefoldin subunit 1"
                     /protein_id="XP_022673895.1"
                     /db_xref="GeneID:34714040"
                     /translation="MSNQPQDIVREMANSLRNSRSQLAMTLAQLEQVQRQKKIAELTE
                     KELTSYDNEKVWRSCGKMFIQQEKQSYTGDLKHDEKLLDEQVKALEQKRHYLQTTVDN
                     TVESLRRVMGS"
     gene            complement(<753531..>754370)
                     /gene="ATG27"
                     /locus_tag="KLMA_10375"
                     /db_xref="GeneID:34714041"
     mRNA            complement(<753531..>754370)
                     /gene="ATG27"
                     /locus_tag="KLMA_10375"
                     /product="autophagy-related protein 27"
                     /transcript_id="XM_022820651.1"
                     /db_xref="GeneID:34714041"
     CDS             complement(753531..754370)
                     /gene="ATG27"
                     /locus_tag="KLMA_10375"
                     /codon_start=1
                     /product="autophagy-related protein 27"
                     /protein_id="XP_022673896.1"
                     /db_xref="GeneID:34714041"
                     /translation="MKSVLGVPLSLLLLLLPLASGLECSKHDILNKYRVSEVAAHGTV
                     AQDTPPSETKENWWLSICDENRSKAKDSKPEQCKDDDTLCGVTSVSLPGKEPLVTRIM
                     DFSGSLASEVKETAEALSIKLSGASWGSHNLNAEIYLECEESGDGSLKESSWNDDKTV
                     KLVFSGPFGCLKKGDNGNGGDGNSGDEPEKPPADEKPKGGAGLGSWLVWLFMYAIIFA
                     FVYLVVTSYMSTRNGSFHDFREEFIDRSKTFATNLPQFAKEVAGKIVNTGSSSQRGGY
                     SAV"
     gene            <755290..>756225
                     /gene="RPL17B"
                     /locus_tag="KLMA_10376"
                     /db_xref="GeneID:34714042"
     mRNA            join(<755290..755598,755980..>756225)
                     /gene="RPL17B"
                     /locus_tag="KLMA_10376"
                     /product="ribosomal 60S subunit protein L17"
                     /transcript_id="XM_022820662.1"
                     /db_xref="GeneID:34714042"
     CDS             join(755290..755598,755980..756225)
                     /gene="RPL17B"
                     /locus_tag="KLMA_10376"
                     /codon_start=1
                     /product="ribosomal 60S subunit protein L17"
                     /protein_id="XP_022673897.1"
                     /db_xref="GeneID:34714042"
                     /translation="MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAISGWDLQKA
                     QKYLDQVLEHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAASNA
                     EAKGLDATKLYVSHIQVNQAPKQRRRTFRAHGRINKYESSPSHIELVVTEKEEAVEKA
                     SEKKVVRLSSRQRGRLATQKRITA"
     gene            complement(<756363..>758393)
                     /gene="COY1"
                     /locus_tag="KLMA_10378"
                     /db_xref="GeneID:34714043"
     mRNA            complement(<756363..>758393)
                     /gene="COY1"
                     /locus_tag="KLMA_10378"
                     /product="protein CASP"
                     /transcript_id="XM_022820673.1"
                     /db_xref="GeneID:34714043"
     CDS             complement(756363..758393)
                     /gene="COY1"
                     /locus_tag="KLMA_10378"
                     /codon_start=1
                     /product="protein CASP"
                     /protein_id="XP_022673898.1"
                     /db_xref="GeneID:34714043"
                     /translation="MSLTTYEHALSLWKQAGFSGLQSMLDESISKIKDLEGTSLESRK
                     VLATETKQFKKLPDDEKLSQILKLVKQYQKEIDSLTARSNFSEKVVIELYEKLIEQPD
                     PTGIIQSMIDELRKEDGSVNELKAENERLSAIVSKSADYDSVKKRLFDLEQSSAKTLS
                     KRLVAKEKEITSKWEEKERNWNSREQELLKQLENMKNTNAALEKKIGTQRSLENEGDD
                     DDIVFIDGANSAQTELLSQELEAAQVRIMSLESRNEELNAEVAKSKNDEQHDSELQEK
                     EDKLNQLENENAKLVACLDEERKSAKRKLETIESQLNSFTLEANTYKAELDTLRRKMS
                     NYSDYERIKEELNAMKKIEFGASSDENDSDDGNEEGDPVVASLKHANQKLQNNLVKVN
                     TEKNKYMKEVNTLKSNIDTLNAKIQKLETLNAKLEADIEKVEDVTNQFSDTQSMMSGA
                     TRQISNRHKTTEKLSPTSSIIGIPEEREMDSFSGNLNNSSSILPIVTKQRDRFRAKNL
                     ELESQLKSVNQEQIKLRTQVKELKTDNARLYEKVKLLTTYSHNSNDGDSSNGNINAAA
                     AAAAATTASATLDLESPFTEEYEESLHPLSGFKQKELDRYERRNMPPMERLFLSLAKV
                     ILANKKTRMLFMLYCIGLHALVMIMTIYVTSFTNYITPEVRSAKGTMIKTNE"
     gene            complement(<758749..>761697)
                     /gene="SWI3"
                     /locus_tag="KLMA_10379"
                     /db_xref="GeneID:34714044"
     mRNA            complement(<758749..>761697)
                     /gene="SWI3"
                     /locus_tag="KLMA_10379"
                     /product="RSC chromatin remodeling complex subunit RSC8"
                     /transcript_id="XM_022820684.1"
                     /db_xref="GeneID:34714044"
     CDS             complement(758749..761697)
                     /gene="SWI3"
                     /locus_tag="KLMA_10379"
                     /codon_start=1
                     /product="RSC chromatin remodeling complex subunit RSC8"
                     /protein_id="XP_022673899.1"
                     /db_xref="GeneID:34714044"
                     /translation="MADEPTGISDAEMGGDLGDLSQSLEPDYADGLPETLGEELPDGI
                     EDDFGDEVVSNTSGLFGLESKQGSEGPAEPLENNLGDNLGDNLGDNLGDNLGNNPEDN
                     LEEPSKGPEQSEVPEQSAEPEQSEVPEQSAEPEQSAEPTETAESVAPSEPVEEPVEAS
                     IDASVEEKNPSEDNEVSEPAEKEPTEQLTEEPEAGSSVPEESATAPVSETTEQPETTE
                     QPEPTEQLETAEQATEQATDQATEQPETTEQPDTTEQPDTTEQPETTEQPETSQQPTE
                     PYVSETDKETGAPSSPKEQEQEQEQEQEQEQESESTSPETNVAVKQEKNTADPSLAIP
                     QSHEIVIPSYSRWFNLSKVHEIEVKSLPEFFTNRIPSKTPQVYVKYRNFMVNSYRLNP
                     NEYFTVTAARRNLCGDAGALFRIHKFLSKWGLINYQVNASKKPKMVEPPFTGEYETRY
                     DAPRGLFPFQSYKPALQLPDMTRLKKIMTQLDTPQAQSSLKRTSDEMSNGTSSNEPSS
                     SSKTNDINESSDKTEQSSEDKLSSLTNDRKPKRPRVSEIADKDWSQEEIHKLVELIRE
                     HGTDWFTIAKSLGTKTPEQCILRFLQLPIEDSFLMEEKDLGVLKFGSHMPFNKSDNPV
                     MSTLAFLIGLVDPNIVQELTQRAIRLHEEKQKTDNEVNAHSTEEEKDTETNKLSEEKT
                     QDKEKDEEQKQDEEKHEEKETEKAEEEKEEEKDIEMVDKTEETKEAENVNDSAVPEAG
                     ESKEQEDSNEAKEDVEMPDQEPNAQDSTQDRNSPEEIEKSTSPKANDVEKEDNNEAKD
                     EAEAELETQAKTETETQTETESKPVSEAKATVKDATEVALATLGLRSHVFATNQERLM
                     NKTTNDLITTQLTKVDLKLKTLDTMEKSLELERKAIHSKQEDIFIQRLSLAKYATSLM
                     GKFEALLKYIPENDETKQQVEEIRNMISDPPKTSISSKLPKLDDQEDLNSEVKPVSVE
                     APQLYRYWSG"
     gene            <763919..>764743
                     /gene="KRE9"
                     /locus_tag="KLMA_10380"
                     /db_xref="GeneID:34714045"
     mRNA            <763919..>764743
                     /gene="KRE9"
                     /locus_tag="KLMA_10380"
                     /product="cell wall synthesis protein KRE9"
                     /transcript_id="XM_022820696.1"
                     /db_xref="GeneID:34714045"
     CDS             763919..764743
                     /gene="KRE9"
                     /locus_tag="KLMA_10380"
                     /codon_start=1
                     /product="cell wall synthesis protein KRE9"
                     /protein_id="XP_022673900.1"
                     /db_xref="GeneID:34714045"
                     /translation="MSVLIRVLVLVQLLARLLLVQADVSIVKPEEGDSYKPSSDGGSV
                     KINIVWEDDANLPSVPSYDYFTFKLLYGPSYDMDLISQIEEVSPSKVVHQGSQYTYTA
                     NFVSSKLGNGQFFIQVYAFSKNLGWTIHYSPRFNIQSVSDGVLTYTYKGQDQPGPQWN
                     LPNAGVDTRSFTLPYTAQTGVRRYAPMQTQPGSRVTVTTWSRRFPTSSVSYYTTKRNS
                     LDQMTTYTPGWSYTVTSDFNYATPAPFPSDNGGWYNPKKRQSLTTRKLNINQHKSK"
     gene            complement(<764916..>765266)
                     /gene="RFA3"
                     /locus_tag="KLMA_10381"
                     /db_xref="GeneID:34714046"
     mRNA            complement(<764916..>765266)
                     /gene="RFA3"
                     /locus_tag="KLMA_10381"
                     /product="replication factor A protein 3"
                     /transcript_id="XM_022820707.1"
                     /db_xref="GeneID:34714046"
     CDS             complement(764916..765266)
                     /gene="RFA3"
                     /locus_tag="KLMA_10381"
                     /codon_start=1
                     /product="replication factor A protein 3"
                     /protein_id="XP_022673901.1"
                     /db_xref="GeneID:34714046"
                     /translation="MSNQTPRIDPSQVSNTEHAVFRIIGKVIDQPQPTALVVQSPTTN
                     GEMLTLSQVKLSQGSNIEVGSWYEFVCRSVDTGDVGLMVLDSVKCELKEGEDISVSGV
                     VALQQLSAKFPDLY"
     gene            complement(<767949..>769268)
                     /gene="STE3"
                     /locus_tag="KLMA_10382"
                     /db_xref="GeneID:34714047"
     mRNA            complement(<767949..>769268)
                     /gene="STE3"
                     /locus_tag="KLMA_10382"
                     /product="pheromone a factor receptor"
                     /transcript_id="XM_022820718.1"
                     /db_xref="GeneID:34714047"
     CDS             complement(767949..769268)
                     /gene="STE3"
                     /locus_tag="KLMA_10382"
                     /codon_start=1
                     /product="pheromone a factor receptor"
                     /protein_id="XP_022673902.1"
                     /db_xref="GeneID:34714047"
                     /translation="MGYSQAIIGLSVIAFLVLLPPLAWHSYTRNTPAIILIVWLLLMD
                     LKAIVDASVWGGADFRDKWLGHGWCDIMTKLQVGANVGVSCAVANIAFNLLRILKANK
                     EIPDNRSWKKIRVDLAISLVFPIIIMSVIYVVQVFRYGIFRYNGCQAMLSPTWLTTIL
                     YTLWMLVWSLIGFIYASLLLFVFYRKRQDVRDILHCTNSGLNISRFARLLVFCMLIIL
                     VMFPFSIYSFVSDLKHVNASYRHYSFSETHNSGIWNVILRFDPGKPLYSVWLYILMSY
                     LVFLIFGLGADALHMYANFLRTIGLGKAVDTTAEWRVKHRNTRLGKLTEKILPSGFAQ
                     SGDSSAQFTCGSSSDGSLSMSEYGDKHDYPSSPSQFEIDYTLPHERNMRENGGGSGAG
                     YTPSSYDPKLSTIFHSISRGSDDSTDGDSSSSSKAGQVQYHYRLDRR"
     gene            complement(<771341..>773479)
                     /gene="SET2"
                     /locus_tag="KLMA_10383"
                     /db_xref="GeneID:34714048"
     mRNA            complement(<771341..>773479)
                     /gene="SET2"
                     /locus_tag="KLMA_10383"
                     /product="histone-lysine N-methyltransferase"
                     /transcript_id="XM_022820729.1"
                     /db_xref="GeneID:34714048"
     CDS             complement(771341..773479)
                     /gene="SET2"
                     /locus_tag="KLMA_10383"
                     /note="H3 lysine-36 specific"
                     /codon_start=1
                     /product="histone-lysine N-methyltransferase"
                     /protein_id="XP_022673903.1"
                     /db_xref="GeneID:34714048"
                     /translation="MTESSTETASFRQPKLFLDEKDMTEEAKKTYVGLDECSYTPRHM
                     GNSKHEFMECDCFEDFKNGLNHACGEDSDCINRATLIECVNGLCKHSCGEDCQNQRFQ
                     KKQYADISVFKTKRKGYGVRANSDIQPHQFIYEYIGEVIPEEEFRKRMVKYDEMGFKH
                     FYFMMLQTGEFIDATIKGCIARFCNHSCNPNAYVNKWVVNGKLKMGIFANRLISKGEE
                     VTFDYNVDRYGANAQPCYCEEPNCIGFLGGKTQTDAASLLPQNFADALGIKPSMEKKW
                     MNMKKAKGEKIVKSDTTTVNVEFVNSLDLEPCTKTEDVNRVMSVLLQVDDAFIAEKLL
                     ERIITTDDEAMHYQFIKLHGYLICSRLLTMFEDKPHIVAKILNFLAVLPKTTKNGITQ
                     SGIDKKVEEIKGKDSEFKSVCEELLDKWSKYETYTRISKKDVNENSKVIDLRRIRLPI
                     GWELIHENGKPVYYNAQRQIKQSVPPTDSAYRSNSNGNISNNGNGGGASDLKSRSGTP
                     NGGTSRYSGSNKYIPPPTYGQMQQKRNLSPEEYEKRKRMRLEWEQRELEQRKQREQEE
                     LKAKLEQEKLKKSELERIIEEANKQKEQEKLEKIKQQKEEEEKRKLKKQTNHTSVVEA
                     KWVKFFAKYVPNLIKNYQQEVGKELFKESAKNIVKSLAQKEMKKGSSRLPPDELSQEK
                     RAKVKTFSTQYMDRLIAKMKEKEKAKKTIT"
     gene            complement(<773862..>776048)
                     /gene="LST4"
                     /locus_tag="KLMA_10384"
                     /db_xref="GeneID:34714049"
     mRNA            complement(<773862..>776048)
                     /gene="LST4"
                     /locus_tag="KLMA_10384"
                     /product="protein LST4"
                     /transcript_id="XM_022820740.1"
                     /db_xref="GeneID:34714049"
     CDS             complement(773862..776048)
                     /gene="LST4"
                     /locus_tag="KLMA_10384"
                     /codon_start=1
                     /product="protein LST4"
                     /protein_id="XP_022673904.1"
                     /db_xref="GeneID:34714049"
                     /translation="MLGRLLRTSSMTDFMAFGGGSNGSAGTSGEEAFQNEPCYMTDDF
                     KTLLFGTRDRMLFDRSASDRLHSGGFRLIIAQELGHLSSRNNYQVVLDHGSPSFHGTS
                     HIPLNELKDYIFGSPIRTVDYSASSDKIKVVKNANIVLFTRIFYLDEKSTLRFAISCC
                     ISDDFLPVLTELWPRVSQYLDQCERTLVNFMVKNSTHFLPKDWKSRDCVEVGCVLQTF
                     QRKVIPLLCGYADTPRLFLYPMNSIPYIKTWVKYVTNWIELKDGPRMRFLPVLLAKLR
                     YDFASILKDQTNARVVVLTGNMNVANRLIFILTAFIGPHFQGTLHKSATPQMFALSAA
                     NNSGHINYSSNINNNKKVTNFSKFSDSPFELKSSSSSITETSKGWEIPRTKRNPTLGV
                     TSVSSDETGVQSFIQPSSLKSGASSVHYLSSSLNSTYGSYGSWFKKVAQSPSSSQETT
                     SILRHNGSSTSLHQQAVLSNANVSQRATPQPSPTVTEYDEYPWIGGSPITRDSPRFEK
                     RASISAIHGVTDRKALLQHEIYEVDMKRTLNRLIDEEDLNEAFASLVLDPPKFSTTQP
                     DENKNHGEIVEVDAILPNKMLSQFDTPHKELLPRYTAYTPAYNQYFQLQACQITPESE
                     NKIIHSMKRDLSSIDQNSNSTSTLLISLRSREIKQITIIKDVNNRFIQKTKRIFQNGK
                     IGPVSKAMVLAIEKTEAQLKGLMENIEDNVELQSQFNDIVECLQPS"
     gene            <776736..>778316
                     /gene="ZRT3"
                     /locus_tag="KLMA_10385"
                     /db_xref="GeneID:34714050"
     mRNA            <776736..>778316
                     /gene="ZRT3"
                     /locus_tag="KLMA_10385"
                     /product="zinc-regulated transporter 3"
                     /transcript_id="XM_022820751.1"
                     /db_xref="GeneID:34714050"
     CDS             776736..778316
                     /gene="ZRT3"
                     /locus_tag="KLMA_10385"
                     /codon_start=1
                     /product="zinc-regulated transporter 3"
                     /protein_id="XP_022673905.1"
                     /db_xref="GeneID:34714050"
                     /translation="MDLFDSGTVPKWLLYSMSSSFLCIFGAFMVPIVYSLFRSSEEVN
                     TKLLNYGLSLSAGSMLCTSLLKMLGSTDRDNDTIVFLGFLTGCFISFFLNHIVHSYTS
                     QSLIHCAHSDNDDGELVMNSYDSAQFYDTTSHSHRASHSHSIKLPHSYDHAHLHGHTP
                     ARGRYNSLEGPNADPQQQQQQQQQHQSHFHPQPQHHHASFSHTNALHTHDNLENINET
                     LPLLANNSTNSPNSPIDQDQEQESQSFLTALRPKKCDSTNTEYDELSCIPIVKSVSRS
                     SLPISKCGGEIKQPALCIEPNIGYDLENLNIYREQFKMRGDTSMDAASGRLTLMHDDD
                     HKHVMETPFSKLISIGIQTCLVICLHKFPEGFIIFYTNNPNDVDETRPDLGFSIFLSL
                     AVHNFIEGFAMTLPLFTAFETKWHALLITIVLGGGSQPLGALLGLEWYRHSNHNNNPE
                     STTAKMDFLLSVTSGFLFVISLQMFQTAVAFSDTHHHHEGEDDSTIRAHHSSGTTCLK
                     YCCLGVLLILASSALKSL"
     gene            complement(<778494..>780155)
                     /gene="TPO5"
                     /locus_tag="KLMA_10386"
                     /db_xref="GeneID:34714051"
     mRNA            complement(<778494..>780155)
                     /gene="TPO5"
                     /locus_tag="KLMA_10386"
                     /product="polyamine transporter TPO5"
                     /transcript_id="XM_022820762.1"
                     /db_xref="GeneID:34714051"
     CDS             complement(778494..780155)
                     /gene="TPO5"
                     /locus_tag="KLMA_10386"
                     /codon_start=1
                     /product="polyamine transporter TPO5"
                     /protein_id="XP_022673906.1"
                     /db_xref="GeneID:34714051"
                     /translation="MKRIYAVNYNRNGKGNRDIRTNRSGFFGLRMTEYIRLSNINENI
                     HIPERLLALLNEEDQDAPDEVKEFNYTQELDKNLLSRTSVIGLGFGLMSPVLGMSTTM
                     GIGLLNGGSPAIIFGYVICGIMTWICSLSLGEIVSKYPIELHGAAAMLASDELRLPMS
                     WYCGWLMLFGSWTMSTSITFAGAQLIISLVTMSNESLIDSDWLMFSTVAMFYIVVTVV
                     GVINLKFARYIEVINKVCVYWILYAILFTSTLLLLFQPNHRSFKEVFTKFDNSLSGYT
                     SVVLSFLIGGFQQSNFTFQGFAMLSALSDETEKPEKNIPYSMTRSVLISLVSGLFFLI
                     PMMMILPDISEVMNHEGVMPIVLIFTKSTKSMFISTFLVLLILANLLFSGIGSVTTSS
                     RAVYSLSRDHGIPYHQLWTYVDPSSESKVPKYSVMLSMGVSYILALLALVSTSAFNAF
                     VGCAVICLCSASLLPIALSLYHRRKKVKGSAFRIKYRLGYIVNGITVIWLLFTIFIIC
                     LPQKVPINFRTMNYSIVVYLLFLVMITLLYKSWGIKNFRAPLVDE"
     gene            <780307..>783132
                     /gene="SNU114"
                     /locus_tag="KLMA_10387"
                     /db_xref="GeneID:34714052"
     mRNA            <780307..>783132
                     /gene="SNU114"
                     /locus_tag="KLMA_10387"
                     /product="U5 small nuclear ribonucleoprotein component"
                     /transcript_id="XM_022820773.1"
                     /db_xref="GeneID:34714052"
     CDS             780307..783132
                     /gene="SNU114"
                     /locus_tag="KLMA_10387"
                     /codon_start=1
                     /product="U5 small nuclear ribonucleoprotein component"
                     /protein_id="XP_022673907.1"
                     /db_xref="GeneID:34714052"
                     /translation="MDEDLYDEFGNFIGDPTELADSDDASESYESDDERNENERIEDD
                     NENRDLVLRDNNGPLDEDVDVLVEIEDREPEKPLVEGSNGRRREEHDNANKRAPKVLF
                     DRDYLMDIFKIQDRQLNIGVFGALHSGKTSFVDMFAMDTHQNLPSLTKKAKEGWEPAR
                     YLDNATIEKERGVSLRLNGMSFAYESSRGRTYAVTMLDSPGHVNFWDDVGITMRACQY
                     GVIVIDVIEGINSIVSKLIRELSKNGIPFVIVLNKIDRLILDLKLPVVDAYHKLQHTV
                     DEINTYTRKRYSPELGNVLFGSTKFGFLFSIDSFVASFYAKGLKQKTDQFVAHLWGQI
                     NYRDGGFYQTEFITESIAFIQFILKPIYKVFTQTLSASEDSLRRIIETHFHVRLSDEL
                     LAKDPQPLLYGVFHAILPHYTCFIDAIEHLNRERVVGITSTNADSDTGTTTIQVLRHM
                     DHEGSSWSLCRVIAGSVKRGNKLFIFNEAVESVDASEENEHSKITVEKIALLGGRYVY
                     EIKEAHKGQIVLLKGLEDQYTKYATLSSVIETPLPPIDFLNESVFKLALQPQKPSELP
                     RLLKGLQKANYMYPALVVRVEESGECIIMGTGELYLDCVMEELRHTFSEIEIKVSPPL
                     VQFAESCDTESFASIPVSSNNNIVSISVMAEKLDGKIVRDLTHGEISPAELNDARKFS
                     KRLRTEYGWDSLAARNCWGLSQCNVFIDDTLPEETDKKLLKQFRPYILQGFEWAVKEG
                     PLADERIHACQFKLLEFKLQKDKLDDFIPSQLVPMTRKACYIALMTATPIIMEPIYEV
                     DIIVSGVLETVVEGLIKRRRGGRIYKTEKILASPFIEIKAQLPVIESVGFETDLRVAT
                     TGAGMCQMHFWNKIWRKVPGDVLDEEAFIPKLKPAPNASLSRDFVMKTRRRKGLSESG
                     HVVQDGPSLKSYIDNELYEKLKQKGLV"
     gene            <783417..>784664
                     /gene="EBP2"
                     /locus_tag="KLMA_10388"
                     /db_xref="GeneID:34714053"
     mRNA            <783417..>784664
                     /gene="EBP2"
                     /locus_tag="KLMA_10388"
                     /product="rRNA-processing protein EBP2"
                     /transcript_id="XM_022820784.1"
                     /db_xref="GeneID:34714053"
     CDS             783417..784664
                     /gene="EBP2"
                     /locus_tag="KLMA_10388"
                     /codon_start=1
                     /product="rRNA-processing protein EBP2"
                     /protein_id="XP_022673908.1"
                     /db_xref="GeneID:34714053"
                     /translation="MAKGYKLKELLQRQKAVEGAEKKEVSKQNKRSAKSKSEEDAPVT
                     VSKEDLKAKKAAEAAAEAESESESENEASGEPEEYESKALSRKEKRKLKKLAKKQEQP
                     VEEAESEEDEEEESEEERLDLEKLANSDSDSDDEEDEEEEEEEEEKKQEEEEEEEEEE
                     EEDVPLSDVEFDDDADVVPYQKTTVNNIKAIKDALERVQLPWEKHSFQEHQAVTSQLL
                     TDENIKDIYDDTERELAFYKQSLDAVVIAREKLKKLKVPFKRPLDYFAEMVKSDEHMD
                     RLKSKLVKEASEKKAREEARKQRNLKKFGKQVQVATLQQRQKEKRETLDKIKDLKKKR
                     KHNEIGGDDFDIGVEDAAETETKRKPNFKRQAKNSKYGMGGMKRFKRKNDAQSSAEMP
                     EFSTRKMKGKAPRPGKSKRSRRH"
     gene            <785086..>786135
                     /gene="FPS1"
                     /locus_tag="KLMA_10389"
                     /db_xref="GeneID:34714054"
     mRNA            <785086..>786135
                     /gene="FPS1"
                     /locus_tag="KLMA_10389"
                     /product="farnesyl pyrophosphate synthetase"
                     /transcript_id="XM_022820795.1"
                     /db_xref="GeneID:34714054"
     CDS             785086..786135
                     /gene="FPS1"
                     /locus_tag="KLMA_10389"
                     /codon_start=1
                     /product="farnesyl pyrophosphate synthetase"
                     /protein_id="XP_022673909.1"
                     /db_xref="GeneID:34714054"
                     /translation="MSDNRTKFLNVFPSLVKELRDILAGYGMPEEAIQWYEKSLNYNS
                     VGGKLNRGLSVVDTYALLKGYKSVDELSDEEYKKVAILGWCIELLQAYFLVADDMMDK
                     SITRRGQPCWYKVPNVGEIAINDAFMLEGAIYCLLKNHFRQEPYYVDILELFHDVTFQ
                     TELGQLLDLITAPEDKVDLSKFSLEKHSFIVIFKTAYYSFYLPVALALYAAGITDPRD
                     LKQARDVLIPLGEYFQIQDDYLDCFGKPEDIGKIGTDIQDNKCSWVINIALKKASPEQ
                     RKVLDENYGRKDAEKEQKCRAVFNELDIESIYHEYEEKVASELRAKIANIDESRGFKA
                     EVLTLFLNKIYHRKK"
     gene            <786629..>786913
                     /gene="QCR8"
                     /locus_tag="KLMA_10390"
                     /db_xref="GeneID:34714055"
     mRNA            <786629..>786913
                     /gene="QCR8"
                     /locus_tag="KLMA_10390"
                     /product="cytochrome b-c1 complex subunit 8"
                     /transcript_id="XM_022820807.1"
                     /db_xref="GeneID:34714055"
     CDS             786629..786913
                     /gene="QCR8"
                     /locus_tag="KLMA_10390"
                     /codon_start=1
                     /product="cytochrome b-c1 complex subunit 8"
                     /protein_id="XP_022673910.1"
                     /db_xref="GeneID:34714055"
                     /translation="MGGPHAKTYMGWWGSIGSPAQKGITMYSVSPYAQKPLNNIFNNA
                     VFNTFRRVKSQALYVILPFSIYWAWWVNCRDYNAYLYTKAGREELERVNV"
     gene            <787741..>790161
                     /gene="NNK1"
                     /locus_tag="KLMA_10391"
                     /db_xref="GeneID:34714056"
     mRNA            <787741..>790161
                     /gene="NNK1"
                     /locus_tag="KLMA_10391"
                     /product="protein kinase"
                     /transcript_id="XM_022820818.1"
                     /db_xref="GeneID:34714056"
     CDS             787741..790161
                     /gene="NNK1"
                     /locus_tag="KLMA_10391"
                     /codon_start=1
                     /product="protein kinase"
                     /protein_id="XP_022673911.1"
                     /db_xref="GeneID:34714056"
                     /translation="MSSSYDVISGIKRSSTPTLYERDFPSEVVSVGSLQSLAQREAKE
                     SESFQLRHKNDSYSHSVDSVSGSNNNNHGEEEEDNDEHLSFKPRRRLKGDGILGLEND
                     SSSRLARVYSDSEKANFNDVTGIRMYDDMKYRPMHFPNNSTDTTANSESVAQDPVPIE
                     INAKPDVGGYRRPRLPQTTRRRFSSGESPMRHPYFKDQFHHDAIPLFNDMQDEYIPDF
                     DFSEAVSRWQSSEDANTLTRFNTWESEFLDKNQKESILHLDDLHSQVEPIPLPNAKPE
                     KQQLHIPISRPDSSSLFSPSSLKTPPAMLEISDQDIERIVRSIPSDFINMPFSQRKKI
                     IQDISPGHDYKTIMNILKRDKLSRSGSLNNIRSRHGSVASKYLNSFTPGSNSFKRDDK
                     SSVVLGYSLGKIIGFGAWGMIRECHTPIEDQQDQRNIENKKPDHSKAKKKAMKIIKFR
                     DNMMVKRQVMREISVWSKLCHPNILPLTNWKVEEDLVAYCLTDKIDHGTLYDLVVSWG
                     ECHHSKISLDERCQITTALTLQLIDAIQYMHSKHIAHGDIKLENCLIEKESENYKDWK
                     LLLCDFGMSHFYGRFNDTQTDRESIQIKSLLDGSTVRIRRRPSIPRSSSSTTTSTSNS
                     VRPSSKLRQLIFDKKLIHDDTPLNVHAQKNKETSEHSSPTITFTQKIDSLTNIPNDGF
                     DHINDNVSRIGSLPYAAPELLEPNPPPIGPSADIWAVGVLIYTMLTGKLPFKHDYEPR
                     LRAIITSGKYDVKTLSQVCSCDLDTVPPPNTEVKYQSLFNAVKGCLTKDLTRRWELDM
                     IKVALTNY"
     gene            <790596..>791012
                     /gene="rplN"
                     /locus_tag="KLMA_10392"
                     /db_xref="GeneID:34714057"
     mRNA            <790596..>791012
                     /gene="rplN"
                     /locus_tag="KLMA_10392"
                     /product="54S ribosomal protein L38"
                     /transcript_id="XM_022820829.1"
                     /db_xref="GeneID:34714057"
     CDS             790596..791012
                     /gene="rplN"
                     /locus_tag="KLMA_10392"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="54S ribosomal protein L38"
                     /protein_id="XP_022673912.1"
                     /db_xref="GeneID:34714057"
                     /translation="MIYLKSLLKVIDNSGAQIAECIKVLGKGSPKSPGRIGDKIVCVV
                     KKAKPLTQNITGQSNNNRVKKGDIVHAVVVRTKQRNMVRPDGSTIAFGDNACVLINKN
                     NGEPLGSRIMGNDGVVGRELRDKGYNKICALASKVL"
     gene            complement(<794536..>796509)
                     /locus_tag="KLMA_10393"
                     /db_xref="GeneID:34714058"
     mRNA            complement(<794536..>796509)
                     /locus_tag="KLMA_10393"
                     /product="lrgB super family"
                     /transcript_id="XM_022820840.1"
                     /db_xref="GeneID:34714058"
     CDS             complement(794536..796509)
                     /locus_tag="KLMA_10393"
                     /codon_start=1
                     /product="lrgB super family"
                     /protein_id="XP_022673913.1"
                     /db_xref="GeneID:34714058"
                     /translation="MRSFVSRHGSCFVDFLHVYKYSLMRQYVFVPIGVIVMWLILYGV
                     NKLIKDVIGVVFPASVAVMLFNFGSLCVFSWINEEYAQKYIGIIDIPLSWALRWMNLF
                     FTPAFVTLPLSPWISFREAMLIATAFVCFYLITGFCLAYTTIFCQKALGLFTKYQPLS
                     SNKEADEEEKPVELSALDSTTLGYSSGEEEEESDAYDSDDDMHSFADIFSEHHHDEDF
                     QLRNVATNSGFPLGRHQSRHHSRTVISVADDSSALEAGFLDHTSTTKKTQASQELEEY
                     LDDEDDLMTYPLHDQGQGQGHTNPAASMPQEPLPALSMPRSSWGSRGIGSAHHRHPDH
                     TGPHEANCERAITRQMSRSIEHKFMINMWHDHLHHILYGIGFFATIFTYYFSWYLMPF
                     QLFTAVCMFFIITDAPLVPNPKYKKYLHPTLCSVALFWLVELISSLIKHRHIKYFLSD
                     LRKYKVGTTYLNLFTNTHTSGDHKNWPGAGDVITSCMDVSIVALSMPMYTYRRDLKRH
                     FAALMPPILALCAVTLMLNPYICYKIGISPYNSIGFIGRSITLALGIPTIENFDGSVT
                     VMAVITVVSGIAGAIFGGPMLDFFRVPKDDFITRGLTLGCNCGAIATSYLLTVDRRAA
                     AISSLSFVVYGALMVILSSIGPIQDFIHNIVSL"
     gene            797232..797306
                     /locus_tag="KLMA_R106"
                     /db_xref="GeneID:34718621"
     tRNA            797232..797306
                     /locus_tag="KLMA_R106"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34718621"
     gene            complement(<797588..>799360)
                     /gene="GAP1"
                     /locus_tag="KLMA_10394"
                     /db_xref="GeneID:34714059"
     mRNA            complement(<797588..>799360)
                     /gene="GAP1"
                     /locus_tag="KLMA_10394"
                     /product="general amino-acid permease GAP1"
                     /transcript_id="XM_022820851.1"
                     /db_xref="GeneID:34714059"
     CDS             complement(797588..799360)
                     /gene="GAP1"
                     /locus_tag="KLMA_10394"
                     /codon_start=1
                     /product="general amino-acid permease GAP1"
                     /protein_id="XP_022673914.1"
                     /db_xref="GeneID:34714059"
                     /translation="MSQEKKFNYSIDQDTQLESGEFQEQNSFDNVSAARSPPSSGSKW
                     QDFKDSFKQAEVAELDPNLTDAEKMAILTANAPLKRSLKSRHLQMIAIGGAIGTGLFV
                     GSGKALATAGPAGILIGWGLTGTMIYCMVMAMGEMAVAYPIAGGFTTYASRFIDESFG
                     FALNTNYMLQWLVVLPLEIVAASITVEFWDTPDRYKSGFVALFYVVIVIINFFGVKGY
                     GEAEFLFSFIKVITVVGYIILGVILTCGGGPKGGYIGGRYWHNPGAFANGFKGVCSVF
                     VTAAFSFAGSELVGLAAAETANPRKSLPGAAKQVFWRITLFYILSLLMVGLLVPYDSK
                     RLIGASSVDASASPFVISIKNAGISGLPSVINVVILIAVLSVGNSAVFACSRTIAALA
                     AQGSLPKICGYIDRTGRPLVGIFITCFFGLLCFLAASKKEGDIFNWMLAISGLSSLFT
                     WAGIMLCHIRVRRALAAQGRSTNELPFVAPSGVWGSVYGFVLIILILIAQFWLALYPI
                     GASKPNASDFFQAYLSFVVAIVAYIGHKLWKRNWRLFIRAKDIDLDTGRRETDIEALK
                     VEIAEEKAWLASKPFYYRTFKFWC"
     gene            complement(<800772..>802886)
                     /locus_tag="KLMA_10395"
                     /db_xref="GeneID:34714060"
     mRNA            complement(<800772..>802886)
                     /locus_tag="KLMA_10395"
                     /product="matE super family"
                     /transcript_id="XM_022820862.1"
                     /db_xref="GeneID:34714060"
     CDS             complement(800772..802886)
                     /locus_tag="KLMA_10395"
                     /codon_start=1
                     /product="matE super family"
                     /protein_id="XP_022673915.1"
                     /db_xref="GeneID:34714060"
                     /translation="MATLLGKTLSQVHPKLRTNGIGIGNNHRRISLGFDLLNADKKNP
                     LLRKYLKKRRHRGLHLHPDEQGSYHTLDEDFGSSVRNSAHVLDEVLEDEEEELGEPLS
                     RTVSLPSRVSERSDETVQQSMDWLLEEHERRFSTTSSRNSEGSREEEEELEEQEQEQE
                     DAIAYDEFMHRVRLQLQQDFQGSSSGKGTVGKGARETRRGSLISVTSRGSVPQVFQDV
                     DSAAYQDLSHARVTVKSEIKVLASYSIPLIFTFLLEQMFPVVCSLTVGHLGKTELAAV
                     SLASMTTNITYAVFEGIATSLDTLCPLAYGAGKYYSVGVHMQRCVAFSMVVFVPFGFV
                     WWFSEPILSCVMPNEPELIHLTSKFLRVSILGAPAYIVFESMKRFLQAQGIFDAGIYV
                     LMICAPLNIFMSYTLVWNSRIGMGFIGAPIAVVLNFWNMVILMVLYAVYVDGFKCWGG
                     FNKKCLTHWKALAELAIPGIIMLEAEDLSYEILTLFSSYFGTTYLAAQSAVSTTAALL
                     YMIPFSVGISTSTRIANFIGSRRPECAKLAAELGIGSSLFVGLLNCLIITVDKRSIAK
                     IYSSDEEVIELMCELLPLVGLVEIFDSLNAISGSCLRGQGMQYIGSIVNLVVYHFVAI
                     PLGIFLGWHENMKLFGLWIGIGVGMLTIGVVQSYFVLFPSWDKIMAQAEKRQDEDSDE
                     EAGEDEFDSTSDDDEEDMPLLA"
     gene            complement(<803037..>804098)
                     /gene="YNG2"
                     /locus_tag="KLMA_10396"
                     /db_xref="GeneID:34714061"
     mRNA            complement(<803037..>804098)
                     /gene="YNG2"
                     /locus_tag="KLMA_10396"
                     /product="chromatin modification-related protein YNG2"
                     /transcript_id="XM_022820873.1"
                     /db_xref="GeneID:34714061"
     CDS             complement(803037..804098)
                     /gene="YNG2"
                     /locus_tag="KLMA_10396"
                     /codon_start=1
                     /product="chromatin modification-related protein YNG2"
                     /protein_id="XP_022673916.1"
                     /db_xref="GeneID:34714061"
                     /translation="MKNLWKKKKGLAMSLGIGDEAGVSALYRGLEGSSSACARMSGMG
                     DRPQDPSSALEQATQDVANLKSEFSHIMEEMRNADSNLVEMKRKYLGQDSQLQKFVRQ
                     QGSGVENAKEGELSRKISEEMARCEALQEQKCVLANTALYLVAKHLRKISSNIESLEE
                     EGLLAPLEEELLEEEAAAAAPTAVGAVASSSGSGSTSNRNGRKRPASGSQTGSQTGPG
                     GAGGSGPGPGGPRKQREPKKERSRSHQRGGTASSRDATPHSQQSSGPLADPTLDGLGY
                     NEELFKMNQGEEDDKQLYCFCQSVSYGEMVACDGPHCKYEWFHYSCVNLTEPPKGQWY
                     CPDCRQEMAAQKVKKKRKQ"
     gene            <842041..>843528
                     /locus_tag="KLMA_10397"
                     /db_xref="GeneID:34714062"
     mRNA            <842041..>843528
                     /locus_tag="KLMA_10397"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820884.1"
                     /db_xref="GeneID:34714062"
     CDS             842041..843528
                     /locus_tag="KLMA_10397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673917.1"
                     /db_xref="GeneID:34714062"
                     /translation="MIHGLRSRFRVGIVNRVLSVQRYSSKSSTPNSSKPATSSEGAEG
                     NENLASNGKSNEWGEKKEKVETKEPKEGADIRTEEKKVKGRRSYVVPQVPSTDYVPRA
                     DLETEGLFAGYKPLFLGNSPLETSRNDVLLDGLFSSIRKLKNAQINSESNTVEIDVSD
                     MLDDLKKDNREYQKLHEKVPKIPWDASISGLVYNDQPFKGVPRSVVSKLKPFKLVKVE
                     KKQPHREEELGKKIKLRFHGPRIKDEPTMVDLTQEAKKSRQNTNPSDLLMDSQSLHAR
                     NRYEASKVDFAYKFNFIEEDQRMFKHKVSKLTRLFAKEFMKVREIRLASDFKDNHLPL
                     YIYIDYSGQSRAMLKRHLRRKMINYVSPLLMTLSHSYETKEQFEKFKGRVYSRIESIS
                     ALLLEYIPSIRFKDPDVDCVISPSPVKGFGRIHWLKPTKRHNVFWGKNISNDYVFSLN
                     YDVKVSRSGIRRMKYPVNLNTSSFDFAFSKWKCYDLIVDEPIESR"
     gene            complement(<843674..>845479)
                     /gene="RIM21"
                     /locus_tag="KLMA_10398"
                     /db_xref="GeneID:34714063"
     mRNA            complement(<843674..>845479)
                     /gene="RIM21"
                     /locus_tag="KLMA_10398"
                     /product="pH-response regulator protein palH/RIM21"
                     /transcript_id="XM_022820895.1"
                     /db_xref="GeneID:34714063"
     CDS             complement(843674..845479)
                     /gene="RIM21"
                     /locus_tag="KLMA_10398"
                     /codon_start=1
                     /product="pH-response regulator protein palH/RIM21"
                     /protein_id="XP_022673918.1"
                     /db_xref="GeneID:34714063"
                     /translation="MAVRSRWRFQAPSRTYTSCEGTWLDDGVIVWSKLPGVFEHVKSA
                     FFKSRCFDSSPVYSSFVELQDGCPFLPLIDYDWHRYITEDSYKGPFKYSIYAIVYSVT
                     VNFIITVFLTVIVFINIPTKPSRKASYILKLGALLASMNLWIFVARVSKKTADTYTRY
                     GYVSSNAFLNLLWDDKAFAIIDLVVVFLLQISQLQIVMRFFDRMLERRLVFYFGLFLI
                     LLTQLLWVIPTFSPTNENGMDSDIDILPPFVYLFRITLATCYASVVCFHISVKRHVCF
                     RGRMIFLTVLTIATVLLHPAFFIIDVSNVWIDDLSEIFNTTCYLASTVIVLEWTNRTH
                     TMERKIQASSILGRPIYEDEEQNFHFAIYALRMQNAMNSYKIHGNNGENHSVNDEYES
                     INNYNNSNYDDNDHYDDDGGDDGESGSYGGNNGDSIMGNRVEHHDNIERTAHLQDAKG
                     METVINNNVLSNLSSSSRRSSVSAPTRYDIPIIHSQQGEANITQFKRPETFWNKCHHV
                     LDSIIYYADNIMVNGLAGPKTFDSSNDSSDRMYKVERVRKTIGLDEPENVYLYRKVNV
                     SSGSESVDTELQAQDYSQVGPSNPMPSSSSSYPHN"
     gene            <846109..>847938
                     /gene="MSB3"
                     /locus_tag="KLMA_10399"
                     /db_xref="GeneID:34714064"
     mRNA            <846109..>847938
                     /gene="MSB3"
                     /locus_tag="KLMA_10399"
                     /product="GTPase-activating protein GYP3"
                     /transcript_id="XM_022820906.1"
                     /db_xref="GeneID:34714064"
     CDS             846109..847938
                     /gene="MSB3"
                     /locus_tag="KLMA_10399"
                     /codon_start=1
                     /product="GTPase-activating protein GYP3"
                     /protein_id="XP_022673919.1"
                     /db_xref="GeneID:34714064"
                     /translation="MDHQESQRSNSFQVRGKGMIFSPSVPDLSQRFKMMNTSEGSIGS
                     ESLRLPKNVDQNASSTSNLLGNKRPNSTILRENSGGLSVINLYCEQDGEEGGEDGENS
                     QCQMNRSDIEFEGEGLHEDSLSSDAMHTSEQLPTPNPELHGEGEGGEVDEAPGVQVTI
                     RNSMTLIEDVKSSHLDRYGFMKQTQYISEQEYNAWWSEYSKYCIRRKRKWKDLLVKSG
                     LPVDNDYPSRFPSRSEKLKRYVRKGIPAEWRGNAWWYFARGQELLNKHIGVYDKLLTK
                     INDPNFMSKDAEIIERDLHRTFPDNVHFQKPKGSDEDPVIIGSLRRVLKAFSIYNSKI
                     GYCQSMNFLAGLLLLFMDEERAFWMLVIMTSKYLPGVHSINLEGVNINQGVLLLCVKE
                     YLPQFWHRIYSDKDKRGDQGKISDKNEFLYKLPPVTLCTASWFMSCFVGAVPIETTLR
                     IWDSLFYEGSHILFKISLAILELSEHSLPKSHHHFHNRHQDDEDMELFQAIQTFPKHL
                     INPNELIDKAIFKRRLKFNALDQEEIERCKKYVISQRAKYKNFQEVMKNENGVPNKRD
                     PKLDQELIDETFSSEGYGFKRGLNGVHWNNNIKERVRRLSRKK"
     gene            complement(<847998..>848645)
                     /gene="MDY2"
                     /locus_tag="KLMA_10400"
                     /db_xref="GeneID:34714065"
     mRNA            complement(<847998..>848645)
                     /gene="MDY2"
                     /locus_tag="KLMA_10400"
                     /product="ubiquitin-like protein MDY2"
                     /transcript_id="XM_022820918.1"
                     /db_xref="GeneID:34714065"
     CDS             complement(847998..848645)
                     /gene="MDY2"
                     /locus_tag="KLMA_10400"
                     /codon_start=1
                     /product="ubiquitin-like protein MDY2"
                     /protein_id="XP_022673920.1"
                     /db_xref="GeneID:34714065"
                     /translation="MSETDFITKFLTLAALNEPVLPSNYRKPLQQVNNLGVALTPLKY
                     KYDPSKSRKKAVPQNVEVSIKSIKAPRFSHVKSFEPTATFGQVKEFLVETEPEIVGAS
                     QIKLLLKGKVLHDTQLVSDLSKDKLALIAMVSKAEKPVETPAATAAAAAPEPAAADPE
                     PMDIDEADPQLNLPTIDSIALPWDKIRDLLETSLGDAEVTKIAVERLQRGWELAK"
     gene            <848815..>849609
                     /gene="ERF4"
                     /locus_tag="KLMA_10401"
                     /db_xref="GeneID:34714066"
     mRNA            <848815..>849609
                     /gene="ERF4"
                     /locus_tag="KLMA_10401"
                     /product="ras modification protein ERF4"
                     /transcript_id="XM_022820929.1"
                     /db_xref="GeneID:34714066"
     CDS             848815..849609
                     /gene="ERF4"
                     /locus_tag="KLMA_10401"
                     /codon_start=1
                     /product="ras modification protein ERF4"
                     /protein_id="XP_022673921.1"
                     /db_xref="GeneID:34714066"
                     /translation="MVKGKKNNRTKALIKVILLSGTRQMVSLILNDTADSSDLSKAAI
                     TVEDSSVAQQPKFFNYHEYVVTNYRALEEQEAREHGPEYPICVTHFPNIYVPESSEEF
                     KTTRVVRIPRRFESSTEFPSFSTDLPGFEPAALPDPHNRHFVPVGEYQGQLFGDSSVS
                     PLANYVSQEEWASIISDINGLLAAAYNPVQFRNFANVVLDYFTLNFWSIVAPYVLKHP
                     LQKLEDYVAELNHSDICKSKGIKIVSPRENSYLSVCIKRKKLQLQY"
     gene            <849864..>852185
                     /gene="TGL4"
                     /locus_tag="KLMA_10402"
                     /db_xref="GeneID:34714067"
     mRNA            <849864..>852185
                     /gene="TGL4"
                     /locus_tag="KLMA_10402"
                     /product="lipase 5"
                     /transcript_id="XM_022820940.1"
                     /db_xref="GeneID:34714067"
     CDS             849864..852185
                     /gene="TGL4"
                     /locus_tag="KLMA_10402"
                     /codon_start=1
                     /product="lipase 5"
                     /protein_id="XP_022673922.1"
                     /db_xref="GeneID:34714067"
                     /translation="MLTMQYNGYTSVTATKDDPITRYFFQKYYEKVNEGKPKADESKQ
                     EPNVFQTTFNKLCKLLRGSDAKQEEIARLMEQKQNAMSYQEWLAAATRLDDITDAEQW
                     KSTRESVLYEYSLVESSTKAMREARLSQDWAHLLYLIRTTWVRNRGGMGNVNLYRHSY
                     VGTKHIIEDYVEESSRSLQELVHNSDLDDTYLLGMLTQTRKNIGRTALVLSGGGTFGL
                     FHIGILVTLFEQDLLPRVISGSSAGAIVAAILCSRHKHEIRSLVDDILVKDFNIFKDD
                     WEKSEGENLLIKISRFFKNGTWFDNKNLVNTMINFLGNLTFREAYNRTGKILNVTVSP
                     ASVHEQPRLLNNLTAPNVLIWSAVCASCSLPGIFPSSPLYEKDPKTGEKKKWNSSSVK
                     FVDGSVDNDLPIAKLSEMFNVDHIIACQVNIHVFPFLKLSVSCVGGEIEDEFSARFKM
                     ALGKVYRYMASEVIHALEIATEIGVGTNVLTKLRSVLSQQYSGDITILPELSSLLRFN
                     QLLSNPTQEFLLREATNGARACWPKLSIIKNHCGQEFELDKMINYLKGKIISNKDFKG
                     NPFQITGQEFPLINSPVLTSNEKKAIHIFDDVLLNADNSEQFMVVPDASGSRRLEDYH
                     NSPRSVSGHKSRMHDRRKSESNSSLTKRGKRHNSISVPYSSSNSPLSERIYAPVMPFR
                     PPFDRKQSIGELQLKKTISVPSKSSSFTKIDSESSPISLTPIVDKGTSGQTDLVLYSG
                     YQSNPSSPLRTKKLKNRKKSSTKQTPKRNSETA"
     gene            complement(<852304..>854412)
                     /gene="DIA2"
                     /locus_tag="KLMA_10403"
                     /db_xref="GeneID:34714068"
     mRNA            complement(<852304..>854412)
                     /gene="DIA2"
                     /locus_tag="KLMA_10403"
                     /product="protein DIA2"
                     /transcript_id="XM_022820951.1"
                     /db_xref="GeneID:34714068"
     CDS             complement(852304..854412)
                     /gene="DIA2"
                     /locus_tag="KLMA_10403"
                     /codon_start=1
                     /product="protein DIA2"
                     /protein_id="XP_022673923.1"
                     /db_xref="GeneID:34714068"
                     /translation="MEGTNEAANIQADGLLLRTYDLGVKCMQCKDYKKALSLFSKAMK
                     LSRSYSMDLIERLRVEAGLPRRSAHDESKAYHPLYNKLLDSRISCLMKVGDYKRAVRE
                     SEYFCKIEPCSTRAMLRLGKSYELANNWDKARATYKKGQELVDRLRSQGTAVSPLHEK
                     LFNDRYLILLRSKSMENADPSVRQEKRVLIEQKTVGLDVELDEDFSVSKKVKTITKDP
                     IDTLPVELVISIMTHLDTKDITTCMRVSKLWYNKLSNTPMIIDAISLNKTSCSKVNSM
                     VKFIKSKNCVSSTIASLNYSVMVSNEELKCSQLLFHNLAKYVEKMVLQFSHTDIAKIL
                     RLLVGKRVLTEQLKEFSIFGSYDPLSLRDNDGEFLQNVPALQKLEVLVGANTAKGGTT
                     SMNGIQQRQLSYDLTPLSHSLQSIKLLYKDNRFTEPPPFACILRPAIHTFPKVQKLVI
                     ANLNFGSIQSRDWVKNFPNVTELWLERNTGASLMDFIGLLKNGKVFKQLTHLTYRESP
                     SESTRSYNVELYSDHEMDTVIENLHKLRTLDLMNSSIGRSVLYRLLNELPHIKTLNIG
                     NLTEISDELYPRTDTETTVFLFLRHMQNLKVLSVPNMSFHHTRCFRQLALVLPEIESL
                     NRLDLSFNPSMQGYQLYDIARELSNSQVKLQCLIVDGCQQISPNTVKDIEQRGYVESI
                     QCSFNKPQWEKFGVNSFWYR"
     gene            <854732..>855634
                     /gene="ATX2"
                     /locus_tag="KLMA_10404"
                     /db_xref="GeneID:34714069"
     mRNA            <854732..>855634
                     /gene="ATX2"
                     /locus_tag="KLMA_10404"
                     /product="zinc/iron permease"
                     /transcript_id="XM_022820962.1"
                     /db_xref="GeneID:34714069"
     CDS             854732..855634
                     /gene="ATX2"
                     /locus_tag="KLMA_10404"
                     /codon_start=1
                     /product="zinc/iron permease"
                     /protein_id="XP_022673924.1"
                     /db_xref="GeneID:34714069"
                     /translation="MRLLIETLLSATILFFGTLGTGFIPIVYMNKLIEKGNGEMKYLK
                     YISDFGIGMLLGTSCLLVIPEGVERFAESGSGRGFGISLLLGFLILYGFDRFLHALQT
                     GSIALSWWDAAAEPVVIESRRDFFNLTKTLPIILSNNIVFALVIHGFSDGLVLGVSQS
                     YDSLKVVMLIAIVIHKIPATLSLTGLMISKQRLPKPTVIVNLTAFSLSTPIGLIFVMC
                     LKFISNDILEKFSDGLLVASGSSLLYASLLSLNASGDDHVPYEALEGDESGPEREKES
                     LPDFKLLLLGVVVPLVISFFVPEG"
     gene            complement(<855706..>856479)
                     /locus_tag="KLMA_10405"
                     /db_xref="GeneID:34714070"
     mRNA            complement(<855706..>856479)
                     /locus_tag="KLMA_10405"
                     /product="bud site selection protein 21"
                     /transcript_id="XM_022820973.1"
                     /db_xref="GeneID:34714070"
     CDS             complement(855706..856479)
                     /locus_tag="KLMA_10405"
                     /codon_start=1
                     /product="bud site selection protein 21"
                     /protein_id="XP_022673925.1"
                     /db_xref="GeneID:34714070"
                     /translation="MGLKKVFESGAAVVAKRHLKFDDDAEDSFHTADEGNSTLEAINV
                     AKKQPVDSDSDSDSDSESDAPEEEGLSSGKDVLEEKIKAQEEAKRAQEEAAKERRRKN
                     ERIFKQQQLEKKKKLELEEAKQRSDVQNSGVAVRTDDMEDPEELPQEFFDELETNEED
                     PEESDKAQGLSVKPKHINFSKQDLEAAREEEQLVREEIRKQKRRTLRDLRKTQVQKGP
                     VTVNLLSSMNVSRSLAPKRETSILKSKDKWLKRRSLKRK"
     gene            <858358..>859275
                     /gene="TVP38"
                     /locus_tag="KLMA_10406"
                     /db_xref="GeneID:34714071"
     mRNA            <858358..>859275
                     /gene="TVP38"
                     /locus_tag="KLMA_10406"
                     /product="Golgi apparatus membrane protein TVP38"
                     /transcript_id="XM_022820984.1"
                     /db_xref="GeneID:34714071"
     CDS             858358..859275
