GenomeNet

Database: RefSeq
Entry: NC_036026
LinkDB: NC_036026
Original site: NC_036026 
LOCUS       NC_036026            1711476 bp    DNA     linear   CON 23-OCT-2017
DEFINITION  Kluyveromyces marxianus DMKU3-1042 DNA, complete genome, chromosome
            2.
ACCESSION   NC_036026
VERSION     NC_036026.1
DBLINK      BioProject: PRJNA264644
            BioSample: SAMD00067077
            Assembly: GCF_001417885.1
KEYWORDS    RefSeq.
SOURCE      Kluyveromyces marxianus DMKU3-1042
  ORGANISM  Kluyveromyces marxianus DMKU3-1042
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1
  AUTHORS   Lertwattanasakul,N., Kosaka,T., Hosoyama,A., Suzuki,Y.,
            Rodrussamee,N., Matsutani,M., Murata,M., Fujimoto,N., Suprayogi,
            Tsuchikane,K., Limtong,S., Fujita,N. and Yamada,M.
  TITLE     Genetic basis of the highly efficient yeast Kluyveromyces
            marxianus: complete genome sequence and transcriptome analyses
  JOURNAL   Biotechnol Biofuels 8, 47 (2015)
   PUBMED   25834639
  REMARK    DOI:10.1186/s13068-015-0227-x
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1711476)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1711476)
  AUTHORS   Yamada,M. and Kosaka,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2011) Contact:Mamoru Yamada Yamaguchi University;
            1677-1 Yoshida, Yamaguchi, Yamaguchi 753-8515, Japan URL
            :http://ds22.cc.yamaguchi-u.ac.jp/~jo-sei08/index.html
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP012214.
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps and the
            genomic and proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: SPS phrap v. 0.990329
            Assembly Name         :: Kmar_1.0
            Genome Coverage       :: 8.4x
            Sequencing Technology :: Sanger ABI3730
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1711476
                     /organism="Kluyveromyces marxianus DMKU3-1042"
                     /mol_type="genomic DNA"
                     /strain="DMKU3-1042"
                     /db_xref="taxon:1003335"
                     /chromosome="2"
     gene            <797..>940
                     /locus_tag="KLMA_20001"
                     /db_xref="GeneID:34714487"
     mRNA            <797..>940
                     /locus_tag="KLMA_20001"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022822531.1"
                     /db_xref="GeneID:34714487"
     CDS             797..940
                     /locus_tag="KLMA_20001"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022674342.1"
                     /db_xref="GeneID:34714487"
                     /translation="MFVSLYSCDVTFFMHYPFFFPPAIPASCISHVPFPITVSMLVKR
                     FFS"
     gene            complement(<6846..>9494)
                     /locus_tag="KLMA_20002"
                     /db_xref="GeneID:34714488"
     mRNA            complement(<6846..>9494)
                     /locus_tag="KLMA_20002"
                     /product="flocculation protein FLO5"
                     /transcript_id="XM_022822532.1"
                     /db_xref="GeneID:34714488"
     CDS             complement(6846..9494)
                     /locus_tag="KLMA_20002"
                     /codon_start=1
                     /product="flocculation protein FLO5"
                     /protein_id="XP_022674343.1"
                     /db_xref="GeneID:34714488"
                     /translation="MWFVIFQVLLVLGISFVDCQSFNTDLNTVLGCAPKTNSLSKGFS
                     VSYYHYPLIPSGSSGCYVDDRKTFLTDEYLHGGYATYGGGLIGSSTGVTNLTFHFHFP
                     GGCLRPILGSLPSNYNNPPQFSMSNFSMLITGYFFAPKTGLYDFVITNGDDVMDINMG
                     DGKAFGCCQLESTISNPAPFDISVVWPSSTGSGSFNLVGGYYYPLRILYINRYYEAII
                     AMSFKDPDGVVHNNFDGYVFTIPDGEKCPAPVATTTLPWTFQSTATGTAIGTTTGVDG
                     EAITEDFIVVRLPHIETAIAINTPWTGTYTTTVATATTTVTGSDGIPTIETIFSVEIP
                     QVKTATTVNKPWTGTYTTTYSTDISTETGADGIPTVRTNFLVETPEIETAVTKVIPWT
                     GKYTTTYSTNIATETGTDGIPTVKTNFLVETPQVETATTINAGWTGTYTTTYSTDIST
                     ETGADGVPTVKTNFLVETPQVETATTINAGWTGTYTTTYSTDFVTVTGSDGIITLQAV
                     YHVQTPTVKLSKFDNLSRTSNDTQAYSTNTIATTGADGVPTVHPTFSVDASEIGSIST
                     VISPWTGTYTTTYSTELVTATGTDGIITVQAVYHVKTPSTGTTNTKNSTWISNYIQTY
                     PTGGIGSSSADGVSNVQTAIHVKTGEAGNAMKINIPWTGTYTTTYSTGAFTSTGSNGI
                     QTVQTAFYVKTPEMGSSSFGYSNTSSTTSHGTDSNGNKNLQSETSNPLVRVSVTSGNV
                     IGHSTAETNLPISQETSSNRPTTSKNDDGPVPERRSTANINTPLGTTMNAVGETSGVV
                     SGILDTETRGKQTKTMSISVGQPVTVSSATSKATSPQPSLNPSIPTFTPSISGASQSA
                     TFETRLEDKANKILISPLVIILLAFL"
     gene            <13803..>14063
                     /locus_tag="KLMA_20003"
                     /db_xref="GeneID:34714489"
     mRNA            <13803..>14063
                     /locus_tag="KLMA_20003"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022822533.1"
                     /db_xref="GeneID:34714489"
     CDS             13803..14063
                     /locus_tag="KLMA_20003"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022674344.1"
                     /db_xref="GeneID:34714489"
                     /translation="MAEAHSETGVLESFSPRRGRYFFIQFIVLFFLFFGVSSCYHFYS
                     EAKRQAGETDPSLHLIRNSIFGFLLSAGMLTAYALMYRWYQR"
     gene            <15336..>17717
                     /gene="OPT1"
                     /locus_tag="KLMA_20004"
                     /db_xref="GeneID:34714490"
     mRNA            <15336..>17717
                     /gene="OPT1"
                     /locus_tag="KLMA_20004"
                     /product="oligopeptide transporter 1"
                     /transcript_id="XM_022822534.1"
                     /db_xref="GeneID:34714490"
     CDS             15336..17717
                     /gene="OPT1"
                     /locus_tag="KLMA_20004"
                     /codon_start=1
                     /product="oligopeptide transporter 1"
                     /protein_id="XP_022674345.1"
                     /db_xref="GeneID:34714490"
                     /translation="MTVIYGGSHLAESDANVSDSSSLSHIQIQTNGKGENTSSLEKDI
                     KEEEIFNEAEFHDGDSIDEDDGLVWEGDPTYLPNSPYPDVRYAVSIEDDPTIRLNHWR
                     TWFLTTIFVVVFAGVNQFFSLRYPSLTIDFIVAQVVCYPIGKALANLPDWKCARVPFF
                     DLNPGPFTKKEHAVVTIAVALTSSTAYAMYILNAQGSFYHMKLNVGYQFLLVWTSQMI
                     GYGAAGLSRRWVVNPASAIWPQTLISVSLFDSLHSKKIEKAIANGWSMSRYKFFVIVF
                     VVSFIWYWVPGFLFTGLSYFNFILWGSKTRHNFVANTIFGVQSGLGALPISFDYTQIS
                     QAMSGSVFATPFYVSANTYASVLLFFVIILPCLYFKNVWYAKYMPVISTSTYDNTQSK
                     YNVTKILNEDYSIDLEKYKSYSPIFVPFSYLLSYALNFAAVIAIFVHCVLYHGKDIIA
                     KLKDRRNGGTDIHARIYAKNYIDCPDWWYLILQVVMLALGFVTVCAFDSKFPAWAFVV
                     AVIISLVNFVPQGILEAMTNQHVGLNIITELICGYMLPLRPMANLLFKLYGFIVMRQG
                     LNLSRDLKLAMYMKVPPRLIFFIQIYATIISGMVNVGVQEWMTHNIDGICSTDQSNGF
                     TCANGRTVFNSSIIWSFPKYLFSPGRIYNPLMWFFLIGLLVPLIVYAIQRKFPKNQFA
                     KHIHTPVFFTGPGNIPPSTPYNYSLFFAASFCLHVIRKRWGPWFKKYNYVMGAAVESS
                     VAIAVVIIFLCVQFPGAKLNWWGNDVWKNTYDNDYKKFYTLEKGQTFGPNKWW"
     gene            <19014..>20270
                     /gene="ADH4a"
                     /locus_tag="KLMA_20005"
                     /db_xref="GeneID:34714491"
     mRNA            <19014..>20270
                     /gene="ADH4a"
                     /locus_tag="KLMA_20005"
                     /product="alcohol dehydrogenase 4"
                     /transcript_id="XM_022822535.1"
                     /db_xref="GeneID:34714491"
     CDS             19014..20270
                     /gene="ADH4a"
                     /locus_tag="KLMA_20005"
                     /codon_start=1
                     /product="alcohol dehydrogenase 4"
                     /protein_id="XP_022674346.1"
                     /db_xref="GeneID:34714491"
                     /translation="MFHRRALKTAERIKLNPLFYSKQRLIKDNQSILKKEMSSTVGFY
                     MPPVSYFGEGALDEVAEYIKNQDYKRPVIITDPGISKIGLAQRVTKLLEKRDRVVGIY
                     DQTQPNPTTSNVNAGLMVLKEHKGDIIISIGGGSAHDNAKAIALLATNGGEIGDYEGV
                     NKSKKKALPMVAINTTAGTASEMTKFTIITNEEEKVKMAIIDNHITPSIAVNDPSTIY
                     GLPPPLTAATGLDALTHCIESYVSTAANPITDTCALKGVELIHEHLFNAFKNGQDSTA
                     RTGMCYAQYLAGMAFNNASLGYVHAIAHQLGGFYHLPHGVCNAVLLPHVQSFNKKDPR
                     ANERLGQIAPYLGAKEANADSLVERLLEFTNSLEIPRNLKELGVKEEDFEILAEHALK
                     DVCGLTNPIQFTKVEVVEIIRQAYEY"
     gene            <21891..>23951
                     /gene="DUR3"
                     /locus_tag="KLMA_20006"
                     /db_xref="GeneID:34714492"
     mRNA            <21891..>23951
                     /gene="DUR3"
                     /locus_tag="KLMA_20006"
                     /product="probable urea active transporter 1"
                     /transcript_id="XM_022822536.1"
                     /db_xref="GeneID:34714492"
     CDS             21891..23951
                     /gene="DUR3"
                     /locus_tag="KLMA_20006"
                     /codon_start=1
                     /product="probable urea active transporter 1"
                     /protein_id="XP_022674347.1"
                     /db_xref="GeneID:34714492"
                     /translation="MDDKPISLLTQASGYGVLVGVGALFALGIIVATKLMTKYLHEDS
                     QSTENFMVANRNIGVGLTGSVVFSSWYWATEILWVVTMVYSYGIMSSFWYFAGLSVQI
                     CVMSLLGIQAKKKIPNGHTCLEIVELRYGKAAHLLYMFMCLANNLLSSSSMILGAAAA
                     ISIISGNLNIVASTMLIPFGVMCYTVVGGLKATFLTDYFHSLIALIILVYFNTAVISS
                     DKIGGISGLYDKVIKHEGDRYIEGNYKGSFLTGKSQGAIFFGIIHCVGDFGLTVMDSS
                     FWQKAFSANLKASVPGYLIAAFLIPAIVWPLGTIVGLSNIVLEKESFFPTYPRTMNSN
                     EVNSGFGLPYTLMAVLGKGSLGALLLAIYLAVTSTVSAQMIAVSSIISFDIYRKYFNS
                     KAENSQLIKVSHIGVIFFGLFSAGFTVMLHYVGVDMTWMGYFISMIICPGVVPLTLTI
                     LWDRQTKLAAMVSPILGCIAGIAVWLGTAFKFYGEVTIKTTGAQLPCMYGGLTALFLP
                     AILTVMISLCDTSYRFDWAEFNKANLIVNDLQDEVSETAIYSQDKLEESRIEVSEAGD
                     KHFDSERNLSVGKEAYSSDIVEITDSASGNATSSNDQRIITIYTKIAAGSVVFVLLIT
                     WVLWPLPLYRDYIFSKAFFTGWTVMSIFWVYLALIMIGFFPLWDGRHSLIKIVKGIQN
                     DLNK"
     gene            complement(<24590..>26104)
                     /gene="yxeK"
                     /locus_tag="KLMA_20007"
                     /db_xref="GeneID:34714493"
     mRNA            complement(<24590..>26104)
                     /gene="yxeK"
                     /locus_tag="KLMA_20007"
                     /product="putative monooxygenase yxeK"
                     /transcript_id="XM_022822538.1"
                     /db_xref="GeneID:34714493"
     CDS             complement(24590..26104)
                     /gene="yxeK"
                     /locus_tag="KLMA_20007"
                     /codon_start=1
                     /product="putative monooxygenase yxeK"
                     /protein_id="XP_022674348.1"
                     /db_xref="GeneID:34714493"
                     /translation="MTEKQSPQVKRVKTSGKKNLIINAFLMSSPGCQTINSWRNEADK
                     TALSAESPEYWIELGKVLEDGGFTAAFFADVLGPYDVYNGPGNFKPVAKAGAQWPLPD
                     PSYYIPILASVTKRLAFGITISTISEHPYHLARRLGTLDLISGGRVGWNVVTSYLDSA
                     SRNLLNGNTLPDKVERYEKAEEYVDVVYKLFLSSWQDAAIKADKKRGVFTDPNGLRTI
                     DHEGKHYKVPGPGLTQPSKQKMPVIIQAGLSPKGRELAARNAEVVFLNYPTKESLKEG
                     IDSIRNLAKEKFGRDPSKIKIITMITVIIGDSDAEVKQKIDQIRALGDEEAALAMFSG
                     WSGVDIGKFADDEPLDKLDNGALVSIIQAWKAAYSDNEVWTKRQIIERVTLAGSGHIF
                     TGTAASIADQIQEWVEYSGLDGINFAYTSSPGAFKDIAEKLIPELRIRGLVPSKEELA
                     NANETGLSFREQLFGTNELDDTHPASALRWKSNETKEEFEARFPKALEKLHATL"
     gene            <28081..>30300
                     /gene="FRE4"
                     /locus_tag="KLMA_20008"
                     /db_xref="GeneID:34714494"
     mRNA            <28081..>30300
                     /gene="FRE4"
                     /locus_tag="KLMA_20008"
                     /product="ferric reductase transmembrane component 4"
                     /transcript_id="XM_022822539.1"
                     /db_xref="GeneID:34714494"
     CDS             28081..30300
                     /gene="FRE4"
                     /locus_tag="KLMA_20008"
                     /codon_start=1
                     /product="ferric reductase transmembrane component 4"
                     /protein_id="XP_022674349.1"
                     /db_xref="GeneID:34714494"
                     /translation="MHAKSFFLALLFLTSWCDARKYTFYNKERSVYQGCLDSLRAYTF
                     SDDGPATRSRSTNCNPNKDRFLSWVICNFDHQSPKDLDKGLERIVSTCKRSKPPYRHT
                     VKGLHELYEKSHSSAIDIDSDPSFNPHVNLTTPVIPPRKRVNLLIRAYYSRGKSQSHA
                     RLYGGAIFIYFAGCMLIGGIVTWSRILFPSVVQRFVGPKINAFRRMFTIPPLNKRHTA
                     NLSWKNWIIGLVPTRAQTYVLFGYFALNIILSCIDYDIFPNNSYNTRAKHQVATQTAN
                     LVQYRTGVISTIHTPVVFLLSGRNNLLLYLTGWPYETFLVYHKWIARGMWIHALVHAA
                     AYTWLEIDDLSRMWQRQYWYWGSISVIVGGLMLFQAASYFRVKWYEIFKTIHFLFSAL
                     YIAGLWYHLRIFNGLWMEYVYAAIGLWCGDHFLRICRVLWFGVFKRAECQLFEEDGTI
                     KIKIPKTSYWKPFPGAFVYIYFLRPYGFWQSHPFTILFHDKDANDDNIYIYMKAKEGL
                     TKSLAKSLAKTCEKKMSIRVFVEGPYGFEAPLTKYKNRLIITGGNGMPTGYSNYCALT
                     RSITPSSPETVKWVWIIRDQEPLKWFRKELLRVQDRLGEIDVYITRLDSKDHVIPVSS
                     NELADSSDQENVSSDKKVIVSSNETTQENSSDTDTTDTADTLCLFKELKHVNIYYGRP
                     DIQTLLISEIQNNSNNSTAILSCGPPKMNDEIRTTIAKNLDMSSSRIDYFEEAQVWS"
     gene            <31334..>32164
                     /gene="ADY2"
                     /locus_tag="KLMA_20009"
                     /db_xref="GeneID:34714495"
     mRNA            <31334..>32164
                     /gene="ADY2"
                     /locus_tag="KLMA_20009"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822540.1"
                     /db_xref="GeneID:34714495"
     CDS             31334..32164
                     /gene="ADY2"
                     /locus_tag="KLMA_20009"
                     /note="accumulation of dyads protein 2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674350.1"
                     /db_xref="GeneID:34714495"
                     /translation="MTDQSSSEKTNRQEFVENRHRRFDSQDPALYHDDIELQRVETGG
                     ENHEFIFIGRQKFLKDELYSAFGGTLNPGLAPPSTHKFANPAPLGLSAFALTTFVLSM
                     FNAQAMGIKIPNVVVGLAAFYGGLVQIIAGIWEIALENTFGGTALSSFGGFWLSFSTL
                     YIPWFGISKAYEEFPDQFHSAVGFFLLGWTIFTAGLTLCTMKSTVAFFSLFFLLTITF
                     LLLSIGSFTQKTGVTRAGGVLGVVVAFIAWYDAFAGVATRENSYITVRPFALPRLKGH
                     "
     gene            complement(<32502..>32984)
                     /locus_tag="KLMA_20010"
                     /db_xref="GeneID:34714496"
     mRNA            complement(<32502..>32984)
                     /locus_tag="KLMA_20010"
                     /product="protein crtK"
                     /transcript_id="XM_022822541.1"
                     /db_xref="GeneID:34714496"
     CDS             complement(32502..32984)
                     /locus_tag="KLMA_20010"
                     /codon_start=1
                     /product="protein crtK"
                     /protein_id="XP_022674351.1"
                     /db_xref="GeneID:34714496"
                     /translation="MSGIITTIFKILLSVIVTVVLGLSSGLVTRSSINTWYPTLHKPW
                     FNPPNWLFPVAWTILYILMGIAAGLVWSDIHTDPEAKPALKFYIAQLVLNMLWSFIFF
                     GCQSPGLALSEIITLWIAIYITRHQFQQVSGLAGLLFLPYLLWVSYALLLNAAIWWLN
                     "
     gene            <33984..>35753
                     /gene="MNT4"
                     /locus_tag="KLMA_20011"
                     /db_xref="GeneID:34714497"
     mRNA            <33984..>35753
                     /gene="MNT4"
                     /locus_tag="KLMA_20011"
                     /product="probable alpha-1"
                     /transcript_id="XM_022822542.1"
                     /db_xref="GeneID:34714497"
     CDS             33984..35753
                     /gene="MNT4"
                     /locus_tag="KLMA_20011"
                     /codon_start=1
                     /product="probable alpha-1"
                     /protein_id="XP_022674352.1"
                     /db_xref="GeneID:34714497"
                     /translation="MSFAHLAGVRFRNVKRLLVSLSILCTLSYLISVMSYNSESRLSE
                     YILDELYKRYTDSRLEAGFPDREIICKEYFGFLHTVHSDWKIRSFDNQQSLLSKNVEV
                     KESIRHLRMYTQCFLNMDYSIDDINLPATEDRLFPFLTMDLPTFTRWDGSIVREFPCL
                     DDSLNACSNTVSADEENQYRSFWGNIKNSMNGKGLVISIANIGVDETKRLLKTLRLLG
                     NQLPIQLVHKGDLHYILMAELVAVARNDLIIEIDGKLQSIGYPQDIWFVNTEPCLKPE
                     ALKLFKRYSNKWLAAMFNSFEEMILLDTDTVLFVDPIHMFETPEYSESGTHFFRDRPI
                     AEFVKKSDVTLYRQLLPSLKERSLLGIPSTSKYTLQNPFFKSQRKHMMESGLVVINRK
                     QYLDGLLISTFLQLWEETSSPFHGDKELFWLGQAISGKGRYKFNKNVAGAIGILRKDE
                     KEGTEYICSTQIAHFNDEYKLLWINGGLKNCKLPAWNYDFKKKKAIRKKYNSVENVKK
                     HYQLPVVFDGAIIPPDYSNKSYHKTTEEKLKNGFLRDVNLGCAGYTWCAYNSLDSPEG
                     KVLRFDETESQKIKNIIEVWNSK"
     gene            complement(<35950..>37560)
                     /gene="yciC"
                     /locus_tag="KLMA_20012"
                     /db_xref="GeneID:34714498"
     mRNA            complement(<35950..>37560)
                     /gene="yciC"
                     /locus_tag="KLMA_20012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822543.1"
                     /db_xref="GeneID:34714498"
     CDS             complement(35950..37560)
                     /gene="yciC"
                     /locus_tag="KLMA_20012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674353.1"
                     /db_xref="GeneID:34714498"
                     /translation="MPSLKSAHSLPKRSTAIPVTILSGFLGSGKTTLLEKILTSNHGM
                     KVAVIINDMSELNVDASLIRDHKVANKEEKLIQLQNGCICCTLRGDLLEELINLHQQG
                     GFDYIVIESTGIAEPMQVAETFSSEFSNTLLDTPDSVTAEERVLLQKVLDLGGLEKLT
                     KIDTTVTVIDAMNFFSNLETTDFLANRWGDSGQGESDRTVTDLMVDQIEFADVIIINK
                     TDRIGKKKLKRIEKVVKSLNPIAKIIKTSYCNVPMSEILNTGLFDFEKACSSAGWLQS
                     IHEMTLKEGYGTKGGSVLSPTPETVEYGINSFVYRSRRPFHPQRLYDTMKEKFFIIEQ
                     QAMADQEHEDLYEPSDDETPEEEQVNSEDETESVDEDNNSETNDDEEELSEKELIQNK
                     NNSPFGPLLRSKGFFWLATRYLMRGEWSSAGLMLTVKGGIPWFAVTGLDDQNQEEFPP
                     GTIELIKKDFVGPFGDRRNELVFIGLGLDSKKLTEALDKCLLTDDEFKEFKNRALKHS
                     NPVKVEQSLSELFLDGFEDWVLFDDEAE"
     gene            <40549..>42231
                     /locus_tag="KLMA_20013"
                     /db_xref="GeneID:34714499"
     mRNA            <40549..>42231
                     /locus_tag="KLMA_20013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822544.1"
                     /db_xref="GeneID:34714499"
     CDS             40549..42231
                     /locus_tag="KLMA_20013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674354.1"
                     /db_xref="GeneID:34714499"
                     /translation="MTNILRTFSLSSGGGISPIPRAGSTSGPSSPLYSGPHPSVSLPK
                     LQSPKNAINTQASTQRIYYNVIQDYFPIDNENQWRPTDTLSPLNVNKGDIVQFICTHE
                     NNTVVVKLLNKLGQGLVPLRCLSLNAELTTLSSPSISSPKTPKALKFEAVSEEPGALK
                     QQDSRCSSVSSVTDTNYFLVKSCKVVSTSTLNERTWYRVETTTLSDHKRYLCRYYQDF
                     YRLQCQLLDEIHKLSLDSKLLPTLPPPMANKKSKRAESLSDRLNSFTEYLESLLNSEA
                     IPLATKQAILYDQWLCPKSGDLVQTPRGSLYRCIRSSNTDKEELQWSKIQATDSTDTQ
                     EHIAKVLCPDANSHNRSLSICTKSSLASPSSPKLSQPQFHTGNSQPSSPILSQRSQCL
                     FNANANANAGAGLGLGLGLGFGPNKDTIKLKITFGNDCYVVKCHICDIETWEKLENLI
                     HTRLIKDIPDPLCPLTIRMKSSSSYDGLLPLDSTNFDIDNIIYMAQEQQSPNANSNAG
                     FNPHYVLGKPHAQYNITAPSSSRSSSVSSSGNVSNSPKSKRQSLKLTLEVSV"
     gene            complement(<42436..>42777)
                     /locus_tag="KLMA_20014"
                     /db_xref="GeneID:34714500"
     mRNA            complement(<42436..>42777)
                     /locus_tag="KLMA_20014"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822545.1"
                     /db_xref="GeneID:34714500"
     CDS             complement(42436..42777)
                     /locus_tag="KLMA_20014"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674355.1"
                     /db_xref="GeneID:34714500"
                     /translation="MAYNSEDSSDEESITHPTQVYQRIYEKEADDHFQERMELERESE
                     KLDQEYQELISKYGGEPGPESTAKMDELDERMQDISERLDEANERWINSYSVAMYYKD
                     KERRDLEEDSD"
     gene            <43112..>43867
                     /gene="YUH1"
                     /locus_tag="KLMA_20015"
                     /db_xref="GeneID:34714501"
     mRNA            <43112..>43867
                     /gene="YUH1"
                     /locus_tag="KLMA_20015"
                     /product="ubiquitin carboxyl-terminal hydrolase YUH1"
                     /transcript_id="XM_022822546.1"
                     /db_xref="GeneID:34714501"
     CDS             43112..43867
                     /gene="YUH1"
                     /locus_tag="KLMA_20015"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase YUH1"
                     /protein_id="XP_022674356.1"
                     /db_xref="GeneID:34714501"
                     /translation="MSEQEVKSVIPLESNPEVFGGFAKSLGLHDAWTFQDIYSLVDPD
                     LLAFVPRPVKAVILLFPLSEESEKELREKPEAEAVIQDPSNSTNKNYPIWFKQTVRNA
                     CGLYALLHSLSNNQDLLTEDSILKQFLTSNPVPHGKYSNNEALDNFIVSISEIYHERS
                     LQGDTAAPPAENEVELHFITFVEKDGVLYELDGRNPSGAKPLGKTVAAESNGEPDLLN
                     EPLLKERFEWYHNNASESMKLQFSLLGLGPSLN"
     gene            complement(<43907..>45814)
                     /gene="THP3"
                     /locus_tag="KLMA_20016"
                     /db_xref="GeneID:34714502"
     mRNA            complement(<43907..>45814)
                     /gene="THP3"
                     /locus_tag="KLMA_20016"
                     /product="PCI super family"
                     /transcript_id="XM_022822547.1"
                     /db_xref="GeneID:34714502"
     CDS             complement(43907..45814)
                     /gene="THP3"
                     /locus_tag="KLMA_20016"
                     /codon_start=1
                     /product="PCI super family"
                     /protein_id="XP_022674357.1"
                     /db_xref="GeneID:34714502"
                     /translation="MKRDTMNTYNQVNPITLKRRPEKNSKESTVVDSTPLISDNDSEN
                     SGTSLPELRAKLKRERAQALQNGIANEKTNTENGKEDTYTPDFDRLLNPLGGMIKQPL
                     PASFYRFVDKEFKAAKVQRLTTKRIKGLYRDIRLLLKEAISKSLVFKNDWDQQLLTSV
                     FREQPLLSPVEEKLDCLLTQEQKKVILDTIPYEKYGIEPPNVTRSTPLSNDTNLYEIN
                     DPTSIVTVEAPSAVPPPPPPISARPPPPWAQNVLQPNRTTTLKVPLPPVSSVPPPAIV
                     PSFTKTVTTSEPTGYNDSRNNNSMSKMQARMDENTRRMERLKRFANPDKSTNTRIKRV
                     KIDDDDSYSDLNAITNKAYKFDKDKPIVGVCHVLEKRYLRLTSEPDPEKVRPLEVLRK
                     ALDWIVGKFRSGSCSYQYFCDQMKSIRQDLKVQMIENDFTVTVYKTHARAALENGDIG
                     EYNQCQSSLKPLFDKDNIDKSDLPEFISYRIYYHMMTSDHSSVNQLRLQLLTNLKHIS
                     GHEMIKRALRMVDAQIQNNYHLFMRIYQQTKGPERHLVDQFIKKERVSALNYMCKAYA
                     RVPLQFLAPELHFNNANEAFTFLTELELIQFMVVPQNNPDDMYIDCKSCRPTIMKHFS
                     DARRVDIKGQI"
     gene            complement(<46201..>47139)
                     /gene="uch2"
                     /locus_tag="KLMA_20017"
                     /db_xref="GeneID:34714503"
     mRNA            complement(<46201..>47139)
                     /gene="uch2"
                     /locus_tag="KLMA_20017"
                     /product="ubiquitin carboxyl-terminal hydrolase isozyme
                     L5"
                     /transcript_id="XM_022822549.1"
                     /db_xref="GeneID:34714503"
     CDS             complement(46201..47139)
                     /gene="uch2"
                     /locus_tag="KLMA_20017"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase isozyme
                     L5"
                     /protein_id="XP_022674358.1"
                     /db_xref="GeneID:34714503"
                     /translation="MSEWNTIESDAGVFTRLITDLGVEGLQFEDIPYLDYLESEDISS
                     ILEGLVFLFPYKKSLYQNPEPVQGRYETDSTKVFFSQQTIQNACATQAVLNILFNLCQ
                     DKKEKVHLGPELSQFYEFVKDFHEPALIGETINGSELIRNVHNSFTPPNLFVMDEDPY
                     RNRGQSQEVYHFVGFIPHESRIYELDGLQPYPIDHGPYTDFAKDVKTLLQERMDILVQ
                     QGVQKFNIIGLILDRLQYLQTELEKDDIPDGKRFVLSEQLQEELNKREKWKEEITFRK
                     HNLTGLALELLKQISSSMSENEFESVLREASMKPSN"
     gene            complement(<47348..>48262)
                     /gene="AIM25"
                     /locus_tag="KLMA_20018"
                     /db_xref="GeneID:34714504"
     mRNA            complement(<47348..>48262)
                     /gene="AIM25"
                     /locus_tag="KLMA_20018"
                     /product="altered inheritance rate of mitochondria protein
                     25"
                     /transcript_id="XM_022822550.1"
                     /db_xref="GeneID:34714504"
     CDS             complement(47348..48262)
                     /gene="AIM25"
                     /locus_tag="KLMA_20018"
                     /codon_start=1
                     /product="altered inheritance rate of mitochondria protein
                     25"
                     /protein_id="XP_022674359.1"
                     /db_xref="GeneID:34714504"
                     /translation="MMLRHNLLLGRRLFNTKTSTLLLQNSPVRRFPRVRVVHPVKESI
                     TSSPVGMGSMNDVIIEEHSPIATTILNEPTIVIERQIEMMNVVLGFEQANQYAIMDAL
                     GNKIGFMQERDFGFFKAVTRQIYRLHRPFTVDVFDNFGNILMTIRRPFSFVNSHIKAV
                     LPDENGTIVGESVQNWHLWRRRYQLFQREYENPLEFTQFGNIDAPFLSFEFPVTDENN
                     KIIASCDRNWVGIGRELFTDTGVYIVRFDSQQSFQGVYPDEFISDKVLNYDQRAVMLA
                     NAVSIDFDYFSRHSRHGGGLLSFGTYDE"
     gene            complement(<48775..>49701)
                     /gene="PPH3"
                     /locus_tag="KLMA_20019"
                     /db_xref="GeneID:34714505"
     mRNA            complement(<48775..>49701)
                     /gene="PPH3"
                     /locus_tag="KLMA_20019"
                     /product="serine/threonine-protein phosphatase 4 catalytic
                     subunit"
                     /transcript_id="XM_022822551.1"
                     /db_xref="GeneID:34714505"
     CDS             complement(48775..49701)
                     /gene="PPH3"
                     /locus_tag="KLMA_20019"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 4 catalytic
                     subunit"
                     /protein_id="XP_022674360.1"
                     /db_xref="GeneID:34714505"
                     /translation="MMKLDDFIETLRQGKHIDEDSIYSLCLMAQELLMNESNVTHVDT
                     PVTICGDIHGQLHDLLTLFAKSGGIEKNRYIFLGDFVDRGFYSLESFLLLVCYKLRYP
                     DRIVLIRGNHETRQITKVYGFYDEVVRKYGNSNVWRYCCEVFDYLPLGAIVNNKVFCV
                     HGGLSPDVLEINEIRAIDRKKEVPHEGAMCDLLWSDPEDVDTWSLSPRGAGFLFGHNE
                     VNKFLHTNNVELIARAHQLVMEGYKEMFDGGLVTVWSAPNYCYRCGNVAAVLRIDDNI
                     EKEYTIFEAVRARDSGGNVILPTKKPQMDYFL"
     gene            <50421..>51503
                     /locus_tag="KLMA_20020"
                     /db_xref="GeneID:34714506"
     mRNA            <50421..>51503
                     /locus_tag="KLMA_20020"
                     /product="protein PEA2"
                     /transcript_id="XM_022822552.1"
                     /db_xref="GeneID:34714506"
     CDS             50421..51503
                     /locus_tag="KLMA_20020"
                     /codon_start=1
                     /product="protein PEA2"
                     /protein_id="XP_022674361.1"
                     /db_xref="GeneID:34714506"
                     /translation="MFNSNLDQWYEHNTGFVQKLHSRYPTKKDELVKYLTKSHENHVL
                     SGSNYNEWKDLPMDLDSQLKLEFALYLINERLQSSGINRLKASVFLQKMGNADSDALK
                     ELVHLVVENGTPRAAQSATDGDDKVEQITSYLISSAISKGINLAPVEDTSNIASSDDD
                     ELAFCKKTISNLINAFPESSSSKKDESAPQTVDVKSSPDTSTFETDTKDMPTKEEDLK
                     TAIKDLQLAYKFLKSQYENDRTEYLSTIENLNKTNRELSEELLHYHSKLKESKEKPKA
                     VAKTKPESLELHGSFSPIFSDFQDIKSPGSSSNNHQSFSMMKQEFKRVLADTQQRYEK
                     ELQQERELRMQLEQELEQHTADRSIY"
     gene            complement(<51843..>52544)
                     /gene="SPT15"
                     /locus_tag="KLMA_20021"
                     /db_xref="GeneID:34714507"
     mRNA            complement(<51843..>52544)
                     /gene="SPT15"
                     /locus_tag="KLMA_20021"
                     /product="TATA-box-binding protein"
                     /transcript_id="XM_022822553.1"
                     /db_xref="GeneID:34714507"
     CDS             complement(51843..52544)
                     /gene="SPT15"
                     /locus_tag="KLMA_20021"
                     /codon_start=1
                     /product="TATA-box-binding protein"
                     /protein_id="XP_022674362.1"
                     /db_xref="GeneID:34714507"
                     /translation="MSEDDRMKQFQQENKIVFDPSTRSVWESQEKREHESLPGTDANA
                     DEGEKGSATSGIIPTLQNIVATVNLDCRLDLKTVALHARNAEYNPKRFAAVIMRIREP
                     KTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFSAKFTDFKIQNIVGSCDVK
                     FPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQ
                     AFEAIYPVLSEFRKL"
     gene            <53025..>54986
                     /gene="SCC4"
                     /locus_tag="KLMA_20022"
                     /db_xref="GeneID:34714508"
     mRNA            <53025..>54986
                     /gene="SCC4"
                     /locus_tag="KLMA_20022"
                     /product="sister chromatid cohesion protein 4"
                     /transcript_id="XM_022822554.1"
                     /db_xref="GeneID:34714508"
     CDS             53025..54986
                     /gene="SCC4"
                     /locus_tag="KLMA_20022"
                     /codon_start=1
                     /product="sister chromatid cohesion protein 4"
                     /protein_id="XP_022674363.1"
                     /db_xref="GeneID:34714508"
                     /translation="MDDFKDELLNVPVAFDQKSLGKRSQELGLIYHLSKQYALTAHDV
                     ASEVQTESELRQYFTLINQAIRCLRYLKDGGFQLSLEQDFQITCDLAWLLIEETHRLD
                     LAEQYLSSLREKLQNTTWINEKMYTDYLLLCKIPLMKNDGAQSKVIVKNLGKLISSLD
                     SSLWKVLFEYFRLQLIPIKERKVSDYRNIIYVVKPHKQFHFVVMCSFINYCLDSCSHI
                     PDDLWSDFEKLESDIPKLQIWKFLLELLVLIVQDINITDKLSEMKLFFDANKEKLDNP
                     LEPIVLFESISLKLDLPVFGYSDVKNLLLFFQSVSYLPNCYDKRSNFSIKFLPKTAAN
                     TEKLIQSLQEKCSLTKLNTIHKFYHTLLELVKFYQACESIILKGTVSDISIGAPYCHL
                     LSAWECHLRGDTESASNIYLKILEEPSQNPEMILISIIHLYALTLAQISECEKGSPDL
                     ASLTEKADILLNQLNSVLESSIFNRSTVWKCTKLLLTIMGKFEPFTQNPQASTNTSVL
                     LNELQQYFEGNSLLGPNDSTEGNGTGTNTEAVTDTMTGKEIHVSNTPVKIKKSLLLHI
                     WLNYISGSMLVNELDKKCILSSTCFKLAKQQYLPYLRYLVGIWNLMNNTIAMNSKEVA
                     LTRARLNQIVRSICETATVEQQQETEEQI"
     gene            complement(<55257..>57908)
                     /gene="TPS2"
                     /locus_tag="KLMA_20023"
                     /db_xref="GeneID:34714509"
     mRNA            complement(<55257..>57908)
                     /gene="TPS2"
                     /locus_tag="KLMA_20023"
                     /product="trehalose-phosphatase"
                     /transcript_id="XM_022822555.1"
                     /db_xref="GeneID:34714509"
     CDS             complement(55257..57908)
                     /gene="TPS2"
                     /locus_tag="KLMA_20023"
                     /codon_start=1
                     /product="trehalose-phosphatase"
                     /protein_id="XP_022674364.1"
                     /db_xref="GeneID:34714509"
                     /translation="MENSSASKPAEKKKNKIISCITQLPFKIEKVVDDDTEGIDASCW
                     SIEAISGNSALQSSLQYLNECGKWDHHIVGWTGEIMNSNEDLDSPMYLTQEEKKVLAT
                     LLQGKEAQDSVRTVHPVWLLRKDQYRWRQFAENVIWPALHYILNPPDDGKMENIWWYD
                     YVKFNEAYAMKVAQIYEPGDIIWVHDYYLMLLPQLLRMRFNNATIAYFHDTPWPSNEY
                     FRCLSKRKQFLDGLLGANRICFQNDGFSRHFVSSCQRLLGCTVKKGSNSNSNNSDEYR
                     ITSYGGDVLVDSLPIGVDTQKILKEAFSPELDEKVNSIRKAYEGKKVIIGRDRLDTVR
                     GVLQKLQAFQVFLAMYPEWREKVVLIQVSGPTAPTDVNIKLESQVNELVTQINSEYGN
                     LNYNPVQHYHLRIPQDVYYSLLRVADICLITSVRDGMNTTALEFVTVKSQLSKYNCYA
                     SPLILSEFSGASTILKDAIIINPWDAVAVSKAINEALKLSPEMKKSLELKLWKEVPTI
                     QDWTESFLKTVIDFTSGQSGNERITPALNRPLLLQRYKKANRRLFLFDYDGTLTPIVT
                     DPAAAIPSARLYSIITKLAQDPKNKIWIISGRDQKFLNRYFGTKLPQIGLSAEHGCFM
                     KDAGSEEWVNLTSKFDMSWQEKVGQLMEEYTNKTPGSSIERKKVALTWHYRRADPELG
                     EFHANALKKALEEFTEGMGLEVMEGKANIEVRPSFVNKGEIVKRLAWTPHGAKQVIED
                     KFTLNDDVLSEELPEFILCLGDDVTDEDMFRHLIQIEKQWEKKYPETSSSLGFGIYPV
                     TVGSASKKTIAKAHLTDPQQVLDTLGLLVGDVSLFQSAGTVDLDDRGHLKDSESSLRS
                     EQASAAYAMKRSTSSGSNIKKVSSRTN"
     gene            <60203..>61837
                     /gene="IPT1"
                     /locus_tag="KLMA_20024"
                     /db_xref="GeneID:34714510"
     mRNA            <60203..>61837
                     /gene="IPT1"
                     /locus_tag="KLMA_20024"
                     /product="inositolphosphotransferase 1"
                     /transcript_id="XM_022822556.1"
                     /db_xref="GeneID:34714510"
     CDS             60203..61837
                     /gene="IPT1"
                     /locus_tag="KLMA_20024"
                     /codon_start=1
                     /product="inositolphosphotransferase 1"
                     /protein_id="XP_022674365.1"
                     /db_xref="GeneID:34714510"
                     /translation="MGAIAAFECVWWFLKRVYLGGTNQRNVFTLALNFCVNFSPVFLW
                     LFMFKNAGVIPNSWRPHIWGSLAYYLDNYMFGDFWHSLDSETQFWFSLFTSSVVCVVC
                     IGLPLLAWYYIYFRKRAKFNVFDDTDCLTQNPLNGVARVQFSPSRLRILLAFAFPAFM
                     FLVLNIDNLLASQDEKNFTRFKDILAWVLYVILHLTAPILTGVYLYVFHAPGTLKCFS
                     FALGLQNIAGLCTHMLLPMAPPWFVHMYGAHDKEHLNYQQQGYAAGLTRVDMHLGTHL
                     NSNGFHLSPIVFGAVPSLHSAIAVQCFFFLMFRSTFTKSVPESISHGNGIDNDDENTT
                     TTTNNNDDDDEYYYQPQGPLTKSTQGTPEGTPESQELTPSGTPAIIPFEFEEDEDVDQ
                     DKFGTLGSFRAYDSDDMERLISSDSDSEVSPENLVQALAAQQKLPLHILQSKWLYVFH
                     KGWVPKFLGTVFVCMQWWSTQYLDHHFRFDLFVGAIYASISYIVINKYVLQPKVIKPW
                     LLVRADPSKDTKNESRTMGMRVFAGTSAEWFFDPLK"
     gene            complement(<62046..>62315)
                     /gene="LSM5"
                     /locus_tag="KLMA_20025"
                     /db_xref="GeneID:34714511"
     mRNA            complement(<62046..>62315)
                     /gene="LSM5"
                     /locus_tag="KLMA_20025"
                     /product="U6 snRNA-associated Sm-like protein LSm5"
                     /transcript_id="XM_022822557.1"
                     /db_xref="GeneID:34714511"
     CDS             complement(62046..62315)
                     /gene="LSM5"
                     /locus_tag="KLMA_20025"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm5"
                     /protein_id="XP_022674366.1"
                     /db_xref="GeneID:34714511"
                     /translation="MATVSEILPLEVIDKTIGQEVSILLKDYREFLGTLVGFDDYVNV
                     VLENAVEYVNDKEIKRFQGKMLLTGNNIAMLIPGGKPGLSKQEST"
     gene            <63205..>63789
                     /gene="PAA1"
                     /locus_tag="KLMA_20026"
                     /db_xref="GeneID:34714512"
     mRNA            <63205..>63789
                     /gene="PAA1"
                     /locus_tag="KLMA_20026"
                     /product="polyamine N-acetyltransferase 1"
                     /transcript_id="XM_022822558.1"
                     /db_xref="GeneID:34714512"
     CDS             63205..63789
                     /gene="PAA1"
                     /locus_tag="KLMA_20026"
                     /codon_start=1
                     /product="polyamine N-acetyltransferase 1"
                     /protein_id="XP_022674367.1"
                     /db_xref="GeneID:34714512"
                     /translation="MSSSSLPLHMYIRPLTIEDCDASVALESQGFPPEERAGKEKIEF
                     RLKECPELTSGLFIREVKGTQILGEKLIGHILGTKLPIPKNGTKETTFITNESMAFTH
                     DDASPVIAVHSVVIDPQHQKKNLATLLLTDYIQKMSNQEIGDQIVIIAHKELVPFYER
                     IGFKLVGENKSVTSKDGKVWCDMVRELVKEEYET"
     gene            <64464..>64733
                     /locus_tag="KLMA_20027"
                     /db_xref="GeneID:34714513"
     mRNA            <64464..>64733
                     /locus_tag="KLMA_20027"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822560.1"
                     /db_xref="GeneID:34714513"
     CDS             64464..64733
                     /locus_tag="KLMA_20027"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674368.1"
                     /db_xref="GeneID:34714513"
                     /translation="MLSFSKTIQSPVLSKTFARGFSSSVLVRTKHASKDPEQRMFDRN
                     KKKLEKLEREGHELEKDLKRPGVSSLKKKGERAQIEQGRPDDGVY"
     gene            <65330..>67729
                     /gene="DOA4"
                     /locus_tag="KLMA_20028"
                     /db_xref="GeneID:34714514"
     mRNA            <65330..>67729
                     /gene="DOA4"
                     /locus_tag="KLMA_20028"
                     /product="ubiquitin carboxyl-terminal hydrolase 4"
                     /transcript_id="XM_022822561.1"
                     /db_xref="GeneID:34714514"
     CDS             65330..67729
                     /gene="DOA4"
                     /locus_tag="KLMA_20028"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 4"
                     /protein_id="XP_022674369.1"
                     /db_xref="GeneID:34714514"
                     /translation="MMQNNSDLYCKSLSQLSAVASKIVAEDVEGEDLKQLLAKCIDTL
                     TIYKRDMKKLGCVTSKTPVEQIYELYETLYVYYKIVSQIASQVIPSLPEFQKIKQSVK
                     KDSNERELLEIYSQLVSALANDKKIGEVKRFIKTHGEEVSQSVTLPTYQNGDLISISQ
                     LHSLIRQPHNNQQQHSSLYDFLLIDIRPRRDFNNGHISCDNIVCIEPISFKETYTDSD
                     IQRKSLITATDRELDLFKCRDKFKLIILYTDTDERTKYYWHQLQVLQNILLSRSFDQP
                     LEGTKVVVLQNGFNAWKAKFPNDISIIKETISMPPVENTENLFPPFVSMPPYPKKQSV
                     SNSTSRAASPSHSLTHYPDAPFLNNSKAPMKTYGLTPNHPLPSTSNLTKALQQNGMGN
                     NNYGYDNKSQYVNGNMNGKKEHMATNNSDTVQSQAKLNLDFTIGLINLGNSCYLNCII
                     QCLLGCHELSYIFLTNSYKKHVNVNSRLGSKGLLANYFSQLVQKMYQQGKLLAYNNTN
                     VEITAVQPAQFKLACGSVNSLFKGKQQQDCQEFCQFLLDSLHEDLNQCGNNPPLKELS
                     PEAEKMRETMPLRIASAIEWERYLTTDFSIIVDLFQGQYASQLKCNACGRTSTTYQAF
                     SVLSIPVPRSGTCTIYDSFKEFTKLETLEKDELWNCPSCKKRQPSTKQIIITRLPNNL
                     IIHLKRFDNMMNKNNVFVNYPEELDLTSYWVDDYRGEMPKDNGVSLPLRGQKPPFNYK
                     LFAVACHSGTLYGGHYTSYVDKGTLGWCCFDDENWRKIRRKGEYITPNAYVLFYRRIN
                     V"
     gene            complement(<67794..>68684)
                     /gene="DOS2"
                     /locus_tag="KLMA_20029"
                     /db_xref="GeneID:34714515"
     mRNA            complement(<67794..>68684)
                     /gene="DOS2"
                     /locus_tag="KLMA_20029"
                     /product="protein DOS2"
                     /transcript_id="XM_022822562.1"
                     /db_xref="GeneID:34714515"
     CDS             complement(67794..68684)
                     /gene="DOS2"
                     /locus_tag="KLMA_20029"
                     /codon_start=1
                     /product="protein DOS2"
                     /protein_id="XP_022674370.1"
                     /db_xref="GeneID:34714515"
                     /translation="MDILCEETGVEAADGIKVTKHDDKTDETFQKFEEQVDQHLQKTS
                     KAIMGFIQDKNGLNIQIPENLGDTVSSRAQEMLGKLDNNLEKVEELTQGYWNKMSNKS
                     FWSSMANSISTQFQEALDLDGNAQKKESESSSESIAETKLRQLSIDKSIYLDFNTDLL
                     KGVDGNDATPKLEEKSAEISDLLSKDKDLKSLHDDLVPSKITDDIFWTIYFVKKSEIL
                     NLASKKREILDVKKEHDKEQQIGWDDEEEDSTEEIIPSSHSKVKSSSVEKDSDKNTTS
                     SNLSKTDNAEEEDDDDDDWE"
     gene            <68987..>69679
                     /gene="OCA6"
                     /locus_tag="KLMA_20030"
                     /db_xref="GeneID:34714516"
     mRNA            <68987..>69679
                     /gene="OCA6"
                     /locus_tag="KLMA_20030"
                     /product="putative tyrosine-protein phosphatase OCA6"
                     /transcript_id="XM_022822563.1"
                     /db_xref="GeneID:34714516"
     CDS             68987..69679
                     /gene="OCA6"
                     /locus_tag="KLMA_20030"
                     /codon_start=1
                     /product="putative tyrosine-protein phosphatase OCA6"
                     /protein_id="XP_022674371.1"
                     /db_xref="GeneID:34714516"
                     /translation="MSLVTPLQFSCVQPKFYRGAYPKEINLPFLKTLRLKYIISLLAE
                     PITNDPVIAEFCEKEKIEPVLMQCLDDKSKSKDKDKSKDKDKSKVKRKKKPVPIEYDV
                     VVECIKFLIDKNHYPCYIHCSTSNTEVTSLVVACLRKLSYWSTVSIFNEYMTYTSSIN
                     IHERNFIENFNLDINIEGIKPSDKVSWIIVRSKQHSEKRAQSKQSSTNSEGPPQLNPP
                     KMPLPTLTFHND"
     gene            complement(<69761..>71020)
                     /gene="DDI1"
                     /locus_tag="KLMA_20031"
                     /db_xref="GeneID:34714517"
     mRNA            complement(<69761..>71020)
                     /gene="DDI1"
                     /locus_tag="KLMA_20031"
                     /product="DNA damage-inducible protein 1"
                     /transcript_id="XM_022822564.1"
                     /db_xref="GeneID:34714517"
     CDS             complement(69761..71020)
                     /gene="DDI1"
                     /locus_tag="KLMA_20031"
                     /codon_start=1
                     /product="DNA damage-inducible protein 1"
                     /protein_id="XP_022674372.1"
                     /db_xref="GeneID:34714517"
                     /translation="MNITITYDNSDDVLGPFELSKDMSLMDLFALIDFNKDKQTIFHN
                     MKELDLSDTNLTLEQVGFQDNDMLLIKNKSFSTPTQESGMSDEQYIEQFRLFLLENPH
                     MGQEMGLPNMQPLINNKEQFHQLLGPALLARRSETERNNPFGISNSEYTRLMSNPDDP
                     ANQAKIAELINQREIDEQLKYAMEYTPEAFTQVSMLYIKLEINGHPVKAFVDSGAQQT
                     IMSTKLAERTGLTSLIDKRFSGIAQGVGTGKILGRVHTTQIKIHDVFLPCSFTVLDTP
                     MEMLLGLDMLRRHQACIDLKNNVLKISDVETPFLPESEIPKDSPLQAMTTPAADEVRN
                     AALKRQAQNSASKTSNAEGDQSTSKLPKVSPTVTNASGTPINPSKEFPEEHIKQLVDL
                     GFSRREAIDALEKTGGNVDYAASLLFQ"
     gene            <71220..>72059
                     /gene="MAG1"
                     /locus_tag="KLMA_20032"
                     /db_xref="GeneID:34714518"
     mRNA            <71220..>72059
                     /gene="MAG1"
                     /locus_tag="KLMA_20032"
                     /product="DNA-3-methyladenine glycosylase"
                     /transcript_id="XM_022822565.1"
                     /db_xref="GeneID:34714518"
     CDS             71220..72059
                     /gene="MAG1"
                     /locus_tag="KLMA_20032"
                     /codon_start=1
                     /product="DNA-3-methyladenine glycosylase"
                     /protein_id="XP_022674373.1"
                     /db_xref="GeneID:34714518"
                     /translation="MKRSRDNDDEGIVLADSYLEQHTDEFKVGIEHILKVDPSLKGII
                     EHSLFTMFAKTNVVEGSMKLYFDKLCSSIIAQQISGIAAKNIRGRIVDMFGNDGKFPS
                     YQRLHKTFKDPVEKQALKDCGLSQRKLSYIESLVEYFYKEESSIEELFKNGDDEHIIE
                     ELVTHIKGIGPWSAKMFLITALRRMDIFAPEDLGIARGCSKYLEERPDILVKLQSKRT
                     RIRKSKIKHKSFKWKIHDEDIIDLCGDLFMPYRTLFMFILWRMSDTNMDVVIKNEKDF
                     VSR"
     gene            complement(<72219..>73697)
                     /gene="COX15"
                     /locus_tag="KLMA_20033"
                     /db_xref="GeneID:34714519"
     mRNA            complement(<72219..>73697)
                     /gene="COX15"
                     /locus_tag="KLMA_20033"
                     /product="cytochrome c oxidase assembly protein COX15"
                     /transcript_id="XM_022822566.1"
                     /db_xref="GeneID:34714519"
     CDS             complement(72219..73697)
                     /gene="COX15"
                     /locus_tag="KLMA_20033"
                     /codon_start=1
                     /product="cytochrome c oxidase assembly protein COX15"
                     /protein_id="XP_022674374.1"
                     /db_xref="GeneID:34714519"
                     /translation="MFRSVLLRGSGLAAFRGVSRSFTSRSLSNLVRTTKGGPSVGLKR
                     VIPAVNVSRFHTNAILKQSTIASKENGESSDSSAGAKPSRSKPLLNSSKVVGYWLVGT
                     SALVFGIVVLGGLTRLTESGLSITEWKPVAGTLPPLNQKEWEEEFTKYKESPEFKQLN
                     SHITLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSRKTSPRVNKRLFGLAALLG
                     LQGFIGWWMVKSGLDEEQLKERKSKPTVSQYRLTTHLGTAFLLYMGMMWTGLEILREA
                     KWVKKPSEALVLFSKLDNPMLTPLRRSAFGLLALTFVTAMSGGLVAGLDAGLIYNTFP
                     KMGEDWTPSKRELMDENFARKEDKSDLVWRNMLENPATVQLNHRILAITTFFTVFAFH
                     MYCNKNKAIIPKNVVHTGHALMGLVTLQAALGISTLIYLVPIPLASAHQAGALALLTG
                     ALVFASQLRKPRAAIKILTAGLYTQQQKAGSKILSEASKLTK"
     gene            complement(<74037..>77279)
                     /gene="PIM1"
                     /locus_tag="KLMA_20035"
                     /db_xref="GeneID:34714520"
     mRNA            complement(<74037..>77279)
                     /gene="PIM1"
                     /locus_tag="KLMA_20035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822567.1"
                     /db_xref="GeneID:34714520"
     CDS             complement(74037..77279)
                     /gene="PIM1"
                     /locus_tag="KLMA_20035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674375.1"
                     /db_xref="GeneID:34714520"
                     /translation="MFKDESYHWMQYRKQMNDPLARSKLEELESQWLKSIQMKQDDKG
                     KDNGIPEADKRSEIEKDQEKEHDRDSEKPGENEGELTTNKSEEIESQGVAGASSSGSG
                     SGSGSGSGSGSGGSGNGKPGKHSKQPFPEVYPQVMALPISRRPLFPGFYKAVVISDPR
                     VMKAIKEMSDRQQPYIGAFLLKDSNVDTDVIHSMDEVYNVGVFAQVTSAFPSKDEKTG
                     AETMTALLYPHRRIKLDELIPPSSGEEVNDSVSKEGAEGVESQDTKEVDQEVVKASLQ
                     KMDNVREFEEEEEDDDDENLTAFLKKYDVSLVNVSNLADKTFNPNSPVINALTSEILK
                     VFKEISQLNTMFREQIATFSASIQSATTNIFEEPARLADFAAAVSAGEEEELQDILES
                     LDIEQRLEKSLTVLKKELMNAELQNKISKDVETKIQKRQREYYLMEQLKGIKRELGID
                     DGRDKLIESFKERVSKLQLPEQVQKVFDDEVTKLATLETSQSEFGVIRNYLDWITSLP
                     WGITSKEQYSIPKAKKILDEDHYGMKDVKDRILEFIAVGKLLGKVDGKIICFVGPPGV
                     GKTSIGKSIARSLNRQFFRFSVGGMTDVAEIKGHRRTYIGALPGRIIQALKKCQTQNP
                     LILIDEIDKIGHGGIHGDPAAALLELLDPEQNNSFLDNYLDIPIDLSKVLFVCTANSL
                     DTIPRPLLDRMEVIELTGYVADEKVKIAENYLSPSAKKSAGLDNANVNITEDAIVALM
                     KHYCRESGVRSLKKHIEKIYRKAALNVVKQLSIDDKPVEEEEESKNTSAESKTKAASK
                     AKSKSKAKSTSSESTVESTTEENEVIKTEKSRDNETSLEVPESVAVTIDENNLKDYVG
                     PPIFTTDRLYETTPPGVVMGLAWTSMGGCAMYVESVLEQPLLHSSQPSLERTGQLGDV
                     MKESSRLAYSFSKMFLAKRFPENRFFELAKIHLHCPEGATPKDGPSAGVTMASSFLSL
                     ALNRGLDPTVAMTGELTLTGKVLRIGGLREKAVAAKRSGAKTIIFPKDNLSDWAELPD
                     NVKEGLEPLAADWYEDVFQKLFKDVDTNTGNSVWAEEFKKIDEKKAKDSK"
     gene            complement(<77940..>78596)
                     /gene="HAP3"
                     /locus_tag="KLMA_20036"
                     /db_xref="GeneID:34714521"
     mRNA            complement(<77940..>78596)
                     /gene="HAP3"
                     /locus_tag="KLMA_20036"
                     /product="transcriptional activator HAP3"
                     /transcript_id="XM_022822568.1"
                     /db_xref="GeneID:34714521"
     CDS             complement(77940..78596)
                     /gene="HAP3"
                     /locus_tag="KLMA_20036"
                     /codon_start=1
                     /product="transcriptional activator HAP3"
                     /protein_id="XP_022674376.1"
                     /db_xref="GeneID:34714521"
                     /translation="MDTETEAEKQERHNTYLNELAEQDRWLPINNVARLMKNTLPATT
                     KVSKDAKECMQECVSEFISFVTSEACDRCTSGKRKTINGEDILISLHALGFENYAEVL
                     KIYLAKYRQQQAIKNQMMYSRDETAANEHAGNDDMDSGIRGVSGDVDPGQDHVIQETG
                     ASASLGTNSGSEEGAKAQSQAQVQTQNNGPSIAESPVQPNIVVQEPLGSRHSMHGTSL
                     "
     gene            <78875..>80566
                     /gene="RFT1"
                     /locus_tag="KLMA_20037"
                     /db_xref="GeneID:34714522"
     mRNA            <78875..>80566
                     /gene="RFT1"
                     /locus_tag="KLMA_20037"
                     /product="oligosaccharide translocation protein RFT1"
                     /transcript_id="XM_022822569.1"
                     /db_xref="GeneID:34714522"
     CDS             78875..80566
                     /gene="RFT1"
                     /locus_tag="KLMA_20037"
                     /codon_start=1
                     /product="oligosaccharide translocation protein RFT1"
                     /protein_id="XP_022674377.1"
                     /db_xref="GeneID:34714522"
                     /translation="MAVKNDHLNKFASGILFLMLGQTLSKGVNFLLNTLLVRYLSPRI
                     FGITSFLEFLLSTVLFFSRESIRISTLRIKSSTDTGKDEKKEDDAIEISEDVATLQSL
                     INFGYIPFLIGVPLSIILISWQYSNLNSYFVDLPYFKMSIFLIWLSILIELMSEPFYL
                     VHQYLLSHYTRSKYESLGVTFACISNFVIVVWFEKMVNGAGFQLHDNHKQEGIAIFAF
                     SVGKLVHAVTLLICYSYNYYSTSHKNAKGESYSYRLTKVDAGNKHEQYYFQSDTVQHF
                     KKVYFQLCFKHLLTEGDKLIINSLCTVEEQGIYSLLSNYGSLITRLLFAPIEESLRLF
                     LARLLSVRSNKNLRLSMKVLIDLTKFYLYLSLFIIIFGPTNSSFLLKFVIGSKWSSTT
                     FLETIRSYCFYIPFLSLNGIFEAFFQSVASGDQIFKHSYVMMLFSGVFLFNCWLFIEY
                     FDLSLEGLIVSNILNMALRIAYCGNFIFKFYHYLLSESVTNNTQSLKPNLSAFKTVSL
                     VASVIGALDWYFIGYVENIQELLINAVLAVSLLIFVIYKEKGLISELLAAKNYTA"
     gene            <80777..>82267
                     /gene="APN2"
                     /locus_tag="KLMA_20038"
                     /db_xref="GeneID:34714523"
     mRNA            <80777..>82267
                     /gene="APN2"
                     /locus_tag="KLMA_20038"
                     /product="DNA-(apurinic or apyrimidinic site) lyase 2"
                     /transcript_id="XM_022822571.1"
                     /db_xref="GeneID:34714523"
     CDS             80777..82267
                     /gene="APN2"
                     /locus_tag="KLMA_20038"
                     /codon_start=1
                     /product="DNA-(apurinic or apyrimidinic site) lyase 2"
                     /protein_id="XP_022674378.1"
                     /db_xref="GeneID:34714523"
                     /translation="MEVDALCDKNGLRLVTFNVNGVRTLFQHYPFSRMNNSLKEAFEL
                     FKADIITFQELKIDASSIQKWGRIDGYQSYISIPRKKKGYSGVGCWVRQPTTENDPLR
                     KHLQVIKAEEGITGLLTTHNKGLSYRNSPDGIGGYTGLDVVDEEQLINIDSEGRCVLI
                     ELACNIVVISTYCPANSTQTEEGERSRLLFLNILFKRIRNLYELGKQVVLMGDINVCR
                     DLIDQAVGLDESNISVSEYKTGSQIEETFKDKCIEFIMEPTRVGRRLLNSMLCDSIIP
                     QYAEKGILVDTTREIQGRDRTKMYTVWNTLLNTRPINYGSRIDFVFVTKDLRERIVNG
                     NILNTVMGSDHCPVFADLKIDNMDINETPVIKPKFEASSRYSLNQKNIMDMFRKVSSA
                     EENVTKTTKTTKITKPALLGSKALGEKFIKRSPTISQPKLQTRSAHIKAFEDMLGKPP
                     KCQHGEETILRTSKTDKTFGRKFWVCKRSKGESNDPEGSCGFFQWK"
     gene            complement(<82317..>82712)
                     /gene="POP8"
                     /locus_tag="KLMA_20039"
                     /db_xref="GeneID:34714524"
     mRNA            complement(<82317..>82712)
                     /gene="POP8"
                     /locus_tag="KLMA_20039"
                     /product="ribonucleases P/MRP protein subunit POP8"
                     /transcript_id="XM_022822572.1"
                     /db_xref="GeneID:34714524"
     CDS             complement(82317..82712)
                     /gene="POP8"
                     /locus_tag="KLMA_20039"
                     /codon_start=1
                     /product="ribonucleases P/MRP protein subunit POP8"
                     /protein_id="XP_022674379.1"
                     /db_xref="GeneID:34714524"
                     /translation="MGKRFHEWYYFKVHATSQDLEKDEETKLDKITWLQIINSALKRS
                     HGVFGEAIEYDILHNDGLDSIIKVNYIDRQVFSTAMTSYISSDELVGVPLVFMIEQQQ
                     GKLSDITVPDEDLLWFKKLVEFEEKEIVD"
     gene            complement(<83094..>87740)
                     /gene="VPS10"
                     /locus_tag="KLMA_20040"
                     /db_xref="GeneID:34714525"
     mRNA            complement(<83094..>87740)
                     /gene="VPS10"
                     /locus_tag="KLMA_20040"
                     /product="vacuolar protein sorting/targeting protein PEP1"
                     /transcript_id="XM_022822573.1"
                     /db_xref="GeneID:34714525"
     CDS             complement(83094..87740)
                     /gene="VPS10"
                     /locus_tag="KLMA_20040"
                     /codon_start=1
                     /product="vacuolar protein sorting/targeting protein PEP1"
                     /protein_id="XP_022674380.1"
                     /db_xref="GeneID:34714525"
                     /translation="MAEFQPKVSSHVDEGTGAKIDAVNFDDSSVVIKLLPQGLFRSED
                     NGQSWENVKLPVKDANFTVSEIHTDTNYLSSTAYLRVSENMFVTKDQGKSWKQLKFEG
                     LKDGLKFDNDEGGFFSFFEVFSHPYKESLNVVNVHSFAIVNGEMVGIERSFASNDGVN
                     FKEMTFDDDEDKKKENDNKEGNTGAHKSGISCSFLQSSKDSKLTQFGEKLICKKVYYE
                     DLFSGLQLESKVYLVESNLKTISPLAKNLNGKTVGRVYNLDSHLYITILDDKFNTDSP
                     VKVLKLREGTVDEFKEIPLPTQVRNSFFTAQEVDGRVILSIYHREEDKSEGEAPPGMG
                     FFKMTAEVLISDSYGENFRMLDLNESSMGSFSLSTSLFVKKTMFATWSPAVFSTNKMI
                     FQSKASFDLGKTWKKLKVVNPENKWEYPCDINDDSNDCGLQIMSMSRNDWFNEAETFT
                     PGIISAVGAVFDGTGGVPFSKMGTFISRDNGLSWEQIFSFPCHVAMGDYGNIVVAYPY
                     DPEADEDEFSEFYYSLDQGKTFQEYQFETKFFPRRILQSAMDGSGSSFLIMGDIFEDN
                     YTIKDSISYTIDFSEAFEGSKCKEDDLEDWYFADGQCIDGVKIKFNRRKQDAKCLIKT
                     EYKDISFQEEVCECSDSDYECSNEFTQDSDGRCIADFSKQSLLEKCENVKDSIKMSPK
                     RKSKTTKCKNDLPIEEQEVHCSAALMPSKLKVSENKFSAAFKSYQYFDTFSQESILVR
                     TDKNEVYASHDGGAHFRKVETDGEDILEINFNPFFNTSAYLFGKNKNLYSTADRAVTF
                     STTKLPEGRQLGFPLSFHAKDPKTFIYYGGENCDSFFDPKCHAVAYITKDGGQSFDRL
                     LEGALSCEFIESAVSNPRVENGITCLVKDKSSGKRNFVTSSDYFKTQTVLYPDALGFM
                     TTGDYLVVAVPHGERQLRAYFTVDGVDYSEAILPKDLESYEQKAFTILGSQEGAIFMH
                     MTTNLHKNQEFGALLKSNTEGTSFVILERAVNRNYLGFVDFEKIQGIEGIILVNVVSN
                     VAEIVDSDNAQTEKKIKTKITFNDGADWTYIKPPSVDSEGKKFKCNPKNLEKCSLNLH
                     GFTERKDVRDTYSSRSALGYMFALGNVGEYLMPRNEASTFLTKDGGVTWTEVKKGAYQ
                     WEYGDHGSVLVLVKDDEPTDTISYSLDGGSSWNEYKFTTDKILVSDLVTVPQDSAMRF
                     LLIGTTVNVHGKETKTYTVDFTDTFKRQCEFSKDNLKDFEYISLSHPKSNECLFGHKA
                     QYLRKTSKDCYIGMAPLKESFNIITNCSCTRNDYECDYNYRRVSDGTCKLIDGTSPAD
                     PEDICKKDNNLIEYFEPTGYRKVPLSTCNGGLRLDNSDNPRPCPGKEKEFKDKYNVNH
                     AHFFGVWIITVLFVSTFLTFIYYRGIKRNGGFSRFGEIRLGDDDLIEENNTDRFVNSV
                     VRNGVFLFSSVYSGLQYLGHETGNFFKRSLGRFGNRSAPSYQSLLHDQFIDDADDLLV
                     GHDEDADDLASFIENDDNFDIGNDDDDEIDMSSETPTHAPYSDNPEGGTPDNPI"
     gene            <88470..>89570
                     /gene="FUS3"
                     /locus_tag="KLMA_20041"
                     /db_xref="GeneID:34714526"
     mRNA            <88470..>89570
                     /gene="FUS3"
                     /locus_tag="KLMA_20041"
                     /product="mitogen-activated protein kinase FUS3"
                     /transcript_id="XM_022822574.1"
                     /db_xref="GeneID:34714526"
     CDS             88470..89570
                     /gene="FUS3"
                     /locus_tag="KLMA_20041"
                     /codon_start=1
                     /product="mitogen-activated protein kinase FUS3"
                     /protein_id="XP_022674381.1"
                     /db_xref="GeneID:34714526"
                     /translation="MGKRIVFNISSEFQLESLLGEGAYGVVCSAKHKPSGETVAIKKI
                     EPFEKPLFSLRTLREIKLLKHFHHENIISIFDVQKPSSFEQFNEVYIIQELMQTDLHR
                     VIATQELSEDHVQYFMYQTLRALKMLHGSNVIHRDLKPSNLLLNSNCDLKVCDFGLAR
                     IVEEVTPDADADANANSNAGANAGGSAAISGLTEYVATRWYRAPEVMLTAAQYSKSMD
                     IWSCGCILAELLSKQPLFPGKDYRDQLLLIFRTLGTPSEQELQELVENKRARDYIRSL
                     PRQPKIKWRRQFPKASLAALDLLDKMLQFDPRRRITAAEALKHPYLASYHDPDDEPEG
                     TPIPASFFQFDQWKSRLNTKDLKRLLWNEIVS"
     gene            <91279..>92850
                     /gene="ACH1"
                     /locus_tag="KLMA_20042"
                     /db_xref="GeneID:34714527"
     mRNA            <91279..>92850
                     /gene="ACH1"
                     /locus_tag="KLMA_20042"
                     /product="acetyl-CoA hydrolase"
                     /transcript_id="XM_022822575.1"
                     /db_xref="GeneID:34714527"
     CDS             91279..92850
                     /gene="ACH1"
                     /locus_tag="KLMA_20042"
                     /codon_start=1
                     /product="acetyl-CoA hydrolase"
                     /protein_id="XP_022674382.1"
                     /db_xref="GeneID:34714527"
                     /translation="MTVSRLLKERVRYAPYLKKVRPVEELIPLFKNGQYIGWSGFTGV
                     GAPKAVPEALIKHVEENNLQGKLRFNLFVGASAGPEECKWAEHDMIIRRAPHQVGKPI
                     AKAINNGQIQFFDKHLSMFPQDLTYGYYTRNRTDGKILDYTIIEATAIKEDGSIVPGP
                     SVGGSPEFIAVSDKVIIEVNTATPSFEGLHDIDMPVNPPYRQPYPYTRVDQKSGLDSI
                     PVDPERVIAVVESTERDKVGPNTPSDAVSQSIAHNLVEFFENEVRAGRMPENLHPLQS
                     GIGNIANAVIEGLTDSSFKDLTVWTEVLQDSFLDLFESGALTYATATSVRLTDAGFDK
                     FFANWDDFSKKLCLRSQVVSNNPELIRRLGVIAMNTPVEVDIYAHANSTNVSGSRMLN
                     GLGGSADFLRNAKLSVMHTPSARPTKTDPTGISTIVPMASHVDQTEHDLDVLVTEQGL
                     ADLRGLSPRERAREIIKQCAHPDYKPILTDYLDRAEHYAKLHGCLHEPHMLQNAFKFH
                     LNLSEKGTMKVDKWD"
     gene            complement(<93489..>94580)
                     /locus_tag="KLMA_20043"
                     /db_xref="GeneID:34714528"
     mRNA            complement(<93489..>94580)
                     /locus_tag="KLMA_20043"
                     /product="methionyl-tRNA formyltransferase"
                     /transcript_id="XM_022822576.1"
                     /db_xref="GeneID:34714528"
     CDS             complement(93489..94580)
                     /locus_tag="KLMA_20043"
                     /codon_start=1
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="XP_022674383.1"
                     /db_xref="GeneID:34714528"
                     /translation="MWYLKRLYTTSRTAGVGQGALKVLFFGSDQYSSHSLTALHSLLK
                     SNDIASLQVVTRSPKACGRYLSEIREVPIMAVNDSLGLPPVIKCDSRQDLLGLLDNPA
                     ADFNMLIAVSFGKLIPRQLIEATNGLAFNIHPSLLPRYRGSSPIQYALLNRDSETGVT
                     IQTLHPTKFDHGHIIKQTEPLSVQELLSQGTVSEFEEDVPPKVATLMDQLGLRSGQLL
                     QQMIKQRDFETKDTPQYEASLAPKITTEMKQVHWKTQGKGAILAMNDALGPLFTYKLA
                     LPKRKKEVMKRRIIIPEIFDAGEEVSMNPGQFKLQDDDETLIIQCIDGQIGTKTLQFE
                     GFAVEPVATFVNRLNKRCGKMNSDEFLLE"
     gene            <94688..>95638
                     /locus_tag="KLMA_20044"
                     /db_xref="GeneID:34714529"
     mRNA            <94688..>95638
                     /locus_tag="KLMA_20044"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822577.1"
                     /db_xref="GeneID:34714529"
     CDS             94688..95638
                     /locus_tag="KLMA_20044"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674384.1"
                     /db_xref="GeneID:34714529"
                     /translation="MEAITSVIKESTITGHIETLIVENPSIPSDPGCMYSEMDSKERL
                     ERRRAKFSEQRRQELLNDPLQDKGLLSRGLSDPSATDSSSDSNAMTRLMNHQKYRDQL
                     FEEIKQLPASDERVEHGLRKLREIIISIRKREHHDPPFLKFTDEVYIYSANYYLDQEH
                     IDWTKLLGVLSANSTSSKEFLTCKTLYHSIELREHTHSIQAITLSSHLFEHPALCKNI
                     ILSCALDNPHQWFTTLAQFKDHSPFLYKFLSRLPYHRKSINEIIKTISKSYRQLSLEY
                     ISQFWFASVPIPHLKQLIASLYTTIDTPSGSTIVKFAQKT"
     gene            <95872..>96858
                     /gene="PGD1"
                     /locus_tag="KLMA_20045"
                     /db_xref="GeneID:34714530"
     mRNA            <95872..>96858
                     /gene="PGD1"
                     /locus_tag="KLMA_20045"
                     /product="mediator of RNA polymerase II transcription
                     subunit 3"
                     /transcript_id="XM_022822578.1"
                     /db_xref="GeneID:34714530"
     CDS             95872..96858
                     /gene="PGD1"
                     /locus_tag="KLMA_20045"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 3"
                     /protein_id="XP_022674385.1"
                     /db_xref="GeneID:34714530"
                     /translation="MGPDSMSGGHNSAGVTGVEILKENLTFETFREKIIEKDSNGDEV
                     KEKVLETKAELDPIRGLMLEFVTMLANLESMSNKTSQEKFLAVRVKLIELQNKIQKFS
                     KDFQQLQPLIQTMERFNEEIAGEKKYFVQETLGYASANPTSSSAGGGTSASTSASAQS
                     KTTKKASGGRRNSAKKGNAVSASSTPNLKQIPNNQPQQQQPQAQIPQQPQIPQQPQQQ
                     PQIPQQMQIPMQMQMQMMPGVSPMAMASPLNNISPQRKLATTMNQSRENSLHQNQNQG
                     QTPAGPMITPQNILNMSAFDMNQNQTPQPPNNINNMDLANLDLDSLNMEFLN"
     gene            <97245..>99374
                     /gene="TRP5"
                     /locus_tag="KLMA_20046"
                     /db_xref="GeneID:34714531"
     mRNA            <97245..>99374
                     /gene="TRP5"
                     /locus_tag="KLMA_20046"
                     /product="tryptophan synthase"
                     /transcript_id="XM_022822579.1"
                     /db_xref="GeneID:34714531"
     CDS             97245..99374
                     /gene="TRP5"
                     /locus_tag="KLMA_20046"
                     /codon_start=1
                     /product="tryptophan synthase"
                     /protein_id="XP_022674386.1"
                     /db_xref="GeneID:34714531"
                     /translation="MSVLLRQAFEKAKQQGRNALVTFMTAGYPTLEDTIPILKGFQDG
                     GVDVIELGLPFSDPVADGPVIQVANSISLKNGIDMHKVLDMVKQAREEGVTVPIVLMG
                     YYNPILNYGEEKFIQDASRVGVNGLLIVDLPPEEALKIRNYVGENGLSLIPLVAPSTT
                     EERLNLLSHLADSFIYVVSRMGTTGAQKSVAKDLSALVQKVRSFSGDIPLAVGFGIST
                     KEHFDTVGSVSDGVVIGSKIVTLIGEAPQEKRYETAKNYVEEISGGKKGPVLSKEEFY
                     KIQQASIDAAKEKKNVVKEFEELHKFPARFGEFGGQYVPEALHACLRQLERGFEDAVA
                     DPAFWEEFRSLYSYIGRPSSLHKAERLSEYCGGAQIWLKREDLNHTGSHKINNALAQV
                     LIAKRLGKKKIIAETGAGQHGVATATACAKFGLECTVFMGAEDTRRQALNVFRMRILG
                     AKVIPVTNGTQTLRDATSEAFRYWVSNLESTHYVVGSAIGPHPYPTLVRTFQSVIGQE
                     TKKQFAELNDGKLPDTIVACVGGGSNSTGMFSPFEHDTSVRLVGVEAGGDGIDTDHHS
                     ATLTVGRPGVLHGVKTYVLQDSDGQVHDTHSVSAGLDYPGVGPELAAWKASGRADFMA
                     ATDAQALEGFRLLSQLEGIIPALESSHAVYGAVQIAKTMRKDQHLIINISGRGDKDVQ
                     SVAEVLPKLGPQINWDLRFESDPTAGN"
     gene            <99785..>102424
                     /gene="RRN6"
                     /locus_tag="KLMA_20047"
                     /db_xref="GeneID:34714532"
     mRNA            <99785..>102424
                     /gene="RRN6"
                     /locus_tag="KLMA_20047"
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN6"
                     /transcript_id="XM_022822580.1"
                     /db_xref="GeneID:34714532"
     CDS             99785..102424
                     /gene="RRN6"
                     /locus_tag="KLMA_20047"
                     /codon_start=1
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN6"
                     /protein_id="XP_022674387.1"
                     /db_xref="GeneID:34714532"
                     /translation="MSLQPRHGERGLQLGIGVASPRTYIPFSQPNEDGNEECWTRSTL
                     ENRGIMYFRDMRVLQNSRNDSFEDSNDVNKLQQDDNMEEVTYPINNQKFWDSILGNQY
                     PSKVIKDIKLQSNEELIAVDNTGIADKFYVPSSLVSKIEKGEMSMTSDDGHRKTNKPI
                     RIESSHNTRDFKAIDPTRKRQFALAEFLPIVDARLDKDPTTLLITIEGSTQSNLSIQA
                     LSTDTKTKLYECTLKPRIINLQSRIKHIEVPKPTNYLGKYPNLFAVITDSKLHIIRLD
                     RIDESGIELTEFVPLEFLEFEQFPIVDVAFNPWDMMEMALVDSKGNWILAKLETHKRK
                     PCTIKLKSDISGSIFDPTVTSPWHHIDWIDDHSSLVVLNRSKMVSINYVENWQLDIVE
                     AKTWSELRDYKRINDNTALLLTSQEIILLDIQNNSFRRMISWKHNWDTNDPSIRMSYK
                     LEEGNNYTHLIHVLIFSKLTLKVYGISIGYKENAWTVIACKPFLLSLDNVKSKHGINS
                     IEFSTSSTEFASDKSEGDIIDNDDDEFAKDIVCVLGFIELNTLVQGFLSTKNSPNHLH
                     LNSHLNQPTYNARSLEKICDAFDHSIPVPKADHQVENEYHMFQEFGYELSERLNKLLD
                     SWKSRSDKYNLNIESLAYLDVCPSYFQSITEYVSLIEQLIAYYQNHNLVFSEVKLFIE
                     QLIGENLGSWEDLFNRLVIAWDPVSTEAEHLSRTVIRDIALYLTLYQQQDTIKTSLDV
                     ISEELSDSMKSLLNSWDTDPTEEFNDVNATPITTFSQALSSQQFQVPTIKSSQQVNRK
                     KRTAALSSAANGINSGTTRVSHRSASQPTQMMANSYTLPGSIPPAFSLSGSSRASQPL
                     SAASQPEGHQRQRRKKKKVGGFN"
     gene            <103034..>105286
                     /gene="CWH41"
                     /locus_tag="KLMA_20048"
                     /db_xref="GeneID:34714533"
     mRNA            <103034..>105286
                     /gene="CWH41"
                     /locus_tag="KLMA_20048"
                     /product="mannosyl-oligosaccharide glucosidase"
                     /transcript_id="XM_022822582.1"
                     /db_xref="GeneID:34714533"
     CDS             103034..105286
                     /gene="CWH41"
                     /locus_tag="KLMA_20048"
                     /codon_start=1
                     /product="mannosyl-oligosaccharide glucosidase"
                     /protein_id="XP_022674388.1"
                     /db_xref="GeneID:34714533"
                     /translation="MDAQGLSKVRHFVEQGDKLDKYGWVWYDPRIGGKEMIIDSENNM
                     KLNFTFVKSHSGENWAIQVEGNKIREADTAESIVLYMKQNGGEGSTSFLKEDRSHVKR
                     SNKNEISFSGHSGQLGAYSVRIYSDQNDFYKNDKVMPLSSDCDPSKPSVLSLNIPDDQ
                     LWKAKDVFQTILGDSIKAHMESQAELNPYSVPSILTIRNIHNFPAGNVQYVQQTFQNH
                     FKFNIIFNKKSSSDQIEPNSVDHLILLAEDLVKQKFDSKFNIPESSKFKTFAEETFSN
                     LLGGLSYFHGTQLVDRKTQFDSESFEKFELLNSNEEGPLELFSMVPSRAFFPRGFYWD
                     EGFHLLQLMDYDADVAFEILQSWFNLIDEDGWIPREVILGDEARSKVPEEFQVQNPNI
                     ANPPTLLLAFSEFLNKAKTLQEEILDVHLEQEYSTNNVYSNGDILNKNPELLISYAKN
                     IYPKLLKHYEWFRDTQKGLLEEYMDVPEISSKAHADEAYRWVGRTFTHCLPSGMDDYP
                     RALPPDVAELHVDALSWVGVMTRSMKQIATVLDLEEDIQKFTTIENNIIENLDVLHWN
                     DEKKLYCDITYNDEAVEDTDLRKFVCHEGYVSLLPFALKLIPSENIERLEHIIDTMSN
                     NETLRTPFGLRSLSKQDEFYDTGEVYWRGPIWLNINYLCLDALKSYFQESPLRNSKQV
                     NKELFQKANDLYKQLRRDIIENVYSVWKQDGYVYEQYNHKTGKGSGVQHFTGWTALVV
                     NMIGKLPDEL"
     gene            <106221..>107777
                     /gene="SCW11"
                     /locus_tag="KLMA_20049"
                     /db_xref="GeneID:34714534"
     mRNA            <106221..>107777
                     /gene="SCW11"
                     /locus_tag="KLMA_20049"
                     /product="probable family 17 glucosidase SCW11"
                     /transcript_id="XM_022822583.1"
                     /db_xref="GeneID:34714534"
     CDS             106221..107777
                     /gene="SCW11"
                     /locus_tag="KLMA_20049"
                     /codon_start=1
                     /product="probable family 17 glucosidase SCW11"
                     /protein_id="XP_022674389.1"
                     /db_xref="GeneID:34714534"
                     /translation="MTDSYLNIRSLLSLLALLSYALAVPVKHKHEKRLIVTRVHTAST