                     /gene="TVP38"
                     /locus_tag="KLMA_10406"
                     /codon_start=1
                     /product="Golgi apparatus membrane protein TVP38"
                     /protein_id="XP_022673926.1"
                     /db_xref="GeneID:34714071"
                     /translation="MADRYEARISSAGGLRTADTDFLDSNDNFDDLDDDFLDIYNLSW
                     KQRIIQQTKRSIRSIREKYDELSAGKKLLVVFLCVLEAILLFIVVVKREAIMHWLVEV
                     SNDLKEKWYTAPLLMLLIILVSFPPVVGYTFLSLSTGLIYGLSVKGWFILAFATVVGS
                     VAAFTVFKKVLRSQAEKLIRMNSKLEAVSSVLQDNDSYYILALIRLCPFPYSFTNGAL
                     AGIYGISIRNFAIANVVTTPKALMYLFIGDRLKSMGEANSGAARLLNFISIVLACVFL
                     VLTTWLLYYRFKKRYLELQSEQRGSFDIF"
     gene            complement(<859419..>860138)
                     /gene="RTS2"
                     /locus_tag="KLMA_10407"
                     /db_xref="GeneID:34714072"
     mRNA            complement(<859419..>860138)
                     /gene="RTS2"
                     /locus_tag="KLMA_10407"
                     /product="zinc finger protein RTS2"
                     /transcript_id="XM_022820995.1"
                     /db_xref="GeneID:34714072"
     CDS             complement(859419..860138)
                     /gene="RTS2"
                     /locus_tag="KLMA_10407"
                     /codon_start=1
                     /product="zinc finger protein RTS2"
                     /protein_id="XP_022673927.1"
                     /db_xref="GeneID:34714072"
                     /translation="MAAGDIGSASFLNKQLKMRGLQKLRFYCQICQKQCRDENGYKSH
                     CKSPSHLKRLSNITHEDIEQYTIQFEKDFLRLLRLMHGEKKVEANKFYNEFIQDKDHI
                     HMNATKFTSLTRFIQHLSQKGSIRVHGIDELTSDSDPGRFMISYIDSSSENVIRKKEI
                     EALKQGERSEQEIKMKLLKAQIEKMKKEEEVQSTSVSDTDNATEPKVDSPPTAPLKLN
                     LSANKVIKKKPKKKLGNVFKK"
     gene            <860393..>861433
                     /gene="OMA1"
                     /locus_tag="KLMA_10408"
                     /db_xref="GeneID:34714073"
     mRNA            <860393..>861433
                     /gene="OMA1"
                     /locus_tag="KLMA_10408"
                     /product="mitochondrial metalloendopeptidase OMA1"
                     /transcript_id="XM_022821006.1"
                     /db_xref="GeneID:34714073"
     CDS             860393..861433
                     /gene="OMA1"
                     /locus_tag="KLMA_10408"
                     /codon_start=1
                     /product="mitochondrial metalloendopeptidase OMA1"
                     /protein_id="XP_022673928.1"
                     /db_xref="GeneID:34714073"
                     /translation="MFRRVFNLGLRSQARFFNTPGTRVTYKRFDGKTSSSFTELLFDK
                     TSRKYLAIVFGTGGLFYLTHLEEAPVTGRTRFIWFPRSLELKVGEYTYNSVIEQTRGK
                     ILPESHPLTRKVSRIFYRIVEAAANDPAVDKTLLKDVNWKIHIVNDPSMPPNAFVLPG
                     GKVFVFSNILPICKNEDGLATVLSHEFSHQLARHTGENLSKAPVYAVLGALLYTITGS
                     EGINRILVDSFMRMPASREMETEADYIGLMVMSRACFHPEEAVKVWQRMAAVEEKQRR
                     GGLVDLEFLSTHPATKKRIDNMNKWLPKSQELYDQSNCGTFGGFYGAFQDAFGHPTTN
                     GISEPKITIWGI"
     gene            complement(<861474..>864707)
                     /gene="PRP16"
                     /locus_tag="KLMA_10409"
                     /db_xref="GeneID:34714074"
     mRNA            complement(<861474..>864707)
                     /gene="PRP16"
                     /locus_tag="KLMA_10409"
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase PRP16"
                     /transcript_id="XM_022821017.1"
                     /db_xref="GeneID:34714074"
     CDS             complement(861474..864707)
                     /gene="PRP16"
                     /locus_tag="KLMA_10409"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase PRP16"
                     /protein_id="XP_022673929.1"
                     /db_xref="GeneID:34714074"
                     /translation="MDSELQRWIQENTSSNVTEKFVATLKQIARLHQDINKFIGAAKA
                     LGKFKNKDDFLKELFTKLREEQNETKGSATTAAPALAAAPTALPEPRIKRKKFAVKFS
                     KPDDDYGEKDEEDDEEEELGISIKPKFKKRVFPGKVKAGGSTQAVVKPDPETERETSL
                     DVNDTNNSDLEDIKDDQDFLSQDRNWYDNNDSFENVIQTGIDDAVAGDLSREDPHDHD
                     DGDADMIEPEIQLRSLTLKERKSLIPPFLLDFHDQYGEHAIIGAMDASTSASNKNIVN
                     PIRNPESDFSINSRKGSKLVAMRRLQKDRKTKSANAAKLQGSALGSLLGVEDGTTDTD
                     EKPTSSVNPQIDSSEKEQSFEQIQAIRRTLPAFKVRDDLLRFIRDNQVTVVIGETGSG
                     KTTQLAQFLYEDGFSANGSMIGCTQPRRVAAVSVADRVAKEMNTPLGEKVGYSIRFED
                     QTSNLTKIKFMTDGILLREAMIDPLLEKYSCIIMDEAHERSLNTDVLLGIFKTLLARR
                     RDLKLIVTSATMNADKFSQFFGNAPQFHIPGKTFPVEINYTNHPVSDYVEAAVHQALD
                     IHLSTPLSNGDILIFMTGQEDIEATCDTIIERLTEIYTKKYGAEFESHMNDVRVLPIY
                     SSLPADVQNRIFQRQQENTRKIVVATNIAETSLTVDGIKYVIDCGYSKLKVYNPKIGL
                     DSLRITPISLANANQRSGRAGRTGPGVAYRLYTHDSAIEDMYPQAIPEIQRTNLSNTL
                     LQLKSLNISDVSKFPFIDAPPSQNLMTSLYDLWTLGALDNFGNLTKLGRLMSSFPLQP
                     FLSKILICSSGYGCTNEMLTIVSMLSVPSVFYRPKEREEESDQERSRFFVPESDHLTL
                     LNVYSQWKANRWSAHWCNSHFIQYKSLQRARFIREQLLYVIKKQGLPISSSGADWSPI
                     RKCLCAGYINQTAKLSGLGKYIHLKTGMELRIHPTSALFGVGDLPPYVVYHELLMTTR
                     EYINVVTAVDPLWVMEISGIFYHIRRRKEKADVSNSNPPDGKDSIDTQIEKLQENAQK
                     AIKQLQQDKTTFESQRNSQKLILESDDSFEEQEQPSVRIGIKRRKPL"
     gene            <865165..>865758
                     /gene="MRPL20"
                     /locus_tag="KLMA_10410"
                     /db_xref="GeneID:34714075"
     mRNA            <865165..>865758
                     /gene="MRPL20"
                     /locus_tag="KLMA_10410"
                     /product="54S ribosomal protein L20"
                     /transcript_id="XM_022821029.1"
                     /db_xref="GeneID:34714075"
     CDS             865165..865758
                     /gene="MRPL20"
                     /locus_tag="KLMA_10410"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="54S ribosomal protein L20"
                     /protein_id="XP_022673930.1"
                     /db_xref="GeneID:34714075"
                     /translation="MVRLFSTSARAAKDLSKIIDKSGKIPKIVGPATIYNPKSSASNY
                     KGYLKAKLPAGLYYDPAPSSIHGSIHSETIPKSFLPANDPRREIVDELTAKDAEISKV
                     APVLHNKGEKTYHLKPEDIEEIKRLRLEDPVKNSRKALAKRFKCSPLFISLVSEPPKE
                     RKEEMEQVLEMIKSQWHPLRAAARADRKKRKALWYRA"
     gene            complement(<865951..>866433)
                     /locus_tag="KLMA_10411"
                     /db_xref="GeneID:34714076"
     mRNA            complement(<865951..>866433)
                     /locus_tag="KLMA_10411"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821040.1"
                     /db_xref="GeneID:34714076"
     CDS             complement(865951..866433)
                     /locus_tag="KLMA_10411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673931.1"
                     /db_xref="GeneID:34714076"
                     /translation="MTVPENVLTTHKRTIDGCSLFNIIPRDIARAWEPQHKLWEGKLI
                     VEELTYLDGSSYSMVSRPSLYRFQFLSEKEVVGVDREEAGEGRLFCETQVINNLEELQ
                     TVLKRTEKWFQVAMLCEGQQRYQIALELRIQDTYQKQLFEDILLRIQDEYEFFDEMQY
                     "
     gene            <866834..>869717
                     /gene="HBS1"
                     /locus_tag="KLMA_10412"
                     /db_xref="GeneID:34714077"
     mRNA            join(<866834..867089,867454..>869717)
                     /gene="HBS1"
                     /locus_tag="KLMA_10412"
                     /product="eukaryotic peptide chain release factor
                     GTP-binding subunit"
                     /transcript_id="XM_022821051.1"
                     /db_xref="GeneID:34714077"
     CDS             join(866834..867089,867454..869717)
                     /gene="HBS1"
                     /locus_tag="KLMA_10412"
                     /codon_start=1
                     /product="eukaryotic peptide chain release factor
                     GTP-binding subunit"
                     /protein_id="XP_022673932.1"
                     /db_xref="GeneID:34714077"
                     /translation="MSKYYDEDDAIDYEEDIPDFQDEDEFDDYLNDEEYELLNQIFPT
                     AKSELEEYQGWDNLTVKKALFEHNFDLTSAMIELKRKFKKKEMLARKRAMQKQQQKSS
                     ATVPTSGQTPSLLDALKKNSSAKKLGGANGPAAKQSLSERLQSLKLSSKGSVSGHTVN
                     TNATNNTNSEVPHTATRTLASKLASLRKAKPEPKKDEESPVSQEPKKNGEPGKNQENV
                     DTLKRIDNTWTWKILKKLNDVASPNKTTNISKSPSLLVTNIIIQEERHENASLKRKHD
                     ELFTVYYPNTNNRSAKKQAISNFNKPSPDDVALTQQKAAFEVDRVKDNIAKLSLQEKK
                     DTQSKHSNNNNDNVGEKEEEEDDDYEDDDEYDRVNVEDVPIRTYKKATVPTKPKNPIN
                     IQSHLADKKPHLNFVVLGHVDAGKSTLMGRLLYDVGAVDSKLIRKLQKESEMAGKSSF
                     HLAWVMDQTAEERNRGVTVDICTSDFATSKGTFTIVDAPGHRDFVPNAIVGISQADVA
                     VLSVDCGTDAFESGFNLDGQTKEHALLARSLGIKHIIVAMNKMDTVGWYEGRFLDIKS
                     ELLVFFEEIGFESENISYVPCSGLTGEGIFKTPYPIGQTWYKGPNLVQELEITAAKYS
                     KINDEEDIKEPFIFNILDVTPTSKNTSAVISGKVEAGSIQPGETITIFPSEQSCVVDS
                     ILCGNDNKKVDIALRGDFVQLKLHGAFAEDIQSGDLASVAGYDIPSAQEFTCRLLTFK
                     IDRPLLPGTSLILFRGATEQPCRIKKLCYTVNKKNPTEVLKKKVRHLGSFQSAIVEIE
                     LVEKKRRIPMLTIKENKKLGRVVLRKEGKTIGAAVINSLDY"
     gene            complement(<869758..>870552)
                     /gene="UFE1"
                     /locus_tag="KLMA_10413"
                     /db_xref="GeneID:34714078"
     mRNA            complement(<869758..>870552)
                     /gene="UFE1"
                     /locus_tag="KLMA_10413"
                     /product="syntaxin UFE1"
                     /transcript_id="XM_022821062.1"
                     /db_xref="GeneID:34714078"
     CDS             complement(869758..870552)
                     /gene="UFE1"
                     /locus_tag="KLMA_10413"
                     /codon_start=1
                     /product="syntaxin UFE1"
                     /protein_id="XP_022673933.1"
                     /db_xref="GeneID:34714078"
                     /translation="MIVRQLTSKYESETEMSDQEKDDFDTESKLQLQQYFEKFKQLEG
                     YERQRQEMMKEKLKKWSSNVPFFSRSVDDLESFHQANNQFRDGLLQCLNMWLMQVSDR
                     LSTIQQTRLSRQRHLYAIDFNAQLHLPQEIHVSQSPVITTTQEEIKQYEETMSKLSQE
                     QLQILATEHEEILNMKNEELRKAEQLRKTAVDIASLQSELATHLQVQTQNINTLLDNQ
                     IEVEIEMQKGNKQLKQANKKGDKLANMVMWFAIICGLLLLFFDYIN"
     gene            <871212..>872120
                     /gene="CDC21"
                     /locus_tag="KLMA_10414"
                     /db_xref="GeneID:34714079"
     mRNA            <871212..>872120
                     /gene="CDC21"
                     /locus_tag="KLMA_10414"
                     /product="thymidylate synthase"
                     /transcript_id="XM_022821073.1"
                     /db_xref="GeneID:34714079"
     CDS             871212..872120
                     /gene="CDC21"
                     /locus_tag="KLMA_10414"
                     /codon_start=1
                     /product="thymidylate synthase"
                     /protein_id="XP_022673934.1"
                     /db_xref="GeneID:34714079"
                     /translation="MNLDSGNPEEQQYLDLCERIINEGEFRPDRTGTGTYSLFAPPQL
                     RFDLSDDKFPLLTTKKVFTKGIILELLWFISGCTDGKKLSDQGVKIWEGNGSREYLDS
                     LGLTDRREGDLGPVYGFQWRHFGAEYKTCDDDYSGQGVDQLSDVIHKLKNNPYDRRII
                     MSAWNPPDFPKMALPPCHVFSQFYVSFPKEEGKRPRLSCVLYQRSCDMGLGVPFNIAS
                     YALLTKMIAMVCDMDAGEFIHTLGDAHVYKDHVDALKTQIAREPRAFPKLKIKRDVKN
                     IDDFKYEDFEITDYNPHGKIQMKMSV"
     gene            complement(<872227..>874152)
                     /gene="SGO1"
                     /locus_tag="KLMA_10415"
                     /db_xref="GeneID:34714080"
     mRNA            complement(<872227..>874152)
                     /gene="SGO1"
                     /locus_tag="KLMA_10415"
                     /product="shugoshin"
                     /transcript_id="XM_022821084.1"
                     /db_xref="GeneID:34714080"
     CDS             complement(872227..874152)
                     /gene="SGO1"
                     /locus_tag="KLMA_10415"
                     /codon_start=1
                     /product="shugoshin"
                     /protein_id="XP_022673935.1"
                     /db_xref="GeneID:34714080"
                     /translation="MGGPLVYDDFQALLEQQKAIYLQQNSQLAKYNSGLMMKITDMET
                     KVSELIQENVQLRSRLSMSELRYREKVNKIFNMLEDGVISRFSEVSQLFDRVRRNQGL
                     EAGIHGHTALGLSPKSIMKRDSSRSPKSTKSVEFRGSEVESDVNVDNSEKPIFEDTIA
                     EDNHENSSNSVELNQDEVRPLAKKRRKSSRRESLFIPADFEFNNENLEMELNDIVNRE
                     NEIANSHNNNEDTERKDVEMTETAVPAVVEAEPEAEAEALPLSEAAEAAETAVELAAV
                     ASTTSTTPSTTQSATDNNADEDESYNFTASVIEYSIPEEASTHDHSHILMDLSKSKIE
                     VYNDKEEPSNGATGAEESTSFVQCAIPSQSKVKHSMKNPKTRLKGNQDDIMPQTEYDE
                     GFDKRERRTRGKAVNYKLPSLRAKMRRPTEKFVDATTVTDIHDLQVQRAKNQHQQREH
                     SSDIDEEKDRPISKSGSNEGFDPTNVMGGEKQVATRLEQKHDNNDNNNETNKSSTDVP
                     PSGPNEKKKSSGVVPLHEMKIPQNVGVKTALKEKPANIMKRNTKDTTIGPIKEINQAN
                     ERILKDVSPNKVLKKQPPDFDSKQQQVSDISGPDLTAFEIIDGISLKHVAKTHRVRAK
                     EDMSRKRKRIHANEPSI"
     gene            <874675..>875043
                     /gene="DAD2"
                     /locus_tag="KLMA_10416"
                     /db_xref="GeneID:34714081"
     mRNA            <874675..>875043
                     /gene="DAD2"
                     /locus_tag="KLMA_10416"
                     /product="DASH complex subunit DAD2"
                     /transcript_id="XM_022821095.1"
                     /db_xref="GeneID:34714081"
     CDS             874675..875043
                     /gene="DAD2"
                     /locus_tag="KLMA_10416"
                     /codon_start=1
                     /product="DASH complex subunit DAD2"
                     /protein_id="XP_022673936.1"
                     /db_xref="GeneID:34714081"
                     /translation="MALEDEMESKRRELNYLKHVSALTERLKSQLDELSVQVSQMNKN
                     ADIVKDVMANWDSVLRSISQASISLLQYTENDYETGKWANKEKESGDSTDIAAETDGV
                     QQGTPLPETLVRVKVTDDAE"
     gene            complement(<875099..>878452)
                     /gene="NUP133"
                     /locus_tag="KLMA_10417"
                     /db_xref="GeneID:34714082"
     mRNA            complement(<875099..>878452)
                     /gene="NUP133"
                     /locus_tag="KLMA_10417"
                     /product="nucleoporin NUP133"
                     /transcript_id="XM_022821106.1"
                     /db_xref="GeneID:34714082"
     CDS             complement(875099..878452)
                     /gene="NUP133"
                     /locus_tag="KLMA_10417"
                     /codon_start=1
                     /product="nucleoporin NUP133"
                     /protein_id="XP_022673937.1"
                     /db_xref="GeneID:34714082"
                     /translation="MTQLFQLRKELSVPAAEESVISVEESTIGSSGTNRQFSNEQVIT
                     ENGKYKVSRLAPSLGFLPQGEELGCSIDAKSGYALCCDCENVYVWPYASSETHPSFLR
                     IPLHQKEYETWSKPPLCCFTWPSVLERDMKANPGLFLVNVKSGEIQFYEDVDAVSQVA
                     SFITQSRYHTASMKLRDGEYVESLVNAEPAGVVLSTNYGRVELYTIRDSSGKPHVSLK
                     QTIIKCQVGIFLSMSKPKRVVSMKVGEISGKGERLVSILTQGGQFQVWNLSSIGNCYK
                     RININVLSEISQTVLEHFPLATSSLQLLDCHPLAGDKTAYLFLSCVSENHNTYYLLST
                     LIFDEDTNSFAIFSSYRLNTYTRPLVDDTFASSIHLPRLVVPSAYTSENLPITSVYTL
                     FADATVLTQTSSKLDSNYPFKRRWEDILQFNKDMRIAGYDCDTNGLYITDASTCTLKL
                     ETFEKYEKSDFQEVRFIKSHVDQFIYFGGNSSEALLDFNLPENLDLQIQEIETDIQMS
                     SDEIKYALSNHIPPVANNVTRHLKIRSELFERLLIFVAHNFLNQMSAQFKLDLISDFE
                     TIKCIEKLYTLLPEQPETIKKAWSTVLGEFNFTSDVDFVTDGISKIPQIIGALLKQLN
                     ASIETTRDPKLKIQIVKFINEIIYHSTLEECENNYRYGLFQMSADEMSKNIPWFTTNE
                     IIQTLNDTFFLIHHAVEDSSMKTDLMPNEEHENLLLLVKSLYYMIKQITMWISFNGIS
                     DSTYKKFFDDNHLLWNRVLRDINKSQDSILITDFYQDLEGLVETLETLPRITAFSLYN
                     EYFQKYGYIFAKALFTYYIKAGKWDALYETFGESNSDFLEQYFEEFPEYGKVKWIGEI
                     YNNKYNEATATLLTISTGTDSLGQDIKQRQAQLSIAKLSALAAESEEGSQVLNDIQTE
                     LDLIDGQILLSQEIQESSINPVFKDFQTYQTLFKYLSDAVKRRESLSVPHMIELFTLL
                     NKDTSYGFALSVLAIDRTLPTEVKKFCEHQIWRRCLLSGEDAIKKTLHVFFNQQFYNE
                     HIELPHLNTLTNEATIRDTYLDGLYHNLIDLPLLADDAKREVVLLKESCPDITTIQAL
                     IGQANEETGNQCVINYESNTIERTNLNSF"
     gene            <879086..>879994
                     /gene="RPF2"
                     /locus_tag="KLMA_10418"
                     /db_xref="GeneID:34714083"
     mRNA            <879086..>879994
                     /gene="RPF2"
                     /locus_tag="KLMA_10418"
                     /product="ribosome biogenesis protein RPF2"
                     /transcript_id="XM_022821117.1"
                     /db_xref="GeneID:34714083"
     CDS             879086..879994
                     /gene="RPF2"
                     /locus_tag="KLMA_10418"
                     /codon_start=1
                     /product="ribosome biogenesis protein RPF2"
                     /protein_id="XP_022673938.1"
                     /db_xref="GeneID:34714083"
                     /translation="MLHDAMVDLSALKKPYIKRFSKKNAIRPFEDYEPLEFLSEKNDS
                     SLIVLSSHSKKRRNNLTFVRTFGYKIYDMIELQIAENYKFLSDFRKQTFNVGLKPMFS
                     FQGAAFEQHPVYMHVKSLFLDFFRNETTNLQDVAGLQHVISISVQGDFQDGEPLPNVL
                     FRVYKLKTYKSEQGGKKLPRVELEEIGPRFDFKIGRIHTPSPEMVKEANKKPRQLEVK
                     VAKNVEIDSMGDKIARIHVGKQDLNQLQTRKMKGLKAKYDQVDSDMEEYLEEEEGAAL
                     DQDDTYGEEFVTATDIDAPPAKKQKK"
     gene            complement(<880210..>881187)
                     /gene="folD"
                     /locus_tag="KLMA_10419"
                     /db_xref="GeneID:34714084"
     mRNA            complement(<880210..>881187)
                     /gene="folD"
                     /locus_tag="KLMA_10419"
                     /product="methylenetetrahydrofolate dehydrogenase [NAD+]"
                     /transcript_id="XM_022821128.1"
                     /db_xref="GeneID:34714084"
     CDS             complement(880210..881187)
                     /gene="folD"
                     /locus_tag="KLMA_10419"
                     /codon_start=1
                     /product="methylenetetrahydrofolate dehydrogenase [NAD+]"
                     /protein_id="XP_022673939.1"
                     /db_xref="GeneID:34714084"
                     /translation="MSSGKPGRTILASSVSKTYVEEITEKVNSLRDVRPEGPLLVGFL
                     ANNDPAAEMYASWTQKTCESMGFRYELRKIEDKDFLEEAIIDANQDDAVDGIMIYFPV
                     FGNAQDQYLQQVVAREKDVEGLNHVYYQNMYHNIRYLDNEKQLKSILPCTPLAVVKIL
                     EYLKVYNNLLPEGNRLYGKKCVVVNRSEIVGRPLAALLANDGADVYSVDINNIQKFTR
                     GQGLKFTKHHVEDLGSYSDDLLRECCKDADVIITGVPGEKYKFPTEYIKEGAICINFS
                     SHKNFDDSVKSKASLYVPSTGKVTISMLLRNMLRLVENREKLSQILAQK"
     gene            <883964..>885664
                     /gene="RAD7"
                     /locus_tag="KLMA_10420"
                     /db_xref="GeneID:34714085"
     mRNA            <883964..>885664
                     /gene="RAD7"
                     /locus_tag="KLMA_10420"
                     /product="DNA repair protein RAD7"
                     /transcript_id="XM_022821141.1"
                     /db_xref="GeneID:34714085"
     CDS             883964..885664
                     /gene="RAD7"
                     /locus_tag="KLMA_10420"
                     /codon_start=1
                     /product="DNA repair protein RAD7"
                     /protein_id="XP_022673940.1"
                     /db_xref="GeneID:34714085"
                     /translation="MYRANNRRNNDGSGVRGPNSALTQFLKEQGISAENIRERWLETQ
                     KNKSEEAADISKDDSETESDEETPKRVTKKKVGKNLKEDDTSSSSDEDSDDSDYSPEE
                     RLKKIRGDTPLDSDEEESSSLPVSGRQKRAVSLLNGKKSSPQRAKAQLQQRKKRRKKA
                     ADLLDRRNSPILSLQDICIKIITKSIIDYNAQSMVEHIRDTLGGISVENLNKLARALT
                     KNRALNDDTLQLFLNTSLTTLSFYDCSKLSFEGYKRLAIFSPHLEHLSLQMCGQLNNE
                     SLLYIAEKLPKLKELCFDGPFLINDDTWVKFFELMKGRLSMFHVSNTHRFSDKALLAM
                     LKNCGSSLTSLGLATLDTVTNYALLPQYLDSPNFTTLTLEEPSRETDINDEVIISLLG
                     AIGKNLKKLSLNRCTGLTDSCIINGFLPFLSNSGESQLEVLELEELDQISTDGIVLLF
                     SSIKFPHLKECSLKRCFSLEDAALVELLLNAAPTLEKLNLNGLKSLTAQAFSFMNCPN
                     LKQLNLGFIHCINDEIVEQISNNNENLSIIEVYGDNQVTAKCSPPNRVTIIGRQSDSI
                     "
     gene            complement(<885733..>887592)
                     /gene="PRP39"
                     /locus_tag="KLMA_10421"
                     /db_xref="GeneID:34714086"
     mRNA            complement(<885733..>887592)
                     /gene="PRP39"
                     /locus_tag="KLMA_10421"
                     /product="pre-mRNA-processing factor 39"
                     /transcript_id="XM_022821152.1"
                     /db_xref="GeneID:34714086"
     CDS             complement(885733..887592)
                     /gene="PRP39"
                     /locus_tag="KLMA_10421"
                     /codon_start=1
                     /product="pre-mRNA-processing factor 39"
                     /protein_id="XP_022673941.1"
                     /db_xref="GeneID:34714086"
                     /translation="MFEGLDQAFLKSNDAWVQSYKLVDWADIATIDKLIVTTESLVQK
                     YNNPNEDVKRNIYQVFGELLDRYPLFYGYWKRFVAVKYQLDGLDASIATLEQSLDSFP
                     TSLDLWIDLLNVRLTHNQNDHELVRSQFEKCESLVGFHFLSHDIWDKHIAFETKLKDW
                     ENLYKIYRKLIKLPLHQYARYYSSFKEFLEYHPEFSNKDPNFDIDAVFVANQVIVNKL
                     WTYESKIKQPFFNIPELPESELQNWDSYLAFLLTDSSFEPDLIKCTFERCLIPCLKYE
                     PFWDAYITWMEKTSPFEAVFPLFKRATEALPAQNKSFKVKYIQFLEKHLDPNDNLSVK
                     YYMDALYAFQLKWPQDSSSIYKYLKFYKKRNFPWSSDDDDKKILEQQKGYAVFLDNII
                     KAYLSENTAQMETLGQSQQLMAMLNDTNLSILVVELIKIYWLVLKNIIQCRKYFTYFT
                     KLDQLKSSVTFWLTYYKFEKSQRNVARLTKFVDQLGSEIPLPTQAINYIVQDFQSFYL
                     MNADFAEYENSLSTNRFGYDPIIHGELKINNPTWKLNPKPSKDWFKSDEYKSNGHPGL
                     LVDKPQIKNTIIGSLSTKSSKGNKAAPLPAFRNLEKIHQKPRYEDYMSIDYLK"
     gene            <888001..>889869
                     /gene="BFA1"
                     /locus_tag="KLMA_10422"
                     /db_xref="GeneID:34714087"
     mRNA            <888001..>889869
                     /gene="BFA1"
                     /locus_tag="KLMA_10422"
                     /product="mitotic check point protein BFA1"
                     /transcript_id="XM_022821163.1"
                     /db_xref="GeneID:34714087"
     CDS             888001..889869
                     /gene="BFA1"
                     /locus_tag="KLMA_10422"
                     /codon_start=1
                     /product="mitotic check point protein BFA1"
                     /protein_id="XP_022673942.1"
                     /db_xref="GeneID:34714087"
                     /translation="MSIRPVVLDDVGETSFEDVESTFTYKNEDVEVPRLAPNSAVSTT
                     TTETTTFSNEKGYSSHTEPASDFDNDINYNSDFEEYQGGQDVPLSVDERLRENSEQDE
                     LEELQEQLEEKLSLNLRPGMQSQNRNSNSSNFPLRNLGAGGRPYAKDSVRQPRSMVDL
                     ATKRNENMRRIPNSRSYMNLRPSSRRTLLYKKSMPSMMRFDHQDALIENDGDDDDDDE
                     DDEPRLYVPRSRSSYKDMHLVTDNDEDDADFDNDFEGIDENFRFDTGNNDNMNNDFNE
                     GYPAFNAALRLSPTYYEIEHDDTLLTPQLHKKHKDYEVPLERYRENRNYYMSRSRSGN
                     VNIDPTKRRSTRAKTRLKTIRQEIDLNTPMKRGKMKYNPREKRWDGNEDILRNFENIE
                     NVDRKAFIIKTKRSRSPLKRSSSNQVLLPSSSSNNNNNIVSSNSNNNLNSNTNANSNS
                     QHGKVVGKMKFDEKNLRWVRVDGPEEDPFQGISDLPPVLSHSSPSKNVKFQTLNGSNP
                     LRSQSHLPFFRDENGNRYLSSDSTRFHSLTINHATTDPTYQISSKQLEKFYHEENKWS
                     RKVGGWFILGDKTTNNNDNINTNDTHGPSPDQSHTTPNDKSYMYEIRNMVMSSAQN"
     gene            complement(<892192..>892308)
                     /locus_tag="KLMA_10423"
                     /db_xref="GeneID:34714088"
     mRNA            complement(<892192..>892308)
                     /locus_tag="KLMA_10423"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821174.1"
                     /db_xref="GeneID:34714088"
     CDS             complement(892192..892308)
                     /locus_tag="KLMA_10423"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673943.1"
                     /db_xref="GeneID:34714088"
                     /translation="MDSSDTRDLDYKTRDWKYTQPLQKAAFQTPKKNSSQCV"
     gene            complement(<892556..>897110)
                     /locus_tag="KLMA_10838"
                     /db_xref="GeneID:34714486"
     mRNA            complement(join(<892556..896134,896292..>897110))
                     /locus_tag="KLMA_10838"
                     /product="transposon Ty2-LR1 Gag-Pol polyprotein"
                     /transcript_id="XM_022821185.1"
                     /db_xref="GeneID:34714486"
     CDS             complement(join(892556..896134,896292..897110))
                     /locus_tag="KLMA_10838"
                     /codon_start=1
                     /product="transposon Ty2-LR1 Gag-Pol polyprotein"
                     /protein_id="XP_022678472.1"
                     /db_xref="GeneID:34714486"
                     /translation="MRKLNIGSDDGAPISSIQKDKPIDPYSDPQSEREVFGGLTYEEF
                     DREYRYQYNSSSDPDLKDTISGESDYISFKAFPNAKIRKIVYLPIIDTEDEFDDWVKC
                     LIVQIKISGLESYVPNKENNWSSVIMNNKRLNSYIMRMWKKCIPEECCPAWVEFTPYN
                     TDDSSNIIALELLTAYDRRNKNREIWREAINQTNKYMSSSDIGKLWKEGNNVYRNFFC
                     SKKHHDVEMILECLEQMMIENYANKCEKLKKELENNENINLPTALKLLHNESKKPVKL
                     ITLNKVQQQTMILMTFRQELIHVFLVQINQKCFYLENVRDIMLDSGTTVALVTNKNLL
                     YNIKDESNIKLLAAGQNEITVEGEGILKLKLNENISIEMKAMIVPSIKINIIPLASLY
                     ENNLHVDETCDNIKSLNGETITSIFKKDKLLWISGNHIQLPTEEHKVYQTTKSKKYKV
                     TLRELHRRLGHTNVRCVRETVKRGGIEDLSMSDVNWEGIDEFQCESCMKGKASRHPHI
                     KNSRDQYNEKYGPFEYIHTDIFGPIRLSEDSKSYRYMITFTDECTRYTWTIPLYLKTE
                     RQVRVAFLTIIKQTRTQYNKRIKVFHMDRGSEYTSEWIRQVLKSRGAKLIYTTVADSR
                     GNGVAERLNRTLLDRCRTLLEETGLSKEFWYHAIEHVVYDLNHTYKEKLKCSPIEKAG
                     IKPPKLKHIHAFGQLACYRINTNSKLDNRAKLGYLLHPSQESYGYIILDAETNKLVDT
                     TDFRPFYKNGPEGITEKEFYEQVGKWLHKAQTKISSNSQEEKNEPEFTTEPHNKRRKL
                     AVQESEKNKSSNNDSDTVRHEENLDTQDISSCGGGEIHSDPKDDSTKESDSDSTKLAS
                     AQDSQVSHNPNTESEQTTAEEFTAHKHPNDDFNPLQDAHKQLKRKITETVEDPEEGSE
                     KRFRVNYVKAVTDHDTIPYSEDATLSYSQAITGNKNKLLRDQFTQAFNKEINQMRKMH
                     VWDENNLIDISEVDRNKVINPMLVFSIKRDGTKKCRLVARGDQQDLSTYSKDRQQDTI
                     NNMALMTVLAVALDHNLIIKQLDISSAYLYADLKEEIYIRAPPHIKQKDKVLRLNKSL
                     YGLKQSGANWQKTIKDYLKGKCELEEMRFWPCVFTKGKFLEIIVCLFVDDIVIAGNNV
                     NTINQFITDLQNRFDTRIVNDGSPNERDAVRYDILGIDVEYKKGVSMKFGMLESLTKK
                     LPLLGVEFKKESRYNIVPGTPNRSLNQDLDIPCDKDYNAKVNWIQRAIGLSNYVAMKY
                     RFDIAYYTNILAQHQLYPSDAVLFETERLLQYLWTTRGKRLVWKRNEKETSELIGLTD
                     ASHAKGLKYKSQAGYFCIWNGKKLFARSTRTSYVCESSTQSETYAASECLAISRSINY
                     LLSTLTGKKPDQILLTDNTALINSIKGTKTIKPGSRHNDLKLYAMKDKYSEGELKVEH
                     IPTKQNEADLLTKPLKIKQFKVLTDKWIK"
     gene            897497..897568
                     /locus_tag="KLMA_R107"
                     /db_xref="GeneID:34718622"
     tRNA            897497..897568
                     /locus_tag="KLMA_R107"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:34718622"
     gene            complement(<897854..>899011)
                     /gene="GSF2"
                     /locus_tag="KLMA_10424"
                     /db_xref="GeneID:34714089"
     mRNA            complement(<897854..>899011)
                     /gene="GSF2"
                     /locus_tag="KLMA_10424"
                     /product="glucose-signaling factor 2"
                     /transcript_id="XM_022821196.1"
                     /db_xref="GeneID:34714089"
     CDS             complement(897854..899011)
                     /gene="GSF2"
                     /locus_tag="KLMA_10424"
                     /codon_start=1
                     /product="glucose-signaling factor 2"
                     /protein_id="XP_022673944.1"
                     /db_xref="GeneID:34714089"
                     /translation="MEVYVRMNEDVENDYAFTVKPDDTVSSRFAKIFDPKEGLTKYMV
                     LRPSIFYKNVPIGFRKSNHPGFLTENGCLLFDYDADNKKYLEDLKDSEKSVWEQLWPG
                     QLVLPKWEKDWNTIFTYLAVMLVWLYTDLPDCVSPTPGICLTNQLSKNFAILADKLGF
                     YELAGKLRDEIRVNQASVTTQWLFFVMHIFKLLVITAVFYSGLVNPLSFNPWRTFMVS
                     KTEISGNNVELKTTLKNIGWVGARRAIYDDYRDTYYKYRIEKAGGAVLAYKSGVMKIA
                     SKPGVKLSAGEGFQTDLENRFNKNTFETMKTAGKFILSEDYFLQLEHDLKENIKKCNG
                     DIAEINNEIRRFRKYGLFECGPELSELVALRRKVEETPAPEPLPEQEKKEQ"
     gene            <900279..>904160
                     /gene="RSE1"
                     /locus_tag="KLMA_10425"
                     /db_xref="GeneID:34714090"
     mRNA            <900279..>904160
                     /gene="RSE1"
                     /locus_tag="KLMA_10425"
                     /product="pre-mRNA-splicing factor RSE1"
                     /transcript_id="XM_022821207.1"
                     /db_xref="GeneID:34714090"
     CDS             900279..904160
                     /gene="RSE1"
                     /locus_tag="KLMA_10425"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor RSE1"
                     /protein_id="XP_022673945.1"
                     /db_xref="GeneID:34714090"
                     /translation="MTQDAGMLLWHTALQRHRNYVYSCTGDFTIDKDVNPVSAAGDST
                     RDDRSNVKYSGKRRKELQLCLATQNCVELYDVSEGSLQSLGKWPISATILSMSKLNLD
                     KCPHTILVLMTDSGNLTFWKFERDSLSGKVFPRTLANEPIWRSGIRRYAPQSYMACDK
                     QSRCVFLGGLERTKMCVLTDWQHGKLVVSSPVELQRQNRVTLAMASCDVGFDNPVTAA
                     IELENESSDCYISFYTMDLGLNSLMLRKEFVQEDKSANFVMPCPNLGQYKIRTRPTSS
                     SSSTYENEDEMINPFVLCGYDGYLTLRDLEGFYEVSVQLPVRKNVSSTNIINGVVHKL
                     KKEFFILVQSNCGDLYKVTIVPDAETLEPVMEIVYFDTIPPSESVHIFKTGTLFNVSE
                     FGTSHLMQFESLGEDLEKTTSYTPGRRIFIEPRTRLQNLSVLSSLRSLNPLTSLHVTK
                     STPLTLLAAANDSGSVSKLTSAIDFEELISTALPHAASRLWTVKVPVKETHSLVLLST
                     ETSTTVLKVHSGTIEDFSGPSCPFTLDKATLFVGTMGEKSIIQVTADQLLQITESKDN
                     STYSKKLEWLPPAGVNIVTAFCNETQLVVSLSNHEICYLEILDESLNELQKRLELDSL
                     VNCISLTTGVRSQYCVLGCDDHSLQILNLQPKHSDFFTVCAMQSLISKPHSLVFVRDS
                     SHLKIHIGMKNGVYASSKLNISDGTVFDVRTKLVGTKPVNVSLLSSIDINYIEEDDEA
                     EEEEEQEEESKSVSSSKRKKESSDFIPVVVLNSNVSWMTYENDNRIVLRPLKTKEAKV
                     LRTVASFITDDIGHNGCCSITNKGHLLIGKLTHFLSWDNWFNEERLALSSNDKGGKEE
                     DDGEDDENEDEDEDEDDTDRCEIFHYQNQKLVKDSIDDTLCYVVSKDSNNQTLLTVIR
                     NDQVLATSNQETSLKVLDEPFRAATSCNFGTTAKYLVLSTSSGKLVTIQVRVKNNVLQ
                     IEFVHETLLESSSLYAMVPFQDKLACCIQGNIVLLALGKKQLLKKSITQMPPHITQVT
                     AMDQWDGQHLAVGDIAESVTLFKYDVKNNVFEGVADDNMKKHVTSIKFLDESTVIGGD
                     RFGNCWVLRVDYNNISRVAANIKTCHYTLDTLCHMYMNDTPIQFEVVKNMDMSDRQSI
                     LWIGLQGTIGCFVPLVTRKEQQLFESFQFTYAELDFLDFQDRNKHEEVDLEEMEGALD
                     EREKTYHSNSNGNDEERIVEGVISRVGRDFLNYRSYYSPLKNIIDGETLEQFSKYTPS
                     EQKWIASKMKHADGQVETFNKFINEMRTNYL"
     gene            complement(<904151..>905077)
                     /gene="AIM32"
                     /locus_tag="KLMA_10426"
                     /db_xref="GeneID:34714091"
     mRNA            complement(<904151..>905077)
                     /gene="AIM32"
                     /locus_tag="KLMA_10426"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821218.1"
                     /db_xref="GeneID:34714091"
     CDS             complement(904151..905077)
                     /gene="AIM32"
                     /locus_tag="KLMA_10426"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673946.1"
                     /db_xref="GeneID:34714091"
                     /translation="MFVRQVLNRQYQFKTLDIALKNQITEQCQCFVSELNHRLPKESQ
                     LDLSLQIPKKVPYYHKHVLMLTPKAGDWKKWPSKIELAISFPFNLVGPLKSSLKNTNT
                     GSSILVNELDLPGFHSSEKEIKFLVIPDMKIYTVDPSQLPQFSTFLGEGNLASSSHKL
                     SFADYLQGSDKVNPESQEGENPGSDINLASQFKTQDFHHDLILVCGHYNRDARCGELA
                     PLLIDKLNSIRPTLKTGIVSHVGGHKFAGNIIYYQFNGVNNKNKNNTCDVEGLWFSKV
                     LPQNLETVLENLDQNIILQDFYRGHISYTGYK"
     gene            complement(<905884..>907278)
                     /gene="GAL80"
                     /locus_tag="KLMA_10427"
                     /db_xref="GeneID:34714092"
     mRNA            complement(<905884..>907278)
                     /gene="GAL80"
                     /locus_tag="KLMA_10427"
                     /product="galactose/lactose metabolism regulatory protein
                     GAL80"
                     /transcript_id="XM_022821229.1"
                     /db_xref="GeneID:34714092"
     CDS             complement(905884..907278)
                     /gene="GAL80"
                     /locus_tag="KLMA_10427"
                     /codon_start=1
                     /product="galactose/lactose metabolism regulatory protein
                     GAL80"
                     /protein_id="XP_022673947.1"
                     /db_xref="GeneID:34714092"
                     /translation="MNNNKRSKLSTVPSSRPIRVGFVGLSSGKGWASKTHFLAIQQLS
                     SQFQIVAMYNSTVESSLHTIQKLQLKHATAFDSLKSFAQCKDIDMIVVSVKVPEQHGI
                     VRSILEHSVNNLNLRYLYVEWALAANIEQAEELYALAQKRTNLQTVICLQGRKSPYIV
                     RAKELISEGCIGDINSIEVSGNGGWYGYERPMRSPEYLYNVEGGVNLVSNSFGHTIDV
                     LQYITGSYFRKINAMISNNIPTQWLLDENGKRTKETISKTCPDHLLFQGVLEQGQVPV
                     SCSFKGGTPAKKFTKNLVIDIHGTKGDLKIEGDAGFVEISNLVLYFCGVKNGNGNGNG
                     NGNGNGPTATATTTNSTSTPTRKVSPTPSGSPPDEEETMEVFHLRNYNSVVGNILRIY
                     ESIADFHFRGKPGSKPPRGPDDLLLSSRFERQGFRFEGFPTFKDAIILHRLIDAVFKS
                     DKESRTLDVSEITI"
     gene            complement(<908690..>909640)
                     /gene="SUR7"
                     /locus_tag="KLMA_10428"
                     /db_xref="GeneID:34714093"
     mRNA            complement(<908690..>909640)
                     /gene="SUR7"
                     /locus_tag="KLMA_10428"
                     /product="protein SUR7"
                     /transcript_id="XM_022821240.1"
                     /db_xref="GeneID:34714093"
     CDS             complement(908690..909640)
                     /gene="SUR7"
                     /locus_tag="KLMA_10428"
                     /codon_start=1
                     /product="protein SUR7"
                     /protein_id="XP_022673948.1"
                     /db_xref="GeneID:34714093"
                     /translation="MLGDDIEDRELGLGGPRRGQKSRMLVVKASKSLVRFISILFLAG
                     STLLLLFIVMSGSINHAPINKFYWLQADTSNISSAPALSRWTFWGVCGVSGGKNVNCT
                     DLGPAYPLSPVDNFHTKVGMPHDFVANRSTYYYLTRFSFVFLLLALVFVGLAMLFYLM
                     SWVSGAFQGTIFVLIGLGTLLNITGSACQTAAVAMAKNKFKDDHFKAKIGVKMMAFAW
                     TTVALDICLFFLLGSFFLKRVYNAHREFVELQKYKEQTAAVGYDQQGLDQGIGGMGPV
                     NTMGPIAGDTVEDPKPEPPHQSGIKFFKIRRTHKSDDESM"
     gene            complement(911079..911171)
                     /locus_tag="KLMA_R108"
                     /db_xref="GeneID:34718623"
     tRNA            complement(join(911079..911117,911135..911171))
                     /locus_tag="KLMA_R108"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:34718623"
     gene            911398..911469
                     /locus_tag="KLMA_R109"
                     /db_xref="GeneID:34718624"
     tRNA            911398..911469
                     /locus_tag="KLMA_R109"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:34718624"
     gene            <911727..>913790
                     /locus_tag="KLMA_10429"
                     /db_xref="GeneID:34714094"
     mRNA            <911727..>913790
                     /locus_tag="KLMA_10429"
                     /product="NADH dehydrogenase"
                     /transcript_id="XM_022821252.1"
                     /db_xref="GeneID:34714094"
     CDS             911727..913790
                     /locus_tag="KLMA_10429"
                     /codon_start=1
                     /product="NADH dehydrogenase"
                     /protein_id="XP_022673949.1"
                     /db_xref="GeneID:34714094"
                     /translation="MPCAPMLLCRPMAGQLARPMARPVFTRLLAKHSINKNPITRTFH
                     MNSRLLQTEQAPGSGTRTKSGTLSKVFKWTIFTTGMIASGLGALVVGFFIYDSTTYKS
                     CDVPEEIKVPKLALNPEIGGPENLPILRETLDAYDSELKELASYKPKLVILGSGWASV
                     GLLKNLTPGDYDVTVVSPQNYFLFTPLLPSAATGTLEVKSLMASIRKIVKDVDGHYLE
                     AYAEKIEFDHNLVKVSQFNTKTGVKECFYVPYDKLVIAVGSTSNTHGVEGLQYCSRLK
                     TAEDAIAIRKKIKTLLERACLPTTTDEERRNLLSFVVCGGGPTGVEFAAEVFDLLNED
                     LPNMYPKILRQQLSVHVIQSRSNILNTYDEKISEYATERFKKETIDVLTNSRVEKILP
                     DRVLFKQKDPETGEVQLKELPFGICLWSTGVSQNPLTKQVVQALSHAQRNKRAIETDS
                     HLRVIGAPTEDVYAIGDCSTVRTDLADNTTEYIRRYIVNRHLSLTRSNEIITDEDIKH
                     LSLSYNEIIDIAKQVARKHPQTREHLIHLEDDLPKYDTNHSGQLNFNQISALLREVET
                     KVTSLPATAQRAHQQGKYMGKKLSKIARASNNTEDGALIIHERGVDERIYRPFRYVHL
                     GSLAYIGNSAVFDLPGYSFVGGLIAMYLWRSIYFAQTVSWRTRVLLFMDWLKRGMFGR
                     DILSE"
     gene            <914571..>917351
                     /gene="PES4"
                     /locus_tag="KLMA_10430"
                     /db_xref="GeneID:34714095"
     mRNA            <914571..>917351
                     /gene="PES4"
                     /locus_tag="KLMA_10430"
                     /product="RNA recognition motif domain-containing protein"
                     /transcript_id="XM_022821263.1"
                     /db_xref="GeneID:34714095"
     CDS             914571..917351
                     /gene="PES4"
                     /locus_tag="KLMA_10430"
                     /codon_start=1
                     /product="RNA recognition motif domain-containing protein"
                     /protein_id="XP_022673950.1"
                     /db_xref="GeneID:34714095"
                     /translation="MSFEAESSLALNDIPLNIQRNNNSHYVNNKHVISKVQVGKVISE
                     KIGSKKVEENKSRQVDERDGGGSCNASTNANVNANANTNANIAIAIEKSYLDQNQEQG
                     QNQAKNQDQQQDHDQDHDQKLGQNENENENEAQTGSDSGASADAESQVHVQSQSQAQH
                     QKHTQNQHNSAVDSRGSSSTDTTSDGSDLVNLSNSKHATQQSNTMKSEKQTALFIGDL
                     PGNVTEDMLGNIFNKFKSFTSVKICVDSNTKKSLGYGYLNFGDQDDAEKAVDEYNYMP
                     IFGREIRMMPSLRNTYFRKNIGTNVFFSNLPLDNNRFTTRVFYDEFKKFGKILSCKLD
                     RRKNIGFIYFENDAAAKEAIRQYNGKQLFDTNIMCGVHFDRNVRKSPEFEQKIGRINN
                     LTVVKEKLEIEDENGSVIIVDACDSATIKEKKSGNGAGSPSSSTLETAGVAVGTTTTT
                     NNNSSVTEDGVTAVGSPVESEASGSKLPHPNAVFVKNLPINPNHDSLLNFFSKVGPVK
                     SVYTSDVSKFESSWAFITYKRIQDTKVAIEKLNGSKYMKRTIEVKKAERHHLEESQCH
                     NNIKPNNYKKTVYLTNLSVICNEEFLKFFCTQERIKTERIVIRYYDDKTDTYSGYVKC
                     NSRNDAQRLFDLMENKLLGDSEVKASWQQPKDLKLLENDALYQDGRKEKRSRNSRNSY
                     VYRAPAPNYRPPRHNGNMINNNINYNYSHGHGHGQNHNGNGNIRNNNHQMKPTANMSN
                     NNSNNNTNQHFFQSPQPYYHHPMHAQQLQLHQPQNQNQQQQQQQQQQQQLQQQPVPMP
                     VPYTNAMGQPMGQPMIGRPPVVISNMNGPKSMTREEQARKSYSYEAKKQLMNMLKKET
                     KRCIDFLQHPVATRDENISTIASYIIDVYYKPNYDTLAQLLLLKTGNNYYERVFQSQV
                     ELAIEKLGLQER"
     gene            complement(<917814..>919299)
                     /gene="LSB3"
                     /locus_tag="KLMA_10431"
                     /db_xref="GeneID:34714096"
     mRNA            complement(join(<917814..919011,919253..>919299))
                     /gene="LSB3"
                     /locus_tag="KLMA_10431"
                     /product="DUF500 super family"
                     /transcript_id="XM_022821274.1"
                     /db_xref="GeneID:34714096"
     CDS             complement(join(917814..919011,919253..919299))
                     /gene="LSB3"
                     /locus_tag="KLMA_10431"
                     /codon_start=1
                     /product="DUF500 super family"
                     /protein_id="XP_022673951.1"
                     /db_xref="GeneID:34714096"
                     /translation="MGINNPIPRSLKSETRKAAKVLASFVKPNQVLSANDVIPPHVLK
                     DAKGLAVITVLKAGFLFSGRAGSGVIVARLPDGGWSAPSAIALAGAGAGGMIGLELTD
                     FVFILNSADAVKSFSQFGSITLGGNVSVAAGPLGRNAEAAASASTAGVAAVFAYSKTK
                     GLFAGVSLEGSVILERREANRKFYGNNCTAKMILSGRVRPPPSVDPLFRVLESRAFNH
                     RAPVDDYDDDYYNDIPSSFDSDDIDSTRANTRSTRRRADSYRSTTSDDSADYRYDDED
                     VDRYSSRGARRTGPASNSRWEDEVYDLNDRFERTSINTRNSRGAPSRPRSEKPDFSSS
                     AYSRTSPRTPSSHDLAPDRSSGAPKAVALYTFKGEQPGDLPFRKGDVITIIKKSESQD
                     DWWTGRVNGKEGIFPANYVELV"
     gene            <920623..>921192
                     /gene="YSD83"
                     /locus_tag="KLMA_10432"
                     /db_xref="GeneID:34714097"
     mRNA            <920623..>921192
                     /gene="YSD83"
                     /locus_tag="KLMA_10432"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821285.1"
                     /db_xref="GeneID:34714097"
     CDS             920623..921192
                     /gene="YSD83"
                     /locus_tag="KLMA_10432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673952.1"
                     /db_xref="GeneID:34714097"
                     /translation="MNEHPEKQLRSILFMPNLSYYPSGTTLSSKLVTNEVQENVLNYY
                     GVLEKLLPHFAGNAFKKLQLIFYNPSLSKNLQLKHHSVEHLVSGLISTFYETMKIEHS
                     HQCDVYMCHIGILGIGGNASTFKYLSVKGSNITKSLCDPIYQLILSRDYIWLRLKRWF
                     CGSVLYCGKGSTLTSWLGSLCPLWLLDLF"
     gene            complement(<921366..>922754)
                     /gene="ARG4"
                     /locus_tag="KLMA_10433"
                     /db_xref="GeneID:34714098"
     mRNA            complement(<921366..>922754)
                     /gene="ARG4"
                     /locus_tag="KLMA_10433"
                     /product="argininosuccinate lyase"
                     /transcript_id="XM_022821296.1"
                     /db_xref="GeneID:34714098"
     CDS             complement(921366..922754)
                     /gene="ARG4"
                     /locus_tag="KLMA_10433"
                     /codon_start=1
                     /product="argininosuccinate lyase"
                     /protein_id="XP_022673953.1"
                     /db_xref="GeneID:34714098"
                     /translation="MAEQKQKLWGGRFTGETDPLMHLYNASLPYDYKMYKADLEGTKV
                     YTSGLEKIGLLNKEELAEIHRGLKQIEQEWADGSFVREADDEDIHTANERRLGEIIGR
                     GIAGKVHTGRSRNDQVATDMRIYCRDIINETILPALSSLIKVLIQRANEEIDVLMPGY
                     THLQRAQPIRWSHWISCYATYFTEDFKRLKQIVERLNSSPLGAGALAGHPYGIDREFL
                     AEGLGFQSVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDLIIYSTAEFGFIKLS
                     DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLAGFLMSIKSIPSTYNKDMQEDKEPL
                     FDCLTTVEHSVLIATGVISTLSINKEKMEGALTMDMLATDLADYLVRKGVPFRETHHI
                     SGQAVALAEKLNLSGIDKISLEQYKSIDARFDSDVFEVFNFEKSVERRDATGGTAKSA
                     VLKQLKNLEAQL"
     gene            complement(<923255..>924913)
                     /gene="DED81"
                     /locus_tag="KLMA_10434"
                     /db_xref="GeneID:34714099"
     mRNA            complement(<923255..>924913)
                     /gene="DED81"
                     /locus_tag="KLMA_10434"
                     /product="asparaginyl-tRNA synthetase"
                     /transcript_id="XM_022821307.1"
                     /db_xref="GeneID:34714099"
     CDS             complement(923255..924913)
                     /gene="DED81"
                     /locus_tag="KLMA_10434"
                     /note="cytoplasmic"
                     /codon_start=1
                     /product="asparaginyl-tRNA synthetase"
                     /protein_id="XP_022673954.1"
                     /db_xref="GeneID:34714099"
                     /translation="MSIYVNEFVGVDEAGVAGSEQQPFKTPAFALYVSGDDSKLLVFK
                     KGDEQESEGYFEISASGLKKAKKGAEGLKKKALKQKEQEEKKREQEAKNAAKKLEAMN
                     ISIEEDKSLPKAERCKINGSYNAIDKRVKVSGWVHRLRNNKSVVFIILRDGTGFLQAV
                     LTGDLARSYQIVNLTLETTISLYGTIKKVPEGKNAPGGVELFVDYYEIVGLAPSGEEA
                     FTNKVQENADPSILLDQRHLMLRGETLSAVMKVRAALMRSIRRVYDEENLTEVTPPCM
                     VQTQVEGGSTLFKLDYYGEEAYLTQSSQLYLETCLAALGDVYCIQESFRAEKSHTRRH