                     TNTVTNFYSTTTQVVAAPTVELIVSGSVTLTTTLPLADGSAPTASPSVTITTIFNDRG
                     VGNIAVPTDLPNEVALSESNGNANAQPNNDNTQSANTPAAQNQNTASSQGNDGTTTLS
                     PSSSPASNPASSPASSPAASPASSPASSPASSPASSPASSPVSSPATSSTSSPSPSST
                     PASSENSNNNNQGTPTSSAASSETTSGNTSSAGSVQGVPTALVYSPYNDDSSCKSADQ
                     VSSDLQQIHSKGVNKIRVYGTDCNSLQTIQPAAAKLGMKINQGFWISSAGVNSIDQSV
                     SDVISYGQSNGWDVFDFITIGNEAIISGYCSVDELIGKISSVKSQLKSAGYNGQVTTS
                     EPPVSFETYPSLCTNSEIDFVGINPHSYFDTNSQASTAGSFVQGQIALVKKACGTDNV
                     KVTETGYPSQGKQNGGNIPSKENQKIAVSSILQELNGDCTILSTFNDYWKSPGPYGIE
                     QSFGVLDILS"
     gene            complement(<108045..>109079)
                     /gene="MIOX5"
                     /locus_tag="KLMA_20050"
                     /db_xref="GeneID:34714535"
     mRNA            complement(<108045..>109079)
                     /gene="MIOX5"
                     /locus_tag="KLMA_20050"
                     /product="inositol oxygenase 1"
                     /transcript_id="XM_022822584.1"
                     /db_xref="GeneID:34714535"
     CDS             complement(108045..109079)
                     /gene="MIOX5"
                     /locus_tag="KLMA_20050"
                     /codon_start=1
                     /product="inositol oxygenase 1"
                     /protein_id="XP_022674390.1"
                     /db_xref="GeneID:34714535"
                     /translation="MSKEPKSPRKERSDSHSNKEEGVIIHSDKGHILELIDEDVQSIN
                     IMKTKLRGHNKSRNDDGPDKKRKKANGHDEAEQPHSVLDGMNDEDFRQYNQAKDRVRE
                     FYKEQHEKQTMAYNLQARINFKTKVRARMTVWDALCKLSKLIDESDPDTELSQIDHAL
                     QTAEAIRADNKPRWMQLVGLIHDLGKILYFFDSEGQWDVVGDTFPIGCGFAKENIFYE
                     YFQGNPDNSHPIYSTKLGIYEEHCGLKSVMISWGHDEYMYYIAKNQSTLNDKALAMIR
                     YHSFYPWHREGAYSYLMSEEDYEMQKAVQDFNQYDLYSKGLQKFNLEKLKPYYLELID
                     EFFPQKTIEF"
     gene            109315..109387
                     /locus_tag="KLMA_R201"
                     /db_xref="GeneID:34718647"
     tRNA            109315..109387
                     /locus_tag="KLMA_R201"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:34718647"
     gene            complement(<109570..>109938)
                     /gene="CGR1"
                     /locus_tag="KLMA_20051"
                     /db_xref="GeneID:34714536"
     mRNA            complement(<109570..>109938)
                     /gene="CGR1"
                     /locus_tag="KLMA_20051"
                     /product="rRNA-processing protein CGR1"
                     /transcript_id="XM_022822585.1"
                     /db_xref="GeneID:34714536"
     CDS             complement(109570..109938)
                     /gene="CGR1"
                     /locus_tag="KLMA_20051"
                     /codon_start=1
                     /product="rRNA-processing protein CGR1"
                     /protein_id="XP_022674391.1"
                     /db_xref="GeneID:34714536"
                     /translation="MSGTSSASETNVEIKGKPVSGRVWKAEKQPLRAKSRVVKNKKLT
                     SWELKEQKRLEDKQFKEKIRELKSEKEAEKKAVIEALKERRAKKEEQERYSRLAEKMH
                     AKKVDRLRRREKRNKALKER"
     gene            complement(<113089..>114318)
                     /locus_tag="KLMA_20052"
                     /db_xref="GeneID:34714537"
     mRNA            complement(<113089..>114318)
                     /locus_tag="KLMA_20052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822586.1"
                     /db_xref="GeneID:34714537"
     CDS             complement(113089..114318)
                     /locus_tag="KLMA_20052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674392.1"
                     /db_xref="GeneID:34714537"
                     /translation="MSEQQSFRIRLATFIEFLDPIASTVQSYSQPSRNYIKEKLHSGK
                     SRLSLQEAELSPQLAKFKIKTLNKLKTIDKPLQSIFFQNSSTLEKSFYPFTLFNIFLI
                     GFIIGRYPEHFHLYYTGMLCLLMPVRFYTYYKTNNHYFLADLCYFVNALCLLFIWALP
                     GSTHLYQTCFAFTFGTLSFAIITWRNSLVIHSVDKITSCFIHIMPPLTMYCITHAISE
                     PVKLRRFPAAASINSKDWNFKTNVFYTSMYYLVWQSLYHYFITVRNSQKIKSGQRMTS
                     FEYLTTHQYKNSWAVKLPPPLPMVLYTLFQYCYQLVTMILCVIWFNHKGAASAFLTFI
                     FLYAAKNGASYYIDYYGKKFEKEVYKLKIQVETLEKQLNEKGSTSSMSLDESDVASIT
                     SNQSDELTWEMKLPTKS"
     gene            complement(<114786..>115142)
                     /gene="RPL30"
                     /locus_tag="KLMA_20053"
                     /db_xref="GeneID:34714538"
     mRNA            complement(<114786..>115142)
                     /gene="RPL30"
                     /locus_tag="KLMA_20053"
                     /product="60S ribosomal protein L30"
                     /transcript_id="XM_022822587.1"
                     /db_xref="GeneID:34714538"
     CDS             complement(114786..115142)
                     /gene="RPL30"
                     /locus_tag="KLMA_20053"
                     /codon_start=1
                     /product="60S ribosomal protein L30"
                     /protein_id="XP_022674393.1"
                     /db_xref="GeneID:34714538"
                     /translation="MRYVSEFVEIIFVQAPAKNQENISQKLALVVKSGKYSLGYKSTV
                     KALRQGKAKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGV
                     LTVLDAGDSDILTALA"
     gene            <116615..>117082
                     /gene="RPL24"
                     /locus_tag="KLMA_20054"
                     /db_xref="GeneID:34714539"
     mRNA            <116615..>117082
                     /gene="RPL24"
                     /locus_tag="KLMA_20054"
                     /product="60S ribosomal protein L24"
                     /transcript_id="XM_022822588.1"
                     /db_xref="GeneID:34714539"
     CDS             116615..117082
                     /gene="RPL24"
                     /locus_tag="KLMA_20054"
                     /codon_start=1
                     /product="60S ribosomal protein L24"
                     /protein_id="XP_022674394.1"
                     /db_xref="GeneID:34714539"
                     /translation="MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQSSKSASLFHQRK
                     NPRRIAWTVLYRRHHKKGITEEVAKKRSRKTVKAQRAVVGASLELIKERRSLKPEVRK
                     AQREEKQKADKEKKKAAKAARKAEKAKLAASGQAKISKQQAKGAFQKVAATSR"
     gene            <117803..>118075
                     /locus_tag="KLMA_20055"
                     /db_xref="GeneID:34714540"
     mRNA            <117803..>118075
                     /locus_tag="KLMA_20055"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822589.1"
                     /db_xref="GeneID:34714540"
     CDS             117803..118075
                     /locus_tag="KLMA_20055"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674395.1"
                     /db_xref="GeneID:34714540"
                     /translation="MSKVVAVPMVLLLLLLSLVNAQSVKTVVSTSCGTIPSPTLETTP
                     ITTQTRTVTSNGQTFIGVTEVYQSITYVEDCTTLEDEEHTSTLLIW"
     gene            <118611..>119264
                     /gene="NAT2"
                     /locus_tag="KLMA_20056"
                     /db_xref="GeneID:34714541"
     mRNA            <118611..>119264
                     /gene="NAT2"
                     /locus_tag="KLMA_20056"
                     /product="DUF1279 super family"
                     /transcript_id="XM_022822590.1"
                     /db_xref="GeneID:34714541"
     CDS             118611..119264
                     /gene="NAT2"
                     /locus_tag="KLMA_20056"
                     /codon_start=1
                     /product="DUF1279 super family"
                     /protein_id="XP_022674396.1"
                     /db_xref="GeneID:34714541"
                     /translation="MFRVVGNLGLKQSIRYGFNPAIRRAYSNSANVKEPTGLKKLIKQ
                     YGWSALGVYLGLSCIDLPICFFAVHSLGEETIKVYINRVKQLADFGKDEEELRQEIKE
                     KQRKDEENRQLGIQDKSTWERVKESTLLTEFLIAYGIHKSLIFIRVPITAAVTPSVVK
                     FMRRFGFSAEKFNKGFKTMADGAKVRNKSGKPDDFIKNGSLPKSEASKGRKWFDGMM"
     gene            complement(<119444..>120367)
                     /locus_tag="KLMA_20057"
                     /db_xref="GeneID:34714542"
     mRNA            complement(<119444..>120367)
                     /locus_tag="KLMA_20057"
                     /product="uricase"
                     /transcript_id="XM_022822591.1"
                     /db_xref="GeneID:34714542"
     CDS             complement(119444..120367)
                     /locus_tag="KLMA_20057"
                     /codon_start=1
                     /product="uricase"
                     /protein_id="XP_022674397.1"
                     /db_xref="GeneID:34714542"
                     /translation="MSYSYLADSTYGKDNVKFLKVKKSKTNPKLHEVMECNVQVLLKG
                     DFDVSYTKADNTPIVPTDTVKNTILIHARKYDTWPIEKFAANLALHFTGKYAHVSGLT
                     VKILQDRWVKYDVDGKESLHSFVHQGPEKKICFLDYDKKNGTSSYKLVTSIKDLTVLK
                     STGSMFYDYNVCDYTTLKPTTDRILSTDIFASLQWNPAKLGSLESIRAGDKDDVFNTS
                     YTAARDITLDIFAKENSPSVQATMYNMATAILKTAPEVELVTYELPNKHYILFDFKWF
                     QGLDNKNELFYPSPDPNGLIKCTVGRKQAKL"
     gene            complement(<121175..>121843)
                     /gene="HOP2"
                     /locus_tag="KLMA_20058"
                     /db_xref="GeneID:34714543"
     mRNA            complement(join(<121175..121746,121813..>121843))
                     /gene="HOP2"
                     /locus_tag="KLMA_20058"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822593.1"
                     /db_xref="GeneID:34714543"
     CDS             complement(join(121175..121746,121813..121843))
                     /gene="HOP2"
                     /locus_tag="KLMA_20058"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674398.1"
                     /db_xref="GeneID:34714543"
                     /translation="MPPKQVKGEDAESLILNYLNENYKPFAINDIVQNLHSQVSKTNA
                     LKALEALSASHRINCKQFGKISIYIRNEIDLEENVGGKEYTFEDIQELNEEYAKITSD
                     RHAWENKTSALLQEPSNVELDAKIKELERKVKELKSSIEYLQKTPEDSAENDLVKFIQ
                     DSRAMVEKEIRARRRIWKSCVQLIKHGIQPKDVNEFLVSC"
     gene            <125266..>126936
                     /gene="MIG1"
                     /locus_tag="KLMA_20059"
                     /db_xref="GeneID:34714544"
     mRNA            <125266..>126936
                     /gene="MIG1"
                     /locus_tag="KLMA_20059"
                     /product="regulatory protein MIG1"
                     /transcript_id="XM_022822594.1"
                     /db_xref="GeneID:34714544"
     CDS             125266..126936
                     /gene="MIG1"
                     /locus_tag="KLMA_20059"
                     /codon_start=1
                     /product="regulatory protein MIG1"
                     /protein_id="XP_022674399.1"
                     /db_xref="GeneID:34714544"
                     /translation="MSSEVVPLQKKGRKKAGAGAGVAVDGEKDGSRPYVCPICHRGFH
                     RLEHQTRHIRTHTGERPHACDFPGCAKRFSRSDELTRHRRIHDSDKPKGKRGRKKKSE
                     TIAREKELELQRQRQQQQQQQLQQQQLQQQQQQLQQQQHQVLPAEIKISAPMASSMME
                     VTQAINQRYQDTHNLSLSYNSGSNSNASSGSNSNSSLNQVFSITSQPARDLAAKPMFQ
                     LGSDESEETSNTTTLHSVHPQQQNNGSVELLLNAARFESEKSTTPLNNNTPSFKFIDR
                     PPLTSSLSSPALSLISQSPGPGAGPGFGPANGNGNGNGNGAANNNGLLLPRPTSRPKL
                     SALSTLKRMTPLSQVSEPQQPAASLPHLQQVPSNGFLDTNGHAASVVRNKSWTNLGVM
                     PSPSESGSSAMISRFSSSASLNKLMDPSSRTSSAVSIATLMNEDKLQSQDDLSVVDEF
                     GRSRKKSKTSTPIRRPSSNMGFGTGPASHAMEFCNELQSRLKSVDQYSDRSAGDEKDY
                     YFQSRSSSSVCTPINSPPSERLVSSTSNNKTIKLPSLRSLDILPREQH"
     gene            <127318..>128640
                     /gene="PRP24"
                     /locus_tag="KLMA_20060"
                     /db_xref="GeneID:34714545"
     mRNA            <127318..>128640
                     /gene="PRP24"
                     /locus_tag="KLMA_20060"
                     /product="U4/U6 snRNA-associated-splicing factor PRP24"
                     /transcript_id="XM_022822595.1"
                     /db_xref="GeneID:34714545"
     CDS             127318..128640
                     /gene="PRP24"
                     /locus_tag="KLMA_20060"
                     /codon_start=1
                     /product="U4/U6 snRNA-associated-splicing factor PRP24"
                     /protein_id="XP_022674400.1"
                     /db_xref="GeneID:34714545"
                     /translation="MDIDTKKRASSDDLDDSSKKAKSKKESTHYREYNTVLVRNLPPN
                     YNHFKVRKYFKTCGSVLQADVVDDKDGSSKLARVEFSSYDEVLTAMTRTLKKIGHYQI
                     TVEHLTDSTLWITNYPPGYDASKLRSMLSDHVESPILSIRLPSLAFNSRRRFAYVDLT
                     SRTAAERAIEELNGKEVAGYKLIVKLSNINDRKKRTDDAISEGRELIVKGISEEVSDE
                     ALLGLFSKYGDIEKHRMVKADEGSTRYAFITYKDEESAERALTLNGETLEDKTLHVSK
                     AMKKAYLERQEAKRLLASKRNDPKIIGLYPLSDQVTREEITALIIDKSSVQSSDIAKV
                     LLVSDHEGALVVMKEEKCAAKVSLALNGFKFKNRMLNCVSTFELSKHFPNERGHSVQV
                     SKEPSHGKLVGETHSNNARNNVGPEQEHLPQQEKKMSNDDFRKMFLSK"
     gene            complement(<128736..>133565)
                     /gene="NUP188"
                     /locus_tag="KLMA_20061"
                     /db_xref="GeneID:34714546"
     mRNA            complement(<128736..>133565)
                     /gene="NUP188"
                     /locus_tag="KLMA_20061"
                     /product="nucleoporin NUP188"
                     /transcript_id="XM_022822596.1"
                     /db_xref="GeneID:34714546"
     CDS             complement(128736..133565)
                     /gene="NUP188"
                     /locus_tag="KLMA_20061"
                     /codon_start=1
                     /product="nucleoporin NUP188"
                     /protein_id="XP_022674401.1"
                     /db_xref="GeneID:34714546"
                     /translation="MSTLSFAGICAFLRSGEYDKVHNEPTFEVIDKFLKDNEEIIVHL
                     SGFVEGKEPIEESGNGIVIRGSKYEVSGEDKKLCEELGEALKVSKRECLRVVSQTRAR
                     FPDCEISKDTLVKQILHERNCVLDTVLVLLNDDSFPVLRNSLLQVVFKNRNTIIDEAI
                     VLLRKCVGQIRDMDEESSYRDAMLAYDLIYITNVLNLVAFVCLNQAIGLETITKWYEL
                     LGETDYFRALKTNKDVPNEIFQMVHALMIMDTMIITGYNTSKDTIDTGAAFFNTADTF
                     RALLDTILDSNPPAVIVYYWSFILYTKTYMLEENPEENFQFVQEVFQTQPISELTKEL
                     ALAAESDNVFEDISKLSETFKDHSFFSAILSSVVVFSLYFIPISLRTSKMIKAVLMNS
                     PTQYVEKFLTNTEFERKFFLVKSKAPLLKESLIPMINVTSVYPEFAHFEWKELQSYVQ
                     EMSLGNLDYDLADDASSTDLISVKTETFVRVPLESNERVLLPIPKNTKGKILPSTAED
                     DMIMFLYKYNGWALLGRVFQNACERYLSTSSKSEIRKDNIQEELIVSLLDLVASIIGN
                     GISVEKSTEILQQMSIYMSDDYVFDVIFRVFEQSLHLRDYDVIDHCLQVLINSTENFS
                     HFIWSHLARSELLDRYGKSGLIASVLGTMELPNGNYSITIKSVKLAQQLVAESLSSKT
                     EFPESLKKEILSKLIQHFIHVYESYQYWNYASIAEKYELGSNLAILFSSVMYNIYGVD
                     PTNSPENKITRVLSSAASHITRRFLSSDSPDVRMVTSLLHVLLSGNSLEALSIGNEVF
                     YNKYNQCLKNSFELANILISIRALLKLPPSTLELQIYSNLPKFIDIYALHNDLRNPII
                     KLMTHLVRAPWNENFPSLLSYLGTKHSKMIFKSFLYDLTSNIDDYQFLKNLYRFFSSV
                     MEGKQDGFSILLVTGETISVGSTLDTSDKGAKTSNVSVLSLLKKNILKLDSYPESVAS
                     RLLEAISYAFNSWAAARNNTTDKEFIDFLVKRLENSEEKTAPKTVQETIKSSSHYRLH
                     ARIAEIFALYLFTASSSDSTITDMLSGSKLVETVKKIFNVDGYDEKLNSNLSEEFKKL
                     WPHLTLEKFAVSPLYKIGKAYQANIYDIELLDQYFCCDEKWTGTDTSVGFREQVIKSS
                     INLQYVSFQISAAKSWGALLTAFIKKTPKPLQPSYIDIVSELLSLNIEYGVDAPIFVE
                     VYLLRIELVFYILYSFVQTSMVIPESTVETLVSQLLAILKSKEVDYLANIPLSNKNNL
                     YRPVIRSILILLTLAKPYHSFIEKCSDSVLELFELSFSKGVNVVLSSILSSFATASTK
                     GKKVIVPNIADKVQDLLLLLSLFTKIKDLSPSASFNAVLASSLNEFGTLKSLLNLYYS
                     SYLLKSNDEPLFAELTLSFISELVTIQEVAQKMIDNGLFSVFLESPISVSIQTNGVQP
                     EISPRLHNIWSNGIVSIVLQLLSKFGSSILSEVCLFVSYFSKQIDLVVSRWSSDSLSI
                     TQAYIQETSQIILLQKMLDDLEYQRFLSVNTSKLKLIDEQEVIELFPGLDTPTERAEL
                     SNVLKHLLTHPKYMNSRIVATTPEKQKMMDDEAYRSQLINSITKQITELQTLLNSNL"
     gene            complement(<133845..>134723)
                     /gene="PPA2"
                     /locus_tag="KLMA_20062"
                     /db_xref="GeneID:34714547"
     mRNA            complement(<133845..>134723)
                     /gene="PPA2"
                     /locus_tag="KLMA_20062"
                     /product="inorganic pyrophosphatase"
                     /transcript_id="XM_022822597.1"
                     /db_xref="GeneID:34714547"
     CDS             complement(133845..134723)
                     /gene="PPA2"
                     /locus_tag="KLMA_20062"
                     /codon_start=1
                     /product="inorganic pyrophosphatase"
                     /protein_id="XP_022674402.1"
                     /db_xref="GeneID:34714547"
                     /translation="MRATRQLFMFKNHLMRRHFHNVTIGSKYSASFKQYLQLDNGEIG
                     SYFHDVPLGLDVAKRTCNMVVEVPRWSNGKFEISKSEPFNPITQDIKKGKPRFVNNIF
                     PYHGYIHNYGAIPQTWEQPVIEVLPGLKGDNDPLDCCEIGSSIARMGDIKQVKILGSL
                     ALIDDGELDWKVICIDVEDELTPKLHTLADVDKYMPGLLDATRTWFRDYKIPTGKPPN
                     QFAFNGEYQDVATTLDTVQDCHNAWSTLVSDEVKTDDQKIELPTIVRAGTQIRIEADE
                     QPETPIPREVEKWWYL"
     gene            complement(<135083..>137806)
                     /gene="RSN1"
                     /locus_tag="KLMA_20063"
                     /db_xref="GeneID:34714548"
     mRNA            complement(<135083..>137806)
                     /gene="RSN1"
                     /locus_tag="KLMA_20063"
                     /product="uncharacterized protein RSN1"
                     /transcript_id="XM_022822598.1"
                     /db_xref="GeneID:34714548"
     CDS             complement(135083..137806)
                     /gene="RSN1"
                     /locus_tag="KLMA_20063"
                     /codon_start=1
                     /product="uncharacterized protein RSN1"
                     /protein_id="XP_022674403.1"
                     /db_xref="GeneID:34714548"
                     /translation="MTSSDTKNTSTSQVLSSLVFNSIVFGVFLISFILLRLKEKRIYQ
                     PKSSYELIDEEKRPQPLPSGLWQWIIPLLKKSDNFIIQQAGLDGYFFLRYLLVISVYC
                     GVSMLYIFPTLIPINVVHGVRHSGFDMLAFSNVDEKHRYYGHVFCAWAFFWGFLYVMY
                     RELTLYASLRQNVLASPRYAKKLSSRTVLFQSVPDQYLSEVEFGKLFDNVSTIWIARG
                     AKELSKLVEERDKLALQLEGAETAYLKKAVKAVNKLKKKHGGVEALSVSNDIETYVPH
                     KKRPKHRLKFLVGKKVDTIDYAKEKLPELNKKIKELQAKHMEEKPMNSVFVEFKSQYD
                     AQKAVQMVRHHTPLMLTPGYVGIDPHDIQWFNLRMHWLERLVRTFGSNSAIVALVILW
                     AIPVAFVGLVSNITYLTNKLPWLRFIYNMPTQLLGIITSLAPTIALTLLMMLLPIFIR
                     KMALLSGAPSVQHIEYYTQQSYFAFQVIQVFLVTTLASSATSTVTAIVNEPTSAMKLL
                     AQNLPKSSNFYIGYIMLQGLSISSGALLQIVPLITFHLLGMLLDSTARKKWTRFTNLP
                     TMSWGTTFPVYTNLAVITFSYAIISPLILLFACVGFFLLYIAYLYNLTYVYQESTDSR
                     GIHYPRALFQTMVGLYLGQICLLGLFVVGKGWGPIVLQAICLGVTVFIHVNLNAAYDH
                     LITVVPIDTMKALDGKSNTPSYVRIENEDEEKDEIKELPPFQIKKYQPRSSGQYDQRT
                     TSMFSDNTYEIQTGVFDTDNENNINAVPLLADGDTTPVVAAPFWKRFFQPHIYLSYKA
                     VKSRLPEIYNLPDPKEMTDPEDIKHAYDYPTVSSKCPYLWIPRDPYGFSTVQIQELEG
                     IVEISDEGASFNEKGAIEWETAPPSYNDSQAEKVISNPFKEEEEDDLKLSD"
     gene            <138686..>140017
                     /locus_tag="KLMA_20064"
                     /db_xref="GeneID:34714549"
     mRNA            <138686..>140017
                     /locus_tag="KLMA_20064"
                     /product="hypothetical conserved protein"
                     /transcript_id="XM_022822599.1"
                     /db_xref="GeneID:34714549"
     CDS             138686..140017
                     /locus_tag="KLMA_20064"
                     /codon_start=1
                     /product="hypothetical conserved protein"
                     /protein_id="XP_022674404.1"
                     /db_xref="GeneID:34714549"
                     /translation="MSPPTMSPLEQVASLPLGHDCPSVSQIKEIHIYDFDQTLYASPL
                     PNAALYTPGTLNHLRFPNTLANGGWFECPDLLEYSIIAPNRPRESKWNMKVCALAAMS
                     LADEHVLAIVLTGRREDTFSGVFKLAMDHFMRDIGPKRPFDAVCLKKPHLGTTTLQSK
                     LSVIKTLLDHYSQATQVRVYEDRESQARGFKRFFKEYIESNSDFRPQLCADVVMVSCD
                     PYYLDPEVELELVMRMVQQSNETVDRTRSGQKYTLSKSLQYSGFKVDACTLKLIQHEA
                     LKQLKKKNIPQDVIESLNWRRSPVIPLDSENPQRMVSSSRLYGFLNAFRAPDEGESEF
                     MKKARDIKKGLRYEPYKWNLADFFYESTQGYLGFILTDYKGPVQLGQGVSVMEDYAIL
                     LAGPGTQDFLTDDQLDKILGMKTCVSIDCESTCFQFNSYLGVYFIYRLKNL"
     gene            <140260..>141762
                     /locus_tag="KLMA_20065"
                     /db_xref="GeneID:34714550"
     mRNA            <140260..>141762
                     /locus_tag="KLMA_20065"
                     /product="DUF2410 super family"
                     /transcript_id="XM_022822600.1"
                     /db_xref="GeneID:34714550"
     CDS             140260..141762
                     /locus_tag="KLMA_20065"
                     /codon_start=1
                     /product="DUF2410 super family"
                     /protein_id="XP_022674405.1"
                     /db_xref="GeneID:34714550"
                     /translation="MHNKKQTRMDETEGKESSKAPEKDGSVSKDTLTMEHSVLFEWNS
                     VDSALNVPSMAHDKIKKICIFDFDNTLFKSPGPNPHLYSPELYRALLSPHVFSNGGWW
                     SEPRFLGSLIDEFLDRSDEVDDSVYWNREMVDEARESWSHRDDGTLTILMTGRKELLF
                     SGLLSKLAHEEVFGEPLHFHGAFLKRQGYATTMAYKCACLRSLLDYYSNAEEVVMYDD
                     RRQQLEGFDVFFNEYREARALSRGQGQGHSLKHTLVAVEPVIDYLAPAKEIATVADIF
                     QEHNNDVDCKMQGLKGMIHGPICSLKFQMDHLTLTTEKTESPRQYLLLDCRETHKLRL
                     LVEKMGEDTNMVYPFSLPVVVACPDSSQQQQEGPEQKIETPEQQQHNHLSVPGPKIVT
                     PDVSTDDFQELMAQPDRVFPHEPIEWSIHEALVLDSRKLAFTVTSAQKQGMHILFTCP
                     YNDADIQDVKNTGMPPHINHSMPTFTAVAVPRYTYTSEPTTGPATTTTYH"
     gene            <142396..>143952
                     /gene="CAC2"
                     /locus_tag="KLMA_20067"
                     /db_xref="GeneID:34714551"
     mRNA            <142396..>143952
                     /gene="CAC2"
                     /locus_tag="KLMA_20067"
                     /product="chromatin assembly factor 1 subunit p60"
                     /transcript_id="XM_022822601.1"
                     /db_xref="GeneID:34714551"
     CDS             142396..143952
                     /gene="CAC2"
                     /locus_tag="KLMA_20067"
                     /codon_start=1
                     /product="chromatin assembly factor 1 subunit p60"
                     /protein_id="XP_022674406.1"
                     /db_xref="GeneID:34714551"
                     /translation="MVQSESLQIYWHDSHPIYSVCFQPVKKNEEAIGGRTRRLFTSGG
                     DNKVRVWQLNENEEGKIDSIDFLSSLTQHEQAVNVCRFNEQGDILATGGDDGLLLLWK
                     QNETVVREFGMDEEEFADLKESWTVWKRLRSGSGLNAEIYDISWNASGTCVAVASLDH
                     TVRVFDVEKGSVVGHISEHNHYVQGIVWDPLGEYLVSQSADRSVVVCRVVYEGGQGQE
                     RGQVCGLELVNKIVKCELPRRKEGELVGPGPGSGERPGLDFESSRVGFLFHNETLPSF
                     FRRLCMSPCGSLLCVPAGIQAQPQAPAQSQPQPEAGAGSESAESQAGPLPLPLASQNT
                     LYIYTRGSLGSNKPLFSLPFLEKPALVARFNPVLFEGASRWVLLPYKLVFAVATTNEV
                     LVYDTQETAPIAVVGNLHYSPITDLAWSADGRLLMVSSTDGFCSYVNFGTALGNALGK
                     DLGTPVPKAIPEAQTMPGPNSKPGAETKPGPQTQASPSQAQASPSQTPATAKAKRRVQ
                     PTLVGEITDE"
     gene            complement(<145056..>145661)
                     /gene="CUE1"
                     /locus_tag="KLMA_20068"
                     /db_xref="GeneID:34714552"
     mRNA            complement(<145056..>145661)
                     /gene="CUE1"
                     /locus_tag="KLMA_20068"
                     /product="coupling of ubiquitin conjugation to ER
                     degradation protein 1"
                     /transcript_id="XM_022822602.1"
                     /db_xref="GeneID:34714552"
     CDS             complement(145056..145661)
                     /gene="CUE1"
                     /locus_tag="KLMA_20068"
                     /codon_start=1
                     /product="coupling of ubiquitin conjugation to ER
                     degradation protein 1"
                     /protein_id="XP_022674407.1"
                     /db_xref="GeneID:34714552"
                     /translation="MADQGTTLFFVLVITGYIALKWFMSNNEQHPSVQANGASSASST
                     NGASNGSSGNGSSGRRTPRPRRIRRPVNQDMIEVVQSLAPHLHPEQIRYDLEQTGSVE
                     ATVERFLSGREMPFPPDYQGEASTTNGTTSSSTDPRKRSNIKPDNLLQKYDVDPEEDM
                     SGVDASDLSINERKRLMVWKARKNMEKEVKKSEYLQKLLGA"
     gene            complement(<145948..>146460)
                     /gene="SAP30"
                     /locus_tag="KLMA_20069"
                     /db_xref="GeneID:34714553"
     mRNA            complement(<145948..>146460)
                     /gene="SAP30"
                     /locus_tag="KLMA_20069"
                     /product="transcriptional regulatory protein SAP30"
                     /transcript_id="XM_022822604.1"
                     /db_xref="GeneID:34714553"
     CDS             complement(145948..146460)
                     /gene="SAP30"
                     /locus_tag="KLMA_20069"
                     /codon_start=1
                     /product="transcriptional regulatory protein SAP30"
                     /protein_id="XP_022674408.1"
                     /db_xref="GeneID:34714553"
                     /translation="MAPRTHSNSESESKGKSESKSKSAAQSGSGSSTRAGVKQRLSSA
                     QQQYLKDLAKKHIHNNHRKNTPLANPVDFEQYSDDFLRRYKDRFQLDTPDNLSIQGYL
                     LSSNIGKHTYSYKRNHESMPDARITKQELARGVKEHFDNYTVREAECLPQFIYKVQNK
                     KKKFRMEFKG"
     gene            complement(<146718..>147716)
                     /locus_tag="KLMA_20070"
                     /db_xref="GeneID:34714554"
     mRNA            complement(<146718..>147716)
                     /locus_tag="KLMA_20070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822605.1"
                     /db_xref="GeneID:34714554"
     CDS             complement(146718..147716)
                     /locus_tag="KLMA_20070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674409.1"
                     /db_xref="GeneID:34714554"
                     /translation="MPPDLPLIDAHCHVSGNTRVQDDDDGIQRCLMSTNQTDLKAIRS
                     AKERLGGRVFAGFGVHPWYSHLFVELNKLNKLEHYSSVLRGPDSEAIAAQLPEPVPLQ
                     QYIDECLGQCQGTGQDTPQWASCIGEIGLDKVFRIPEPEPGPGSESSPKASPKASPKA
                     NPKTTLSRSRTTMDHQIAIFTSMLDLACAKRLPVSIHSVKCHGKVLEICTKKLLDSSV
                     NVCIHSFTGTLDTLHLWLATFPHERLFFSVSWIINVNRAQAQGQAASTNLLKHIPLQC
                     ILTETDCCVDVEPLDSQRRMLTRVLEAIAEAHSMSIEDAAATVQRNFARYIGETHS"
     gene            complement(<148170..>148763)
                     /locus_tag="KLMA_20071"
                     /db_xref="GeneID:34714555"
     mRNA            complement(<148170..>148763)
                     /locus_tag="KLMA_20071"
                     /product="DUP super family"
                     /transcript_id="XM_022822606.1"
                     /db_xref="GeneID:34714555"
     CDS             complement(148170..148763)
                     /locus_tag="KLMA_20071"
                     /codon_start=1
                     /product="DUP super family"
                     /protein_id="XP_022674410.1"
                     /db_xref="GeneID:34714555"
                     /translation="MTTPYLPLMKEGSENPPQLSRSKLGKDLGRGRFSHAKAEHPWAY
                     ASSIASIVIMILFIVAAVQEIRNGDEESILPLFHLLLSVVCFIVGAICMGIMFDPIPT
                     SRISEAQDALFFLKLIATGHSWDEVGRIMNSYLFERGIWWTNSCFYDSEQCYNFFVSY
                     SKGCADPAIEPFIEQAKSKLAESMAVQWEEIQVPGHS"
     gene            complement(<149057..>149668)
                     /locus_tag="KLMA_20072"
                     /db_xref="GeneID:34714556"
     mRNA            complement(<149057..>149668)
                     /locus_tag="KLMA_20072"
                     /product="hypothetical conserved protein"
                     /transcript_id="XM_022822607.1"
                     /db_xref="GeneID:34714556"
     CDS             complement(149057..149668)
                     /locus_tag="KLMA_20072"
                     /codon_start=1
                     /product="hypothetical conserved protein"
                     /protein_id="XP_022674411.1"
                     /db_xref="GeneID:34714556"
                     /translation="MTPPDSPFSPDRPLMKGESDNHPQLSRSKLGKERYGGSSVSYSI
                     AEHPTAFRFLIGTVLTIALLICAIVYYSVYSPSENGVGVCLFLLLFSIIIAIGSIIPI
                     MCKPATSDILKTPDDVLFFLKLIATGHSWDEVARIMNSYLFERGIWWTNSYFYDSEEC
                     YNLFVIYSKGCADPAIEPFIEQAKSKLAESMAQRWEGIGLSGV"
     gene            complement(<150036..>150626)
                     /locus_tag="KLMA_20073"
                     /db_xref="GeneID:34714557"
     mRNA            complement(<150036..>150626)
                     /locus_tag="KLMA_20073"
                     /product="hypothetical conserved protein"
                     /transcript_id="XM_022822608.1"
                     /db_xref="GeneID:34714557"
     CDS             complement(150036..150626)
                     /locus_tag="KLMA_20073"
                     /codon_start=1
                     /product="hypothetical conserved protein"
                     /protein_id="XP_022674412.1"
                     /db_xref="GeneID:34714557"
                     /translation="MTTPDSPLIKEGSENYPQLSRSKLGKDLGRGRFSHPTAEHPWAY
                     ASSIASIVIMIVSIGAIVHDVRSERQSILPLFYLLLCVVCFLVGGVCMAIMFDPIPTS
                     RISEAQDALFFLKLIATGHSMDEVGRFMNSYFYQRGIWWTDSYFYDGKQCYDFFVRYS
                     KSCSDPVIEPFIEQAKSKLTESVALQWEAIQVPGHS"
     gene            <151723..>155118
                     /gene="TSL1"
                     /locus_tag="KLMA_20074"
                     /db_xref="GeneID:34714558"
     mRNA            <151723..>155118
                     /gene="TSL1"
                     /locus_tag="KLMA_20074"
                     /product="trehalose synthase complex regulatory subunit
                     TPS3"
                     /transcript_id="XM_022822609.1"
                     /db_xref="GeneID:34714558"
     CDS             151723..155118
                     /gene="TSL1"
                     /locus_tag="KLMA_20074"
                     /codon_start=1
                     /product="trehalose synthase complex regulatory subunit
                     TPS3"
                     /protein_id="XP_022674413.1"
                     /db_xref="GeneID:34714558"
                     /translation="MVVIIASLFLPFQPQFEIHTSAVETATLVESQPVKVVDSEGLSA
                     LALSRKRSSSSHSRSPFVGLEMSAAPDEENSGQLGSQGQKEGSVPAAPVPIPMQSTEF
                     AHRRSDEVTKPVVAQPQISSELFMESLTGNSHGNSQGPGPHHGPIGGGPSVEEFFSSG
                     SPDSAMSIQSSPVVSSVHPSGMDSTSNLLKNVNRSLLYQTVLNESHSASALEGASKFF
                     RNSPGSTVITPRSRALPDVNASVSPLGKGGLHGKSQAQAQAPAIKHVHGSKPPSSNLK
                     YSSKASAEEEEGEFSSGGAHDSSSLEDTAVSETEEEPEPESTLEEEDEEELDDYDMDQ
                     LDSSERFHYYVPKFGGYSNNAKLRNALLKGSDNIFGTAPWSIVPSPKGNGGLKNAVST
                     ALLEKTVVEPVTWVGTVGIPTDSIPKSTLNAICEELGKNFHSRAVVTDDLTFKGAYKN
                     YCKQILWPTLHYQIPDNPNSKAFEDHSWNYYQHLNQLFADEIVKVYQEGDIVWVNDYH
                     LMLVPEMVREKLPKAKIGFFLHISFPSSEVFRCFPQREKILSGILGANSVGFQTDEYA
                     RHFMQTATRLLMTDVDGNQLRMQGRIVQVNDNPIGIDVFNLNQQIDTERVVQWRKLIR
                     ERWSDKSLIVCRDQFDRIRGLKKKMLAYERFLKENPEYIDKVIMIQICLGAARDVELE
                     RDIMTVVDRINAMSHDISISQPVVLLHQDLEFSQYLALNCEADLFIVGSMREGMNLTC
                     HEFVVCSKERNAPVLLSEFTGSAQILKRGALLINPWDIRSFALSIKQGLEMCPEEKRR
                     RWKKNFKSVVNHDSDNWITQSLHNINSSWEFNQERSQVFSLSVNEILSSFNKSTRHLF
                     VLKISEPPTPRMLKILSDLSTSSVVYIMNSNSRGVLERLYSRVPNVGLIAENGAYVRL
                     NGSWFNIVEQVSWKEDVIKVFEDKVERLPGSYIKAGDSMVKFHTENAEDSDRVQGVIG
                     EAMTHINTLFSDKGIHAYVHKNIVFVQEVGLSLKTMQFLLNYYNSVDDVSCAPQSPVK
                     QKSSAETSHSPLLSPISPRNGAGFFHVAPKRANSDPIDFLCVTGSSSPVIEPLFQFVN
                     ELSKNDKIRSAYSVVHGDTSSTYAKEHVKGLNELFSILQRLGQ"
     gene            <155847..>156317
                     /gene="TIF11"
                     /locus_tag="KLMA_20075"
                     /db_xref="GeneID:34714559"
     mRNA            <155847..>156317
                     /gene="TIF11"
                     /locus_tag="KLMA_20075"
                     /product="eukaryotic translation initiation factor 1A"
                     /transcript_id="XM_022822610.1"
                     /db_xref="GeneID:34714559"
     CDS             155847..156317
                     /gene="TIF11"
                     /locus_tag="KLMA_20075"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 1A"
                     /protein_id="XP_022674414.1"
                     /db_xref="GeneID:34714559"
                     /translation="MGKKNTKGGKKGRRGKNDSDGPKRELIYKEEGQEYAQITKMLGN
                     GRVEATCFDGIKRMAHIRGKLRKRVWMSQGDIILVSLRDFQDDQCDVVHKYNLDEART
                     LKSQGELPENAKINETDNFGFESDDEVNFEFGNADSDDEDEDDDEAGDFDIDDI"
     gene            complement(<156564..>157628)
                     /gene="NIPA2"
                     /locus_tag="KLMA_20076"
                     /db_xref="GeneID:34714560"
     mRNA            complement(<156564..>157628)
                     /gene="NIPA2"
                     /locus_tag="KLMA_20076"
                     /product="magnesium transporter NIPA2"
                     /transcript_id="XM_022822611.1"
                     /db_xref="GeneID:34714560"
     CDS             complement(156564..157628)
                     /gene="NIPA2"
                     /locus_tag="KLMA_20076"
                     /codon_start=1
                     /product="magnesium transporter NIPA2"
                     /protein_id="XP_022674415.1"
                     /db_xref="GeneID:34714560"
                     /translation="MEDKYIGLFLAVTSSLAIGSSFIFTKLGLNAASEQNNFQGAGLD
                     YLKNPIWWGGMTLMVIGEVANFAAYTFAPAIMVTPLGALSVIIGAVLAAIFLKEELGL
                     LGKLGCSICLLGSVIIVLHAPSDKEIETVDEILRYAMQPAFVFYVVTVAIVSLYMIYK
                     VVPRYGTTNPMVYISVCSLVGSVSVMAIKAFGIALKLTLSGNNQFTHISTYVFIVVVV
                     VCIVTQMNYFNKALDTFDTSIVNPLYYVTFTSATLTASFILYRNLDDSDAKDSISLVC
                     GFVIIFIGVYLLNLSRKWSNHGAHGPHGLPLHQSDPLDLEQIPLETRVPQENRHQRKI
                     SSTSSYLGDNVEHEDDGFEI"
     gene            complement(<157905..>159473)
                     /gene="SIF2"
                     /locus_tag="KLMA_20077"
                     /db_xref="GeneID:34714561"
     mRNA            complement(<157905..>159473)
                     /gene="SIF2"
                     /locus_tag="KLMA_20077"
                     /product="SIR4-interacting protein SIF2"
                     /transcript_id="XM_022822612.1"
                     /db_xref="GeneID:34714561"
     CDS             complement(157905..159473)
                     /gene="SIF2"
                     /locus_tag="KLMA_20077"
                     /codon_start=1
                     /product="SIR4-interacting protein SIF2"
                     /protein_id="XP_022674416.1"
                     /db_xref="GeneID:34714561"
                     /translation="MSITSEELNYLIWRYLQESGHEVAALAMEEETRVLEFEQRFKEH
                     IPVGSLVHLVQKGILYSESELLVGPEGKLRTLGPEERENYKRNFTLVQALEVDKQRYP
                     ELVSKGRFELENDVEAKLLAEKEEAGASGAGAGASGPGGSGTTSGNGSSFIKTLSERL
                     TVPDSFVCEWSPVQEDAVALGGSNATAKIAKVVDWALQDSVELVHPIRGQAGSTEVIS
                     LWWSHDGELVLTGTRQGELRLWNKQGKLKNILDSHRSPIVAAKWNDDCTHLLTTDVSN
                     VVILWSTLTGTQLQHFSFTEDESAAAGGTDGPTDTDSMQQQPDSLGIALEWIETDKFV
                     VPGPSGSLLVYTIGDNKPLGRLLGHKSTITALHFNPVTKSLLSASDDDTIKIWKGGNV
                     NPSLDFSPHKKTISSADWLTDDLVVSTGYDGAVKVWSVSQNTSICETNLDSEPIFEAS
                     LSPNKEWLAVGTLQGSAIVLDMRNCNSESLKSAYAEYQPDHDGLQVTNIAWNSHSSAF
                     AVSYIDGTTTLLEL"
     gene            <159821..>161983
                     /gene="EXO84"
                     /locus_tag="KLMA_20078"
                     /db_xref="GeneID:34714562"
     mRNA            <159821..>161983
                     /gene="EXO84"
                     /locus_tag="KLMA_20078"
                     /product="exocyst complex component EXO84"
                     /transcript_id="XM_022822613.1"
                     /db_xref="GeneID:34714562"
     CDS             159821..161983
                     /gene="EXO84"
                     /locus_tag="KLMA_20078"
                     /codon_start=1
                     /product="exocyst complex component EXO84"
                     /protein_id="XP_022674417.1"
                     /db_xref="GeneID:34714562"
                     /translation="MVDFSLKKRSVSTWRGSLGRRQADSDSTSTFKSSRYQDMKVSDT
                     ELPKVSAKERSKAGTMMKRRLSVHQPGNVKVDYDSMPAMPAMPSGVMADEQFPARNSS
                     LLSLSTQQRMQQRMNNSDLYSGKALKQLLSDPSFKAKRFVTERLGDATAVEIDQFTSS
                     LNDLSLEIQDEIKANIDKSFKEILTVNKDLETATSELKVLRTKVHDVKEVMSQFVSMA
                     EKRLQLEQQAQGQLHESDLSRTPSTASSFNGNGHVPSLLPAVKPGSRKDRTSTMILER
                     MWNEQLLQLFKNVEGAHKFITNTPGRHILLDSDNWTEINAATLKPLQKARIFILNDVV
                     LIASPKPSKLQSSNNSVGELTVSKFSPLRELSCEQQSPTEITFTLSNNKQRALYGNRD
                     PEACSKVMETIRQAKDALLEISQAEEDNTRKIRNSYTLLQQERTPNPNREATTSPIKM
                     HGRSRSDAQQQFPTQNQSQNDALLTSITRSMHVRSGGANNDISEVSKKLKRLDDALED
                     MDLEIGRQNFDLAITKLNHIQTSLKSLYSTATFDESVMVELLSLKCLQRKNVLYNKLT
                     NLLASESSDVSKLKSYMLNLIALNEPVDALEVFLQNRSNFINDLILQIGIIDNVTSFI
                     TQIAIIRFQTLRKVTEQYLEVSKHLKRDFTSLLVCWCSEEVDKHFQLMERELSNQSTL
                     SVQAIKMTRKQIDELKNVGMDYVYKLDDFIRRNNNKIH"
     gene            <162377..>163249
                     /gene="FES1"
                     /locus_tag="KLMA_20079"
                     /db_xref="GeneID:34714563"
     mRNA            <162377..>163249
                     /gene="FES1"
                     /locus_tag="KLMA_20079"
                     /product="hsp70 nucleotide exchange factor FES1"
                     /transcript_id="XM_022822615.1"
                     /db_xref="GeneID:34714563"
     CDS             162377..163249
                     /gene="FES1"
                     /locus_tag="KLMA_20079"
                     /codon_start=1
                     /product="hsp70 nucleotide exchange factor FES1"
                     /protein_id="XP_022674418.1"
                     /db_xref="GeneID:34714563"
                     /translation="MEKLLHWSIANAQGDSEAVARAGQPDPKLLEQLFGGGPDEPTLM
                     KHAMAVISNPEATLENKLTAFDNFEMLIENLDNANNIENLKLWEPLIAVLDSPESELR
                     AFALSVTGTAVQNNEKSQNNFAKYDGSLAKVMQIAGNAQEDAQVRIKAFYTLSSLIRH
                     NKEIYKQFYELDGLKLIAPVLNDANANEKLKLRVMALLSTIMTVADVKDAKFLSLLRD
                     DNIISSTLSFLQPESNLYLIDRVLNFLAQLIDIGFEFSASELEQLKAGVHNIKPVEDR
                     LNEDDYKTVQYVFK"
     gene            complement(<163433..>165568)
                     /gene="EME1"
                     /locus_tag="KLMA_20080"
                     /db_xref="GeneID:34714564"
     mRNA            complement(<163433..>165568)
                     /gene="EME1"
                     /locus_tag="KLMA_20080"
                     /product="crossover junction endonuclease EME1"
                     /transcript_id="XM_022822616.1"
                     /db_xref="GeneID:34714564"
     CDS             complement(163433..165568)
                     /gene="EME1"
                     /locus_tag="KLMA_20080"
                     /codon_start=1
                     /product="crossover junction endonuclease EME1"
                     /protein_id="XP_022674419.1"
                     /db_xref="GeneID:34714564"
                     /translation="MDEVKIIDINDTTELSIGDSKQTKNDVVVLISSEGDDAKSPSND
                     NLYDKLTRSFADSIISQPVEDDDVVLLENNASISFSFEVEGRFQNDTAIESQEEEKEV
                     DHGAKSDRQTQSQLTQNFKRSQSRLLDDIENSPVSLSLLSDDEEDCQPPPSRGQLSQK
                     VLVTIPQSSPIGSRMGSYNYNAVTSSPTLRKTQSQIHKPIRTKPINERTESPISPISG
                     NNKLRRPYSGSLPLPRTNLYSNSSSIRKDAANASTDLSSVALDLTKYMDYNDNSRKVK
                     KRRKSPEANGEDSMIIDSDDSYLVKDNERPLFVENSSQSTPVNSKKRSIKYTEDDNLD
                     EGLIMVNARPFSDQEYHEMTKKCLSSSEMKKLYNECNKVTRTEESIANEMVLTINHKI
                     MNLIQSKHISLADDLKPLTIINNYEEFPIIRFKRKCTSIYDQTHGIFYPCEETIADES
                     ICVLVYEALPFFHRYRTDKKGLWDEIRQFSKNGMKVIVVIYGQNALRKKMCNMENRQH
                     ENRVLESLPRSASSQTQTQSQSQSQSQSQSQNVNLNFTLTQSQPSKPRGRKPTLEAKI
                     KELNMRSKDLERVINEVTIYANVDVFPIENLNEFSNWMKNLVWVVGKMRYDVSVKYKE
                     WSHLNVKSGKSPTDVLFNFLKQIAHVNEPKAKRVVSHYKTFQSLADDMKAGYVARSND
                     DKPLMLKSLERALHTLYTSDNPNDLIFTD"
     gene            complement(<165850..>168804)
                     /gene="SEC8"
                     /locus_tag="KLMA_20081"
                     /db_xref="GeneID:34714565"
     mRNA            complement(<165850..>168804)
                     /gene="SEC8"
                     /locus_tag="KLMA_20081"
                     /product="exocyst complex component SEC8"
                     /transcript_id="XM_022822617.1"
                     /db_xref="GeneID:34714565"
     CDS             complement(165850..168804)
                     /gene="SEC8"
                     /locus_tag="KLMA_20081"
                     /codon_start=1
                     /product="exocyst complex component SEC8"
                     /protein_id="XP_022674420.1"
                     /db_xref="GeneID:34714565"
                     /translation="MLGTEWNRIITKDTNPLELALRFLDETSVGLHHRFGEFIELKSR
                     FARDLQEVANDNYQAFNDSVASFSKTVDCITDAQDTLADIKTGVSNSLQKLAIKDETL
                     NDLNEDFMKQSKMISTLTAMEEVIRANEKVEKALMNSDFTEAQEALSLGFTLAKEHDL
                     WELDVMKNIRDQFTSHELTLFELLLESITDIVYSKRATHVGDDQSMFSGEKTEDTFGS
                     LENYLHHVIHEDISEESYKKNLLLREFLKKLGQAQSDDDEFAVNEETDYDKLFSYMKT
                     LHLMNKLPLALELLQKKSKAEIKNIVTKSVDDMRLKHPSILKITASLQNNNTNNANLG
                     ISGQDILSVLIRRLFWDTFIKFLTAVQNHYALYEITKALQPPATSNISYPFVEIWNTI
                     FRVAKDLISNYTKDPALVRNVRQKRRGSSNLLQVKGTSEGQIFSLQSNIEKDNNSQLG
                     HANELKSMLTEMFPGFALSTNIDLENIYLTEEKYEADETLVPPSVFNMRMILESLLVF
                     VQGSKDLLPPSLEEKTISATEFFLDLMELDFLPQLSQTMNHLYDTQVESNVPFAVEKF
                     VNGTPILKSAIDFKNLFFTMLQTTNASNFYRNNVASILVSILEKFYNYYYSIYQSICG
                     TANTVVSKKLISGWLTDKAAGKITSKIFSGDKSFVDAETQRLLEQCPRVFQSQTTLGK
                     SDYFSDATIDTLIHFATTLEWISSWLPDLMKEVKDTEPANIDRRKDVSHTELRSMWSF
                     FEVSEVDLSDKTASLKFLLAGQNMKKFQNVTEKLRNLHYLILQSVRYDVRVRCLYHIN
                     QMFYASKWNPEVTSIELDENISSLVSDLSFLHNKLKAAFTAEHSILVFIGISNFMNHA
                     LITGSKSITILNVHGAKKLLRNVNALQQACKAATDGGDTEDLSKSISFFTICSLDSEN
                     VLEYFQKGELNGLTKEDVKNALRLVFSEELHRQSKRQSGTNHRTISMSASKRLEDAIK
                     KADQFLTSKGLD"
     gene            complement(<169270..>170139)
                     /locus_tag="KLMA_20082"
                     /db_xref="GeneID:34714566"
     mRNA            complement(<169270..>170139)
                     /locus_tag="KLMA_20082"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822618.1"
                     /db_xref="GeneID:34714566"
     CDS             complement(169270..170139)
                     /locus_tag="KLMA_20082"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674421.1"
                     /db_xref="GeneID:34714566"
                     /translation="MSVPGRKRKNRKSVRQGLEGHRQNRGTDQRYAPGRRESVSSNRV
                     QATNVGSMLHDESDVISFRQCLKNEVIASSRLLDLLTTQAIPLDKIQPPEMFPKGALE
                     FMMQQLETQKRIIEDARRISESKVAAATQLDDNVRFYKEGIDVLADKLYDPETVKRVE
                     SEFRDKFKLQITSGNVVFHKNKFSQLSSNRTKAPSDYWEKYKRRLEEQKEEERRIKEQ
                     EEERKRQEEMALSVDPISSDLTSAAKNDEVEQQQLSVPDPNDPNLLDDVFGEEPFQND
                     FDDGFGDLDTAFF"
     gene            <170970..>173435
                     /gene="DAP2"
                     /locus_tag="KLMA_20083"
                     /db_xref="GeneID:34714567"
     mRNA            <170970..>173435
                     /gene="DAP2"
                     /locus_tag="KLMA_20083"
                     /product="dipeptidyl aminopeptidase B"
                     /transcript_id="XM_022822619.1"
                     /db_xref="GeneID:34714567"
     CDS             170970..173435
                     /gene="DAP2"
                     /locus_tag="KLMA_20083"
                     /codon_start=1
                     /product="dipeptidyl aminopeptidase B"
                     /protein_id="XP_022674422.1"
                     /db_xref="GeneID:34714567"
                     /translation="MVNETRLDEESEVPEFRLDSVQLKNSRRKSAFVTSCFSLAAVLF
                     SAYLFISIVSSVQSSNGVSRIPSLQQNITRDGSLKVSFANVRNKTFQPVLKPLQWIST
                     SDSKENDKGLFVTLENDTYSVRSVLDEKYSRSIFEGTSFVFEGKNRTVDGVVASPDLS
                     KVLIKTNTEKNWRHSSFATYFVYDDGKFYEIGEQISIAKWSPNSKDIVYVKKHDIYLY
                     SCESFKTVERVTKDGSELVFNGIPDWVYEEEVLEGDTALWWSPSGDYLAFFKINETGV
                     QEFPIPYFVQENQTDPAYPEVRKIKYPKSGSVNPVVRLNVFDLKSKVSFEANASSAES
                     LITEVTWIGNHQILAKTSDRSSDVLSVYLIDALEGGNSELSRKEESNGGWWEITHKTK
                     FIPKDKKNGRPHNGYIDLVPIKGYNHLVYFTGSDKIVLTSGDWEVVDGPAAFDEESNT
                     VYFIATKKASTERHLYYVRLGEPLKVHAVSDVHSDGYYSASFSAGARFLLLNYLGPNV
                     PYQKIIDLKSSEKDKVTHGNVVGKTLYYLEENKKLQEALKPYAIPERTFQELNLGLDD
                     EGKEIIVNSCEILPNDFNPSLKNHYPVFFFAYGGPNSQQVAKTFGVGFNQVVASQLDA
                     IVVIVDGRGTGFKGKEFRSIVRDNLGDVESTDQILAAKLYGNKPYVNKEKISLFGWSY
                     GGYLTLKTLEKDAGAHFKYGVSVAPVTDWHLYDSVYTERYMHTPQQNPDGYAKCKVHN
                     ATGFATVPRFLLMHGTGDDNVHFQNSLKFLDMLNLNNIENYDVHVFPDSDHSIRYHNA
                     DVIVYNKILNWIRHAYNGDFLLQ"
     gene            <173881..>176898
                     /gene="RPN1"
                     /locus_tag="KLMA_20084"
                     /db_xref="GeneID:34714568"
     mRNA            <173881..>176898
                     /gene="RPN1"
                     /locus_tag="KLMA_20084"
                     /product="26S proteasome regulatory subunit RPN1"
                     /transcript_id="XM_022822620.1"
                     /db_xref="GeneID:34714568"
     CDS             173881..176898
                     /gene="RPN1"
                     /locus_tag="KLMA_20084"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN1"
                     /protein_id="XP_022674423.1"
                     /db_xref="GeneID:34714568"
                     /translation="MAEDKVTKESAVPKAEEKAAEIPEDNKDNKDVKDKKTDGNGEEE
                     LSEEDQKLKDDLELLVETIKGTDVKLYKGALEQLKDSIKNSTSSMTAVPKPLKFLRPS
                     YPELKEVYELWTDESLQSLLADILSVLGMTYSDEGKYDSLKYRLLSNEKEIESWGHEY
                     MRHLALEIGEVYNRQVEKEADESSPEPDADFNQEELVSLSLEIVPYFLKHNGEADAVD
                     LLLEIESIEKLPQFVDDAIYHRVCQYMVACVPLLAHPDDISFLQTAFSIYLSHNELTE
                     ALYLAIRIGDESLVRSVFDATSDPVMHKQLAYILSAQRSAFQQADVQDIIGHVELSEH
                     FRYLAKELNLQQPKVPEDIYKSHLESSKASFNKTSMSSAQQNLAEFMVNGWLNLGYCS
                     DNIYSKDSNCVYKTKGDGMTSAVASIGSIYQWNLDGLQELDKYLVTEDIEVKAGALLG
                     IGISTCGVHDGDVEPALLLLQEYVTNPNTKLSTAAIIGLGIAFAGSNNDELLGTLVPV
                     AADTSLPIEVCSMACLSLAHAFVGTCNGDITTTIMDNLLERTPEELKTHYTNFFALAL
                     GILYMGQGEQVEDVLDTISAIENPITSAIEVLVTACAYTGTGDVLMIQDLLHRLTPKK
                     DSKDDEDDEGDEDDDEDIDAEMPGVLPTEIQNGLGLGLQDLQNAAAPGGPTAATTVGN
                     ETEEAPAPGAIEDVVMKGTEEEGEGEGETDDKAKKDDKEDKDEDSSEHHEEEDKKSDK
                     NSKAAELAFAVLGIAMIAMGEEIGKEMSLRHFGHLMHYGSDEIRRSVPLAMGLISVSD
                     PQMKVFDTLSRFSHDADLSVSMSSIFSMGLCGAGTNNARLAQLLRQLASYYSKESDAL
                     FMTRLSQGLVHLGKGTLTLDIFNDAQVLNKVSLASLLTVLVGMISPEFMLKNHSLFFY
                     LNSATKPKYIVTLDEEGNPIKASVRVGQAVDTVGQAGKPKTITGWITHSTPVLLGHGE
                     RAELETNEFISYNSRIEGVVILKKNPKYTEEVN"
     gene            complement(<177139..>177774)
                     /gene="VMA16"
                     /locus_tag="KLMA_20085"
                     /db_xref="GeneID:34714569"
     mRNA            complement(<177139..>177774)
                     /gene="VMA16"
                     /locus_tag="KLMA_20085"
                     /product="v-type proton ATPase subunit c''"
                     /transcript_id="XM_022822621.1"
                     /db_xref="GeneID:34714569"
     CDS             complement(177139..177774)
                     /gene="VMA16"
                     /locus_tag="KLMA_20085"
                     /codon_start=1
                     /product="v-type proton ATPase subunit c''"
                     /protein_id="XP_022674424.1"
                     /db_xref="GeneID:34714569"
                     /translation="MSKHVSGSRAAWGYTKSAINYTVITIVLVYVLYKLFTNHGEDIN
                     FGKFLLKTSPYMWANLGIALCIGLSVVGAAWGIFITGSSIIGAGVRAPRITTKNLISI
                     IFCEVVAIYGLIMAIVFSSKVTVAEPETMFSKSNLYTGYSIFWAGITVGVSNLICGVA
                     VGITGATAAVSDAADSSLFVKILVIEIFGSVLGLLGLIVGLLMAGKAVEFK"
     gene            complement(<178272..>179345)
                     /gene="THR1"
                     /locus_tag="KLMA_20086"
                     /db_xref="GeneID:34714570"
     mRNA            complement(<178272..>179345)
                     /gene="THR1"
                     /locus_tag="KLMA_20086"
                     /product="homoserine kinase"
                     /transcript_id="XM_022822622.1"
                     /db_xref="GeneID:34714570"
     CDS             complement(178272..179345)
                     /gene="THR1"
                     /locus_tag="KLMA_20086"
                     /codon_start=1
                     /product="homoserine kinase"
                     /protein_id="XP_022674425.1"
                     /db_xref="GeneID:34714570"
                     /translation="MGRNFKISVPASSANIGPGYDVLGIGLALFLTLEVSIDPKNASL
                     TNQDRNNCKLSYTPESDGYATVPLASDENLITRTALYVLRCSGIRSFPSGTQILVHNP
                     IPLGRGLGSSGAAVVAGVMLANEIGQLHFSKQRMLDYCLMIERHPDNITAAMMGGFVG
                     SFLRDLTPQEVERREIPLAEVLPEPSGGEDTGLVPPLPPTDIGRHVKYNWNDKIKCIA
                     IIPDFELSTSDSRGVLPQAYTTKDLVFNLQRLAVLTTALTLDPPNPDLIYPAMQDRVH
                     QPYRKTLIPGLTDILSSVTPQTHPGLLGICLSGAGPTILALATENFEDIAQEIINRFA
                     KNKVTCTWKVLDLAYDGAETTYD"
     gene            <180215..>181426
                     /gene="MAS2"
                     /locus_tag="KLMA_20087"
                     /db_xref="GeneID:34714571"
     mRNA            <180215..>181426
                     /gene="MAS2"
                     /locus_tag="KLMA_20087"
                     /product="mitochondrial-processing peptidase subunit
                     alpha"
                     /transcript_id="XM_022822623.1"
                     /db_xref="GeneID:34714571"
     CDS             180215..181426
                     /gene="MAS2"
                     /locus_tag="KLMA_20087"
                     /codon_start=1
                     /product="mitochondrial-processing peptidase subunit
                     alpha"
                     /protein_id="XP_022674426.1"
                     /db_xref="GeneID:34714571"
                     /translation="MTETLELLGDNYQCSSSREAMMYQSSVFNPDVEKMLHLMSETVR
                     FPKITEEELEEQKTTALYEIDGVWQKHDLILPELLHQTAYSGETLGSPLLCPKELIPS
                     ISKYYLADYRNKMYNPENIVAAFVSVDHDKAVKLTEKYFADMKSKHPPLTRKAAVYTG
                     GEQCIAPGPVFGGLPELYHMQLAFEGLPIDHPDIYALATLQTLLGGGGSFSAGGPGKG
                     MYSRLYTQVLNQYYYVENCIAFNHSYSDSGLFGVSISCVPQAAPYAAEIIAQTLSNIF
                     ANEKTKLTEEEVGRAKNQLKSSLLMNLESKIVELEDLGRQVLLHGRKVPIEEMVENIE
                     KLTVDDIKRVAETVFTGKVKNPGNGSGKATIVMQGQRDSFGDVETVLRYYGLGNYPKL
                     EIPQPKKKGWF"
     gene            complement(<181644..>187229)
                     /gene="MYO1"
                     /locus_tag="KLMA_20088"
                     /db_xref="GeneID:34714572"
     mRNA            complement(<181644..>187229)
                     /gene="MYO1"
                     /locus_tag="KLMA_20088"
                     /product="myosin-1"
                     /transcript_id="XM_022822624.1"
                     /db_xref="GeneID:34714572"
     CDS             complement(181644..187229)
                     /gene="MYO1"
                     /locus_tag="KLMA_20088"
                     /codon_start=1
                     /product="myosin-1"
                     /protein_id="XP_022674427.1"
                     /db_xref="GeneID:34714572"
                     /translation="MSYSESLEHSQGQGQQKERFWVPDEREVFLQGHLVEWKTSTNKR
                     GQEEKVAVVCVNGKNEEYLEEEIAPVNPSSFDKVDNLSELTHLNEASVLFNLENRYQD
                     DLIYTYSGLFLVAINPYSNIKIYNNSYMKLYHGSPKEDNKPHIFAVAEQAYQNLLHQK
                     QDQSILVTGESGAGKTENTKKILEYLASITTDDKLLLNQTQESFERKILQSNPILESF
                     GNAQTVRNNNSSRFGKFIKIDFDEYGKINGAHIEWYLLEKSRVIQAHPRERNYHIFYQ
                     VLTGMSKQELRAIELESNSILDYQYLKNSNPSIPGVDDAQNFQELLSAFDIVGFSKDD
                     IQAILKCISIILHIGNIEFVSERSEQASIKNDIKPLCKLIGIQENDFKTAVLKPRSKA
                     GKEWVSQSKNASQARSILNSLSRSLYEKLFEYIVNQINKSLEHGSMTEYSIGLLDIAG
                     FEIFKDNSFEQLCINFTNEKLQQFFNHHMFVLEQNEYQKENIQWSFIDYGKDLQSTID
                     LIEQKKDIPGILPILEEESILPKSSDDSFYSKLISSWDNKSTKFKRSKLDNCFVLKHY
                     AGDVEYNVTGWLSKNKDPLNENLLQVLSSSSNALVSQFFADHIRGSSFRTSSTKHREQ
                     LSTLIQELGNTDPHFVRCIIPNNKKKAREFDKKLILDQLRCNGVLEGIRIARDGYPNR
                     IFFKEFFQRYKILSDEYRFTTSSKKNCEILLSSLHLDPTIYKVGNTKLFFKAGVLANL
                     ELLKEQRLCAAVTKFNALVSGKNVRKEIKSQLRKLQAARVLKVTFETYDRLMENPWYN
                     LYMKLQPLLDSSNDIVKTKKIAEQVKQLELKLSESEKDKTAISEAKSMVEQELENIRS
                     VLNTKVEELNKTQDLLVTTQTKHSELQSKWEETVKLKETIQTQNTSLNEELDSLRLQL
                     EEAQAATVSSRENYDSLNNDKQKLEEAFAELEAKMDDLKQEENTLDSEKADLLKQVDS
                     LKAEIENKEALVKEMETKLKDSEIAIDVKLKSLEKNLASTSKRMKGFVEENSELVSQI
                     NILKTDLNTKTKLLEKRTDELNRLNAKLATHESMVNDLSNEKESLLNEVSTLSKELKS
                     LRQENDSNKWKLESLNEQYQRELEKLNEQSNNSHVDNGEVDALRKELLQEQSLNKFLN
                     DRLVSASKSNKTINGFASSLDNDLRDEFDKMSLKYKEIEQQLSNEIEEKKTLISRLRF
                     AETRLASASFDNQTLVAQLKKIKELTKATIGESKLDNELQNIDRFEINQEKMLLEVDF
                     LKKQLEKEMEARKSAERVAIALHQKFSQIERSDSSADIYKLRYEAKEDYVKSLESRLN
                     PSSPLKDKTNVTNGDIFKHRESFEKYEEEVQRYKVEANRMHSLLNEYQDKINELTLSY
                     NKSMITETSLKEQVAHLEDELKTIEQQKTMIQSNSKRYQAQYEGSQRDLIAVEGEVRA
                     VKHGLKQAEKDIESMTQMIQKLRSQNKQKEQEIWKQETQITELESVLDEKTIELDKCT
                     ARNKALEEDIAHYKERARAVENNKEYLDQIDSLRGELDKHLRLETEMKKEISNLGYQL
                     ETLKLDSDAKIEDLLKQTNHYENLVSELGIQRDEAEAAKKTLETNLKTLEVKVSNMEE
                     NIRSLSGENHQLQEERKFLREKLEEAGNDVSKSLKEKEKYSHDVQFLEESLALQKQQT
                     ERNEALISELQTTVDSLKKSLSTEKDKNGDLFQENSSLGKANDMLRNELLEAKNKLAD
                     TSEKEAWFNKVQDLEKHLEEERTSKFEEVKKSRKLERIIEELEKKNEEQANVIEQANE
                     ARAKFEGTVGNLDEKLGELEAMNASKDTALSKLHRDNVYYQEQITELEREIQSWKERY
                     EKLSDRRQSLAQSTEGVFI"
     gene            <188046..>189998
                     /locus_tag="KLMA_20089"
                     /db_xref="GeneID:34714573"
     mRNA            <188046..>189998
                     /locus_tag="KLMA_20089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822626.1"
                     /db_xref="GeneID:34714573"
     CDS             188046..189998
                     /locus_tag="KLMA_20089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674428.1"
                     /db_xref="GeneID:34714573"
                     /translation="MSERRDESFNGMLFETVPYGELSRRDIMARYFNLSAPIGHSGVP
                     FPQQVYQTERASDIGKESVFKRSSGGEEILGEKILNLPIEIKVEITKNLSQYDLVNLA
                     SVSKSFYDAAMFSLYENVVVDASYSILNDSLRTDKNLRCTYIKTRYNLKKFMKSLCAD
                     ELETAFPLGILVKSLKIINLPDGVSNSEIVNFVHKSIQSLSRLSCLYWESGSRKLPLD
                     TLKYLPNKKELTSLGINLDLSKCGDSKIEFPQLERLSVVPFNNSETLCKFMNQISIDK
                     IADRIRVLQLGRQLASMKQINKSNLNLGQSLIVTKYMIDNNLPRPDAVGTDYTATMNG
                     IDFEFWDFLNPIVQDEKLNGSRRRRFKQLEILDIDSVNILANDSEKVISAINLSKLHT
                     LSLNNVNEIQWLPEVDFQLTDFTSAATENFRKGLLISIAPHLKHLKQLRLDYQEAYRD
                     SIPQFLGLLAKNNVLLDEIDLTITWDDSKLATVMSWEKLMENYATAICKHSSTLKKLS
                     IVTKESLRYCDVPKQIPVDSVLKLTQCTKLESLRINGDSLQPSGIHLLHKFPRLRFLS
                     LCGESSGGPRHMGLQMAHDGIMDDWYRVMHVALTLAQANKNLQFVKIDRCLFECGKSG
                     NAIPRPDVLNDWFTKQTRVTISEDQF"
     gene            <191521..>192702
                     /locus_tag="KLMA_20090"
                     /db_xref="GeneID:34714574"
     mRNA            <191521..>192702
                     /locus_tag="KLMA_20090"
                     /product="ras-related protein rapC"
                     /transcript_id="XM_022822627.1"
                     /db_xref="GeneID:34714574"
     CDS             191521..192702
                     /locus_tag="KLMA_20090"
                     /codon_start=1
                     /product="ras-related protein rapC"
                     /protein_id="XP_022674429.1"
                     /db_xref="GeneID:34714574"
                     /translation="MTSNVILFEERCECESKLPGEIDVLTSKVALIGDSSVGKTCLVG
                     RWVKGHSVLQDIDETGDHVEDLYHKTVDYNVLMKSHSFQEYSKLLTTTVVPQMKRDKN
                     GKPIPRPKMNYNVNTKLDAQVIDVTDFDVTDYSDIRQLQVNQADGFILCYDTTNPMSL
                     ADMTLYQRIITRIKGDNVPIIVCGTKIDCLQERKVSEEEAMNLCEEMGIDYATCHFET
                     SAMENINVNETFFAILCLIENRRIANSAYTGCNGIDCPMKKERELHLNGDSSPKQDHS
                     DLNESHTKSTGSSSSNSSQHNSHIKASPLNIVQSIKEEHLSSPDSSVSMLEGRASTSK
                     PVVLTKEDVVSTYQTAKLPTGKSSTGPSVRTFEDPLTNVSGETKKNKKSHSQSACCII
                     S"
     gene            <193336..>194168
                     /locus_tag="KLMA_20091"
                     /db_xref="GeneID:34714575"
     mRNA            join(<193336..193338,193923..>194168)
                     /locus_tag="KLMA_20091"
                     /product="ribosomal protein S27"
                     /transcript_id="XM_022822628.1"
                     /db_xref="GeneID:34714575"
     CDS             join(193336..193338,193923..194168)
                     /locus_tag="KLMA_20091"
                     /codon_start=1
                     /product="ribosomal protein S27"
                     /protein_id="XP_022674430.1"
                     /db_xref="GeneID:34714575"
                     /translation="MVLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNIT
                     TVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK"
     gene            complement(<194442..>196640)
                     /gene="RSM22"
                     /locus_tag="KLMA_20092"
                     /db_xref="GeneID:34714576"
     mRNA            complement(<194442..>196640)
                     /gene="RSM22"
                     /locus_tag="KLMA_20092"
                     /product="37S ribosomal protein S22"
                     /transcript_id="XM_022822629.1"
                     /db_xref="GeneID:34714576"
     CDS             complement(194442..196640)
                     /gene="RSM22"
                     /locus_tag="KLMA_20092"
                     /codon_start=1
                     /product="37S ribosomal protein S22"
                     /protein_id="XP_022674431.1"
                     /db_xref="GeneID:34714576"
                     /translation="MLRFGRTFRLPIKSTFAARLNSSLADSSNNFAELVDRKSPDSRS
                     TFGFVVDGTQQDNVRVVERDELLNNSVKGEYRDKMGNLLQGLNAEEARLLPQTLEGRA
                     FRQQIQLSHTVTEAIQHNIMSLHIPNNLRRAASKYFVELYERSLHRPTSSNMEVDSHI
                     ASIFVQNYAAIYQSLSELKKRVGKDFNPQRVLDVGYGPATGIVALNDLMGKEYRPKVK
                     EATIIGHLEMQKRAKLILSRQLNEIPDDLLYAEEKSYTDPPKKDTEEEVEEEEEADNI
                     DAQDEMLGEVATKSIRINTRLRKDVPGSNEYDLIILTHQLLRHEERFPAQIDDNLDHY
                     LKLLSPKGHLVIIERGNPMGFEIIARARQFMIRPENYPDEHGKIPRPWNRGNKMMGRA
                     SYRSVPVENEEPTIESLNLDDEEYLELAQSLDSKYGPVKAEDLEFEEDLLKSMETEEE
                     PNEENYHIKIIAPCAHHRKCPLQIGKPHYYDLSEGSKLNFCNFQKTVLRPKFTIELKK
                     GKILATPWQTPTDGIGIKGKSSAGSGRKNGRGFEIVNYSYLIAERSAKDRETSQSIKA
                     EREENKTKYDIGSLGDNTANTWPRIIKQPIKRKGHVTLDLCAPSGNFEKWTVPRSLDK
                     NIYHDARKAQKGDLWALEAKTKIQGGGALNVKKLEKLHKEEIKKMKNAVKVKSRELKD
                     IANQLDQEKEDLDPQSAVDALAKFHQHNFHLENAKKEKKYANRKLAVDEY"
     gene            <196995..>197744
                     /gene="SRP102"
                     /locus_tag="KLMA_20093"
                     /db_xref="GeneID:34714577"
     mRNA            <196995..>197744
                     /gene="SRP102"
                     /locus_tag="KLMA_20093"
                     /product="signal recognition particle receptor subunit
                     beta"
                     /transcript_id="XM_022822630.1"
                     /db_xref="GeneID:34714577"
     CDS             196995..197744
                     /gene="SRP102"
                     /locus_tag="KLMA_20093"
                     /codon_start=1
                     /product="signal recognition particle receptor subunit
                     beta"
                     /protein_id="XP_022674432.1"
                     /db_xref="GeneID:34714577"
                     /translation="MVTAAFLLIVQKTSANVIPGATKYTNREPTFIIAGLPNTGKTSL
                     FNLLTTDSNHATVMSQEPNIAEDYMLPSSHKNFKFKLIDYPGHAKFRSDLLQTIREST
                     QLRGLIYVIDATVDPKELTSTAELLYEILCVTETRPGGVDILLACNKAESFVARPPLK
                     IKDALETEITEIIKRRVKSLKVNSKKATRGSSDDDEDDEDAGHDLMALHQSSSGFEFD
                     RIDGNVDAVGGSVLKKDIDKWECWIDERAMN"
     gene            198343..198415
                     /locus_tag="KLMA_R202"
                     /db_xref="GeneID:34718648"
     tRNA            198343..198415
                     /locus_tag="KLMA_R202"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:34718648"
     gene            <198665..>203611
                     /gene="NUP192"
                     /locus_tag="KLMA_20094"
                     /db_xref="GeneID:34714578"
     mRNA            <198665..>203611
                     /gene="NUP192"
                     /locus_tag="KLMA_20094"
                     /product="nucleoporin NUP192"
                     /transcript_id="XM_022822631.1"
                     /db_xref="GeneID:34714578"
     CDS             198665..203611
                     /gene="NUP192"
                     /locus_tag="KLMA_20094"
                     /codon_start=1
                     /product="nucleoporin NUP192"
                     /protein_id="XP_022674433.1"
                     /db_xref="GeneID:34714578"
                     /translation="MWALSPFATLYNSIQNGSLDTGLFDSLAVDLKALNLCSNARKDA
                     NKRKELESGQIRLSDGSEYKLNQEFIIEVIKISDELDFDEIACAEQILTAEDSSEGFN
                     QELSLHNKGLLVYYLRRQYVLQIVAYILNALPSTDDVFEKLTSDGTLCNNVIEAFNSI
                     HKELEDIKALINKAQILDNYDVIFKQNVTFRRDFLIKEYDTLGTILFGLSKKKLLSKR
                     PILQKLIDHVSMLDSDNFFIVFYLPALVSTLQNLESFSSEDVQALHSQFVKDLESQAI
                     YTKPTKVVLIFVFLTFFIGWCKAEPNTRAKKYDFATAVDAPMTLAVELGAIEQLMVFA
                     AETSMVEADKSMELFFDIRSLLEKHIPRMSPKMLLDPEFSSAVITKASLDNPSTKYTN
                     LSIFNYGLDNFLSTFHEFFQAFITDCAFLLTKIKNAEEDSLLSGEDLYLDDISAKADL
                     ERFFITIYFFYASRPELSQSFWSDKESNLYGFIEWAAKCNDTLMRSCFYLMVSSLSYG
                     YSNSQNVFHYIEHGQYISWQTMAHNVSETTEKIAQLEKKLQDLQQNGAASSVMMTTAV
                     QSGLSEETVILLSSYFTLIQSVAYEVDEQTKLQIADCFYDTLFKFLKVRSPLIGAAFK
                     VLSHLVPTEESQRYRYWTKLDQIIFKSSALDSTDSSYISAFKSFLSNESEVLGFLQLF
                     SKLISVGTTNHSNEYMKFGKMSFPVNLGYGYRKTGIWPYYEYILGNTFLEESKKPLSE
                     LETSKNILMLEIIKSSLLSFDYSVILNSVLASCNLDSLVPTQDFYSFVQQSNATATMN
                     YLYNEKVFSKLFELASLGIDELEGELGSIVKPKSMIVKNSLYIIDIMLTYEGTYAEEF
                     YPIVKKCTDTSVFLPKTISIRGLRSFYDAIFFHLPLTAHFGLYVGSTYPNISSSSISI
                     LEKLATKFNTGNSKGIHKNVLLTVFDSIDDSARIKQSFIEQLTSPISNEHSLELKIKM
                     LNFLTKNLSYTDRVATISHFLLGFQISNSISLGPELDTFINSKTSLLHCIVNLLIESL
                     SCINNLNIEYAPIRLCAEFMEIITKLCRNPLTSKITLEYLANQDLDKTLLSLDPKVSV
                     LTHWDGRPYNGNFDEIGSEFINSTSIGALLYFLKYRSLLMQFLSLSVHTYLYTTNNSK
                     SNELIDALVSNAIHSATIFSFLDTLNLKMHSPSSDALKKITLLEGLDLSLDKIEKSTS
                     SSGIIYNFSNLDSLIELKKRTQTVLAITAEAKTDHQQLEEVASQEATIIKQTSVAFLS
                     NQELSTLQLSALHSWVQLVQIIVVDSKLSAVQRSNFILEIFEFIIPKVNDYLESRLSY
                     SEELVSLAVFLYELYHNDRIAIDNERTLDSRLHTLFKTCIHGISTPSATLRSDFYVLG
                     TKYLNCVLKDENRSKEVLQWLKFSNETLVETVCNDAIMGEGSNRVTGILFLDALNQLA
                     SFNKVNFVLESLVKSNMLLLIIRSIKNTDEVLETPNEAVTSYSLLYELTIFKCVVHFL
                     TKIAQTKAGAHALLQKKIFQTIASCNFLNMDPDLGIEVLFETFYGKNSGKMRANLNLD
                     NPLHITSYENGVSLFEIIIPIFQLIASILLSSGASNKAAFSDARKLLFHFKQLIQGAL
                     KRDALLEKNGIETKPEGLDEFVRLIILVCTLTNYSGHQ"
     gene            complement(<203757..>206099)
                     /gene="NSP1"
                     /locus_tag="KLMA_20095"
                     /db_xref="GeneID:34714579"
     mRNA            complement(<203757..>206099)
                     /gene="NSP1"
                     /locus_tag="KLMA_20095"
                     /product="nucleoporin NSP1"
                     /transcript_id="XM_022822632.1"
                     /db_xref="GeneID:34714579"
     CDS             complement(203757..206099)
                     /gene="NSP1"
                     /locus_tag="KLMA_20095"
                     /codon_start=1
                     /product="nucleoporin NSP1"
                     /protein_id="XP_022674434.1"
                     /db_xref="GeneID:34714579"
                     /translation="MSFNTNSAFNFSGASNAAGGNNNSSLFSNSGSGQNANTNSSNTT
                     GGSSLFGNIGGQNNASKPAFSGFGANSTNSNAQGSAFGSFGASNSNNTAQNKPAFGGF
                     GAATTQQNSTESKPAASPFSFQTSNATPNNANAPKPAFGAFNSTLNANPSSNTTTTTS
                     NDQPAKPAFGGFGSSNASGNTGSLFGGSNSQQTQNTQTNSAFSFGTKTDQKTDAKPAF
                     SFGGLGGNNATASKPSDSTASKPLFGGNAGTASSSSLFSSTTKPADSSKTEGTNTNTL
                     FGSTTNTTKPAASNTTTTTTTPAFSFGASGATDDSKKPSFSLSLGSDTKDKTTDAKPA
                     FSFGSKPQAATPPLGNKPGFSFGAKPEEAKKEDEKKPEAKPAFSFGAKVDETKKEAEK
                     QPETKAAFSFGSKPTDNKQDSKPAFSFGAKADDSKKDDTKPTAKPAFSFGAASTGDNK
                     PSEESKPAAKPAFAFNSKPEASGSDAKPLFSKPQATTGTTGATEAKNDSKPAFSFGAA
                     KTEQKDTGSNNESKPAFSFGGKTQTTTTNNDTKTAGPTLTTNEQKSDENKPSAETSKQ
                     ESTSTKSSVKPVAVEPVSLDNKTLDDLVSKWTSQLSSTVDKFEDYSKKINEWDNVLMQ
                     GGEQISQLYSDTLSAEQSQNRVDQSLSYIERQQTELEHFLSSYEQKAEELLSEVLSSS
                     NTNSNSKTNDQKRQQAYHTVEMLDDNLNSLSLNLSSLITEINEVSETFNKATNSSFPN
                     KEENAQLIQLLNSHLDALKSLENNSQVLEDKLKTVGKPLK"
     gene            complement(<206510..>210844)
                     /gene="MHP1"
                     /locus_tag="KLMA_20096"
                     /db_xref="GeneID:34714580"
     mRNA            complement(<206510..>210844)
                     /gene="MHP1"
                     /locus_tag="KLMA_20096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822633.1"
                     /db_xref="GeneID:34714580"
     CDS             complement(206510..210844)
                     /gene="MHP1"
                     /locus_tag="KLMA_20096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674435.1"
                     /db_xref="GeneID:34714580"
                     /translation="MSKEDFGLDVGWVIRKKSDAVSSGSESVVGNGSGELKQQQSKGR
                     SGSETPSPKSSTVKIAELDAKNPDVTTHIEILGPNRIVKQRRNSSVDKEAGISGSAGV
                     MDGHVTSVFGFPTGRENSVGAGAGGAGAGAASPPRTLSPPTAAARVGRGRGSVSVGSS
                     VASSMSEPLRRTQSASYPSEQGQKRKSGFFRSLFRRKSSAASSASTSPERQKGSRGSE
                     PAAAARADTDAGLKPPRGRSKSISAASTNEKKFHTPLAGDLLGYKGPGDAASRADHTN
                     DGGPLKRVQTESQVSQQDLDPRLEEFIRYYKEHGVNAFKNESVNPSTAGVEHEGNGFP
                     PILQRPPVRAKASFSLDSTLVPEGKEESKSDTENEGQEKKRKIRLDKKGRPIPPHPPR
                     SRLPPVLKLKPSYQQPPSTSSNHNYHLESSSHSPLSGASKFGSFLKRVTSHTDESVTS
                     SQRISAASSLVSLSKDMDDSSIESSEQPINISVVPGLENLKPLKRVAFAANTYFNDPP
                     QQICSRNPRKGEVEVKPDGSVVIHRLTPAEKREILENSSCGIVVGGTGQLKLINHDKN
                     SSVANEHEGVALKQHAENEEDHATQRRNIELAAAEAAAEARAKDAPLDLQRTITNNEE
                     EVTVNNTAKKVTIDKPMISRKKGSTTSLASMMSSDSGLLPSEDENDVLPPRNIKIPHD