                     LSEYTHIEAELCFLDFDDLLSHIERVISKTVQYVLEDPVAGPLVKQLNPGFKAPQLPF
                     KRMEYKDAIEWLKEHGIKNEDDEEFKFGDDIAEAAERKMTDTIGVPILLTRFPLEIKS
                     FYMKRCADDPRVTESVDVLMPTVGEITGGSMRIEGTEELMAGFEREGIDPASYYWFID
                     QRKYGTCPHGGYGLGTERILAWLCDRFTVRDCSLYPRFSGRCKP"
     gene            <925253..>927286
                     /locus_tag="KLMA_10435"
                     /db_xref="GeneID:34714100"
     mRNA            <925253..>927286
                     /locus_tag="KLMA_10435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821318.1"
                     /db_xref="GeneID:34714100"
     CDS             925253..927286
                     /locus_tag="KLMA_10435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673955.1"
                     /db_xref="GeneID:34714100"
                     /translation="MSLEETFGKLAIDGGDGAIAVKSLVFKPKTPKGQTPVPVVVVAL
                     QTTGTPSGVIASVSGTKDPRLARDELFQSHFKIGNAKEFHLGHLAQAEGEFKLLLDDK
                     LVALEDDAILQLNEEKFVLKGGLVKDYLKSFEPVEVDFSQVIEAKPKEAAKPKSKSKE
                     KDASAAALEDAKLIGITVDKALDFSGWYQQILTKGEMLDYYDVSGCYILRPASYAIWE
                     QIQRWFDDKIKGLGVQNAYFPMFVSSRVLEKEKDHIEGFAPEVAWVTKAGSSELDEPI
                     AIRPTSETVMYPYYAKWVQSYRDLPIKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHT
                     AHLTKEEAEEEVMQILDFYAGVYEELLAVPVVKGRKTEKEKFAGGDFTTTCEGYIPQT
                     GRGIQGATSHHLGQNFSKMFNISVENPLGSEHPKIYAYQNSWGLSTRVIGVMVMIHSD
                     NKGLVIPPRVSQFQSVIVPVGITAKTSDEQRAKIHESAKDVESRLRKAGVRVFGDYND
                     NYTPGWKFAQYELKGIPLRIEMGPKDLEKQQVTCVRRNDGKKVVVSLDELEKRIPEVL
                     EELQQDLFNRAKELFDSHRVIVDEWKGFVPALNKKNVILAPWCGVEECEEDIKASSAK
                     KDDGEEFEVDDKSPSMGAKSLCIPFQQPPLKSGQKCVKCDREAKQYCMFGRSY"
     gene            complement(<927530..>928552)
                     /gene="HIS2"
                     /locus_tag="KLMA_10436"
                     /db_xref="GeneID:34714101"
     mRNA            complement(<927530..>928552)
                     /gene="HIS2"
                     /locus_tag="KLMA_10436"
                     /product="histidinol-phosphatase"
                     /transcript_id="XM_022821329.1"
                     /db_xref="GeneID:34714101"
     CDS             complement(927530..928552)
                     /gene="HIS2"
                     /locus_tag="KLMA_10436"
                     /codon_start=1
                     /product="histidinol-phosphatase"
                     /protein_id="XP_022673956.1"
                     /db_xref="GeneID:34714101"
                     /translation="MHSHHSHSGDYVAHGVDPLEDIITEVKRRQFHTWCLTEHMPRLQ
                     PSLLYPEEVRTADEPEKDLARLVTQFESFLDHAQRIKERESLNILIGMEIEGCNAAHL
                     EHAKALLSRKSGILQFMVGSVHHVHDIPIDFDQTMWNQAIAKTGNNIKQLLVDYFTLQ
                     RKMLESVKPLIVGHFDLIRLYMPGDLLVDKTSGKIISEKDEVVSSKVENVVTISSIDS
                     IMTLWPEVKDLIIGNLQYACSYGAALELNSSGLRKGLIDPYPHRDIVGLAKKVTPDLK
                     YVMSDDAHAVSQVGVCYDKLLNYMENVVKMDKVSYLAEMPNGQLEFKDISLEELKKAP
                     FWTTFR"
     gene            <928932..>930041
                     /gene="DAO1"
                     /locus_tag="KLMA_10437"
                     /db_xref="GeneID:34714102"
     mRNA            <928932..>930041
                     /gene="DAO1"
                     /locus_tag="KLMA_10437"
                     /product="D-amino-acid oxidase"
                     /transcript_id="XM_022821340.1"
                     /db_xref="GeneID:34714102"
     CDS             928932..930041
                     /gene="DAO1"
                     /locus_tag="KLMA_10437"
                     /codon_start=1
                     /product="D-amino-acid oxidase"
                     /protein_id="XP_022673957.1"
                     /db_xref="GeneID:34714102"
                     /translation="MSKVVVVGAGISGLSSAYSLLQLYGDKIKDLTILARDIPGTFTS
                     HDYTSPWAGANWHSFADSDDLEQIKRDRITYERLTELARTKPETGVKEYKLKLIKKRA
                     APEPWYIQERFVRDFKYLSDEELVYRNLDPSEYVGYEFTTFTITPSTYKFWMVSEIKR
                     LGGKIRQLAKIDGIESVPDIVGFLPDLIINATGVYAGQFLSTFEPSEVEKVFPVKGQI
                     VQIYEDLPFQLVIDDLPKDDNPLSYQFLNIFPRGDGGCIIGGMMKKNDWTNTVDEKLS
                     ERFVEICKRHTPELKSTTVYNSYAALRPGRKGGVRVGYSEYKLPNSNAKLHVVHNYGI
                     GGAGYQASHGLSLEVSALASKVLGQPKCRYGSSKL"
     gene            complement(930269..930341)
                     /locus_tag="KLMA_R110"
                     /db_xref="GeneID:34718625"
     tRNA            complement(930269..930341)
                     /locus_tag="KLMA_R110"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718625"
     gene            <931216..>932187
                     /locus_tag="KLMA_10438"
                     /db_xref="GeneID:34714103"
     mRNA            <931216..>932187
                     /locus_tag="KLMA_10438"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821351.1"
                     /db_xref="GeneID:34714103"
     CDS             931216..932187
                     /locus_tag="KLMA_10438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673958.1"
                     /db_xref="GeneID:34714103"
                     /translation="MDLPPIVDNIFKCAPQVAGTVYHYSVKFCWSIACKIAGNIWRIF
                     VEPLSRFINGVFFVPVRIILRNLFEFALLPVNMPLYILFGTNLSNLLLTFDTNAGLFA
                     LVMFSQYVISTFIFGVSLGVISGVLLSAFHKSMPIPNYYYEPSIRRSFGYIKDVIWKV
                     VFKLIGIELESPEISPEPNSFNVPVYEHPIVQTQQKLTDPEQVVSVKESSTFKDAQEY
                     PYTESSSSSSSNANSDLNIHATSISDLGASSQGIDLGNMTPMSMPDTNGEEDYDIDET
                     SEITRLWDSDNSYAADTARTEGVDDISQLVYRNRIKKAIDNIDLRNL"
     gene            complement(932491..932563)
                     /locus_tag="KLMA_R111"
                     /db_xref="GeneID:34718626"
     tRNA            complement(932491..932563)
                     /locus_tag="KLMA_R111"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:34718626"
     gene            <933078..>934703
                     /gene="PGS1"
                     /locus_tag="KLMA_10439"
                     /db_xref="GeneID:34714104"
     mRNA            <933078..>934703
                     /gene="PGS1"
                     /locus_tag="KLMA_10439"
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /transcript_id="XM_022821363.1"
                     /db_xref="GeneID:34714104"
     CDS             933078..934703
                     /gene="PGS1"
                     /locus_tag="KLMA_10439"
                     /codon_start=1
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /protein_id="XP_022673959.1"
                     /db_xref="GeneID:34714104"
                     /translation="MFRKIQSGSFKFNRIPVWSAVLKPKVDAGARFSMATVTKQSEND
                     NKQLGHLQLIGKDGSKNENDFINMVKQKLSFLNTKVYLRKGEIEILSNPSEFYSTLKD
                     KISGAKKRVFMASLYLGKSESELISCISDSLRKNGNLKVYFMVDGLRGTRETPNQCSA
                     SLLAQLEKEFGDRVDIRLYRTPEFTGLKTLIPKRFNEGLGLQHMKIYGFDDEVILSGA
                     NLSNDYFTNRQDRYYVFKNKYLSEYYFKVHELISKVSYRVRYSNNEQKFEMKWPESNI
                     AIEPMKNKHEFIKQCSGVFGTFLKGQPSMGNGHLINDFSQYPTIVYPVSQFTPLFHKH
                     NDLSTEKPGILSILSCISNPMNKWTFTAGYFNMLPEIKERLLASPSVDGKVITASPYA
                     NGFFKSSGISKHLPDAYLYLSKTFLKDVHNYGKDNHIKLREWRYGTVNQPNGWSYHAK
                     GLWISDHNNDSRPCLTIVGSSNYTRRAYSLDIETNAIVLTKDDELKTAMQAEVDNILK
                     NTTEVTLDVFKNDEDRKISPGVKLATKILGGRL"
     gene            complement(<934818..>935465)
                     /locus_tag="KLMA_10440"
                     /db_xref="GeneID:34714105"
     mRNA            complement(<934818..>935465)
                     /locus_tag="KLMA_10440"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821374.1"
                     /db_xref="GeneID:34714105"
     CDS             complement(934818..935465)
                     /locus_tag="KLMA_10440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673960.1"
                     /db_xref="GeneID:34714105"
                     /translation="MMLYVTLQYEFSPLIRSQLADRFPLFYPMDGDSVAISVPLLVGE
                     VIVLLVNYKALTQLFRYRGTKHTYQGFSALFTFLLILGAVFHVFTFACSTFYLPDKNM
                     GKFGVFYLEHLNYIWVNAQAFQCVKYVPQLSLNWMGMCTMGVSSKFVLISLLSSVIGI
                     LSHYIGFPDKSQFYLIPWNSYPLFVFMCQAISVILLLYQSHFIYANRSPYLPRGS"
     gene            <936303..>936851
                     /gene="RER1"
                     /locus_tag="KLMA_10441"
                     /db_xref="GeneID:34714106"
     mRNA            <936303..>936851
                     /gene="RER1"
                     /locus_tag="KLMA_10441"
                     /product="protein RER1"
                     /transcript_id="XM_022821385.1"
                     /db_xref="GeneID:34714106"
     CDS             936303..936851
                     /gene="RER1"
                     /locus_tag="KLMA_10441"
                     /codon_start=1
                     /product="protein RER1"
                     /protein_id="XP_022673961.1"
                     /db_xref="GeneID:34714106"
                     /translation="MDLNGDERSSNGVVGEAQRLKALYQYYLDQATPHVKYRWASLAG
                     LLVLFMFRIVFSQGWYVVCYSLGIYLLSQFLGFLTPKFDVSLQQNEQNEELEAGEMTD
                     EFRPFIRRLPEFKFWHNAIRATVLCFFLTFFSIFDIPVFWPILLIYFIVLFALTMRKQ
                     IKHMIKYKYVPLDIGKKKYTQK"
     gene            <937236..>938411
                     /gene="DOM34"
                     /locus_tag="KLMA_10442"
                     /db_xref="GeneID:34714107"
     mRNA            <937236..>938411
                     /gene="DOM34"
                     /locus_tag="KLMA_10442"
                     /product="protein DOM34"
                     /transcript_id="XM_022821396.1"
                     /db_xref="GeneID:34714107"
     CDS             937236..938411
                     /gene="DOM34"
                     /locus_tag="KLMA_10442"
                     /codon_start=1
                     /product="protein DOM34"
                     /protein_id="XP_022673962.1"
                     /db_xref="GeneID:34714107"
                     /translation="MKLINKVEGSGTNEGTILTLLPQDKEDLFTLYNIINTDDEIIFK
                     KKVTSKTEESGKKKTTQLEKLRIRVVSSEFEPQNEFLRYKGVTTEDDYSNANQDMPIG
                     KFFSFTIDFQYPFTLIKSDYNSYVSNLIKEACNIEGRSDMAAVVLQEGIAHICLMNSF
                     STVLKHKVEYSIPKKKRATDIMKFDDKVEKFYKATYESMLRHFDFESLKCIILCSPGF
                     YAKTLYDKILNYARETKNKSVLSNSNKFLVAHCSTGYLQGIDEVLKNPAYKHKLEDVK
                     NSKEVIIMDEFLDHLNKDDFKAWYGEQEITKAAELAAIDTLLISDSWMRSDDVKIRQK
                     SLNLVKEVEQSGGKAYIFSSLHNIGEELDRLTGIACILKYPIPDLDEDIDDVSDEDN"
     gene            complement(<939433..>940440)
                     /locus_tag="KLMA_10443"
                     /db_xref="GeneID:34714108"
     mRNA            complement(<939433..>940440)
                     /locus_tag="KLMA_10443"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821407.1"
                     /db_xref="GeneID:34714108"
     CDS             complement(939433..940440)
                     /locus_tag="KLMA_10443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673963.1"
                     /db_xref="GeneID:34714108"
                     /translation="MVIKSEKLIMNVPLEHQNEDICESGDEQKLIKRKRDRFKQLIGK
                     SNDRFALKIQRFKQKFHENSGHNKKVDAASQVVVNYGTSPNSLSNQNQLKLSVTEGKF
                     RSHILHRWFNSKSCPKSEIDEIVSNKNKPRVSKASVFSATLYDGTLIIESQNSSKNFK
                     EVNPIPWESVQRKQKVSATQSSSDLNKNAFVNLQYDKHPAEKSRLTMEGSLLTIDNTR
                     ECSSSYTVTLSSTFLNRLKQDCSKISSRRELLLGSEDEELSVDCSCVDRSLLTDSFCQ
                     TKENSIQMETSDNHQCSHLLKNNELAECSKSTSEELLSTRNENTRTVTRRIAMTRICD
                     L"
     gene            complement(<940780..>941526)
                     /gene="AML1"
                     /locus_tag="KLMA_10444"
                     /db_xref="GeneID:34714109"
     mRNA            complement(<940780..>941526)
                     /gene="AML1"
                     /locus_tag="KLMA_10444"
                     /product="N(6)-adenine-specific DNA methyltransferase-like
                     1"
                     /transcript_id="XM_022821418.1"
                     /db_xref="GeneID:34714109"
     CDS             complement(940780..941526)
                     /gene="AML1"
                     /locus_tag="KLMA_10444"
                     /codon_start=1
                     /product="N(6)-adenine-specific DNA methyltransferase-like
                     1"
                     /protein_id="XP_022673964.1"
                     /db_xref="GeneID:34714109"
                     /translation="MSDSESDNELQLSAHALAALQEFKSEEQKREEEFQRLLNKADED
                     FERKKREEGMRLFKEDWQLSQFWYDEATADLLADALLDGADEDTVIAIVSAPSVYAAI
                     LRKPESEIPTKHIYLFEYDKRFALLAGEDHFYYYDFAHPLDIDEKLLGKINRLLIDPP
                     FLNEHCQTNFSITAKALLAPNNGEKTSKGVEKHRIITSTGERMRDIVAKIYPGTKMTT
                     FYPGHANGLSNEFRCYANFEWSKWTFSTEP"
     gene            <942067..>945546
                     /gene="TFC3"
                     /locus_tag="KLMA_10445"
                     /db_xref="GeneID:34714110"
     mRNA            <942067..>945546
                     /gene="TFC3"
                     /locus_tag="KLMA_10445"
                     /product="transcription factor TFIIIC subunit"
                     /transcript_id="XM_022821429.1"
                     /db_xref="GeneID:34714110"
     CDS             942067..945546
                     /gene="TFC3"
                     /locus_tag="KLMA_10445"
                     /codon_start=1
                     /product="transcription factor TFIIIC subunit"
                     /protein_id="XP_022673965.1"
                     /db_xref="GeneID:34714110"
                     /translation="MTADSVLSPDQLIQIVIDEISYRKGKITLGELWEIASDYIDLSD
                     DYMKSFTLNNILAHPDTVVLVSGKPVDSKSLTYEQMISNATNVQIGITDDKLWLTLTG
                     HSKKEASVVGFAFDLLLEVAAAKEKGINTMELARNTGQDPRSVTGRIKKFSHLVTMTQ
                     LVYKGHLVKSLTLNRFVREKPKKPYINIKQHLPDIVQIVKDSKNGVRQVIDLKREMGF
                     DKEKRLSKAFTSAISWLDQQGYLRKVIVVSPANPSVKIRCVQFVKSYVAEDISSNNVF
                     EDESADEDDEDGLNGEEQDMAADDTERATIDDEDLIEGFDKVNATNILQDSNLVIQDS
                     SAEKKEFTINRFYPLQTQIYSMADKAGLSGISTLELISNFVGPGYKRCFSKNTEYFIE
                     GTSQKSSKFSSDDGIGLVKIYDFEGKKKFHRIFTKKNFAKLTDQESEYNEGDLPEIEE
                     QPYTLEELSKMNFVPLNASLRYMNDGEKDIFFWHGELDIPASSKTSVRGRKRVTLPDT
                     EEKPKRIKVPELTSQMKEEHIEVPALKNAPASITVNGFTGSSLKSIQRQKALLTVLRE
                     SGGVRYIGDQLYDSISKHMGTDMILDKKTLKKESEILVESGKLKIIEDPNTKRRLLCL
                     PDTSDEKINDYLVHSKDTRGRFNAEVVCKEDIYFFDQTEKDRFHRSAKAAKRIKEFER
                     KSRKSQPDNTTPDVISDAPTATKKLRKKAKPKNTTKATEKKEKEKVESPSNIRSNFHS
                     GTKEGMKALIYAVVITKSIKGQILWDEITKIFPHNALESLKKQWRIRRVRMGESGWRA
                     LMEKWRKIMVDAVKDERATIADAEQLNLIKLINLWLNTKETSTHFIKLYKDYSVNRSK
                     YTFVPISGRSGTDVKGRGVAMSSMIQRENFLLNKKYSITIDASRKEKTTEDEIRTIVR
                     SMLFEKTSAEPIDVNVLQGFNHEQVDKVILDMAKERLVTFMDSSKLQLTERGYDLLKY
                     QGDTSFLQEASACRTKAIEIFNNKNALIISEEPLRHVPCVLLDLIENYGIKSEVVPLE
                     VQHKKMYYTTRQYEVRALTPPLAFYSPGQIKDKKIKKANVPVGKAFSRLWIDGNSQIR
                     EHVWKSVVSLILKEILFHPGVTADCLADKLSILLSPREVAEVLQWLTDTRLVSSIKFN
                     GYMVCDGWYFAVG"
     gene            <945503..>947618
                     /gene="NUP60"
                     /locus_tag="KLMA_10446"
                     /db_xref="GeneID:34714111"
     mRNA            join(<945503..945577,946140..>947618)
                     /gene="NUP60"
                     /locus_tag="KLMA_10446"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821440.1"
                     /db_xref="GeneID:34714111"
     CDS             join(945503..945577,946140..947618)
                     /gene="NUP60"
                     /locus_tag="KLMA_10446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673966.1"
                     /db_xref="GeneID:34714111"
                     /translation="MVTWCVTAGTLLSDEFHIFIEYIVIKPSFFNKIKSFFQNQQGQD
                     KEAKSDTQSTSNKTRRSESSFHVPGGFYDSNVAAESSAILSRVLSSHTTANSTFDGLN
                     NEENEEEEDPNVSNAKLASFFKEKGDRPLTEMEMEGVISLMKKSRSVSSTPYGSRIIS
                     ESKHAPTSKILRTTSESIATPLRATSYTPRFEDTSQGNHSIRSTRSSVTRRIFDYSKV
                     PSPYRTTVYKYSAGSLPSKDKDSNTSLSQPIETKNKVTRNRAQQPKKLSNTASALMSI
                     LDGDSAKNAQTTNVSVASSIANPYASHVARVRKTKPSETSSSHPPSTPAKSTGSNITD
                     PQPSLSLNSSSQPQNTTSISLEKESSKTTDGANNTTNTNANGSSQYKPVISSSLRQAV
                     TAEKSPVKPADEKQPESKPQPAAQIFGNDSSKNSNFSFTFQKPEPFNMPSLPKSTIPS
                     KADSTNGKSHTFSFGKTEPVKPKETEASEKHTKPALQFSFGEAPKSNVDPNTIDKRKV
                     EQYKSMFAF"
     gene            complement(<947713..>948363)
                     /gene="ERP1"
                     /locus_tag="KLMA_10448"
                     /db_xref="GeneID:34714112"
     mRNA            complement(<947713..>948363)
                     /gene="ERP1"
                     /locus_tag="KLMA_10448"
                     /product="protein ERP1"
                     /transcript_id="XM_022821451.1"
                     /db_xref="GeneID:34714112"
     CDS             complement(947713..948363)
                     /gene="ERP1"
                     /locus_tag="KLMA_10448"
                     /codon_start=1
                     /product="protein ERP1"
                     /protein_id="XP_022673967.1"
                     /db_xref="GeneID:34714112"
                     /translation="MIFQVLLQFFVLLQLPLNAYAFYYYGNSGERRCFHKELTKGTLL
                     KGKYKLSVYDSSQDSYALTYGQDSNVVIMVEEVFDDNHRVVNQKGAPSGDFTFTALQS
                     GEHLICFQPAVRSGRVKTMMDIEFQVGSISEIDSKKKSTIQSLQNKVQVLIEKANGIR
                     REQDLVREREAMFRDASESANSRAMWWSVISLIVLGGTCAWQLSHLRTFFVKQKIV"
     gene            <949009..>950379
                     /gene="SWD1"
                     /locus_tag="KLMA_10449"
                     /db_xref="GeneID:34714113"
     mRNA            <949009..>950379
                     /gene="SWD1"
                     /locus_tag="KLMA_10449"
                     /product="COMPASS component SWD1"
                     /transcript_id="XM_022821462.1"
                     /db_xref="GeneID:34714113"
     CDS             949009..950379
                     /gene="SWD1"
                     /locus_tag="KLMA_10449"
                     /codon_start=1
                     /product="COMPASS component SWD1"
                     /protein_id="XP_022673968.1"
                     /db_xref="GeneID:34714113"
                     /translation="MANLLLQDPFGVLKEYPEKLTHTLEVPVAAVCVKFSPRGDYLAV
                     GCSNGTIIIYEMDSLKPISMLGTHSGAHTRSVQSVSWSHDGRYLWSSGRDWYVKLWDL
                     SQPSRCFKEYKFDGPVWSCHIVRWNLCVVSVVEKPTAFILKYDESSGLLNSWALQSSG
                     NEDSTNNYGYTLVACPHPTVESLIITGSSKGWIQGFKFDFETPDNENESESEKDDQGP
                     EDHISIQCCFEEKIANSNIKQVIISPSGTRCAVNCSDRNIRQYQLQVQMDPESETGPC
                     SVTLELEHKYQDMINRLQWNTIFFSNHAGDYLVATAHGSSAHDLYLWETGSGSLVRVL
                     EGADEELLDIDWNFYNMRIASNGFESGWVYMWSIVIPPKWSALAPDFEEVEENIDYQE
                     KEDEFDIMDDDNNLHALTEAEEVTIDLCTPEKYDVRGNDLSIPRFVIPLDYEGILVLQ
                     NWATNA"
     gene            <950714..>952456
                     /gene="CDH1"
                     /locus_tag="KLMA_10450"
                     /db_xref="GeneID:34714114"
     mRNA            <950714..>952456
                     /gene="CDH1"
                     /locus_tag="KLMA_10450"
                     /product="APC/C activator protein CDH1"
                     /transcript_id="XM_022821474.1"
                     /db_xref="GeneID:34714114"
     CDS             950714..952456
                     /gene="CDH1"
                     /locus_tag="KLMA_10450"
                     /codon_start=1
                     /product="APC/C activator protein CDH1"
                     /protein_id="XP_022673969.1"
                     /db_xref="GeneID:34714114"
                     /translation="MQNPFANNTPSSSPVKRAPGQSGRVVKRPASSSTTLSNSSSSSS
                     LLASPVRRPRSSSSGGSTAFADRFIPNRTEMDLNTVSSIRSNPNIPIFKPSSGSDNRL
                     EWERERQAHHTFDIVLKNELFGELINTDSNSGDNISRIQYSESLERPSTPPSGLRDGE
                     GDTDEDEDQELHQTTTSEPLFPTTPRRSHNTSFINNDHSQRPTSNTTKGVSLFSYGSR
                     SQNSRNHSSNMDLGLNQYLQSLSPMRPESQKLLQSPGKKFREIAKVPYRVLDAPSLAD
                     DFYYDLIDWSSTDVLAVALGKSIFLSDNATNSVTHLATSETDFTSLSWVDSGSHLAVG
                     LSSGIVEIYDILKNKCIRTLSGHVDRVACLGWNHHVLTSGSRDRKILHRDVRAPEPFF
                     EQIDTHSQEVCGLKWNVNENKLASGGNDNTVFVYDGTLRQPLLSIEEHTAAVKALAWS
                     PHTRGVLATGGGTADKKLKIWSVSKAVKLNEVDTGSQLCNMLWSKNTDEIITSHGYSK
                     YNLTLWNYPTLEPMAVLKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFDKPKARG
                     YQESLISNAFNTLR"
     gene            complement(<952682..>954547)
                     /gene="RFA1"
                     /locus_tag="KLMA_10451"
                     /db_xref="GeneID:34714115"
     mRNA            complement(<952682..>954547)
                     /gene="RFA1"
                     /locus_tag="KLMA_10451"
                     /product="replication factor A protein 1"
                     /transcript_id="XM_022821485.1"
                     /db_xref="GeneID:34714115"
     CDS             complement(952682..954547)
                     /gene="RFA1"
                     /locus_tag="KLMA_10451"
                     /codon_start=1
                     /product="replication factor A protein 1"
                     /protein_id="XP_022673970.1"
                     /db_xref="GeneID:34714115"
                     /translation="MGVQLLEGDLLDIFRIPERYNNPVGGIYQVVQTKKGETNAKKNL
                     ILINDGKYHVKALLRNKAAETAQQAELERGDVFKVLSAECAVIKEKKKFVLLVDEIEI
                     LSRGLDLFNSSTEFVDAYLAEHMNELVTLTENGATPSEAASATSSMSSKVAPTSTSNI
                     PAPQARAVPQMKPRGGNGNSSASQSSRPIFAIEQISPYQNNWTIKARVSFKGDLKKWQ
                     NNRGEGYILNVNLLDSSGEIRATAFNDNAVKFNEILQEGKAYFVSKARVQPAKPQFSN
                     LKHPYELSLERDCVVEECMNEDANDVPEMHFNFIKLNDVNNVEKNTAIDVVGILKSVG
                     PHFELAAKSGKKFDRRDVELVDDSGACISLGLWGEQAIKFNLPEGSVVALKGVRVTDF
                     NGKSLSMGNTSSLFANPDIQEAYTLKGWYDANASNTTFKALKTEGGSGDSSKFIAERT
                     TIAKAIESNLGRSEKGDYFSVKAAISFLKVDNFAYPACLNEGCQKKVILQSDNTWRCE
                     KCDMNHPHPKYRYMLTISIMDQTGQIWLTLFNDQAEQLLGVSANELTELKESNNQAFV
                     ALTQKVQMNEYDFRIRAREDNYNNETRIRYTVSNLHELKWKAEADFLANELLKAL"
     gene            <955047..>956333
                     /gene="RPN14"
                     /locus_tag="KLMA_10452"
                     /db_xref="GeneID:34714116"
     mRNA            <955047..>956333
                     /gene="RPN14"
                     /locus_tag="KLMA_10452"
                     /product="26S proteasome regulatory subunit RPN14"
                     /transcript_id="XM_022821496.1"
                     /db_xref="GeneID:34714116"
     CDS             955047..956333
                     /gene="RPN14"
                     /locus_tag="KLMA_10452"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN14"
                     /protein_id="XP_022673971.1"
                     /db_xref="GeneID:34714116"
                     /translation="MKVDEWTITSEFDDIVQDVKEEKVESDKIWVSKYGHGESGDCNL
                     DLEFEVKLDKRNEVSFGKSVCQGNEYSVVRAQSNIYEVVVANGTESGPGSSVVARFQN
                     FKRKCEFQKGHSPDLTSVDITNVFDPEERVVCADSEGSIYVLRGSRNGPMEEKFRIEQ
                     GHASHVSKVRFFPNGHGFLSSGIDMRLKIWDANNGTELRTFVGHTRPVNDFAMVDRGR
                     NFVSGSSDGCLKLWECSTASCVFSMGSDAGDGINCVALSNYTASASSSLSIDRTNEYN
                     TEGKAVFSGHDSGAITFHDLYNRKKVLEIPSVNGSSCVTLAQSSSGDNSHYLWAGHSD
                     GSIYSWDTRNTSEPIDHLEVNSGVPITKIFLANNLLHVSSGIQYFFSLPVVDGEFKTG
                     KLVNFIRPYEDITDFCINESYQDLWCVGNNGTMLKF"
     gene            <956670..>957440
                     /gene="COG7"
                     /locus_tag="KLMA_10453"
                     /db_xref="GeneID:34714117"
     mRNA            <956670..>957440
                     /gene="COG7"
                     /locus_tag="KLMA_10453"
                     /product="conserved oligomeric Golgi complex subunit 7"
                     /transcript_id="XM_022821507.1"
                     /db_xref="GeneID:34714117"
     CDS             956670..957440
                     /gene="COG7"
                     /locus_tag="KLMA_10453"
                     /codon_start=1
                     /product="conserved oligomeric Golgi complex subunit 7"
                     /protein_id="XP_022673972.1"
                     /db_xref="GeneID:34714117"
                     /translation="MSGSANTSTKTSNSNDALLNMFFDEDFVPQAYVDILLSSFQINQ
                     LDEIKTTSSSLLSRMDFYSGHVTRELESTIHRLEKPAELILYTPSTDQKGTTKLEYYL
                     DTLANSVSLLEADVKNIEEQLEALNVKYESSNSVTETLSKLMLAKNSLLKVKRSFDTL
                     KTIMEISIQDDQEKLQHITVEEFNLALATLQETITSTLAKPVKEPTELLRKIGDFIEL
                     KQMLKGLPKFYVPYSEFAQAIQKERDAYLNSIQSADEL"
     gene            complement(<957753..>961577)
                     /gene="PMC1"
                     /locus_tag="KLMA_10454"
                     /db_xref="GeneID:34714118"
     mRNA            complement(<957753..>961577)
                     /gene="PMC1"
                     /locus_tag="KLMA_10454"
                     /product="calcium-transporting ATPase 2"
                     /transcript_id="XM_022821518.1"
                     /db_xref="GeneID:34714118"
     CDS             complement(957753..961577)
                     /gene="PMC1"
                     /locus_tag="KLMA_10454"
                     /codon_start=1
                     /product="calcium-transporting ATPase 2"
                     /protein_id="XP_022673973.1"
                     /db_xref="GeneID:34714118"
                     /translation="MSEKLRQDALAADSAENRRGMAAAAIPGDGDESSSGGGSPGELV
                     HRGTQATMMSVSRVNNRSSFKLTTSQLGELHDPKSLSAFNNIFDNKEENLYAYLQTDK
                     DKGLTIQDEDIEGLERTQVYGLNRLPTRKGKSFLRLAWEAFNDKTMILLTVAAVISFA
                     LGLYETLGQPAEYDAEGNKKVKVEWVEGVAIMIAVVVVVLVGAVNDYQKEMQFAKLNK
                     KKDDREVVVIRNGDEHLISIHDLLVGDIVSLQTGDVVPADAILISGTCECDESALTGE
                     SDTIKKVALKPALEKYNEIFDVDPSLDVGNRYEGDRIPDPLLISGSKLLSGLGHAVIT
                     AVGVNSVHGRTMMALNVESESTPLQERLSNLADNVSIYGSMAALLLFIVLFIRFLTYL
                     PSGKKYSDLSPAQKGTKFMHIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNL
                     VRVLRACETMGSATAVCSDKTGTLTENKMTVVKGYIGDTTFDDTVNAENKEVASDAVF
                     QNDCNAAVLNDLLTNISLNSTAFENKQNKDNGDQEVTENPYHKSRKRRFPWSRNNRAQ
                     ELIDNALKEVSEPFIGSKTETALLSLAKKSLGMSDLHNLRDHPESLGVEEVVQIIPFE
                     SSRKWGAIAARLKDNAGYRLYVKGAAEILLKQCSQKRNSDNSVTPMTQAVFDECGKRI
                     QDMASQALRTISLAHKDFTQWPPKEFTDSVDPTLATPEIVTGVKVDRNSPEKDGFVLD
                     AMVALQDPLRAGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCSILSEEEFNDPEC
                     AMEGPEFRKMPYKKMLRVVPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAP
                     ALKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKWGRCVAVSIKKFIQFQLT
                     VNITAVILTFVSAVASSEEASVLTAVQLLWVNLIMDTLAALALATDKPDEFILDRKPK
                     GRDAPLIAVSTWKMILGQATLQLTVTFVLHFRGKHIFFPHHDKITGHQQEQLDAMTFN
                     TFVWLQFFKLIVTRKLDEADGIKSFRERLTANNLNFFQHLFRNYYFLAIAVLIGAFQI
                     LIMFVGGAAFSIARQTPAMWATAIICGLLSLPAGAFIRACPDEWALAIYPRRIVRPIL
                     YVIGLEFIFNRNKNKKRDDHEEDEEASLLVDHSDEQGLVETSAFRRAKSEMLTHKEHP
                     HSSESSKFNPFSVIKRWRNSTEEDNESDDDHSLIASVTMVPTLVGGAVGGFSHITDAH
                     KSDSTKEEKTTD"
     gene            <962836..>963513
                     /gene="SEN34"
                     /locus_tag="KLMA_10456"
                     /db_xref="GeneID:34714119"
     mRNA            <962836..>963513
                     /gene="SEN34"
                     /locus_tag="KLMA_10456"
                     /product="tRNA-splicing endonuclease subunit SEN34"
                     /transcript_id="XM_022821529.1"
                     /db_xref="GeneID:34714119"
     CDS             962836..963513
                     /gene="SEN34"
                     /locus_tag="KLMA_10456"
                     /codon_start=1
                     /product="tRNA-splicing endonuclease subunit SEN34"
                     /protein_id="XP_022673974.1"
                     /db_xref="GeneID:34714119"
                     /translation="MMEEAVWLVEQGVAAIVSGTGEGVAERLSGVRAEQWAEWERGAA
                     LERGAQLAWKREQLAQKKPERAVTERDEALMQQSVFVHTRDTPRAVPSGVPRDAESTA
                     ESPGSAAIDVTALLKRDNRLRANYGVYRSLRAKGYVLSPGARFGGRYVAYPGDPLRYH
                     SHLIVQEAMDKKQEIDLLSMVNGARLGTSVKKTWVLAGVGAEKEEAGAEAEPETEFYS
                     VEWAGFG"
     gene            963765..963848
                     /locus_tag="KLMA_R112"
                     /db_xref="GeneID:34718627"
     tRNA            963765..963848
                     /locus_tag="KLMA_R112"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:34718627"
     gene            964049..964123
                     /locus_tag="KLMA_R113"
                     /db_xref="GeneID:34718628"
     tRNA            964049..964123
                     /locus_tag="KLMA_R113"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718628"
     gene            <967797..>970496
                     /gene="PMA1"
                     /locus_tag="KLMA_10457"
                     /db_xref="GeneID:34714120"
     mRNA            <967797..>970496
                     /gene="PMA1"
                     /locus_tag="KLMA_10457"
                     /product="plasma membrane ATPase"
                     /transcript_id="XM_022821540.1"
                     /db_xref="GeneID:34714120"
     CDS             967797..970496
                     /gene="PMA1"
                     /locus_tag="KLMA_10457"
                     /codon_start=1
                     /product="plasma membrane ATPase"
                     /protein_id="XP_022673975.1"
                     /db_xref="GeneID:34714120"
                     /translation="MSAATEPTKEKPVKAQDSDDEDEDIDQLIEDLQSHHGLDDDSDD
                     DGHHAAGTARPVPEELLQTDPSYGLTSDEVAKRRKKYGLNQMSEEVENLLVKFLMFFI
                     GPIQFVMEAAAVLAAGLEDWVDFGVICGLLFLNAGVGFIQEYQAGSIVEELKKTLANT
                     AVVIRDGNLVEIPANEVVPGDILQLEDGVVIPADGRLVTEDCFVQIDQSAITGESLAV
                     DKRYGDSTFSSSTVKRGEAFMIVTATGDSTFVGRAAALVNKASGGTGHFTEVLNGIGT
                     ILLILVIVTLLLVWVASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYL
                     AKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLTACLA
                     ASRKKKGLDAIDKAFLKSLINYPRAKAALTKYKLLEFHPFDPVSKKVTAIVESPEGER
                     IICVKGAPLFVLKTVEEEHPIPEDVRENYENKVAELASRGFRALGVARKRGEGHWEIL
                     GVMPCMDPPRDDTAQTVNEAKHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLG
                     LGGGGDMPGSELADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLK
                     KADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLH
                     LEIFLGLWIAILNQSLNIDLVVFIAIFADVATLAIAYDNAPYSPKPVKWNLRRLWGMS
                     VILGIILAIGTWITLTSMFVPKGGIIQNFGSIDGVLFLQISLTENWLIFITRAAGPFW
                     SSIPSWQLSGAVLAVDVIATMFTLFGWWSQNWNDIVTVVRVWIFSFGVFCVMGGAYYM
                     MSESEAFDRFMNGKSSKERPSGRSVEDFLMAMQRVSTQHEKEN"
     gene            968143..968324
                     /locus_tag="KLMA_R114"
                     /db_xref="GeneID:34718629"
     tRNA            join(968143..968177,968264..968324)
                     /locus_tag="KLMA_R114"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:34718629"
     gene            complement(<972244..>973455)
                     /gene="KYE1"
                     /locus_tag="KLMA_10458"
                     /db_xref="GeneID:34714121"
     mRNA            complement(<972244..>973455)
                     /gene="KYE1"
                     /locus_tag="KLMA_10458"
                     /product="enoate reductase 1"
                     /transcript_id="XM_022821551.1"
                     /db_xref="GeneID:34714121"
     CDS             complement(972244..973455)
                     /gene="KYE1"
                     /locus_tag="KLMA_10458"
                     /codon_start=1
                     /product="enoate reductase 1"
                     /protein_id="XP_022673976.1"
                     /db_xref="GeneID:34714121"
                     /translation="MSYMNFDPKPLGDTNIFKPIKIGNNELKHRVVMPALTRMRAIAP
                     GNIPNTEWAEEYYRQRSQYPGTLIITEGTFPSAQSGGYPNVPGIWSKEQLAEWKKIFN
                     AIHENKSFVWVQLWVLGRQAWPEVLKKEGLRYDSATDDLYMGEEEKERALKANNPQHG
                     ITKEEIKQYIKEYVDAAKKAIDAGADGVQIHSANGYLLNQFLDPISNNRTDEYGGSIE
                     NRARFTLEVVDAVVDAVGAERTSIRFSPYGTFGTMSGGENPGIVAQYAYVIGELEKRA
                     RAGKRLAFIDLVEPRVTDPFLPEFEKWFKEGTNEFIYSIWKGPVLRVGNYALDPDQAT
                     LDSKKPNTLIGYGRSFIANPDLVYRLEKGLPLNKYDRNTFYKFTKEGYTDYPTYEESV
                     AKGYKKEEKKY"
     gene            <974815..>977283
                     /gene="PUF4"
                     /locus_tag="KLMA_10459"
                     /db_xref="GeneID:34714122"
     mRNA            <974815..>977283
                     /gene="PUF4"
                     /locus_tag="KLMA_10459"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821562.1"
                     /db_xref="GeneID:34714122"
     CDS             974815..977283
                     /gene="PUF4"
                     /locus_tag="KLMA_10459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022673977.1"
                     /db_xref="GeneID:34714122"
                     /translation="MSSNPVVPDTINVALGQLHLDEAGAVPVPVSGQENAPSVKVSTS
                     NNDDDNSSNSDSNGHANESVNASSINAGPSAHVTPMFAPHMMNPFMPYHPMMHMPHSG
                     FFPGAQDPMFPPPDSSAAVDFTPAQGIDLSIPQEMGSVSNGGVSVGVDANSLPANDPM
                     MMQQYMSNGQRQMFWINPDSLNSSAVDDINPADDSHGHDPFVRGSSFALESSTAAGAE
                     HEKTDAKVPGANISRRQTFAAVSTSNLLGSENVESSADLASPSDAANAKKEEQERVYP
                     QAAAYPYTGALLQPNPVMSGHPLGHPHHPHPHHPHPIGSPFHGYGFNTAFSPVPVAGS
                     PLTNRSPVTTGEGKDANGGEDANNDQPNMHKIHSGMNSPSMGQSAGMPPNPWMFAPHG
                     SPNFMLPHPGHPGHPGHPGHPGHPGHPGHPGHPNHPNHMGGHQRPQSGNSQHKKRSYN
                     NNNGNNNNNNNANGGNRNNNYNGGKYHGKPHRYEDGSRYQNAVLEQFIGSLYSLCKDQ
                     HGCRFLQRQLDEEGEKAASIIYAEIKDHICDLMSDPFGNYLMQKLFECINEADRVEIV
                     KNCAPHFVDIALDAHGTRALQKLVECVQTEEEVQLLVSTLQPSILPLSRDFKSNHVVQ
                     KMLEKFSCKDTQFIYDAACEDIIKISNHRNGCCVVQRCLDFGDETQRNELCDKIVENS
                     FELTMNPYGNYVIQYILTKEREKENPDFKYTKKIVDVLKLNAIDLSLNKFGSNVVESI
                     LRTPAVSDVMISKILNSNDESGLSKLLHDSYGNYVLQTALDVVKDSNSSLFSLLSESL
                     KPLLVGQIRNTPHGRRIAALIQTD"
     gene            complement(<977775..>981323)
                     /gene="PDR1"
                     /locus_tag="KLMA_10460"
                     /db_xref="GeneID:34714123"
     mRNA            complement(<977775..>981323)
                     /gene="PDR1"
                     /locus_tag="KLMA_10460"
                     /product="GAL4 domain-containing family protein"
                     /transcript_id="XM_022821573.1"
                     /db_xref="GeneID:34714123"
     CDS             complement(977775..981323)
                     /gene="PDR1"
                     /locus_tag="KLMA_10460"
                     /codon_start=1
                     /product="GAL4 domain-containing family protein"
                     /protein_id="XP_022673978.1"
                     /db_xref="GeneID:34714123"
                     /translation="MSPPGLSQEAKSVVGHGNGEGMNGKGGGVVKSRTKVSRACDSCR
                     KKKIKCSGTLPCKSCQTYGCECVYSYVAGSVSKRKKTKKSDAAGGNEVVDRTSVSILN
                     PSSVALKMETAKRFEAVSRNPAAVAATTTTTSSVSRDGMAHPHGHPQGLSSATPCKVD
                     IPTVVRATEPLAGAGARARAGSGSVASEGVAGQLPPHVSPSAVAGTCSPPVPGPGQVS
                     GQGSSHASTHGSGTGNGTGNGNGNPEASSPQKKEPHILYRSLSDVEDRIEDLKKCIQD
                     LKKSSQPQSESIVYAIKNIEFEIATLKKKISEPRIKREELSNPALAEDNAICLEAKLL
                     RNYESTQVNLNRYVKVDTNRLEGYLYKPPLIDITYGMHYPGQWLSLRGIGHFAKEFLR
                     DGLFHTKESKENLYLLLRHFDISSAIEKENAQCWSAPIETYCARASINVPEGERIRFL
                     LNKIPTRLLHKLVNTKKQFRIENWYDIVSNVGNNTVSYTMETFHWVVAILETNRIEYQ
                     KLCRHFKLAAQQKDGKNISRETTSFIEAEELLFSLALHFFKRISISRSDAEPLAFIDD
                     VLDFVMNLYWIDGHQTFTYLLTQVVQVLQVYGLDQWETYLVMDERMADSRRMLWWKTF
                     FWDQYSIFITGSKPLFHGADSQSPLFPKFMRQMNCVDYQDLLKKIDEEVDVGTVDFTN
                     KADISLRDVLGFVIFLSCFFSRQFQMNIIYNDRFANFRIFAQNHAERVRMAEELLREL
                     RIYKRRLDILNAALQRYVLSGNVKADPNEDPDLKDPGLYWYYITTEAFFTFCVVSATH
                     ILARLNLGPDNAEMNHEMKTFRKSISLSWKTVISYLEMNDDIYDLFFMSKLILLIAVS
                     YVGENLLYFKLSTLDDVFSFLKLCRYFEYCGVSCDSIDQTRIQRSLLQVQFFVKILVR
                     VVIDLYLDYMKKDFNALLAEVASSEHPEYQDTILKLFDNTFSYFSPSLSSIKESELHV
                     QVKTWLSEALFNKSDSMPSSLFFFDDLFPTNLSSESTTTTDHAETPNTILEQTLGKVP
                     PTATQPSLNVNSSQVPNQFGVEGKDGVSMYGQDKRPINMQQQPQHQQHQHQPQPQPQP
                     QHPQQHPQQHPQQHQQPQHQPSVPVGGKTDTFHQFNPDMTQSPQKSVDPQGKNDQGTF
                     FNLGTIQDFADHGNVDQLFSFLWDDLVTGPAPPPQK"
     gene            <981978..>984320
                     /gene="SPC97"
                     /locus_tag="KLMA_10461"
                     /db_xref="GeneID:34714124"
     mRNA            <981978..>984320
                     /gene="SPC97"
                     /locus_tag="KLMA_10461"
                     /product="spindle pole body component alp4"
                     /transcript_id="XM_022821585.1"
                     /db_xref="GeneID:34714124"
     CDS             981978..984320
                     /gene="SPC97"
                     /locus_tag="KLMA_10461"
                     /codon_start=1
                     /product="spindle pole body component alp4"
                     /protein_id="XP_022673979.1"
                     /db_xref="GeneID:34714124"
                     /translation="MEDRGVHERVYVLSEGSGAFGCRVNSGPLCSEEIKVKTYPIDKT
                     SSERVQESLVVRDLLLVLQGYEGVYIRYNNSYSREMLVGPEYKVVKMMNVAFKSFSKK
                     LIKIGSIYVKLEKFGQWCGEDRYGRVMHRLGYEVRRFLHEDYLSCVKELERRFQEDVL
                     FSIRDLEMALEEEYVYKFKLLDRLVDEVVGSVKYRSEMDRVQMDFDNFMEDLKRDTNS
                     EIDLRVLYDTRVSLYVKGGSLLLILQKMMEQEQGDSRHIKFLSALCEPLYEVYSKMFI
                     QWMEHGQLADIHDEFLISDTVADVDDEKLSYMLDNERLWDTRYVIRKDGLLPQLQDKE
                     LLQKILLTGKIWSLIRVCCGTTGTTTSTSTNTKNNGGVSSGGSITGNIFTNTTLLRAY
                     VNDWYQRANDECVRMFYEGYHMDKFMQLVHDQSYVHGVLDQIWSSKFLAKSLFELTRS
                     PNEATVVKIQRHFSDVVREVKVEDSYKGMLLQLTSLKLDTNPFFQTLRQFIDDQESQL
                     LNADNFQQLKVMLVGNQGVGEEPQFGRTKKKKNSVPAAMYVQFDTSIPYPLNIIWTKP
                     VMVQYQMIHRLIFILSYHERLLEDTWFEISKNDYWRRNGVPSQENNMLKVQCIRLARV
                     LHFQMRSMVKEKRRQVTTAAAAAAATAAACGAATAAVGPATRERDLLTLQHTVQDHVT
                     NIVSIAGLTSIHHIETQEATLHLIHSFIRFVASWRRSKRPTSTNSNANTTTITTGMHA
                     SRMLDHDNTDGAEEDISTWQLRMDTLRQYMSVWNDIVSQT"
     gene            <985523..>986836
                     /gene="ENO"
                     /locus_tag="KLMA_10462"
                     /db_xref="GeneID:34714125"
     mRNA            <985523..>986836
                     /gene="ENO"
                     /locus_tag="KLMA_10462"
                     /product="enolase"
                     /transcript_id="XM_022821596.1"
                     /db_xref="GeneID:34714125"
     CDS             985523..986836
                     /gene="ENO"
                     /locus_tag="KLMA_10462"
                     /codon_start=1
                     /product="enolase"
                     /protein_id="XP_022673980.1"
                     /db_xref="GeneID:34714125"
                     /translation="MAVSKVYARSVYDSRGNPTVEVELTTEKGMFRAMVPSGASTGIH
                     EALEMRDGDKSKWLGKGVLKAVANVNDIIAPALIKANVDVTNQQAVDDLLLSLDGTPN
                     KSKLGANAILGVSLAAAKAGAAAKNVPLYQHLADLAKAKTEPFVLPVPFLNVLNGGSH
                     AGGALALQEFMIAPTGAESFSEALRIGSEVYHNLKSLTKKRYGSSAGNVGDEGGVAPN
                     IQTAEEALDLIVDSIKLAGYEGKVSIGLDCASSEFYKDGKYDLDFKNPNSDKSKWLSG
                     EQLAEMYHELVKKYPIVSIEDPFAEDDWEAWSHFYKTAGVQIVADDLTVTNPLRIKTA
                     IEKKAADALLLKVNQIGTLSESIKAANDSFAANWGVMVSHRSGETEDTFIADLVVGLR
                     TGQIKTGAPARSERLAKLNQLLRIEEELGSKAIFAGKKFHNANQL"
     gene            <987192..>987656
                     /locus_tag="KLMA_10463"
                     /db_xref="GeneID:34714126"
     mRNA            <987192..>987656
                     /locus_tag="KLMA_10463"
                     /product="ctr super family"
                     /transcript_id="XM_022821607.1"
                     /db_xref="GeneID:34714126"
     CDS             987192..987656
                     /locus_tag="KLMA_10463"
                     /codon_start=1
                     /product="ctr super family"
                     /protein_id="XP_022673981.1"
                     /db_xref="GeneID:34714126"
                     /translation="MHHEQQPSMMKHHPAAPDHGNHHPGSGPGSGPMCSMDMTFNWNT
                     ENVCIVFKSWRISSYTQLFLSALFIFCFSYGAEYLKYYVGVLNQRLTGSLTRRTRIQA
                     SLWYGLQYTISILLMLIYMTYNGYLIAAVLLGGMLGHFHWSQSPAIQLPPCH"
     gene            <987813..>989087
                     /gene="FMO1"
                     /locus_tag="KLMA_10464"
                     /db_xref="GeneID:34714127"
     mRNA            <987813..>989087
                     /gene="FMO1"
                     /locus_tag="KLMA_10464"
                     /product="thiol-specific monooxygenase"
                     /transcript_id="XM_022821618.1"
                     /db_xref="GeneID:34714127"
     CDS             987813..989087
                     /gene="FMO1"
                     /locus_tag="KLMA_10464"
                     /codon_start=1
                     /product="thiol-specific monooxygenase"
                     /protein_id="XP_022673982.1"
                     /db_xref="GeneID:34714127"
                     /translation="MLSVGVIGAGPAGLATARVLVANNKAAKVDLFEASDKVGGVWNY
                     ESNTAMYDVLETNLSNVLMAYEGFPFAGRKRFPTRQEVQQYLESYWESVIKPNDRVRL
                     FTNTRVTGLEKVDNGWEITGEGANGVTLHQYDYVVVANGHFSKPFVPRNIPGLETWPQ
                     ASQCHSRDYKKCTQFQDLNVVIVGNGSSATDIATQISTTARQVYQSVKPDAKTNWPDN
                     SIVEVVSQIESVAWDQERSVHLIDGTVLENIDYIIWATGFYYDLPFLRNDKYRSDLFK
                     GQPQGQQKHLYSLYEHIVYTGDHTLFFSLIPANIVPFPLAELQACVIDLCIAGRIPDS
                     EIVSPAIEEPTSHFLPTPKDIEYYQHLQGILDKYGAADAAFKPRNWTQKWVDERLSSA
                     ELKAQRQKLLVQWAIELHARGQPYTLPPGPGS"
     gene            <989239..>991296
                     /gene="STB5"
                     /locus_tag="KLMA_10465"
                     /db_xref="GeneID:34714128"
     mRNA            <989239..>991296
                     /gene="STB5"
                     /locus_tag="KLMA_10465"
                     /product="protein STB5"
                     /transcript_id="XM_022821629.1"
                     /db_xref="GeneID:34714128"
     CDS             989239..991296
                     /gene="STB5"
                     /locus_tag="KLMA_10465"
                     /codon_start=1
                     /product="protein STB5"
                     /protein_id="XP_022673983.1"
                     /db_xref="GeneID:34714128"
                     /translation="MMRREEWKQAVKRREWCFKVAEALVYGLMGAESSNETDGGAGMP
                     SHSCSRCRRIKKKCSKEVPACQNCVKAGKACDYPGRARRRKRKEIEEALLREARVRSG
                     TSSGNGTSTSNKEEQKRPQHSLVSASSVSSFLNLLNTLNDTKGIASGSPDLDESEDVS
                     SSSPTAEPRLKRFRGKKDAVASHAGLPEHEKHRSESTPITASAIQIETVLSVFKGGRT
                     TPMKQLPLQIQRPLYDRFVAAFFKHNHMSYPLLNKVDFLNKVSNIRDFNTLEDEEEGY
                     DDVFIFELYMTMAIGCTTLQRAGMLSAEEEGLSEHFSYMAMKRFCPVMHLQNLETIKC
                     LLLLGIYSFFEPKGVSSWTISGLIMRLCIGFGLNRALTTKKLKTMSMIDVEMRYRAFW
                     SFYSYERLVATSLGRISCLHDDDISVPLPRPLFEEENDDIEVTNMMISLRKLGGRIYR
                     KVHSVGVGKKKLMLEEKRAIVEGLRAELDEVYKQETIKIRNLNIRANRYNEDNQKNQN
                     SSSCSGSCISFHHSEEWLTMRYYQLQIMLYRPSVLIPKPAMDSLTILGDACLKSLKYT
                     YSLYQRRLLPLNWITLFRVLTICNTMLYCLCQWSIDIIESKIEIHQCIEVLKHFGAKW
                     VFAAKCADVFSNVNNMILDISLSNGRVPNMDKLTRELFGASNEYQEILDENNVDISWV
                     DNI"
     gene            991459..991532
                     /locus_tag="KLMA_R115"
                     /db_xref="GeneID:34718630"
     tRNA            991459..991532
                     /locus_tag="KLMA_R115"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:34718630"
     gene            <992605..>993060
                     /gene="SVP26"
                     /locus_tag="KLMA_10466"
                     /db_xref="GeneID:34714129"
     mRNA            <992605..>993060
                     /gene="SVP26"
                     /locus_tag="KLMA_10466"
                     /product="erv26 super family"
                     /transcript_id="XM_022821640.1"