                     VVYTRCCHLREILPIPATMKQLKKGSTDPIPLLQLRNPKPSKVEVLSFSDFLSIAPVL
                     CLSLDGVALSVEMLRIILSSITYKDNFEKLSLRNTPLDAEGWKVLSYFVSRCKSLNSL
                     DVSMVPGLALNVQKPSKSSSNSNVNRMKCNMENRSDMNWSLLSAAVAAKGGLEEMIVS
                     GAHMNMFQLQNFIDIAWTKTVRLGMAYNDLTFEQCEAIAKWMSNSRVTGLDLGFNDLD
                     GKVRPFVDTVIEKTNKGKNVFKYLSLNSTNLSVPKGAKSENNDVLALLNVLCYCDNLK
                     FLDLSNNPGLFPYSMRTLTAILPMSVSLVRLHLDYDNLSTTTVMQLAEVLPMCQRLNY
                     ISLLGTRLNIISASALATAVKNSNNIITMDIDYTNVPDRIKEKISIYSMRNTQSELEQ
                     INKEGGNDEHLKLRSLQEELARLLTENSASRRDYDTVVSNFYDRIQSVRSKLHAATEE
                     LFKLRINGELSTEGKETLIKFCFIEASFERGLKLLAKKSGKSGIFSGSNQNVSGKGKG
                     SNQFSDSSDTPPPEAEADGKKWHRDPLSSSKYATSGHAALLPFHQPATESYEPADEAV
                     ELTGATDEVQNEAKEQLKEEGDVLRRTRGLMMELQNTADKRGQKLNKEVLQRVGEGVD
                     SERIKNLLLNQDISSVIALLDQLSAQGYNVDDIFKKKKEDKRSSTLLSPSTSSSSTDD
                     QRSSTVPEHSSDSKENHNGEVLEDSISSEEEEEEQMDRAFDDVLDTIERTREELMPGT
                     TVSTKPST"
     gene            <211683..>212639
                     /locus_tag="KLMA_20097"
                     /db_xref="GeneID:34714581"
     mRNA            <211683..>212639
                     /locus_tag="KLMA_20097"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822634.1"
                     /db_xref="GeneID:34714581"
     CDS             211683..212639
                     /locus_tag="KLMA_20097"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674436.1"
                     /db_xref="GeneID:34714581"
                     /translation="MVVGHRDRVEQEEHPLAVVNGVSMMENRELIRLDVSRLQWPDKD
                     NGPAAEAVQEILYGWVRTSGLEYKQGMHELCLAVYVEAAGSRSRSDVMFREMMEWLYP
                     LFYADGGVSRWIDAELMQCVRPAAAAGQAAGQAAAGAGPLPLLHPLPLRRVAALLERY
                     SGSHEVWCVRWCRLLFMRELAGPQEYWPVWRAVMRADASARGRVVACVAVVLMACVLP
                     ELCAAQDESEWLGVLLHYPGLRGVSVDDIVLWAAELEAQRQEVPEVPEVGPPVLTLED
                     RILQQTNREWYAKHKDSDISRIRMEARLQRRVNWRLHQTGLK"
     gene            complement(<212871..>213841)
                     /gene="GPM1"
                     /locus_tag="KLMA_20098"
                     /db_xref="GeneID:34714582"
     mRNA            complement(join(<212871..213616,213805..>213841))
                     /gene="GPM1"
                     /locus_tag="KLMA_20098"
                     /product="phosphoglycerate mutase 1"
                     /transcript_id="XM_022822635.1"
                     /db_xref="GeneID:34714582"
     CDS             complement(join(212871..213616,213805..213841))
                     /gene="GPM1"
                     /locus_tag="KLMA_20098"
                     /codon_start=1
                     /product="phosphoglycerate mutase 1"
                     /protein_id="XP_022674437.1"
                     /db_xref="GeneID:34714582"
                     /translation="MKSKSKAKANPVSMPKLILVRHGQSEWNEKNLFTGWVDVKLSAK
                     GEQEAARAGELLKEHNVKPDILFTSKLSRAIQTANIALEKADLLWIPVVRSWRLNERH
                     YGALQGKDKAETLAQYGEEQFTTWRRSFDVPPPVIDDASPYSQKHDARYKDVDPNVLP
                     KTESLALVIDRLLPYWQDSIAKELLAGKTVMIAAHGNSLRALVKHLENISDADIAKLN
                     IPTGIPLVFELDDELKPTKPSYYLDPEAAAAGAAAVAAQGKK"
     gene            <215514..>216347
                     /gene="ADY2"
                     /locus_tag="KLMA_20099"
                     /db_xref="GeneID:34714583"
     mRNA            <215514..>216347
                     /gene="ADY2"
                     /locus_tag="KLMA_20099"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822638.1"
                     /db_xref="GeneID:34714583"
     CDS             215514..216347
                     /gene="ADY2"
                     /locus_tag="KLMA_20099"
                     /note="accumulation of dyads protein 2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674438.1"
                     /db_xref="GeneID:34714583"
                     /translation="MSTESSLKHDHQHQEGTTGLRNTYNSQDPTLYQDIELQKVEVGG
                     DNQEFVYIGRQKFLKDELYTAFGGTLNPGLAPPAAHRFANPVPLGLSSFGLTTFVLSM
                     FNAQAMGIKIPNLVVGLACFYGGLMQLIAGIWEIALENTFGGTALTSYGGFWLSYASI
                     FIPWFGIQDAYKDAPEQLSDAIGFFLLGWTIFTVGITVCTMKSTVAFFTLFFLLTITF
                     LLLTIGEFTRKTGVTKAGGVLGVVVSFIAWYNAYAGVATKENSYIVVKPLPMPQIKKF
                     A"
     gene            <217029..>217826
                     /gene="RVS161"
                     /locus_tag="KLMA_20100"
                     /db_xref="GeneID:34714584"
     mRNA            <217029..>217826
                     /gene="RVS161"
                     /locus_tag="KLMA_20100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822639.1"
                     /db_xref="GeneID:34714584"
     CDS             217029..217826
                     /gene="RVS161"
                     /locus_tag="KLMA_20100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674439.1"
                     /db_xref="GeneID:34714584"
                     /translation="MSWEGFKKAINRAGNSVLVKNVDKTHDKDYDMEERRYRVLEKAG
                     KELQKEAKGYLDSLRAVTASQVTIAEVISDLYDDSKATSTSANNVGNYYLQCVRDFDS
                     ETVKQLDGPFRETVLEPITKFSTYFEEIETAIKKREHKKQDYDAAKAKVRRLVDKPSK
                     DASKLPRAEKELAFAKDIFDNLNDQLKTELPQLVSLRVPYYDPSFEALVKIQLRFCTE
                     GYTRLAQIQQYLDQQSRDDYANGLLDQKIDDLLQQMANLNICALGVK"
     gene            <218846..>222628
                     /locus_tag="KLMA_20101"
                     /db_xref="GeneID:34714585"
     mRNA            <218846..>222628
                     /locus_tag="KLMA_20101"
                     /product="sterol-sensing super family"
                     /transcript_id="XM_022822640.1"
                     /db_xref="GeneID:34714585"
     CDS             218846..222628
                     /locus_tag="KLMA_20101"
                     /codon_start=1
                     /product="sterol-sensing super family"
                     /protein_id="XP_022674440.1"
                     /db_xref="GeneID:34714585"
                     /translation="MFRKVYLPSKVSAYVLSYPQLFIAIPLLITFLISYSPLLSYSAS
                     YEASSTYLSRSVLETHENGNSSSDWGLLSYDYNYSLTKVIIQPDDGSNALTKPFLIES
                     LAAQARIMHDLSNVTILHSPFDLWDNSIDALRKDRMPLATINRNLHRIPLFLFQGLVK
                     VNGHVSFAKRLSFTVICPRDNTSTVASQLSSNIEEMNKIRNISNFYIFTSGPFTSLET
                     SSSPVEILRFHISKLNALDYLLILAIYFLIGSFFFYNIEHLKSVKSRLGVSIAILAQL
                     VLTVYSAKAITCLVFKTSSDNIPWFLVYIPVIFASLSSLFKTTMEKKGTVLIESESTS
                     DETALKEDVPPYVASQKDFLITTVNSNNYTLRTTLSMLLLLVIVTPFSRKVSCFFIVS
                     LLTNLFLQITYFSAVLSLDHRRFTYNELLALSNNGDDSTSDLNVSLDKGLDGNKRRSK
                     WATCIELCSELNEWLPKTELLSPSSIATELYMFYLNTRFSSIRSSTSVLYKLFKGNLF
                     SFFNMSTPFTRIVFDKRFIANELYRLSGSKTSVQNVLLNDPLIIIKHKAEGTSLENKT
                     FEQISRSYNFSPLNTYKFDVYYFFEFMIFLVLIFVSTLLVLQLIVRKLDHYNLKLYEI
                     TLEERKNRHQRGEMKRSSSVSSVNSSTSSLSLADGQSDENVNAFHTKELSINGHELDI
                     VNIATSQAPFVVSIALDHKVLVWSPLSKPMPPPTKIPLPSRFWPVVHCTLSNDGAYIA
                     FFNNTGRIKCWSRKTMSFIWSIKLDSVESMLPLESFFRKKTIPGFMKRKGASNMATTQ
                     NKIGLERRGSVMSIKSIASVSSTQFGSSTPVDASYENFSYHATNDEVNAEFVFITAAN
                     MIHVIDYEGNLASHQITSSEYPLKSCKRLVTPRMNERLVLCDEVGELYVSTAVNNKWR
                     TRKLQVIRDRFNKGQGLMTPRSLRMKAGGLMGNSISQETLNDENSSISTIQPSETDNT
                     LLLVPFVGMAVKKNGHFVELIDVQCGILIKKVKIGEFKPGTLRVFHDQPTHCRFCGSA
                     SVATLSIAYTSLKNSLIMHSFQLESRTKTSICLRVERDPREIRCLGLESVVEKKHILS
                     NVDRWDVTENNTLIGIRRKPELISANTNEQIASTSMSHTMSANEFDLDNNIHNRSKNS
                     NQVKRLNSFKINNVWEGWTMNADGKVVFHEIPTGVNGLLVNRIGPLRKFGTKSIIVGF
                     GNIMKMFYIGHEEFLLEADSVGVNEENSGLRFVNKRRERLVNKISTNYEVLTDSPT"
     gene            complement(<223356..>225020)
                     /gene="SAT4"
                     /locus_tag="KLMA_20102"
                     /db_xref="GeneID:34714586"
     mRNA            complement(<223356..>225020)
                     /gene="SAT4"
                     /locus_tag="KLMA_20102"
                     /product="serine/threonine-protein kinase HAL4/SAT4"
                     /transcript_id="XM_022822641.1"
                     /db_xref="GeneID:34714586"
     CDS             complement(223356..225020)
                     /gene="SAT4"
                     /locus_tag="KLMA_20102"
                     /codon_start=1
                     /product="serine/threonine-protein kinase HAL4/SAT4"
                     /protein_id="XP_022674441.1"
                     /db_xref="GeneID:34714586"
                     /translation="MSIGPVPEQAGIRQDSPVVRTKSRKGTITSKIGKIFGVSKNEDL
                     LNSQAQGQDKAQATSQGQDKAPPSPPTSASSSCSSSVASSRYHAVSSPRASGVSAKLQ
                     SGNGASNGQGNGPGNGPAVAAASNGTPVQRSASPVPSASSASINARFVVHEDGSHEHS
                     LKNAKRQEKLGSMIKNMLGAQKLRGEAKSAVPDILIKSMKSGDPPSLFSGLIKQVNAN
                     ASGTAFPYSGATQIIGAKRDDQPQSSRADIDEATTVNPLHNQSSVTFAEKYGRCQEVI
                     GKGSFGTVRICHKKNLKGANGEILYAVKEFRRRPTENPAKYSKRLTAEFCISSSLKHT
                     NIIDTLDLFQDAKGDYCEVMEYCSGGDLFTLIIAAGKLEYQEADCFFKQLITGVVYMH
                     NMGVCHRDLKPENLLLTHDGVLKITDFGNSECFRMAWEKEIHLSGGICGSSPYIAPEE
                     YTQDEFDPRAVDIWACGVIYMAMRTGRQLWATAQKEDEFYMKYLKGRKNAAGYDPIEK
                     LKRARCRNVIYSILDPVPSRRLNGNQILNSEWGREIVCCHQGHPVR"
     gene            complement(225767..225842)
                     /locus_tag="KLMA_R203"
                     /db_xref="GeneID:34718649"
     tRNA            complement(225767..225842)
                     /locus_tag="KLMA_R203"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:34718649"
     gene            complement(<226078..>226740)
                     /locus_tag="KLMA_20103"
                     /db_xref="GeneID:34714587"
     mRNA            complement(<226078..>226740)
                     /locus_tag="KLMA_20103"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822642.1"
                     /db_xref="GeneID:34714587"
     CDS             complement(226078..226740)
                     /locus_tag="KLMA_20103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674442.1"
                     /db_xref="GeneID:34714587"
                     /translation="MTFQQELIHVFLVKINHKCFYLENVRDIMPNSGTTVALVPNKNL
                     LYNIKDDSNIKLLAAGQNEITVEGEGILKLKLNENISIEMKAMVVPSIKMIIIPLKSV
                     YKNHRHVSDNVDSIISKNGEIITSIFEKEELWWILGNHIQLPTKEHKVYQTTKSKKYK
                     VTLRDLHRRLGHTNVRCVRETVKRGGIEDFSMSDVNWEGIDDFQCESCMKGKASRHAR
                     MR"
     gene            complement(<228339..>228566)
                     /locus_tag="KLMA_20104"
                     /db_xref="GeneID:34714588"
     mRNA            complement(<228339..>228566)
                     /locus_tag="KLMA_20104"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822643.1"
                     /db_xref="GeneID:34714588"
     CDS             complement(228339..228566)
                     /locus_tag="KLMA_20104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674443.1"
                     /db_xref="GeneID:34714588"
                     /translation="MVVPSIKMIIILLESLHQNNLHVDETRDNIKSLNDETITPIFKK
                     EDLWWISGNHIQLPITEHKVYQSTKSKKYIS"
     gene            232475..232547
                     /locus_tag="KLMA_R204"
                     /db_xref="GeneID:34718650"
     tRNA            232475..232547
                     /locus_tag="KLMA_R204"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:34718650"
     gene            <233518..>234957
                     /gene="CIT1"
                     /locus_tag="KLMA_20105"
                     /db_xref="GeneID:34714589"
     mRNA            <233518..>234957
                     /gene="CIT1"
                     /locus_tag="KLMA_20105"
                     /product="citrate synthase"
                     /transcript_id="XM_022822644.1"
                     /db_xref="GeneID:34714589"
     CDS             233518..234957
                     /gene="CIT1"
                     /locus_tag="KLMA_20105"
                     /codon_start=1
                     /product="citrate synthase"
                     /protein_id="XP_022674444.1"
                     /db_xref="GeneID:34714589"
                     /translation="MLSTRNALARGLLRGSNNGLQSKKLLLQLVAARCYSNGEKTLKQ
                     RFAEIFPEKAEEIKKLKKEHGKTVIGEVLLEQAYGGMRGIKGLVWEGSVLDPEEGIRF
                     RGRTIPDIQKELPKAADGDEPLPEAIFWLLLTGEVPTESQVKALSADLASRSELPQHV
                     EQLLDSLPKNLHPMAQFSIAVTALESESKFAKAYAQGVSKKDYWNYTFEDSLDLLGKL
                     PVIASKIYRNVFKDGKVAAIDGNADYGKNLAHLLGFQNKEFVDLMRLYLTIHSDHEGG
                     NVSAHTTHLVGSALSSPYLSLAAGLNGLAGPLHGRANQEVLEWLFKLREEVKGDYSKE
                     TIEKYLWDTLNSGRVVPGYGHAVLRKTDPRYTAQREFALKHFPDYELFKLVSTIYEVA
                     PKVLTKHGKTKNPWPNVDSHSGVLLQYYGLTEASFYTVLFGVSRAFGVLPQLIIDRAV
                     GQPIERPKSFSTEKYIELVNSIKSKGGVQ"
     gene            <235720..>236463
                     /gene="YCP4"
                     /locus_tag="KLMA_20106"
                     /db_xref="GeneID:34714590"
     mRNA            <235720..>236463
                     /gene="YCP4"
                     /locus_tag="KLMA_20106"
                     /product="flavoprotein-like protein YCP4"
                     /transcript_id="XM_022822645.1"
                     /db_xref="GeneID:34714590"
     CDS             235720..236463
                     /gene="YCP4"
                     /locus_tag="KLMA_20106"
                     /codon_start=1
                     /product="flavoprotein-like protein YCP4"
                     /protein_id="XP_022674445.1"
                     /db_xref="GeneID:34714590"
                     /translation="MVKVAIITYSMYGHINSLAEKVKEGVEKAGGKATIFRVEETLPA
                     EILESLSAPPKADYPIATLQTLEEYDAFLFGIPTRLGTIPSQWSAFWDSTGGLWQKGA
                     LYGKPAGIFVSTGSCGGGQETTVKNSLSYLVHHGMVFVPLGYKNAFAELSNVEEIHGG
                     SAWGAGVIASSDGSRAASDLELKVAEVQGSTFYETAKKLVKKSSKPAAADGAAATEKP
                     AAGASKPAARKTEKPAAKESKKDSCCTIM"
     gene            complement(<236769..>238511)
                     /locus_tag="KLMA_20107"
                     /db_xref="GeneID:34714591"
     mRNA            complement(<236769..>238511)
                     /locus_tag="KLMA_20107"
                     /product="jmjC super family"
                     /transcript_id="XM_022822646.1"
                     /db_xref="GeneID:34714591"
     CDS             complement(236769..238511)
                     /locus_tag="KLMA_20107"
                     /codon_start=1
                     /product="jmjC super family"
                     /protein_id="XP_022674446.1"
                     /db_xref="GeneID:34714591"
                     /translation="MTTSHQQVKRPRKIPNYRIPPFTSAPTHPLGVKPSGNALIESAS
                     QKDIKNTSKKLLGNLSVLPEDLLIELISYIDDPKDLQSLGSCSRILYAYTYDEELWRK
                     IYTKEYLRLENELENPDQERISPFGCSEWKGSWRKTLLKLDEEALIQCNNLIFSDTLY
                     RPYQCSKIDYQELFKKVIEFEKSSYDLGTTLNPEFGVPRFQEDDFSISTFHQEYIQKP
                     FILQNQNAKNDDGTPRWPRWTLDDLLKRFPHELFRQEAVKWDLSLYARYFKANRDESP
                     LYLFDCNSSAIKVISKEYKPPAIYQDDYFKLFQENGVKCRPDHRWLIAGPARSGSTFH
                     KDPNHTSAWNTGLCGMKLWVMLPPGENPPGVMTDKEEEEVTSPVGIAEWIISGYYNDA
                     VRLAQEGRCQICVTFPGECIYVPSGWWHSVINLTDSVALTENFVPEPIVPKVMNFFKN
                     KPTQISGFHLKDFLQSVRTYLQEDRQNSDRIEKLRSFVENSADYKLDNEDCGVLDTKE
                     LHPPIYEFFVELISSSKYADKLEQFSNKMAALEQAVLQEKRANAAANVRESEAWNQLT
                     KQASESFSFGFSFE"
     gene            complement(<238933..>239490)
                     /gene="MRPL32"
                     /locus_tag="KLMA_20108"
                     /db_xref="GeneID:34714592"
     mRNA            complement(<238933..>239490)
                     /gene="MRPL32"
                     /locus_tag="KLMA_20108"
                     /product="mitochondrial 54S ribosomal protein YmL32"
                     /transcript_id="XM_022822647.1"
                     /db_xref="GeneID:34714592"
     CDS             complement(238933..239490)
                     /gene="MRPL32"
                     /locus_tag="KLMA_20108"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL32"
                     /protein_id="XP_022674447.1"
                     /db_xref="GeneID:34714592"
                     /translation="MSIGAVTGSFGRVLLESATSILPRWSTSNGTSAPSMGAALQRKI
                     MELLERRQNNGSDVDYFSNNGILLAVPKKKVSHQKKRQKLYAPGSKQLKMMHHLNKCP
                     SCGHYKKAHTLCMHCVGQIRQIWKAHTNNKPAEPIQEQELSELDKRILYPGRKETAYT
                     KKLKEKDSYLLKRMKPLPVEKSEKE"
     gene            <240054..>241070
                     /gene="CDC10"
                     /locus_tag="KLMA_20109"
                     /db_xref="GeneID:34714593"
     mRNA            <240054..>241070
                     /gene="CDC10"
                     /locus_tag="KLMA_20109"
                     /product="cell division control protein 10"
                     /transcript_id="XM_022822649.1"
                     /db_xref="GeneID:34714593"
     CDS             240054..241070
                     /gene="CDC10"
                     /locus_tag="KLMA_20109"
                     /codon_start=1
                     /product="cell division control protein 10"
                     /protein_id="XP_022674448.1"
                     /db_xref="GeneID:34714593"
                     /translation="MATTTENSTTSNIAADGYDLINPSTYVGFDSITSQIEHRLLKRG
                     FQFNIMVVGHSGLGKSTLINTLFASHLIDSSTGKDITQEPISKTTEIKVSSHSLLEDR
                     VRLNVNVIDTPGFGDQINNDKVWEPIIKYIKEQHSQYLRKELTAQRERHIVDTRVHAV
                     LYFIQPNSKGLTELDIAALKRLTEIANVIPVIAKADTLTLDERTSFRNILQEEFKKYN
                     FRIYPYDLEDLTEEEVQLNKSIRSIIPFAVVGSEKEITVNGELVRGRKTRWGAINVED
                     IKQCEFVYLREFLIRTHLQDLIETTALIHYESFRSKQLIALKENANARTSAHMSQTST
                     TMLR"
     gene            complement(<242591..>244921)
                     /gene="DNM1"
                     /locus_tag="KLMA_20110"
                     /db_xref="GeneID:34714594"
     mRNA            complement(<242591..>244921)
                     /gene="DNM1"
                     /locus_tag="KLMA_20110"
                     /product="dynamin-related protein DNM1"
                     /transcript_id="XM_022822650.1"
                     /db_xref="GeneID:34714594"
     CDS             complement(242591..244921)
                     /gene="DNM1"
                     /locus_tag="KLMA_20110"
                     /codon_start=1
                     /product="dynamin-related protein DNM1"
                     /protein_id="XP_022674449.1"
                     /db_xref="GeneID:34714594"
                     /translation="MSSLEDLIPVVNKLQDVMYDAGIDNLDLPVLAVIGSQSSGKSSI
                     LETLVGRDFLPRGTGIVTRRPLVLQLNNIDPDSPLVHNHNNSSSTSLDGVNGGSESHE
                     ERELTLEDHLRKNTNYKPEVKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKG
                     ISRIPINLKIYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIENLILEYVAKPNCIIL
                     AISPANVDLVNSESLKLAREIDPHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLG
                     FVGVVNRSQQDIQQNKSVEEALNSEEEFFAKHPVYRTISTRCGTRYLAKLLNQVLMNH
                     IREKLPDIKARLNTLVGQTEQELARYGDNKIITQENRAGLVLQLMNKFATKFISSIDG
                     TSSEISTKELCGGARIYYIYNTLFGKSLNFINPTSNLSMNDIRTAIRNSTGPRPSLFV
                     PELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICHNCGSPELARYPKLQSKLIEVVS
                     ELLRERLGPTRSYVESLIDIHKAYINTNHPNFPSATEAMAEIVEARKNRKLADKRQKQ
                     REAENQMLLESQQKAQQAARNPDVADDNDQDLKVDSDSTATSENDSDEDVDMKHSKDS
                     FLNYFFGKDQKNNSSKSTTKQDYNNKDSFGLEGLQIQDFKGNDAGNEEANTDSDVGFT
                     EREELECELIRRLIVSYFSIVREMIEDQVPKAVMCLLVNYSKESVQNRLVTKLYKEQL
                     FDELLMEDQTLAQDREKCVKLLETYQKASSIIGDIL"
     gene            complement(<245428..>246723)
                     /gene="RTT109"
                     /locus_tag="KLMA_20111"
                     /db_xref="GeneID:34714595"
     mRNA            complement(<245428..>246723)
                     /gene="RTT109"
                     /locus_tag="KLMA_20111"
                     /product="H3 histone acetyltransferase RTT109"
                     /transcript_id="XM_022822651.1"
                     /db_xref="GeneID:34714595"
     CDS             complement(245428..246723)
                     /gene="RTT109"
                     /locus_tag="KLMA_20111"
                     /codon_start=1
                     /product="H3 histone acetyltransferase RTT109"
                     /protein_id="XP_022674450.1"
                     /db_xref="GeneID:34714595"
                     /translation="MTLEDCLKDSLPLGEEFEIFNLQSPPRETSPIVFPEAGGNINKK
                     NENIKTVKTQHFVALCHSQKVVFAVEIVVYFTIYLNSSAPTERLLFVSKADTNGYCSV
                     KLNVGRIVRSIIAFILAIDPNHYLQKVKPGVRKLLASDHIIRRTTPVRKALKILSERK
                     LDRYGINSKVHIPEHELYVKYPAATELITQISLFTRAEPQYLFSDSSKNPNKHILSGD
                     KLLLWWLRIIDQVIVESFDDTTKATLQIPGEEKRIIANYLRRTKYKNWTVGDIFSKDP
                     QDIALYRIPLFPDDPKGRFLEHLASDGRIHKVTVSTFWTELQARQEFRLGSTVSVIGV
                     SGRYTGITNVLQPQDIVVTMSKNEFKNLKNYITGEEYDTSEGAEEAYMNIRDILKNNY
                     ASQMVKITGNFKSQVNAPQQNTNTINVINTLSIHRKPRA"
     gene            complement(<247020..>247759)
                     /gene="PRE3"
                     /locus_tag="KLMA_20112"
                     /db_xref="GeneID:34714596"
     mRNA            complement(join(<247020..247602,247695..>247759))
                     /gene="PRE3"
                     /locus_tag="KLMA_20112"
                     /product="proteasome component PRE3"
                     /transcript_id="XM_022822652.1"
                     /db_xref="GeneID:34714596"
     CDS             complement(join(247020..247602,247695..247759))
                     /gene="PRE3"
                     /locus_tag="KLMA_20112"
                     /codon_start=1
                     /product="proteasome component PRE3"
                     /protein_id="XP_022674451.1"
                     /db_xref="GeneID:34714596"
                     /translation="MDGIQVDMNRLKKGEVSLGTSIMAVTFKDGVILGADSRTTTGAY
                     IANRVTDKLTKVHDKIWCCRSGSAADTQAVADIVQYHLELYTSQYGEPTTKVAASIFK
                     TLCYENKDNLTAGIIVAGYDEKNGGEVYSIPLGGSVHKQSYSIAGSGSAFIYGYCDKN
                     YKENMTKEETINFVKHSLSQAIKWDGSSGGVIRMVILTAEGVERLIFYPEEYENL"
     gene            complement(<248137..>251169)
                     /gene="SFI1"
                     /locus_tag="KLMA_20113"
                     /db_xref="GeneID:34714597"
     mRNA            complement(<248137..>251169)
                     /gene="SFI1"
                     /locus_tag="KLMA_20113"
                     /product="protein SFI1"
                     /transcript_id="XM_022822653.1"
                     /db_xref="GeneID:34714597"
     CDS             complement(248137..251169)
                     /gene="SFI1"
                     /locus_tag="KLMA_20113"
                     /codon_start=1
                     /product="protein SFI1"
                     /protein_id="XP_022674452.1"
                     /db_xref="GeneID:34714597"
                     /translation="MEDVEFSGTIGSSTDALISPEYTHSTGSLVHKDFSELLQKSNVI
                     AHEEENTSSILGNGNNVKINVNLQDRRNDDDYNVRQPEKYFDQVFGKLSTDNNHGNND
                     NADEKGYTHFNLQPNGLEDPIDIQKRLYGNVNNPIMLRLYNMIQVFLLRHGLTLDFLS
                     VFQRYITLLNEADMNPLEDKYLLTLQNELSKGYEFSNTLQEIITAFLLEPENVIMKLA
                     NFQFKNERLLLKRVFSGWRLKYSLNYNLAELEEIWGRYVKKKFYDQWVQTLRIKTQQW
                     PEDADQFYEQKLKTECFNRLLGSMNQLATKSQIADNFFLDNTFVKIKSKHERLHSSSN
                     NVIQTRNKLLLANSLRSWKLKMCKNHFNPIAIKRHLLAKYLTLWKLQYRHNRHLSELS
                     VISERTLALRPCLKIWISRFRNVESYRIDLYDKSDLFIKSRYFRTITSAYTLAKIKSK
                     VQDVNSRSLQKHFLMAWKKRVQERSNCIDIISNRNEKLLGMYFTQWKNKCDSYVRADS
                     QYTDSLKKRFLKKIRLKARLLQSKSNINRSIASKCLEVWNKKFQLNILCKEYDKLVLQ
                     RYYKVIRTKRQLLKDLGDLSARCYNNDITKRFFILWKKRFENISAKNQKCDAFIKLRF
                     ITLIKRGILNARMKDRLSIELAKKYDQQHLDKFWVLWKSHLNSKRMIKLNTYADVFEE
                     RRDEYIKRKYVQVWRKRYDFYSVECMDIALDKYDLGVTIRSLEQWKTRYSNIQLMYKE
                     ADGIYDNTTLSNAFDLILQKMDNLKLQDSKLVLYVEEKQAKLLLKWTNQWSMKMMKLK
                     RNEESVQMFRARWNRANMRAIMSLWKEKTFSYPNSLAADDTRNISSQKEDIAFQTPMK
                     PLDINSNGFTTIPGSERIKRNKMDRIKNRFSRARGAIPSPIKSTQILDSTAKTRLAGT
                     EYNQTQPLQNSTDDTPHITGDASNLSLLNVNKRLAGKTKSISFNRIPHTTLFGFPSPQ
                     SAIEPSPKDLTVDLDFLDSDSLPERDDDSPTKRRTRPH"
     gene            <251513..>252895
                     /gene="OST1"
                     /locus_tag="KLMA_20114"
                     /db_xref="GeneID:34714598"
     mRNA            <251513..>252895
                     /gene="OST1"
                     /locus_tag="KLMA_20114"
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit 1"
                     /transcript_id="XM_022822654.1"
                     /db_xref="GeneID:34714598"
     CDS             251513..252895
                     /gene="OST1"
                     /locus_tag="KLMA_20114"
                     /codon_start=1
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit 1"
                     /protein_id="XP_022674453.1"
                     /db_xref="GeneID:34714598"
                     /translation="MKYHTLSSVVCLLISLVVVQARGLYWENVEIVKAIDVSKSYVNE
                     AAEITIRNTGEEPDDLYLVAFTSEVADSLSMFSSMLKGKNVFIECALTNKFKHLPNGQ
                     KVQYGSVRLPTPVQPGEQIELVIRYSHKANFSPVPKHIEMSDTQTLVLETETLPFSPY
                     LTDKFTVSIIGSDSIEKYKDAASKDQQNSNAFTITEENVTEPFTLSRSQFLYTHNAPL
                     TRAVHLNREAWISHWGSTVEFKEDYELVNDAAELSSGFSRAEFMKSGLAKKPSHALVA
                     LDIPLPENSHSHYYTDLVGMISTARVFSNHYILKPRYPIFGGWKFNFTIGWTNSLTDY
                     LKVLSNDEYIISIPVLEGPQDIFYDAVTLSVYLPEGAVVKDIQTPMVNSDTQTTYEHS
                     YFDLGSGHTKVAITLKNLNDQMRDGPVFLKYHYSQADLLRKPASIAIYVFIALFSLFL
                     IKKIQLVIYA"
     gene            complement(<253054..>254985)
                     /gene="ORC3"
                     /locus_tag="KLMA_20115"
                     /db_xref="GeneID:34714599"
     mRNA            complement(<253054..>254985)
                     /gene="ORC3"
                     /locus_tag="KLMA_20115"
                     /product="origin recognition complex subunit 3"
                     /transcript_id="XM_022822655.1"
                     /db_xref="GeneID:34714599"
     CDS             complement(253054..254985)
                     /gene="ORC3"
                     /locus_tag="KLMA_20115"
                     /codon_start=1
                     /product="origin recognition complex subunit 3"
                     /protein_id="XP_022674454.1"
                     /db_xref="GeneID:34714599"
                     /translation="MDLGEFAESQKQSFVYTPKFRKDGIDKFDHGSSPVPFVKLFEGK
                     ESDESVLSRWMLYNKLHADFHATVDDILASIDKEVVSSISNTIQELIEPASTRAKSYA
                     QTKQFKTLILLGSDVDTNIELPEDTPDYYNVFVDLEPKDAPNVRLLLKRVIFKMLEAM
                     ELKLQEQANASGTDDTGIEYDEDVARSLRLYDMLVFEMFQPTFKRKLNLIINFKETET
                     FFMNVFQEFIDLMKSTLNIDGMQVCFIFNLATNVEKFENNLDQSTVRAISSEVRTVDL
                     SNTKGYKYSNMIFQSFLDCVDRKLNLSPKFVKFILDKMDNNTNQNLQLLLKILDYSLM
                     AYFFNNPYSIFIDVANISFLDSKYLDRLTKCQTFLDFVENMVNSKADAEDILSLLSNE
                     NNALEEFFVDFLVAENPINDKLHQIIDILENKLHIYDYNLIDLYYHMLNNRLIDYLEK
                     WESCKEYKDEFDFENIQIVFQELFTLDNNNGLLSQGLFPFFRTNLEDNLLNCERVLPR
                     TKAIQMMSNSKIEFTDLEVKLNELITPIISQVFALYREASFFINVYDFFTAFKESLPK
                     AEIYELLKTALASEEVQTSVKSKSQKILEQLSEEEFMDRLALVWFIKGLTECQYLGIL
                     KTQRYKTYEVVEKIIWRGI"
     gene            complement(<255379..>255735)
                     /gene="COX16"
                     /locus_tag="KLMA_20116"
                     /db_xref="GeneID:34714600"
     mRNA            complement(<255379..>255735)
                     /gene="COX16"
                     /locus_tag="KLMA_20116"
                     /product="cytochrome c oxidase assembly protein COX16"
                     /transcript_id="XM_022822656.1"
                     /db_xref="GeneID:34714600"
     CDS             complement(255379..255735)
                     /gene="COX16"
                     /locus_tag="KLMA_20116"
                     /codon_start=1
                     /product="cytochrome c oxidase assembly protein COX16"
                     /protein_id="XP_022674455.1"
                     /db_xref="GeneID:34714600"
                     /translation="MSFSGKKFRSRREQLAYEASIAGRYQKNMNRNPFLWFGLPFCSL
                     IVLGSFWLSEFTAVRYDQQDKKVQELQEEDVVKMRSNKREFDIKEEYYRLQGLGEQDW
                     EPKRIPRFKGESENVW"
     gene            <257178..>261362
                     /gene="ADR1"
                     /locus_tag="KLMA_20117"
                     /db_xref="GeneID:34714601"
     mRNA            <257178..>261362
                     /gene="ADR1"
                     /locus_tag="KLMA_20117"
                     /product="regulatory protein ADR1"
                     /transcript_id="XM_022822657.1"
                     /db_xref="GeneID:34714601"
     CDS             257178..261362
                     /gene="ADR1"
                     /locus_tag="KLMA_20117"
                     /codon_start=1
                     /product="regulatory protein ADR1"
                     /protein_id="XP_022674456.1"
                     /db_xref="GeneID:34714601"
                     /translation="MQTACSSMSSDIHDIREIHGTESMGTGGGRSSRRRKSSQLPLRG
                     SFNSGSNTNGGGVESGIVLPPNNTNKKFETLPEHLQLNGVTPSGKPRLFVCKVCTRAF
                     ARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRHCQKLHGGNCGEYIRRTSRKVR
                     KEAKNAGQAQGQGQTETETLVGTSSEGKRVRKRSTRADSSASSAAMTRSLKTAVAAES
                     RVAAASGSGSGSGNTDTVADIKPGTGECSPGTTEEKNPSRLFSDTSAQLPKKNTVSNM
                     HRRVSFSAQSGGNYAILPDSDAFAKEKPERVDFSTPQMLPLDFLDPMSQLEEPTGFNL
                     LDRNNWINDFNNDILLGTDDLQGSSSNPRSNSYSEASPASNANSNSNSNTRNSSWEIQ
                     GDTLKINSLFSFPMSQSDSNRSNTDWKTLAATLKPEIEGVSAMDSTESGAPRNSADEI
                     TNTLHNFQLKLDENGTNGGVDFDMNLNQINANGTENGTSKNSISPDFNMVVLGSSVNP
                     NAIHRNGISTHNGIPTESPPLRTNSNIDNELKLLHPADFTPSNDILDHDSTIKGSVAF
                     NPNDNLFNETRNKRDDSNYNLKANANNSTNNNDNNNDINNNNNNNSNDNNNDDTNPKK
                     SKMSLPSSNVSKERQILYPNEDSDDKSHIDPIQLQAVLDPGYTFYDIQYPQPCNISKA
                     SPKERDAEINFFNDEMRRYCEDALLHYSSICGPDYKPCTLSCSNDELNTYLRLYIKRF
                     HPHHPFIHPSIWTQDQQVYRSYVYEQNASNISSSVDNLIHYTNIICLPLFAATIGSLF
                     KNTSSRSASKTKELYEIARRILHVYLDRRKNLKQTDMNTPLNSNLWLIQSLTLSVMYS
                     IFAEHDSSNVNKSDQILKQIGAVCSLLRNYFLPILRKKPPHLSSEAEIIIWESKLRTT
                     LTNYNLCQFLQVFHRVSSSNFIKNQELQTIMIPNDEARWVSLSFNWEDTTINSDHLYH
                     LSFLQFFQSFQFSDLGYHTIPEVLVNAMLFFEYSTKLSGNNMTVFINKIDTKKLEKNL
                     PQIEQNAITSDCLIGDAINLKNSLICLRLFDKLDPHFFKVISKYGLTDHIFENCLSPI
                     HANILSKNSDSLIIDLLVSVNVSIKNIASLFYFTNESGYYQEIKFNYSKTSMYQVQGY
                     FYNFLCILKFILDFEATPNFKVLSIFAELRKIIEQLMIPKLINNYPTEFAKFPDIMSI
                     FEGPSPQNAAPNHTFNLEHLEKLIESVLAQSFNDYNYLKMPVGSVNALNEFDFHSSSE
                     TSAPKPSKSSINLMRHHETCKQNGARVKQGFYERYHLSDKLLQVAKCSFLLIYESHVH
                     CSQLSNFIDILNTIQSKFDDQRKMTNILTNSVNQAYGHDTVPQGQMSSYSLANMLNLP
                     NSNTPPGDYYFNPNSL"
     gene            complement(<261710..>264601)
                     /gene="RAD9"
                     /locus_tag="KLMA_20118"
                     /db_xref="GeneID:34714602"
     mRNA            complement(<261710..>264601)
                     /gene="RAD9"
                     /locus_tag="KLMA_20118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822658.1"
                     /db_xref="GeneID:34714602"
     CDS             complement(261710..264601)
                     /gene="RAD9"
                     /locus_tag="KLMA_20118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674457.1"
                     /db_xref="GeneID:34714602"
                     /translation="MTSEGSGSIAGSTPKPNSKAIRNNDGIHLSKVAQILGNERAGVI
                     FDDDSGVEDTPEGDRDVEIRRRDDIRSKNDILKRFQGAYDMDLSVELPSDLSETEGIK
                     LNKNENTDTYHLEMLDTPLKSKMSIRTLRNEGHNRNPENIKLDNDGNNNDDNEEEGDA
                     SVHSELPTNKTEDKLIETFVSTPKDTQNNMNMNFNVSMNTQSVTQNSKEMMVPATNSD
                     RITQTQNIPTSIPDEKATQLIKTQANDYEVSESLLKLDDQSQLQETSVLHTSPINFAS
                     FHQSLIASNGIFPAKDAASELVQSPINANYRYPNHIKSTNTLQSTVVSEPEDQSQSQH
                     QLQSQSESHTPSHSKAFNQGSQEGRLSSSEMQFKLTYYAKPTSQPLNNNDDNSFAGEV
                     SHSVENFAHDGDHEGSRSIEQSYNEFTRLDTEQEYEQTQELPEVLDQADNNKIKQSFE
                     SEEPLNPSRKRKENIIILDDDFEDSSTPFKIPRFQSTFKELRNSDPELLTSKDISCNN
                     AVWYYFSDCNYYPGKVVSQKENEPGFCTVQFETRQNDVKIEDIYYLDLRCGEKLHWKM
                     NEYEVVALECRNPNDSDVIRCIRGYDTVHLKRILRNGKLSKDTIVDSIGSVYITTEEW
                     AKRAKIKLDDDGKKFGPLAELRRSARSRSARNSLSPIKKVSESCNNSTTEIYRDTFHD
                     TTILHQIDSNRGTIFEKCLFVLSGLSDEDRKRTSYLIELQAGYVVNVGFEKLLVYDET
                     SHRLKWQDSWLENYEFVCLVSGGFSRSPKYLEALALGFPVLHWRFIEQCLAKGQISVK
                     LITQNLLPSGESNRFTSSVGKGVIKSSNIFQFLTNFNNSLTLKDQLDISTVSMEHYAV
                     IVLGNSYMDFFIDFIFKCFKVSYWEYISTSRTKNSNEKLDSSVLDDLLNFREANSSKT
                     KIIFINETSLQISKEWENAVSKSLDDKGVSDMIIEDKEWLVQTIINEEP"
     gene            <265348..>266547
                     /locus_tag="KLMA_20119"
                     /db_xref="GeneID:34714603"
     mRNA            <265348..>266547
                     /locus_tag="KLMA_20119"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822660.1"
                     /db_xref="GeneID:34714603"
     CDS             265348..266547
                     /locus_tag="KLMA_20119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674458.1"
                     /db_xref="GeneID:34714603"
                     /translation="MEVWDDIVTNILSFIPLDHARECLKPGIKVITTVMQDILNLNPD
                     IDFTVDANYMADNLCARYADDAYVLRFKTNIVIKFRIIQAFFEVISKDYGTAFFSFRW
                     ILQFISSVRSKFPNDLNATFINSSEISWVVRQVSLYLSKCLNLDFNQKKRIKYVSSRC
                     VRVNRLDLFKGILYTILENSNDCIPTQDDFMHRHITAEYFKVCAEIYEAIALLDGKLI
                     NYEQADDLKVAVIMPQRMFSIYMTRHYMIAAQHYTVDDPNRLVCFHKILMGLFFVNRI
                     EIETYNFFYSQLRECAKNIKDSHISNDYSNFPLSGTFVNIINSVGLRRHTLKFLPTVL
                     IRLATNEVIMDSEFSSESICRPVCTKEAGKLKRKVLGSNYDDNDHIGLEDMSTYDLIS
                     FWKQIKT"
     gene            complement(<266811..>267872)
                     /gene="SPR28"
                     /locus_tag="KLMA_20120"
                     /db_xref="GeneID:34714604"
     mRNA            complement(<266811..>267872)
                     /gene="SPR28"
                     /locus_tag="KLMA_20120"
                     /product="septin GTPase family protein"
                     /transcript_id="XM_022822661.1"
                     /db_xref="GeneID:34714604"
     CDS             complement(266811..267872)
                     /gene="SPR28"
                     /locus_tag="KLMA_20120"
                     /codon_start=1
                     /product="septin GTPase family protein"
                     /protein_id="XP_022674459.1"
                     /db_xref="GeneID:34714604"
                     /translation="MIKKSRYQMLTAEEIRRRKNAKRGIDFCMLVIGESGLGKTTFCN
                     NICNEQVFEHREDDFKPETAHLSPGIDIVSKNFHLEEENPTPISLDIVLIPGLGDNID
                     NSTNHEVVVEYLESQFDRVLNEEIRIKRNPKNIDNRPHVCLYFIRATSKGLRELDVKL
                     MKALGDKVNIIPVISKADLLTDREIALNKRLIMEDIYENHINIYDFGDDKLEDTLMLA
                     EPVEDSPIPNNSASLDGFSLGSALEGTGANINTAFCRIKDMLPFSIIGSNQREYAPNG
                     ELYHVRKYPWGTVRVESRAHSDFIYLKSILFGSHLQDLKDTTHNKLYENYRTQKLLST
                     NNFVSAGNDRDLLAESTVL"
     gene            complement(<268258..>269463)
                     /gene="BUR2"
                     /locus_tag="KLMA_20121"
                     /db_xref="GeneID:34714605"
     mRNA            complement(<268258..>269463)
                     /gene="BUR2"
                     /locus_tag="KLMA_20121"
                     /product="protein BUR2"
                     /transcript_id="XM_022822662.1"
                     /db_xref="GeneID:34714605"
     CDS             complement(268258..269463)
                     /gene="BUR2"
                     /locus_tag="KLMA_20121"
                     /codon_start=1
                     /product="protein BUR2"
                     /protein_id="XP_022674460.1"
                     /db_xref="GeneID:34714605"
                     /translation="MATSLEEDKVKPETNDSTNSNGSTKKATSDTIEPEQQPYFNPRQ
                     LWPDIIKCPVNKWTFQCSDIIGKLGTDPEKAQITKKKMEKCLMYFHRLRKEMKLFDHT
                     YTASCILFYRYWYMYDLPASIPQCIHLAQALLVTACKTMENNRPTDHYIKATCDFMVK
                     DGPSSVGQKLNLEKLKWEVRDQLVTYEKKVLCQLGFDLALDNPKELIEELFSAYYRHV
                     RDSDIEASFKEIFPAILQEARNFIIQTGTQPISLLCDGYTMVATALIFAGITFQKAKD
                     PSFKFPHNFFRKRFPVKLTPEGVASLFADFRSLEKAFFDLKSNKGDALLISAADIEKL
                     IDEDPQDGEEPYNLYEYDLIKDGEVNEDLLKYTERKVEELATRIISERSIKRPAESVP
                     DQIPKKQRI"
     gene            complement(<269854..>271278)
                     /locus_tag="KLMA_20122"
                     /db_xref="GeneID:34714606"
     mRNA            complement(<269854..>271278)
                     /locus_tag="KLMA_20122"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822663.1"
                     /db_xref="GeneID:34714606"
     CDS             complement(269854..271278)
                     /locus_tag="KLMA_20122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674461.1"
                     /db_xref="GeneID:34714606"
                     /translation="MSSHFEIEGFEVRSLDGLPLDILLRILGQLEFSDLKNVSETCWT
                     LRLVANETLMYHSVLQNLRTRHLWTKRYFFDTLRMLRRQQPGFDFRSLSDTTIIQSLR
                     YLQVGVRKVSGNFMRLLEADSQRVDDDDDDERESSNGNCRTKYIEYDDIEDYDYDERI
                     PDNSDCYSSSISDFEEDDNNEEEEEEEEEDISSLIEIESDNDDIEDKICAVNDTPCKK
                     GVIASKPVKIDKEGLKYLRILQGFHKVSAVQAKSKQTVEKGTSTPTKYGMLIDDVEFT
                     PLSTINSLLKRIDSSADSHHVHINSPDSFGVSHSRSGSSSVFSDSVPKLTDNLWSKIY
                     ELEHQSFSSSDSDSSSSTEFIRKLQSSKKVKDKAVLFERLLAKNKDKNASYIGNTGVP
                     ASCSSSTKLKKPHVRKISDNYMEAVRRSASPVDLLNESSPDGSGAFINGTGRGRPTKH
                     SKTHHRRKLKASVMDGNRICYEKI"
     gene            <271848..>273884
                     /gene="GTB1"
                     /locus_tag="KLMA_20123"
                     /db_xref="GeneID:34714607"
     mRNA            <271848..>273884
                     /gene="GTB1"
                     /locus_tag="KLMA_20123"
                     /product="glucosidase 2 subunit beta"
                     /transcript_id="XM_022822664.1"
                     /db_xref="GeneID:34714607"
     CDS             271848..273884
                     /gene="GTB1"
                     /locus_tag="KLMA_20123"
                     /codon_start=1
                     /product="glucosidase 2 subunit beta"
                     /protein_id="XP_022674462.1"
                     /db_xref="GeneID:34714607"
                     /translation="MLFPIAFLACVVCASGSIRGVSPDKEALYAPLKDDPTKWACLND
                     SSIVIDYSKINDNVCDCPDGSDEPGTNACVDSKTLFYCENEGFIPRRIANYKVDDGVC
                     DCCDCSDEEWPVEKQGSLVRGKSCSELKVEFDGIVEKELANWRAGVSALEKLQGKAKK
                     FGHNKATNQGEENVYIELARMQKYGRDVSEALERTGEAIEGLQDAYKKKLAEQSPQLF
                     EYENMGIALITESITTVFTHVRTLSNAFNELRYILNELYETYNRKVKDKVVARNMRRF
                     VELERSFDKTFQPDGSLDATQRDQINDYLIDELPLFLFEGKSKYPADIIVAKSNFIKA
                     IITVKLETMDQTIDGIKQFQEIAEDIINNHDINFQDAAVKAFTDSYMSFMSKYGDSIY
                     RVDFPEEFDETFSNLLKFIEREAPKVTRVDYTPEDDSKWGVMRLVKGALNRIQAFSNS
                     PQSYRSQIKVMKEQEVKLRQKLRKTEKQIRELKERAAAAAAAELDDADLKHRVLHQQV
                     DTLLNNLNDFCVDSKLNSYIYKLCFSKENGGAIIQIEDKPKGKEVTVGHFKGFAIDDS
                     TKYETYLQGLQYRYPDTEVGKYLYSDTEEIGKQDILLGNLPDLDTGLRLDYRGGDRCW
                     NGPLRSAKIRMRCAPQFSIESVSEPTKCEYLFEMAGPLGCDPSFKYERKHSRIN"
     gene            <274911..>276191
                     /locus_tag="KLMA_20124"
                     /db_xref="GeneID:34714608"
     mRNA            <274911..>276191
                     /locus_tag="KLMA_20124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822665.1"
                     /db_xref="GeneID:34714608"
     CDS             274911..276191
                     /locus_tag="KLMA_20124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674463.1"
                     /db_xref="GeneID:34714608"
                     /translation="MGYFKPVGSVPETEEIYEEICDVKEFGWKTCPKVDDAAEDHALG
                     RTLTRVGILEASSMIMKRGTATKIETQSLYFCDSRTGYCGLIQMSNSVVLGGFHKSFE
                     LNIKLFNVDKGDQQHLEVCRNVKLKKPSIFQPMEVSNKDIRSVLKQKNGDQTQTQTQN
                     QDHENNCIGYLGVEGQVDDIEIHFEVKIGKGFKVKPDGRSFYSSTPIDGSPNIDRCVR
                     HAFAPNCTGSGYISVGSQRIELLDVPMVIISAMQGLKPNNAAKAWNFAAFLSAKRCIL
                     CMEFTTPKEYGEQTVTITSDTDKTASQLRVYCGTAKSHNHVEHANKILDPETNIMYPN
                     VIRIPLPNGDYEQFGPLVLFKRFDVLLEVPAVLRSIVEKVEGVNPQLYQFCQRAGESS
                     ASANGNANGNASGILLVETIFMTNTRESATKPLI"
     gene            <276796..>280005
                     /gene="IFH1"
                     /locus_tag="KLMA_20125"
                     /db_xref="GeneID:34714609"
     mRNA            <276796..>280005
                     /gene="IFH1"
                     /locus_tag="KLMA_20125"
                     /product="protein IFH1"
                     /transcript_id="XM_022822666.1"
                     /db_xref="GeneID:34714609"
     CDS             276796..280005
                     /gene="IFH1"
                     /locus_tag="KLMA_20125"
                     /codon_start=1
                     /product="protein IFH1"
                     /protein_id="XP_022674464.1"
                     /db_xref="GeneID:34714609"
                     /translation="MSGKSPRKLAAGKKPTTLKALQSKMGVSGEKPPNLSGRPRRFSL
                     IYSSDSSLSDIPQDMGKKSAVFKNRKGASKVKRQYSNSVGKNGKLISNGREESAIASD
                     SEVSEVQSGSEEIEDLEEEDDDDDDDDDDDDDDDDDSDGSMTSSDDDIDFVRLTAERK
                     KNAMKQLHALKRGKTPADISGKTVGGIRSEYSGVKMGSHSDSDSDSGSNSHSNSNSDS
                     DSDRDHGHGHGHGRGHDSDVSSSELSDAPELDFNFKGDDGIKFGDAATVSNEVVEDLG
                     EEVKEEDQLATVDSGKPNVDRLAVPNFSDSEESDYNIDQEAYFKTIDEDNNESITGMD
                     PGIETGDDDMAILDAEEQNMVKQLEHDGQSSFYESQDDHDKDNKDNDKNNEDLDYDED
                     DDEDAIMSDFDMPFYEDPKFSNLYYYDGSDQPLTLSTSLPLVLSEEKRKREERRQMRQ
                     RERQERLKRRMKSKRSKREHSATPDLADDEYVFGLFFQSDDERRPRILNDLESPLRRL
                     STVAVSDKDLSSGDDEYEDILLDIAHMPTDEEDDDDDHSVSGADDEDGSKKLKKRLHG
                     NAKGNGNGKSDLDRSDLDGDDEDDDDDDDVDIDDYDDDDDYDDDISVTNVFIDIDDLD
                     PDGFYFHYDSLSDEDGMDSKSYPETPDDHVEAVIYVDDESTDEDETLPPPNTRRKIGT
                     KAKEVVSANVVGLKPPKLGTWKTDNKPFSIIDGLSTKSLYPAIQQLQQIVDPRSAGAG
                     GTDMEDVSSPNGGGLGIGPGSGSAGEKEELTLNELLNMSELEDDDDDEGESTLKGKDI
                     STWYHKPSVPLSAFRNKGVSVEHQEDEYMLPVFSARKFPIGYVGSERTRRKIDKMKEY
                     QRKKDEKRRKLKKKKKLLKMKRERQRLEKQKLLSATEDEADVKLEQTSGNTTAGTTAG
                     TTDTTANIAANSLASPGSSIMTDTTNTPHNHHHLDLDLALPPRKNSVKGLGMEDIDEL
                     LKSDEELMLTHHGDLDGDIDLLGSEDADLLVSLAAPIDELDFDDKQMSNIAAWRRRNS
                     IAEAAAENMRVTKNGLFSETALADLEEIIGGSAELPKLT"
     gene            <280387..>282867
                     /gene="UTP13"
                     /locus_tag="KLMA_20126"
                     /db_xref="GeneID:34714610"
     mRNA            <280387..>282867
                     /gene="UTP13"
                     /locus_tag="KLMA_20126"
                     /product="U3 small nucleolar RNA-associated protein 13"
                     /transcript_id="XM_022822667.1"
                     /db_xref="GeneID:34714610"
     CDS             280387..282867
                     /gene="UTP13"
                     /locus_tag="KLMA_20126"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 13"
                     /protein_id="XP_022674465.1"
                     /db_xref="GeneID:34714610"
                     /translation="MDLRTTYASTKLEPFYASSGAIASVSEDGKLLATPVVDKINIVS
                     LQEPRRILHSIETDDEQDITALQLTPDGEYLCFVSQAQLLRVYSLKEERVIRSMKVSS
                     PVYVMACDETSTLLALGGTDGSVSVVDIEKGFVTHSLKGHGATISSVKFYGELNSETW
                     KLGSGDTNGMVKVWDLVKRACQFTVQEHTTAVRGLDFRPVGDGDGEKVQLLSGGRDNI
                     VNLYEFGKSQKKCKLLKTVPVNEQVESCGFTHEPEVFYCAGGGAVYQLVSLVSGKVVK
                     QTRAPIEELFIIGTLPILHGTKQYLVFSDQTLFLIDIEEALSSDNSEYIEVEGKIAGN
                     HGTIADIRFVGPNLDKLALATNSPTLRIIPTPLSRDPEEQGDQEEFPIEVSMYEQHTD
                     LLNSLDATSDGMWVATASKDHTVVLWKYYRDLEEFFPYAKFVGHVGSVTAVGLPHVMP
                     RQWPEFVLTASNDLTIKKWRVPKPAAATGGEEEGDQPLDEPIVVKTSEYTRRAHEKDI
                     NALSIAPNDSVFATASYDKTCKVWNLDDGEFLATLANHKRGLWDVAFCQYDKLLATCS
                     GDKTIKIWSLDTYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVILWDLSTGEAV
                     KTLDAHNNRIWALAVMNDGESFVTADADGFFEFWRDNSEEEQERNMEQEKLKIEQEQS
                     LQNYLAEGDWTNAFLLAMTLDHPMRLYNVLRRTINFSSEASDDSIVFNKEIDELVGKL
                     DKDQILMLVKRCRDWNTNARTHTVAQKMIRCILLRQNIEELSEIPGLVRIVESIISYA
                     ERHYARVDNLVQDSYILDYALVQMDKLL"
     gene            <283155..>283742
                     /gene="RSA3"
                     /locus_tag="KLMA_20128"
                     /db_xref="GeneID:34714611"
     mRNA            <283155..>283742
                     /gene="RSA3"
                     /locus_tag="KLMA_20128"
                     /product="ribosome assembly protein 3"
                     /transcript_id="XM_022822668.1"
                     /db_xref="GeneID:34714611"
     CDS             283155..283742
                     /gene="RSA3"
                     /locus_tag="KLMA_20128"
                     /codon_start=1
                     /product="ribosome assembly protein 3"
                     /protein_id="XP_022674466.1"
                     /db_xref="GeneID:34714611"
                     /translation="MSQGDIAVKKSAKRKNRRKKRRTQDVSDSESSSSSSSDGEEVQN
                     QDLGQDQDQVEASVEASVAEMDVDVVLSDDELPREMSKDTVERLSEVKLTTSDLTGTH
                     GIHLGNIDLQKMAGNLDASREKFQGKAQGQGQDKSGLKNEYLSMLFESYGDDMNELRQ
                     APDFTNKTLVMLANVLKDGGDMFDVETLKTVVEGK"
     gene            complement(<283938..>284810)
                     /gene="CCC1"
                     /locus_tag="KLMA_20129"
                     /db_xref="GeneID:34714612"
     mRNA            complement(<283938..>284810)
                     /gene="CCC1"
                     /locus_tag="KLMA_20129"
                     /product="protein CCC1"
                     /transcript_id="XM_022822669.1"
                     /db_xref="GeneID:34714612"
     CDS             complement(283938..284810)
                     /gene="CCC1"
                     /locus_tag="KLMA_20129"
                     /codon_start=1
                     /product="protein CCC1"
                     /protein_id="XP_022674467.1"
                     /db_xref="GeneID:34714612"
                     /translation="MSLVAIKNAVSKLVSKNDEAPLLSNNNNHNNSYGSSTDVESGKN
                     THEDHLDYPQPSNGLGFFGKVDPRVMSDLIIGLSDGLTVPFALTAGLSSLGDARLVIT
                     GGFAELISGAISMGLGGYLGAKSESDYYKSEVSQEKKKFYSNTQLINHEIEDILLEMN
                     PNFSEDTVISFVKDMQRDPGLMVDFIIKYGKGLDEPDDNRQWISAVTIGGGYFAGGFV
                     PLVPYFFVDKVITGLLVSIVLMTITLFWFGYFKSQVSMADSTLQRKVLEGLQMVAVGG
                     VAAGAAWFFVKIIE"
     gene            complement(<286313..>287413)
                     /gene="ECM4"
                     /locus_tag="KLMA_20130"
                     /db_xref="GeneID:34714613"
     mRNA            complement(<286313..>287413)
                     /gene="ECM4"
                     /locus_tag="KLMA_20130"
                     /product="glutathione S-transferase omega-like 2"
                     /transcript_id="XM_022822671.1"
                     /db_xref="GeneID:34714613"
     CDS             complement(286313..287413)
                     /gene="ECM4"
                     /locus_tag="KLMA_20130"
                     /codon_start=1
                     /product="glutathione S-transferase omega-like 2"
                     /protein_id="XP_022674468.1"
                     /db_xref="GeneID:34714613"
                     /translation="MGIADFADKDGSFKRQVSSFRETISPNHPVYKPEKGRYWLYVSL
                     ACPWAHRTLITRVLKGLTSVIGVSVVHWHMDDKGWRFLPYEKGQEAPNQPFTPAAGLK
                     SENKLVVSSGVANDSLRYDVDGTIDHNYHFNRISEIYFKSEPEYNARFTVPVLWDLKT
                     QTIVNNESSEIIRIFNSGVFDAVADAHEPIDLVPKELESAIDEINSWVYDTINNGVYK
                     AGFAEKQDVYEKEVQSVFQGLDKVEAILKANSEKKLKTESSISTSSNSKNSLYLVGDQ
                     LTEADVRLYPTIVRFDPVYVQHFKTNLTTIRDGYPYIHLWLRNLYWNYPAFRETTNFN
                     HIKWHYTRSHGKINPLGLTPLGPSPCVLPLPE"
     gene            complement(<287793..>288212)
                     /locus_tag="KLMA_20131"
                     /db_xref="GeneID:34714614"
     mRNA            complement(<287793..>288212)
                     /locus_tag="KLMA_20131"
                     /product="Golgi apparatus membrane protein TVP15"
                     /transcript_id="XM_022822672.1"
                     /db_xref="GeneID:34714614"
     CDS             complement(287793..288212)
                     /locus_tag="KLMA_20131"
                     /codon_start=1
                     /product="Golgi apparatus membrane protein TVP15"
                     /protein_id="XP_022674469.1"
                     /db_xref="GeneID:34714614"
                     /translation="MSTPVLNAYRIATIGFSGVLSLLFLSQLFFNLFRLSVLTRAIFG
                     LVLSVLLGLLEFREVGQLDKYASFYYTYPGRGALFALLFGLLDYSGAFSIIVGVLLWP
                     MIGAHAVLSVRPDLGEPAYFKTANIALSTGEDEGDIV"
     gene            complement(<288647..>289399)
                     /gene="BMH2"
                     /locus_tag="KLMA_20132"
                     /db_xref="GeneID:34714615"
     mRNA            complement(<288647..>289399)
                     /gene="BMH2"
                     /locus_tag="KLMA_20132"
                     /product="protein BMH2"
                     /transcript_id="XM_022822673.1"
                     /db_xref="GeneID:34714615"
     CDS             complement(288647..289399)
                     /gene="BMH2"
                     /locus_tag="KLMA_20132"
                     /codon_start=1
                     /product="protein BMH2"
                     /protein_id="XP_022674470.1"
                     /db_xref="GeneID:34714615"
                     /translation="MSLSREDSVYLAKLAEQAERYEEMVENMKNVASSGQELSVEERN
                     LLSVAYKNVIGARRASWRIVSSIEQKEEAKEKSEHQVQLIRTYRSKIESELTKICDDI
                     LSVLDTHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGEVRETATQSSLEAYKEASDI
                     ATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKD
                     STLIMQLLRDNLTLWTSDMSETGQEDQPVEGA"
     gene            295119..295233
                     /locus_tag="KLMA_R205"
                     /db_xref="GeneID:34718651"
     tRNA            join(295119..295155,295189..295233)
                     /locus_tag="KLMA_R205"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34718651"
     gene            complement(<295538..>300078)
                     /gene="IRC20"
                     /locus_tag="KLMA_20133"
                     /db_xref="GeneID:34714616"
     mRNA            complement(join(<295538..299048,299138..>300078))
                     /gene="IRC20"
                     /locus_tag="KLMA_20133"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822674.1"
                     /db_xref="GeneID:34714616"
     CDS             complement(join(295538..299048,299138..300078))
                     /gene="IRC20"
                     /locus_tag="KLMA_20133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674471.1"
                     /db_xref="GeneID:34714616"
                     /translation="MSSRSDCTVWELREEDVEFVEGISTFSFNETLKPFESVNKKSYE
                     KYSVVPILDWEFKYGEFTKSDKCKQVSVSLSFERDQETDKSYMLFSHDSWLLGKWNCT
                     QWSPQLQQAIDCASVKVQEARNWEELVRANENTNANVNGGETAAVISNKRKKKKRRIA
                     IRDKNTYRFKDVKLHPLIMYVDENNNWMIKLQLSLLCYLDNANNFGKETNKLLSDLFL
                     SRDVERYVKKIDKAKIRNEFSDVVSRYTEQTVRKGVQIEVPPQLDVSLMPFQMESIDW
                     MLRKEGYYDKEDTPPARDVKTTEELLEFLNEHISFGYQEWISNHRHEGKRAKGLLAEE
                     MGLGKTIEILCLFAKNVRNIPKGSENETFISPLNGKIIKRVKTNLVVCPESILQQWID
                     EMAIHIRGEDSDFSVFHYEGFEKARKRFNNEQPKQIVERLAEYNVIICSYSTLSSEVH
                     YAEFSQIQRPSRESTRRYDYTSPLSVMEFHRIILDEAQLLRRTLYATRCADTIHRVHT
                     WGVSGTPVQWFTEIQNIFGYLQIHPFHVMQNIVSTVSSIEFRRKRLLLRPDAYNAIFP
                     EEEFNGFQGSIVSLEEFVDIFPRFNLAIRHLKRDVQNQIKIPRQINYMVPVEFNPIEQ
                     DHYVNLWNSFLSVSGYDSRGNGSGNLDTSQLSVWLNRLRMTCCHASMSIMNGSEGVSW
                     RETDELKDMDAILDGMREEVLDKIYGLQRENYAIKIQLGQVRMEIDEKFEDAISIFKG
                     IIKEITHDLKQTYGIENFLKINEDSVKKGLSTKNMANIRLLLHILHQAFFFLATTCYQ
                     LGTKKLDEAQADAETEAKSEVKSETKSIVYTADEMSTITRFQELEKYNYGIAEQLRRE
                     MLHERIYDVDSEINRVRDWLMNAKHKRKMLLDTISSKKGNLGSILESSYIFQKMVTLF
                     EIMNQQAQQFNRLMKDLEVLSYNTIIKDYDNDDNDEEKAKEYGRSIDDQDKVFSILDV
                     MERILKNREDMMVMETTVEPVNVKLEVSLLSSEFHAELLKSTVFVHGETLKQLLNKAE
                     EDKSIRQLLSKSGLANHMMQDFINCYEMEIPRIVRENQEVRNGVLKRFNDIYNAKTSY
                     YSYLQRISDSLVPLSDQSVKVKNGIIKRVNEGYEYESNVKVIHNLESRVRYLETLSQL
                     KSAIARGENISCAICYSEIYTGSILKCGHFFCKECVTHWFRKNASCPLCKNAILTTEV
                     YHFKFREGTEDAAKEEAKEATAKAGDAETEVKANCKGQEQEQEGREGEREGSEEDIIT
                     KKYSRFSKMSEVDNVVLGNSWGGKVDQVLKLIMYIKQKHLEDEPHKKRPQIVVYSSHQ
                     AFLDILSRLLMSHGIVYARSVRNTKFAKAVNKFRKDPECTCLLLNLQSQATGLTLVNA
                     RHLILLDPILGESTEQQAISRIHRIGQSEETYVWNFMVRNTVEESIMKYKAILAGAAG
                     NTSGETSGEDNFSLEDLSSDSRGKEHLWHCLFESGSGSGATHHLVNN"
     gene            <301321..>302952
                     /gene="RCK2"
                     /locus_tag="KLMA_20135"
                     /db_xref="GeneID:34714617"
     mRNA            <301321..>302952
                     /gene="RCK2"
                     /locus_tag="KLMA_20135"
                     /product="serine/threonine-protein kinase srk1"
                     /transcript_id="XM_022822675.1"
                     /db_xref="GeneID:34714617"
     CDS             301321..302952
                     /gene="RCK2"
                     /locus_tag="KLMA_20135"
                     /codon_start=1
                     /product="serine/threonine-protein kinase srk1"
                     /protein_id="XP_022674472.1"
                     /db_xref="GeneID:34714617"
                     /translation="MFKLKNMFKRKSPAPTVLPDTTEGGSTSGGSTTLEISFQKQLNV
                     SEKTSTVSNSAKEEPEQIIVEQEEHARSSEDTTKVEEIEADEDSTDSTMTPPEEPEGN
                     FAEQSELRDYTLIQKIGEGAFSKVYRGVPSKSNSSNTSSSVIANQYKQVAIKVIIKQQ
                     LPNSKSKRGEHEENKGKTSTAEQVLKEIAIHKMVSAGQNIVTFIDFQESDSYYYIIQE
                     LLSGGEIFGEIVKYTYFSEDLSRHVIKQVAHAVKYMHQLGVVHRDIKPENLLFEPIDF
                     IPNPKRKLRKSDDPSTKLDEGIFRPNIGGGGIGVVKLADFGLSKQIFQTNTKTPCGTV
                     GYTAPEVVKDERYSMQVDMWGVGCVLYTMLCGFPPFFDEKIDVLTEKISRGEYTFLRP
                     WWDEISDGAKNCVRKLLEVDPAKRYTADQLLEDSWLNTYDCIPSSIGQQENINSSSNM
                     SKRRHSHRHARKAYKKDTALLYSPAAVAMRDAFDVSNAVQRIEDDRRMTPGPKNIYNG
                     LDVLAEDVESEIQHREPFTLKLDSSSIIKRRRNNV"
     gene            complement(<303226..>305622)
                     /gene="MEF2"
                     /locus_tag="KLMA_20136"
                     /db_xref="GeneID:34714618"
     mRNA            complement(<303226..>305622)
                     /gene="MEF2"
                     /locus_tag="KLMA_20136"
                     /product="ribosome-releasing factor 2"
                     /transcript_id="XM_022822676.1"
                     /db_xref="GeneID:34714618"
     CDS             complement(303226..305622)
                     /gene="MEF2"
                     /locus_tag="KLMA_20136"
                     /codon_start=1
                     /product="ribosome-releasing factor 2"
                     /protein_id="XP_022674473.1"
                     /db_xref="GeneID:34714618"
                     /translation="MFLKLFVRRYATNSKRDLSKVRNIGIIAHIDAGKTTTTERMLYY
                     SGKINRIGDVDQGDTITDYLPQERSRGITIQSAAISFNWKKDYKVNLIDTPGHADFTF
                     EVIRSLKVLDGCVTILDSVAGVEAQTEKVWKQSSGLPKICFLNKMDREGAGFSRTVKE
                     LVVKMNTRALLVNTPVFKVEPGTKDSKFVGVLDLIYGKQLVWDRDDPDKINVIDVTEG
                     HEYYDDLLHGREALVETLGEVDESLVEHFLSDADGDYLKVSPDVLNKSIRNATLSLHA
                     TPVLCGASFRNIGVQPLLDAIVNYLPDPSEARPPEVNNKDIKVTSNPKNGLILNNNPN
                     LCVSLAFKVITDAIRGTMVFIRVYSGVLRSNHTVYNTTTGTKFKIGKLIQMHANIPEE
                     VNELYPGDIGVLTGSNVSEYIKTGDTIITHVTKKDGIRSFDKKKELTLKINPIEIPPP
                     VFNAAIEPKTLGNKKPMEEALAQLTREDPSLVVTQDEESGQTLLSGMGELHLEIARDR
                     LLNELNAQVDVGKVIVSYKETVNSTCKERTIETEDGYRITAVIEPLDEEIKSNPPGNE
                     EWYSLASDNNFMVMEKHMTYDAEKNWPFQVPYVTVVNSLLPSCLVALQRGGKIGGFPL
                     NSCVVRIRGDWEVPKDATSITPLLTHSRQLFSQILAEEDEKNFSVLEPVMNVEVMVQQ
                     QDMGPIIQDLSSARKANILSIEDENTSAIDESNITFKNIAEQMWLPKDMTLEFAKIGK
                     EAQAPKLIQAQAPLKEMVAYNNKIRSITQGRGSFNMYYHGMQPVTHDRLQAILSDYYN
                     "
     gene            <305948..>306877
                     /gene="GCN3"
                     /locus_tag="KLMA_20137"
                     /db_xref="GeneID:34714619"
     mRNA            <305948..>306877
                     /gene="GCN3"
                     /locus_tag="KLMA_20137"
                     /product="translation initiation factor eIF-2B subunit
                     alpha"
                     /transcript_id="XM_022822677.1"
                     /db_xref="GeneID:34714619"
     CDS             305948..306877
                     /gene="GCN3"
                     /locus_tag="KLMA_20137"
                     /codon_start=1
                     /product="translation initiation factor eIF-2B subunit
                     alpha"
                     /protein_id="XP_022674474.1"
                     /db_xref="GeneID:34714619"
                     /translation="MSEQEFNITDTYLKFLAEDSEMTMPIAAIEALVTMLKVRNPKTS
                     AEMIKSTKQSIEELTTSIPNSISLRAGCDIFMRFVLKNTHLYGDWENCQQHLIENGHL
                     FVSRAKQSRNRIAEIGLDFISDDDIILVHGFSRAVFSLLSHAAEKLIRFRCVVTESRP
                     SSQGKQLYDLLKGKGIPATLIVDSAVGTIIHKVNKIFVGAEGVAESGGIFNLVGTYSI
                     GVLAKNARKPFYVVSESHKFVRMFPLSPDDIPMERDPLDFSKNNTEDNDEYPLSGPSL
                     DFTSQEYITALITDLGGLTPSAVSEELIKMWYD"
     gene            complement(<306944..>307663)
                     /gene="RPC37"
                     /locus_tag="KLMA_20138"
                     /db_xref="GeneID:34714620"
     mRNA            complement(<306944..>307663)
                     /gene="RPC37"
                     /locus_tag="KLMA_20138"
                     /product="DNA-directed RNA polymerase III subunit rpc5"
                     /transcript_id="XM_022822678.1"
                     /db_xref="GeneID:34714620"
     CDS             complement(306944..307663)
                     /gene="RPC37"
                     /locus_tag="KLMA_20138"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit rpc5"
                     /protein_id="XP_022674475.1"
                     /db_xref="GeneID:34714620"
                     /translation="MNGAERDEKKVFAGEEEEEDPVVQEIPINLTTGPCPLHVLQFVN
                     KPKKLSKNMEEHPPVAGVRYKEESHVWELDIPLNTQVFYDKEKAKEVWDNVELQSLSG
                     VAVESDMQQYVGVMKEGQLYLVPVEKVAQMRPYFNYIDVQQKARKDDDSKRAAGAGSN
                     NAKSNQVVTMSVKSSSEANQNRLGGALLAHKVAEEEEPKDLEWKEDTYEAFVEEITCK
                     DSVRETLKPKDDEATYLSKLF"
     gene            <308254..>310464
                     /gene="DBP7"
                     /locus_tag="KLMA_20139"
                     /db_xref="GeneID:34714621"
     mRNA            <308254..>310464
                     /gene="DBP7"
                     /locus_tag="KLMA_20139"
                     /product="ATP-dependent RNA helicase DBP7"
                     /transcript_id="XM_022822679.1"
                     /db_xref="GeneID:34714621"
     CDS             308254..310464
                     /gene="DBP7"
                     /locus_tag="KLMA_20139"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DBP7"
                     /protein_id="XP_022674476.1"
                     /db_xref="GeneID:34714621"
                     /translation="MSLEDDDGMLLNFTTDVSSEDRVGSKSNSKVTGGKWKDRRRAKL
                     LLEGRKPRGRARGQEFPGAEVSGEGSEDLGEGELEVKRSRYEQVKAREEAAAKPAAPR
                     EVQLNAQIVSSLFTSSRTIDTVTNNNAHDDSAEVNPSNAPLVGDTFEDFGITETMVKH
                     LNEKMKISKPTKIQKLVIPPFMQAKNDLFIHAQTGSGKTLAFLLPIFQKILSLGQNVN
                     RQSGCFALIVTPTRELANQIYQVTTELAQCCHFLVPCLLIGGERKKSEKARLRKGANF
                     IIGTPGRVLDHLQNTKVITEQLAPSLRYVILDEGDKLMELGFEETLKEILNIIHGIDI
                     DIHRFPKLPKRILHVLCSATVKGNVSKLGNVTLQDYKLISSGQKQTETTTVPDQLIQK
                     IAIVPPKLRLVTLAGVLTTLTQKHYKLAKTECTRTIVFLSCSDSVDFHYETFSSNDGN
                     YRGLVGDTARLLTKGSTVLPCFSDQEDPNVICYKLHGSLSQQTRTATLKHFATNNDAT
                     KGRHLILFCTDVASRGLDLPHVSTVIEMDPPFAVEDHLHRIGRTARAGCEGESLLFLL
                     PGEEEGYMDYIKPYHPKGWKLLTYDEQILRPAFEGLNVRRTDKKKADWDKHEAQAWDN
                     NATTWHLNVERRVLEDSHFKELAVKGYMSHIRAYATHLSQEKQFFNLKCVHLGHLAKS
                     FALRERPKSMGLQQGKAGSAAAASQKKPKEDAKSKMLRMARMAMKQSNDEFNFA"
     gene            <310810..>312606
                     /gene="GSM1"
                     /locus_tag="KLMA_20140"
                     /db_xref="GeneID:34714622"
     mRNA            <310810..>312606
                     /gene="GSM1"
                     /locus_tag="KLMA_20140"
                     /product="glucose starvation modulator protein 1"
                     /transcript_id="XM_022822680.1"
                     /db_xref="GeneID:34714622"
     CDS             310810..312606
                     /gene="GSM1"
                     /locus_tag="KLMA_20140"
                     /codon_start=1
                     /product="glucose starvation modulator protein 1"
                     /protein_id="XP_022674477.1"
                     /db_xref="GeneID:34714622"
                     /translation="MTRKLSPQEKMNRKPINTACVFCHSKHLQCDVGRPCQNCTKRGI
                     GETCRDKERKPRKRGPRKLKREGSVDQEQKFEKVASSDNNESVTIVSTIHHNMLVPVV
                     NTAKSSVREAKPAKILKPKKPVDVATKRKNISKLAMDTFQLPLPPVHSQPESSLEKHK
                     KIVSPELLPKIPSLTQLFNPTAEPVISDALLPSNQSSTTNIPSLVEKMNLEHKDRVQE
                     QVADHLSLHTRDHSSNDTSGNSSGGEFGSVWTTEEYTKLNDMLSTPNLSRNGSKTYLN
                     ANATWSPSNMIKMDPIDESPNPNTSNNILASAATQNHTINLAGNSLRRTNSRPHISLD
                     QMVGDSRRGDSVTDTSPESQSAETAETLTPYKFRMIVKSAEDLYKHQDLIQPHNYKSA
                     YLELSKFLRSRFIQEGDKAASSQKEERDGPAQLQNIAYSIKSHYAPIFVTLTTNLIAQ
                     DLKLQELILQRALLEYESMAKLVNCTPMCIWRRSGEICFASNEFISLTGFSKKEILNQ
                     RKFIMEFMDNESIVDYYDIFHEYLAFGSTQGGAFSSSMGTSDGQAIFSECNLLLKNGC
                     YLRCACIWTVKRDGFNIPMLIMGQFLPIFDME"
     gene            complement(<312753..>314249)
                     /locus_tag="KLMA_20141"
                     /db_xref="GeneID:34714623"
     mRNA            complement(<312753..>314249)
                     /locus_tag="KLMA_20141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822682.1"
                     /db_xref="GeneID:34714623"
     CDS             complement(312753..314249)
                     /locus_tag="KLMA_20141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674478.1"
                     /db_xref="GeneID:34714623"
                     /translation="MTKEQAIEYAVQELPNILPLDSDQIKDLCEQTIKENGGDSERIA
                     QALFEILGQDDLSVHFIFEFNERLMEPPKSVKPVAPVKPVSPVKPVAPVKPVASVAPV
                     KQAKPETSTVRSDHHPVKESAPRKTSKDSKEIRLESLKDIDDVLKMLELRSGTGNPEQ
                     YKCNCQGTRHPIFDPAPNCLHCGKIICVKEGLHMNNCSFCQEELIPREERENIMKLLQ
                     MEKEHIELKKVQENMPKPKPKQTKKYKITSGAGTNLWKEQEKMLQRVEKDRNQERETK
                     RQQILNQDEEAGGDEDEEEQLKEARMRLEKLLHYQDTSAERTKIIDNASDFALNEDVM
                     WGSAYERALQLKKQQRNLRKWEKIEKERNGRREKIVLDLTIGKDGKVVMTEAVKKKNG
                     NDNVNAASDDEFDDISDEEDLQDLEDIHNLKAEISSQREQERSKLQSRVWDYEKAQAE
                     FSKPVYVPGPDEQTEKVPERPEVQKKVHRVQVGDNDRPSLQDNILAIL"
     gene            complement(<315406..>315816)
                     /gene="PAM16"
                     /locus_tag="KLMA_20143"
                     /db_xref="GeneID:34714624"
     mRNA            complement(<315406..>315816)
                     /gene="PAM16"
                     /locus_tag="KLMA_20143"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM16"
                     /transcript_id="XM_022822683.1"
                     /db_xref="GeneID:34714624"
     CDS             complement(315406..315816)
                     /gene="PAM16"
                     /locus_tag="KLMA_20143"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM16"
                     /protein_id="XP_022674479.1"
                     /db_xref="GeneID:34714624"
                     /translation="MAHRAFVQVIFTGAQVFGRAFAEAYRQAASQTAKQSANASRARG
                     ASAEYGGITLDESSKILNIENEKDMNLDKINERFKYLFDVNDKDKGGSFYLQSKIYRA
                     AERLKYELAQKEKAAADAAGGGKQAKPQEPANGE"
     gene            <316616..>318469
                     /locus_tag="KLMA_20144"
                     /db_xref="GeneID:34714625"
     mRNA            <316616..>318469
                     /locus_tag="KLMA_20144"
                     /product="hap4 transcription factor"
                     /transcript_id="XM_022822684.1"
                     /db_xref="GeneID:34714625"
     CDS             316616..318469
                     /locus_tag="KLMA_20144"
                     /note="heteromerisation domain"
                     /codon_start=1
                     /product="hap4 transcription factor"
                     /protein_id="XP_022674480.1"
                     /db_xref="GeneID:34714625"
                     /translation="MSKPVSVPIESLHGHGHGHSQGSGGGGHHQITIAPNLQPRKHGK
                     PTGITIRTSRHWVLPPRPKPGRRPSPAVSIKQQASASASASVSASASSVSPGVSSSVS
                     PAPAVKVKTETEEHSVQAKKSDKGGSVTGSRPNANSIPLTNSKSKVQNAKQTRKSEIT
                     AKTQVKVKTEHSNAVHSPVSTATAAATAAAAAQPIPSQTPAPVQSADTKKKPSSKTAL
                     KKEIQILKMENNKLKQELSDLVGNLQELKRQFPIASPPEDANLLKTQKGVPAAKGKAS
                     AVAAAGMTRKRSIIDSDIDMLQAHPLQASSSSVSHHHHHEVKPEPLDDTEIFLKFDED
                     DEPHKDLIKNLSSSRMNQTSSLSSRTSFTDDDDLLLSSSTPSSLFSTDLNRTVSNQMF
                     STSTMVTNTGSSPSSSHTSNKSLQNSQYSDTIETMKFIDGYEQMEFYSKYKLSSNHSQ
                     EPLKSVQKLKSDHVASHQDELDCIREEEPVTDLLATGAISASNSTSVTAKPSNPDQDS
                     GMLYFLQKHALSKNPGSKLGDLPIDLDDSLPSSLLLKLGEEDENSFMNLNLKSIDPDD
                     PLNEHVTDTPFVAPTLEELMEEQDDKDSKLLGPENTEQDMDLLKMGIFFTD"
     gene            complement(<318940..>320112)
                     /gene="CTF13"
                     /locus_tag="KLMA_20145"
                     /db_xref="GeneID:34714626"
     mRNA            complement(<318940..>320112)
                     /gene="CTF13"
                     /locus_tag="KLMA_20145"
                     /product="centromere DNA-binding protein complex CBF3
                     subunit C"
                     /transcript_id="XM_022822685.1"
                     /db_xref="GeneID:34714626"
     CDS             complement(318940..320112)
                     /gene="CTF13"
                     /locus_tag="KLMA_20145"
                     /codon_start=1
                     /product="centromere DNA-binding protein complex CBF3
                     subunit C"
                     /protein_id="XP_022674481.1"
                     /db_xref="GeneID:34714626"
                     /translation="MFDCRLFLSLPIDIRRNVYLFLGDNVQIVRPPPKSSIFSDEIIE
                     YPAVTVTEYDNTLAERYEQHVKIYDYIPNFVSNWCRGFELIKQDPLVADRLKVCMKYE
                     EEDWFCMQWILVCGQLEVGIFTQDEQFLQVSYGLKEFCEVVDVPVQRLSLGMNVSEIN
                     NIEELCTEIKRHWLFDTVQFVSFVNCWDMEHPNVASIINFMENFNNLRLLKVESQNMF
                     DNLINTQGVRANPGKTIVYNVRQNILELRAYSLRELGYKSLVNLSRWEQLVSLSLIGC