                     /db_xref="GeneID:34714129"
     CDS             992605..993060
                     /gene="SVP26"
                     /locus_tag="KLMA_10466"
                     /codon_start=1
                     /product="erv26 super family"
                     /protein_id="XP_022673984.1"
                     /db_xref="GeneID:34714129"
                     /translation="MKQFPYISLSNPTLMLSCVLVLINHYLWFKHFNDVKIPPQFKFD
                     PNYVPKRRATFAEVASFFGICIWFIPFALFVSLSAGENVLPTHTSGKKSDDAAAMGSA
                     GAAEGSKTGVRRRAKGLAMIVIDYAREYFYSIGKLFGLKDSKKADGLLI"
     gene            <993242..>995353
                     /locus_tag="KLMA_10467"
                     /db_xref="GeneID:34714130"
     mRNA            <993242..>995353
                     /locus_tag="KLMA_10467"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821651.1"
                     /db_xref="GeneID:34714130"
     CDS             993242..995353
                     /locus_tag="KLMA_10467"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673985.1"
                     /db_xref="GeneID:34714130"
                     /translation="MALFWYTFWSSVSTVSANSLHEAVVDDIHVVDQYLEFIGKLNKV
                     WSSSQQSVRKIPANRAVGVSRLVLERLEEELGSRVVDCGELVELRKRYETLLADSKEG
                     KKREVSLMRELKGLKAVVLRVKRSARGSAKGSAIAEGNDNDNDNDNDNSKANSKANAL
                     GISLGLGNADMMAFLEQIKKTLQYSRRFIPLSGMANEYFTGMQLVEAAKKLSPGSVWS
                     MYQQERFGQWLMDEGYMMHHNDILRLRKTFSVDGYYCWQMKTNKNKNKVHEDMEPFVS
                     RSEACNVMWEQWSKYSIKRLEFETWHMACMGQLGELREKLVDVVGRLEEVLGGNRSSS
                     SCNITMESLYARNMGSIGFYVTMNEPLVKPGANPGDIPEDSPLEIGERDDDVEKSGLW
                     VVLDSLEQEDAVEVRKWWDTEFDLVHWHRVREDIQRKWWGYDAEWESFVVGLPVEKRV
                     CVVKGILIEMGESIVPGRVVERSLREEQSLRKSLGECKVGRTTLKVLAKLAGSPAFAG
                     AMAEAEAMAEAEAKGEPQGFAQGLAQDKRIPLVHFFMRCQHQVPQKLAVLERLWWEFV
                     GDLEGLLEEAVEESVDEPVAAPAPQVPIVSVTRSRSSSRGASAAGASPPPPPPLPPVS
                     PKRGHVTDTQFIPKPFKSSRPASYSGPDSTSTSTGQGPGQSQALGSSSGTNSATSSGS
                     SSGTTSREKRRSGTPLVHILG"
     gene            <997726..>999204
                     /gene="GND1"
                     /locus_tag="KLMA_10468"
                     /db_xref="GeneID:34714131"
     mRNA            <997726..>999204
                     /gene="GND1"
                     /locus_tag="KLMA_10468"
                     /product="6-phosphogluconate dehydrogenase"
                     /transcript_id="XM_022821662.1"
                     /db_xref="GeneID:34714131"
     CDS             997726..999204
                     /gene="GND1"
                     /locus_tag="KLMA_10468"
                     /note="decarboxylating 1"
                     /codon_start=1
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="XP_022673986.1"
                     /db_xref="GeneID:34714131"
                     /translation="MSQPAGDIGLIGLAVMGQNLILNAADHGFTVVAYNRTVSKVDHF
                     LANEAKGKSIIGAHSVAELCANLKRPRRIILLVKAGAAVDAFIEQLLPHLEKGDIIID
                     GGNSHFPDSNRRYEELKGKGIYFVGSGVSGGEEGARYGPSLMPGGAEEAWPHIKDIFQ
                     SIAAKSDGEPCCDWVGPAGAGHYVKMVHNGIEYGDMQLITEAYDIMKRVGGFNDKEIG
                     EVFAKWNKGVLDSFLVEITRDILLHDDVDGTPLVEKILDSAGQKGTGKWTAINALDLG
                     MPVTLIGEAVFARCLSSLKDERVRASKVLPGPQVPKDLIKDKQKFVDDLEQALYASKI
                     ISYAQGFMLIREAGKTYGWKLNNPAIALMWRGGCIIRSVFLGEITKAYRENPELENLL
                     FNKFFSDAVEKAQSGWRNTIGLAVTAGIPTPAFSTALSFYDGYRSERLPANLLQAQRD
                     YFGAHTFKVLPEAASETLPAGQDIHINWTGKGGNVSASTYQA"
     gene            <999616..>1001598
                     /gene="SSP1"
                     /locus_tag="KLMA_10469"
                     /db_xref="GeneID:34714132"
     mRNA            <999616..>1001598
                     /gene="SSP1"
                     /locus_tag="KLMA_10469"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821673.1"
                     /db_xref="GeneID:34714132"
     CDS             999616..1001598
                     /gene="SSP1"
                     /locus_tag="KLMA_10469"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673987.1"
                     /db_xref="GeneID:34714132"
                     /translation="MDHPPLELNSEEHYFYPTYQDPGQDPDQGLNLGQDFGQILGQEF
                     GPHHNYPPPKVLDSRKIYEKLKNKVRFWRQTDDDADRMNTVDRRQQELWKLIRDSSFK
                     LTPEANGGPEGGSEGGPQAPIHDASTLKLKHEATVTTVPATVPATTMPVPVPGPGPGP
                     GPGLGPGASANTFLTQGEDGDDDHERAPNNNNNPSPMKVTALDRSPLFDIPSTTNMDS
                     LGPSPPVLVERLSDKFQFKRVGLKRIQDRLRRIAEAKENVAKNYNKLASEITSWCSLC
                     LERDSEIDLLTDLQQVLATDKRSEQTMAKLFNMIDTKLEYVAKREENMLQERKDMNSM
                     AKKYDALRVKKGDQNMETEYLKENLHRKRNSLQQLKEQYYESLSKILREEFTRSCFTI
                     YEMGSDLKDVTREFSLQSLEQLKSTNDSGYIDYFLEDVRKVRADKQWSKLSPREKNNP
                     NKLAELVGNLYNGQDSLLRVASNKIPIKFSPLPLYDNISSSDTSLNRKGLKPEDEGPL
                     DISISQYGNDKYYNNISSNQYLLKRPILPPMSRPQSHPLTALQNLRAPPMSSQGQGQG
                     QGQGQGGHPRTLVSDNAHIRPYSRPPQQQQQPPLLRPKAEPSVLRNEVISENVSRESL
                     NEMDANDHEEVVIRFGQDLTNSFIEADQLLATNAWD"
     gene            complement(<1001833..>1002945)
                     /gene="MTM1"
                     /locus_tag="KLMA_10471"
                     /db_xref="GeneID:34714133"
     mRNA            complement(<1001833..>1002945)
                     /gene="MTM1"
                     /locus_tag="KLMA_10471"
                     /product="mitochondrial carrier protein MTM1"
                     /transcript_id="XM_022821684.1"
                     /db_xref="GeneID:34714133"
     CDS             complement(1001833..1002945)
                     /gene="MTM1"
                     /locus_tag="KLMA_10471"
                     /codon_start=1
                     /product="mitochondrial carrier protein MTM1"
                     /protein_id="XP_022673988.1"
                     /db_xref="GeneID:34714133"
                     /translation="MSGDRSSTEIMKERMLSACAGSFLTSFILTPMDVVRIRLQQQEM
                     IPDCSCGATGGAGSGIGGSEKVLVGQEGVAGRNAPKIFWQDVCFQDIQCKNSALRFNN
                     TWDAFAKISEIEGLSTLWRGLSITLLMAIPANVVYFSGYEMFRDHSPLRNTYPTVNPL
                     ICGATARILAATTIAPLELLKTRLQSIPRSMNGANTQQMFKDLLKETKNEIAAGGYKV
                     LFKGLEITLWRDVPFSAIYWWSYELYKKNCWVDFSQQYLSLNLSSNWDFFINSFLGGS
                     ISGTNAALLTHPFDVGKTRMQITMDIENRKRNTLVAHKGEKVSARGMFKFLYNIKQTE
                     GYGALYTGLLPRVMKIAPSCAIMISTYELSKKFFAV"
     gene            complement(<1003214..>1003987)
                     /locus_tag="KLMA_10472"
                     /db_xref="GeneID:34714134"
     mRNA            complement(<1003214..>1003987)
                     /locus_tag="KLMA_10472"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821696.1"
                     /db_xref="GeneID:34714134"
     CDS             complement(1003214..1003987)
                     /locus_tag="KLMA_10472"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022673989.1"
                     /db_xref="GeneID:34714134"
                     /translation="MDEMGAQKPLGVNIAILNKHIPNKSPYKRSRARKTLDRSEIRNK
                     GRLRYKNDIQELEFLDSMDTSGDTAQQAQQQVQQHQHHHISHSLPPDYDDLQFQMQEQ
                     QLQLQLQLQHNYYSSSPLHQQQVDHSITPLLPPRPDVNSSMLVFNSAHYHNSSPHSPV
                     PIVSGFPSYFNPRQARNMPHSEKVERWMENLPVFFEESTQLTHTDCFNAAEDSDFWEE
                     DEFDNGMDDSIVLTNSVEIIFLQQRRITSLINRLYNTNT"
     gene            complement(<1004347..>1007508)
                     /gene="RAD2"
                     /locus_tag="KLMA_10473"
                     /db_xref="GeneID:34714135"
     mRNA            complement(<1004347..>1007508)
                     /gene="RAD2"
                     /locus_tag="KLMA_10473"
                     /product="DNA repair protein RAD2"
                     /transcript_id="XM_022821707.1"
                     /db_xref="GeneID:34714135"
     CDS             complement(1004347..1007508)
                     /gene="RAD2"
                     /locus_tag="KLMA_10473"
                     /codon_start=1
                     /product="DNA repair protein RAD2"
                     /protein_id="XP_022673990.1"
                     /db_xref="GeneID:34714135"
                     /translation="MIFFVTFKAMCNIESLYASLLHSKLAHRKNISTPKKASSIRSPS
                     LTMGVHSLWDIVSPTAKPVRLESLNERRMAVDASIWIYQFLTAMRNKEGDALRNAHII
                     GFFRRICKLLYYGIKPVFVFDGGVPVLKLNTIRERKERRQGKRDSANATARRLLAKQI
                     HQSQVEKEASPKKKNENKSDEVSSKNQPFYPHDEYHLPDIKGFSYEKGDMRITDSEDY
                     KTVMDQIDDLDGIDLDTVNPASKEFDELPKSTQYLILSALRLKSRLRLGYTKEQLEQV
                     FPDSMEFSKFQIEMVKRRNFFTQKLMNVTGMHDGGASKLNEEVVNRVAGQRDRQYALI
                     RTENGWALSLAQNDGSESAKAIKLEDDDDDDEAENLDWEEVDTKPKPKKKELDYSINA
                     SLLPRLSSTKMQGGSQSFLDKRPDLAPTTSHLLDEDGEKNSEEEDDYVQLLKETRAMA
                     QYQESQSRLKEQPPIQVNLESSEAESESEAESDGEFEDVNFKPTSIPPNVRPSTESSK
                     DLEPISGGTGGAGAAGAAGAGAAGAEPPLTHSTKSTAIPVLDNQESRKDLENIVNKIP
                     QFSFSLNVKGKAFENEKPSEEPSAPAEKKSKGKSTDAPVPEVPAWFSSSTNDNPYNQS
                     SFVTDREPSNSKTDENYGLLTGEAAQELVRNRARFHQEVVELNDESDSDSDKEDVIEI
                     QNPEQEVKETSAPKTDAGSQPESESEAESEPASDSDSEVVREQLPLLDYDFYEDEEER
                     LAEQLTKEQEDYNQFKSVLNPNLVQNAFLDDDEIYEQQRKDKRDADEVTVEMIHEIQS
                     LLSRFGIPYITAPMEAEAQCATLLQLKLVDGIITDDSDVFLFGGTHVYKNMFQEKNYV
                     EYYSLDLLDQKLGLDRDKLIQLAQLLGSDYTAGLKGIGPVMGVEILAEFGSLKEFAKW
                     YNEGQFDKQKLENETTFQKQLRKRLVKNDIVLDENFPSAAVYDAYIHPTVDSDKTKFV
                     WGSPDLDKLRSFLQQTIGWNREKSDEVLVPLIRDLNKRKSTGVQKRINEFFPVQYLQQ
                     EKQYKLGKRIETATSKLKKRRLK"
     gene            <1008740..>1010266
                     /gene="TNA1"
                     /locus_tag="KLMA_10475"
                     /db_xref="GeneID:34714136"
     mRNA            <1008740..>1010266
                     /gene="TNA1"
                     /locus_tag="KLMA_10475"
                     /product="high-affinity nicotinic acid transporter"
                     /transcript_id="XM_022821718.1"
                     /db_xref="GeneID:34714136"
     CDS             1008740..1010266
                     /gene="TNA1"
                     /locus_tag="KLMA_10475"
                     /codon_start=1
                     /product="high-affinity nicotinic acid transporter"
                     /protein_id="XP_022673991.1"
                     /db_xref="GeneID:34714136"
                     /translation="MTKVMEVTSQNGSLGEDIIEENVNGCKESLGSGSVVDEVCSGVE
                     EERPSLTHPMESRVVRKMDMYLIPLLCLLYFLSNLDKSNIGNAEVAGLSKSLGLVGNQ
                     YGNCVTVFFATYIFFDPIGANLLKVIGPKYMMSGCLLCFGAISLGTAWVKDYGHLLLV
                     RILLGAFEATIYPSINMYLSMCYRREQYAIRFAWVFFAACISSSFGGLISYACSKING
                     SLAAWQYIYIVEGSISIGVVPLYVFGLANNLEDSWFWTPEERKYIVERYQTMSTFNPE
                     DKFNWEQVWLAVKDIKTWVSAVALFGIDMSSFGLTVFMPIIITSMGFTHVNAQLMTVP
                     IYFLTAVTFFICAYISDKIRIRSPFIFGSCISCAVGLAIVLGSEKHGVRLFGVFVTAL
                     GIYVNASMNCLWLSGNNGNYFKRATALGINLFVGSSSGLVSGQIFVAKDKPKYTKGLS
                     TCLGLQIMAAGLTVVQFLMYRRLNKKKEALIKHCEEHDEPIPYDERLSDMNPQFKYMY
                     "
     gene            complement(<1010467..>1014975)
                     /gene="KOG1"
                     /locus_tag="KLMA_10476"
                     /db_xref="GeneID:34714137"
     mRNA            complement(<1010467..>1014975)
                     /gene="KOG1"
                     /locus_tag="KLMA_10476"
                     /product="target of rapamycin complex 1 subunit KOG1"
                     /transcript_id="XM_022821729.1"
                     /db_xref="GeneID:34714137"
     CDS             complement(1010467..1014975)
                     /gene="KOG1"
                     /locus_tag="KLMA_10476"
                     /codon_start=1
                     /product="target of rapamycin complex 1 subunit KOG1"
                     /protein_id="XP_022673992.1"
                     /db_xref="GeneID:34714137"
                     /translation="MVVYGPQPLTRLNTETRHGFEEQYSSEKLLQSLANNFIFYYDDK
                     RHRTNGNPVPDEVKEEDKDGYYQPIYDWKIVKDRQKTVAAALLLCLNLGVDPPDVTKT
                     QPCARLEAWVDPLSFQDSKKAIEQIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFCN
                     SLRRASKDERILFHYNGHGVPQPTPSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIYV
                     WDCNSAGNIVSNFKKFVQKRIRDDKEGNHDVASPSPTESYTECVQLASCENNELLPMN
                     PELPADFFTCCLTNPIEISVKVFLMQSPLKDTKYAPFFQNNDPRRKETGINEMPNITI
                     PGKLSERRTPLGELNWIFTAITDTIAWTSLPRALFKKLFRHDLMVAALFRNFLLAKRI
                     MPWYNCHPVSDPALPDSIADHPMWRSWDLAIDEVLTKLLEGSHSNSTNTTFADTQLSK
                     APSDVSENLDGMPNKSSLGNLSSMSLVNYNQASQNSGNSTSYPTAAQQQQQQFTKFFE
                     QNLTAFDLWVKYGANSRHPPEQLPIVLQVLLSQVHRVRTLVLLSRFLDLGPWAVYLSL
                     SIGIFPYVSKLLQSPAHELKPILVFIWARILSIDYKNTQTELIKERGYQYFVKMLVPE
                     FGVPRAQSISSNGSPLTMNVPASSTTQRYQMYQHQQQQAYNNATLLSNNNTTDEQKAM
                     AAFVLSCFVRDFPLGQRHCFSIELVNKLCFFIENSEVPLLRQWCIILIGQLFIHNPLH
                     KTLCLENENMNTVVESLKDPIPEIRCAALLAIKYFLSEEDDVNIILKLQQEFQQQIQQ
                     FQAQLQLLQSQQNQQQQQGNQQNNTSHIQQQYYQIQQQLQNVQTSITQLQSINLRNLK
                     QYEIKTIVTTLSLVNDGSPIVRKELIIFLSQVVERYIDFFTIIAFTEISSEIASLESN
                     GHEDDVRNVSSVGHGSIFNTVWKALLILSEDPFPENKDLAQDVIDYILLKLNEHPKLG
                     EIIKEMEQYILSKNAVNSKGLVSSNKLPTIRRPASLNNNKKDSVRNESPNDRRVFSMS
                     TLFKALGFSHEQESYSDNESIRSSGGRAAQGLSLMGIEYGTNPRAFPMMYKKRDTEVK
                     LPLESRFLDYCSEYFQEPQMKKHEVDEPGSIEYTAREWKRNRNESIIQETQSEKELAL
                     YGDWSRKTVTFDNKTQPKILLFTQFDNYVTASDDRDNVTVYDWSTQEKLARFSNGNPF
                     GTKITDMKFLNDDDTPLLLTGSSDGVVNIYKDFYDMEKLHMISSWRGLTDLLLTPRST
                     GLLTEWQQSRGSLLVTGDVKIIRIWDALTESIEVDIPAKSSALITSLTSDQLTGNIFV
                     AGYSDGSIRVYDRRMDPRDSMIRLWKTAKRGTSPVGSWVNNIHLQRGGYRELVSGTNN
                     GVVSLWDIRNDQPVCNFTDEGEPGKKSGSTMTSMQVHEHAPVIATGTKEIKIWTTSGD
                     LLRTFKNHGYGHSNTISGMASGTRSSPFISALTFHPHRMMLAANNSHDTTFNIYECYD
                     SRREYMYY"
     gene            <1015763..>1016650
                     /gene="IKI1"
                     /locus_tag="KLMA_10477"
                     /db_xref="GeneID:34714138"
     mRNA            <1015763..>1016650
                     /gene="IKI1"
                     /locus_tag="KLMA_10477"
                     /product="elongator complex protein 5"
                     /transcript_id="XM_022821740.1"
                     /db_xref="GeneID:34714138"
     CDS             1015763..1016650
                     /gene="IKI1"
                     /locus_tag="KLMA_10477"
                     /codon_start=1
                     /product="elongator complex protein 5"
                     /protein_id="XP_022673993.1"
                     /db_xref="GeneID:34714138"
                     /translation="MSSTNNNPKILLKRTLSLKEQASLILCVDTLAQSSRYIIDEFIY
                     NISDEVPVVFVSFETVTAPKYAKQFIDASGKSVKQLIAAIQPYLPQKEEKAPRMHLLI
                     FDSLNYIPSEQLTQFISTIAAPFVTILATYHQSIPLWRSSELQNYPTSSQLLQFISNT
                     VIEVSPNTQLDEDDLDSELARFVIPRNLNSNTYYITVVNKRKSGREVKNKFLINSKTH
                     EYEYCIEKTTSSSEETPELFDGLTTFNLNTSEKQKLAKDQVDLPFLEAQSFNSGGAIV
                     YEFEKDDDYDEEDPYEDPF"
     gene            complement(<1016769..>1018658)
                     /gene="GPI16"
                     /locus_tag="KLMA_10478"
                     /db_xref="GeneID:34714139"
     mRNA            complement(<1016769..>1018658)
                     /gene="GPI16"
                     /locus_tag="KLMA_10478"
                     /product="GPI transamidase component GPI16"
                     /transcript_id="XM_022821751.1"
                     /db_xref="GeneID:34714139"
     CDS             complement(1016769..1018658)
                     /gene="GPI16"
                     /locus_tag="KLMA_10478"
                     /codon_start=1
                     /product="GPI transamidase component GPI16"
                     /protein_id="XP_022673994.1"
                     /db_xref="GeneID:34714139"
                     /translation="MRLDWWLHFLVLLVASVADNNETITETETESKLEEKISSKPYSP
                     KLVSLDVPIDYKFQEKLDLTPLPNNFLLASFQFWMESEKFGIEKDGKDGDEYSHHTIF
                     PKAIGPLMSQTNTRQLHLRFTHGLWDSEEWGQLPHSGSKSGGNGVELWAIVEAADNEE
                     AFQSWITLANSLGGLFCASINFVDSSKTTFPVSSFLPKEDEDIPVFNSSNRLYLMRAA
                     LANEPICTENLTPFVKLLPTRGKSGISSLLDGHKIFDSNWHSMSIDVETVCNEHDNMC
                     SLRMEEFIETVVNVPNSLARAERPIPKPLPGDELRCDMSKPYDAFQCFPLPQSKEVSY
                     TLSKLFGKKIRGGSLLAHTESRICAHVTSEWNALIQVGESYYATDDNCFDLKNTEPHD
                     IHLETTNSGDIVPLKDAPIYISRALTGYAQDRGGLRSVFSNPSNESVELVYFESLPWF
                     MRIYLSSLTLESDNSELTLGDIVKSTFYSPAKDRERPTHLERTMVIPPNTTFAISYQF
                     DKSLLKYAEYPPDANHGFEIEAAVATVLKPENYQMRTSSLLLYLSTPDFSMPYNVIIL
                     TSTVMGLAFGTLFNLLSKQLLTVEEADKILANSGIKVKLAKVRARVLDVLKKKTSKPK
                     ENKIS"
     gene            <1018929..>1021796
                     /gene="HSH155"
                     /locus_tag="KLMA_10479"
                     /db_xref="GeneID:34714140"
     mRNA            <1018929..>1021796
                     /gene="HSH155"
                     /locus_tag="KLMA_10479"
                     /product="U2 snRNP complex subunit HSH155"
                     /transcript_id="XM_022821762.1"
                     /db_xref="GeneID:34714140"
     CDS             1018929..1021796
                     /gene="HSH155"
                     /locus_tag="KLMA_10479"
                     /codon_start=1
                     /product="U2 snRNP complex subunit HSH155"
                     /protein_id="XP_022673995.1"
                     /db_xref="GeneID:34714140"
                     /translation="MKSVDFKKPSEMRSLVSQYTAPKDALESTLGSDEVEDELMANQK
                     RRQVYEKQSEYHKRRFERSLDGKGEDTEAPDSNKRQKTEHNDKEKEQEQDGYMLPTTS
                     RNVVQALSEEVITEVPGVPNLQFFKPSDKAHFALLFDERSESDLSEEERKRKQLLKLV
                     LRIKNGLPSSRKIAFKILARKVAFFGPSICFDTILPILLDKTLEDHEHQMMLKLIDRI
                     LLQLQDSVKPYTGKILMVVSPMLIDPVILTRATGRDIISNLAKAVGLPTMIYTMRPDL
                     DHDDEYVRNTSARAMAVVAKALGVNQLVPFLRLVCKSKKSWKARHTGIKTVQQIAILM
                     GIGVLPYLNDLISCIDKGLIDDHLPVRIMTAQAVSSLAQSCQPYGIECFNPVLEPLWR
                     GIKRNRGRELAASLKSLGFLIPLMDPDYASYYTEEVMRIVKREFNSPNDEMKKTVLFV
                     IQKCSVTEGVTSKYLREELAPEFFKQFWIRRTALDRQLNKIVVFTTVLLAEKLGSAFT
                     LEKLLPPLKDESEPFRTMAAHAVNRVVKKLGTNDVDDRLEARLLDALLIAFQDQTDGE
                     KIVYTALGNTAKSLDTRMKPYVAPISSTILEHLKHKKPMVRSFAANLCTILIPVFKRC
                     GEMALINKFNIILFESLGEVYPEVLASIIFAMDKIASQIPFSELQPPPNQILPTLTPI
                     LRNSHSLVQESTVKLVGKIARRGPEYVSPKEWMRICFELLEMLKSPVMPIRRAANKTF
                     GYIAKAIGPQDVLVTLLNNLKVQERQLRVCTSVAIGIVAKTCGPFIVIPALMNEYRTP
                     DTNVQNGILKAFAFMLEYIGPMSKDYVYPLIPLLQDALTDRDLVHRQTAATCLKHLAV
                     NCAGRGLEDAFVHCMNLLFPNIFETSPHVISRIIEGIDGLRTALGPGVAMNYVWAGLF
                     HPAKNVRTAYWKLFNSACVSQPDALVPYYPVNEVDELNLIL"
     gene            complement(<1021873..>1024374)
                     /gene="APL6"
                     /locus_tag="KLMA_10480"
                     /db_xref="GeneID:34714141"
     mRNA            complement(<1021873..>1024374)
                     /gene="APL6"
                     /locus_tag="KLMA_10480"
                     /product="AP-3 complex subunit beta"
                     /transcript_id="XM_022821773.1"
                     /db_xref="GeneID:34714141"
     CDS             complement(1021873..1024374)
                     /gene="APL6"
                     /locus_tag="KLMA_10480"
                     /codon_start=1
                     /product="AP-3 complex subunit beta"
                     /protein_id="XP_022673996.1"
                     /db_xref="GeneID:34714141"
                     /translation="MVDSIQRITSALQSARDLTLGAAAVASSRIGESSYTQYSKSIDP
                     DALIRLLNSRNSREVKDAMKRIMSLLATNDQTMELRGLLADVLKNITSDDLKVKRMVC
                     IYLLRFAESDPNLALLSVNTIQKSLVERDPEAKALALKALSDINVSSLYPITLQSVKK
                     CVSDVSPLVRSTSAFAVYKLFQECVAASSRKGATAHHQDDGVADMRKNELVSLIVDLL
                     ADADPLVISSAIIVLHNCIPDRLDLLHGHFRRYCQALTSLSHWAQPLLVESLIQYSRR
                     YIERPKYVNKNDQSEIPVPFNQDEDETLGPEFFKDHELVMDPDLELFLNSLRPLLFSS
                     NAAVVASVAKAVFHLAPLSKFREFGIPQCLIKSFQLSSNENKCVILQVIAYYSVYDPR
                     SFARLYQSFLPANNDDSLVGSYKLKIISILINESNVQNIVRELKHHISSSSDTAIVKQ
                     ALSTLVVCAYVSNGICSHVIKWLLEFMETDELKDVEVTSELVNVLRHLIQINPSKNLS
                     VMIKLSEIITTTDNLSGYAKAGIIWLFGEYLHTEPRIVPDILRKLIPNFAEESKECRM
                     QILILAAKILSFDIDKSEGTYDFENSRIAQLYDAVIYLAKFDDDFDIRDKARSFDSLF
                     TNQRYEILTLLLQAPKPWPAFSVFSYEDKAKDIAHLDLSQEVVNSFQAEEWNNDREEE
                     VDRTPAPVNDFMKNKSSISSSTFFANRSRNTEPRTMESPSFIKSPSPDVTTFTSSKGK
                     TYKLQSLEEFFADVPERPKTKKKIVIQEESETDSAEESEESEDDDDDDDESENSEDDE
                     NEDDEDDDEEEEEEDDDDNSNESESSNHILLSPDN"
     gene            complement(1024692..1024766)
                     /locus_tag="KLMA_R116"
                     /db_xref="GeneID:34718631"
     tRNA            complement(1024692..1024766)
                     /locus_tag="KLMA_R116"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34718631"
     gene            <1025384..>1026631
                     /gene="ABZ2"
                     /locus_tag="KLMA_10481"
                     /db_xref="GeneID:34714142"
     mRNA            <1025384..>1026631
                     /gene="ABZ2"
                     /locus_tag="KLMA_10481"
                     /product="aminodeoxychorismate lyase"
                     /transcript_id="XM_022821784.1"
                     /db_xref="GeneID:34714142"
     CDS             1025384..1026631
                     /gene="ABZ2"
                     /locus_tag="KLMA_10481"
                     /codon_start=1
                     /product="aminodeoxychorismate lyase"
                     /protein_id="XP_022673997.1"
                     /db_xref="GeneID:34714142"
                     /translation="MMDSSALDAIKQKIVRNVVIPDFDFSKQEFQILATIRYDPNFTH
                     VFASQELVETDDDFSSQLDPQLTSLMDSSSFLQQSDDSVGKDDFLEYLDYNDTSNSSV
                     LSSPISGIFDMSSSGVFHRDPVLQGLYETANYSVKAGASQGQSQSPGEDESTDASLWS
                     IYYNRFFLLGEHYKRLKLALDFFQWPLALTPKVFLTQLVHSLPVQGSMSIEDKMRALL
                     NVNVSYKMRVLVSKDGNMKIEAHELPRFPGYFPDTHEYIVRNLLSGFLDGEPTWDVYI
                     NTEPINVSPFTTFKTTKREHYNKARENMEQLKRDIPDQRPKSEILVYNNLYQLMEGSI
                     TNVAVKSQVGTDSDAVRYTTPYLASGCLCGVTRYFLLRKGLLQEDAIDIRDLHLGDEI
                     ILFNGIMGCVKGVIRNSVDFSGV"
     gene            complement(<1026683..>1027477)
                     /gene="BUD32"
                     /locus_tag="KLMA_10482"
                     /db_xref="GeneID:34714143"
     mRNA            complement(<1026683..>1027477)
                     /gene="BUD32"
                     /locus_tag="KLMA_10482"
                     /product="serine/threonine-protein kinase BUD32"
                     /transcript_id="XM_022821795.1"
                     /db_xref="GeneID:34714143"
     CDS             complement(1026683..1027477)
                     /gene="BUD32"
                     /locus_tag="KLMA_10482"
                     /codon_start=1
                     /product="serine/threonine-protein kinase BUD32"
                     /protein_id="XP_022673998.1"
                     /db_xref="GeneID:34714143"
                     /translation="MSSEIIAGISSVLTENIPLTPISQGAEAVVFTSPVHPYLPPQVA
                     ASDDEALYILKYRPEKKYRHPVIDKALTKHRTLGEARLLAKLRLIDGLNVPKLIGCDP
                     YHGCIWLEFLGEDLPNGHGFSNLKNFLWMNASDPYSDLVKEVLIKVGKQIGLMHWNDF
                     CHGDLTSSNIVLVRSGDHWEPYLIDFGLGSISTLVEDKGVDLYVLERAIISTHSSFSE
                     RYNGWILEGFKSVFEANGKVGLGKYKELIKRFEEVRLRGRKRSMIG"
     gene            complement(<1027852..>1030113)
                     /gene="MES1"
                     /locus_tag="KLMA_10483"
                     /db_xref="GeneID:34714144"
     mRNA            complement(<1027852..>1030113)
                     /gene="MES1"
                     /locus_tag="KLMA_10483"
                     /product="methionyl-tRNA synthetase"
                     /transcript_id="XM_022821807.1"
                     /db_xref="GeneID:34714144"
     CDS             complement(1027852..1030113)
                     /gene="MES1"
                     /locus_tag="KLMA_10483"
                     /note="cytoplasmic"
                     /codon_start=1
                     /product="methionyl-tRNA synthetase"
                     /protein_id="XP_022673999.1"
                     /db_xref="GeneID:34714144"
                     /translation="MASQISFDQSKLHTATLQLANNIKLAYALLSAPASLKLEENSEV
                     SVSQLIVGSSGFRLFDANAILRYVLNDFESEESDEYSFAVSSLEALASHKDQIKEHVT
                     ESVKKSIETYLTSVEEPLSATRIVTFANSYALDSAAVEAKFPLASVPEKLQKAVALAK
                     SKAVRSSTDYKHTGAVNVSQEYLMKSQGSEILPKDGERNILITSALPYVNNVPHLGNI
                     VGSVLSADIYARYTKGRNYNTLFVCGTDEYGTATETKALEDGVTPRELCDKYHKIHAD
                     VYKWFQIGFDYFGRTTTEKQTEIAQDIFLKLNDRGYLEEQSMKQLYCPVHKGYLADRY
                     VEGTCPKCGYEDARGDQCDKCGALLNPFELIDPRCKLDEGKPEPRNSDHIFLSLDKLE
                     PQIKEWNEKASSKGEWSKNSKTITQSWLKEGLHPRCITRDLVWGTPVPLEKYQDKVLY
                     VWFDACIGYVSITANYTDKWENWWKNPDNVDLYQFMGKDNVPFHTVIFPGSQLGTGED
                     WTMLHHLNTTEYLQYEGGKFSKSRSIGVFGNNAQEIGLSPSVWRYYLASVRPETSDSQ
                     FSWSDFAARNNSELLANLGNFVNRVVKFVNAKYNGVVPEYKVENLPGYDQLKKDLDEI
                     LANYVNTMEHVHLRRGLEIAMSLSSRGNQFLQENKLDNSLFAQQPDKSDAVVGVALNI
                     IYTVASIMAPFIPETSETIYRMLNAPPLRIDDHFNLPIRAGHNINKAEYLFTRIDEKD
                     VEEWRKRYAGKQV"
     gene            complement(<1030773..>1032308)
                     /gene="HAS1"
                     /locus_tag="KLMA_10484"
                     /db_xref="GeneID:34714145"
     mRNA            complement(<1030773..>1032308)
                     /gene="HAS1"
                     /locus_tag="KLMA_10484"
                     /product="ATP-dependent RNA helicase HAS1"
                     /transcript_id="XM_022821818.1"
                     /db_xref="GeneID:34714145"
     CDS             complement(1030773..1032308)
                     /gene="HAS1"
                     /locus_tag="KLMA_10484"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase HAS1"
                     /protein_id="XP_022674000.1"
                     /db_xref="GeneID:34714145"
                     /translation="MAKDSVKKESRKRAREENNEEVSVVETETETKPTSNSNSSSDGN
                     AVGEDFADLKLSDGTMKAIAKMGFTKMTAVQARTIPPLLAGKDVLGAAKTGSGKTLAF
                     LIPAIEMLHSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANR
                     RQEAEKLMKGVNILIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQ
                     IIKILPNEDRQSMLFSATQTTKVEDLARISLRPGPLFINVDSEKDTSTADGLEQGYVV
                     CDSDKRFLLLFSFLKRNQKKKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKR
                     TNTFFEFCNAERGILVCTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTKG
                     KGKSLMFLTPNELGFLRYLKAAKVPLNEYEFPSNKIANVQAQLEKLIKSNYYLHQIAK
                     DGYRSYLQAYASHSLKTVYQIDKLDLAKVAKSYGFPVPPKVNITIGASGKTPSSNKRR
                     KKD"
     gene            <1033208..>1035361
                     /locus_tag="KLMA_10486"
                     /db_xref="GeneID:34714146"
     mRNA            <1033208..>1035361
                     /locus_tag="KLMA_10486"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821829.1"
                     /db_xref="GeneID:34714146"
     CDS             1033208..1035361
                     /locus_tag="KLMA_10486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674001.1"
                     /db_xref="GeneID:34714146"
                     /translation="MTDDWFDKVDVEALYAGKVVGCDDCGQSPVKAKESGIVCGPILR
                     LISVDYSKKVYRGSMLIIVKNSGEQPVVKLQVGPAKSEDGSSPSIDEPRTLKCTLFYE
                     ESGSEASYKFYRYSIEVPLQGYEQMCKYSVDSEIEPHYRFFVPSEEQNFNTISVSCNG
                     FSLSVDTTKFKGSMWYDILRKHEKVRYHVILGGGDQIYSDSINIYCDRFKHWLKIKDP
                     IKKHKTKATPEMKRDLDAFYLQEYLDWFGYGHWKGSTDKSKTTQRCFPISMSTIPSLN
                     IFDDHDIIDGYGSYSHQFMASEVFKQVGKSAFKYYMLFQHHTSTSEREAYLQDPCWVL
                     GAQPGDYIGEKSHSIYTRLGPSMAVLGIDCRTERKVNQVCSSKTYDALFARLRQDLSE
                     NENKLDHLLVMLGVPIAYPRLVWLEYLFSSKLLAPLKWLSKKGIFARGLVNEFNGDVE
                     LLDDLNDHWCAHHHKRERNALVARLQDFGAQQGVRITILSGDVHLASVGRFRSAGHRH
                     LDHVIPNSDSNAAPSSPEHDVRLMMNVISSAVTNTPPPNQMALLLQNRAKKPHHFDHE
                     TDEDAVPLFYEDVTGEPRSANAFMNRRNWSDIIPVANLLQNQYLSNQYKLNVGDVMKP
                     GKVGTGVTRGTNSGETHESAKAATKAAAATKSGENTTEESYPVTARGIVATIHCEKDA
                     LSASSETVGYTLPIPELCARVDKLSHVGIKHLNLE"
     gene            <1036118..>1037827
                     /gene="TDA1"
                     /locus_tag="KLMA_10487"
                     /db_xref="GeneID:34714147"
     mRNA            <1036118..>1037827
                     /gene="TDA1"
                     /locus_tag="KLMA_10487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821840.1"
                     /db_xref="GeneID:34714147"
     CDS             1036118..1037827
                     /gene="TDA1"
                     /locus_tag="KLMA_10487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674002.1"
                     /db_xref="GeneID:34714147"
                     /translation="MSGKSDYVTIGEKVWPDGCRAVGQGTATGLGSGPSQYQCTYVTK
                     KSALGDGHFSVVKECMNTMTKDRYAMKLVDKRLVVDKLQLIQREISVLKRISELIREL
                     ERVKKTESGGNQAVFEGHHHVLQLFDFFETPKNIVLITQLCEPEDLYDKILNAGHLDL
                     KKQVQPFTACILSALQFLHEHGIIHRDIKAENVLFRLRNSSSSNALLEVPQEGADYDT
                     SAHDLILADFGLAIKASTGSTEFVGTISYLAPEIVACKNSARMSAVQLNRLRPYGRGV
                     DIWALGVLCYFMAFGYMPFDCETDAETMDCITKSDYYMDEEKVQDPDFKEFWSFLERC
                     FDVEMDTRSSADELAAHGFLCAQYFPNKLAKSTDVAKGNNATKLTTKPVLKVSKSSSN
                     IHSRAPPSRSASTLSMDLGESMRRSNSSEANLNRIRETLKKTLSMTSIKNAGGIPNPN
                     ANIANNFNRGISTFTLEPELPNVALMNGCLCATPKSYSNFTTSPVMSRNASRSNINTA
                     YGSWNEPHISALNSGATLTDSEAQAQNETMSLAMALGTGTSQGTVTGGEPIHRNHKTV
                     FEL"
     gene            complement(<1038117..>1038854)
                     /gene="FOL2"
                     /locus_tag="KLMA_10488"
                     /db_xref="GeneID:34714148"
     mRNA            complement(<1038117..>1038854)
                     /gene="FOL2"
                     /locus_tag="KLMA_10488"
                     /product="GTP cyclohydrolase 1"
                     /transcript_id="XM_022821851.1"
                     /db_xref="GeneID:34714148"
     CDS             complement(1038117..1038854)
                     /gene="FOL2"
                     /locus_tag="KLMA_10488"
                     /codon_start=1
                     /product="GTP cyclohydrolase 1"
                     /protein_id="XP_022674003.1"
                     /db_xref="GeneID:34714148"
                     /translation="MENKHISQVSDLERNSTPLNIRPASPYTLNPPVEKDGLSWPSIG
                     ARKRVDESEEEEQARADRIAEAVKTILQELGEDTSREGLLDTPQRYAKAMLFFTKGYQ
                     DNILDDVIKKAVFEEDHDEMVIVRDIEIFSLCEHHLVPFFGKVHIGYIPNKKVLGLSK
                     LARLAEMYARRFQVQERLTKQIAMALSDILKPRGVAVVIEATHMCMVSRGVQKTGSST
                     VTSCMLGYLRESHKTREEFLNLLGRRS"
     gene            complement(<1039247..>1039864)
                     /locus_tag="KLMA_10489"
                     /db_xref="GeneID:34714149"
     mRNA            complement(<1039247..>1039864)
                     /locus_tag="KLMA_10489"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821862.1"
                     /db_xref="GeneID:34714149"
     CDS             complement(1039247..1039864)
                     /locus_tag="KLMA_10489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674004.1"
                     /db_xref="GeneID:34714149"
                     /translation="MGRPNDGLPTYEEVISQETGNSNTPPLPARPQTHSESHSYSYTT
                     SQTQSEYYGGAPPQQPPRPSNNNNNNLPFTYPPRYYCRKCRNTGYKIKNGHKCKTCWS
                     KFYTPPPPAPAPPVTAVPVTAAPITVAVNPSGIVYGPVNPVPGPAPAAPNANPIYVRP
                     GDPRIGGFLCPTCNGTGQVRFLLDKVPCVDCHGVGRVFNAYHRPY"
     gene            <1041554..>1045699
                     /gene="YTA7"
                     /locus_tag="KLMA_10491"
                     /db_xref="GeneID:34714150"
     mRNA            <1041554..>1045699
                     /gene="YTA7"
                     /locus_tag="KLMA_10491"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821873.1"
                     /db_xref="GeneID:34714150"
     CDS             1041554..1045699
                     /gene="YTA7"
                     /locus_tag="KLMA_10491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674005.1"
                     /db_xref="GeneID:34714150"
                     /translation="MTGHGSDEIAAENVDGGSSAAGQNTGQDQGLGQGQGQGQGQDPG
                     VGAGAGITADGEPAKPPGRVKRRSGPIGTRSRRAPPKKPPRAAPRAADDDDVSFHEED
                     LDDLEESEESEEDDSDEYIDSADERKRVARRRDRSFIVKDDMDGSGDESIKETDLELD
                     DDDDDDDDEEVNVGRGRGRGGRGRGRRRTRMDEEEDEDEHELLEEEEQPRKLRTRTRS
                     MRASGASGASGSGSGSESDGVGGRRRRGRARTRTRRSTAEALSLADEIRELQEDSPIR
                     EKRSLRERTKPVNYAIPPPLSETQAAGLAAGNTYPGETGYLAAAGALNGVPNVQPMAN
                     GNGNGISNGNGNGLGLGAAGAAGGFYPTASFQSPRGKRGLHAGTSFGPIRRLFPTGGP
                     FGGNDVTAIFGKNVQFYNNNEQTNKFLDSDSSDDEILPLGAAEDPEKKKLKEQRKLNK
                     KKKPEIADLDPLGVDMNINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGV
                     LFHGPPGTGKTLMARALAASCSNEKRKITFFMRKGADILSKWVGEAERQLRLLFEEAK
                     KQQPAIIFFDEIDGLAPVRSSKQEQIHASIVSTMLALMDGMDNRGQIIIIGATNRPDA
                     VDPALRRPGRFDREFYFPLPDLHAREKILQIHTKKWDPPVSPQFIKKLAGLTKGYGGA
                     DLRALCTEASLISIQRKFPQIYKSDAKLKVDPKKVVVKARDFMLALQKIVPSSARASG
                     SSPQPLPKAVEPLMGDQFAKVRDQLAKILPKQNERLQSGSSIIQYYLENEDVDEDGNG
                     SGPDDDGSGFDRHEFLERIKKSRVWKPKLLITGPAGNGLQYITSATLNFLEGYNIQML
                     DIPTMVSDSTRTMEATLVQTFAEAKKRQPSVICIPNLELWLQAVPQSCLVTLTTLFRS
                     LQSTDNVVLLAIADGLSRSEINEAPLSMFAFGSNVIEIHRPSSSQRHEYFQSVADLVK
                     MKPTQYIESRKRKKPLKQLPVADEPLPHEVDETGRVLTEEERLKLELKKFQHQDMKLK
                     NTLKIKLSGLMDLFKNRYKRFRKPPIDDAYLVHLFEPESFAANQGWQPAYVKDGDMIL
                     EVATGRKFYNMDLDIIEERLWNGFYSEPKQFLKDIELIYLDATTSADRERVIKASEMF
                     ANAQVGIEDISQPEFVAECKATRQRELLRQELFLKEEKERIEREQQEVTEVIPEDSAA
                     QVELTTASGNQVQSQAQLNANEKLPPAEEPASIQPYEVPQQSATEEKANGDLSTLNDK
                     ENDEAMTDSTPPTQPDAQKEQKLDGKPASASESKPEPESEPESESESEPEPEPEFIYD
                     IARINDLVSALEKRTKKFTVEKLEEVYSVITNIIWDDRLSWDKTKTIEKLEQFVETLQ
                     TSK"
     gene            complement(<1045874..>1047271)
                     /gene="HER2"
                     /locus_tag="KLMA_10493"
                     /db_xref="GeneID:34714151"
     mRNA            complement(<1045874..>1047271)
                     /gene="HER2"
                     /locus_tag="KLMA_10493"
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit A"
                     /transcript_id="XM_022821884.1"
                     /db_xref="GeneID:34714151"
     CDS             complement(1045874..1047271)
                     /gene="HER2"
                     /locus_tag="KLMA_10493"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit A"
                     /protein_id="XP_022674006.1"
                     /db_xref="GeneID:34714151"
                     /translation="MSLRNALTKLHRIPEVQNQYNVFTHINENAANQIKNIELSDKPL
                     SYTVAGIKDNIVTKDMPTTCGSKILEGYKSPFDATVVSLLLEAGTVIAGKTNMDEFGM
                     GSAGVHSHFGPTFNPLFDAKDRIIAGGSSSGSAAAVAADTVDFSLGTDTGGSVRLPAS
                     YTSVYGFKPSYGRISRYGVISYAQSLDTVGIMAKDIDIVKKVFTILDKHDEKDPTSLS
                     EEVRHKFEQLSSKKKKLRIGVPEEFSQENIPQEFKSKLAGIIKNLMARGHEVYPVSIP
                     SVKHALSIYYTLSPAEAVSNLSRFDGIRYGYRADSDIEDGVLFTPTRSAFGPEVQNRI
                     ILGNYNLCSEAFKNNYIKAQRLRVQLINDFDCAFRFPNCLSNNSVNHEGVDIMLAPTS
                     TSLPTTYEEVLSKEEKSPLNTYINDVFTMPISLSGLPAISIPVGHAFGIQAFSQHGND
                     GELLDAVSEIQECAL"
     gene            <1047554..>1048657
                     /locus_tag="KLMA_10494"
                     /db_xref="GeneID:34714152"
     mRNA            <1047554..>1048657
                     /locus_tag="KLMA_10494"
                     /product="dynamitin"
                     /transcript_id="XM_022821895.1"
                     /db_xref="GeneID:34714152"
     CDS             1047554..1048657
                     /locus_tag="KLMA_10494"
                     /codon_start=1
                     /product="dynamitin"
                     /protein_id="XP_022674007.1"
                     /db_xref="GeneID:34714152"
                     /translation="MASEIIDLSASVEEFGLEPDNTGKVIYETSDVDESEVEVSKGPQ
                     NEDIIEDPVSDVANSTEVYESTQLSADQTDFSGRLDSLPTYKSRFVKETPKQKLARIQ
                     REILEVQHELEVENSNSNEKDLLDVKNLYKSLSRFNTEKMGELQRRLLSDSESQETET
                     VRLPNIKLDPTSIMKLEKLEQKLTSMESQIGISTDARSSKSIISTINDIYRDMNILKM
                     DEQSLTNFQKRMKEISDQYDQSIIGRRAQKDPELMTEIEKKMKTTEAKLQDIYVNYQL
                     LNRYSKLIPQITQRLKSLSSLHGSINDMNNTVAQINDHISSMDGQIEKWSTLVNTAND
                     ALTSHETAFDKKKNTLEAQLHETESRITKLQSK"
     gene            <1048990..>1054809
                     /gene="SLH1"
                     /locus_tag="KLMA_10495"
                     /db_xref="GeneID:34714153"
     mRNA            <1048990..>1054809
                     /gene="SLH1"
                     /locus_tag="KLMA_10495"
                     /product="antiviral helicase SLH1"
                     /transcript_id="XM_022821906.1"
                     /db_xref="GeneID:34714153"
     CDS             1048990..1054809
                     /gene="SLH1"
                     /locus_tag="KLMA_10495"
                     /codon_start=1
                     /product="antiviral helicase SLH1"
                     /protein_id="XP_022674008.1"
                     /db_xref="GeneID:34714153"
                     /translation="MVESVQSFPPLENYMVPEVDNELEDDTVNNNGDKLLVMSQDRNE
                     WDEIFDQFSNLSSERLQKLISNKHSTSNAQSQIFKELFRLLDQVESDFPRDQLLEQLI
                     ELLRNNESTGTADQDLFDYLGAENIELISFLLEHQDVLKQMPVPSASGNDADDGSRFM
                     TEEDIRAQVMMNREKGKNAKLAPMQKRVRYPHVFRQYEDGGSSMLSFAGQKFALPIGS
                     TRATFQTHEEITIPCATPRKNFNVPLVKVSDLDEYCRKVFEYEYLNKVQSLVYPVAYN
                     TNGNMLICAPTGAGKTDIALLTILNTIKQFSMINEEGGFDIQYDDFKIIYVAPLKALA
                     AEITDKFARKLAVFDIKVRELTGDMQLSKKEILDTQVIVTTPEKWDVVTRKASGDNDL
                     TSKVKLLILDEVHLLHEDRGSVIESLVARTLRQVESSQTMIRILGLSATLPNFVDVAD
                     FLGVNRNVGMFYFDQSFRPKSLEQHLIGCRGKAGSKQCRENTDKVAYEKAAEMRRLGN
                     QVMIFVHSRKDTVKTARTMISMARDFHEMELFTSDDPSASFFKKELSKQKDKDLKELF
                     QSGFGVHHAGMSRSDRNITEKMFKSGAINVLVCTATLAWGVNLPADCVIIKGTQVYDS
                     KKGGYTDLGISDVIQIFGRAGRPGFGAEFGTAYLCTSNDRLDHYVDLITQQHPIESRL
                     GAKIVDNLNAEISLGTVTNVEEGVKWLGYTYMFVRMRQNPFTYGIDWEEIINDPQLYD
                     KRRQIIITAARRLHSLQMIVFDEVSMHFIPKDLGRIASEFYLLNESVEIFNQISDPRA
                     TEADVLAMISMSSEFDSIKFREEESGELKKLLDTAVECQVSGDVDSSAGKTNVLLQAY
                     VSQSRINDSALNSDANYIAQNSARICRALLFIGINRRWGTFSRVMLDICKSIEKRMWA
                     FDHPLCQFHLPDTVLRNIKEKNPSMEMLLDMDSRELADLVHNQKMGGKLYRIISRFPR
                     IDIDAEIFPITTNVMRIHISLSPNFEWDYHVHGDAQFFWVFVEESNQSSILHFEKFIL
                     NKRQLSNPHEMDFMIPLSDPLPPQVVVRVISDTWIGCETTHTISFQHLIRPHNETLQT
                     RLQKLNPLPTTALKNPLIESIYPFKYFNPMQTMVFHTLYHSNVSTFVGSPTGSGKTVV
                     AELAIWHAFRDFPGSKVVYIAPMKALVRERVDDWRKRITPVTGDRIVELTGDSVPDPQ
                     DIRDATIVITTPEKFDGISRNWQTRKFVQNVSLVIMDEIHLLASDRGPILEMIVSRMN
                     YISSQTKKPVRLLGMSTAVSNAFDLASWLGVKENGLYNFPSSVRPVPLKMYIDGFPDN
                     LNFCPLMKTMNKPAFMAIKQHSPEKPVLIFVASRRQTRLTALDLIHLCGMEDNPRRFL
                     HIDDEEELQYYISKVKDDTLKLSLQFGIGSHHAGLVESDREISHQLFQKSKIQILVAT
                     STLAWGVNLPAHLVIIKGTQFFDAKIEGYRDMDLTDILQMMGRAGRPAYDTSGTAIVY
                     TKESKKMFYKHFLNVGFPVESSLHKVLDDHMGAEIASGTIGTKQEALDFLNWTFLFRR
                     AHHNPTYYGITDDTTTAGVNKYLSELVNQTLENLEESSCVEIYGSNIYATPFLSISSY
                     YYISHKTLRTLLKHINKNATFQDALKWLSLAVEYNELPVRNGEIIMNVEMSAQSRYSV
                     ESTFVDDLELPMWDPHVKAFLLLQAYLSRAELPIVDYHQDTVSVLDQSLRILQAYVDV
                     AAELGYFKTVLTLIRVMQCIKQGCWYEDDPLSLLPGAQLKRDNNIAFGDDGWPLSEKE
                     GYKMNLESLARLESTNKGKLKSIMSRHYKVDATHQNKMMKTVSRLPILDDIEFAPQHN
                     SESLVMTATHHNRIPKDFTIYCSKYPKTQRELWFAIGYVGDELFMLKRCQPRPSAHGK
                     GGLSFDFVIPEEVRGREVDFVLINDALDIKYHMKHKLLP"
     gene            complement(<1054856..>1055551)
                     /gene="EFG1"
                     /locus_tag="KLMA_10496"
                     /db_xref="GeneID:34714154"
     mRNA            complement(<1054856..>1055551)
                     /gene="EFG1"
                     /locus_tag="KLMA_10496"
                     /product="rRNA-processing protein EFG1"
                     /transcript_id="XM_022821918.1"
                     /db_xref="GeneID:34714154"
     CDS             complement(1054856..1055551)
                     /gene="EFG1"
                     /locus_tag="KLMA_10496"
                     /codon_start=1
                     /product="rRNA-processing protein EFG1"
                     /protein_id="XP_022674009.1"
                     /db_xref="GeneID:34714154"
                     /translation="MNPKSKRPRQRHDSSLQLASVIGAGANKIKKQIRNVERLLQKRR
                     DVLPDTVIVEKERMLEGLKFELKEAELRQIGRKNAKKYHMVRFFERKKAMRKYKQASK
                     KVLAQPEDKELQKELREATIDLCYVVNFPRLSKYIALYPATSDSVEKMSEEERKGVEQ
                     TNAKRAEFRSLVAKQLDEGTLPVSLEDIIKGKRLNKDSTGVMLEEEQVQEEAMERDLD
                     NQGVEEEEDDFFE"
     gene            complement(<1056161..>1056727)
                     /locus_tag="KLMA_10497"
                     /db_xref="GeneID:34714155"
     mRNA            complement(<1056161..>1056727)
                     /locus_tag="KLMA_10497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821929.1"
                     /db_xref="GeneID:34714155"
     CDS             complement(1056161..1056727)
                     /locus_tag="KLMA_10497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674010.1"
                     /db_xref="GeneID:34714155"
                     /translation="MGVFKRHSRGGSGSNGSGGSAEVKITKQDREHLKVRTANVHDPI
                     LEAVQEAQPFEQAADQFQENVNRQSYLNSGELRDVFGAPIREPDVSNPLRARDERPMD
                     TIRGFEYSISGDPTWAQQLETPQYGFRVKPGFAGYTGGAAGGAAGGYHDNMNTSYQQG
                     VYQPPAPAVDGEKKKKKKRGLFGRKKKD"
     gene            complement(<1057187..>1058848)
                     /gene="LCB1"
                     /locus_tag="KLMA_10498"
                     /db_xref="GeneID:34714156"
     mRNA            complement(<1057187..>1058848)
                     /gene="LCB1"
                     /locus_tag="KLMA_10498"
                     /product="serine palmitoyltransferase 1"
                     /transcript_id="XM_022821940.1"
                     /db_xref="GeneID:34714156"
     CDS             complement(1057187..1058848)
                     /gene="LCB1"
                     /locus_tag="KLMA_10498"
                     /codon_start=1
                     /product="serine palmitoyltransferase 1"
                     /protein_id="XP_022674011.1"
                     /db_xref="GeneID:34714156"
                     /translation="MIDPQEVPEVLPNSIPVPSAIVSSASYIWFYFIKTFKLIPGAHY
                     IIDYVKKSHQDDPYRTFVEALLMIYSIVYFLSKPKKKGAVDQPKLSEREIDNLIEEWQ
                     PEPIVMPDKRTEWRLAKIPVCEGSGPRNVVDITRDNGKEAYASVFNLCSFNFLQLTAH
                     PSVMQVAKDTIKNYGVGSCGPAGFYGNEDVHYNLEYDLAAFFGTESSVLYGQDFCVSS
                     SVIPAFTKRGDVIVADDKISLSSQNALQLSRSTVYYYKHNDMASLENLLHELDEAEKK
                     EKLPAIPRKFIVTEGIFHRTGEIAPLPELVRLKNTYKYRLFVDETFSIGVLGRTGRGL
                     AEYYNVSRASTIDITVGSLATAIGTTGGFVLGDSVMARHQRIGSNAYCFSASLPPYAV
                     RTASAVLKLMDQDNSAVLKLQQLANNLHDWFQHDEQLNKIIEVTSHPDSSVLHFKLTD
                     EERLARFNSTIESIFQESQYQQQHCISDHYVEAWEQEEKFLQQIVDVALEEGNVLISR
                     DAVILKQETLPLAPNISICCNAAMDDVQLYEAFKVVKAAIVKVCA"
     gene            <1059948..>1061570
                     /gene="PRC1"
                     /locus_tag="KLMA_10499"
                     /db_xref="GeneID:34714157"
     mRNA            <1059948..>1061570
                     /gene="PRC1"
                     /locus_tag="KLMA_10499"