                     EFIDLNKLVFPKRCKILNIQDIKYIVWWNQAEILEVLDSNWLNRTTISKPQSPEQVEK
                     WYSVYIRVVETYHPINCITIQNVKRIKGNIIVPARLLEASRIKISNVTKMDEILMI"
     gene            <320249..>321418
                     /gene="SLD2"
                     /locus_tag="KLMA_20146"
                     /db_xref="GeneID:34714627"
     mRNA            <320249..>321418
                     /gene="SLD2"
                     /locus_tag="KLMA_20146"
                     /product="DNA replication regulator SLD2"
                     /transcript_id="XM_022822686.1"
                     /db_xref="GeneID:34714627"
     CDS             320249..321418
                     /gene="SLD2"
                     /locus_tag="KLMA_20146"
                     /codon_start=1
                     /product="DNA replication regulator SLD2"
                     /protein_id="XP_022674482.1"
                     /db_xref="GeneID:34714627"
                     /translation="MVEKVETAGPQTSVIYKMDQLKIEIKLWERSFEKEHGRLPEKED
                     IKADKEIKRKYKQYAQYKKLIEHQGKQEHLESKQSGIDQTPVKAVVDDAKTEFGPTPQ
                     MNGKLVSIFEMKFSLVKDHSSETLEAVGSPVRGHESVRRQLNFAITPGSSPIKGAPKL
                     EYPEASTTAASNGLRYGPNSPMRVDDIGLKLSDTPKTLGRMHDIKSSPYSPSPLIKRP
                     SKTLSELAKEHALIKNEFESNTEDFSEFNAIRTLTEKLMQEEKLKKIDEEAEEDDNAN
                     TSAFIRKAKTIKKKTRAKMRPAPATLNEVKQNKMLNTNVHERLAKLKQREYNRMLGKD
                     DIESDSDSETEMAPTPAKKPRKKNSKYNLVSNNFKRLNLPTKAGRNRAKKWRSRM"
     gene            complement(<321536..>323098)
                     /gene="UTP15"
                     /locus_tag="KLMA_20147"
                     /db_xref="GeneID:34714628"
     mRNA            complement(<321536..>323098)
                     /gene="UTP15"
                     /locus_tag="KLMA_20147"
                     /product="U3 small nucleolar RNA-associated protein 15"
                     /transcript_id="XM_022822687.1"
                     /db_xref="GeneID:34714628"
     CDS             complement(321536..323098)
                     /gene="UTP15"
                     /locus_tag="KLMA_20147"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 15"
                     /protein_id="XP_022674483.1"
                     /db_xref="GeneID:34714628"
                     /translation="MSSARPRVIPLKAPVLPKQTTPEQRYWRQYSSTQLVKEHNAVTH
                     VSFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSATFRQDGKLLVAGDAT
                     GLVSVYDSYNPRTLLLSIQASSHPTHVTKFHDQDNKTLVTANDDRVVRLWDVSHAYEP
                     TLQLTGASDYVRSVCFVPNAPHMVVTGSYDGVVRLYDVRSKSDKPTTTLDHGLPVEDI
                     TAISPTQLASCGGNGFKVWDLTSDRIICERQNFAKTVTCLNYTNMDTESPMSSVLVAS
                     SLDGHVKIFSPLENFEFKFGWKFSNAVLSCAVSPGDAQGNKHFVAGLSSGILAIKTKK
                     KSNKINLADVSSLDDLPLQQQEKSAKSNNFQRMMRGSEYRGDLEHIIHNDKPNPQRKL
                     RQFEKYINQFKWSDALDSAFIPGMAKELTLTVLQELRKRGKIKVALYGRDESSLEPLL
                     NWCLKGIEDVRSAPIVADWIAVVIELYGNDLEKSPVLEEMVITLKKRVREEIYKAKEA
                     QKIEGMLQLLTN"
     gene            <323699..>325567
                     /gene="AIP1"
                     /locus_tag="KLMA_20148"
                     /db_xref="GeneID:34714629"
     mRNA            <323699..>325567
                     /gene="AIP1"
                     /locus_tag="KLMA_20148"
                     /product="actin-interacting protein 1"
                     /transcript_id="XM_022822688.1"
                     /db_xref="GeneID:34714629"
     CDS             323699..325567
                     /gene="AIP1"
                     /locus_tag="KLMA_20148"
                     /codon_start=1
                     /product="actin-interacting protein 1"
                     /protein_id="XP_022674484.1"
                     /db_xref="GeneID:34714629"
                     /translation="MASISVEEVYGPAPSTKRNFTTHLSYDSKSDSLGYGSGRSAILR
                     SLDGKSVVQFTGHGTSNVTVVRFSPIGGSQYVVSGDDSGKVIVWSWNRDDASGEIEYN
                     VKSEFQVLAGPVVDISWDFEGKRLAIVGEGRDRFGAFISWDSGNSLGEVSGHSQRINA
                     VHLKQSRPMRAFSVSDDGSVVFYQGPPFKFASSDRTHHGQGKFIRDIRFSPGNGLYAV
                     SVGSDRKICCFDGKTGEFLKYIESKESPIEGGLFSVAWLDDGEGSSRVVTGGADGLVR
                     LWDVTKESDPLLKVWTLGEGLSSQVVGLAVTKENKVAALTLDGTINILSLEDDNVEFI
                     YGHNKGITALTVNPLVSGSYDGRIVTWKDATHGADVPTLSHDIHTNIVLAVDNSDNEV
                     SSVSWDNTLKNFIYGSKSAETKYHFDHQPKCAVFAESMLAAATEDNKLLIIDNKTGLL
                     SKSVKLDKPIATIALGTTYVAVAYEQTNNVQIFQISDLSDVFTLSQPLRATPSALSFS
                     PSQKYLAAGDSSGKIILYDLETKEVKTSRWSFHTSKITSIDWRKPADEDAEEDHVVTA
                     SLDTNIFIYSVKRPMKVIKRLNAHKDGVSSALWEDDHTIVSAGVDALIRRWKVEFA"
     gene            <325948..>327234
                     /gene="NPL6"
                     /locus_tag="KLMA_20149"
                     /db_xref="GeneID:34714630"
     mRNA            <325948..>327234
                     /gene="NPL6"
                     /locus_tag="KLMA_20149"
                     /product="chromatin structure-remodeling complex subunit
                     RSC7"
                     /transcript_id="XM_022822689.1"
                     /db_xref="GeneID:34714630"
     CDS             325948..327234
                     /gene="NPL6"
                     /locus_tag="KLMA_20149"
                     /codon_start=1
                     /product="chromatin structure-remodeling complex subunit
                     RSC7"
                     /protein_id="XP_022674485.1"
                     /db_xref="GeneID:34714630"
                     /translation="MAAATRGRGRGRGKRSSRSTGKQPSYNIGSEDVDVQYDDKDDEY
                     AGSANDDEYDDDQDGDNDFEGTSTRGRRKAHSSTPVPVALPTRGRPSKRKSGDDLKDP
                     KRQKLPYPVDENGSPYPIVNDEYALPEDEEGETKITKNGDLLGGRQFVVRTFTVASRG
                     ETKYMLSTEAARAVGFRDSYLFFQYHSNLYKLIISQTERDDLIKQGVLPGSSRNRIIA
                     LVTARSVFREFGAKIIVDGKNITDDYYATKLRASGTVKEGTPARETSHSNVNQHAGRT
                     NNVHGIDIPHQLSVNPSRNAVEFFDKRNHNIPSTSNISSTNWLYHHAAACSRFNSDLF
                     YDRERILLIENLGIRDTYTNVLHIPQSTQPTKVISMRKVKGNTNQVMYETRIKSLDLA
                     RPHTGLSDVPAAMYEDILDKDIIAAIEEQKNFEMGL"
     gene            <327626..>330157
                     /gene="YTA12"
                     /locus_tag="KLMA_20150"
                     /db_xref="GeneID:34714631"
     mRNA            <327626..>330157
                     /gene="YTA12"
                     /locus_tag="KLMA_20150"
                     /product="mitochondrial respiratory chain complexes
                     assembly protein RCA1"
                     /transcript_id="XM_022822690.1"
                     /db_xref="GeneID:34714631"
     CDS             327626..330157
                     /gene="YTA12"
                     /locus_tag="KLMA_20150"
                     /codon_start=1
                     /product="mitochondrial respiratory chain complexes
                     assembly protein RCA1"
                     /protein_id="XP_022674486.1"
                     /db_xref="GeneID:34714631"
                     /translation="MLHLVKPVVRFSRSYGVARSALSGQRAFGGQHAVLRVGLMRSFH
                     HGRVNWLQNRFEREANDDDVEKVRKEVWEYIDDLNKNKSLGMEERKRKIEEQLQRLEE
                     AVKRQQEQNDEGSKKQQRNEEEEEEESKQQQQQKKKDQSQSRSNPNFTPNDPNMMTVN
                     INMFKIGLTLTILAYLLHRVNTMEEQREITWQEFRNKLLVKGYVSKLIVINNNLVKVV
                     LNDNGKNQPENMGHDFYFFTIGSVESFERKLKKTQDELNIAEDFRIPVLYTREGNWVK
                     VAFQILPTALLIAGLIWITTKGASAAGGGPGGLFNVRKSKARRFNKDTDVKVNFKDVA
                     GCDEAKEEIMEFVSFLKEPARYEKMGAKIPRGAILSGPPGTGKTLLAKATAGEAGVPF
                     YSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSGANDE
                     RENTLNQLLVEMDGFTTADHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELAGRK
                     EIFKVHLKKITLAGDLEDLQNRLATLTPGFSGADIANVCNEAALIAARNDCDSVKLEH
                     FEQAIERVIGGVERKSKLLSPQEKKVVAYHEAGHAVCGWHLEFADPLLKVSIIPRGQG
                     ALGYAQYLPGDVYLLSEQQLKDRMTMALGGRVSEELHFPSVTSGASDDFKKVTRMATA
                     MVTELGMSDKIGWINFAKKSENDLTKPFSEETGAIVDAEVYRLVQECHDRCTKLLKEK
                     ADEVEKIAQLLLEKEVLTREDMIRLLGKRPFPERNDAFDKYLNERETKKIREQEEKSD
                     AKNKDDSHKEENKNDENDKNNNKNKNNEKNENDKDKDTNNDPNVL"
     gene            <330654..>332351
                     /gene="VBA1"
                     /locus_tag="KLMA_20151"
                     /db_xref="GeneID:34714632"
     mRNA            <330654..>332351
                     /gene="VBA1"
                     /locus_tag="KLMA_20151"
                     /product="vacuolar basic amino acid transporter 1"
                     /transcript_id="XM_022822691.1"
                     /db_xref="GeneID:34714632"
     CDS             330654..332351
                     /gene="VBA1"
                     /locus_tag="KLMA_20151"
                     /codon_start=1
                     /product="vacuolar basic amino acid transporter 1"
                     /protein_id="XP_022674487.1"
                     /db_xref="GeneID:34714632"
                     /translation="MSTTNSCDEHSRLLSHDESNLEEEYHQYNLSLPKGPILYSLWMG
                     SFLGSIDSTIVANIMNRVAEEFEASDKKQWIVTSFLLTNTAFQPLYGKLSDLTGRKTA
                     LMVAHSFFLIGCLFTALSNSLTQFAVSRAICGMGAGGISALSSITVSDICTAKERGVY
                     QGYANVVFGTGSLLGGPVGGFLMDTFGWKCIFAIQVPLIMTCMFLGYRNVNIKLTHIP
                     PPGERLTWKNLKRIDIGGSLSLIGTIFGVLCLASTDLNKPMLAVLTVVSGVIFAMNEL
                     YWSEERIIPIHLLSGTFGITSLLTIFSSFIQFGDVFRNPVYLQLVQNISLTSTGGFLL
                     FSSIAGATSSLTTGWILRHTKLPLAKCSYMLITIGVCLHFTSLSLGYTTISHLQPNQT
                     SYADAVDTLNEAGNHYWFQAGQFRWRIFYVMAMFINSWGYASLLVSTLVSIVFTIPRN
                     QQATITGCFYLWRSIGTVIGASTVLTIFETSVSSKVYKYLHSQGMDKEFDILIHDTSY
                     LRSHFKGSQLAHLLELYKDSFLISYLPTLTASVIALVIAFRLFLSLERHPHDKDGQL"
     gene            complement(<332425..>333177)
                     /locus_tag="KLMA_20152"
                     /db_xref="GeneID:34714633"
     mRNA            complement(<332425..>333177)
                     /locus_tag="KLMA_20152"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822693.1"
                     /db_xref="GeneID:34714633"
     CDS             complement(332425..333177)
                     /locus_tag="KLMA_20152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674488.1"
                     /db_xref="GeneID:34714633"
                     /translation="MTMKILLIDINPRVIRHWGKSLGGLIKNGDVIIHNGTLDTLDTG
                     SKVRRSIVSPGNSFGFLGGGFDLALQRHFGGITFEKYVRYKLVHSYVPVGNCTVIPLE
                     QFARDGFEYLLHIPTVVTPVIPDFDRPDPQHTGYRVVFDVTWNALHYAPSGTEQLVVP
                     GLCTGYAGVPIPVACKAMSFAIRLFHLKIRQVLSQDLINAMIMCFLGYQYDAFISDDC
                     IEECERVGIDWDVLNNFNPNKDPLDYILPENL"
     gene            <333636..>334922
                     /gene="AAT1"
                     /locus_tag="KLMA_20153"
                     /db_xref="GeneID:34714634"
     mRNA            <333636..>334922
                     /gene="AAT1"
                     /locus_tag="KLMA_20153"
                     /product="aspartate aminotransferase"
                     /transcript_id="XM_022822694.1"
                     /db_xref="GeneID:34714634"
     CDS             333636..334922
                     /gene="AAT1"
                     /locus_tag="KLMA_20153"
                     /codon_start=1
                     /product="aspartate aminotransferase"
                     /protein_id="XP_022674489.1"
                     /db_xref="GeneID:34714634"
                     /translation="MNSSAIAKMKIPIGTASSVLSRVSMAAPDKILGLTEKFNVDRNP
                     NKINLTVGIYKDEAGIVTTFPSVSRAQAMLDSHLDLNNDLSYLPITGSQEYQNNVLNF
                     LFRESSDGNELLDENRITFVQTLSGTGALAVVSKLLSTFVSKTVWIPNPSWANHANVF
                     KWNGFKQIKYYTYYENGKLNVDKWLSDLQSSYTAEKDDENWPPCIVLHACCHNPTGVD
                     PTLEQWQRILPVIHDMGIIPIVDMAYQGMESGNLVQDAYLLRMCLEYEWENGLYLCQS
                     FAKNMGLYGERVGSLSVVVPPNPKDLKARLDSQLKKIVRGIYSSPPGYGSRVANLVLS
                     NPDLKRQWFVDVKAMSDRLWGVRNLMHERLNWPNLVNFETQHGMFYYTGLSPQQVQKL
                     QDQYGIYLTQDGRMSLSAVNDGNIDYLCNSLLDVVE"
     gene            complement(<335033..>337999)
                     /locus_tag="KLMA_20154"
                     /db_xref="GeneID:34714635"
     mRNA            complement(<335033..>337999)
                     /locus_tag="KLMA_20154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822695.1"
                     /db_xref="GeneID:34714635"
     CDS             complement(335033..337999)
                     /locus_tag="KLMA_20154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674490.1"
                     /db_xref="GeneID:34714635"
                     /translation="MFRFRKSREPRQIDPGAIVAANTIGKALVPSQNSIGGQVVDKDK
                     IPRYNSFTGRSYSLVNKSQGGAAAAAKKPISRQSSVRHSSSGSSRYGSMQSSSEKSGS
                     KVKSGGRSSMTKKMSKTPSNGSSASSRAEAERVFHDFGGKEAKAKYVPGPNGLKPADV
                     TKGTPKMISKYIPSSHGLIKVEVPEDEYEAERKNSIRRSASMRSGMTGPRHSLSSKRS
                     QSSLRSNSFGNKTPSGTPLRRLTEVSALEEKKDSRTSSLVVKPLTFTKRSQSPQTPEK
                     PATKDLLGAALSDEPIRETSVTDDQFVEAELDEEAEPEVLNDEPEAVAPVSDTELAEV
                     EEVEEEEEEPANIDDVLEEAEELEEEQKLEEEQKLEESKPEPSKVEEANEEPKEEANE
                     EPKLEEPKLEEPKLEEPKLEDVKVEEPKEDPKLEDTQVEEPKEEPKEEPKEEPKEEPK
                     EQPKEEPKEEPKEEPKEEPKEEPKEEPKEEPKEEPKEEPKEEPKEEPKEEPKEEPKEE
                     PKEEPKEEPAVEDVMLEEATEVQNESKKESEEEPKQEVKEEAKDEPKPEVIDSEELPE
                     PTESQKIEDTVTEHPSTVINGGVENNKTEEVTVVNETTTTELPNGKQPETAKDTVETI
                     ESPKSDDDIEGTNKSSLAQYIRSANPELQRVADDNSINLPKNPLEKSPSPIKSAMKKT
                     KKSALKNPQAAHASGAYLSLTTKENTRLNAQLSHENLRETASAGSGKRLNSPSLKRNQ
                     RPQSMMAQRVNGDRRSFIQTNSPVSPRNDTRPRSNIGKPTVNAKALQNSALYPKEPPQ
                     KRSSFEKQRPTPTSFAFRNLSLRQEPEQFETQPLQEPLQPPSAQFNGRSSRNSTPQKA
                     PVRSSIHVSTPTSTNTTTGGEYAKPRPASNIPGFKSRFADSDSDDESATQMFSQQGSR
                     STQLSSQYETAPTPPVPYNPNATLRPIKEPESQSHSNHNHHFPSSHKHKQNGVPTEKK
                     KGTFSKLKKLFGKKKH"
     gene            complement(<338732..>340852)
                     /gene="GFA1"
                     /locus_tag="KLMA_20155"
                     /db_xref="GeneID:34714636"
     mRNA            complement(<338732..>340852)
                     /gene="GFA1"
                     /locus_tag="KLMA_20155"
                     /product="glucosamine--fructose-6-phosphate
                     aminotransferase [isomerizing]"
                     /transcript_id="XM_022822696.1"
                     /db_xref="GeneID:34714636"
     CDS             complement(338732..340852)
                     /gene="GFA1"
                     /locus_tag="KLMA_20155"
                     /codon_start=1
                     /product="glucosamine--fructose-6-phosphate
                     aminotransferase [isomerizing]"
                     /protein_id="XP_022674491.1"
                     /db_xref="GeneID:34714636"
                     /translation="MCGIFGYCNFLVEKSRGEIVDTLVEGLQRLEYRGYDSTGIAIDG
                     DDEDETLIFKQIGKVSALQKEIEKHNPNRDVHFVTHCGIAHTRWATHGEPKQVNCHPH
                     RSDVTCQFVVVHNGIITNYRDLRQLLTNKGYKFESDTDTECIAKLFMHIYQTNLKNGH
                     DPDFHELTKQVLQELEGSYGLLCKSTHYPNEIIATRKGSPLLIGVKSEKKMKVDFVDV
                     EFPDSEQMPDVPVNNECNLLNDAERSLLPLAGNESTLRRSQSRAFLSEDGSPSPIEFF
                     LSSDAASIVKHTKKVLFLEDDDIAHIYDGELHIHRATNKLNESATRSIQTLEMELAQI
                     MKGPYKHFMQKEIYEQPESTLNTMRGRIDFETNTVTLGGLTSRLPAIRRARRLIMIAC
                     GTSYHSCLAARAIFEELTEIPVSVELASDFLDRRAPIFRDDVCIFVSQSGETADTMLS
                     LNYCLERGALTLGIVNSVGSSISRGTHCGVHINAGPEIGVASTKAYTSQFIALVMVAL
                     SLSDDRLSKLERRKEIIQGLKLIPEQIKQVLKLESQVKDLCSNELKDQKSLLLLGRGY
                     QFASALEGALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVLSS
                     IEQVTARKGHPIIICNENDEVWEAKKKNSNGSLVTLEVPRTVDCLQGLLNIIPLQLTS
                     YWLAVNNGIDVDFPRNLAKSVTVE"
     gene            complement(<341585..>343159)
                     /gene="LAP4"
                     /locus_tag="KLMA_20156"
                     /db_xref="GeneID:34714637"
     mRNA            complement(<341585..>343159)
                     /gene="LAP4"
                     /locus_tag="KLMA_20156"
                     /product="vacuolar aminopeptidase 1"
                     /transcript_id="XM_022822697.1"
                     /db_xref="GeneID:34714637"
     CDS             complement(341585..343159)
                     /gene="LAP4"
                     /locus_tag="KLMA_20156"
                     /codon_start=1
                     /product="vacuolar aminopeptidase 1"
                     /protein_id="XP_022674492.1"
                     /db_xref="GeneID:34714637"
                     /translation="MSQDYKITKETLNNLTSVLQKLAVQSEQLEIREEKASQRNLVVG
                     SSSTKHELKKSFKEYSQDYIDFTYECPTIYHVVRYFGKLLEENGFKYISEKSDWDDVH
                     QGKYYTTRNGTNLCAFTLGSSWTPQKGVGAIGGHIDALTAKLKPASKKPEVEGFELLG
                     VAPYGGTLNEIWLDRDLGIGGRVLVKDSKTGAVKSVLCDSTPHPIAKIPSLAPHFGAP
                     AVGPFDKEDQTVPVIGYVGNGDYDDDDADYDLEDEKKSPLYGKHSIHLLRYIAQLLSV
                     KVSEISQFDLDLFDVQKGTFGGLKDEFIFAPRIDDRICSFSAITALIEYCNSTPAHVL
                     ENGSQFNLAALYDNEEVGSLSRQGAKGGLLESCVERVIANLFSDVAKTRTAFANSIII
                     SADVNHMVNPNFNNVYLENHKPKPNVGITLALDANQHMATDVVGTALVEELARLNDDK
                     IQYFQIKNNSRSGGTIGPSIASQTGARTIDMGIAQLAMHSIRATTGSKDVGLAVKFFS
                     GFYKNWREVYDNFGDL"
     gene            <344205..>348116
                     /gene="HSL1"
                     /locus_tag="KLMA_20157"
                     /db_xref="GeneID:34714638"
     mRNA            <344205..>348116
                     /gene="HSL1"
                     /locus_tag="KLMA_20157"
                     /product="probable serine/threonine-protein kinase HSL1"
                     /transcript_id="XM_022822698.1"
                     /db_xref="GeneID:34714638"
     CDS             344205..348116
                     /gene="HSL1"
                     /locus_tag="KLMA_20157"
                     /codon_start=1
                     /product="probable serine/threonine-protein kinase HSL1"
                     /protein_id="XP_022674493.1"
                     /db_xref="GeneID:34714638"
                     /translation="MASTAQAAAIAAMNENSGGQVPYRANNEHLHRVVQSVTDATKRL
                     SQISTASSTNANTKTSKRKNRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIV
                     PKKYVRSNQSKQLPYGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELF
                     DYLVSKGKLPEEEAIHYFKQIIQAVAYCHGFNICHRDLKPENLLLDKKKKSIKIADFG
                     MAALETSDRLLETSCGSPHYASPEIVLGQKYHGSPSDVWSCGIILFALLTGHLPFNDD
                     NVKKLLLKVQSGKYQMPQGLSVEAKDLISRILVVDPNKRITIDQILQHELLTKYDSKA
                     RSKSNSNLNLLKNTPSIINFTSEQEIDGQILSNLQILWHGAPRKHLVTRLLKSGFTEE
                     KMFYSLLWNYQQKQQKVVQKDSTPVSVMQNSSASSVSPLKITTSVETDGSGNGVTTNT
                     TYTVKPVTTKGGMLPASMTPTIPSFGNQQQAPRLQQKSQFSINSLKNAGHSKSPKKTK
                     QGFIASSSSSKLFNPNVGARPLSQSISKSSSKKSLVQAQHNAATTPKTRTLHNSSSKR
                     SLYSLQSISKRSVNLKDLLQDELIIPPLPEIDSASSQHTSTKIASIVDGYGGDDTMSL
                     HGNDKIESITKPAFQLHIHNPQSNKNILAQPKLNESSENQDQTPSSSTLSAPSEKLEL
                     RTPFSSTVPLKDVTNTFHSKNTYVSSLDPKHRKAKPSIENLLRKVAVPQRMKSKSSIR
                     KMRDSGDWTVSGEAKSLFGDSMYENQLQRLQTNPSKITAPETVISTSTPMPNAKSGLL
                     RMPSMSINSSMTFKDLSQLLMHIDEENDNADTMNSKNRNNSDKHNDNSSNTNKQGLGI
                     SIIRHNLRKESSSNDLMHRFETSSNYDDYEIATSTQAATTGADIDIFEDAPGDSNESV
                     TTSESVIDQSQPNLKKKAASIDSINTSHVLTPANDVRVSLYVNQMDKLESMPRETTEQ
                     IISKFKLSPIKDSKQKRFSYTDRDMTLSGSIISMFKDLDGDDSHVDYEDGGLLSKREV
                     DHQNQLEQKSADSNSNAVNDAVKSGTGPTTLENDEEVQGITGKDLLAKEKSIVKDSKA
                     TSGDDSGKRVTLLFDDRISESERVFKAAASTGKAATNKSQSGLDESQNMGTATANSTS
                     NTTNKRRSYINKLPKIKEDDGNGQEISRKQRSPNNWFVKLLHRLKTSSPKSAVYQHKS
                     DKLQFDELHILLVAEFGKNGIDCELKKLERKGNKEHVSYSCSFGRRRKFSVSMACNNG
                     VETVVSCEAHGSKFVSDAKSMELFEHFNEELANAISIKESK"
     gene            complement(<348437..>349576)
                     /gene="ADH4b"
                     /locus_tag="KLMA_20158"
                     /db_xref="GeneID:34714639"
     mRNA            complement(<348437..>349576)
                     /gene="ADH4b"
                     /locus_tag="KLMA_20158"
                     /product="alcohol dehydrogenase 4"
                     /transcript_id="XM_022822699.1"
                     /db_xref="GeneID:34714639"
     CDS             complement(348437..349576)
                     /gene="ADH4b"
                     /locus_tag="KLMA_20158"
                     /codon_start=1
                     /product="alcohol dehydrogenase 4"
                     /protein_id="XP_022674494.1"
                     /db_xref="GeneID:34714639"
                     /translation="MFRLARAQTSITTTSKALGGSRRLFVRLNSSFAIPESQKGVIFY
                     ENGGKLEYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGAG
                     VVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGYESNCLQADLSGYTHDGSFQQY
                     ATADAVQAAQIPKGTDLAEIAPILCAGVTVYKALKTADLQPGQWIAISGAAGGLGSLA
                     VQYAKAMGLRVLGIDGGPGKEELFKSLGGEVFIDFTKSKDMVADIQEATNGGPHGVIN
                     VSVSEAAISMSTEYVRPTGVVVLVGLPAHAYVKSEVFSHVVKSISIKGSYVGNRADTR
                     EAIDFFTRGLVKSPIKVVGLSELPKVYELMEAGKILGRYVVDTSK"
     gene            complement(<351057..>351809)
                     /gene="UTP11"
                     /locus_tag="KLMA_20159"
                     /db_xref="GeneID:34714640"
     mRNA            complement(<351057..>351809)
                     /gene="UTP11"
                     /locus_tag="KLMA_20159"
                     /product="U3 small nucleolar RNA-associated protein 11"
                     /transcript_id="XM_022822700.1"
                     /db_xref="GeneID:34714640"
     CDS             complement(351057..351809)
                     /gene="UTP11"
                     /locus_tag="KLMA_20159"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 11"
                     /protein_id="XP_022674495.1"
                     /db_xref="GeneID:34714640"
                     /translation="MGALQHSIQKKQHRERSQVQERSRFGFLEKHKDYVKRAQDYHKK
                     EKTLKVLKSKAKERNPDEFYYGMNSKRVDEDGLLVTSRHGASEDDGVLTMDQVKLLKT
                     QDSNYVRTMRLVEKRKAEKKREQVLFNGTGKHTVFVEDAESLESFSPEEYFKTSSEML
                     GRRSNRLREEQLVGDLNLDKAEYSESLRKKKVKKLRAITKHMERESQLAGVEQRMNMQ
                     REVMKSGSKKKIEVGEGASKRVVYKWKKQRKR"
     gene            <352234..>353127
                     /gene="MTC2"
                     /locus_tag="KLMA_20160"
                     /db_xref="GeneID:34714641"
     mRNA            <352234..>353127
                     /gene="MTC2"
                     /locus_tag="KLMA_20160"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822701.1"
                     /db_xref="GeneID:34714641"
     CDS             352234..353127
                     /gene="MTC2"
                     /locus_tag="KLMA_20160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674496.1"
                     /db_xref="GeneID:34714641"
                     /translation="MSLASLSYGVQTAVALKRHVVCFTGSEEPPNTELIAQLVSPVAC
                     EVYSGPLEAMAMCMDQGEDVNSNSNSNSNSYSNSSSSRSGVLLYIIQFPGDSNELDSE
                     SQSDFAHWLYRCFQNGVAVILVCQHDPNMIPYLRHQFWYACGESIGESEPMALDSTAL
                     LNNVHVHHTIKRYILDLIVHLRMHRLSRPSQGGGAHSRSLADMMLLCKWIALQSKCSF
                     VTPDMVQIACQRYFPWHLQLIESSREDPSVMYGSREDLVDELISKFDTFGLKMQKEYN
                     NPLFKQLCVVQSVMKNVIPAT"
     gene            complement(<353260..>354162)
                     /gene="GGC1"
                     /locus_tag="KLMA_20161"
                     /db_xref="GeneID:34714642"
     mRNA            complement(<353260..>354162)
                     /gene="GGC1"
                     /locus_tag="KLMA_20161"
                     /product="putative mitochondrial carrier protein
                     YHM1/SHM1"
                     /transcript_id="XM_022822702.1"
                     /db_xref="GeneID:34714642"
     CDS             complement(353260..354162)
                     /gene="GGC1"
                     /locus_tag="KLMA_20161"
                     /codon_start=1
                     /product="putative mitochondrial carrier protein
                     YHM1/SHM1"
                     /protein_id="XP_022674497.1"
                     /db_xref="GeneID:34714642"
                     /translation="MATNDKKQSGLARVLGSASAGILEIGVFHPVDTISKRLMSNHTK
                     ISSASQLNSVIFRDTASEPLGKRLLSLFPGLGYAASYKILQRVYKYGGQPFANEFLNK
                     NFKSDFDQAFGEKTGKALRSATAGSLIGIGEIVLLPLDVLKIKRQTNPEAFRGRGFMK
                     ILKDEGFGLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYGQATWGQNFISSIV
                     GASASLIVSAPLDVIKTRIQNRNFENPESGFTIVKNTLKNEGITAFFKGLTPKLLTTG
                     PKLVFSFALAQTLIPMFDNLVSGK"
     gene            <354737..>356590
                     /gene="PCF11"
                     /locus_tag="KLMA_20162"
                     /db_xref="GeneID:34714643"
     mRNA            <354737..>356590
                     /gene="PCF11"
                     /locus_tag="KLMA_20162"
                     /product="protein PCF11"
                     /transcript_id="XM_022822704.1"
                     /db_xref="GeneID:34714643"
     CDS             354737..356590
                     /gene="PCF11"
                     /locus_tag="KLMA_20162"
                     /codon_start=1
                     /product="protein PCF11"
                     /protein_id="XP_022674498.1"
                     /db_xref="GeneID:34714643"
                     /translation="MSSEGREVDAEVEVEDNSNAKILEEFKSTLDGLTFNSRPIITTL
                     TQLAEENMSLAQEFVGMVENRVEKCVPSQKLYAFYVMDSICKNAGSPYTIYFSKNLHK
                     LFRKAYLLVDNQTRTKMISMFKTWLVPLPAGDLMFDHSSLESIEKFLIKASALHQKSA
                     MFPQHSHRGNSPGAPRMGDGPSGAITVRSLLSDIDKLALITQSKLVGVPSDTKLQAKV
                     AILKQLRQELQKEQLAPEFLSQVHQQLRQIFAQEQQQQQQMEQQQYQQQQQQQQQQQQ
                     QQQQQQQQKGNSQFLPPSDRFGAADSNNGNSNNNNSMFGGSLQFNAPFLNQLTNSNKR
                     NKLSSLVSSLREKQLLYEPSENSIVTLANKLESELDSSNSVKLPSYSVLQNILGDLEA
                     QKQTQNFDILNASVLQLSQQFVLNDNHPITNVLIHFLYRAKTNKCSICGKRFGNSQEE
                     RDLETKHLDWHFRVNKRIKGIQSNTTTSTKVIQSRNWYLDETQWTDFKDEEIIATDID
                     SNAPEQQPTFDNAKTDTSEAIYTKLMGKYVVVPDYAADMKFQCPICTEDNYGKYDEEL
                     GEWIWGNSIQVGDKFFHATCYYEAAKNQQSNESSSLQHLQLDIGIINALLQ"
     gene            complement(<356851..>360384)
                     /locus_tag="KLMA_20163"
                     /db_xref="GeneID:34714644"
     mRNA            complement(<356851..>360384)
                     /locus_tag="KLMA_20163"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822705.1"
                     /db_xref="GeneID:34714644"
     CDS             complement(356851..360384)
                     /locus_tag="KLMA_20163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674499.1"
                     /db_xref="GeneID:34714644"
                     /translation="MSIRRTYSDHKDGQLSLKQRQKHKRRSIGIESSEKYGYIPTIKF
                     LRQKELERDRKIKEDGQLGQVSVSSPSMDSASSRKVEKPGKKAGWRLSSMLKSGASHS
                     DRLKKLYVGSDSEIKIESPSSAAVPKPSTPVPKKAAAEPSGRTGIHEHFQKKRNGSPF
                     QKTSRPMSANRLASQTRTFKNVNFAFETSLNEVDLNLLSKARASSSEAGGISKSSTPI
                     PVAPPSQVRAPTPPQAKKVPSEVKQPSVAPKNASETKDLSSLLSSRLKMRKTLFNNKS
                     AGIEKQTNNSVANKLDAPTTDHMERKENKKLDSEMISENSQQNAPDQRAPEQPAQQSQ
                     QSQQPQPIPQLDLRTASSPQGDSDSDTSSLSSVGEDEYKTVEQKSEILNVVEKNATDA
                     SPEPEFNLTKNGSESREEAGKLVELSDSSSDSSSESTSTDNASGHEVDDFQLLNSIRT
                     RMVGPKVNKWKKLDKEKLTELMDYLVVNHTPLSARPTVSCSNDICNARNYESVEVHHL
                     QKLPQRLKFIDLEAMTASSTEKASRTNNRVEKPRKNQPFNNGAVQKRRTRASQLHSEV
                     PKRTIPLEEHPLNDIELAEENVNETLKSVDATSGTKNNVEIQQVQESLAGPTREEDPQ
                     LNPEGISEPKVNVSTVLQSELPLTSDDSKIDTRISGTDDAQAFSHEMVHENEFSSKLS
                     RFDAAKCTDIEEMRREYIKLQNSMNDNGERLAEANIVNTDKTLVIEKLTQEIMQSEMK
                     YASLVGVNHQLREKIKAMNSLQLKLMHELELAVAEPNLSEEQSNRSNDLENGSSNADS
                     SLQHKRSNMFENTTKTTSTLTTTSEPPSEDSINELLSLTLLTHKASSKFTSCDLPETV
                     GAEFRNLNHKLALVSFFLARMRNSNDNTNDKSQLMIENYNELTNASSPHCANFIQYAG
                     NIQPIVHTQIPENNRDVSMKSSDKTSSTVPTEESVVEEEEAYNWRAENDKAKEKIKQL
                     EDRIESMTKELEVEAKKGIYYKQLEDYVSPVVNYCAEKNITIKILMEKLSWINKMEMA
                     IVRLSKERDFYLKRVKDLESSNVDPPPSHLVQENTRLKEAILRLHNERKKLLEVINKE
                     KQDRKQIQKQSQKQDQKQGHKQVSSQNIKQGENQSENQHQNPLKIVYVDKDDYGKQNR
                     KKNRNKNKNKSKKSGDDNKEENSSNVSNIQQ"
     gene            complement(<361067..>363523)
                     /locus_tag="KLMA_20164"
                     /db_xref="GeneID:34714645"
     mRNA            complement(<361067..>363523)
                     /locus_tag="KLMA_20164"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822706.1"
                     /db_xref="GeneID:34714645"
     CDS             complement(361067..363523)
                     /locus_tag="KLMA_20164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674500.1"
                     /db_xref="GeneID:34714645"
                     /translation="MEKIKSEKKAVNLGKKPRGRPRKRVETTKCGPDLIPELTANHRI
                     SVREELESKLRYSFNSKPVNWMYFWYISHVLPEFSYQMWYSIVQLRQSQDDVDLILSR
                     LDILKLIAMREFTEGSNNVDATWESRKISHSHDQLACIFVGMIEGIAVGAWRDEISRL
                     EQKLKKGHMMMLPEGLPGAVSLPEKVFLVSEIYGLQITPVVEWMITTLEEILEMNKGN
                     KRKNEKKVCYDQLSYSMLDLEAFEDNPLGPNRCLIHRIEELINESGELTPCKKAQIKY
                     NRKEIICELMEFNLPREKIKDVLEHYKHEFISSLQLWSEEHLVKYFQSGTFNPSIDSF
                     DYNDVDLCYRNAIIYYSFCKNNVSSDIRFEGMVTSTAEVEFTDKSKKDKSGTQYFEDP
                     AAYIDLLKSKDLPRIIADTSRFTPARKSWHNRWAVELSRSKIHFVKEFPRGTNKVEHE
                     LWTKLEQRLFLYFEHFNVTSTEFEPEILESIKLPPPCLKTRYVIFKRDGPLKANKNPR
                     LWDYGKAIRFLQDMGFDMSTLRSVFTSLQNGVLKQERKGRASVSTKTSTKRKKGETDA
                     DADADADADTSTSNRIKKLKLLTGAHSYLYTKTHPSLTLSSLNTPPRASSTRKHLREE
                     SLELLGSIERDASASDKSVLDANTTVCAENSPTNKITHRNNIPDTPKGHIGHHTGHHT
                     GHHTEETDFFTAPQNLSAGTDDIGDDNEEYIGDGDGDGDDELTSYANKTWLEIRRKIP
                     KPYHPLITSMITSISTYANTKLLDENVLWAKKVSERDQLIHTLSKRIIESEKRIASYQ
                     GKLLQIHMESAPEDKPQGPL"
     gene            complement(<367931..>368614)
                     /gene="ADK1"
                     /locus_tag="KLMA_20165"
                     /db_xref="GeneID:34714646"
     mRNA            complement(<367931..>368614)
                     /gene="ADK1"
                     /locus_tag="KLMA_20165"
                     /product="adenylate kinase 1"
                     /transcript_id="XM_022822707.1"
                     /db_xref="GeneID:34714646"
     CDS             complement(367931..368614)
                     /gene="ADK1"
                     /locus_tag="KLMA_20165"
                     /codon_start=1
                     /product="adenylate kinase 1"
                     /protein_id="XP_022674501.1"
                     /db_xref="GeneID:34714646"
                     /translation="MTQDLSHVPESIRMVLIGPPGAGKGTQAPNLKEKFCACHLATGD
                     MLRSQVAKQTPLGIEAKKIMDDGKLVSDEIMINMIKDELSNNPECKKGFILDGFPRTI
                     PQAEKLDEMLADQGRPLEKAVELKIDDELLVARITGRLVHPASGRSYHKLFNPPKVEM
                     KDDLTGEPLVQRSDDNVEALKKRLSSYHKQTEPIVDFYKKTGIWAGVDASQPPKTVWS
                     DILKCLGKN"
     gene            <369692..>371848
                     /gene="MSC3"
                     /locus_tag="KLMA_20166"
                     /db_xref="GeneID:34714647"
     mRNA            <369692..>371848
                     /gene="MSC3"
                     /locus_tag="KLMA_20166"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822708.1"
                     /db_xref="GeneID:34714647"
     CDS             369692..371848
                     /gene="MSC3"
                     /locus_tag="KLMA_20166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674502.1"
                     /db_xref="GeneID:34714647"
                     /translation="MVFGLSIGNKRRSSRVPDLSRYDYHYNGDGPSAGYYKSHDLSAD
                     AAFAASVNSGGRSRSMVNTSLRAGQGPGPRQGPGQGPGQGMAHHGTSFAPRKAAAGNS
                     RVSSSRGGQRQRSGGPVPYGYGSNQGYAGSAQAARSYSLTSGRHVGGKQGKKQGKVGG
                     SKASSRAGSLTNSIIIKTQEVKDMSGRTQSITTQTIRRVNGMEYVETTTQTTGALADD
                     PQFHFQQFSENNGLSEEEEIGMESESESEPEPHTQPDAEHEYISGSEPESKPEPESEP
                     EHEPELESEPESKPESKPESKPEPEAEDGEFADASEIIEEEDHTQFFAKVNKVKVDAA
                     GAPLASHTGNNSTNNNNSNNNNNNKNINNNTNNNDNSNNDNSNTSVHDKKTHRKSAMS
                     KRMTLRDSEVPDTTTTTESPVNHTYQGKRRVQAPPVVAPSSSRKVLTQEEMYAMALEI
                     AQQRYAESQQQQQQRSLQGNGNAVPVQVQGERPSQSIKSAGSHSGMEPILEDTAENPV
                     EGTTAAGSTGVSGAPVGAPAGGPAGGPAASGPSVASGVPVPVPTNEKSRRPKKKVKSL
                     LDRVVQFSQENTLSQPSGKHRRGHRGQVDAQAQVQPQPQPQPQARPQPQVQPQPHAPV
                     QTPAQTPAQTPVQTQTEAPQTLATTQETSSSSSLRHAGPQQEEEPAPVPAPNAQAEAQ
                     ANHVTQAPAPAPAQAKGSPKKTSFFKKLFKTKDKHH"
     gene            complement(<372267..>372659)
                     /gene="HTA1"
                     /locus_tag="KLMA_20168"
                     /db_xref="GeneID:34714648"
     mRNA            complement(<372267..>372659)
                     /gene="HTA1"
                     /locus_tag="KLMA_20168"
                     /product="histone H2A"
                     /transcript_id="XM_022822709.1"
                     /db_xref="GeneID:34714648"
     CDS             complement(372267..372659)
                     /gene="HTA1"
                     /locus_tag="KLMA_20168"
                     /codon_start=1
                     /product="histone H2A"
                     /protein_id="XP_022674503.1"
                     /db_xref="GeneID:34714648"
                     /translation="MSGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRKGNYAQRI
                     GSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVT
                     IAQGGVLPNIHQNLLPKKSTKAKASQEL"
     gene            <373375..>373773
                     /gene="HTB1"