                     /product="carboxypeptidase Y"
                     /transcript_id="XM_022821951.1"
                     /db_xref="GeneID:34714157"
     CDS             1059948..1061570
                     /gene="PRC1"
                     /locus_tag="KLMA_10499"
                     /codon_start=1
                     /product="carboxypeptidase Y"
                     /protein_id="XP_022674012.1"
                     /db_xref="GeneID:34714157"
                     /translation="MRGSGVLQALAVASCASYASAFTVQDKLHGQTVLDKAVDALGLD
                     ASELLRSLPGHLKTAWNEMGMLYPQEASQLEFVSKPKGKIVKHDKWDHVVRPESFVST
                     ASVNNDNVGNYQLRVKKIKDPKVLGVDPDVKQYSGYLDVEDEDKHFFYWFFESRNDPK
                     NDPVILWLNGGPGCSSLTGLFFELGPSSIGEEVKPIYNPHSWNSNASVIFLDQPVNVG
                     YSYSSSEGVSNTVAAGKDVYAFLQLFFQQFPEYASGQDFHIAGESYAGHYIPVFATEI
                     LSHPQEERSFNLTSVLIGNGLTDPLSQYPEYEPMACGQGGEPSVLDEEQCENMLETLP
                     RCLNLIQSCYEYESVWSCVPASIYCNNAQMGPYQNTGKNVYDIRKECKGNLCYDEMKY
                     MDEYLNLDYVKEAVGAEVDNYESCNFDINRNFLFAGDWMKPYHKHVAELLDQDLPVLI
                     YAGDKDFICNWLGNKAWTDVLPYKDAEEFAKQPVKKWVTSVGEHAGTVKNFDKFTFLR
                     VYGAGHMVPFDQPENSLEMVNDWVNGKFDFKH"
     gene            <1061884..>1062342
                     /gene="LIP1"
                     /locus_tag="KLMA_10500"
                     /db_xref="GeneID:34714158"
     mRNA            <1061884..>1062342
                     /gene="LIP1"
                     /locus_tag="KLMA_10500"
                     /product="ceramide synthase subunit LIP1"
                     /transcript_id="XM_022821962.1"
                     /db_xref="GeneID:34714158"
     CDS             1061884..1062342
                     /gene="LIP1"
                     /locus_tag="KLMA_10500"
                     /codon_start=1
                     /product="ceramide synthase subunit LIP1"
                     /protein_id="XP_022674013.1"
                     /db_xref="GeneID:34714158"
                     /translation="MAKEKYVPQNRVFILLQYIACALALVAAVEYFKYKTRISYEWFH
                     CTPQFAPLGSNSHSSSSSAQKLWAVGGPSCDKRGELKTIMKRITMDYDPNEEPVRFCI
                     VENHQIPSIHYPVENGNKGEAGYVSYVGYERDAAAVEEACASHEATVFNL"
     gene            complement(<1062415..>1065582)
                     /gene="TAF1"
                     /locus_tag="KLMA_10501"
                     /db_xref="GeneID:34714159"
     mRNA            complement(<1062415..>1065582)
                     /gene="TAF1"
                     /locus_tag="KLMA_10501"
                     /product="transcription initiation factor TFIID subunit 1"
                     /transcript_id="XM_022821973.1"
                     /db_xref="GeneID:34714159"
     CDS             complement(1062415..1065582)
                     /gene="TAF1"
                     /locus_tag="KLMA_10501"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 1"
                     /protein_id="XP_022674014.1"
                     /db_xref="GeneID:34714159"
                     /translation="MPRGAGSSGGKKQAKAKKDLSHEDEAYNALFSGEFGALEIANYT
                     SADGKQDETEHLPNAIDFEDEDELADEELPEEEEPSNRNGAGSHVVEGSFQRSLSGED
                     EYMTLIGHGDVIQDDGEPVFDVQGNNALFMESTYQSFGPEQHQFNEYDEQHRIQMEEQ
                     RRREEEENAKEEELLFQSYFPELKPGRVLRMTKIAPKPLAHYQWQRELYLRNRVLKPL
                     IPLKIQFQVQKDTRKLFKTRTKSSKPWQGSLTELTERPRRNVVKVSLDEIYPEDSVDS
                     KRDYHDEVIPEDLLIVADEWDYEKIVDDRDTADAKGDNSSDGDKKSVVTVENTLEETG
                     KDWEWNEDDIINGKMITKEPPIDMNDEQLLILPNDSQDSAIETTSKVSKKPLIPYNEK
                     SLLAKFNISNDETYKILKKNYQTKIRSTISNLNIEHSQPATRLQSPFYKVFLPKEQLR
                     HFHRNHFGKRIRPGTNIVFSKIKTRKRKKDRGKDVHEIFQHSSDLTVGDSAQVFLMEF
                     SEQQPIALSKFGMANKLINYYRKTDENDTSRPKLPVGETHVLGVQDKSPFWNFGFVSP
                     GNIVPTLYNNMIRAPVFKHEVSKTDFLLVKSTGNGSGNRFYLRQINHLFTVGQTFPVV
                     EVPGPNSRKVTAMGKNRLRMVVYRILNKSPEHRLLVKQVARHFPEQNDMQNRQRLKEF
                     MKYQREGDDQGFWKLKEGEVLLDNENVKKMITPEDVSLVESMYYGQQFQEDIDFYNFE
                     EKAKELEENLIFWNATKNFLNATQMRAMIQIHGAGDPTGCGEGFSFLKTSMKGGFVKS
                     GSKDQPHIAGGHSYNVAQQQKAYEEEISRTWYHQAKSLSIQNPFEEMDDPDIVNESNK
                     NVPSTRPDEKVLRIVRKKRDSNGIIQRQTVIIRDPRVIQGYLRAYEKRREEAERNLGL
                     EELINDNINIVGGENEEERQLKQKKLLEEQLAKLEKSKERRQARKAAREKTKDGKVTK
                     AKNTTRRCATCGAIGHIRTNKSCPMYNGGVAANAAAAAQSGSTSSLEASSTTPGPGPS
                     SGPGSGPDPASSMPASLPIKNDPEL"
     gene            <1066162..>1066701
                     /locus_tag="KLMA_10502"
                     /db_xref="GeneID:34714160"
     mRNA            <1066162..>1066701
                     /locus_tag="KLMA_10502"
                     /product="Rtt102p-like transcription regulator family
                     protein"
                     /transcript_id="XM_022821984.1"
                     /db_xref="GeneID:34714160"
     CDS             1066162..1066701
                     /locus_tag="KLMA_10502"
                     /codon_start=1
                     /product="Rtt102p-like transcription regulator family
                     protein"
                     /protein_id="XP_022674015.1"
                     /db_xref="GeneID:34714160"
                     /translation="MSLISKANRLGGFSSDVKHWEYEWTSTAKQNENGTDDKVKYKFK
                     EWVKQENAVVDMEEDDSDVLNLDEFDRTKIAKKHVRTQENGGPESLSINDIRGAVGGS
                     DIPGFSSSDAKKEAEAKQEAKSETKEESKEESKEESKEESKEESKEEPKDESTKEEST
                     KEESKDEPTKDEEGDVNME"
     gene            complement(<1066806..>1068932)
                     /gene="RNH70"
                     /locus_tag="KLMA_10503"
                     /db_xref="GeneID:34714161"
     mRNA            complement(<1066806..>1068932)
                     /gene="RNH70"
                     /locus_tag="KLMA_10503"
                     /product="RNA exonuclease 1"
                     /transcript_id="XM_022821995.1"
                     /db_xref="GeneID:34714161"
     CDS             complement(1066806..1068932)
                     /gene="RNH70"
                     /locus_tag="KLMA_10503"
                     /codon_start=1
                     /product="RNA exonuclease 1"
                     /protein_id="XP_022674016.1"
                     /db_xref="GeneID:34714161"
                     /translation="MSNSVSSSPKSAVLVSPGKNAEISHGITTESLAAAPSPTVDTKN
                     NIINNSNSNNNSLSVRSRVERLSICEGTETKDEILSKLHPPSSSSSRDSVSFTDGKED
                     DEITDINNTQSGSKRRRRRSSAVQSSSSLDNLKRDNLSTSSLAVPKKKKKSTKSVNIV
                     LEKLSKPLSIKDLRDLVLFAFRDTNNAPSWLQIDNRSALQKIIVLFVPGLLPEDFSKD
                     AEHKEKLTSFADNLETLTGSHTLPPTLFSNPEAQWYNLPLCAPGSKNSLFSAYNSFVN
                     VGLNKKEKEKKRAQLSKKKVVMDDLLMTVDNLIENDYPIHLETPGLSDEFKETLQENY
                     SKPEYKDWVNTKSFEHEAPHTFAIDCEMCLSDNGPVLTRCSVVDFNEKLIYDKLVKPD
                     VPIIDYLTRYSGITEEKLRDVTTTLKDVQEDLLKIISTDDVLIGHSLQSDLNVLKVRH
                     TRIVDTAIIYEHKAGPPFKPGLKYLASEHLNIDIQKDTGLGHDSYEDAKTCLELTKLK
                     IQNGLAFGLGINTENLFHRLSRSGVSSMILNDSASRQSKVLKSDSSNELHVRCKDDQM
                     IVDEICEHIEEHNFFVGRLRELEFARQFATCNNPDTKIAESPEIAIHNLKERFTKIYE
                     HLPPSSMLLVCSGTGDTREWIKIMGELNKLDKDVRFSEKAKREEEIQQSVKTARDAIS
                     FMTVKAMKPKQLQPPQQQPSNENGIN"
     gene            complement(<1069392..>1070540)
                     /gene="DYN3"
                     /locus_tag="KLMA_10504"
                     /db_xref="GeneID:34714162"
     mRNA            complement(<1069392..>1070540)
                     /gene="DYN3"
                     /locus_tag="KLMA_10504"
                     /product="cytoplasmic dynein intermediate light chain
                     DYN3"
                     /transcript_id="XM_022822006.1"
                     /db_xref="GeneID:34714162"
     CDS             complement(1069392..1070540)
                     /gene="DYN3"
                     /locus_tag="KLMA_10504"
                     /codon_start=1
                     /product="cytoplasmic dynein intermediate light chain
                     DYN3"
                     /protein_id="XP_022674017.1"
                     /db_xref="GeneID:34714162"
                     /translation="MTREEPSWEVFLKDLKQQCEDNNGSKTISVIVFCEEEDTLKQFF
                     KYIDAIDESSNSNLLQEVPVVLSPIGYYTKEITTDQGWQVELNISCMPPPWKTTSIDL
                     IPLLLKSEDPKSSMCFILLVDWVKEDQSYWLEDMNELFTKCNQIQPDVSKHNSLMMIN
                     SDYCKHLETTHARWSASTVDFMHQSLRIMALNLGLSVYSDKNDSVLATKSAAGIPLTG
                     EERKELSDLVHLESLNIIQGSDSLSKISMIDESFPTSAYSKDLDKLRQDYANTIPQMK
                     TRDNKATVETSDTQESVAIPDVQEQLEHLYNLQKKQSSTKRLQQHQQQQLDSHQSVIQ
                     ETITTAIMNGGKHDYNNEALEAATISPGEDDDALDSLVDNIVQRHQIS"
     gene            complement(<1070942..>1072471)
                     /gene="ADE4"
                     /locus_tag="KLMA_10505"
                     /db_xref="GeneID:34714163"
     mRNA            complement(<1070942..>1072471)
                     /gene="ADE4"
                     /locus_tag="KLMA_10505"
                     /product="amidophosphoribosyltransferase"
                     /transcript_id="XM_022822017.1"
                     /db_xref="GeneID:34714163"
     CDS             complement(1070942..1072471)
                     /gene="ADE4"
                     /locus_tag="KLMA_10505"
                     /codon_start=1
                     /product="amidophosphoribosyltransferase"
                     /protein_id="XP_022674018.1"
                     /db_xref="GeneID:34714163"
                     /translation="MCGVLGICLADQTATVAPELFDGCMYLQHRGQDAAGISTCGQRG
                     RLYQCKGNGMARDVFTQQRMAGLVGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGICM
                     GHNGNLVNTQALRRYMDEDVHRHINTDSDSELLLNIFAAELEKYNKYRVNNDDIFHAL
                     EGVYRLCRGGYACVGMIAGFAMVGFRDPNGIRPLLFGTRTNADGTKDYMLASESVVLK
                     AHNFNEFRDLNPGEAVIVPKDASEGEPEFRQVVPVNSYRPDLFEYVYFARPDSVLDGI
                     SVYHTRLAMGVKLAENVSRCINPDDIDVVVSVPDTARTCALECANTLNKPYREGFVKN
                     RYVGRTFIMPNQKERVSSVRRKLNPMESEFKGKRVLIVDDSIVRGTTSKEIINMARES
                     GAVKVYFASAAPAIRFNHIYGIDLADTKQLVAYNKSEEEIEQELGCDKVIYQSLDDLI
                     SCCKTSHIEKFEVGVFTGNYVTGVEDGYLLELEKARASNILKANAKAESDIGIYNSAD
                     Y"
     gene            complement(<1072940..>1075066)
                     /gene="ATM1"
                     /locus_tag="KLMA_10506"
                     /db_xref="GeneID:34714164"
     mRNA            complement(<1072940..>1075066)
                     /gene="ATM1"
                     /locus_tag="KLMA_10506"
                     /product="iron-sulfur clusters transporter ATM1"
                     /transcript_id="XM_022822029.1"
                     /db_xref="GeneID:34714164"
     CDS             complement(1072940..1075066)
                     /gene="ATM1"
                     /locus_tag="KLMA_10506"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="iron-sulfur clusters transporter ATM1"
                     /protein_id="XP_022674019.1"
                     /db_xref="GeneID:34714164"
                     /translation="MVPMFRRSPVVISVWKSGLKSGLKSAFHTSLVQPRLLSMRQCLG
                     NGARVEFKRFNSSISNNKAAGSAATAIPVKKIVPPQPASKEKSKTPTISELRIMKDLF
                     KYIWPRGDKKIRIRVLVALGLLIGAKLLNVQVPFFFKQTIDSMNIEWGSDVGTVLPVA
                     ITMTILSYGAARFGSVLFGELRNAVFSRVAQNAIRKVSLQTFQHLMKLDLGWHLSRQT
                     GGLTRAMDRGTKGISYVLSAMVFHIIPITFEISVVCGILTYQFGTSFAAVTFATMLLY
                     SIFTFRTTAWRTEFRRSANRADNKAASVALDSLINFEAVKYFNNEQYLANKYHKSLSN
                     YRDSQIKVAQSLSFLNAGQNFIFTSALTAMMYMGATGVMGGSLTVGDLVLINQLVFQL
                     SVPLNFLGSVYRELKQSLIDMESLFKLQKNPVLIQSPAKPLMLPDHLPCEIKFENVTF
                     GYQPDRNILRNATFTIPPGKKTAIVGPSGSGKSTILRLMFRFYDPQQGRILLDGKDIK
                     ELDLEQLRKIIGVVPQDTPLFNDTIWENVKFGRIDATDSEIVAAIEKAQLSELIHKLP
                     KGTETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKE
                     NFNNVSKTSVYIAHRLRTIADADKIIVLENGAVKEHGTHNELLADPNSLYSELWNIQE
                     NLDMLQEELEEERNLEQHPSLVKEKK"
     gene            complement(1073879..1075413)
                     /locus_tag="KLMA_R117"
                     /db_xref="GeneID:34718632"
     tRNA            complement(join(1073879..1073935,1075380..1075413))
                     /locus_tag="KLMA_R117"
                     /product="tRNA-Val"
                     /db_xref="GeneID:34718632"
     gene            complement(<1075519..>1076220)
                     /gene="PRE5"
                     /locus_tag="KLMA_10507"
                     /db_xref="GeneID:34714165"
     mRNA            complement(<1075519..>1076220)
                     /gene="PRE5"
                     /locus_tag="KLMA_10507"
                     /product="proteasome component PRE5"
                     /transcript_id="XM_022822040.1"
                     /db_xref="GeneID:34714165"
     CDS             complement(1075519..1076220)
                     /gene="PRE5"
                     /locus_tag="KLMA_10507"
                     /codon_start=1
                     /product="proteasome component PRE5"
                     /protein_id="XP_022674020.1"
                     /db_xref="GeneID:34714165"
                     /translation="MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSSKYA
                     VVVALKRNADELSSYQKKIIKCDEHMGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRK
                     LALERAGYLLSDKAQKNTQSYGGRPYGVGLLLVGYDNTGAHLLEFQPSGNTLELYGAA
                     IGARSQGAKTYLERVLDEYRDIEDADELIKHGVEALKHSLKDETLSTKNLSIAIVGHD
                     KPFTIYDGDDVQPYL"
     gene            <1076718..>1078499
                     /gene="TGL3"
                     /locus_tag="KLMA_10508"
                     /db_xref="GeneID:34714166"
     mRNA            <1076718..>1078499
                     /gene="TGL3"
                     /locus_tag="KLMA_10508"
                     /product="lipase 3"
                     /transcript_id="XM_022822051.1"
                     /db_xref="GeneID:34714166"
     CDS             1076718..1078499
                     /gene="TGL3"
                     /locus_tag="KLMA_10508"
                     /codon_start=1
                     /product="lipase 3"
                     /protein_id="XP_022674021.1"
                     /db_xref="GeneID:34714166"
                     /translation="MLWLKQMFILFFYAILNHVPKPVWDIMHVISDIYMFWWRRFMNK
                     VRPRSRTVYREAVSGLDGCEDYEEWYEKASLVDELTGVDLWRRNFFSKRYDFESVLEQ
                     YGALLEALENEDIDAVVSRFINTGPTMLRNFAGIVDKRLFTKSFVGTKLLIEQYLDKV
                     VETLYMLAERRTQQVQRPFFQRCKLSLGATALALQGGSLFGLFHLGVLKGLLDRNLLP
                     NIINGTSMGACVASMACCLSDVELEDLLTANRLVSTIKRDTVLLLECGYGAIDEHFSI
                     GTLVQNVVHNGYSKDVYLFIKFVQRSIIGDLTFEEAFRRTGKVLSIVVHPTNKNICPT
                     LLNYVTTPNVLISSAINCSFGSNTISKDTWLLAKNIHNEVVDFLDRNEPCYQNLKFLS
                     PQSVQDSSELEAPYTRLTELFNVNNFIVSLARPYLAPLALNDLKHDIRTSEYYYYKRY
                     PYIDPGTFTPGQLSSVNKVEPLASKFKYHMERKMKHILTMELNHRIEIMDSIGLLSNW
                     IKRIAIDERTPRSATEVAIVPQINSLSVSRIIEGRLDNINYWMMCGQRSTWPTISLIK
                     TRCAVEFTLDDIINGYRSNAPQQITHI"
     gene            complement(<1078538..>1079344)
                     /gene="ELP6"
                     /locus_tag="KLMA_10509"
                     /db_xref="GeneID:34714167"
     mRNA            complement(<1078538..>1079344)
                     /gene="ELP6"
                     /locus_tag="KLMA_10509"
                     /product="elongator complex protein 6"
                     /transcript_id="XM_022822062.1"
                     /db_xref="GeneID:34714167"
     CDS             complement(1078538..1079344)
                     /gene="ELP6"
                     /locus_tag="KLMA_10509"
                     /codon_start=1
                     /product="elongator complex protein 6"
                     /protein_id="XP_022674022.1"
                     /db_xref="GeneID:34714167"
                     /translation="MSSIQKQDLLVFSDSSVISKGLFGPGVGSNMILVTDTAATSGSW
                     LLNALVEAVTLGSVVSLNGGNGNSGGIGARVGKVVVGSFLSMQTQIVGAFEKSKIPRD
                     RYTVLPLAEDIVSKNVGKPIDVIVGGILKQFEGVEGSIFVLEKPEILMSLFNMSSDDL
                     QLRLINPLLRKCSMLIVSTSVEAFDNDFPENIGRDTVEFVRFTTSSFHKCAVVLSVRP
                     LDTGKAKDITGTLAIRRGGALLNATNAALHVVENQYLFHSVKDVTTLFYR"
     gene            <1079961..>1081442
                     /gene="SKN7"
                     /locus_tag="KLMA_10510"
                     /db_xref="GeneID:34714168"
     mRNA            <1079961..>1081442
                     /gene="SKN7"
                     /locus_tag="KLMA_10510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822073.1"
                     /db_xref="GeneID:34714168"
     CDS             1079961..1081442
                     /gene="SKN7"
                     /locus_tag="KLMA_10510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674023.1"
                     /db_xref="GeneID:34714168"
                     /translation="MDELDEQFSGSNEASYAKVSDKRDVSSAGSQSGCTSGSRGRNQR
                     SSFNDFVRKLFLILESEEYRNIISWSEDGKNFIVMDTNKFTTDILPKHFKHSNFASFV
                     RQLNKYDFHKVKRKKNEVSEGTQNAWEFNHQHFRRHDEAGLDNIRRKPSSQKKILLDE
                     NSVILRKLGNGNPEEGFAAGAGLGGLGGGDEDSLAAKALLKNTVNKAKFNQMKRKVEE
                     MESQIQYLTNENHNVKLDLQKIQSRYNMVLETLLSTESFNTELINNFHLLIDSLSQQG
                     IKLPVGLTLKKNDSSLLAKQKQEGGSSGSPPNLNMIGLPVSNPVIKQDPVNILPIDQQ
                     QQHQQQQQQQQQSVLPRGFHVLLVEDDSVCIQLCSKFLRKYGCSVEVVTDGLSAISTL
                     EKQRFDLVLMDIVMPNLDGATATSIVRSFDNETPIIAMTGNIDDQDLVTYLQHGMNDI
                     LAKPFTKDDLHSMLIRYLKDRIPLSKQGQNSNNDPKSFVENSC"
     gene            complement(<1081839..>1083308)
                     /gene="SET5"
                     /locus_tag="KLMA_10511"
                     /db_xref="GeneID:34714169"
     mRNA            complement(<1081839..>1083308)
                     /gene="SET5"
                     /locus_tag="KLMA_10511"
                     /product="potential protein lysine methyltransferase SET5"
                     /transcript_id="XM_022822084.1"
                     /db_xref="GeneID:34714169"
     CDS             complement(1081839..1083308)
                     /gene="SET5"
                     /locus_tag="KLMA_10511"
                     /codon_start=1
                     /product="potential protein lysine methyltransferase SET5"
                     /protein_id="XP_022674024.1"
                     /db_xref="GeneID:34714169"
                     /translation="MPLKLETLRLNDEAQSDDSQKITPSQTQICDDVVRWWKEEPAAE
                     DLPINTLYEQLIRRRQNWSLSQEELYDALKSHKLYAQELNELDTYSDQISSSKLSDED
                     MRKLNKHMMEKVSIVETDFGKGLVATQDIRKGTLVYFEPIPLSVIPQLDKQPLVARGK
                     CCGLCSAFTSMSPQLIMKNNLDCSMCETIWCSKQCKTLDVTHSVLKHATSRNHLCNTV
                     NWAKFEAFCLKESLYSMYAVGVLYARHCLQPNSNLWELFTSLCSVSQQVRWQASDSLN
                     VGGTFDASSNGKTASGSPAPVDLQTQSEVAYEMFTKAFPKCEMTYEDCLKLTGTFNLN
                     QIMDQLYPLTCHINHSCEPNVRIDAKNKFGLNVYARKDIKQGEQLFLTYVNPLHGVTL
                     RRRELRVNYGFLCHCSRCNREWEKRQEILKDQHNHLHTSALQTKARRKSSMKMSRPSL
                     KELLENGHEFDLEMPSEYNPKRRTSVRFNSHVTMAVEEE"
     gene            <1083591..>1084430
                     /gene="FMP10"
                     /locus_tag="KLMA_10512"
                     /db_xref="GeneID:34714170"
     mRNA            <1083591..>1084430
                     /gene="FMP10"
                     /locus_tag="KLMA_10512"
                     /product="uncharacterized mitochondrial membrane protein
                     FMP10"
                     /transcript_id="XM_022822095.1"
                     /db_xref="GeneID:34714170"
     CDS             1083591..1084430
                     /gene="FMP10"
                     /locus_tag="KLMA_10512"
                     /codon_start=1
                     /product="uncharacterized mitochondrial membrane protein
                     FMP10"
                     /protein_id="XP_022674025.1"
                     /db_xref="GeneID:34714170"
                     /translation="MIRGFNGFRGKLVGQIGGRNAGAWRKSVVGRMYSVESEAANQAK
                     QATREAKFVVRPKERSRKWNNVLIFGTCFGIGWYTTQHLTLSDIMAWMFYSKLPDTDA
                     KVVEYRDELNQRCDRLPIVKQLLAKGYVAVYKKNGSGKSGESGLESNTLIDKTLSVPG
                     AISIPPRIYYNPTTKDTVSIYHLGMKLTGYPFLVHGGILATVLEDTMRDSVKLVTGKQ
                     AEITKALKLSYSFPTLANQFVVVRRTKWEPKTGSVVEMEAELMDQAGKRPLVKGKATF
                     KVK"
     gene            complement(<1084467..>1085183)
                     /gene="FAU1"
                     /locus_tag="KLMA_10513"
                     /db_xref="GeneID:34714171"
     mRNA            complement(<1084467..>1085183)
                     /gene="FAU1"
                     /locus_tag="KLMA_10513"
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /transcript_id="XM_022822106.1"
                     /db_xref="GeneID:34714171"
     CDS             complement(1084467..1085183)
                     /gene="FAU1"
                     /locus_tag="KLMA_10513"
                     /codon_start=1
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="XP_022674026.1"
                     /db_xref="GeneID:34714171"
                     /translation="MVPQKQVLRRQVKQALRAITQRELVQQSETLSRLALRVIDAQGY
                     RHVACFLNMEHSEVKTEPLLESLFREGKTVYLPRCTTTRVSKQKILRGNQADQQADQQ
                     AGHHAHLTFYAMSSIEQVRALKPQGKYQLREPQAVDPEPLPPQELEVILMPGVAFCKK
                     NGARMGHGAGYYDDYITRHLHYTGKKPLLVGLALKEQLVDDVPVEEHDYTVDCLVSGD
                     GEVTWYGPRPSPDRSKKDHK"
     gene            <1085835..>1086959
                     /gene="BAT1"
                     /locus_tag="KLMA_10514"
                     /db_xref="GeneID:34714172"
     mRNA            <1085835..>1086959
                     /gene="BAT1"
                     /locus_tag="KLMA_10514"
                     /product="branched-chain-amino-acid aminotransferase"
                     /transcript_id="XM_022822117.1"
                     /db_xref="GeneID:34714172"
     CDS             1085835..1086959
                     /gene="BAT1"
                     /locus_tag="KLMA_10514"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="branched-chain-amino-acid aminotransferase"
                     /protein_id="XP_022674027.1"
                     /db_xref="GeneID:34714172"
                     /translation="MSSLDASKVKITKVSEPSKPRPNDELVFGQTFTDHMMTVEWTAK
                     DGWGVPEIKPYGNLSLDPSACVFHYGFELFEGLKAYRTPDNKISMFRADKNMERMNKS
                     AARICLPTFDGEELIKLIGKLIEQDKYLVPEGQGYSLYIRPTMIGTTNGLGVGTPDRA
                     LLYVITSPVGPYYKTGFKAVRLEATDYATRAWPGGVGDKKLGANYAPCVLPQLEAAKR
                     GYQQNLWLFGEEKNITEVGTMNVFFVFKDSATGKKELVTAPLDGTILEGVTRDSILQL
                     CRKNLDPEEWVVSERYYSIFEVEERAAKGELVEAFGSGTAAVVSPIKEIGWRGNDINV
                     PLLPGEQSGQLTKQVASWIADIQYGRKEYNNWSRIVADLN"
     gene            <1087251..>1089209
                     /locus_tag="KLMA_10515"
                     /db_xref="GeneID:34714173"
     mRNA            <1087251..>1089209
                     /locus_tag="KLMA_10515"
                     /product="GAL4 domain-containing family protein"
                     /transcript_id="XM_022822128.1"
                     /db_xref="GeneID:34714173"
     CDS             1087251..1089209
                     /locus_tag="KLMA_10515"
                     /codon_start=1
                     /product="GAL4 domain-containing family protein"
                     /protein_id="XP_022674028.1"
                     /db_xref="GeneID:34714173"
                     /translation="MKKVVRSYNGCQKCRSLKKKCSEEKPQCSNCKKQGYDCSYVRPL
                     KWGGRPFKDKRVTKMMRFEHTYVVEGICAVDLKAATGKNSSGTASDSKVAKKNKKKKN
                     SRAEMGAQQMLLQMPLQQQQQQQQQQQQTSFPEAKIVEYLPQVDVEVKVDVDENSINI
                     DPSVGGESFSPLSALFDNSNTERSPTALDTDQLVFQPNAANTAFSSEVVLQNQQFMSP
                     TTRLPSFMIPDLLLQSPELAESFDFFFSQTSKLLVPAPSTTYSRNPFFNFLPRMAMNS
                     SALMNLLLVFGANHKHKIMHSQGFYTDGNSSLVANDLLTNTFTSLLTQLTDFDTRNSD
                     STLATILLLAAFDIFFGDKKQKWRTHVYGARKIMKERLSNGTGALTLSDHSADFRQEH
                     FLLRWFAYTDIISSLSSTNSINNIHKLSSLKYEMETNVEDSLMQKMIRLEDIEYFTGM
                     EVSCLWMLAEVSRLVNEKETDETTVFPQVLVLKALELDHKMTTYLKKTELKRDEVYQT
                     YYLSKTDAVMAERYEVYRILRGTNQIFTLTGVLQLKRRVLGISPSSPIIIELLKEITK
                     LIENCIAFESSAETCIIFCIFSCGCELMDPELYEYRLLYQQHLTSLVRKGVTSAKQAQ
                     NIMEECWLSGKQWWDLFKEKNMDITFAL"
     gene            complement(<1089524..>1091050)
                     /gene="PGU1"
                     /locus_tag="KLMA_10516"
                     /db_xref="GeneID:34714174"
     mRNA            complement(join(<1089524..1090697,1091040..>1091050))
                     /gene="PGU1"
                     /locus_tag="KLMA_10516"
                     /product="polygalacturonase"
                     /transcript_id="XM_022822140.1"
                     /db_xref="GeneID:34714174"
     CDS             complement(join(1089524..1090697,1091040..1091050))
                     /gene="PGU1"
                     /locus_tag="KLMA_10516"
                     /codon_start=1
                     /product="polygalacturonase"
                     /protein_id="XP_022674029.1"
                     /db_xref="GeneID:34714174"
                     /translation="MHVDSSNDNSNDNNDTNKQQQQKVSSETKKKKMLFSNTLLIAAA
                     SALLAEASPLEKRDSCTLSGKTAGGGLSNCATVTVNNVEVPAGKTLDLTGLQDGATVN
                     FVGQVTFDYDEWVGPLVSISGKNIKVVGKSGHLLDGDGARWWDGKGDSGKKVKPKFMS
                     LKLTGNSDVGGLQIKNTPIQAISVNSCSDTVIHDVTIDNSDGDKDSLGHNTDGFDVGN
                     VNNVTIENCHVYNQDDCIAVNSGTGVYFKNNYCSGGHGASIGSVGLRSNNVVDTVYFE
                     NNQIVNSDNGLRIKTIQKATGSVNNVHFLSNTISGIRKFGIVVETDYSSGSTTGTPGS
                     KVPITNFEVDGLTGSVDSSAYRVKILVAGASKWTWKDVDITGGSSFGSCTGIPSGSGA
                     SC"
     gene            complement(<1091639..>1092328)
                     /locus_tag="KLMA_10517"
                     /db_xref="GeneID:34714175"
     mRNA            complement(<1091639..>1092328)
                     /locus_tag="KLMA_10517"
                     /product="uncharacterized protein conserved in bacteria"
                     /transcript_id="XM_022822151.1"
                     /db_xref="GeneID:34714175"
     CDS             complement(1091639..1092328)
                     /locus_tag="KLMA_10517"
                     /codon_start=1
                     /product="uncharacterized protein conserved in bacteria"
                     /protein_id="XP_022674030.1"
                     /db_xref="GeneID:34714175"
                     /translation="MSFKFDDDGVVKEFHGNTIICHIPQQTEFFNKLLDFYRFAKRLS
                     FYDKITLLPPSSYHVTIMNCCHEHDRSEGHWPKGIDPDTSMLRCTSHLTNILTSENAA
                     TAGSADSELELQVYKPAMSMQLDKPRSINVVMEPSTDSQETKIKQFRDNVSSLTGLID
                     PSHDSIRFHITLAYINEELTIAETQELTKTINELHKSLAEACPIIKLAAPEFVTFDDM
                     FYFHTVAKLSM"
     gene            complement(<1092883..>1094553)
                     /gene="INU1"
                     /locus_tag="KLMA_10518"
                     /db_xref="GeneID:34714176"
     mRNA            complement(<1092883..>1094553)
                     /gene="INU1"
                     /locus_tag="KLMA_10518"
                     /product="inulinase"
                     /transcript_id="XM_022822162.1"
                     /db_xref="GeneID:34714176"
     CDS             complement(1092883..1094553)
                     /gene="INU1"
                     /locus_tag="KLMA_10518"
                     /codon_start=1
                     /product="inulinase"
                     /protein_id="XP_022674031.1"
                     /db_xref="GeneID:34714176"
                     /translation="MKLAYSLLLPLAGVSASVINYKRDGDSKAITNTTFSLNRPSVHF
                     TPSHGWMNDPNGLWYDAKEEDWHLYYQYNPAATIWGTPLYWGHAVSKDLTSWTDYGAS
                     LGPGSDDAGAFSGSMVIDYNNTSGFFNSSVDPRQRAVAVWTLSKGPSQAQHISYSLDG
                     GYTFQHYSDNAVLDINSSNFRDPKVFWHEGENGEDGRWIMAVAESQVFSVLFYSSPNL
                     KNWTLESNFTHHGWTGTQYECPGLVKVPYDSVADSSSNSSDSKPDSAWVLFVSINPGG
                     PLGGSVTQYFVGDFNGTHFTPIDDQTRFLDMGKDYYALQTFFNTPNEKDVYGIAWASN
                     WQYAQQAPTDPWRSSMSLVRQFTLKDFSTNPNSADVVLNSQPVLNYDALRKNGTTYSI
                     TNYTVTSENGKKIKLDNPSGSLEFHLEYVFNGSPDIKSNVFADLSLYFKGNNDDNEYL
                     RLGYETNGGAFFLDRGHTKIPFVKENLFFNHQLAVTNPVSNYTTNVFDVYGVIDKNII
                     ELYFDNGNVVSTNTFFFSTNNVIGEIDIKSPYDKAYTINSFNVTQFNV"
     gene            complement(<1096252..>1098069)
                     /gene="ARN1"
                     /locus_tag="KLMA_10519"
                     /db_xref="GeneID:34714177"
     mRNA            complement(<1096252..>1098069)
                     /gene="ARN1"
                     /locus_tag="KLMA_10519"
                     /product="siderophore iron transporter ARN1"
                     /transcript_id="XM_022822173.1"
                     /db_xref="GeneID:34714177"
     CDS             complement(1096252..1098069)
                     /gene="ARN1"
                     /locus_tag="KLMA_10519"
                     /codon_start=1
                     /product="siderophore iron transporter ARN1"
                     /protein_id="XP_022674032.1"
                     /db_xref="GeneID:34714177"
                     /translation="MTSSDNGDIAFKDKGNNVIIDEKHVEKDSFKSSKSIVIRKTEIL
                     AEQYSSWQWRFVLLLSAFLCGYGYGLDSTLRSFYTTYATNSYSTHSLLSTVGVINAVM
                     GAAAQIVYARLSDVYGRFTLFCTAIMFYVVGTIIESQAYDVQRYAAGAVFYNIGYVGV
                     ILIVLLILSDFSSLRWRLFYSFVPAWPFIINTWISGDIVASVKPQKHWSWAIAMWAFI
                     FPLSCLPLITCMIHMRMRARKTAAWKELSQEQTFYQKHGLKSTLVELFWKLDVVGVIL
                     MIVILGCILVPLTLAGGTSSKWRQAHIIAPFVVGFVLIPFFIVWESRFAVEPVAPFKL
                     LKDRGIWAALAISFLVNFIFTMAAGYLFTILIVAVDQSNKAATRITSISTFTSTVFSP
                     FFALFVTRVTRLKPYIILGCSLWMVAMGILFHFRSGQHSDNGIIGALVVWGIGTTMFT
                     YPVTVSIQSVTSHEHMATVTALSYTMYRIGSAVGSSVSGAIWTQLLYKQLLKHLGGDA
                     ELAAKFYGAPLTYVALYPWDSPIRQSVVQAYRYVQKYEVLVALIFTVPLFVLSLCLRD
                     PPLTDSVAHENIKEGEYIDVEHDDPVSNWISSKWNRLTK"
     gene            <1098832..>1099554
                     /locus_tag="KLMA_10520"
                     /db_xref="GeneID:34714178"
     mRNA            <1098832..>1099554
                     /locus_tag="KLMA_10520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822184.1"
                     /db_xref="GeneID:34714178"
     CDS             1098832..1099554
                     /locus_tag="KLMA_10520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674033.1"
                     /db_xref="GeneID:34714178"
                     /translation="MYIPSHLEVTELDQQVELIREYPLGTMFSYNGGKSRLLDYFKSG
                     KEDDAIDSEMCATHVPFCYVAGNSGTGPGKLIAHLARRNQHVELLEQSPNCLVVFQSV
                     DSYVSPEYYPLKKKTHKFVPTWDFGCVHVYGRARIIRDDPAWLLEMLNAITDQEEEKR
                     PDEANRWKVSEAEPSYLERMMKEVVGIEIEISSMQCKMKFQQDQPPVNVNGVLDGYSK
                     ELDAAKAQELSKFTRKHYPRDL"
     gene            complement(<1101666..>1102202)
                     /gene="FMP23"
                     /locus_tag="KLMA_10521"
                     /db_xref="GeneID:34714179"
     mRNA            complement(<1101666..>1102202)
                     /gene="FMP23"
                     /locus_tag="KLMA_10521"
                     /product="protein FMP23"
                     /transcript_id="XM_022822187.1"
                     /db_xref="GeneID:34714179"
     CDS             complement(1101666..1102202)
                     /gene="FMP23"
                     /locus_tag="KLMA_10521"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="protein FMP23"
                     /protein_id="XP_022674034.1"
                     /db_xref="GeneID:34714179"
                     /translation="MIKFTRAFRTFAPVSSKSVSNRIIIPPVTQVNYGQPSLKALQSE
                     YKQLPDNSNFIEKYYNELQTFRDEFLVPHLNKQYTDFEENPDDLVFEIEKYIECQVIP
                     KHSVYTQKSDLMAHGEQLPMVYCDTVGDKMIIERFLDFCRGVRHTLRLNGGHSVIFDI
                     MLQSNSVFEDFERRRASS"
     gene            <1103297..>1104355
                     /gene="ZTA1"
                     /locus_tag="KLMA_10522"
                     /db_xref="GeneID:34714180"
     mRNA            <1103297..>1104355
                     /gene="ZTA1"
                     /locus_tag="KLMA_10522"
                     /product="probable quinone oxidoreductase"
                     /transcript_id="XM_022822188.1"
                     /db_xref="GeneID:34714180"
     CDS             1103297..1104355
                     /gene="ZTA1"
                     /locus_tag="KLMA_10522"
                     /codon_start=1
                     /product="probable quinone oxidoreductase"
                     /protein_id="XP_022674035.1"
                     /db_xref="GeneID:34714180"
                     /translation="MASLARLANRLSLRTMSSSAIPSVQKVVLIRETGGPEVIRYEED
                     FPVPKISENELLIKNSYAGVNFIEAYFRKGIYPSEKPYVLGREAVGTVVAKGEKSGDK
                     FEIGDKVAYLSPGTFAQYTKYPSNGKIIKLPQDISKEKLITTAASLVQGLTALTFIDE
                     AYSVKKGDYILVYAAAGGVGLILDQLLKKRGARTIAVASTDEKLQLAKEYGAEFLINS
                     SKEDIVERVNEITNGQGVEAAFDSVGKDTFETTLQALKRKGTFVSYGNASGPVPPVPL
                     NKLVPKNIKLVRPQVFGYITADDEWEHYSSELVRLIDSGELKIKVFKVYPLKDYRQAT
                     EELEGRKTTGKLVLEIPE"
     gene            <1104977..>1106692
                     /locus_tag="KLMA_10523"
                     /db_xref="GeneID:34714181"
     mRNA            <1104977..>1106692
                     /locus_tag="KLMA_10523"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822189.1"
                     /db_xref="GeneID:34714181"
     CDS             1104977..1106692
                     /locus_tag="KLMA_10523"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674036.1"
                     /db_xref="GeneID:34714181"
                     /translation="MATSLLTSIELNDSPAISSGTKRAKIKRLFSTLGGGVSTALSEN
                     QPLGDETPPTPDQFSGLSPTKQAIKKMRFFFARHWLGTADPMDNNEFVSNSANVSVED
                     FSCYNKYKTDGMELERLFNEAVVDKRPPSTRDEIVRKMGPFESMDFWQSKNWMQGIRD
                     FNVTFSPVESEPSADLSMSSDAFKKPSNNRDDDHKGTALSSSKAPYLDKLASGSANGN
                     SYVYDFGNSSALPDLIYGLETAPTQSGAGSSAKQVKSLQLIEENDGLALLTSGRSLKN
                     GAKIFNSNSPESNQLESADCAVSQKVMIPTFREEIGMEVHSIANNLQGGTITEADLIK
                     LACCKKRTFMDANFYNDEDDNEERSISSLEEYHMAENFSIRSKGFVQTGSIEHDQERE
                     RNLANMEVEKGDKGDTVKFNKFSYLVIYDASKKCHYSESTDKLTLKIPHDGGSQTRAK
                     IAVSALVNTETSLNIEAESTPYSDSMRLKSILKRRTNEQESIEAQRARKCDEIDASDF
                     LEFVENHENKRRSGEDILVLARERQLKNYYDDQMLQTITVRKEKQSFSGFEDEYNKVS
                     GLTSC"
     gene            complement(<1107100..>1108479)
                     /gene="SES1"
                     /locus_tag="KLMA_10524"
                     /db_xref="GeneID:34714182"
     mRNA            complement(<1107100..>1108479)
                     /gene="SES1"
                     /locus_tag="KLMA_10524"
                     /product="seryl-tRNA synthetase"
                     /transcript_id="XM_022822190.1"
                     /db_xref="GeneID:34714182"
     CDS             complement(1107100..1108479)
                     /gene="SES1"
                     /locus_tag="KLMA_10524"
                     /note="cytoplasmic"
                     /codon_start=1
                     /product="seryl-tRNA synthetase"
                     /protein_id="XP_022674037.1"
                     /db_xref="GeneID:34714182"
                     /translation="MLDITQFIEEKGGNPDLIRKSQVARGASVEIVDEIIADYKEWVK
                     TRFQVDELNKQQNKVQKEIGLKFKNKEDASELLAEKDRIVAEKKVLAEKEQEQDKQLR
                     FKVNQVGNIVHPSVVVSNDEENNELVRTWMPENVKEVGQVATCTGAEAKLSHHEILLR
                     LDGYDPERGVKITGHRGYFFRNYGVFLNQALINYGLSFLASKGYTPLQAPVMMNKDVM
                     AKTAQLSEFDEELYKVLDGDDEKYLIATSEQPISAYHSGEWFEKPQEQLPVRYVGYSS
                     CFRREAGSHGKDAWGVFRVHAFEKIEQFVLAEPDKSWEEFDRMISLSEEFYQSLGLPY
                     RVVGIVSGELNNAAAKKYDLEAWFPYQKEYKELVSCSNCTDYQSRNLEIRCGIKKMGD
                     REKKYVHCLNSTLCATQRALCCVLENYQTEDGLKVPEVLRKYIPGEPEFLPYVKELPK
                     NSTSNKKKN"
     gene            1108853..1108926
                     /locus_tag="KLMA_R118"
                     /db_xref="GeneID:34718633"
     tRNA            1108853..1108926
                     /locus_tag="KLMA_R118"
                     /product="tRNA-Val"
                     /db_xref="GeneID:34718633"
     gene            <1109182..>1109601
                     /locus_tag="KLMA_10525"
                     /db_xref="GeneID:34714183"
     mRNA            <1109182..>1109601
                     /locus_tag="KLMA_10525"
                     /product="atg31 super family"
                     /transcript_id="XM_022822191.1"
                     /db_xref="GeneID:34714183"
     CDS             1109182..1109601
                     /locus_tag="KLMA_10525"
                     /codon_start=1
                     /product="atg31 super family"
                     /protein_id="XP_022674038.1"
                     /db_xref="GeneID:34714183"
                     /translation="MDTPMLLVTNVNDAIQNDDLRMDSLTNENAWFLNNISYIFEDDE
                     PIQQEDHSNYENLFIIDSDLNGKISGVELLSEKWQLLSYDQNKPYNCISLRVMDELRA
                     DLSPQDGDVKDLDSLARRYHDRNVQIRNLLDSLIQED"
     gene            complement(<1109644..>1110840)
                     /gene="FAL1"
                     /locus_tag="KLMA_10526"
                     /db_xref="GeneID:34714184"
     mRNA            complement(<1109644..>1110840)
                     /gene="FAL1"
                     /locus_tag="KLMA_10526"
                     /product="ATP-dependent RNA helicase FAL1"
                     /transcript_id="XM_022822194.1"
                     /db_xref="GeneID:34714184"
     CDS             complement(1109644..1110840)
                     /gene="FAL1"
                     /locus_tag="KLMA_10526"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase FAL1"
                     /protein_id="XP_022674039.1"
                     /db_xref="GeneID:34714184"
                     /translation="MSFNRDEDSKLKFKTSKKLKVSATFESMNLKPDLLRGIYSYGFE
                     LPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDSKSKELQALVLSPTRE
                     LAAQSESVISNLGDYLNVTAHACTGGKTLQQDIKKVSKNCQVVSGTPGRVLDMIKRQL
                     LNVRNCKILVLDEADELLGESLGFKQQIYDIFTKLPTTIQVVVVSATMSKDILEVTKK
                     FMSDPVKILVKRDEISLDVIKQYYVDVEKEEWKFDTLCDLYDSLTITQCVIFCNTRKK
                     VDWLSKKLTQTNFSVSSMHGDMKQEERDHVMNDFRSGKARVLISTDVWARGIDVQQIS
                     LVINYDIPDNLENYIHRIGRSGRFGRKGVAINFITKDEKSKLKEIEAHYRIKIKPTPA
                     NLEELS"
     gene            <1111191..>1112285
                     /gene="TLG2"
                     /locus_tag="KLMA_10527"
                     /db_xref="GeneID:34714185"
     mRNA            <1111191..>1112285
                     /gene="TLG2"
                     /locus_tag="KLMA_10527"
                     /product="t-SNARE affecting a late Golgi compartment
                     protein 2"
                     /transcript_id="XM_022822195.1"
                     /db_xref="GeneID:34714185"
     CDS             1111191..1112285
                     /gene="TLG2"
                     /locus_tag="KLMA_10527"
                     /codon_start=1
                     /product="t-SNARE affecting a late Golgi compartment
                     protein 2"
                     /protein_id="XP_022674040.1"
                     /db_xref="GeneID:34714185"
                     /translation="MYRDRTNLFLSYRRTFPHQRLSSTKYTVANKDLEDQPFIGNEDG
                     IAMDNFSRRLPPRFFDLTFQVDEALALVDRLLVQLAKLYQKNSLPGFQDNRQDEQQIE
                     DISFQVIKKFQECFGVIKTLTRIKETQFSNGQQLNKDELRILDNLEKNYALKVQEKSQ
                     KFRVLQNNHLKFLNKDDFKPLPTAKSNDDTLLLLEEEVQQGDSNEIDSYSKQTLQKQN
                     AKMHDSNQQFLQQRDEEITQLAKGVLEVSTIFREMQSLIIDQGTVVDRIDYNLENTVV
                     ELKQAQRELDKATHYQKRSQKCKIILFLSLLVLAMFMLVMLKPHHRTIKETAPSPDQG
                     QPKNGNSGGSGNQADVVNADPLLDPESNIQ"
     gene            complement(<1112494..>1114542)
                     /locus_tag="KLMA_10528"
                     /db_xref="GeneID:34714186"
     mRNA            complement(<1112494..>1114542)
                     /locus_tag="KLMA_10528"
                     /product="pH-response regulator protein palI/RIM9"
                     /transcript_id="XM_022822196.1"
                     /db_xref="GeneID:34714186"
     CDS             complement(1112494..1114542)
                     /locus_tag="KLMA_10528"
                     /codon_start=1
                     /product="pH-response regulator protein palI/RIM9"
                     /protein_id="XP_022674041.1"
                     /db_xref="GeneID:34714186"
                     /translation="MAKTYTFGYATLLTVLQCIALAFLILACLSAPVFKNISLAKLGD
                     IHYGVFGYCQQGEGCSSAKANYHPENLSSDDGDWKMKHDARKSLGNLLIVTPVAAGLT
                     LLALVTSFLCQFKHFDANTIWFCCNFSFSVLAFIASALCCISTILLFYPHVTWTAYIL
                     IGSAVLTLVCLPLCFLARSETASNGLGDGSDDEDGEYASSSSMRDKLFKDELNQTDLT
                     NMDDLSFPEYYKAPKIVTTTTLNSNTVTDSDVSDSYLNKFAPAGMGGGAGAGAVAAAA
                     ASSSSSLPYQRASNNNVNNISNSHAASSRFQSAVPKQPFSVIDSSTTSVATSSAAPRL
                     AASGRLGPGQQPLATTDRIASDAPSSVYTEQEQDGSNNNMGMGVGVGPSNAGHRAAPF
                     TSSNDRYRNGYPMTQRQQQPQPQPQPQQPQPQQPQQPGRQPEPVPLHHTDEDGVLQDL
                     INGVLPEDEEEFLKRNTIDPSDRPPMDAFDEDGDGINDDDSEFTSVSQRGINPRYYQG
                     RGGIPPQGMQYYPPPMGQQPQSANGMIHPPLPQQQQQQQQQQPMSAQYYPPMPNHGGA
                     VPPPQHQQGHYQDPSMGMPMGVSPHLHQQPAPPHQQLQQRSSFSAGPSASDFVLQSNP
                     EFTIGSGPASLPGGQRAGNPNSGLGSNMHYKPAYKKRLPRKMNIAPASMSRDSPYGGF
                     "
     gene            complement(<1115132..>1115551)
                     /locus_tag="KLMA_10529"
                     /db_xref="GeneID:34714187"
     mRNA            complement(<1115132..>1115551)
                     /locus_tag="KLMA_10529"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822197.1"
                     /db_xref="GeneID:34714187"
     CDS             complement(1115132..1115551)
                     /locus_tag="KLMA_10529"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674042.1"
                     /db_xref="GeneID:34714187"
                     /translation="MAELLPQNVPHSACPRPKNVPQNPRLNQDQHGPVRPLGTHTPPI
                     SALSLHYTTLHYGYTCMPSSPFLSFLPPSLPSKIATTLRHSPIKTQPATQLIKDRKRR
                     STEQAQRNAHALAHTAGVLRMLDLVRKDHKTAQNPAI"
     gene            complement(1115647..1115739)
                     /locus_tag="KLMA_R119"
                     /db_xref="GeneID:34718634"
     tRNA            complement(join(1115647..1115685,1115703..1115739))
                     /locus_tag="KLMA_R119"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:34718634"
     gene            <1116032..>1116499
                     /locus_tag="KLMA_10530"
                     /db_xref="GeneID:34714188"
     mRNA            <1116032..>1116499
                     /locus_tag="KLMA_10530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822198.1"
                     /db_xref="GeneID:34714188"
     CDS             1116032..1116499
                     /locus_tag="KLMA_10530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674043.1"
                     /db_xref="GeneID:34714188"
                     /translation="MGAQPSKPAETKVYVPETPVNFESKLIAQIDNSTETDFTRAQKA
                     ERYLQEKVSAKLADLEAEALKEFESKLSSSTLPDDSNSNSSTNTLSTALVNEKVEQLK
                     NRLAKLEESHKAKSTESVVATKKSLTECLLKNKEKPLNCYDEVEQFKKAVMEI"
     gene            complement(<1116837..>1118432)
                     /gene="UBP6"
                     /locus_tag="KLMA_10531"
                     /db_xref="GeneID:34714189"
     mRNA            complement(join(<1116837..1118275,1118417..>1118432))
                     /gene="UBP6"
                     /locus_tag="KLMA_10531"
                     /product="ubiquitin carboxyl-terminal hydrolase 6"
                     /transcript_id="XM_022822199.1"
                     /db_xref="GeneID:34714189"
     CDS             complement(join(1116837..1118275,1118417..1118432))
                     /gene="UBP6"
                     /locus_tag="KLMA_10531"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 6"
                     /protein_id="XP_022674044.1"
                     /db_xref="GeneID:34714189"
                     /translation="MSDFQFNIKHAGKVYPITLSSEAVGSDLRAKVETLTLVPQDRQK
                     FMVRGGLTDNSTVVSSVIKPNSTVMVLGTPDANLILKPTDDTKFLEDLSEKERSMQED
                     ATPVGLRNMGNTCYFNASLQALYRIKPLREKVLAFNESNPDLHGQLVAQLKQCFNAFA
                     QRKEKAFTPIIMLTILRKIYPQFAEKDPSTGFYKQQDAEELFTQLLHTVDAVFGESLS
                     SKFEIEFKTTITDTLNETDVQTKVESDKKLQCHISSTTNFLKNGLTESLVEKVEKRSE
                     VTGSNSIFENSKKITKLPEYLTVQFVRFYWKKSTGKKSKILRKVQFPFQLDVADLLTP
                     EYAAEKIKMRDELREVDKLREDDFKEFNKNIQEHVPLSLSPAERYETQMALEESKREH
                     WATEFAKKFPKDLRPGENPSSVYNLIAVITHQGANSDSGHYQSFVRDEVDEQKWYKYN
                     DDKVSVISQDKIEQLAGGGESDSALILIYKGLGL"
     gene            complement(<1118952..>1120727)
                     /gene="TAT2"
                     /locus_tag="KLMA_10532"
                     /db_xref="GeneID:34714190"
     mRNA            complement(<1118952..>1120727)
                     /gene="TAT2"
                     /locus_tag="KLMA_10532"
                     /product="tryptophan permease"
                     /transcript_id="XM_022822200.1"
                     /db_xref="GeneID:34714190"
     CDS             complement(1118952..1120727)
                     /gene="TAT2"
                     /locus_tag="KLMA_10532"
                     /codon_start=1
                     /product="tryptophan permease"
                     /protein_id="XP_022674045.1"
                     /db_xref="GeneID:34714190"
                     /translation="MKKEGDIDIDRLGMSELVSPSSGDLEMKFSDNTVTKEVEADLDD
                     RTSGSCSKRRTLLTRMVDSFKPPLDGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVG
                     SGKALAVGGPLAMIIGWLIAGSQMVGTIHGLGEITIRFPVVGAFANYGTRLLDPSVSF
                     MVSSIYICQWYFVLPIELIASAMTVQYWTTKVDPVVWVAIFWALVVCINLVGIKGFGE
                     AEFAFSLIKVVTILGFIILSVILICGGGPKHEFIGGRYWHHPGALANGFKGVASVFVT
                     ASYSLGGSEMVCLCSAETDPKELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLLG
                     GSSVNNSPFVIAIKLNGIHVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIP
                     RVFGYVDRAGRPLVGIIVNALFGLLAFLVKSSSMDVIFDWLMAIAGLATCVVWLSINI
                     SHIRFRMAMKAQGRSLDELEFKSSVGVYGSIYSAVINCLILIAQFYISLWPVGGWTSG
                     SDRAELFFKQYLCALVLVMIFVLHKIYFRISTGKWFDFKPLTEIDLETDRKNIDIEIV
                     KQEVREREFYLSTRPWYIRFYNFWC"
     gene            <1121530..>1124562
                     /gene="DIS3"
                     /locus_tag="KLMA_10533"
                     /db_xref="GeneID:34714191"
     mRNA            <1121530..>1124562
                     /gene="DIS3"
                     /locus_tag="KLMA_10533"
                     /product="exosome complex exonuclease DIS3"
                     /transcript_id="XM_022822201.1"
                     /db_xref="GeneID:34714191"
     CDS             1121530..1124562
                     /gene="DIS3"
                     /locus_tag="KLMA_10533"
                     /codon_start=1
                     /product="exosome complex exonuclease DIS3"
                     /protein_id="XP_022674046.1"
                     /db_xref="GeneID:34714191"
                     /translation="MASTKPLVRKRISDGLAVTQKVFVRSRNGGAQKVVREHYLRRDI
                     PCLSKVCDKCSEIIVPNAVGEFPKFVLSESPQELEDLGKHYVVVDANIILQSIDLLEN
                     PKCFFDVIVPQIVLDEVRNKSYPIYTRIRALCRDSEDDVKRFIVFHNEFSEYTYIDRN
                     GTESINDRNDRAIRKTVEWYSSHLKEKDVSVVFVTNDRLNRQEALKSGLVAKSLSEYV
                     DMLPNSEEIKDLIPNLAPVSGMSGKMLEDDAEGRSKSGSNEFCFPEYYSTSRIMGGLK
                     NGSLYQGSIQISEYNFLEGTVSLPNFKKPVLILGQKNLNRAFNGDLVVVELLPESEWK
                     APSTVTIDSEHFNVNDNPDNDEDDDDSTGVLTGTQSASAMMSDKDRRLLAQSAIKAQQ
                     SNKIQPTARVVGITRRSWRQYVGQITPTSVDPQNSGTQNVFVILMDKCLPKIRIRTRL
                     AKQLLNKRIVVSVDCWPENYRYPLGHFVRDLGEIESAEAETEALLLEHDVEYRPFSKK
                     VLDCLPSEGHDWKAPADLSDPEAISKDPLLVKRKDFRDKLICSIDPPGCVDIDDALHA
                     KQLPNGNWEVGVHIADVTHFVKPGTALDAEGASRGTSVYLVDKRIDMLPMLLGTDLCS
                     LKPYVDRFAFSVIWELDNDANIVGVDFFKSVIRSREAFSYEKAQNRIDDKSQNDELTQ
                     GMRALLQLSKKLKQKRLDAGALNLASPEVKVHMDSETSDPNEVEIKKLLDTNSLVEEF
                     MLLANISVARKIYEAFPQTAMLRRHAAPPSTNFELLNEMLQVRKGMSISLESSKALAD
                     SLDRCEDPNDPYLNTLIRIMSTRCMMAAQYFHAGAFSYADFRHYGLAVDIYTHFTSPI
                     RRYCDVVAHRQLAAAIGYESLDLSHRDKQKMEMICRNINKRHRNAQFAGRASIEYYVG
                     QVMRNNESTETGYVIKVFNNGIAVLVPKFGVEGLIRLENLTDDPQQVDFIEDKFTLKF
                     VDKNGVSREVSVFDKVDVQVKSILDPTTSKRKAQLLLK"
     gene            complement(<1124608..>1126866)
                     /gene="GCN20"
                     /locus_tag="KLMA_10534"
                     /db_xref="GeneID:34714192"
     mRNA            complement(<1124608..>1126866)
                     /gene="GCN20"
                     /locus_tag="KLMA_10534"
                     /product="protein GCN20"
                     /transcript_id="XM_022822202.1"
                     /db_xref="GeneID:34714192"
     CDS             complement(1124608..1126866)
                     /gene="GCN20"
                     /locus_tag="KLMA_10534"
                     /codon_start=1
                     /product="protein GCN20"
                     /protein_id="XP_022674047.1"
                     /db_xref="GeneID:34714192"
                     /translation="MSNIGFSLRKNAPQVDSIVTDYVLGYFNHLSNATYDAVQSKQLD
                     LNSEVSFLRDLLVNAGASSEKISSVIQEMQDKLSAQLKENQAKLELTGDTSKRLLDIN
                     VLQSHNNKSNLNNSLAALGVSGDIEHTGRKMETRVDLKKLKKAEEKIAKKVAKRNNKF
                     VKYEASKLINEGQNEDYDSFFLKINPLEFGSAAGKSKDIKIDTFDLYVGDGQRILSNA
                     QLTLSYGRRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQEIRGDETKALQSV
                     LDADVWRKQLLSEETKINERLQEIEELRKEFDEESLEVKKLDNERADLEDHLEQISAK
                     LIDMESDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLD
                     EPSNMLDVPSIAYLAEYLKTYPATVLVVSHDRAFLNEVATDIIYQHNERLDYYRGQDF
                     DSFYATKEERRKTAQREYENQMAYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPIL
                     EPPEEEKTINFHFPDCEKLSPPIIQLQEVSFSYKESAPLLTDVSLDVQMDSRIALVGA
                     NGCGKTTLLKVMMEQLRPTKGFVSRNPRLRIGYFTQHHVDSMDLNLSAVDWMSATFPG
                     KTDEEYRRHLGAFGISGSLGIQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLD
                     TAGLDALVDALKSFTGGVLMVSHDIAVINSVCNEIWVSENGKVNKFDGTIFDYRDYII
                     ANAGKAGFIKRQ"
     gene            complement(1127243..1127313)
                     /locus_tag="KLMA_R120"
                     /db_xref="GeneID:34718635"
     tRNA            complement(1127243..1127313)
                     /locus_tag="KLMA_R120"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718635"
     gene            <1127927..>1129231
                     /gene="TSR4"
                     /locus_tag="KLMA_10535"
                     /db_xref="GeneID:34714193"
     mRNA            <1127927..>1129231
                     /gene="TSR4"
                     /locus_tag="KLMA_10535"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822203.1"
                     /db_xref="GeneID:34714193"
     CDS             1127927..1129231
                     /gene="TSR4"
                     /locus_tag="KLMA_10535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674048.1"
                     /db_xref="GeneID:34714193"
                     /translation="MSKNDQNNFDGEEEEDSYSYENKNSNVYLGLVDTAIKEDDEPVP
                     EDTFIGGEPCWLAPDSMPNEEMLNCGSCKSTEFMKLLAQAYAPLDMDMVEPVCQKKKI
                     KLSTSSFINPDYTRVLYVFICTRCKRKNGSVKCIRGVKKNDSVDYVTEKMEQLQSKEF
                     QLNPFDLSSSKNDSKSGPESNPFALSSAFSGDAAVANPFGATAANPFAQTDSKTENEK
                     DKDVKEEAPALSQKALRKLHDQKKDKEFDSSKAFPGYFVFVEEESFKNKTPDHLKLPK
                     NLKIDKTALDLSEDAFDSLEENQAKLDPRTEKLSKFLDDDVFQKFQEVVGYNPGQVIR
                     YDFGGKPLYYAKTPKEFEDIVAKPSYNPASKRVFEMQLMPKMILDLEEEVSLTEGMDW
                     GTIMVYTDIENYIPKFDENMVGYVEEVVKVQWEAIDYDETKN"
     gene            complement(<1129299..>1131320)
                     /gene="IFM1"
                     /locus_tag="KLMA_10536"
                     /db_xref="GeneID:34714194"
     mRNA            complement(<1129299..>1131320)
                     /gene="IFM1"
                     /locus_tag="KLMA_10536"
                     /product="translation initiation factor IF-2"
                     /transcript_id="XM_022822205.1"
                     /db_xref="GeneID:34714194"
     CDS             complement(1129299..1131320)
                     /gene="IFM1"
                     /locus_tag="KLMA_10536"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="translation initiation factor IF-2"
                     /protein_id="XP_022674049.1"
                     /db_xref="GeneID:34714194"
                     /translation="MILTRRLPVRACSRLTMTFPLATSVRDFHWSGLQLAGKRKKRYA
                     PSKELKKLTFDIPKHTSVNNLSNLLNIRLEKLIQDLKKLGFSQASSNYILTREYIELI
                     LQEYNYEFESTKTVDSSNLYDELKSPMNPRFLEPRPPIVTIMGHVDHGKTTILDYLRK
                     SSIVSQEHGGITQHIGAFQCIAPVSKKPITFLDTPGHAAFLKMRERGANITDIIVLVV
                     SVEDSIMPQTLEAIKHAKNSGNELIVAITKIDKITNMKERAKAIEKVENSLIANEIEL
                     EKIGGDVQVVHISAKTGENMDQLEESIISLSDIMDLKAEKNVKTVCEGWVLESEVKKA
                     VGNVATVLLKKGIMSKGDILISGNSICKIRSMLNENGDNVPKAFPSQAVEIVGWKSLP
                     NAGDEVIQVKSESIAKKYVSKRQHLLQEESEVKDIEKLNDDRAIEQEKVSMTEDELDD
                     LEDGDEAAAEVETGPKDINFIIKADVSGSEEAIVQSIEHLGNEEVRCNIVQSSVGVPT
                     EGDLKMAKITGSTIICFNLDNVPNDIINNKDKVPVKQFNVIYKLIEDVTETLTENLKP
                     IFEEKQLATVEIREIFEFKVKRKFIKIAGCKVVNGKVSRNSMVKVVRGPQEDEVYNGR
                     IASIKQGKETVQDVNKGNDCGITLENDFEDYEVGDKIIVYEKIKVPRFL"
     gene            complement(<1131780..>1133839)
                     /locus_tag="KLMA_10537"
                     /old_locus_tag="KLMA_10538"
                     /db_xref="GeneID:34714195"
     mRNA            complement(join(<1131780..1133010,1133310..>1133839))
                     /locus_tag="KLMA_10537"
                     /old_locus_tag="KLMA_10538"
                     /product="trimethyllysine dioxygenase"
                     /transcript_id="XM_022822206.1"
                     /db_xref="GeneID:34714195"
     CDS             complement(join(1131780..1133010,1133310..1133839))
                     /locus_tag="KLMA_10537"
                     /old_locus_tag="KLMA_10538"
                     /codon_start=1
                     /product="trimethyllysine dioxygenase"
                     /protein_id="XP_022674050.1"
                     /db_xref="GeneID:34714195"
                     /translation="MPSQSHQAGQAPGQSHGNLQAPLKPEFLESRDFTALDNPPEPKR
                     TPDPFAQKKESKNGDYLSDLLSSVSKRLQGVHSTNTTDHRHFFQQKSEPETLREPPEH
                     PQAGEEVKFKDSYQDKHRDSDKGEGEVRSNSNSNSHSSRSGSSGEIPPFKRRNSSLYE
                     DFKKDYYDNIHMFDPPNTSSNHSPKMTIEIIDYAVNSSFDNYVSLQINGKAYLFHLVY
                     LRDNCTDKKSFHDETHQRLVDIFNDIDLESDLNGAVDIEKGELVVKWRDGAVSRFTEQ
                     WLLRHAYYPADVVEPNEHVQFPEKITWGRTKFDSLIQNGQHFKNDYQHLQDPSVKKNI
                     FQEIYQYGFTLIQNVPVSIEATKQVSELISIIRPTHYDTGVWDFTSDLAKKDTAYTSL
                     AIDMHTDGNYWYETPGLQLFHLLFHDGEGGETRICDVARVLELIKARAAEDESWQETL
                     DILTKQPIEFHQSGEPENVFVENRFPILQIDDDGNLVQCRWNTSDRSSMMKNAKYPVN
                     KIYLAMSRFNELINDTVNYVRFPLAPGTIFVFDNWRVLHARTAFNGKRRLCGSYLTRD
                     DFIARFRSLLFDREQWLNSV"
     mRNA            complement(<1133306..>1133839)
                     /locus_tag="KLMA_10537"
                     /old_locus_tag="KLMA_10538"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822207.1"
                     /db_xref="GeneID:34714195"
     CDS             complement(1133306..1133839)
                     /locus_tag="KLMA_10537"
                     /old_locus_tag="KLMA_10538"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674051.1"
                     /db_xref="GeneID:34714195"
                     /translation="MPSQSHQAGQAPGQSHGNLQAPLKPEFLESRDFTALDNPPEPKR
                     TPDPFAQKKESKNGDYLSDLLSSVSKRLQGVHSTNTTDHRHFFQQKSEPETLREPPEH
                     PQAGEEVKFKDSYQDKHRDSDKGEGEVRSNSNSNSHSSRSGSSGEIPPFKRRNSSLYE
                     DFKKDYYDNIHMFDPPK"
     gene            complement(<1134266..>1136002)
                     /locus_tag="KLMA_10539"
                     /db_xref="GeneID:34714196"
     mRNA            complement(<1134266..>1136002)
                     /locus_tag="KLMA_10539"
                     /product="inorganic pyrophosphatase"
                     /transcript_id="XM_022822208.1"
                     /db_xref="GeneID:34714196"
     CDS             complement(1134266..1136002)
                     /locus_tag="KLMA_10539"
                     /codon_start=1
                     /product="inorganic pyrophosphatase"
                     /protein_id="XP_022674052.1"
                     /db_xref="GeneID:34714196"
                     /translation="MDLQAPDEDLRYMALKSYIDRQWKQENKGIDQGQGQGIGQGPSN
                     DQDIVLLGLHDSSVLIQDLASTSLVVSFCRCKHPQAVVGLFRSLLDDASLPCTRALKT
                     LLLETQQQQQHYLSVSFENIEHYVSKLVSQPMVQSVHWDVVVLLLEQYSELKPLDSVF
                     SQGLGPGLGLGPGSQDPQGPQGPQEGPSIPDPVVKAFVPYLSRILVSSYPFTLRQLAL
                     VSELYPHKFTRTRALQILSEVTRIPPEGPQGPESPQGQGLPENVRLTYNLFWFWYSSE
                     GVPPEILAFLETLRHYSKDEGDLDDASDSDEFDISLSDDEDGEITSSSDHQRVAELES
                     LISRFDSLIESLTALSQTESQHLDMPPEPEPPLYAEITRSLAIAPATATATATATPDS
                     DHLLENWLKEFQNYNLAYTLSIVNQLLDSEFTLYHAQWLITLAPRLPLHTLLHFLPKF
                     IPFLKPTKRFIHVIQVGNLKQRQDAASNLRLQLWSLLNSLLHFNQQSLNLPQLRILQL
                     IIPYLQFGLKDAAKDPVLEPILTQILHKLAHHCGPLIITHEDLLQSLHSLDQEQYPGI
                     RQLIALIDFKLI"
     gene            <1136884..>1138134
                     /gene="PGK"
                     /locus_tag="KLMA_10540"
                     /db_xref="GeneID:34714197"
     mRNA            <1136884..>1138134
                     /gene="PGK"
                     /locus_tag="KLMA_10540"
                     /product="phosphoglycerate kinase"
                     /transcript_id="XM_022822209.1"
                     /db_xref="GeneID:34714197"
     CDS             1136884..1138134
                     /gene="PGK"
                     /locus_tag="KLMA_10540"
                     /codon_start=1
                     /product="phosphoglycerate kinase"
                     /protein_id="XP_022674053.1"
                     /db_xref="GeneID:34714197"
                     /translation="MSLSSKLTVKDLDVAGKRVFIRVDFNVPLDGKKITSNQRIVAAL
                     PTIQYVLEHKPKAVVLASHLGRPNGSPNDKYSLEPVSVELSKLLGKPVTFLHDCVGDD
                     VTKAVNNAKDGEVFLLENLRFHIEEEGSKKVDGQKVKADKADVEKFRHQLSSLADVYV
                     NDAFGTAHRAHSSIVGFDLPQRAAGFLLSKELEYFAKALENPTRPFLAILGGAKVADK
                     IQLIDNLLDKVDSLIIGGGMAFTFKKVLENTEIGDSIYDAAGAELVPKLIAKAKANNV
                     KIVLPTDFVIGDKFANDANTKVVTDKEGIPAGWQGLDNGPETRKAFAATVAEAKTIVW
                     NGPPGVFEFDIFAKGTEALLDAVVASSQAGNTVIIGGGDTATVAKKYGVVDKISHVST
                     GGGASLELLEGKELPGVTFLSNKQ"
     gene            complement(<1138371..>1139903)
                     /gene="POL4"
                     /locus_tag="KLMA_10541"
                     /db_xref="GeneID:34714198"
     mRNA            complement(<1138371..>1139903)
                     /gene="POL4"
                     /locus_tag="KLMA_10541"
                     /product="DNA polymerase IV"
                     /transcript_id="XM_022822210.1"
                     /db_xref="GeneID:34714198"
     CDS             complement(1138371..1139903)
                     /gene="POL4"
                     /locus_tag="KLMA_10541"
                     /codon_start=1
                     /product="DNA polymerase IV"
                     /protein_id="XP_022674054.1"
                     /db_xref="GeneID:34714198"
                     /translation="MLKGRKFVVLPNEETPRRRYMRTLIEKNGGDNGYEVGLVDDSFV
                     SGGHVTKHKLFYAELNPKNVPLERLQLFKLSDLTKWLKYKYVDLSQPLQLHEEIVVDE
                     EGDDSQESNNGSRQVIVEQKREAQNDVGKTEPNTIPNSSNPNSQLIKVLRQLEKRYKL
                     QNDIFRSLGYQKAIKKLQTVQDKIETEDDALRNGLSAGLSRKVPMLLQLSAGRGSELN
                     MDLKEQTQRYFQQCHGIGVFTSQQFVNMGYTSFQDLVPFMNWVQLTGLAFYEDWQLPI
                     PREETKKHESVIRDAISEVSPELQMEITGSYRRGSRTSGDIDIVVHIPGQDDLDYVSA
                     QLQKVIVKLVESGYIICPLNLNETLKEAFEPWFRQLFSHFDKRFDVKTYDEAVHKFYC
                     GAAVDMMGEQEGEQEGESRHVIPFKSQDLRYKMSVGGGKVCRRVDFLISGYSGLGATK
                     LYFTGNDDFNKKCRTVAKQRGFVLRNDGLYREGQLIPLGDEYEVLDMLGIERLEPEQR
                     NI"
     gene            complement(<1139897..>1140586)
                     /locus_tag="KLMA_10542"
                     /db_xref="GeneID:34714199"
     mRNA            complement(<1139897..>1140586)
                     /locus_tag="KLMA_10542"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822211.1"
                     /db_xref="GeneID:34714199"
     CDS             complement(1139897..1140586)
                     /locus_tag="KLMA_10542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674055.1"
                     /db_xref="GeneID:34714199"
                     /translation="MLKRILVLDFDGTITTKDTTSLIGESVYRLKNVKVPWNHYTKVY
                     EAHHVPKPRSLGTNPWITVCNYERDAKSCELASINELEAQDHFKDVVIQDLLQVVKPQ
                     VQVRPGLREMMGQFHETYIVSLNWSKDLIHDLTGVRKGNIFCNDLISRDNVTYNGHFT
                     KQVVTGLDKYNLLKDKILDPKSEVTYIGDSFGDLPCILAEGVKGYIIGDSLKHLQLDV
                     PTIQGFDEVQC"
     gene            <1141390..>1142211
                     /locus_tag="KLMA_10543"
                     /db_xref="GeneID:34714200"
     mRNA            <1141390..>1142211
                     /locus_tag="KLMA_10543"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822212.1"
                     /db_xref="GeneID:34714200"
     CDS             1141390..1142211
                     /locus_tag="KLMA_10543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674056.1"
                     /db_xref="GeneID:34714200"
                     /translation="MSEHVPAWKRFQIKGSDEGKKVEDELDSLIVSTHLSTGSLSKKE
                     KKRIIQGHKGDVGTTNKVSKKSKDRKREKLAKEERLKKKQVVLKDQLRYLINFYTMKL
                     ELELPEAVKELPSVKENIALQTGAEEEEQNTVKEVWKFSKQKQNWLIKHFTFLDEIPA
                     EFDPLMVKYFKDLQGGSKEQLQKSCLEIVNRYNECMEKQKEEMAKIVLGEAETDKKED
                     AKDADKDESSEETKEDSKEQTAAEKKDEILPPSKDLLKRACSMLDAWNIQYQLVE"
     gene            <1142560..>1145889
                     /locus_tag="KLMA_10544"
                     /db_xref="GeneID:34714201"
     mRNA            <1142560..>1145889
                     /locus_tag="KLMA_10544"
                     /product="glycoside hydrolase"
                     /transcript_id="XM_022822213.1"
                     /db_xref="GeneID:34714201"
     CDS             1142560..1145889
                     /locus_tag="KLMA_10544"
                     /note="family 1, active site"
                     /codon_start=1
                     /product="glycoside hydrolase"
                     /protein_id="XP_022674057.1"
                     /db_xref="GeneID:34714201"
                     /translation="MNETLENDGNNERSCVLELLRKPFKQRLRYEEATKQALEELSYS
                     KDKELARRNVFPLLKVLPIRLIKSDNKRSDMFHSLRQYCKTNKHKSYGEEWPTELADS
                     MGLDSLLDWDFDTDAHEDTNGSTRANYKPTETLIITERTVAVQGYQHIFTTNCRIIDA
                     IVIPNQNQTNKNDTCLICLSTGEIISLDFCYSWESAIYNIECVCTGGNPNPSSVKLEA
                     RFIYSSEDDTVMLVTSLLVMCVVALHKRERTFFKPEFNVLLQIGCDVSSSTWQAGKLL
                     YMVKRASEAMDCVLIEQDVLRFGPFEEILTISDVHDSDKLVILERDNVLQINAVSKMG
                     SIISGGLQRTFVGALDVKFSKEVDVHIHDLGRVFNEPLKKAHLLVLENSVVVLCMATD
                     TTNKIISFVVTRLPIPIDDITIEQLDTNDLATFLVVSRAEVYRYTIDFHEAIAKEMTS
                     ENDSVLADEMPLANVTNVFKMTEGYEDIEDIFRFKDMVLLRSKNKTYHLPRAPNRPVV
                     HMDQLAFFTEFQAFHEVKVYNLKQQEDGVSSVQENKFGPIPIRHEDPQVEQYILVGLS
                     FFCSAEAYYVEVVNNEQVEFQIIDDLLPETQERMIEFGIIDGKFISVTETAVYVNDFE
                     GVKSHTLPFSVTGARVTKECGILVWPEGQGQGEGQEQEQEQANVYSIDWETGNATATA
                     TNAETLTQNPDQYDTIDAIKLDATAAPLDWAKSTVTGKILLGSTNTGTVREIDTDGPM
                     RLAKLTGPWIVFYNATSVNVLNVLLEGCQACCMDHPDSIIVEVTCPQTSSSASSSASS
                     SSTHVFTLHDNGLAVNSIRVNEPHGRPSLEQDWAGMEWTIEMGSDLRIVSNSDMSKLI
                     YIQDGDSGALQVENRPKHKLPGEIVGYAILDDEARRLCVLSFGENALWADVFTRGIDK
                     KKKAAAETLQWESRTKALALEGGTNLCWSPGPGPGPGPGRIRGRSRRLPGRTAGQFVT
                     VVSENGAAEVLQLSLRPDSASEENKLAADKRLSIPMVEEREGGNSCQFFDSGGYVVRV
                     THNATGSSTSTSSITTPSAAGPGGSPDSGQDSSQDSSQDISQDISPSGSVVVTVYSAV
                     PCGTTMRIEKKSGDFRYSDSF"
     gene            <1147866..>1149536
                     /gene="HGT1"
                     /locus_tag="KLMA_10545"
                     /db_xref="GeneID:34714202"
     mRNA            <1147866..>1149536
                     /gene="HGT1"
                     /locus_tag="KLMA_10545"
                     /product="high-affinity glucose transporter"
                     /transcript_id="XM_022822214.1"
                     /db_xref="GeneID:34714202"
     CDS             1147866..1149536
                     /gene="HGT1"
                     /locus_tag="KLMA_10545"
                     /codon_start=1
                     /product="high-affinity glucose transporter"
                     /protein_id="XP_022674058.1"
                     /db_xref="GeneID:34714202"
                     /translation="MTLKDKLLLRNIEFKGTFYAKFPQIHNIYAIGVISCISGLMFGF
                     DISSMSSMIGTETYKKYFDHPKSITQGGITASMSGGSFLGSLLSPAISDTFGRKVSLH
                     ICAVLWIVGCILQSAAQDQPMLIAGRVIAGLGIGFGSGSAPIYCSEISPPKVRGLITG
                     LFQFSITVGIMILFYVGYGCHFLSGNLSFRLTWGLQVIPGFVLLVGVLFLPESPRWLA
                     NHDRWEETESIVAKVVAKGNVDDEEVKFQLEEIKEQVILDAAAKNFSFKDLLRPKTRK
                     KLFVGVCAQMWQQLCGMNVMMYYIVYVFNMAGYTGNTNLVASSIQYVLNVLMTFPALF
                     LIDKVGRRPVLIVGGIFMFTWLFAVAGLLASYSVPAPNGVNGDDTVTIRIPDKHKSAA
                     KGVIACSYLFVCSFAPTWGIGIWIYCSEIFNNMERAKGSSVAAATNWAFNFALAMFVP
                     SAFKNISWKTYIVFGVFSVALTVQTYFMFPETRGKTLEEIDQMWVDNIPAWKTSSYIP
                     QLPIIEDEFGNKLGLLGNPQHLEHVKSVEKDTVVEKLESSEANSSSSV"
     gene            <1151230..>1152945
                     /gene="HGT1"
                     /locus_tag="KLMA_10546"
                     /db_xref="GeneID:34714203"
     mRNA            <1151230..>1152945
                     /gene="HGT1"
                     /locus_tag="KLMA_10546"
                     /product="high-affinity glucose transporter"
                     /transcript_id="XM_022822216.1"
                     /db_xref="GeneID:34714203"
     CDS             1151230..1152945
                     /gene="HGT1"
                     /locus_tag="KLMA_10546"
                     /codon_start=1
                     /product="high-affinity glucose transporter"
                     /protein_id="XP_022674059.1"
                     /db_xref="GeneID:34714203"
                     /translation="MSFLDKKTIRGKPVKDILLLRNIDYKGTFYKKFPHVYNIYAIGM
                     ISCISGLMFGFDISSMSSMIGTKRYKRYFGHPGPTAQGGITGSMAAGSFLGSLLSPNF
                     SDTFGRKMSLHICSVFWIIGAIIQCAAQGKAMLVVGRILSGIGIGFGSSAAPVYCSEI
                     SPPKIRGLISGLFQFSVTVGIMILFYIGYGCHFINGTGSFRLTWGLQMVPGFILALGV
                     LFLPESPRWLANHDRWDEAETVVANVAAKGNRQDEQVQFQLEEIKEQVLIDAAAKDFS
                     FKDLFRPKTRKKTIVGISAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYV
                     LNVIMTIPALFLIDKAGRRPVLIVGGILMFTWLFAVAGLLATYSDPAPGGVDGDSTVT
                     IKIPHKHKPAARAVIACSYLFVCSYAPTWGIGIWIYCSEIFNNMERAKGSSVSTATNW
                     AFNFALAMFVPSSFKNISWRTYIIFGAFSVSLTVQTFLMFPETRGKTLEEIDQMWADN
                     IPAWKTTSYVPQLPVVEDEEGNKLGLLGNPQHLEDVNSNEKSEQTNSNSNNSTHNSIA
                     NDSRV"
     gene            <1155075..>1156763
                     /gene="HGT1"
                     /locus_tag="KLMA_10547"
                     /db_xref="GeneID:34714204"
     mRNA            <1155075..>1156763
                     /gene="HGT1"
                     /locus_tag="KLMA_10547"
                     /product="high-affinity glucose transporter"
                     /transcript_id="XM_022822217.1"
                     /db_xref="GeneID:34714204"
     CDS             1155075..1156763
                     /gene="HGT1"
                     /locus_tag="KLMA_10547"
                     /codon_start=1
                     /product="high-affinity glucose transporter"
                     /protein_id="XP_022674060.1"
                     /db_xref="GeneID:34714204"
                     /translation="MSLKDKILLRNINYQGTFYKKFPQLYNIYLIGLISCISGLMFGF
                     DISSMSSMIGTKEYKRYFGHPDATRQGGITGAMSAGSFLGSLLSPNFSDTFGRKMSMQ
                     ICSILWIVGCIIQCASQDVAMLVVGRVISGMGIGFGSSAAPVYCSEIAPPTIRGLISG
                     LFQFSVTVGIMILFYVGYGCHFINGAASFRLTWGLQMIPGFILGVGVLFLPESPRWLA
                     NHDRWDEAETIVANVAAKGDRENEQVKFQLEEIKEQVLIDAAAKDFAFKDLFRPKTRK
                     KTIVGICAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVIMTIPALF
                     LIDKAGRRPVLIIGGILMFSWLFAVAGLLATYSDPAPGGVDGDTTVTIRIPDKHKSAA
                     KGVIACSYLFVCSFAPTWGIGIWIYCSEIFNNMERARGSSVSAATNWAFNFALAMFVP
                     SSFKNISWKTYIIFGVFSVALTVQTFFMFPETRGKTLEEIDQMWADNIPAWKTGSYVP
                     QLPVVEDEEGNKLGLLGNPQHLEDVNSTEKGLMDKSSSNLDSNSQSNNSNSNSN"
     gene            complement(<1157968..>1160907)
                     /gene="CWH43"
                     /locus_tag="KLMA_10548"
                     /db_xref="GeneID:34714205"
     mRNA            complement(<1157968..>1160907)
                     /gene="CWH43"
                     /locus_tag="KLMA_10548"
                     /product="protein CWH43"
                     /transcript_id="XM_022822218.1"
                     /db_xref="GeneID:34714205"
     CDS             complement(1157968..1160907)
                     /gene="CWH43"
                     /locus_tag="KLMA_10548"
                     /codon_start=1
                     /product="protein CWH43"
                     /protein_id="XP_022674061.1"
                     /db_xref="GeneID:34714205"
                     /translation="MVSVRGSVIAWTHTVCAASAFIAAFVVGYTLHFHKIVTNAWYSY
                     PEEWFPSVSATIGDRYPERSIFQILIALTALPRFLLLFTHYYVNRSVITLLVGIVRTV
                     TCGGWVYITSTDDHDIHDVFMISYIILTLPWDILVIRNSEHKKWKKIVMGTFFGTLVP
                     LVYWFIQHQIHRRAGAYSIYAYFEWSLIILDITFDGLAAHDFEQIKIEVSHYDNEDDK
                     ARNTTENEFDITFTGDLSEKSEVGKKNNEDSIADISFDDQEGVVQQDRSLLLNSNDDE
                     ITILLRETERVMYPEDLPSPPEQDSFMYIIVNIFNSFMFWTTLTSLFCMIWHFPLWYM
                     GISGYETVVIATLSPILLYIPLANVIIDQYGTLLANVLSIGAYFIESPEDRLITVAVA
                     TALSVMTFALNLNSLNSSTVTTFSVTWALGLVLSTVVKMGFFTNNPLWAIMDETNGGL
                     NFPGLIVSVLFALITPFTNSCHLWNKPKVQTRLPYYQRILASMGFGSLVFAIHQSLTD
                     ASTLIYWCWEGWSSHKGPMAWPWAALVCIVMCFAIVTINQSKRIMFITLALSTLLVSL
                     PQVKEWYKFIFGVLPYTVSIIWTIPSYFQMMNYLQSPGLLTFSFSIYVILVLAHVWTV
                     AYAFVPYGWLLREREPEVLFFSTILILAGLIKFDNLTLFSSVTSSFLKKVKTIVVLIM
                     ILTATFTYQIRPTIVPEPYHPEANLITSGIWTIHFGFDNDLWASEDRMINLIKDMELD
                     VVGLLETDTQRITTGNRDLTAKLAHDLGMYADFGPGPNKHTWGCMLLSKFPIIKSEHH
                     LLPSPVGELAPAIHATIEAYGELVDVFVFHSGQEEDEEDRRLQSEEMARLMGSTDRPS
                     ILLSYLVTDPHEGNYNTYVSEKSQMYDIDPTDEDRWCEYILYKKLKRTGYARVSRATI
                     TDTELQVAKFQVLHDVDQISDDDLYEYRTISSDEVPESFKFPDKFLGEGERGHYYHVF
                     DEPRYFD"
     gene            1161389..1161463
                     /locus_tag="KLMA_R121"
                     /db_xref="GeneID:34718636"
     tRNA            1161389..1161463
                     /locus_tag="KLMA_R121"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34718636"
     gene            complement(<1161910..>1164063)
                     /gene="GLC3"
                     /locus_tag="KLMA_10549"
                     /db_xref="GeneID:34714206"
     mRNA            complement(<1161910..>1164063)
                     /gene="GLC3"
                     /locus_tag="KLMA_10549"
                     /product="1,4-alpha-glucan-branching enzyme"
                     /transcript_id="XM_022822219.1"
                     /db_xref="GeneID:34714206"
     CDS             complement(1161910..1164063)
                     /gene="GLC3"
                     /locus_tag="KLMA_10549"
                     /codon_start=1
                     /product="1,4-alpha-glucan-branching enzyme"
                     /protein_id="XP_022674062.1"
                     /db_xref="GeneID:34714206"
                     /translation="MGGNDDKSDVPENVRGVVDIDPWLRPFAQVLSERRYLADEWKYR
                     IEHSGDKQTSLSKFARDSYKTFGLHANQKTFEISYKEWAPNAVRAFLVGEFNNWDSNA
                     NEMERDEYGVFHLVVPPVVGSDGKKQFAIPHDSKIKVSFELADGSRIYRLPAWITRAT
                     QPDKETAKQWGPSYEARFWNPPTQYTFKNARPSFVSATDSLRIYEAHVGISTPEPKVG
                     TYKEFTKNVLPRIKDLGYDAIQLMAIMEHAYYASFGYQVTNFFAASSRFGTPDDLKEL
                     IDTAHGMGILVLLDVVHSHASKNVTDGLNQFDGSDHQYFHSIASTRGEHPLWDSRLFN
                     YGHFEVQRFLLANLAFYIDVYQFDGFRFDGVTSMLYLHHGVGEGGAFSGDYNEYLSKE
                     RSFVDHEALAYLMLANDLVRELLPENGITIAEDVSGYPTLCMPRDLGGAGFDYRLAMA
                     LPDMWIKLLKEYKDEDWNMGHIVHTLVNRRHREKVVAYAESHDQALVGDKTLAFWLMD
                     AAMYTDMTILKETNPVVDRGIALHKLIRLLTHSLGGEAYLNFEGNEFGHPEWLDFPNV
                     NNGDSYHYARRQFNLVDDKLLRYQQLYQFDKAMQLCEKQYKWLNTPQAYVSLKHEVDK
                     VIAFERNGLLFIFNFHPTESFTDYRIGVNEPGCYRIILNSDRSAYGGWDRIDESKSEY
                     FTTDLKWNDRNNFIQVYIPNRSALVLALDSRIQKH"
     gene            complement(<1164706..>1165598)
                     /gene="UBC8"
                     /locus_tag="KLMA_10550"
                     /db_xref="GeneID:34714207"
     mRNA            complement(join(<1164706..1165307,1165363..1165415,
                     1165594..>1165598))
                     /gene="UBC8"
                     /locus_tag="KLMA_10550"
                     /product="ubiquitin-conjugating enzyme E2-24 kDa"
                     /transcript_id="XM_022822220.1"
                     /db_xref="GeneID:34714207"
     CDS             complement(join(1164706..1165307,1165363..1165415,
                     1165594..1165598))
                     /gene="UBC8"
                     /locus_tag="KLMA_10550"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2-24 kDa"
                     /protein_id="XP_022674063.1"
                     /db_xref="GeneID:34714207"
                     /translation="MSGNVAGLRGEAISDLLTCYVMKLLMSDHDVELVNDNMQEFHIK
                     FYGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIYHPNIDAASGSICLDVINSTW
                     SPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKDKDMYEQKINEYICKYATKEK
                     YIQQFGKWNASDDTDDQEEDEDMDESEDEQLNDDNDSIELSDIEISDDDDDEEDDDGE
                     E"
     gene            <1166651..>1166926
                     /locus_tag="KLMA_10551"
                     /db_xref="GeneID:34714208"
     mRNA            <1166651..>1166926
                     /locus_tag="KLMA_10551"
                     /product="N-terminal acetyltransferase C complex subunit
                     MAK31"
                     /transcript_id="XM_022822221.1"
                     /db_xref="GeneID:34714208"
     CDS             1166651..1166926
                     /locus_tag="KLMA_10551"
                     /codon_start=1
                     /product="N-terminal acetyltransferase C complex subunit
                     MAK31"
                     /protein_id="XP_022674064.1"
                     /db_xref="GeneID:34714208"
                     /translation="MNNLSSVKLHDLLGQALYVTLSETRSLTGKLIAIDCKANLLLDE
                     VVENNEGHVRRMGLVSVPFAAVSSVKIKKELVSQIQAMKASIHSQYG"
     gene            complement(<1166978..>1168012)
                     /gene="MAK32"
                     /locus_tag="KLMA_10552"
                     /db_xref="GeneID:34714209"
     mRNA            complement(<1166978..>1168012)
                     /gene="MAK32"
                     /locus_tag="KLMA_10552"
                     /product="protein MAK32"
                     /transcript_id="XM_022822222.1"
                     /db_xref="GeneID:34714209"
     CDS             complement(1166978..1168012)
                     /gene="MAK32"
                     /locus_tag="KLMA_10552"
                     /codon_start=1
                     /product="protein MAK32"
                     /protein_id="XP_022674065.1"
                     /db_xref="GeneID:34714209"
                     /translation="MSLLTTNGMLIIDEIETESSHYYDILGGGGMYAILGASICCSNI
                     DLRRGLLWIVDRGSDFPDSLTEAISSWGTGCVFRDDKNRLTTRGYNLYGSNDFRQFEY
                     LSPKKRIDVEDWCECFSENVVQEIRCYHLLCSADRVSVIINKLEERYYLQDGTHSFVW
                     EPIPDLCTPDQFPLMKKLLNGPNHFIFSPNAEEGARMLGESEPSTLEDCRSLLVRLAA
                     EIKPGNVCVLRCGKEGSLAVTSGTNDAILHFPAYHYKTPELVIDPTGGGNTFLGGFAF
                     AYAMCNDISIASICGNIAAGCAIEQYGVPVYQNVQWNKRSFADRLSYYLSAYDLKGDP
                     VKILEALSGK"
     gene            1168277..1168350
                     /locus_tag="KLMA_R122"
                     /db_xref="GeneID:34718637"
     tRNA            1168277..1168350
                     /locus_tag="KLMA_R122"
                     /product="tRNA-Met"
                     /db_xref="GeneID:34718637"
     gene            complement(<1169482..>1171224)
                     /gene="VAC8"
                     /locus_tag="KLMA_10553"
                     /db_xref="GeneID:34714210"
     mRNA            complement(<1169482..>1171224)
                     /gene="VAC8"
                     /locus_tag="KLMA_10553"
                     /product="vacuolar protein 8"
                     /transcript_id="XM_022822223.1"
                     /db_xref="GeneID:34714210"
     CDS             complement(1169482..1171224)
                     /gene="VAC8"
                     /locus_tag="KLMA_10553"
                     /codon_start=1
                     /product="vacuolar protein 8"
                     /protein_id="XP_022674066.1"
                     /db_xref="GeneID:34714210"
                     /translation="MGLCCSCLRGSGSLDDSTGLPIAENEREAVTSLLEFLENKDQYD
                     FYSGKPLRALTTLVYSDNLNLQRSAALAFAEITEKYVNPVSRDVLEPILMLLTNPDPQ
                     IRIASCAALGNLAVNNENKLLIVEMGGLEPLIEQMKSDNVEVQCNAVGCITNLATQDD
                     NKIEIAQSGALVPLTKLARSSNIRVQRNATGALLNMTHSGENRKELVDAGAVPVLVSL
                     LSSMDADVQYYCTTALSNIAVDESNRRYLSKHAPKLVTKLVSLMNSTSPRVKCQATLA
                     LRNLASDTNYQLEIVRAGGLPDLVQLIQSDSLPLVLASVACIRNISIHPLNEGLIVDA
                     GFLPPLVKLLDYKESEEIQCHAVSTLRNLAASSEKNRAEFFQSGVIEKFKQLALSCPI
                     SVQSEISACFAILALSDNTKYDLLQQDVLKVLIPMTMSQDQEISGNSAAAVANLISRV
                     SNLEKILEYWDQPSDGIKGFLIRFLSSDFPTYEHIALWTILQLFECHNDTIYKLIKED
                     QKIVSGVKKIADENYAVAREYMHDGQGNNNMEHSTDANNMANGRSNNRQSSEKEDASF
                     ELYNITQQIIQFLV"
     gene            complement(<1171900..>1175781)
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_10554"
                     /db_xref="GeneID:34714211"
     mRNA            complement(<1171900..>1175781)
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_10554"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822224.1"
                     /db_xref="GeneID:34714211"
     CDS             complement(1171900..1175781)
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_10554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674067.1"
                     /db_xref="GeneID:34714211"
                     /translation="MLDTGAQISVVTDLKLLHNYTSNITRNITAANMGTLNTMGEGIL
                     ILRLSNNVVVQFPAVYSEETPSNILSVMQLTAKQKITVDFYQRKMLVQDHNINIDIIH
                     RNGFYWLSSEYLVLNETNIHSPADDDSPVSISLCHIRENTVPKKKWSLEFIHNLLAHV
                     NIKQIRKSISNGDIRFIKLEDIDWSDMNSFTCQYCNIGKGKFHDHFTDSRDVYMKKFK
                     KFEYLHTDIMGPFREDNTIPPNYLITFSDEVTKYRWIFPMSLASEHQVSAIMRKLISN
                     IRTQQGVRVKEILMDQGSQYTGRMVRDLLDEFGIEGKYTSTGDKRSNGVAERLNRTLL
                     DDARTLLASANLPEFLWYDAAEFAVIVRNSMHMRKLDGSPNMAAGLGGIAINKILPFG
                     QPVVVYYNTGKKTLPRGKIVYALHPAKQSDGYTFYDPSSKQTMETTNYKIINTIQGDY
                     LNSEENLDTLNQVDDIVRQRSNDPSTDSQRHITHRNQREQDYISQERDPTDEPQQPES
                     DSTETHGNYLRTHKNEFQKGIATHTLGKDSRYPVRNSSDVPSQSPQEVQETLPVALSP
                     ASPPNNIFISQERLMEEEARSVKHPTKHVPAENGKRPAQRDELGVSTKRPNTKASPEQ
                     CSPIPEHLSHNDDTTDTSSLNEEERRSLYDKLSAKYRDSSIELQSTDSLYGGGGSDIG
                     DLSNPDKQIMGIISCTKTELKINDSKSDQNHEHQIDAIVNMLIQENPVQTYDNIKHEN
                     RVKIPLVNSLKMVRSLPNTKIDRSLSYSQAITKNSNHQEREAFKEAYDSEIAQLMRRG
                     TWDTTEVDIKSIEPHKLLNTMFIFTTKRDGRKKCRLVVRGDLQHWSTYEKHLESNTIH
                     HYALMTILSVALEENMIVKQLDITAAYLYADLKEELYIRTPPHMKMPNKAFRLRKSLY
                     GLKQSDANWYGTITSFLKERCGLKEDKIWSCVFTKEPPLSIIVCIFVDDIIVTGKDTQ
                     EIERFLEQLRSTYETKLVHDGKMGEDGTARYDILGLDLEYKRNGYMKFGMLDILSHKL
                     PLLNLPLREGSRYNQAPVSSSSEPPKVDKNLYVTEKDYKSNVKKLQQVVGLLSYVAHK
                     FRFEALYHVNVLAQYQLYPTDEVMKWANESVQYFWNTKEKRLVWTKNKTPVDYEFTII
                     SDASDRCEPEGKSRLGWFYEIYGHKISARSTKSSYVCDSSTGAEICAMKEATKFDFAI
                     SALLFTLTGKRPRVRLLSDNKPALGRITNPNSTVSPFKPTFTRTMELREKHNEGLCDF
                     TYIPTEQNVADILTKVLSAKRFNRLTNGWLI"
     gene            complement(<1175840..>1176766)
                     /locus_tag="KLMA_10555"
                     /db_xref="GeneID:34714212"
     mRNA            complement(<1175840..>1176766)
                     /locus_tag="KLMA_10555"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822225.1"
                     /db_xref="GeneID:34714212"
     CDS             complement(1175840..1176766)
                     /locus_tag="KLMA_10555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674068.1"
                     /db_xref="GeneID:34714212"
                     /translation="MTQIQHGSAAFYDPEEYRKMFINSKGMFQTVNIKEVLPDEEPEG
                     MIKGKYMIIRGIPDSSAEHQIAITIVENEEMYQSWLIDLYRYLHRHNVDNAMTPKELK
                     LPKSLTANQRFWLRDVNEQCVHISKMPTWLEHELEGLYTSDDRLLNVLTYTRVKYDPE
                     RLYEEICGFRLQKYYKLENVERILQNFNERLELARLPSLEPLLVERAIEGMMVTKDRN
                     GRFHNFAHLEPRLTHIIAEIREKIADEKFYLHRNESMRTNDVGKKVHKPYNKFSNKPN
                     NNKNFTKKSNVKQSTPKVDDKNESKTVANLRH"
     gene            complement(<1177193..>1178689)
                     /gene="EDC3"
                     /locus_tag="KLMA_10556"
                     /db_xref="GeneID:34714213"
     mRNA            complement(<1177193..>1178689)
                     /gene="EDC3"
                     /locus_tag="KLMA_10556"
                     /product="enhancer of mRNA-decapping protein 3"
                     /transcript_id="XM_022822227.1"
                     /db_xref="GeneID:34714213"
     CDS             complement(1177193..1178689)
                     /gene="EDC3"
                     /locus_tag="KLMA_10556"
                     /codon_start=1
                     /product="enhancer of mRNA-decapping protein 3"
                     /protein_id="XP_022674069.1"
                     /db_xref="GeneID:34714213"
                     /translation="MLNFKGYQIEIELKDGKRITGTLKQVSPKSLTLTDAVFQDGGVS
                     PIFKIKSDKLQDLKVLKLPPNVIGKHQDRGEKGKDRGEKEREKEKEKSNEIWDTEMSS
                     DFDFQGNLQRFNKKDAFKDFQNIEIPKDETKIPHNEMVTAGNKFSTSSYGSNSNSNSN
                     SNSNSNSGFGSGSGSASVSGSGSASGSESEPHHSESERITESINITHLLRNDSIAASL
                     ASQRRTFTCGGKNKIKVPLATPIQLLEMEKLADEKFMFPLKTSLEHSAIHISRLLRNM
                     LKPLQDVATPTVVAFVSGGRSGSRCVSALRCLLSIKDVKCIIVNPFINERESFDDDIS
                     SEQLNKIKRFENVHFPDSLAKLKETVGDETPAIIIDALQGFDDTVSDLDFSPDSNDNI
                     AQYINWINSHESTPGCLEIISLDCPAHIDPSSGDVIESDFVHPSTILSTGWPLHCLPK
                     LTQFLPDWKKTYVYDTGIPQQTYLLKPNLRKFHKLDIYPSFSGTQELK"
     gene            <1179412..>1179984
                     /gene="rhb1"
                     /locus_tag="KLMA_10557"
                     /db_xref="GeneID:34714214"
     mRNA            <1179412..>1179984
                     /gene="rhb1"
                     /locus_tag="KLMA_10557"
                     /product="GTP-binding protein rhb1"
                     /transcript_id="XM_022822228.1"
                     /db_xref="GeneID:34714214"
     CDS             1179412..1179984
                     /gene="rhb1"
                     /locus_tag="KLMA_10557"
                     /codon_start=1
                     /product="GTP-binding protein rhb1"
                     /protein_id="XP_022674070.1"
                     /db_xref="GeneID:34714214"
                     /translation="MSVRDRKIIVLGSRNVGKTTLLVQLTESHFVESYYPTIENQFIH
                     EFVLKKPNGTELKFNLDIVDTSGQDEFSMINAKSMLGVAGCILMYSVANRHSFEILEL
                     IRDKMLDMLGLRELPIVLVGNKIDLERQVSYQEGEELAKRLKCGFVEICVKQGSGIEM
                     PFKTLIQKIEGFEDGSSRSEEGGSEGCIVM"
     gene            complement(<1180332..>1181273)
                     /gene="ARDH"
                     /locus_tag="KLMA_10558"
                     /db_xref="GeneID:34714215"
     mRNA            complement(<1180332..>1181273)
                     /gene="ARDH"
                     /locus_tag="KLMA_10558"
                     /product="D-arabinitol 2-dehydrogenase [ribulose-forming]"
                     /transcript_id="XM_022822229.1"
                     /db_xref="GeneID:34714215"
     CDS             complement(1180332..1181273)
                     /gene="ARDH"
                     /locus_tag="KLMA_10558"
                     /codon_start=1
                     /product="D-arabinitol 2-dehydrogenase [ribulose-forming]"
                     /protein_id="XP_022674071.1"
                     /db_xref="GeneID:34714215"
                     /translation="MSGLSQEVRSATPINPSIPSLADVVPSFRLDGHVTIITGAAGGL
                     AHTLSQALVAQGSQLALMDLSHESLENTRRDLIHFQKQNNLPEVAISIWACDISNADE
                     VEEVVRAIPGEHNGIIPQKLVHTAGFCQNINAHEYDAAKAQKLVNVNLLGSLYICQSM
                     ARQLLARRTRRKSISTDVNESGEVLPHFPEASFVLIGSMSGLIVNTPQPQCAYNMSKA
                     GVIHLVKSLAAEWAKYGIRVNAISPGYIATALTKQVISQSPEGAALQKEWTNRIPVGR
                     MAEPKEFVGSMLYLLSRSASSYTTGENMVVDGGYVCW"
     gene            complement(<1182171..>1184090)
                     /gene="NPP1"
                     /locus_tag="KLMA_10559"
                     /db_xref="GeneID:34714216"
     mRNA            complement(<1182171..>1184090)
                     /gene="NPP1"
                     /locus_tag="KLMA_10559"
                     /product="sulfatase super family"
                     /transcript_id="XM_022822230.1"
                     /db_xref="GeneID:34714216"
     CDS             complement(1182171..1184090)
                     /gene="NPP1"
                     /locus_tag="KLMA_10559"
                     /codon_start=1
                     /product="sulfatase super family"
                     /protein_id="XP_022674072.1"
                     /db_xref="GeneID:34714216"
                     /translation="MVSPGSEFDLDFSDLDDPLEFLDSPSWSQRLRAFANKSRNYFRK
                     WYYVTPFQSGIELETWNDVDLDSVSPDLQSDYFRNSGTENRNSKKAYIWKWITFVLMI
                     ISLLLLSILIVSSVKNKKRRVHGAAAAAMSTGVGLAKTLIISLDGFHPGYISESRTPF
                     LNQIFSSEANSFNDTIVAPYMVPSFPSQTFPNHWSMVTGQFPHHHGIIANRFWDQKQD
                     LAFQIGDLSSRMNTFWNRTLPIWYFTNENELQTHTHMWPGSEIVHEDPLRNPTIIDPF
                     NIDEPLNDKLVVIQKALQNESTTLTFAYVPVVDTMGHKYGNLLDSGHSKVLKEVDDFI
                     EQLLSDIDPSVNVVIVSDHGMSTILKKNVYVWEDHFGDVAKYPSIAKLYDDVNTLIYT
                     KDGKDSAVDELYRELQPKVPPVCELVKSTDLFPDVRDPLIQNRIPQLVITCDPGYLIV
                     TREKYDKLPARFGNHGFRRDEPDMRALFMGKGPFFEHARSKLKLPDQYIKPFDNIQIF
                     SLLLNLCGIDVSGKDIDVDADLKFWDHLMPLGKYSESSPEMLQHYPDSEYNKLWNTYE
                     KASAPTTTTTPTTTPTSTTTAPTSTTSSTSTTDEADVPPSLGDIIDEVESTINDIIHK
                     IWPSKGKGNHNGDSD"
     gene            complement(<1184742..>1185695)
                     /locus_tag="KLMA_10560"
                     /db_xref="GeneID:34714217"
     mRNA            complement(<1184742..>1185695)
                     /locus_tag="KLMA_10560"
                     /product="glutathione transferase 3"
                     /transcript_id="XM_022822231.1"
                     /db_xref="GeneID:34714217"
     CDS             complement(1184742..1185695)
                     /locus_tag="KLMA_10560"
                     /codon_start=1
                     /product="glutathione transferase 3"
                     /protein_id="XP_022674073.1"
                     /db_xref="GeneID:34714217"
                     /translation="MSTVLERFKKAELIDLADKLGLSVSSSNTKPKLVLKILDHLESL
                     PEPVDLMEFPELELYYEALAQISTTSSGTSSSGSSDDEEEDGEGDDDDEDDDDEEEEE
                     EIEIDFKSDLPNKSPACLWFSNLKFVNKVTNSPYYFRFHEFIDDVQYTTQEWNERVQD
                     YLSTLQTVKQLVLAVELFFFVKPLVQFDFTRFPSPEFVSFYPSQRDFLFSISFWFLFA
                     HLLPSVISYYFNFVRHELFSIEFDPLVYHLSKALISLQFLYNSPAVKKEIELLLTDNY
                     SITQLLTHGYNVGLFYWKFQLGHLPLIANAAAVVVALYVLA"
     gene            <1187415..>1187534
                     /locus_tag="KLMA_10561"
                     /db_xref="GeneID:34714218"
     mRNA            <1187415..>1187534
                     /locus_tag="KLMA_10561"
                     /product="plasma membrane ATPase proteolipid 2"
                     /transcript_id="XM_022822232.1"
                     /db_xref="GeneID:34714218"
     CDS             1187415..1187534
                     /locus_tag="KLMA_10561"
                     /codon_start=1
                     /product="plasma membrane ATPase proteolipid 2"
                     /protein_id="XP_022674074.1"
                     /db_xref="GeneID:34714218"
                     /translation="MLPAGVILVFVLVGLAAIAVIGTIMYRKWQAKQRGLQKF"
     gene            complement(<1188212..>1188973)
                     /gene="EAF5"
                     /locus_tag="KLMA_10562"
                     /db_xref="GeneID:34714219"
     mRNA            complement(<1188212..>1188973)
                     /gene="EAF5"
                     /locus_tag="KLMA_10562"
                     /product="chromatin modification-related protein EAF5"
                     /transcript_id="XM_022822233.1"
                     /db_xref="GeneID:34714219"
     CDS             complement(1188212..1188973)
                     /gene="EAF5"
                     /locus_tag="KLMA_10562"
                     /codon_start=1
                     /product="chromatin modification-related protein EAF5"
                     /protein_id="XP_022674075.1"
                     /db_xref="GeneID:34714219"
                     /translation="MEDVKINEILDMIKEMFPNQTSLNDGQITFYHLQINEIQNKIMD
                     VYERCQRDLVNKLAKNEAELRRVRGPSGSNGTNGSIASTVPATASSSTTGSSSTGGSG
                     SGSAPASTSTSAVAAAAAPATAGSSGGATSNNSANGGSGGSNKVDYMKSRRGKILAMY
                     RDTVIAKLESFEQFKKVFDSFANISNNEVIKVENDLKKLKTLHLNNLIDLQWNLQNCV
                     TNGVMSMGHEDTEKVLLAQDELDMTVNFVRDAMDN"
     gene            <1189358..>1190122
                     /gene="MMS21"
                     /locus_tag="KLMA_10563"
                     /db_xref="GeneID:34714220"
     mRNA            <1189358..>1190122
                     /gene="MMS21"
                     /locus_tag="KLMA_10563"
                     /product="e3 SUMO-protein ligase MMS21"
                     /transcript_id="XM_022822234.1"
                     /db_xref="GeneID:34714220"
     CDS             1189358..1190122
                     /gene="MMS21"
                     /locus_tag="KLMA_10563"
                     /codon_start=1
                     /product="e3 SUMO-protein ligase MMS21"
                     /protein_id="XP_022674076.1"
                     /db_xref="GeneID:34714220"
                     /translation="MSGTVRLPDVLPITSKNIDYLNKITVPDLSQEISNSKTSIQEST
                     IALLSSTSTYPEEKVKQLEEMYKELLRLEEKQKFLSSKLIELKAEYKEQSADLPRLDL
                     ENWNHYLNNDYNLTNIRKKWIELQSEEVEINKKDQWLRVFYALPYIWSDPSRVIPYDP
                     LENNNSTEEEEDIKVDGGVIDLNCPVSLKKFNLPMISLKCFHTFDDASLKELFRPSKT
                     IECPTPGCGKVLTTKDFTEDKLMRIRVLISDLRNSK"
     gene            <1190335..>1191666
                     /gene="SLM5"
                     /locus_tag="KLMA_10564"
                     /db_xref="GeneID:34714221"
     mRNA            <1190335..>1191666
                     /gene="SLM5"
                     /locus_tag="KLMA_10564"
                     /product="asparaginyl-tRNA synthetase"
                     /transcript_id="XM_022822235.1"
                     /db_xref="GeneID:34714221"
     CDS             1190335..1191666
                     /gene="SLM5"
                     /locus_tag="KLMA_10564"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="asparaginyl-tRNA synthetase"
                     /protein_id="XP_022674077.1"
                     /db_xref="GeneID:34714221"
                     /translation="MRLPVTLKQVFEQVKGNGGSPIKCDKISGWVKDVRQLKTITFVE
                     LRDGTSLQDLTIVLKQGLPEFKPTLGQSITVEDPVVVQRKNNQFETLCPPDKLKLLGN
                     TTNYPVQNKQTTLATLRRMPEFKHRTTYLSNLLRFRHKVESQLTKTLDDLDFTLVRPP
                     TLTSIDCEGAGEMFQLKQSHWNKPVNLTVSSQLHLEVLMMGLGRVYCLQPCFRAEKSD
                     TNRHLCEFWMLEVETAFIDKNESLMDLVELMIKNVVSSLSESNDLPKYFPIECDNKVS
                     TKWAKLLQDWRRITYTDAIELIQSSGAKFDNTSTWGQDLNSEHEKWLCEHFGGPVFVT
                     NYPRDCKAFYMKQRPQEGTVECFDLLFPEIGEIVGGSIREDNYDVLKNEVERRKMDYK
                     ELEWYLNLRKEGTVPHGGFGIGIERLVSYLYGNPNIRDSIPFHRTTGQIDL"
     gene            <1191925..>1192374
                     /locus_tag="KLMA_10565"
                     /db_xref="GeneID:34714222"
     mRNA            <1191925..>1192374
                     /locus_tag="KLMA_10565"
                     /product="PGA2 super family"
                     /transcript_id="XM_022822236.1"
                     /db_xref="GeneID:34714222"
     CDS             1191925..1192374
                     /locus_tag="KLMA_10565"
                     /codon_start=1
                     /product="PGA2 super family"
                     /protein_id="XP_022674078.1"
                     /db_xref="GeneID:34714222"
                     /translation="MNGTTKQRSSRQLYIYSRMEIVERFKNNLIQSFDIDLKHAIRLV
                     LIVGGYYFIRQIAQRELAKRQLKSQLEQKDAELHAQHEGELNSANDLALDEESTADTT
                     SFGWGKKTRQRVKKQEKLLEAEFKRLQENAAEIDEEEDKDIEDLLID"
     gene            <1192641..>1193390
                     /gene="RPC31"
                     /locus_tag="KLMA_10566"
                     /db_xref="GeneID:34714223"
     mRNA            <1192641..>1193390
                     /gene="RPC31"
                     /locus_tag="KLMA_10566"
                     /product="DNA-directed RNA polymerase III subunit RPC7"
                     /transcript_id="XM_022822238.1"
                     /db_xref="GeneID:34714223"
     CDS             1192641..1193390
                     /gene="RPC31"
                     /locus_tag="KLMA_10566"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC7"
                     /protein_id="XP_022674079.1"
                     /db_xref="GeneID:34714223"
                     /translation="MSFRGGARGKSSSAFSNLPFGLSYSDVGANGSTELPTIPLPMNH
                     PSNDLEREIAMHYINFRNALKDGPLFTGSMELISEDDEEDNGEAEKNGKKKRKQKQQV
                     DADGLNDGIERYSDKYLKRRKIGTSIDEYPFNVDFFPKELYQVLGINKKKLIQLSKLD
                     KNQTLFGASGSKEEDEAVGRALLEKLSGMAEEEEDADEENEEKDRDKGDVDEDDEFEE
                     DDDDDYNAEKYFDDGDDDLGGEDEYPDEAEF"
     gene            complement(<1193609..>1194718)
                     /locus_tag="KLMA_10567"
                     /db_xref="GeneID:34714224"
     mRNA            complement(<1193609..>1194718)
                     /locus_tag="KLMA_10567"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822239.1"
                     /db_xref="GeneID:34714224"
     CDS             complement(1193609..1194718)
                     /locus_tag="KLMA_10567"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674080.1"
                     /db_xref="GeneID:34714224"
                     /translation="MISQNGTLVILPNKLNIGKRLQAGSYFMLKFGNSCVRFDSVKGP
                     LEMKVSSEHWNQQMGFVLFRRRPRLNGDPVGFRRRDIIEQTSLSIKARKPERIAEYCV
                     TWKNIELDLPVQDIQLIFDLEFYPSDGPIKPLKKNQPYQLQANELKERRPNIRQKSPE
                     PVKHQTEPMNKVKPSHTILNRFKKGIKNLRHIHSTDRTDYPADESEVVYDNVIEYNKE
                     EPQQVVMGNYVHGMNMPEIVDDSATNVDTMDVYSFIRRNKEISANRLSDDDTLVIGDT
                     PRDLMKNKHARLSLGERVQFAQIFPSRNTRLTGYVGNGKWVIPEGNEFRRQYYMLHGK
                     ALPAPQVPPKCPKGMLWEEYYLLDKDKYTNEVIRN"
     gene            complement(<1194997..>1196172)
                     /gene="INN1"
                     /locus_tag="KLMA_10568"
                     /db_xref="GeneID:34714225"
     mRNA            complement(<1194997..>1196172)
                     /gene="INN1"
                     /locus_tag="KLMA_10568"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822240.1"
                     /db_xref="GeneID:34714225"
     CDS             complement(1194997..1196172)
                     /gene="INN1"
                     /locus_tag="KLMA_10568"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674081.1"
                     /db_xref="GeneID:34714225"
                     /translation="MSLSSSGNVITGANGRLDVYVSKAKDLPNLRKLDKQDPFVKLRI
                     AHLTEISPVIYRGGQTPKFDFHCVFQLTPDMKPLLSVELYDDHDHKHGSRLIGKCEVD
                     LLPALLSDPEEGHDQWYYLNKGSIEAGKVYIELTFVPNAISESRNIEVSNMDFSIQSR
                     TVPPLPSDPPEFHDQYNMATSSLGQRTGSSLVPGGYVHGSHMRSRSPVVSSHSVARAS
                     SYYPGDQQRVQVQEPADFDVSMGSNATTDTYHSQQTQSTEGLMDKLKLIKEKLNYFKN
                     GSSDPSNESVANNAMDLEVLQKVVGAGMESSSTSRVPSHINVPTSVAKNFQEPPLPPI
                     PTSANRTPSRTSVRDSPTRSPFRPPVSPRLPDLPTNYSPASSRHGPPSPTRRRPPPM"
     gene            complement(<1196496..>1201172)
                     /gene="THO2"
                     /locus_tag="KLMA_10569"
                     /db_xref="GeneID:34714226"
     mRNA            complement(<1196496..>1201172)
                     /gene="THO2"
                     /locus_tag="KLMA_10569"
                     /product="THO complex subunit 2"
                     /transcript_id="XM_022822241.1"
                     /db_xref="GeneID:34714226"
     CDS             complement(1196496..1201172)
                     /gene="THO2"
                     /locus_tag="KLMA_10569"
                     /codon_start=1
                     /product="THO complex subunit 2"
                     /protein_id="XP_022674082.1"
                     /db_xref="GeneID:34714226"
                     /translation="MALFERLNNLASKLPNNTDNDNSSFFNQKFFDEPETGISTLMDK
                     FKALDSASQKRDYVYELLEEALSLLNRKPEDKPESLNLDAIGKVIVLLCDHDRFNFDI
                     FVSLVNSFPWEPENGLYDLLGCMKELQTDLCVYLNDSFLSKGPEKWSKDFWSSFKKAI
                     VPEFFLLQKPNVFLECSTGFSQLILMLSIAFENVDRFQSVQYYSKQLKFIMGKYRLDP
                     IRCLDLILQVCSLHVVEHHEFILELLRLTEFWPHSNLANCQEYEHLNQGGNPVATRLI
                     INHLNTQSSDEKYIDLVVQLIKGGFVSFAAIFDCLTPGDSTIEEFVSLKLKKLEEESL
                     EGSLNPLAMAAVLPDDDDDDKDDSKGNEDTKASDLKDAEMSEKEREALLSESVETSPK
                     WKLVERLLTHSMLMPGLYALLKYPKFFNVNDKLVECVLQVFDDMIEPLLRSLNKMDIS
                     QSFRPISKLSHNGIPTKQDRLVRQYNSLQKTPSFIQGAQYIFYSQDTRENILKIETIQ
                     ELFDYSHLLFDTIGPRILLNPKLVEHICAIIESDISNNSQNENNLEKWIDYTRKFLVP
                     VLGLIEDQQIVANAIYSVMKHFPYEKRYFLYNELNTKISEDNIHVRLQFNKYQKKIRS
                     LLKSLSIDNIAVKCRDVANYVSCNPLSTLGSILKQIENYDKVSELIVVSAEFFSEFAY
                     DTLQYILLIQLASERSTLQDDGITPKMWISRLSLFIAGLAKVCSKMDMSNIFVFMVKS
                     LHKDPSLTLSILKEMITQVAGIQNLYDVNWNTLIMLNSGPFLKQLGRALVLDFRDKYF
                     NRSKAIINYLVKLNAVSEMIVMLTNLNLKIQSENDVHFKILSSKCDESNSLLWSFIEL
                     LKHVLTEEQFKANVLPFNVLIEEYQFPIEWAFDIWRDYFDSKLVRSEEDASQINNILY
                     DTNFNSIEFNNLEKTLLIDFWRLSLYDIRLDEKLYKEQHDLFEGKRRNAKVLKERHSL
                     LNDVQKISNDLSEHRNVLEKTKKLLEEKKALWFPVMSSERIAAFLQHCVIPRVIFSPF
                     DAIYSATFITETFSKQEVLDIVKQLVSSGILGTLLFSLTVNESSNMALFFKDIFVKVE
                     EWRHLALFDDNELTKQQLCEVYYELTEQVSFALEESNYMSIRNTIQFLNFISEVFPVV
                     DEHLQLVLETLDDLLEREKREDIILPCNALKGHLKARLATASKKSDFVTLPESEVKKY
                     QEELALIKKYRDAKKAEELEEKRKEEAEQREREIAERKSSDNTQSTSSHSKTNGNRAI
                     PISQVMDGLYKVERHIKDVDYSRAVPFIYDLQSQSDFRKLIHNPNNINSFRNKLRILL
                     EDYYEKVTNNPPEHYKSIFESILKSTQSAPLPQGPISSSMYEESDVKPTKGAASKYSS
                     DKSRTTTSTRIPSEPKNANQSSTNTNSRATPATATAASTTPASRYQRSSGPVNLPKAP
                     AGASKPATTQSRFHNALPSGPRNDNSYNNRNSNNPKSSSAASQPPARSYGNHNQGKSF
                     GNIPNEPRKRQSEESYQGSSRFSNSKRPKLNERDRDHDRDRSSKVQNSLPTGPKRQAG
                     GSRFSR"
     gene            <1201411..>1201754
                     /locus_tag="KLMA_10570"
                     /db_xref="GeneID:34714227"
     mRNA            join(<1201411..1201413,1201497..>1201754)
                     /locus_tag="KLMA_10570"
                     /product="SF3b10 super family"
                     /transcript_id="XM_022822242.1"
                     /db_xref="GeneID:34714227"
     CDS             join(1201411..1201413,1201497..1201754)
                     /locus_tag="KLMA_10570"
                     /codon_start=1
                     /product="SF3b10 super family"
                     /protein_id="XP_022674083.1"
                     /db_xref="GeneID:34714227"
                     /translation="MSNKVREEQVYEAIRKKHAGVGNEKTTKEEWSANISKDTYAGLA
                     MHQNMLEYVTLASNYTSKKDAQLAMLRKVANPPTRPASKRQQ"
     gene            complement(<1201881..>1202459)
                     /locus_tag="KLMA_10571"
                     /db_xref="GeneID:34714228"
     mRNA            complement(<1201881..>1202459)
                     /locus_tag="KLMA_10571"
                     /product="RNA recognition motif-containing protein"
                     /transcript_id="XM_022822243.1"
                     /db_xref="GeneID:34714228"
     CDS             complement(1201881..1202459)
                     /locus_tag="KLMA_10571"
                     /note="alpha-beta plait"
                     /codon_start=1
                     /product="RNA recognition motif-containing protein"
                     /protein_id="XP_022674084.1"
                     /db_xref="GeneID:34714228"
                     /translation="MGSQRSQSKSKNTKQVGKGGNSLFGRVGTQNNGRNVPQKKQNKK
                     QTGISNTGKKEAAAGLTFVGGKLVVAGDSNKNKKQQNQQKRKKQNNISLNKRDGSANK
                     KLVISLKDSAKCLKIRNLPVGTNPSHLQRVLQDLGSCKVVDLKVIDLPTGSAHAEVFA
                     SVSDLESLHKRFNQAEIDGRRILTEISSQPEL"
     gene            <1202784..>1204385
                     /gene="SRV2"
                     /locus_tag="KLMA_10572"
                     /db_xref="GeneID:34714229"
     mRNA            <1202784..>1204385
                     /gene="SRV2"
                     /locus_tag="KLMA_10572"
                     /product="adenylyl cyclase-associated protein"
                     /transcript_id="XM_022822244.1"
                     /db_xref="GeneID:34714229"
     CDS             1202784..1204385
                     /gene="SRV2"
                     /locus_tag="KLMA_10572"
                     /codon_start=1
                     /product="adenylyl cyclase-associated protein"
                     /protein_id="XP_022674085.1"
                     /db_xref="GeneID:34714229"
                     /translation="MSETNFSVQGYNLVKLLKRLEDATARLEDVTIYQEGYVQSKFGG
                     KEQKDSSKTPEAVSETPAETPAAVASEVASAPEPAKVEEAPKAVTEFEQFIATNVDPL
                     VELSKEIDPAVEKAVKYLAEAFRAQLTFIKAAVQSKKPDMSSPEFSKAIAPINESVSA
                     IVELKDENRKNKYFVHLNAISEGSPLFSWIAVPTPVSTITDFKDAAQFWTNRILKEFR
                     ESEPKSVEWVQAFLKMFDNLKAYVKEFHTQGPAWNDASGEDFGTVYEKVLNGGDSKTA
                     APAAAPAGAAGGPPPPPPPPPASVYEVKDSSSAGGSSTGGIGAVFEELNQGENITKSL
                     KKVDKSQQTHKNPELRASGTVSTKSAPPPKPKKPSTLKTKKPPRKELIGNKWFIENYE
                     DQAEPLVIEARIDESVFIGKCVNTLVQIKGKVNAVTINECEKSSLVLDASISGIEIIK
                     CFRFGIQVEQSLPQITIDQCDSGSIYLSKDSLQAQIFTSSSTGININTPTGPDGDFVE
                     VPLPEQMVHSFVEGKLQTKIYEHAG"
     gene            complement(<1204601..>1206049)
                     /locus_tag="KLMA_10573"
                     /db_xref="GeneID:34714230"
     mRNA            complement(<1204601..>1206049)
                     /locus_tag="KLMA_10573"
                     /product="37S ribosomal protein NAM9"
                     /transcript_id="XM_022822245.1"
                     /db_xref="GeneID:34714230"
     CDS             complement(1204601..1206049)
                     /locus_tag="KLMA_10573"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="37S ribosomal protein NAM9"
                     /protein_id="XP_022674086.1"
                     /db_xref="GeneID:34714230"
                     /translation="MPRKAQLLNSLARGRVRTSFNKYNLFNLYKKSQLGFRNKTLYQQ
                     KWSSKQETRAYHGEHLTESRWQTVFEPQLKSVAQLDASLRGSDIEPTPILLQTYAVLE
                     KRLDFALFRAMFASSVRQARQFILHGNVHVNGVKITSPGYTLKAGDVFKVRADKVLQA
                     LGAKKPSLKEALKIDNTQIYLWNKYVIEARKNPRKFWTEKIEKLRKMDINDPKKKEFL
                     SFLENYNKTMHVQMRTELDKVNEEYLILKALSSAKEAKDLETLAVKDFLPAFYNDEAL
                     AAKAFEIFREVKTSNAVETVAGKPLSEIPNEQAELSKIATGIAKPANNIKDDLKKKFR
                     SIHKIAVDLRHKYEAAVREHFNQKMASVDSVDIPYDSKWAEKLPLHPKINVAELLENE
                     QKAKTAINLPWQKGVFGRQDPSKPYFTPWKPRPFLAPFAILPHHLEVSFKSCHAIYLR
                     DPVARPGQSEVITPFGLPVHERSYMYYLRKGK"
     gene            <1206438..>1207922
                     /gene="EAF7"
                     /locus_tag="KLMA_10574"
                     /db_xref="GeneID:34714231"
     mRNA            <1206438..>1207922
                     /gene="EAF7"
                     /locus_tag="KLMA_10574"
                     /product="chromatin modification-related protein EAF7"
                     /transcript_id="XM_022822246.1"
                     /db_xref="GeneID:34714231"
     CDS             1206438..1207922
                     /gene="EAF7"
                     /locus_tag="KLMA_10574"
                     /codon_start=1
                     /product="chromatin modification-related protein EAF7"
                     /protein_id="XP_022674087.1"
                     /db_xref="GeneID:34714231"
                     /translation="MSIVKEESPKGQSLQWTKVEEIRLFKWMTLFKPAGIHKHFHMIC
                     LLERLNKPDQYPIKLLQGDKGSGGKVFSGEDVWEHLDQYYDLEKADEVENRPYPNIDL
                     ELYHTKYHEDSNDEEVEDEDDEDYEVIPLQNRLTKETEFELPWEEYGDLMLEHAHNHN
                     ELEAEQEVTIRDEQEKEEEDEEEVEEVKQDNSHDDEKEDEKEREDEASIKDTEPTSET
                     EEKLESKSEEPVEPKASDASKESDDGTKEPEGVTEEASGAKEVIQEPEEETKSTVNPE
                     EEEKPTEQEEEEEENKEKEENPTEETEKEEKVTENHEKSEDPEAAKGPEKKEEPETAE
                     EPVKVEDAHSETTKNSIDLEKKPRTRLSTRLTRSQKRGLDEESENEHDNDHEHEGTHT
                     EGSTQPSKSATPDEHGQTPSKQVTFADENGEDATDLKDKQTTTGKDETAEQPTTRVKK
                     QKVASHDENTADPLVDVDSPARRTRRKSVTKPVTRLSSRLRSRK"
     gene            complement(<1208091..>1210277)
                     /gene="FCP1"
                     /locus_tag="KLMA_10575"
                     /db_xref="GeneID:34714232"
     mRNA            complement(<1208091..>1210277)
                     /gene="FCP1"
                     /locus_tag="KLMA_10575"
                     /product="RNA polymerase II subunit A C-terminal domain
                     phosphatase"
                     /transcript_id="XM_022822247.1"
                     /db_xref="GeneID:34714232"
     CDS             complement(1208091..1210277)
                     /gene="FCP1"
                     /locus_tag="KLMA_10575"
                     /codon_start=1
                     /product="RNA polymerase II subunit A C-terminal domain
                     phosphatase"
                     /protein_id="XP_022674088.1"
                     /db_xref="GeneID:34714232"
                     /translation="MSLEAKVKLTEDLPYPITIAQLYVKPGEHVEKGQRLFAYEYWDF
                     QEVLVKDEEKAKKRRVDLVATFDSPVSGVVQSWNCSVKDEYVNANHEIITIKQDCNHD
                     ITYGGLCVQCGKTVDDEDNSKNLTISHVNTNIKISEKQAETLEKSSLSRLRSEKKLVL
                     VVDLDQTVIHCGVDPTIGEWMRDPQNPNYKALQDVRSFTLEDEPIIPAMYYGPKPPAR
                     KSWYYVKLRPGLKEFFDAISPHFEMHIYTMATRSYALEIAKIIDPTGELFGDRILSRD
                     ENGSLTTKSLERLFPMDQSMVVVIDDRGDVWNWFPNLIKVIPYSFFVGIGDINSNFLP
                     RQQNSVLHLGRHHRRKQEEEKLISDIMDNEKKLKEKINEEVKRQEELMSQIGEESRKE
                     AGGSNMNDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDQDDELPHLSKTLLRV
                     HEEYFKEYSKDPQHPPDIKYLLPQIKSKVFSGCHFVFSGLIPLETDVNKADIVLWTNM
                     FGASTTSDINYETTHVITRTSRTFKARLAKSFNPDIKIVHPDWIFECLVQWERVKESP
                     YELLIEDPVDEEKVKEFKEALDKKLLDPSYNDTSFIEEEGLDEEFHLLAGNDDWLDND
                     DDEMDELLNDEDDDDDEAEEEEEEGEAELESNEDEDNNDDNIEEPSAKRLKLDPSSIQ
                     SSSENDPETNSSANHNNNNNNSEDFEGSSSDLDDELEAELLQELGS"
     gene            complement(<1210644..>1212218)
                     /gene="TAF8"
                     /locus_tag="KLMA_10576"
                     /db_xref="GeneID:34714233"
     mRNA            complement(<1210644..>1212218)
                     /gene="TAF8"
                     /locus_tag="KLMA_10576"
                     /product="transcription initiation factor TFIID subunit 8"
                     /transcript_id="XM_022822249.1"
                     /db_xref="GeneID:34714233"
     CDS             complement(1210644..1212218)
                     /gene="TAF8"
                     /locus_tag="KLMA_10576"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 8"
                     /protein_id="XP_022674089.1"
                     /db_xref="GeneID:34714233"
                     /translation="MTASEDKDVASEAIESKKVQLCKLPNLDEVPHANSMEQLFAQAV
                     LLQFKCLNKDVSISQLAFDDLCYITLLQLDDLLQGLKKITQVQRRTKISKHDLELYFK
                     GVDMDLSALNEQVDISNHIHKTFPKETQKLNENVDKVMSKFMTELEETELLSSKHSEF
                     FVQDVDILNLLSTSKKSNKCFPDWLPELPPDHTYKFTSLYKRPITDERVMKEKLLEEG
                     RRSEKALIKMLNEAGVNEDPLSEQDNIALTDQLNESQLETALIYGLDETKSSKKEELE
                     SFKPLPLKNFDVSEYCLKRQSILKRRAERLESKALNRKRNPFIRAAAICSPYGQGSIK
                     SRKSVENQLKTMLKRSYVGLIHSIPKLKEEREKARKEAEEKERQLQEQRRLEKEKKMT
                     EQEVLDLNNLQNDPLIGWDNDDSDDDDDDNIEFDDVKQNTTQNASSTLGSEQHTKQQS
                     EEPATDASELPSSQLNEEQKDAKLNHWPSESAPSLTPTQLADESSQPDVENDTHHEGE
                     TPNEKEQSSIPSQVGS"
     gene            complement(<1212865..>1214010)
                     /gene="SCS7"
                     /locus_tag="KLMA_10577"
                     /db_xref="GeneID:34714234"
     mRNA            complement(<1212865..>1214010)
                     /gene="SCS7"
                     /locus_tag="KLMA_10577"
                     /product="inositolphosphorylceramide-B C-26 hydroxylase"
                     /transcript_id="XM_022822250.1"
                     /db_xref="GeneID:34714234"
     CDS             complement(1212865..1214010)
                     /gene="SCS7"
                     /locus_tag="KLMA_10577"
                     /codon_start=1
                     /product="inositolphosphorylceramide-B C-26 hydroxylase"
                     /protein_id="XP_022674090.1"
                     /db_xref="GeneID:34714234"
                     /translation="MSSSKVLPLYSKSDLASHAKKDDCWVSLYQRKIYNVTAFLDEHP
                     GGPEYLLEHAGKDITEVMKDSAIHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDH
                     VVEVNLKGDAEFDSTTFVKELPTEDKLSVATDPTSDYKRHKFLDLNKPLLWQVMFGNL
                     TKDFYLDQVHRPRHYGKGSAPLFGNFLEPISKTAWWVVPTVWLPVVIYHIHKALVNMN
                     QPFAVFLFGLGVFVWTLIEYCLHRFLFHLDARLPDNNAALTLHFLLHGVHHYLPMDKY
                     RLVMPPTLFVVLCTPFYKLVFALLPYYWACAGFAGGLFGYVCYDMTHYFLHHAKLPPY
                     MRKLKKYHLEHHYKNYELGFGVTSWYWDKVFGTYLGPTAPLSKMKYE"
     gene            complement(<1214551..>1214871)
                     /locus_tag="KLMA_10578"
                     /db_xref="GeneID:34714235"
     mRNA            complement(<1214551..>1214871)
                     /locus_tag="KLMA_10578"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822251.1"
                     /db_xref="GeneID:34714235"
     CDS             complement(1214551..1214871)
                     /locus_tag="KLMA_10578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674091.1"
                     /db_xref="GeneID:34714235"
                     /translation="MSTSENVYRMLILLEEPAPESKEDTKKQNATHEFVDEVTLPIQV
                     DEMDLLNSWFDKFDEKICIPNEGNIKYEISSDGLIVLILDKSIEHLVADVKQFVEENI
                     PEEQ"
     gene            complement(<1215125..>1217998)
                     /gene="ZDS2"
                     /locus_tag="KLMA_10579"
                     /db_xref="GeneID:34714236"
     mRNA            complement(<1215125..>1217998)
                     /gene="ZDS2"
                     /locus_tag="KLMA_10579"
                     /product="protein ZDS2"
                     /transcript_id="XM_022822252.1"
                     /db_xref="GeneID:34714236"
     CDS             complement(1215125..1217998)
                     /gene="ZDS2"
                     /locus_tag="KLMA_10579"
                     /codon_start=1
                     /product="protein ZDS2"
                     /protein_id="XP_022674092.1"
                     /db_xref="GeneID:34714236"
                     /translation="MTMSKRDKRKSEVLIAAQSLDQEVQHVKNLKRLSIGSMDLLMDP
                     EMEYRVSTRQSSPTSVNSQEIKRRSTSGTSTDSDISPVSQDSILETPVTQEGTPDETF
                     TSGEDTTIGGTADEEDDTYSFTDDSMDVTNAEYLDQDAQANLTNSTYQQEPLPKRRVL
                     SGSVAGQLRSRSTSGSSDGKEELKHSESLSQNLLWVRADQHPNVKPENYLELVQNTLE
                     NLNLDDHTAANDVQAHSLSDLKILRRRSLQSQNSLARRPSRLRKSYTEISEDVDGTQQ
                     TEDNAKQLLLPVSVPSLKETRRTMSLKDITEELTKLSNQAGLTDTDAVTLARTLRVAD
                     NIPDEENEQNKNHGPQQEEDDSEYASTMLIKNRFTLPARHSLRRSKFNTYRIQSFDSN
                     EEIENGALGMNHRSPSGTNSPNSIIGMYNDEPYYEKKPIVQEFFSTLPANDDLESDTS
                     TEEADSSTDFSNELSAELETANTSQRVMSDRSDNTTKWKWSQNTTTAVDFQQAQSVPK
                     DNLSPYKINHSRNRHNVPSSSTGLNTSETSIHSGNSTLSSSSSTLSLGTSKVSVPEVE
                     AKNVPLSHVGPQKQHLDKPLPAIEDKKGKKSGQSQNKFIKFFKKRTSSSESKMLKELN
                     SNLNHDTQVRELKQKQSGNGLSTKFKISPKKSSKTELSKFEQIKHRGKVIIEFDRDKK
                     ESKRKASLQPAVTVTKANDEVKLQKEPRGQLGTIIYEDNVNNMGDGNVHGNAASKTKS
                     HDNYDDEVEVSEFSVQEDSFTSLNSGQSNISLSKEPMLTSMEQNSPNSNESIHSSPTS
                     PASASASPPVPLQTNAQTQEELRLEQEQLPTLPDNNYPLPPRKLTFDDVVKPDRPNAP
                     MKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSHLKLSDPKRVLRQQVLLSN
                     FMYAYLNLVNHSLYLQQLEEERMGGQGSSQLGSGNPLIDIPDI"
     gene            complement(<1218697..>1219671)
                     /gene="RCE1"
                     /locus_tag="KLMA_10580"
                     /db_xref="GeneID:34714237"
     mRNA            complement(<1218697..>1219671)
                     /gene="RCE1"
                     /locus_tag="KLMA_10580"
                     /product="CAAX prenyl protease 2"
                     /transcript_id="XM_022822253.1"
                     /db_xref="GeneID:34714237"
     CDS             complement(1218697..1219671)
                     /gene="RCE1"
                     /locus_tag="KLMA_10580"
                     /codon_start=1
                     /product="CAAX prenyl protease 2"
                     /protein_id="XP_022674093.1"
                     /db_xref="GeneID:34714237"
                     /translation="MGMERLSDVIGIYVSVSYVIAVYLASKNVNDFKIRRNDPNVIKA
                     RMKSVTLLTLLNLIMIPLVLKYLNGDDIKNTLLRFGLVPGFLNNPKTGLPEWIPRGYF
                     KDVVSHMKLAAILYTSPLIDSFLHYCFMPDKSWNDMFKDIIYEFSNIWGFRDYIFGPV
                     TEELFYTSMILVCYLRLCHNSTIHDANYLKFVVPNLFGFAHLHHAYEQYTLGMMNFIN
                     IVFVTLLQMTYTWLFGSFTNHLFLNSAGNLLSCILIHTFCNFMGLPQGNSFSKSYSIL
                     PEGKKSRLGTMASLIWRLLYLPTLIITIVAFKNNFSSLTRSDSFPALI"
     gene            1220457..1220579
                     /locus_tag="KLMA_R123"
                     /db_xref="GeneID:34718638"
     tRNA            join(1220457..1220490,1220542..1220579)
                     /locus_tag="KLMA_R123"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718638"
     gene            <1220858..>1221781
                     /gene="COQ5"
                     /locus_tag="KLMA_10581"
                     /db_xref="GeneID:34714238"
     mRNA            <1220858..>1221781
                     /gene="COQ5"
                     /locus_tag="KLMA_10581"
                     /product="ubiquinone biosynthesis methyltransferase COQ5"
                     /transcript_id="XM_022822254.1"
                     /db_xref="GeneID:34714238"
     CDS             1220858..1221781
                     /gene="COQ5"
                     /locus_tag="KLMA_10581"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="ubiquinone biosynthesis methyltransferase COQ5"
                     /protein_id="XP_022674094.1"
                     /db_xref="GeneID:34714238"
                     /translation="MIPTRTKLGTQLCFKNGKLALPHQTINNLRYLSSTRLQLNKNTT
                     VDENSTTHFGSKTVLKEEKEKLVGNVFSSVASKYDVMNDIMSLGIHRLWKDHFINKLD
                     AGKRPNSTEPLHFIDVAGGSGDIAFGLLDHAEQKFHDVESTMHIVDINADMLKEGEKR
                     AMEQGKYYNDPRVTFLVQNGETLEQIESNSKDIYTISFGIRNFTNIQAGLNTAYRVLK
                     PGGIFFCLEFSKIENPLVNLAYQNWAKVLPVMGSIVANDYDSYQYLVESIERFPSQEN
                     FKSMIEKAGFQSCGYENLTFGTCAIHWGIKT"
     gene            complement(<1222049..>1224805)
                     /gene="BUL1"
                     /locus_tag="KLMA_10582"
                     /db_xref="GeneID:34714239"
     mRNA            complement(<1222049..>1224805)
                     /gene="BUL1"
                     /locus_tag="KLMA_10582"
                     /product="ubiquitin ligase-binding protein BUL1"
                     /transcript_id="XM_022822255.1"
                     /db_xref="GeneID:34714239"
     CDS             complement(1222049..1224805)
                     /gene="BUL1"
                     /locus_tag="KLMA_10582"
                     /codon_start=1
                     /product="ubiquitin ligase-binding protein BUL1"
                     /protein_id="XP_022674095.1"
                     /db_xref="GeneID:34714239"
                     /translation="MRPQLRKQQTEDEISARGRSALRNTSSTSSLFFRSSSTSTLFRL
                     RNSFTSGNGSSHSTNASQQHSLSAMSSRDGLVVSPDAVEGADTHHMVDVLPSFEMYNA
                     LHRNIPRGNVNPDQHDLPPSYQEVQSQYKQAELTDGSTVSQLECPSSPPLSRGDINGA
                     STQSLQSLHSLATIPSSVVQSNLQALSTRYEAIIDDLNDSDNINIEKLYSLPKVSTPV
                     DVNIRILKKATKPFSEKPEEESILKEYTSGDIINGYVVIENRSQHPLRFEMFYVTLEG
                     CTCVIDKKQGKRTIKRFLRMVDLSASWSYSNIDLATGFQYTPGDIDQDGCVLGLNNDR
                     FLQPGVRYKKFFTFKFPNQLLDISCKHEIFCHCLVPPSFGVDKYKNHARYSNIKLNSM
                     LGYGHLGTKGSPILTNDLCGENVSVSYTIDARIVGKDSKTSELTIMKEKEYNLRFIPF
                     GFCQPLTGEGDPIKQMNALQKLIEERMEALEKVFKKLEDGECITASDINNTDISGTID
                     NDTNVDSTDIVNRKLNQLHIGNRINPDAAAFPVRNVKYSKGPKNSVESEFPYTIKHRS
                     KSKSRLKKSIFSGLYGSSSNSSSNATSPENDSSSSATSSSPKCGIIMLDCEIPEDGLP
                     YLRPSLLKKTNQFNNKNKHDQSNWKSLQSSLLDEERKVLEQLNIHLRCIQANNSEPHS
                     PPEIQLVTTQLICITCKAISSFPLKLNAQLLLNTDRMKDIMNTFREYLTRAREYKARF
                     NEQLKELNELYNKSRSNSSTQQEIRFSDFITPQLMNDIESLASLIIDIKSLNTVFKKQ
                     ENTLNNSTEKISGSSTPNHNDSQLSLHTSLSHGSSNHHGNYSTLMKEELLHEWVQSND
                     KEYDREVTVNLELDNEIKETLVPTFESCLCSRMYCVRVSVKFENSVGVASIDVPVRIR
                     NLEC"
     gene            complement(<1225341..>1226312)
                     /gene="CTK3"
                     /locus_tag="KLMA_10583"
                     /db_xref="GeneID:34714240"
     mRNA            complement(<1225341..>1226312)
                     /gene="CTK3"
                     /locus_tag="KLMA_10583"
                     /product="CTD kinase subunit gamma"
                     /transcript_id="XM_022822256.1"
                     /db_xref="GeneID:34714240"
     CDS             complement(1225341..1226312)
                     /gene="CTK3"
                     /locus_tag="KLMA_10583"
                     /codon_start=1
                     /product="CTD kinase subunit gamma"
                     /protein_id="XP_022674096.1"
                     /db_xref="GeneID:34714240"
                     /translation="MDAFEARLQFVQVIKNLHKTLHKKRDTSPSGAALSSSGSSSGSA
                     FTDPVQFYLKHFEHHYEDFQQCFFETALNMDSLDRLNVLIYWSRIISSLWPRCLKNVD
                     GQWNIQGKVLFEFLLLDLNKMVDIVLPKEDWKSLTNLDVSIEVLQFIISLVKSDSNAL
                     NFEPYKEDGLEKYQKLLELDRSHIVDQFSESIWNKINEKSFEFEWVEHTKQPTCEQSI
                     IQCLQILVDRRSKAFILQEAYRKHLVLNLPNTSQLPTVLHRMENDRERHKKSKEHRWF
                     IERDDMMDTIEFDTIWNSFSLGMNRNDYQNIKTIQEIAQASYKYLEN"
     gene            complement(<1226756..>1227772)
                     /locus_tag="KLMA_10584"
                     /db_xref="GeneID:34714241"
     mRNA            complement(<1226756..>1227772)
                     /locus_tag="KLMA_10584"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822257.1"
                     /db_xref="GeneID:34714241"
     CDS             complement(1226756..1227772)
                     /locus_tag="KLMA_10584"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674097.1"
                     /db_xref="GeneID:34714241"
                     /translation="MAKKLSDGRKPGSGRKPGKAKTLAEGRKPGSGRKKGSKNVAGSG
                     AGMANSVTKNVGNGTKGKSKSRVKGGGLDVAGSLIGGGKPSSQSSSTGSSPAMAMATS
                     LLLQQDSQDSHGQGHHQHGYAAPQGLMGHSHGHGHGHGHGHDAGSNGGGNVNGNGNGG
                     NGNGNGNGNGNGSVSRRDRELIDALNKLSKCKSPPQSPEPLQASKLPMLTSFWGGMES
                     VPLRQDQEQQLQHQLQLQFQLQHQQQQQQQQQQQQQQQQQQQQQQQNHSHSHNQHHSH
                     INSHSHNQGQQQNQQPFPQNQHLSQQSSVAWLNTPPPQVGSSNSPIHQSNSSAHPSDL
                     GTSH"
     gene            <1228577..>1229740
                     /gene="DSK2"
                     /locus_tag="KLMA_10585"
                     /db_xref="GeneID:34714242"
     mRNA            <1228577..>1229740
                     /gene="DSK2"
                     /locus_tag="KLMA_10585"
                     /product="ubiquitin domain-containing protein DSK2"
                     /transcript_id="XM_022822258.1"
                     /db_xref="GeneID:34714242"
     CDS             1228577..1229740
                     /gene="DSK2"
                     /locus_tag="KLMA_10585"
                     /codon_start=1
                     /product="ubiquitin domain-containing protein DSK2"
                     /protein_id="XP_022674098.1"
                     /db_xref="GeneID:34714242"
                     /translation="MSDKITVHIKSGQNNWSVEVEQSATIRGFKEKISEVSDVPADNQ
                     RLIYSGKILKDGETVESYKIQDGHSVHMVKSGGARAASGTSGASAAAEPASGASGAAN
                     SNGGAAVPSNISAGQTGGFNPLADLTGARYAGLTNLPSADMFGPDGGLNSGEGANAES
                     MLHMLENPIFQSQMNEMLSNPQMVDFLIQQNPQLQALGPRAREVLQSPFFRQMMTDPQ
                     MIRQSMQMASSMGLSPDGGAASSFPAPGSAGTQSTTATRDDASGTSGNTGNTGASSGN
                     TGGAAANPFASLFGNAGGAGGAAAAANPFAGLFPQGQQPQFNPELFASMFGGAAQPPT
                     QPADNRPPEERYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV"
     gene            complement(<1229877..>1230851)
                     /locus_tag="KLMA_10586"
                     /db_xref="GeneID:34714243"
     mRNA            complement(<1229877..>1230851)
                     /locus_tag="KLMA_10586"
                     /product="pre-mRNA leakage protein 39"
                     /transcript_id="XM_022822260.1"
                     /db_xref="GeneID:34714243"
     CDS             complement(1229877..1230851)
                     /locus_tag="KLMA_10586"
                     /codon_start=1
                     /product="pre-mRNA leakage protein 39"
                     /protein_id="XP_022674099.1"
                     /db_xref="GeneID:34714243"
                     /translation="MEADLRERMDRLAHVLGGSKSRTEDDVQYMVKWVEKIAKGSHRI
                     NKYRYRSRSKVTSRGDLEQILTRVTPYVKVIDTVGNKENLFNRERIHEGLRQVVEATR
                     TSPICWDSQFVNPVAIVSRGLSVSFCEDSVVTLCCNSCKETVSLDLCDMDLNEQYACR
                     LKDVHSQECVWSYLSVPLDMVYHLNVNTVMYEITRIKQTLDKISSVEYYKSWKLQFVL
                     PEKIQKIAQWFGFSPSDNLAVIYVLLCGYEPVGSPEEEILECVGSYIKTGLSQVLQDA
                     DYVGHPRWSCYYDKDRILDLMYETLIRGTEDSSISSRLSRLRDIVTKW"
     gene            <1231711..>1232388
                     /gene="URA5"
                     /locus_tag="KLMA_10587"
                     /db_xref="GeneID:34714244"
     mRNA            <1231711..>1232388
                     /gene="URA5"
                     /locus_tag="KLMA_10587"
                     /product="orotate phosphoribosyltransferase"
                     /transcript_id="XM_022822261.1"
                     /db_xref="GeneID:34714244"
     CDS             1231711..1232388
                     /gene="URA5"
                     /locus_tag="KLMA_10587"
                     /codon_start=1
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="XP_022674100.1"
                     /db_xref="GeneID:34714244"
                     /translation="MPVLEDYQKNFLELATESKALRFGEFTLKSGRKSPYFFNLGLFN
                     TGKLLSNLATAYAIAIIQSDLKFDVIFGPAYKGIPLASIVCVKLAEIGGSKFQDVRYA
                     FNRKEKKDHGEGGNIVGAALKDQRVLIIDDVMTAGTAINEAFEIIAKEEGKVVGTIIA
                     LDRQEVVNTEDAERLSATQAVSKRYGIPVLSIVNLSNIISFLDGRISPEERERMENYR
                     LTYGVSE"
     gene            complement(<1232604..>1233431)
                     /gene="SEC65"
                     /locus_tag="KLMA_10588"
                     /db_xref="GeneID:34714245"
     mRNA            complement(<1232604..>1233431)
                     /gene="SEC65"
                     /locus_tag="KLMA_10588"
                     /product="signal recognition particle SEC65 subunit"
                     /transcript_id="XM_022822262.1"
                     /db_xref="GeneID:34714245"
     CDS             complement(1232604..1233431)
                     /gene="SEC65"
                     /locus_tag="KLMA_10588"
                     /codon_start=1
                     /product="signal recognition particle SEC65 subunit"
                     /protein_id="XP_022674101.1"
                     /db_xref="GeneID:34714245"
                     /translation="MPVIEEIEDIDDIDNLDMDLAQLDASLKTPVAPKIVPTVVRSQD
                     EEEQKQQQQLSGTSSQEGGAGFSFIDSETGKVEKSHALSKAELDEIKEFQMLYPCYFD
                     ARRSHAQGRRAPVELCVENPVAKTIADAARSLGIPSIFEGSKTHPQDFGNPGRVRVLI
                     KSEGKPFVNDIPNKRVLMKRIGEYLKRHPTTLAGVKQLPYGHEFDEVQPSKIPLLKGT
                     PMNDIVPLHSPFLMKHPMTKSLYDAPPPSQQIGAGAAGGASEKQMKAPKNKFRVVRR"
     gene            <1233680..>1234954
                     /gene="RRN9"
                     /locus_tag="KLMA_10589"
                     /db_xref="GeneID:34714246"
     mRNA            <1233680..>1234954
                     /gene="RRN9"
                     /locus_tag="KLMA_10589"
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN9"
                     /transcript_id="XM_022822263.1"
                     /db_xref="GeneID:34714246"
     CDS             1233680..1234954
                     /gene="RRN9"
                     /locus_tag="KLMA_10589"
                     /codon_start=1
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN9"
                     /protein_id="XP_022674102.1"
                     /db_xref="GeneID:34714246"
                     /translation="MDSQLVRDAVDLLATLDQEQRNDLSVHLYSAHLLKHLLYRANKD
                     EKKILRTETFVKTVLKEDWTAWPSENVIIDPNTTSLYEDQSVTETQKTRSESGLEPGQ
                     LDQESLNHATEMLYGELNAFWQQKLKESFNNGKERDEKEQQDAEEEGEGTEEETEGNK
                     EKFNGYAGTVLDINQMDLPDDIFQNTLFKLDQFIGTLHLDAAEKNTISLSTVPNEPQI
                     KLTKEELGSVQTQSLKGKAKYDYKDIIVHACASGEDMSQEYLKAVELFQDLPKTLDKS
                     QFVLPDSFLNKFTHINLGTFDDSQGSSDDSNLNNTGVKHKKKKKTKNSKQIQEEEEIT
                     DEPEKESEAESFVELKRIFGDRRNDPNARREARLLLRKDEFARDKKMFFTVLEHQKKG
                     YSSTLKRKPKKKLNTYGDALDIDTDYGFADLD"
     gene            complement(<1234930..>1238337)
                     /gene="MDM1"
                     /locus_tag="KLMA_10590"
                     /db_xref="GeneID:34714247"
     mRNA            complement(<1234930..>1238337)
                     /gene="MDM1"
                     /locus_tag="KLMA_10590"
                     /product="structural protein MDM1"
                     /transcript_id="XM_022822264.1"
                     /db_xref="GeneID:34714247"
     CDS             complement(1234930..1238337)
                     /gene="MDM1"
                     /locus_tag="KLMA_10590"
                     /codon_start=1
                     /product="structural protein MDM1"
                     /protein_id="XP_022674103.1"
                     /db_xref="GeneID:34714247"
                     /translation="MSGIDDRAKWGAGFLILVFLLSSSWITISTIILSLVFILSCLVY
                     FIVNEKPAKPPRRRVLKFCDASFKVQQGLGSSRSSELLFPENEPLSKEIEVLLDNIVK
                     NFIESWFRSISDSDNFPNAVKSVLSDAIVRLSSALSDVDLCQLLILKILPLLTKHYTT
                     FYISQETITSGLSMDKPEKDVDFAVAVEFNKQYRIHKALTLTLSQEKRSDDIQKYSRK
                     LANDLLKILIDPKELESPFVRPILREIVACSVLQVLVEKISNPDFWNTKLIDICSQVL
                     KERSQITELRAVLSKTIEHEDVNSISDEGVDKNLNIDVSAIYGVEEEYESFLKQLSSV
                     TGVNQLTTMKVRLWIEALRMKKDIEEHDSPKIEKKYSGSKKRIYLALDLIDSKLSFLL
                     PYNSDSTQSKNVLDQQLANFQKFIETITVQDILSSGLSSNYVMSFLESSSDKSGAIDL
                     QLWLFIEHLRNPLEDISNDEIQVETSNDIKEDLKELYTKFLTTKSTLDHLMHLDPINV
                     KTIKEFVESNDDLSECSKNIQKISALEARKSMLLLQKMALKSITDNWFPKFKSSELFF
                     QMLSDFNFIKEHIDSIQSSKMPNDNVQADTVKLITHGDLGKALDDILNHDTDLKVDDT
                     KEKVAHKKSFSNLFGNETESLFQDGLFGDTSINEEDHVNETEGTSFDPYSVANSSQES
                     LSGSNKMSSSTYNDSNIINYTNLKEEIGKLALSIESLNKQLQLVHHLILKAELTNNQS
                     RLVLLRKSERTLRRELEYQELLKQQYMVHEDSNSLYGRAKISIKSYLTDISSENGKET
                     VYYLMTVQHIFNKQLVTWDVPRRFSEFYRLNTYLRKKYPFKMRYLQTSDGFPERVKIS
                     LKYHVSKTLLYEERRRRLEHYMQELLKIREICQDEQFRKYLTDVSNTFKIKENLSDSS
                     EIKEDQRRSWVLMKADNSVGEVTNIPSDLLRDTSELEEELDFFEDERNFYSSAKANGP
                     GTLVKPICELFISFFALNQSNSGWLRGRAIIVVLQRLLGSTIEKYIKDLIQRIKSPEK
                     LSFCISKLNSIIWVDGVFFKSSSVPQPAPRTEGEINRASIESQAMLEKFMVETCGKVV
                     GTMYASNAGYRLHAMLQNEYLNASLILEILDVVFEEINKAQSKSANP"
     gene            complement(<1238577..>1239155)
                     /gene="TMA23"
                     /locus_tag="KLMA_10591"
                     /db_xref="GeneID:34714248"
     mRNA            complement(<1238577..>1239155)
                     /gene="TMA23"
                     /locus_tag="KLMA_10591"
                     /product="protein TMA23"
                     /transcript_id="XM_022822265.1"
                     /db_xref="GeneID:34714248"
     CDS             complement(1238577..1239155)
                     /gene="TMA23"
                     /locus_tag="KLMA_10591"
                     /codon_start=1
                     /product="protein TMA23"
                     /protein_id="XP_022674104.1"
                     /db_xref="GeneID:34714248"
                     /translation="MDSKGYLKSYGWEEGEALRHGGLKKPILVKHKKDKKGLGCAPGN
                     DDSEAWWERLFDGQLRGLDVQTGSNGISFKQSEVIASSVSKSESPLYKWFVRGEVLKG
                     TIEIKLPNEDKSSVVKVTELAEKDTKKKEKKEKKKEKKKEKKKEKSDKSKKSSKHKSK
                     DKKHKSKYKVEKDRSHHKSDKKHKKKSKKKED"
     gene            complement(<1239577..>1240791)
                     /gene="KYE1"
                     /locus_tag="KLMA_10592"
                     /db_xref="GeneID:34714249"
     mRNA            complement(<1239577..>1240791)
                     /gene="KYE1"
                     /locus_tag="KLMA_10592"
                     /product="enoate reductase 1"
                     /transcript_id="XM_022822266.1"
                     /db_xref="GeneID:34714249"
     CDS             complement(1239577..1240791)
                     /gene="KYE1"
                     /locus_tag="KLMA_10592"
                     /codon_start=1
                     /product="enoate reductase 1"
                     /protein_id="XP_022674105.1"
                     /db_xref="GeneID:34714249"
                     /translation="MSAEEPHFMSFEPKPFAGTNALKPIKVGKCELQNRIVLPPLTRV
                     RADINGVPDGKLSGEYYSQRGQSPGTLLITEAVSVSKQASGFDHTPGLYSEEQVEQWK
                     IVTDAVHSKKSYIFAQLWATGRAGNPASLARDGLRYDSASDDVYLSEDIKEAALKAKN
                     PQHGITKEEIKEYVANFAKAAKNAVAAGFDGVELHAANGYLVDQFLDPATNHRTDEYG
                     GSIENRARFALEIIDAMVEAIGAERVAVRLSPFGRFQGMSGSKNPLFLAQHAYIIGEL
                     ERRGQEGKRLAFIDLVEARLPNPFTEELDGKPTDSSDFIYTVWEGIVVRSGNFGTHPD
                     VALKVFENERTLLAYGRVFISNPDLVYRLEKGLPLNQYNRSTFYGGGAVGYTDYPTYE
                     EAVAKGYKVVSS"
     gene            <1243473..>1243931
                     /locus_tag="KLMA_10593"
                     /db_xref="GeneID:34714250"
     mRNA            <1243473..>1243931
                     /locus_tag="KLMA_10593"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822267.1"
                     /db_xref="GeneID:34714250"
     CDS             1243473..1243931
                     /locus_tag="KLMA_10593"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674106.1"
                     /db_xref="GeneID:34714250"
                     /translation="MSAFNDYCTVCGQLIQRDVAEDELLDDRLYCSSQCQENDRLNVE
                     NFKLSNELSGTPASLIRSPLLQPVDGSRASHNSLMESLGREQEQDDYDYDFELEMPLD
                     NVMIGSGPAIPMMTIPRSVLGSDSTSKPDVVCDNTAEDNYKLWLNYNLTS"
     gene            complement(<1244326..>1246002)
                     /gene="SEC9"
                     /locus_tag="KLMA_10594"
                     /db_xref="GeneID:34714251"
     mRNA            complement(<1244326..>1246002)
                     /gene="SEC9"
                     /locus_tag="KLMA_10594"
                     /product="protein transport protein SEC9"
                     /transcript_id="XM_022822268.1"
                     /db_xref="GeneID:34714251"
     CDS             complement(1244326..1246002)
                     /gene="SEC9"
                     /locus_tag="KLMA_10594"
                     /codon_start=1
                     /product="protein transport protein SEC9"
                     /protein_id="XP_022674107.1"
                     /db_xref="GeneID:34714251"
                     /translation="MGIKKFFKIKPPPEATVEENRDYLNELGIATKQDSTKRREKFAA
                     YGKFANDRVRTNVYAPEGYAQYANPDTEPSDKADMDDLNKSPYDQVSMVNNRNTSAGV
                     SNSSPYGNNYGAGNYVDPYSNSGPSPYGTNQYSQSSTNTPASDPYGSANTNTNTRYND
                     SSRQGYGNSYGNVYENTSPPANAYSTSALPNSNSYKSSGRAPSGNPYASVNATDPYIS
                     NSRSTSANAYGSTSSTPVPPRSSSNKGRGSAAQKEFDFERNKEDDDLDLNDTISQDKF
                     GSGRGEDFDDLNHSIHENQRIGAGVSGAGGEPKGYQTFEDLQKQQQQQEQAEEDEEVD
                     SIKQQIKFTKQSSVASTRNTLKMAQDAELAGMNTLGMLGHQSEKLNSVERNLNLMQIQ
                     NRVADDKVAELKKLNRNILAVHVSNPFNSKRRARETEEKIKTQRRLDKQAQQDLSSQL
                     SQSTRRIEGVLSTDNGASEVRDRYQRQQVLEKSKRYQFENDEEDDEMELEIDRNLDKI
                     GQISGRLKKLAIATGKEIDSQQERIQNIEENADDLDIKIHVNTTKLSNIR"
     gene            complement(<1246402..>1247139)
                     /gene="TIF6"
                     /locus_tag="KLMA_10595"
                     /db_xref="GeneID:34714252"
     mRNA            complement(<1246402..>1247139)
                     /gene="TIF6"
                     /locus_tag="KLMA_10595"
                     /product="eukaryotic translation initiation factor 6"
                     /transcript_id="XM_022822269.1"
                     /db_xref="GeneID:34714252"
     CDS             complement(1246402..1247139)
                     /gene="TIF6"
                     /locus_tag="KLMA_10595"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 6"
                     /protein_id="XP_022674108.1"
                     /db_xref="GeneID:34714252"
                     /translation="MATRTQFENSNEVGVFSKLTNSYCLVALGGSENFYSAFEAELGD
                     AIPIAHTTIAGTRIVGRMTAGNRRGLLVPTQTTDQELQHLRNCLPDSVKVQRVEERLS
                     ALGNVICCNDYVALVHPDIDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGAL
                     VHPQTTVQDQEELSSLLQVPLVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVI
                     ESIFRLQDAQPDAISGNLRDTLIETYS"
     gene            <1247723..>1248874
                     /locus_tag="KLMA_10596"
                     /db_xref="GeneID:34714253"
     mRNA            <1247723..>1248874
                     /locus_tag="KLMA_10596"
                     /product="hemocyanin"
                     /transcript_id="XM_022822271.1"
                     /db_xref="GeneID:34714253"
     CDS             1247723..1248874
                     /locus_tag="KLMA_10596"
                     /note="copper-containing"
                     /codon_start=1
                     /product="hemocyanin"
                     /protein_id="XP_022674109.1"
                     /db_xref="GeneID:34714253"
                     /translation="MDALSLKAISPSKLNRKSDMSDRYENKSTEFKLHTNINEEEEES
                     SIRSDVVSKMKNEKFHLELELEQKTHEIAKLRAMLLPKQTPPAIDLRFTTPRRDPMYY
                     KPEKEVNPEFGDFISHFSSSSYDGIRNDINETSTVASTTSSRKEKNHMLFTRSILPFI
                     RDSISIYQSSHVLNGEMVPIKEEFDNFYDKSLSKEERCEVLSKVLVGILRVQRLNVAA
                     LNRELEMKAVDRKMDYLAACFSDPTDYDMPKSKMMKRIRNEMLSVIISLYGELPSMTN
                     TKPHYHVDTTQKSYKTKQILREQEPNIGQFEPEILPIGYTTSTSKPSRSKKKRVRNIK
                     LTPFKTTSQENIDPDDDIELDLSDPLHMLLAERLSGTDMDNTSSLTNTM"
     gene            <1249770..>1251584
                     /gene="RLF2"
                     /locus_tag="KLMA_10597"
                     /db_xref="GeneID:34714254"
     mRNA            <1249770..>1251584
                     /gene="RLF2"
                     /locus_tag="KLMA_10597"
                     /product="chromatin assembly factor 1 subunit p90"
                     /transcript_id="XM_022822272.1"
                     /db_xref="GeneID:34714254"
     CDS             1249770..1251584
                     /gene="RLF2"
                     /locus_tag="KLMA_10597"
                     /codon_start=1
                     /product="chromatin assembly factor 1 subunit p90"
                     /protein_id="XP_022674110.1"
                     /db_xref="GeneID:34714254"
                     /translation="MSATASPVSGPKKHGILSFFQNTAKSEKRAEESDTKGDGESQEA
                     AIQIEEDSDKADPIESADELNEDSQRSTSTAEKGNETEVDDKENNYKENNKNNDDADL
                     TQDNKKAERALRREKSKELNLKKKEQERIERENKKLEEKQKREKQKQEREAKKLQERE
                     ERERRKQQEKEERERKKRQEKEERERKKQQEKEEKEQERLKKEEDKRKKEEEKRKKEE
                     EKRKKEEAKERTQSRIGNFFKKASSKQTDEVEVSDFEKYFLPFYVKSGVVMVNSYNST
                     TSEDLESKVKDIDQLLESNDTSSSIEWLHSHNQKHGYEIKMTAVEVLQTMTAKKKSDE
                     ELSKLLDKVPQKFIKFYENVRPPYVGTFSKKLTLPRDNPFSTEGTGFDYGYDSDLDWV
                     NEEEEEGGVDDLENDDEDEEEEQDDEDDGENEMDGFLDKDDDETGVSRKKFVGPLIPT
                     IKLRKDLSTLDEESQKYFALVSVECLYQDAEFPVDPFKPLNKRVATETPDQPEQKSSS
                     TTPNKKTKSLITEPQDIVKLLEQVHDSTFSLSTITEIVQKHLPHYKKDTIKNSIKEYA
                     AKSTKGDRKWQVKDMESWEELKKLPSGPIKTELSSVQT"
     gene            <1252281..>1252979
                     /gene="RRT8"
                     /locus_tag="KLMA_10598"
                     /db_xref="GeneID:34714255"
     mRNA            <1252281..>1252979
                     /gene="RRT8"
                     /locus_tag="KLMA_10598"
                     /product="EI24 domain-containing protein"
                     /transcript_id="XM_022822273.1"
                     /db_xref="GeneID:34714255"
     CDS             1252281..1252979
                     /gene="RRT8"
                     /locus_tag="KLMA_10598"
                     /codon_start=1
                     /product="EI24 domain-containing protein"
                     /protein_id="XP_022674111.1"
                     /db_xref="GeneID:34714255"
                     /translation="MVDYKYWYYGFVIMVCYMILFIILIWIYATFLLPILAGWQIILL
                     GPIGLFIAIVQMILQCNTWTLRGIKNFVLNIFTDDIFELTLLRKGQAESLKNFKMRQL
                     PAGPELHLNHIEYWIHDVPFNTFSFLRWLFVFIALTLISLIPIIGPFTANFLQTPDRA
                     YGYYDVWMSRRRLSDKAKRDEYYSRLGQLWAFGLTAGLLELIPGFSALLMISNVIGVG
                     IWAHEDIKFKRVQT"
     gene            complement(<1253274..>1254962)
                     /gene="LCB2"
                     /locus_tag="KLMA_10599"
                     /db_xref="GeneID:34714256"
     mRNA            complement(<1253274..>1254962)
                     /gene="LCB2"
                     /locus_tag="KLMA_10599"
                     /product="serine palmitoyltransferase 2"
                     /transcript_id="XM_022822274.1"
                     /db_xref="GeneID:34714256"
     CDS             complement(1253274..1254962)
                     /gene="LCB2"
                     /locus_tag="KLMA_10599"
                     /codon_start=1
                     /product="serine palmitoyltransferase 2"
                     /protein_id="XP_022674112.1"
                     /db_xref="GeneID:34714256"
                     /translation="MISVNSTRVPLIPPEDIPLEDKKENEFGRLTSKEFLYQSKSRDG
                     KALQDPILDAPAYYVSLITYLNYLILIILGHIHDFLGLTFQKEKHKSIMEHDGLAPWF
                     STFESFYVRRLKQRIDDCFSRPTTGVPGRFIRCIDRVSHDLNEFFTYPGTTSMCLNLS
                     SYNYLGFAQSEGQCTDAALESVDKYGVYVGGPRTRIGTTDLHVMAEKYVAQFVGKEDA
                     LLFSMGYGTNANFFNSFLDKKCLVISDSLNHTSIRTGVRLSGAAVKTFKHNDMRKLES
                     LIREQIVQGQPKTHRPWKKIIICVEGLYSMEGTMANLPKLVELKRKYKCYLFVDEAHS
                     IGAMGPSGRGVCDFFGIDPKEIDILMGTLTKSFGAAGGYIAADKWIIDRLRLDLTTPY
                     YSEPTPAPVLAQTVSSLKTITGELNPGEGKERLQRIAFNARYLRLALQRLGFIVYGIA
                     DSPVIPMLLYAPSKMPAFSRMMLQRKIAVVVVAYPATPLIESRVRFCVSAALTKEDID
                     YLLRHIDEVGEKLFLKVSSGKAGGSLDGKPPRWNIEEVIKRTPEDCKDDRFFRI"
     gene            complement(<1255457..>1257034)
                     /locus_tag="KLMA_10600"
                     /db_xref="GeneID:34714257"
     mRNA            complement(<1255457..>1257034)
                     /locus_tag="KLMA_10600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822275.1"
                     /db_xref="GeneID:34714257"
     CDS             complement(1255457..1257034)
                     /locus_tag="KLMA_10600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674113.1"
                     /db_xref="GeneID:34714257"
                     /translation="MTASGAASKYVVKITDGLFKSSLRKGASSVFPNRINFEIKDNEK
                     WCIWGPTKEKFIDVLSNKFLADPPLALRYGKVAEGTFPRIEQVKFKGVMPTAHLSARY
                     EYFKDDFDQTCEKFILDNSIGSRNVNYEVSTTDRTIDPELLSYLLKKLKLFDIKDRWA
                     MGLSNGQMRRARLARSLLKEPDIAIIDDPFLGLDPSATAIMSQFLAAYDRGTSIIIGL
                     RYQDQIPEWCTHIVCVDNDGIEFQGPLEQYRDEVESMRLQLLEALQLNKPQSKYTIQD
                     LISPHKFFKEPHHDLVKVPEVLKLEGLSVAYKGEPVLKDIHWGVKQGSKWHIQGNNGT
                     GKSTLLSLITADHPQSWNSKLVDHGVPRRTGSANFFDINKRIGLSSPEMHALFLKKAS
                     NLSTLETVASGLHVVSSNNFHPTYKSLSDEQKRIVDMYIDYFHLDPETPFGSLSISDQ
                     KIALFIRALVKMPEITILDEAFSGVETEQLIKAHDFLQQWPGTVLVVSHIQEETPRCD
                     HYIRLIKPGEYEIGDLH"
     gene            <1257389..>1258198
                     /locus_tag="KLMA_10601"
                     /db_xref="GeneID:34714258"
     mRNA            <1257389..>1258198
                     /locus_tag="KLMA_10601"
                     /product="PQ-loop super family"
                     /transcript_id="XM_022822276.1"
                     /db_xref="GeneID:34714258"
     CDS             1257389..1258198
                     /locus_tag="KLMA_10601"
                     /codon_start=1
                     /product="PQ-loop super family"
                     /protein_id="XP_022674114.1"
                     /db_xref="GeneID:34714258"
                     /translation="MGSEGAATALATIGTVCWCVQLIPQIIYNYRRKDCTGLPPTMMF
                     LWVVSGVPFGVYFLVTKANIILQIQPHLFMFFCSISWIQSLYYPPRNIPIKRIMIWYV
                     VPMSMFIVGFEIGFTLWLRPVYSHGTKWPALLIGIFAAILLAAGLVPPYFELWKRRGR
                     VVGINFLFLFVDSMGAWFNIASVIVGNMDVMGIVLYSVVAAMEIGIFASHFIWCCRFK
                     WFGNSLDEEDLNSISDLDSASGDVDLEIQTITDNNNTSIHSINSNKKATGA"
     gene            complement(<1258209..>1258697)
                     /locus_tag="KLMA_10602"
                     /db_xref="GeneID:34714259"
     mRNA            complement(<1258209..>1258697)
                     /locus_tag="KLMA_10602"
                     /product="vacuolar protein sorting-associated protein 51"
                     /transcript_id="XM_022822277.1"
                     /db_xref="GeneID:34714259"
     CDS             complement(1258209..1258697)
                     /locus_tag="KLMA_10602"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 51"
                     /protein_id="XP_022674115.1"
                     /db_xref="GeneID:34714259"
                     /translation="MAEQISHKKSLKRVDNEKRKRLKEYYGLKKNGGDAERDSGVSGA
                     GSENADSSGVGESSENVSESRLATPEENSTGKEEDIKAELENGNVDIKTRSLKELLQI
                     QNVLLAEETEADNTIKNTIYDNYYDLIKVDDILREMSQLNSGIVDELRETCTMAQSLM
                     KQ"
     gene            <1259248..>1260978
                     /gene="IRS4"
                     /locus_tag="KLMA_10603"
                     /db_xref="GeneID:34714260"
     mRNA            <1259248..>1260978
                     /gene="IRS4"
                     /locus_tag="KLMA_10603"
                     /product="increased rDNA silencing protein 4"
                     /transcript_id="XM_022822278.1"
                     /db_xref="GeneID:34714260"
     CDS             1259248..1260978
                     /gene="IRS4"
                     /locus_tag="KLMA_10603"
                     /codon_start=1
                     /product="increased rDNA silencing protein 4"
                     /protein_id="XP_022674116.1"
                     /db_xref="GeneID:34714260"
                     /translation="MRFGSRRHSAKANIIPSYAERNGANQVVEDASLKAAQAMFKKHS
                     VGQVPAIQAPRPVPIRVSSSSSRHVSANMGRRSPRMTVPRSGASSESVARSVSPLDGT
                     TMDRGESGVSDAAQQAASVALDSEINMSGDGSYSLAIPAHVTSSDGYLSSRNSSKLSL
                     PRQHSPSQSVGLANKLHSMSLESVSTVGNSPGTAHSGNKTLIARKDGTVGGVPSVLVE
                     SDGTPMVFRDDMSEQDDRSLRNITYDTTTKMNVPVTYKGTLPDLIPVHQRHRKKRWHS
                     IFGGIQSSGISGLASGGSSSWDHEQNGVAGGTVSEVQFNQADDNLVVKSENPMQKTRL
                     RTTMRPNNNNYTAEQENDMDSSGDSSNESTYSANSEFDKRHSMDVTGSHTDIHLFSNT
                     GTSTKKKRRSIMRSHKRHSFNEDKPWKSHVDIGYVSEKERKRYEGIWVTNRNSYLELL
                     PWWDENDLLDDEDHTIFPQDGLILNQVVLDLWSRSNLPPQLLAQIYDKVDTRRDCTLN
                     RQSFLIGMWLVDQCLYGRKLPKEIDQRVWDSVEKFSINIPNNNPHHHHRRRKKMLKKE
                     LKTIKKELNI"
     gene            <1261408..>1263588
                     /gene="IML2"
                     /locus_tag="KLMA_10604"
                     /db_xref="GeneID:34714261"
     mRNA            <1261408..>1263588
                     /gene="IML2"
                     /locus_tag="KLMA_10604"
                     /product="mitochondrial outer membrane protein IML2"
                     /transcript_id="XM_022822279.1"
                     /db_xref="GeneID:34714261"
     CDS             1261408..1263588
                     /gene="IML2"
                     /locus_tag="KLMA_10604"
                     /codon_start=1
                     /product="mitochondrial outer membrane protein IML2"
                     /protein_id="XP_022674117.1"
                     /db_xref="GeneID:34714261"
                     /translation="MFRVLNALKGGGSPKVSELSGEERTRFILQQAHDFEIALQAMDY
                     VLDDNAEAGLQLLADNAATSPGDKTVGVLAKGVIEFLEATLGFEPEVMKKAANTLGQA
                     EQLSLKSRAKQQKLNIKTSSLYPPGTEYAVTYTESCLLHALLMLFSESMVEGAKALFK
                     LRKAYHMLQDILREINAAEKKLSSAIYLQKINESTASFISAESSFTSYDIPYKLTPEE
                     ARDKELLDFANTVYSLRKKRLCGAHIGNSPAINRLRKDIGMDSLKSEKAEHVDEYHLI
                     NDESDANQATMDEFIHSGVNLCFGILQVVLSLIPPAIGAVLSVVGFHGSREEGLRLVW
                     KSTKYRNIHGGIGLLGLLFYYDGPFQFTDVDFDIPAAKADEPIPKEEMDRATLLHPGK
                     ILTNALLQARALFPNSALWLLQEARMLSKNGRLKEAVDLLESIDHNSIQMKQIKALIV
                     FEKANTLVFMHEFEKGAKYMLLMLDISDWSHALYTYYAGCCYLEMYRKYDMGILKEEE
                     GDERKMWFKKKATELIFDSAKIVGKKKFMSKVLPLDRFLLRKVDQFKKFSTMINSNDP
                     LDSIGVSPVHELIYLYNGFNRMTTKELDLSLKSLTEYHNPTIDLKNPDQELITNVLTS
                     LIMRRTGKIQEGCDLLDKKVLPQLYTMQGGKVRFIKKTEDPWIYPTAFYERALFTWKL
                     KGVDGLKEAHGWLDKAQNYQDDYELSTRIGMKVKAAKDRVEESL"
     gene            <1263884..>1265386
                     /locus_tag="KLMA_10605"
                     /db_xref="GeneID:34714262"
     mRNA            <1263884..>1265386
                     /locus_tag="KLMA_10605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822280.1"
                     /db_xref="GeneID:34714262"
     CDS             1263884..1265386
                     /locus_tag="KLMA_10605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674118.1"
                     /db_xref="GeneID:34714262"
                     /translation="MTSLEDYNFEVSEDDEYYQLIGDSDYESDYSLTKDSKVSQNSHN
                     SQDLQFRYKSLSRDELFADVMERVKFVGSITQLSLDSMIILLRLYGWNEEKLLEDYTE
                     NPRDILEKGGLIVPENGKRGIQLEKDYMCPICCDTYDKVSVFMMECGHVACINCYRSY
                     LTSTLKKPRAPTCMSCNISITSSDIDQIFGNSDFSKKHICLSFETFINKHSKNYKWCP
                     YTGCGNIIYSNNESTLNEMLKRHMIPEVICNNKHAFCFYCSTEVHSPCDCKIAQYWIE
                     KVRDESTNLNWILNNTKPCPFCGTSIEKNGGCNHMTCQSCQSEFCWICDGRWSIHTDN
                     YVCKFQNEKKDNRGVKSISKRFTDGYKMFIVHENSSDLDLKLAGTIESKIFTLQKELG
                     ISWIEGQFLSESIKILLHGRSVLKWSYTIGVFCDPSHNLTHILEQNQTMLSNAVESLS
                     LKLQIKDPNVIIKSKAEFRDSSSLVNGRIAALERCCQELLVKGICKLESI"
     gene            complement(<1265523..>1267097)
                     /gene="ARP4"
                     /locus_tag="KLMA_10606"
                     /db_xref="GeneID:34714263"
     mRNA            complement(<1265523..>1267097)
                     /gene="ARP4"
                     /locus_tag="KLMA_10606"
                     /product="actin-related protein 4"
                     /transcript_id="XM_022822282.1"
                     /db_xref="GeneID:34714263"
     CDS             complement(1265523..1267097)
                     /gene="ARP4"
                     /locus_tag="KLMA_10606"
                     /codon_start=1
                     /product="actin-related protein 4"
                     /protein_id="XP_022674119.1"
                     /db_xref="GeneID:34714263"
                     /translation="MSNPALQVYGGDEINAIIIDPGSYVTNIGYSGTDCPQTILPSKY
                     GTYEIDPESDESTTKTIFNEQPLLFPRSGLEIKPIVENSVIVDWDRAQEQWEYALKSE
                     LKFDTNKGTPALLTEPIWNPESNRKKSLEVLLEAMEFEACYLTAAPSAVSFAMGRPTC
                     LVVDIGHDVTSVSPVIDGMTLSKPSTRNFVAGKYLNHLIKENLKPREIVPIFQVLKKK
                     PTFVKRSLSFDVNESIIDFANERQFFQEFKETLLHIAPKSLKSFADELQSQSKRSLEA
                     PWGEELIYDAEQRYSFAEQLFHPLKESFPEGWPVSKDGVVETWHNDYVPLKRTKPGTS
                     TNTKDKEGTAESTPVPVATEQEAVGSPSQEPNENGKRPIDPKDEKGEKENHNESNNDQ
                     ENGNETSSTPAPSSDGVNGKDNDHVAGIVDLINKTMMEADVDLRATLAHNVVLTGGTS
                     KIPGLSDRIMYELNKSLPALKFRMLSSGHLRERQYQAWLGGSILASLGTFHQLWVGKQ
                     EYEEVGADRLLKDRFR"
     gene            complement(<1267555..>1269147)
                     /gene="FCJ1"
                     /locus_tag="KLMA_10607"
                     /db_xref="GeneID:34714264"
     mRNA            complement(<1267555..>1269147)
                     /gene="FCJ1"
                     /locus_tag="KLMA_10607"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822283.1"
                     /db_xref="GeneID:34714264"
     CDS             complement(1267555..1269147)
                     /gene="FCJ1"
                     /locus_tag="KLMA_10607"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674120.1"
                     /db_xref="GeneID:34714264"
                     /translation="MLRASRIVGRRLASTSAPVKTAHPIRNFFLKLTAATTAFYAGGV
                     ALSVYNYQFAELFTDNVPLAEELVQLVESYNDGTLNAPQLSLEEIRQKFGSFARRVEN
                     VRHEGSSPVAAVTPTPVTSSVTVPEPAVAVVDPSIPPVGSVLLKLPHLKLDEESVSPK
                     NKEFVESFNRQVDLLNESHLVLPENAVELFLNSYKNLSVELNKLNKDLTEQLNSQLST
                     LSSELKQSVEADKAKEIENNRAQLVQQFEKDLSNLKVEFEQKFDSQLQASLKANEQAL
                     LAKHKNELAMLSIKQVQEFNKIISDKIENERNGRLKNLDELNDSVKNVSDSLESIEQT
                     ILKSECINQLTTLVSSIRFKLNLDNTPSLDLSKDLQRLKLLVNILPGKPNKCECKEPQ
                     LIDVVVKELDTLISGKSEQERQVLSNEQLLNRWNLLQEKVREASLLPPNAGFLGHISA
                     KFFSLFLFNKSGISNDNDIDSVISRVSENIKLNRLDKAVEEVVQLQGWSRLEAESWLQ
                     AARSKLELETLVDVIDHELKTL"
     gene            <1271390..>1272661
                     /locus_tag="KLMA_10608"
                     /db_xref="GeneID:34714265"
     mRNA            <1271390..>1272661
                     /locus_tag="KLMA_10608"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822284.1"
                     /db_xref="GeneID:34714265"
     CDS             1271390..1272661
                     /locus_tag="KLMA_10608"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674121.1"
                     /db_xref="GeneID:34714265"
                     /translation="MDSFVNSVTCQQVSPEQCEQMLQLSRVDSTVSCSNFKKILGWFK
                     TAHAGSSEDRALASTVANVLLNSSEQRMHASQDRSLIKCVESRLFNNPYDLPRWRIMF
                     LMAHCKPEGREHEHEQQHEQQRDQPFDRLLAPTCFQRMVSELRMDSEYMNTLCELGKF
                     WYALCFNYGCTITNSVLYWNIFTDFAAKPYISVPGFQDCLIQFGSLYLLVHSNEMCVE
                     KTTVNRFLCIFEDKFNDWYTQTTREWYCSLQEHRLPQILNILELLIAYSSPSLKQEIR
                     QCFLSSQNSLHCPFVNSSFIKLIESPINNVSNTTASILSLLHLRHDKSSHSLKLMAPP
                     LASRDSLSSTKSSDYITYSGLPTPSVSSQADPAVSTFSTAASFGSASPVCGQPSNYDD
                     WSEEEQFLEAEKIGAAIERLNELGFVKMSTE"
     gene            <1273295..>1273918
                     /gene="YPT52"
                     /locus_tag="KLMA_10609"
                     /db_xref="GeneID:34714266"
     mRNA            <1273295..>1273918
                     /gene="YPT52"
                     /locus_tag="KLMA_10609"
                     /product="GTP-binding protein YPT52"
                     /transcript_id="XM_022822285.1"
                     /db_xref="GeneID:34714266"
     CDS             1273295..1273918
                     /gene="YPT52"
                     /locus_tag="KLMA_10609"
                     /codon_start=1
                     /product="GTP-binding protein YPT52"
                     /protein_id="XP_022674122.1"
                     /db_xref="GeneID:34714266"
                     /translation="MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQT
                     IKLSEEYDEEVLKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPNSLPKAKLWV
                     DELKEKVSDEKLIICLVGNKLDLASETDPSSLVDESEAREFARENNLLFHQVSAKTGE
                     HVIDVFQDIGQRLYLQNKDELQNSKKNASNNVSLQRPSTNDSQSCCI"
     gene            complement(<1274368..>1278051)
                     /gene="SCP160"
                     /locus_tag="KLMA_10610"
                     /db_xref="GeneID:34714267"
     mRNA            complement(<1274368..>1278051)
                     /gene="SCP160"
                     /locus_tag="KLMA_10610"
                     /product="protein SCP160"
                     /transcript_id="XM_022822286.1"
                     /db_xref="GeneID:34714267"
     CDS             complement(1274368..1278051)
                     /gene="SCP160"
                     /locus_tag="KLMA_10610"
                     /codon_start=1
                     /product="protein SCP160"
                     /protein_id="XP_022674123.1"
                     /db_xref="GeneID:34714267"
                     /translation="MSEATPDVSESHSQVVLDTPPSSVDESSKMATTTGEENGESVSS
                     SAVGESQNETESESKSENDSETVDGVPTPTPTPVKVSFPRLGGNSGSSSGSTGSNALS
                     WGSTLKSVGSAATSNKARPSSMGSAKPMRSKNIQEVFSLDLEAQYQITKAEFSSIIQT
                     IKQKYDVSVESTLSKTSRTFLISGASDKIGLARRDLVKKLTKPVSVSFEVPSKTRSAI
                     IGSGGRTIRGISDSTGVKIDVPKEVNEDSYDADLEDYNVSISLHGDAESVTLAKNKIL
                     EIVKEETKNARIVVPVEDPKLVSFIELESIDTPADVKVQLFTNNEPSEIVLTGPRDDV
                     KLAKVKVINYMNELGLRIIVKKEKVPFKFHSLINAAELKEKFHVEVKPPHAVDDDHFV
                     FTGLADNVNEAITYAKNQSKYHAIESLEISKAHGKNLEHAKHLVLYFHKYNILKEISE
                     RFPNVQITLPKLETVPALESVIITLIAKNEFTDEIKNARKQIVALVNELAPEQTLVVS
                     DLDYHLFHKDIKQTLLATENDVQFVQLGDYYPDNDSILLITKVDEEDFKPSDDELKAK
                     LQSVNQQLDSLRQKQSALASNVLTLSKEQQAQLFSEDKVTLKLINEEVTHAGAHALIK
                     LGTPSADKITIRGDDNGCKIASAAIKSIIENPSVESKITFQVPTNVVARLIGPKGAHL
                     QQIRDKFDVTTFIPQDAKDEHTEITLTGLKFNLDHAKPYILAEAKKWSDIITKELIVP
                     SKYHGTLIGSQGSYRIRLENKYSVYIKFPKEGEVVTIRGPSRGVKGAYEELKALLDFE
                     IENSHKETVKVPVEYVTRVIGKSGETINDIRAEFGVELNFLDKTDSEAAKKAGEVELE
                     IIGSRTNIKEAASKVKSIIKEASDYETVKIEDVNPKWFSEIVGRNGAQLKNIISKAGG
                     DLIHNKRLRIPDADAEEKAIVVAGPTDFVKKAVKHIKEIIDSLENSVVVELSVPQEKF
                     GLLIGPGGSVRQALETEFNVRIHVPNRDSKDETVKISGSPANTEACKAKIEKDIIKEK
                     FDAVVEVPAEYHFYVSNSGLLFQTLRNELSIDVSHGKFNRTAQKLARAKYTVPENIRE
                     NEGSKFNVITKKLEEPESTSQSIPWRLTYDPVDLSDVLGEEYKKEIESKDTVIEKVTK
                     LIEERIAEAKNANTEGFIWAKDPKKFRNIVGPNGSKVKEIRNSTKTVIHVPRNNDAVN
                     DVIYVRGSEEGVKKAVELITSKL"
     gene            complement(<1278746..>1279387)
                     /gene="PRY3"
                     /locus_tag="KLMA_10611"
                     /db_xref="GeneID:34714268"
     mRNA            complement(<1278746..>1279387)
                     /gene="PRY3"
                     /locus_tag="KLMA_10611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822287.1"
                     /db_xref="GeneID:34714268"
     CDS             complement(1278746..1279387)
                     /gene="PRY3"
                     /locus_tag="KLMA_10611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674124.1"
                     /db_xref="GeneID:34714268"
                     /translation="MRIFTASALKLLPLLATLLHKVQSVTITKYKTVVVTPASIVSTS
                     TRSTTSTTIVYRTATGTYTESITSNPQTTEPDFKTEILDLHNSLRAKHSAGPLQWDSN
                     LASKAQDYANTYVCDGQLKHSTLPYGENLALGYNTTAATMAWYDEYKLYDFSNGQFST
                     QTGHFTQLVWKNSTKLGCAYLICGKYYGQYTICEYDPPGNIVGQFQQNVLPST"
     gene            complement(<1280105..>1281022)
                     /gene="PRY2"
                     /locus_tag="KLMA_10612"
                     /db_xref="GeneID:34714269"
     mRNA            complement(<1280105..>1281022)
                     /gene="PRY2"
                     /locus_tag="KLMA_10612"
                     /product="protein PRY1"
                     /transcript_id="XM_022822288.1"
                     /db_xref="GeneID:34714269"
     CDS             complement(1280105..1281022)
                     /gene="PRY2"
                     /locus_tag="KLMA_10612"
                     /codon_start=1
                     /product="protein PRY1"
                     /protein_id="XP_022674125.1"
                     /db_xref="GeneID:34714269"
                     /translation="MKLSSATLLTLAATAIAAPVATVTVHDHVKQTVVVEGYVYFDGT
                     HTTTGYTTHGAAPAATQTDSPAPASTASPAASPLAESAVEDDSSSPAPSPSTNTAPAS
                     TQPASVVNNAAELNIEPATTSSSEQPATTSTPAPSPTPTTTTSSSSSSAAPAATSSAS
                     SSDSNLSSFASEMVNAHNSKRSLHKNTPSVSWSDDLASYAQNYADNYDCSGTLTHSGG
                     PYGENLALGYGNTGSVEAWYDEIKDYDYSNPGFSMSTGHFTQVVWKASTSIGCGVKQC
                     DSWGAYIICSYDPAGNVDGGYQDNVQPLA"
     gene            complement(<1282475..>1283176)
                     /locus_tag="KLMA_10613"
                     /db_xref="GeneID:34714270"
     mRNA            complement(<1282475..>1283176)
                     /locus_tag="KLMA_10613"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822289.1"
                     /db_xref="GeneID:34714270"
     CDS             complement(1282475..1283176)
                     /locus_tag="KLMA_10613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674126.1"
                     /db_xref="GeneID:34714270"
                     /translation="MAEASSSSPYAFYAFYQLYRHFHKIPAVSLQTIDERLYQGKGVK
                     PEFARCPLFVTWKKLSRHGQYQLRGCIGTFAECEIEQGLTRYALIAALQDSRFSPISE
                     KELALLSCGTNLLSNFKTIYKKNNAAAASPDSLPKSSIFDWELGKHGIELKFRHPKTG
                     ARLSATFLPEVMPEQGWNQQETFENLIEKAGCWKYVTLVMDHWDEYFEEVIRYEGTKS
                     QITWEEFESKLPMIT"
     gene            <1283430..>1284542
                     /gene="MPD1"
                     /locus_tag="KLMA_10614"
                     /db_xref="GeneID:34714271"
     mRNA            <1283430..>1284542
                     /gene="MPD1"
                     /locus_tag="KLMA_10614"
                     /product="protein disulfide isomerase MPD1 family protein"
                     /transcript_id="XM_022822290.1"
                     /db_xref="GeneID:34714271"
     CDS             1283430..1284542
                     /gene="MPD1"
                     /locus_tag="KLMA_10614"
                     /codon_start=1
                     /product="protein disulfide isomerase MPD1 family protein"
                     /protein_id="XP_022674127.1"
                     /db_xref="GeneID:34714271"
                     /translation="MLRLPAAICCYLLLCLVRASNFYDRDEHIMELTPASFDKVIHQT
                     NYTTIVEFYAPWCGYCQEMKGHFKSAARMLSGIVQVAAVNCDESVNKQLCAQHRVSGF
                     PTVMVFRPPKFDLNNQNHGNADASSIASSRHASETYKGERKLKPMVDFALSRVKNYVK
                     KLNRYEKFEDVLKTDRSRYAVILVTKKDKVPSLFKAVALDWLGIHDFYAIWNKKLNGV
                     SQLTFQDDTSRWPNAIEYIKSLETTAGSLESPKIIVIDKQNDTVSELDLVKENGKQQI
                     AEFLSNFGLTPREGPLSKRDEFIQSIVKKADRAKSSKSKKQAKAKAKAKAKAKAKSKS
                     KSKSKSKASESQSKSKASESQSNSEPHQNTMVDDEL"
     gene            <1284787..>1285272
                     /gene="rplM"
                     /locus_tag="KLMA_10615"
                     /db_xref="GeneID:34714272"
     mRNA            <1284787..>1285272
                     /gene="rplM"
                     /locus_tag="KLMA_10615"
                     /product="54S ribosomal protein L23"
                     /transcript_id="XM_022822291.1"
                     /db_xref="GeneID:34714272"
     CDS             1284787..1285272
                     /gene="rplM"
                     /locus_tag="KLMA_10615"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="54S ribosomal protein L23"
                     /protein_id="XP_022674128.1"
                     /db_xref="GeneID:34714272"
                     /translation="MSQKVGHTGLAFARMWHHVDLAKDKRTLGRVASQIAITLMGKHK
                     PVYHPSADCGDYVVVTNCQALRVTGNKMSQKTYWSHTSRPGSLKLTTMEDMISNKGHS
                     EILKKAVSGMLPKNKLRKLRLSRLKVFDGGDHPYKSNITAFADQQPKVQELLQKQQQK
                     A"
     gene            complement(<1285534..>1287739)
                     /gene="CRN1"
                     /locus_tag="KLMA_10616"
                     /db_xref="GeneID:34714273"
     mRNA            complement(join(<1285534..1287598,1287735..>1287739))
                     /gene="CRN1"
                     /locus_tag="KLMA_10616"
                     /product="DUF1900 super family"
                     /transcript_id="XM_022822293.1"
                     /db_xref="GeneID:34714273"
     CDS             complement(join(1285534..1287598,1287735..1287739))
                     /gene="CRN1"
                     /locus_tag="KLMA_10616"
                     /codon_start=1
                     /product="DUF1900 super family"
                     /protein_id="XP_022674129.1"
                     /db_xref="GeneID:34714273"
                     /translation="MRFVRASKYRHVYGQAAKKELQYENLRITSNAWDSNLIKANGKY
                     ISVNWNSSGGGAFAVIPIKEVGKAPDQVPLFRGHTAQVLDTEFNPFNDNIVASASDDG
                     KIGIWEIPEDYSLHGYVDEDGTPTDLKPLKMLSGHSRKVGHLLFHPTAENILASSSLD
                     YTVKIWDISEGKDKFTLKHPDMVTSMSFSYDGNRLVTVSRDKKLRVWDIRAEKIITEG
                     PAHSGAKNQRVVWLGNSERIATTGFSRLSDRQIGIWDAENIEKGDLGGFYNVDQSSGI
                     LMPFYDDSNKILYLAGKGDGNIRYFEFQNDELFELSEYQSTEPQRGFAVAPKRAVNVK
                     ENEVLKGFKAVGEHTIEPISFFVPRKSEVFQDDIYPDAPSSKPALTAEEWLSGKSVDG
                     PILFKLQAIYDGSELEFTNAKKADSNGASANEKKKESSPTSTPPKSPSVEVKHEISVE
                     VTPKDSVNGESTSSTPQSSLKKEVPSPKSTGKNQVDELLSKDASVDKLLQKATELDAD
                     NDAENPSEESSVWDSEDEKVTKSKNEPVKEKEVETKSTPEPVVKTESKEEPLPAETKE
                     TPPAKENAESGVVTTALVTSKVESGSDTTIETVSQASVQTSIKTPSKEPKEPKETNEP
                     SKTSTSTPTSASAGNKSLNLKQSVEKLSALVLQMESYIQTLTEQNAAKDERLAALEAK
                     VEKLLQK"
     gene            complement(<1288093..>1289961)
                     /gene="MAG2"
                     /locus_tag="KLMA_10617"
                     /db_xref="GeneID:34714274"
     mRNA            complement(<1288093..>1289961)
                     /gene="MAG2"
                     /locus_tag="KLMA_10617"
                     /product="RING-finger protein MAG2"
                     /transcript_id="XM_022822294.1"
                     /db_xref="GeneID:34714274"
     CDS             complement(1288093..1289961)
                     /gene="MAG2"
                     /locus_tag="KLMA_10617"
                     /codon_start=1
                     /product="RING-finger protein MAG2"
                     /protein_id="XP_022674130.1"
                     /db_xref="GeneID:34714274"
                     /translation="MSEKLNIESPSFVPEHKKGGRRGTANKQADTDKGSNKRKPKRNN
                     NRHLPRAKTASSPGDLEWNIQDELANGNYKLNGKKTKISINHLLDFQLPEIEAPKPLS
                     RNPADRRRRRHSDNHDRVFLHGDSFVNANYKFIVDDKGSYEAQSNDPNVPLETESIRR
                     VVMPKGQSCPICLTDDLISPRMVICGHVFCQTCLLELFKNDPIVSKGEESTLARMKRK
                     ELRECPLCSSIIKKSNVKPVLLTEEDSKANTPTIGSEVELQLICRPHGSLLPLPVTLN
                     IDPLTIGNFPSVNMKELVEYSRIMKCSNQYAIDLLEQDNLQIFTQLEVDKALYHDNGR
                     LAQMAIDENLALIESLKNTDKENEVPDIMGLTLDAHQGIEKYTDDSAFFYYETGFSSS
                     TKFYLSPLDIKVLKNAFPHYHEFPPVLKVKVEDIHYGSMVTETTISKFKYFSHLPIGT
                     ELAFIDLDWRNEDTIPKAVYNKFAAELKQRHRKAMARRSKEDKDKLLYQERLEQEQLE
                     FYQRENNDIFSSIQPAQTYFPSKKPSKPETISQHTPSSLNDKKQGELSLDDHPSKPKL
                     KERTVWGTQIVVTDQNTIEEDLEFERMLLEASQSKKNRSKKKGKTLLLSNSSTRAL"
     gene            <1290677..>1291186
                     /gene="SPC2"
                     /locus_tag="KLMA_10618"
                     /db_xref="GeneID:34714275"
     mRNA            <1290677..>1291186
                     /gene="SPC2"
                     /locus_tag="KLMA_10618"
                     /product="signal peptidase complex subunit SPC2"
                     /transcript_id="XM_022822295.1"
                     /db_xref="GeneID:34714275"
     CDS             1290677..1291186
                     /gene="SPC2"
                     /locus_tag="KLMA_10618"
                     /codon_start=1
                     /product="signal peptidase complex subunit SPC2"
                     /protein_id="XP_022674131.1"
                     /db_xref="GeneID:34714275"
                     /translation="MSKPINVYAVSEARQAFEEALPGIFSRLGYTQTFKLIDTKLFLG
                     YSLVVFAAASFLLDKKLTWEESKQYQLILVSLYAVVCGVQWWFNKFVEKGIIYQGTNK
                     DNKISIGAKFKKNSHEFHIYIADSTNQRVELETSFTKFFNEQGYLQTELLYNYFKQQT
                     EQLVSKKSK"
     gene            complement(<1291346..>1292344)
                     /gene="TDA5"
                     /locus_tag="KLMA_10619"
                     /db_xref="GeneID:34714276"
     mRNA            complement(<1291346..>1292344)
                     /gene="TDA5"
                     /locus_tag="KLMA_10619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822296.1"
                     /db_xref="GeneID:34714276"
     CDS             complement(1291346..1292344)
                     /gene="TDA5"
                     /locus_tag="KLMA_10619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674132.1"
                     /db_xref="GeneID:34714276"
                     /translation="MCTQLPVFTNHQYGPCTCSFNYGIRTIHINSRLLYAVFFTYTLL
                     LAGYMHIDKKYKTRGSWISIKDLADPTCVITGGSRGLGSEIVQSLIKSIPNIRIVILD
                     VVEPELKLQSWKEQIKFIKCDLSEDNAVEEAISLIKKTYGKVNVLINNAAIRGRFSRL
                     ADMPSNEIATIFHANVLSTIKLIQAFHPLKTEPNDFYYVVNVASALGILSPARASTYA
                     ATKAALISYHESWTYELLSENVMNVRTLLVLPGQMDTQMFQGFEPPRQFFAPVVKAPK
                     LAKEIVACCIQGKRGEICKPFYVNFLRMFKCFPEMLIEKLRAFSKMDECLPLDEAK"
     gene            complement(<1292934..>1296827)
                     /gene="TUS1"
                     /locus_tag="KLMA_10620"
                     /db_xref="GeneID:34714277"
     mRNA            complement(<1292934..>1296827)
                     /gene="TUS1"
                     /locus_tag="KLMA_10620"
                     /product="rho1 guanine nucleotide exchange factor TUS1"
                     /transcript_id="XM_022822297.1"
                     /db_xref="GeneID:34714277"
     CDS             complement(1292934..1296827)
                     /gene="TUS1"
                     /locus_tag="KLMA_10620"
                     /codon_start=1
                     /product="rho1 guanine nucleotide exchange factor TUS1"
                     /protein_id="XP_022674133.1"
                     /db_xref="GeneID:34714277"
                     /translation="MDSKRQSPKLPALPPLQVQPQTFRRRRPPPLPPREIITSPVTPT
                     SGTSFNIVPMRPNDSPFQPSSNSAYSSPFVSEKNNTMGERKPSAPKVYKSPFVGDPSV
                     FRSPTSPVSSQSNQRLSSSSTSSIFTNNIQLPNIEYEGFITQDSKDVTLKALPALPPR
                     NFSGPINAATKTSAVSTTPTSHTHVDTAAQLPALETISPISTGNFNFNWSTSDKSSLQ
                     NTTLYYQQPPRLGGELTHERGLSDSLNSYYSNSSYAFNKNAEEFARHESFGSITGSKP
                     LNNVASITVPTQPFPIKLLDERKLYQCYNISQLSHIYQWLLKVYFEWFNEYVFFKLEF
                     FQIVQLLLEFQLPSSCEQDIIDSNVDKIIESLVHQGAVRFEEDPETSKQITIIIAGLD
                     TQGVFTDLLPCYSYSHIHDDPTTDLKCYSHTCWSTKTSESYRSEIKISEFINKSVGLW
                     TDYWKLTADEIAEINPREVKRQSFIFDLIVLEERSLNLANAAVEIYGASFDPALLPYE
                     PNFKAMAYDIFVPLIELHKDFLLSPILWKLKIKGKFIDGVGKIYLKWANEAKTVYVKY
                     AQNMAAVHEIINWEKENNTRFAAWLKEIDESSAITRSKLYHDVIFFGGFFKSLQNMPV
                     TLRSILKCTDPSMDDYEYLKLAIQEIEELSRLVDKTHGDAIDRRKIIRLARQLIITFK
                     TGNTVNYLNIQSNNANLSSNSTNTEHLDLKLGDPDRKIIKEGMLHKKRELWLESAPVY
                     IILLDNYFLITEEVLKGTEKKYKLLDRPIPIDYLSLETKEEINYKRKSTSEGDDESSS
                     LQTPSTPKKPPLLQAGTTMSSIPKTIYQTATNANHNGEDDEDYSYSFKIRNTASNESH
                     TFYTSSIEDRELWIAALIDSFQKYMGNSGKEAFQLQCLCDMFSYDDIQAPTNLPLEPE
                     GSAVGRAIKEFYGSEPISSYGVKGDVLSSLSFTYENENFVLCGVNTGVYIASYRCLKQ
                     WKRILNLPKTTRMEINSKLGLLFVLADRKLCYFNIPSIISAFYDSEQYLPENKLVGIM
                     IQEKISFFKVAEDFSNSRHLFYERKGEIVIMTPEFDPLTKVFRFFKHYKSYKIPASSN
                     GLVNTSISDITIFKNSFIVCSSKGAILYSESFNEEGAFLPITLPESSKTKFNGLPFKK
                     QIDYKSKSNSSSMKMAEYVRSDILTKKTKPIGCFQIDPNIFILCYDEAIIRINKFGEI
                     PDWKNDILVLDFYCINVSLCQGYLVLTGDNLVQVYDLHILDGADWAISSIKPVQIIKG
                     KKIKMTSSVEDYTSIVLTHPNIPGRQLLMEFNLTS"
     gene            complement(<1297706..>1299484)
                     /gene="CYB2"
                     /locus_tag="KLMA_10621"
                     /db_xref="GeneID:34714278"
     mRNA            complement(<1297706..>1299484)
                     /gene="CYB2"
                     /locus_tag="KLMA_10621"
                     /product="cytochrome b2"
                     /transcript_id="XM_022822298.1"
                     /db_xref="GeneID:34714278"
     CDS             complement(1297706..1299484)
                     /gene="CYB2"
                     /locus_tag="KLMA_10621"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="cytochrome b2"
                     /protein_id="XP_022674134.1"
                     /db_xref="GeneID:34714278"
                     /translation="MRSAARVINKSCSGSALSRRCLRKSSLSMSMRYLSTSNIGVRKG
                     FNGQGKSSNKTMLFLAAGASAVAGIGLLSQFSDSLQNATKEELNKPKVSPLEVAKHSS
                     PDDCWVVIDGFVYNLTEFISAHPGGPAIIENNAGKDVTAIFGPIHAPDVIEKYIAPEN
                     RIGPLDGKMPDDLICAPLTPGETPEDVARKEELRQNMPDLDSLVNIYDFEFLASQILT
                     KQAWSYYSSAADDEVTHRENHAAYHRIFFKPRILVNVKEVDTSTTMLGEKVGVPFYVS
                     ATALCKLGNPKEGEKDIARGCGESDVKPIQMISTLASCSLQEIVEAAPSKDQIQWFQL
                     YVNSDRKITEELIKNVEKLGLKAIFVTVDAPSLGNREKDAKVKFTNKDSSAKAMEKSN
                     VKESKGASRALSTFIDPALCWDDIVTLKSKTKLPIVIKGVQCVEDVLKAAEIGAAGVV
                     LSNHGGRQLDFSRAPIEVLAETMPILKEKKLDDKIEIFIDGGVRRGTDILKALCLGAK
                     GVGLGRPFLYANSCYGKEGVKKAIELLKDELEMSMRLLGVTSIDQLSEKYLDLSTLHG
                     RTVSVPRDNLYNGVYVPHEPTDFKEN"
     gene            1300257..1300330
                     /locus_tag="KLMA_R124"
                     /db_xref="GeneID:34718639"
     tRNA            1300257..1300330
                     /locus_tag="KLMA_R124"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:34718639"
     gene            complement(<1300613..>1301215)
                     /gene="YKT6"
                     /locus_tag="KLMA_10622"
                     /db_xref="GeneID:34714279"
     mRNA            complement(<1300613..>1301215)
                     /gene="YKT6"
                     /locus_tag="KLMA_10622"
                     /product="palmitoyltransferase YKT6"
                     /transcript_id="XM_022822299.1"
                     /db_xref="GeneID:34714279"
     CDS             complement(1300613..1301215)
                     /gene="YKT6"
                     /locus_tag="KLMA_10622"
                     /codon_start=1
                     /product="palmitoyltransferase YKT6"
                     /protein_id="XP_022674135.1"
                     /db_xref="GeneID:34714279"
                     /translation="MKIYYIGVLRNSGDKTLELSSVKDLSEFGFFERNSVAQFMSFFS
                     ETVAGRTSAGQRQSVEEGKYVGHVYARSEGICGVLITDKEYPVRPAYTLLNKILDEYL
                     VAHPPLEWKDVAETNDSLKLKELDIYISKYQDPSQADAIMRVQQELDETKITLHKTIE
                     NVLQRGEKLDNLVDKSESLSAASRMFYKQAKKTNSCCIVM"
     gene            <1301619..>1302782
                     /gene="MIA40"
                     /locus_tag="KLMA_10623"
                     /db_xref="GeneID:34714280"
     mRNA            <1301619..>1302782
                     /gene="MIA40"
                     /locus_tag="KLMA_10623"
                     /product="mitochondrial intermembrane space import and
                     assembly protein 40"
                     /transcript_id="XM_022822300.1"
                     /db_xref="GeneID:34714280"
     CDS             1301619..1302782
                     /gene="MIA40"
                     /locus_tag="KLMA_10623"
                     /codon_start=1
                     /product="mitochondrial intermembrane space import and
                     assembly protein 40"
                     /protein_id="XP_022674136.1"
                     /db_xref="GeneID:34714280"
                     /translation="MFRVSAQVGRRLVVRSVRQARVYSSASHGGSGASMSKSALLLAG
                     FSTLGALYVANGCPTLIKSKPASVAAPVSEPVKDKSDAPHSAQDEGAEPVTAPGNETV
                     FSEEKFGELKAAQEAQEAHETQEDAQGAQGAQENTEAGESTTQASGVDESSESSETSA
                     PSLSVDNEITKKNVVLHHEADQKELVQVTGPDGVKMVTKDSEPASETEEKSFAPASPS
                     ENENEAKPEQSATAEAAAAGVQGEENNEQKSAYNPETGEINWDCPCLGGMAYGPCGEE
                     FKTAFSCFVYSEAEPKGINCVEKFSAMQNCFRQYPDYYAEQIKDEEEASAEASKIEDK
                     STTDASTATATVEVETENAVFEPVLEKYVEENPQLKETSEAAPVVTSDAGDKN"
     gene            complement(<1303126..>1305126)
                     /gene="SPP382"
                     /locus_tag="KLMA_10624"
                     /db_xref="GeneID:34714281"
     mRNA            complement(<1303126..>1305126)
                     /gene="SPP382"
                     /locus_tag="KLMA_10624"
                     /product="pre-mRNA-splicing factor SPP382"
                     /transcript_id="XM_022822301.1"
                     /db_xref="GeneID:34714281"
     CDS             complement(1303126..1305126)
                     /gene="SPP382"
                     /locus_tag="KLMA_10624"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor SPP382"
                     /protein_id="XP_022674137.1"
                     /db_xref="GeneID:34714281"
                     /translation="MEDEDKEEHKRRKLSPSMNSMSFIDPYGYSDEEEDVEDVEVKRT
                     SNSMEKRYGIGAKLLSKMGYKQGEGLGRDGKGIVNPIETIARPKGVGLGMLSAVHNME
                     KGEETDTSSEEENLSQKKTPVRFKSVSNAQLEGLVKDVKLLMEQNIQIPNNVTERINN
                     SLLSNEDIEEIRRTTKDLLKISTEIKTVESSLERLRLESKRESQQRSILRETMATMSE
                     NVDEKSETSAQLTLSEQITRCLEVDDEFLADKLCSFVLAKGLKPLASEDDLETAQVSQ
                     LQQIVDYLSYRMESKYTLNNTQSVIFRKIYEPLCRMLESTNDQNELIRRALVQYMPII
                     EFISCKEHFISTYVIPYLEKNLSESFLYDGFMVTYNQIQSVLEARELKMTKELMIHKF
                     ESFLKGWTASKRVVTEDVIILRETIGELKFYDLINTYWLPRFVDYFDSTFNLTDEFID
                     YNEKDGEGGYISEVAEVIHEYEPFFDSDTSRKVFEVIINSIQKVLFQWFVLQPKTFVP
                     DAEYWVNHILNQICSETLAMNHSAELRNIYNFVRNPSLVSEHDEELTLHSLIRSTREQ
                     CSKRDEYNSTPMTKISTTFKTVVETFCHEHGLSLRRTATENTTIKILGREKVVPTFMV
                     SNFSNNKKIHVALSDDILWLKKGNGTYKPIYIYELLHFTSDK"
     gene            <1305360..>1306625
                     /gene="ATG17"
                     /locus_tag="KLMA_10625"
                     /db_xref="GeneID:34714282"
     mRNA            <1305360..>1306625
                     /gene="ATG17"
                     /locus_tag="KLMA_10625"
                     /product="autophagy-related protein 17"
                     /transcript_id="XM_022822302.1"
                     /db_xref="GeneID:34714282"
     CDS             1305360..1306625
                     /gene="ATG17"
                     /locus_tag="KLMA_10625"
                     /codon_start=1
                     /product="autophagy-related protein 17"
                     /protein_id="XP_022674138.1"
                     /db_xref="GeneID:34714282"
                     /translation="MSYHYDGIPDIEIDLYWNKARNHLLKAQVECEESLKLLSTIRSE
                     MDSCQKSRLKLQFILNCLVNQVEFFSSVILEKCIAVELLDNEWSKVVLVGVVKDLNYW
                     QDEITNKINALKNTKYDLNAEYKSLADFICEDHVEILQQKLDEVPFIKKQVSNIRQHY
                     KSIKEGVQYQLKAGKVKKLKKYYETHFSRDNHLFELLEGEYLTKLNSYESELTDYIRS
                     ITDHFDKCSILKADGLPPQDLKDLFEVVKNDDAELEHIRELIYESDAEITQFYKNVEG
                     TITSIKENVADFYGLSTKIMVELEKCEEYVSIFQDIAKLVSVYKESCIRKIEQVQELC
                     EVYDKFKKAYFNLLKERERRKSVAIQMKSILDECKGKLMALNEDDLDHRQQFLHENGD
                     YLPENIWPGKIDDMTPLYSLEYTIYNEQK"
     gene            complement(<1306681..>1308066)
                     /gene="MST1"
                     /locus_tag="KLMA_10626"
                     /db_xref="GeneID:34714283"
     mRNA            complement(<1306681..>1308066)