                     /locus_tag="KLMA_20169"
                     /db_xref="GeneID:34714649"
     mRNA            <373375..>373773
                     /gene="HTB1"
                     /locus_tag="KLMA_20169"
                     /product="histone H2B.1"
                     /transcript_id="XM_022822710.1"
                     /db_xref="GeneID:34714649"
     CDS             373375..373773
                     /gene="HTB1"
                     /locus_tag="KLMA_20169"
                     /codon_start=1
                     /product="histone H2B.1"
                     /protein_id="XP_022674504.1"
                     /db_xref="GeneID:34714649"
                     /translation="MSAKASKAPASKAPAEKKPAAKKTASSVDPSKKRNKARKETYSS
                     YIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATESSKLAAYNKKSTISAREIQTA
                     VRLILPGELAKHAVSEGTRAVTKYSSSTQA"
     gene            <374109..>377376
                     /gene="SPO71"
                     /locus_tag="KLMA_20170"
                     /db_xref="GeneID:34714650"
     mRNA            join(<374109..377247,377372..>377376)
                     /gene="SPO71"
                     /locus_tag="KLMA_20170"
                     /product="sporulation-specific protein 71"
                     /transcript_id="XM_022822711.1"
                     /db_xref="GeneID:34714650"
     CDS             join(374109..377247,377372..377376)
                     /gene="SPO71"
                     /locus_tag="KLMA_20170"
                     /codon_start=1
                     /product="sporulation-specific protein 71"
                     /protein_id="XP_022674505.1"
                     /db_xref="GeneID:34714650"
                     /translation="MDEKLHEVLDIVLSDEKLLGYLQENGIICDRDVNQIRIPKHSFT
                     SHQLTYCTVDEVSQNHQSVLVGGIPAIWNMQHSYGLFQMVEKLSDFRLRKRIKYVYER
                     TRRREAKILGWRQHNSAGQLRKFEESAKPSKQVMMYNGTNTDVEDDESCYNTDDSLAA
                     SDLPSSSESARASASASSSTSTSIDALPSGVVTNPVNSEPAPRFASILGKPNSNSNNN
                     NNNNGVANVKVVVNDYDSDNSGAGIGIEAYSPVSNRGARNALGSTRSRTRRDRSVSPA
                     RSLRSTTSSRDPITVLRPIPQKITLEEEMRIKNSSKQYTALKAIGKRIADNFPEKKTD
                     NFVDRYPNGYNSGSSNIILDTSRLNKVIKMEKMLVMVKEALSAKVVPSHFSEDEPVDT
                     RIYQRWKEYIVVARATGNPNAPIKLQFYTSSKIKTVDTRQKKPWHCKMEFDLDKTCLI
                     EFYNSLDKSLCIVKQDDELTQEIRFSENNKKKANLKKPYDPLQIFILRCDNLISSSRW
                     LVFLRSSIGQTSKFHKINVHIPTIDFSLDIDLPKHVLNQLAKKAEEEEDTMKIFFLSK
                     GYLVLQLPIIRFLRLAIREMVLKLGYKEAALQWDKPSVLMGICWKHYDRLEWAFGNQA
                     DILYGSFVMRKSHTVEYRHLQTYPKSVEISVDREEDTDISNGNNEVSNYVLLEPPPIE
                     GFLSQNTIKYHNSTVGLSQPYFKISYWFTSNNLLFVMRSAKATPPLPDEEIVDPFGFV
                     KDKNKLQDLLKSIPKIYESNPYTLNENGHIEWLNDKMTDEEFSKRDKTAARSFLRKVS
                     SILKADSCIDMTSVLEIRPFNHTLINNQTFKVWNEANNLIWKNNMPVEETKSSIIELV
                     LDNKTSKLLLAPDPESCAEWMSRLKDISFYWKKRLAKDRQLLWDLKFKNLNTFNITEQ
                     EEKHISAFAPKWMTEVSVTDDNIYNVSAHAMAHPIIHQGLIYQKSRKHSVFKKEFMIL
                     IPGFVLLFHCFERSVRGYAKNSTEYRHSLTFPIEKCYVYSGALTEQELLKRDKEFNSI
                     NPGSHSLSRVYTDGWRN"
     gene            complement(<377475..>379766)
                     /gene="STE5"
                     /locus_tag="KLMA_20171"
                     /db_xref="GeneID:34714651"
     mRNA            complement(<377475..>379766)
                     /gene="STE5"
                     /locus_tag="KLMA_20171"
                     /product="protein STE5"
                     /transcript_id="XM_022822712.1"
                     /db_xref="GeneID:34714651"
     CDS             complement(377475..379766)
                     /gene="STE5"
                     /locus_tag="KLMA_20171"
                     /codon_start=1
                     /product="protein STE5"
                     /protein_id="XP_022674506.1"
                     /db_xref="GeneID:34714651"
                     /translation="MNSQEILFQLTNVGSTPVSSKNDTMTTPTSGSNTSSPRRWTELF
                     SKKRAKTPSISTPSTSSSAVSSLHDGSPVRPGSKQSFRHFNIDSALQYPPVMQSPESY
                     HSAGNGNGSGHGNVQVGKKPHRRGGNKSWKNEKCCICRDLCSFKGSTERVIILQCNHM
                     CHEDCLMVSLNPVSKTFDLYDALPKCQMCSMLCVPSQEDMKQRLRNQLLTVNSSSSDQ
                     LSSAIPQVQSQLKPHNSPENTRTGIGPLAPPPPPLSMRNAVKTTPTNRDIRLSFASSL
                     KPPVFVTPSVRDSWRLPRASSIKRRSNNYRGSTISALSSITSSSSLYNDSQLVCSLHI
                     QRQYFMQAFLTSFEEIKPWEIDSRYGLLRLIDNFLISLDDQGFKQCCCYLFSEYLLLC
                     QPSSKASSNVLQFSSYRFLQLNSPANIELIDATTLELKAKTGERVRIKPFNSDTKSLE
                     KWITAFFDPTLTFGNLDFTSIPLPDFVSAMPSADDSRTIIVRRQNTINETIVTAGPRD
                     STLFTSISSILSIKRSTPRELNVILQVDRRKLKSENLITIKNVLSALTWKYHDFNCCI
                     VGVDGLIVKIGGAREILDSWAEISDAGTQPFSPALLYKTWYKERGKVCNNAGVLVISN
                     ASMETGKTCLFHDYRMFANVGKRHVNELKIKVGFLNVDYTSKIKELVEIQDWNELLEA
                     VSYSFNINFDDDDDDDDDEGDSDTSDSFSVGSSEFNKSLNSDNERLVRPPSPTSFEDI
                     EADSHSQFDDDSELQHSIIYDYL"
     gene            complement(<381001..>382242)
                     /gene="PDA1"
                     /locus_tag="KLMA_20172"
                     /db_xref="GeneID:34714652"
     mRNA            complement(<381001..>382242)
                     /gene="PDA1"
                     /locus_tag="KLMA_20172"
                     /product="pyruvate dehydrogenase E1 component subunit
                     alpha"
                     /transcript_id="XM_022822713.1"
                     /db_xref="GeneID:34714652"
     CDS             complement(381001..382242)
                     /gene="PDA1"
                     /locus_tag="KLMA_20172"
                     /codon_start=1
                     /product="pyruvate dehydrogenase E1 component subunit
                     alpha"
                     /protein_id="XP_022674507.1"
                     /db_xref="GeneID:34714652"
                     /translation="MLCLKVQSSLVGKTAGLRVARGFSSNARALSKVAEDSKLADGDD
                     IVQIELPETSFEGYMLEVPELTYQTTKSNLLQMYKDMIIVRRMEMACDALYKAKKIRG
                     FCHLSVGQEAIAVGIENAITKRDTVITSYRCHGFTYMRGASVQAVLAELMGRRTGVSF
                     GKGGSMHLYAPGFYGGNGIVGAQVPLGAGLAFAHQYKHEDACSFALYGDGASNQGQVF
                     ESFNMAKLWNLPAVFCCENNKYGMGTAAARSSAMTEYFKRGQYIPGLKVNGMDILAVY
                     QASKFAKDWAVSGNGPLVLEYETYRYGGHSMSDPGTTYRTRDEIQHMRSKNDPIAGLK
                     MHLLELGIATEEEIKAYDKAARKYVDEQVELADAAPAPEAKMSILFEDVYVPGSETPT
                     LRGRLQEDTWDFTNNKFAFRD"
     gene            <383114..>384829
                     /gene="ARX1"
                     /locus_tag="KLMA_20173"
                     /db_xref="GeneID:34714653"
     mRNA            <383114..>384829
                     /gene="ARX1"
                     /locus_tag="KLMA_20173"
                     /product="probable metalloprotease ARX1"
                     /transcript_id="XM_022822715.1"
                     /db_xref="GeneID:34714653"
     CDS             383114..384829
                     /gene="ARX1"
                     /locus_tag="KLMA_20173"
                     /codon_start=1
                     /product="probable metalloprotease ARX1"
                     /protein_id="XP_022674508.1"
                     /db_xref="GeneID:34714653"
                     /translation="MSLQISKEDTQVLLKDKNVLNEPTVEKYRTAGQIAQTGLRFLIN
                     MINKMYHEKSAAPLPIHQLCLLTDSFIAECLSTKFNNKVNEKGISMPTCIDVDEINEN
                     WCPEVDDIENLQHWNQKSRNSKSIEKCNGVNSSLAGFLKVGDVAKITVGCHIDGYTCN
                     LSHSMVIYPTVQDAASGQTVPEAALLGGKADALAATHIAVETVTNLLACANDLTKLPA
                     DFNASQVTGSLIRVVVDTIAQSYNCCVVPGSRVRRIKRFLSGQNENIIVERDFKGVIW
                     TESHQESSMLAKTVDETAVDIKRKNPFITEDTVVPTDDFVVAKGEVYMIDLKLAPLQG
                     LEPGLITLQTVDQFSGKSESADLIARPGAICRDFSRTHILKLRSSRQLLARLDKQGVY
                     PTKLAHVADSFPLDTQEPDFESIKQELKPFRLGLSELANNYLTFNRDITIVKHVPWAK
                     ILELTNPAGVSSYDAMAKHKGLYPGFELPLPKLGLSNLQLKSLLKKHSSPVPVVRQCI
                     TVAICDEELLRISGKLKPNWVHSVYSMDATNNIVAGIFKLAQLSEDKRFGLKIRETQP
                     WKMKN"
     gene            <385340..>386329
                     /gene="DMC1"
                     /locus_tag="KLMA_20174"
                     /db_xref="GeneID:34714654"
     mRNA            <385340..>386329
                     /gene="DMC1"
                     /locus_tag="KLMA_20174"
                     /product="meiotic recombination protein DMC1"
                     /transcript_id="XM_022822716.1"
                     /db_xref="GeneID:34714654"
     CDS             385340..386329
                     /gene="DMC1"
                     /locus_tag="KLMA_20174"
                     /codon_start=1
                     /product="meiotic recombination protein DMC1"
                     /protein_id="XP_022674509.1"
                     /db_xref="GeneID:34714654"
                     /translation="MSTETETTSSIVSIDELQNFGINASDITKLKSAGIFTVNTALST
                     TRRNLCKVRGLSEVKVEKIKEAANKIITVGFIPATLQWQIRQSVLSISTGSKQFDSIL
                     GGGIMTMSITEVFGEFRCGKTQLSHTMCVTAQLPKELNGPEGKVAYIDTEGTFRPERI
                     KQIAQGYDLDPEACLENISYARALNSEHQMELLEQLGEELSSGEYRLLIVDSIMANFR
                     VDYSGRGELNERQQKLNQHLSRLNRVAEENNIAVFMTNQVQSDPGASALFASADGRKP
                     IGGHVLAHASATRILLRKGRGDERVAKLQDSPDMPEKECVYVIGERGIMDSDE"
     gene            complement(<386387..>387796)
                     /gene="TMS1"
                     /locus_tag="KLMA_20175"
                     /db_xref="GeneID:34714655"
     mRNA            complement(<386387..>387796)
                     /gene="TMS1"
                     /locus_tag="KLMA_20175"
                     /product="membrane protein TMS1"
                     /transcript_id="XM_022822717.1"
                     /db_xref="GeneID:34714655"
     CDS             complement(386387..387796)
                     /gene="TMS1"
                     /locus_tag="KLMA_20175"
                     /codon_start=1
                     /product="membrane protein TMS1"
                     /protein_id="XP_022674510.1"
                     /db_xref="GeneID:34714655"
                     /translation="MGMIVSLPIQMAATCFSSMVGSCCSSSLSSLGSLTSSSLMVRIT
                     YALWLLFNSVVSWISMSANKSILWPGKSCTSTGECGFFTVHRLNFALGMMHLILAAIM
                     VNIKSTKDARATLQNKAWTFKFIFYLLLIVLAYWIPNEFYIWFSRWVSVPSGFLFILI
                     GVVLLVDFAHEWAETCIQHVEQEDENSGFWRKLLIWSTSLMYSGSVIMMVVMFVLFCH
                     DGCDMNRSSATINVILSLVVSVASIHPRVQEFNPKCGLAQSSMVSVYCTYLTMSAMAS
                     EPDDKLCNPLVRTSNTRKFSTVLGALFTFIAIAYTTTRAAANNALSVRSGAISLYDDD
                     VEYSGIGESRNQLRLQAIKQAVEEGALPQSALLDYEAEQQRMLMHDGSASSEDDEFHV
                     TKYNYSLFHFIFFLATQWIVILLTINVTQDDVGDFIPVGRTYFYSWVKIISAWICYGL
                     YGWTLFAPIIMPDRFEYEF"
     gene            <388014..>388790
                     /locus_tag="KLMA_20176"
                     /db_xref="GeneID:34714656"
     mRNA            <388014..>388790
                     /locus_tag="KLMA_20176"
                     /product="actin superfamily"
                     /transcript_id="XM_022822718.1"
                     /db_xref="GeneID:34714656"
     CDS             388014..388790
                     /locus_tag="KLMA_20176"
                     /codon_start=1
                     /product="actin superfamily"
                     /protein_id="XP_022674511.1"
                     /db_xref="GeneID:34714656"
                     /translation="MTVVAVVDISSSHIEVGFAGHSRSVAKIQRDIEWLDDDMLTYKT
                     CRTWFHDVLLCDSKDAKVVISEPLWLSMKRKLRISKVLFNRLRVNSITFLPNCLGVFI
                     GAGIKNGLYIEVDAQHTELMPVFEGRLLDLFSQSSKVGYDDMSSLQKDLSNVTLEDTD
                     ALSLPMLVSTLRKKLPIDLRNAVLKQLVVVSRNNVVLSYLKEQNKDASVVESLGSWIG
                     TSIYTWCNLMKGLPDDLEVKRIDFEQHGKIPDWSLHKFEM"
     gene            complement(<388896..>389807)
                     /locus_tag="KLMA_20177"
                     /db_xref="GeneID:34714657"
     mRNA            complement(<388896..>389807)
                     /locus_tag="KLMA_20177"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822719.1"
                     /db_xref="GeneID:34714657"
     CDS             complement(388896..389807)
                     /locus_tag="KLMA_20177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674512.1"
                     /db_xref="GeneID:34714657"
                     /translation="MDVLLNENSGPCLTAVTQFQKVKPISKTPALKEQVLNSINVKRA
                     IDNDTLELVEYIRSPEPAIVRQARDLTGTSVDTHLTTPLYESVTASGPIASPFVPPSG
                     RTIDSNALNGEPSAVVPVHIVNIDIPGHYRDIPALLPDTAPLDLTCLGNKHEPGYDVG
                     PLKAVQDGSDLRENDLLKMEWKLLQILSCERDENKQFPAFAKEMELREKSAQSRWYHY
                     PLYYVFGVDTTGFFQLKDEFDWYVNHPWSSFDQVESEFWDLEPEEDGDDSRDAADLSY
                     SVCGSDDAELTLPISGISERSLDRYLP"
     gene            complement(<390031..>390234)
                     /locus_tag="KLMA_20178"
                     /db_xref="GeneID:34714658"
     mRNA            complement(<390031..>390234)
                     /locus_tag="KLMA_20178"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822720.1"
                     /db_xref="GeneID:34714658"
     CDS             complement(390031..390234)
                     /locus_tag="KLMA_20178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674513.1"
                     /db_xref="GeneID:34714658"
                     /translation="MSESNETNSKTNSDGLAEKTKILRDTLDLLLNKSIEQRRICEEL
                     KQENKYLQDYIDNLMGMGDVLSK"
     gene            complement(390608..390683)
                     /locus_tag="KLMA_R206"
                     /db_xref="GeneID:34718652"
     tRNA            complement(390608..390683)
                     /locus_tag="KLMA_R206"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:34718652"
     gene            <390983..>393802
                     /gene="RDH54"
                     /locus_tag="KLMA_20179"
                     /db_xref="GeneID:34714659"
     mRNA            <390983..>393802
                     /gene="RDH54"
                     /locus_tag="KLMA_20179"
                     /product="DNA repair and recombination protein RDH54"
                     /transcript_id="XM_022822721.1"
                     /db_xref="GeneID:34714659"
     CDS             390983..393802
                     /gene="RDH54"
                     /locus_tag="KLMA_20179"
                     /codon_start=1
                     /product="DNA repair and recombination protein RDH54"
                     /protein_id="XP_022674514.1"
                     /db_xref="GeneID:34714659"
                     /translation="MNQYVNKPFKPPRMVGRSTSSDTLVEKNPKLNRNSKRSLTAPAN
                     TNTNVKTKIHSTDLAKRSHTLPVQNSSNGTSVAPSAIFTANYRRVTTKKNKTWDGDGY
                     ASLLSDDKIKFFNEAGTSLGSVQIKGRDLYETVFRVGSNEFQLDYKISDPEELSSVQD
                     ICRIKGNSLSKTTDSLSLKRQKIDTSIPDNKSPIQTFIPRVTTKFRPAIKNNYNRTVV
                     SAPIGDKILKSMPAKSALPPLSEKLIGEITYCPVFDPLSIDNPLTMNKSQDSKVDVVV
                     DPVLSKFLRPHQREGVKFLYDCVMGLEHKKSDKSEIVNKTDDIKGCLLADEMGLGKTL
                     MTITLIWTLLKQTPYPTLINQRGVPLVGEISKVLIVCPVTLISNWKKEFKKWLSMNRI
                     GVLTLHNRNTPAEDKAQVRNFLKVPKTYQVLIIGYEKLLSVKDELQSHKEKPDIVVCD
                     EGHRLKNKDSKILKALQSLDIEKKIILSGTPIQNDLEEFFTIIDFINPGILGSFSGFK
                     REYINPIVRSRDVNAKHNEMLLEQGLMKSKELIDITKQFILRRTNDLLNQYLPPRTDL
                     IIFCRPTNDQITAFAEILNRGRFNFSNMTFNSSLGLITLFKKICNSTSLIEGDSFYNE
                     KLKTQNNTVKSSSSSGKLKVLLALLQEIKSKTEEKVVVVSNYTQTLDIIENHCSSLGF
                     SIARLDGTTATKNRGDIVNSFNNNPSTFVFLLSAKSGGVGLNLIGASRLVLFDNDWNP
                     SIDLQAMSRIHRDGQKKPCYIYRLVTTGCIDEKILQRQLMKIALSKKFLDDNKKQSSN
                     DDDLFQQEELKDLFTVNTSTLSNTHDLICNCNGEAEDFEAEEDVEEEEEEEGSKKEKS
                     IELQEHIPTRSSKPTWTSALEMKKYIEEEESEKQGSKSELVRNCLSGYKHIDPQRTED
                     LIDESISNVFNEMRDCITYAFVKDT"
     gene            complement(<393857..>395755)
                     /gene="VMS1"
                     /locus_tag="KLMA_20180"
                     /db_xref="GeneID:34714660"
     mRNA            complement(<393857..>395755)
                     /gene="VMS1"
                     /locus_tag="KLMA_20180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822722.1"
                     /db_xref="GeneID:34714660"
     CDS             complement(393857..395755)
                     /gene="VMS1"
                     /locus_tag="KLMA_20180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674515.1"
                     /db_xref="GeneID:34714660"
                     /translation="MSDHIQKNDLYVYDLADDVLSSLEVIYFNSELEEVQIKRTEEPK
                     PVVKPITKSKRVYSCTSCHIEKFSDGNGDYRSHFKSDFHKFNLKRVIKGLDPVDELQF
                     SKLISENRDSKMEKAGTNDEEDSDSSTDSGSDSDSESEERNDDGNDAQDELDTIIEAE
                     VQNLNIRDDDSDAGVVSHLNTQSPLVFLRSNKLPEGKVFGVYKCLFSKNGLQHPLKSI
                     STWKEQDQSQKFSVLFMIGGGHFAGAIVSHQRVASSGNSGKKSKLSVQEQSVQFLEQK
                     TFHRYTTRRKQGGSQSANDNAKGKANSAGSTLRRYNEAALRADVQSLLKDWEPYISKA
                     ENIFIRAKSVSDRKIFLDNTCISKDDPRLKSFPFTTMRPTSHELKRAWCDLTYLTIND
                     KPQPKVKKVIPATQPMKSTSKRSTPEPSSQPSEEEQHSEKLISMIQKSKAPLLISYIR
                     KNGIDINFRLQPSSEYHHNPTMLHFASANGYKHMVLVLLSTLKADPTITNENGKTAWD
                     LAKDNSIRESFQLARHNLGEDYTNWAESHIGEPLSTEEIEDRRQKLMLEEESQKKQLI
                     EKELQAVKERIKEEKEAKRGPGRQLDSSAPNAQINLNSLSENQRLRLMREQRARAAEA
                     RMKKFSGN"
     gene            complement(<396105..>397214)
                     /gene="HEM12"
                     /locus_tag="KLMA_20181"
                     /db_xref="GeneID:34714661"
     mRNA            complement(<396105..>397214)
                     /gene="HEM12"
                     /locus_tag="KLMA_20181"
                     /product="uroporphyrinogen decarboxylase"
                     /transcript_id="XM_022822723.1"
                     /db_xref="GeneID:34714661"
     CDS             complement(396105..397214)
                     /gene="HEM12"
                     /locus_tag="KLMA_20181"
                     /codon_start=1
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="XP_022674516.1"
                     /db_xref="GeneID:34714661"
                     /translation="MQVQNVDRSKFAPMKNDLILRAALGEKVERPPCWIMRQAGRYLP
                     EYHEVKNGRDFFETCHDAEIASEITIQPVRRYAGLLDAAIIFSDILVIPQAMGMKVEM
                     LEGKGPHFPEPLRTEEQVKEVLNYKVNVLHELDWAFKAITLTRTKLDGQVPLLGFCGA
                     PWTLFVYMTEGGGSRLFRFAKQWLNESPELCHQLLQKITDVAVEFLCQQVVAGCQMLQ
                     VFESWGGELGSRDFDEFSLPYLRQIAQRVPPRLKELGITERIPMVVFAKNSWYALDKL
                     CDSGYNVVSLDWSWNPEEAVKINNNRVTLQGNLDPGVIYGTDEIISKRVTEMIHGFGG
                     GKQHYIVNFGHGTHPFMDPEKIKFFLQECHRVGGQ"
     gene            397606..397691
                     /locus_tag="KLMA_R207"
                     /db_xref="GeneID:34718653"
     tRNA            397606..397691
                     /locus_tag="KLMA_R207"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34718653"
     gene            complement(397841..397926)
                     /locus_tag="KLMA_R208"
                     /db_xref="GeneID:34718654"
     tRNA            complement(397841..397926)
                     /locus_tag="KLMA_R208"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34718654"
     gene            <398409..>401174
                     /locus_tag="KLMA_20182"
                     /db_xref="GeneID:34714662"
     mRNA            <398409..>401174
                     /locus_tag="KLMA_20182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822724.1"
                     /db_xref="GeneID:34714662"
     CDS             398409..401174
                     /locus_tag="KLMA_20182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674517.1"
                     /db_xref="GeneID:34714662"
                     /translation="MVSSYLRSTFKFRKTTVSLLFALTVLALALTTFIDANRYKSSLP
                     SDKYSKKLLDTAWHDLEVITEKPHPYTSHFNDEVHDYLLKRVRETTKGNPHVKVWDDY
                     KNRVTKLFKHLDVFNDSSTDTRLVYYESSNVLVKVQGKNPDLPGLLLSAHFDSVPTAY
                     GATDDGKGVVSLLALLQYYSDHQPERTIVFNFNNNEEFGLLGATIFTYHPWFKIVSYV
                     INLEGTGTGSKAVLFRTSDTGTASVYGNSVKNLPYGNSMYQQGFYSRFVSSETDYKIY
                     ELNGLRGWDIAFYKPRDLYHTGKDTVLYTSKDALWHMLSTAWQLSKYMASDDANTSQD
                     ILDDEGKQTPAVYFDVLTNYFFVVSAKQLYFWNIVLLLIVPITLLLLRFVCSKLQVWN
                     MPESSLFTRLPVSVTLSGLTVLFSKKLLSQLNSAIWSRNFIIPLLFFVSEFIVINAIV
                     LNFFEHLWPLQDFKTLSLLEITALLWLVLIKITWDLDNSDFKNTGVYPFTIVYVLVSL
                     GAMFGLLSMCFNTKAFDDNDDQNESEPEQVNRTLLSADSDSQAQSLEEPSNIEATENS
                     PLIRTPMSSGQPTPTASIRKVPGAVHYLRSTLNYDWSIQYLLVVPFSVFILWQSLYLL
                     LDALAMTVQESNKAVQSVFTFATYGAIVVSVPLLPFVAKLNRYIVLILTFTILITASY
                     SILMDPFTETSPLKLRFVQRLDLSSSSGVSQKVEVYGRSGANLANALESLPSRPTVQC
                     EAIDPKMEKCSYEGIWPNFGIPMKVDVLKNTRNDKEHLEYEPYFANVRISVQDNRNCA
                     VRFNSTAVKLLKQVEFKIGNNTESYSYKSDEGIDSLLLHKLDFSAPYYDLQLKWIPRY
                     ADEENVDTLGVSIDCYWGEFDEMVKDGQVLEKVPAYSEALQYLPKNMILSNRESGIVT
                     IHKYLEL"
     gene            complement(<401407..>403752)
                     /locus_tag="KLMA_20183"
                     /db_xref="GeneID:34714663"
     mRNA            complement(<401407..>403752)
                     /locus_tag="KLMA_20183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822726.1"
                     /db_xref="GeneID:34714663"
     CDS             complement(401407..403752)
                     /locus_tag="KLMA_20183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674518.1"
                     /db_xref="GeneID:34714663"
                     /translation="MLTPLDTALDQVSLLCGRTATSMGLIHSAYNTLSRLLQRNPQNG
                     VCLLLLCENYWKQNQPQQESNHAIVIDLLTKSLQHDSSVSPLPANGTGMHMSDSGDTA
                     VGGSGAKNSLENGNGNSIAAGTVDNKKSSTSGKNNMMNSPVVNGNGVAVVAADSNNNS
                     NSSNNNSESNAGQVPLSSNYLVWTYLAVAYLHTNQIDQSLKSITQATSLNPDEPFLWT
                     LQTRIISRWYFLLSLDPQIRQQQGALPTIETLLPYYINSIEWSTAKRDPQMQLESHIS
                     LATLYFQFSLFDQSLAEMTFALNLLDSIQSSIPLNEKLQKLTFIYNFIAVLHQRLNDP
                     NNALQFLQQVKDLAPTESHVIRCCITMSEISLLSNYDPQIEKSIALLTTELDTLTKLK
                     SSKGAYFSITSNEEFMLRYILARCHSHLGNTETSYYQFQQLLKLFINHDYSPLVWTSI
                     ASLYLQLDQLADSLQAYSQAVQMAMDKLSDPQIVNTTSEFSNVYLSLKFYKLFAAYGW
                     FGISQVYSKTDQVKDALNALEQSIELFRAGGDFATAQQLKQYYDQVSSQPTSSQNGTD
                     HFLPPDIPIDLLLDFSVYHYMQSAFIVESLDSPALNAKIPGVDLQMPVHQAQPIQQTQ
                     QHMQHMQQQQQQQQQQQAQQIHQAQQAQQLNHASQSVSPPQLPMLQQHGIQQSNMSQN
                     TSPVQPRVMITQNDGASLGQNIGMTSGLAGSQQLLQPVPPHVHPHHAQSLGMYSLPYV
                     VQNATFAGQPPAAGPPPMSLGYIQHQQPQMAQAHIAHTRYA"
     gene            complement(<406199..>409234)
                     /gene="DSE4"
                     /locus_tag="KLMA_20184"
                     /db_xref="GeneID:34714664"
     mRNA            complement(<406199..>409234)
                     /gene="DSE4"
                     /locus_tag="KLMA_20184"
                     /product="endo-1,3-beta-glucanase"
                     /transcript_id="XM_022822727.1"
                     /db_xref="GeneID:34714664"
     CDS             complement(406199..409234)
                     /gene="DSE4"
                     /locus_tag="KLMA_20184"
                     /codon_start=1
                     /product="endo-1,3-beta-glucanase"
                     /protein_id="XP_022674519.1"
                     /db_xref="GeneID:34714664"
                     /translation="MLAQVWLLSLGYVLTTFLSAVGVAAQGSVTKTLEPANIDGLDPM
                     AQETEVVYVQPSATTFTVGEVFLANATSSFESDVESATATAPASGRPSRVSAPSNSPL
                     SLASPTMYVNTTCASSSSSSVDVEATISSVFAVTTLLTKSKSTSTSMIFSTTKTLAPS
                     VTAGTTVTTIQTKPQPLVTQAMVSSQQSVTVTWATLVSDVVVAPTGLTSTQVNSMTTF
                     VVTSLVTSPHASAKSSPSANPTAAVYRNSTTTSIDSTDIASSNRYNSTLSLLNSSFFT
                     EVTVVSTTQVPTVVPTNSATLVDLFVPVATSEPNSVFQRVQNPLNLASGVDNGNTPYE
                     TNKFYTNLIVGSQESGAFVYPYVIFKNTNGIGIQHTKASQQVVSSTSLVNPLGISSFI
                     VTSAEFASGSSSMNFKVTNMFHSSCDVQMVSSNDASDYIESPLVQGMGFVSSIFHGKL
                     TPQLQSSVGFSTLSQETSENLATGILKYRVTLLNGVDWLVYVTLPSSLASNQVSLAIN
                     NGDIQFTLNNGNAYGDGMIIQIAEAPNDSASETYYDSAAGMYLKSMDLSGTSDGNTAN
                     FKFSYETEGTSASGATVIFTLPHHSKSLTSNMQQANTGIEIASTTKGNMTGFLTTELE
                     FETQLNANVNWLPWSEQKGSNALTYTSDQLQLLAQVANDELQVNIKQSIQGLNTYYLG
                     KVLDKYAFILLTVSDIIKDSTVAKQTLELMKEAFAVVAANQQLYPLDYDTKYGGIISS
                     GDLASTSTQYDFGNTYYNDHHFHYGYIIHAAAVIGHVDQQYGSGDWASENKDIVEALI
                     RDVANPSLLDTYFPQFRSFDWFNGHSWAAGLYENGNGKNEESSSEDYHFAYGMKLWGE
                     VTNNESMNRLGSLMLNILRDSMQDYFLYTDDNTVEPSLIVANKVSGILFDNIIDYTTY
                     FGTNTEYIHGIHMLPLTPASGLIRSTEFVQQEWNEKLASIIDSLQSGWAGILRLNQAL
                     FDPKSSYDFFSQSNFDSTTYLDNGMSRTWALAYAGGLQS"
     gene            <411555..>415436
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_20185"
                     /db_xref="GeneID:34714665"
     mRNA            <411555..>415436
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_20185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822728.1"
                     /db_xref="GeneID:34714665"
     CDS             411555..415436
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_20185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674520.1"
                     /db_xref="GeneID:34714665"
                     /translation="MLDTGAQISVVTDLKLLHNYTSNITRNITAANMGTLNTMGEGIL
                     ILRLSNNVVVQFPAVYSEETPSNILSVMQLTAKQKITVDFYQRKMLVQDHNINIDIIH
                     RNGFYWLSSEYLVLNETNIHSPADDDSPVSISLCHIRENTVPKKKWSLEFIHNLLAHV
                     NIKQIRKSISNGDIRFIKLEDIDWSDMNSFTCQYCNIGKGKFHDHFTDSRDVYMKTFK
                     KFEYLHTDIMGPFREDNTIPPNYLITFSDEVTKYRWIFPMSLASEHQVSAIMRKLISN
                     IRTQQGVRVKEILMDQGSQYTGRMVRDLLDEFGIEGKYTSTGDKRSNGVAERLNRTLL
                     DDARTLLASANLPEFLWYDAAEFAVIVRNSMHMRKLDGSPNMAAGLGGIAINKILPFG
                     QPVVVYYNTGKKTLPRGKIVYALHPAKQSYGYTFYDPSSKQTMETTNYKIINTIQGDY
                     LNSEENLDTLNQVDDIVRQRSNDPSTDSQRHITHRNQREQDYISQERDPTDEPQQPES
                     DSTETHGNYLRTHKNEFQKGIATHTLGKDSRYPVRNSSDVPSQSPQEVQETLPVALSP
                     ASPPNNIFISQERLMEEEARSVKHPTKHVPAENGKRPAQRDELGVSTKRPNTKASPEQ
                     CSPIPEHLSHNDDTTDTSSLNEEERRSLYDKLSAKYRDSSIELQSTDSLYGGGGSDIG
                     DLSNPDKQIMGIISCTKTELKINDSKSDQNHEHQIDAIVNMLIQENPVQTYDNIKHEN
                     RVKIPLVNSLKMVRSLPNTKIDRSLSYSQAITKNSNHQEREAFKEAYDSEIAQLMRRG
                     TWDTTEVDIKSIEPHKLLNTMFIFTTKRDGRKKCRLVVRGDLQHWSTYEKHLESNTIH
                     HYALMTILSVALEENMIVKQLDITAAYLYADLKEELYIRTPPHMKMPNKAFRLRKSLY
                     GLKQSDANWYGTITSFLKERCGLKEDKIWSCVFTKEPPLSIIVCIFVDDIIVTGKDTQ
                     EIERFLEQLRSTYETKLVHDGKMGEDGTARYDILGLDLEYKRNGYMKFGMLDILSHKL
                     PLLNLPLREGSRYNQAPVSSSSEPPKVDKNLYVTEKDYKSNVKKLQQVVGLLSYVAHK
                     FRFEALYHVNVLAQYQLYPTDEVMKWANESVQYFWNTKEKRLVWTKNKTPVDYEFTII
                     SDASDRCEPEGKSRLGWFYEIYGHKISARSTKSSYVCDSSTGAEICAMKEATKFDFAI
                     SALLFTLTGKRPRVRLLSDNKPALGRITNPNSTVSPFKPTFTRTMELREKHNEGLCDF
                     TYIPTEQNVADILTKVLSAKRFNRLTNGWLI"
     gene            <420976..>422193
                     /locus_tag="KLMA_20186"
                     /db_xref="GeneID:34714666"
     mRNA            <420976..>422193
                     /locus_tag="KLMA_20186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822729.1"
                     /db_xref="GeneID:34714666"
     CDS             420976..422193
                     /locus_tag="KLMA_20186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674521.1"
                     /db_xref="GeneID:34714666"
                     /translation="MMTYALDDTVMSAEDLPSRIQDNSSISPSADTSGNVADVGEDSG
                     ADASGSADISSGNVQLDLLASNMNDIEVPASNPALEMYKMIKPVTSFQFTSFTAAFAR
                     PSWLEEYNPVECHSVPATQTNENIMTAHSSSGAGTSHSSMGPVWASTYDNEFGSIWRN
                     STSVSVPRPRPASVPAIIQQNHFHQNPMNYFGLPQGPSSVPETRLHDSMVDSANDSAS
                     ESISGSVADSVAGSVAGSVVGSISGSITDSIMDHSSVDRTDSLSSTEAASNMASPSMS
                     MLESVPHRINQNLSAGSSVSSAVSSSHPLFDASVSMSSVSSSTSSGSLLATGSPITNV
                     KYRCSQCGKAFARPSSLNTHINIHTGDKPYKCLYQNCTKQFNAKSNMLRHYKLHSKKP
                     KAKVQNKNKARKL"
     gene            complement(<423646..>425598)
                     /gene="DBF4"
                     /locus_tag="KLMA_20187"
                     /db_xref="GeneID:34714667"
     mRNA            complement(<423646..>425598)
                     /gene="DBF4"
                     /locus_tag="KLMA_20187"
                     /product="protein DBF4"
                     /transcript_id="XM_022822730.1"
                     /db_xref="GeneID:34714667"
     CDS             complement(423646..425598)
                     /gene="DBF4"
                     /locus_tag="KLMA_20187"
                     /codon_start=1
                     /product="protein DBF4"
                     /protein_id="XP_022674522.1"
                     /db_xref="GeneID:34714667"
                     /translation="MGKSGRSPLKENNPNTMGAHLNNPKKRSLDLLELEVSNRQKQRT
                     LRTIEGAIAHPPNALLKTMQGGATAGASAGGTSVANALGVISTGTKLSAPGGVAASVS
                     GSVSGSASAVEKTGNERGVNGTNTKAQTQRLSNKELIDWQNNWRRIMKRDTYIYFDCS
                     ETANDNRKDVLRRSFSTLGAKIKQFFDHEVTIVITSRKITNYSHLPSTDILTRAHKRG
                     YMKIWTLEKAARFLTNMDVDLKEMERDSINGKGLPTSNLLNLLENEKLFGSNERDPKA
                     KREDLHYFKHPHVYLYDLSQINAPLITLEWKQQDINSNSKKHIYPVIYPGSFGRCPFL
                     GDDTTDELQPRRIIKRYKRDKANESYAMKLRLLYQTSAEPAALPTADVDELDSNPEND
                     REPIILPYQNIYNNSTTQYNKLVSSMARFKQPKLPRGDTFDDDEMPYGAGAAAGGAGG
                     YKNKFQQEIRASGVQSVDANSNGTATTGNGLEPVKASNLNKDLLSLKRMVIERKTLLN
                     TNTNANTNSNSNSNSTSTVNTNNKVNGKNTTIVAETKSKSVSTGVLANAADASTAVSN
                     ATTSASTKATSAKATSTSVTQQRVHQPIGKQNPGYCENCKVKYDSLETHVNTERHTSF
                     ANKDSYFEGVDAMIQCVRQFRDINSA"
     gene            complement(<425973..>426392)
                     /gene="SLM4"
                     /locus_tag="KLMA_20188"
                     /db_xref="GeneID:34714668"
     mRNA            complement(<425973..>426392)
                     /gene="SLM4"
                     /locus_tag="KLMA_20188"
                     /product="protein SLM4"
                     /transcript_id="XM_022822731.1"
                     /db_xref="GeneID:34714668"
     CDS             complement(425973..426392)
                     /gene="SLM4"
                     /locus_tag="KLMA_20188"
                     /codon_start=1
                     /product="protein SLM4"
                     /protein_id="XP_022674523.1"
                     /db_xref="GeneID:34714668"
                     /translation="MLLSENIKGLLQETIKDAPLLEGKTPPIYTSMIITNRGSILWYV
                     NNKTPETYNSSVTNLKMMALLIKDKWCEDKDSVPADTIHHFELEDLHIALSRIPDSDL
                     LLVYIAGNEFPNGLLGLKLKYSLEAFRDLHGYRLAGN"
     gene            426718..426807
                     /locus_tag="KLMA_R209"
                     /db_xref="GeneID:34718655"
     tRNA            join(426718..426752,426770..426807)
                     /locus_tag="KLMA_R209"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718655"
     gene            <427221..>429017
                     /gene="RGP1"
                     /locus_tag="KLMA_20189"
                     /db_xref="GeneID:34714669"
     mRNA            <427221..>429017
                     /gene="RGP1"
                     /locus_tag="KLMA_20189"
                     /product="reduced growth phenotype protein 1"
                     /transcript_id="XM_022822732.1"
                     /db_xref="GeneID:34714669"
     CDS             427221..429017
                     /gene="RGP1"
                     /locus_tag="KLMA_20189"
                     /codon_start=1
                     /product="reduced growth phenotype protein 1"
                     /protein_id="XP_022674524.1"
                     /db_xref="GeneID:34714669"
                     /translation="MHLHRRDRAIIEGNIKLEIIHESNPYFAGEPICLLIRLKHLGSE
                     QQRETIKKKIDALEQKRRELIDSLNNDNESKPWLVKTLWNTFHQEERFKDESLQSQID
                     GLKKKLEFHEAVDLMSCFMQIVGQCSMDDDVIHMDSLSVGSKGPQLVGIGSQNTQSGE
                     DDPLTSIVSSFFNTNLDEESLKASPLMSTETIDTKDWIKVPFLLIPQTLLFSELLLQP
                     GETRVFKFNTERLRKDLPPSYTNSAHFNISYITQLGISINDPNEIPHQHFFNFPITIY
                     PYVDKNICQYEMPLNRELTISSPGKVQDMGNSVRYTKNRKRTMQSTQIEEDIRRRSIS
                     MIGKTSGPSIESMKNKFKEVVSKWDEKEDPELAMNSLLEHQFEKEQPASVRVNLAQFF
                     FEGKHDHESLTEDPDSKLLSQLHSLQKEYVVKMNEKFICNLELSKPVYSIIDQIDLTL
                     DFESPENDPSFKVTAVTACIETFELINPKFSTEQNVSKKKPNGTLIYESHATNFDECK
                     RISMKLMPQCSPTTMITSQFKTDIFQLKWMLTFKFVMIPISSEKEEYFLDKTYEDKKG
                     TLYHAKKDIEGYNFVFHVPLNVLPTEKQLAGW"
     gene            complement(<429121..>430833)
                     /gene="AVL9"
                     /locus_tag="KLMA_20190"
                     /db_xref="GeneID:34714670"
     mRNA            complement(<429121..>430833)
                     /gene="AVL9"
                     /locus_tag="KLMA_20190"
                     /product="late secretory pathway protein avl9"
                     /transcript_id="XM_022822733.1"
                     /db_xref="GeneID:34714670"
     CDS             complement(429121..430833)
                     /gene="AVL9"
                     /locus_tag="KLMA_20190"
                     /codon_start=1
                     /product="late secretory pathway protein avl9"
                     /protein_id="XP_022674525.1"
                     /db_xref="GeneID:34714670"
                     /translation="MSKDVIFGCGLVDFHHTRGPEVEYWYDGGNTGLSINNLWEYLPF
                     QALPDGAHSFEQSFTYFTLLYDEVNQKCCSSVGDSLKNGAESGRYSTFFAISCSKQIQ
                     SDELLNKSKDVVRSTVQKSVVVVCRKPIVGQIKDKLAIITNALFLQRDFSDRTIIDTL
                     FSNLNSIEYDDNDESHLYIGLNLRKMIYDLRKDVLVILKAMLLEKRILFYGNDVEQLC
                     NIQFSFISLIPCLLSNIQDCGSPLLDTYSKNITMKSSFKSSDRISVLRFLGFPLQIFT
                     KGGFFSPYVPLQQINDLSSSVTRWFIAGTSNTLLLEQSKSLCDVLVNLDDFTVQIMNK
                     KDKELHQALQLSHSDKKWMDIIIQSVIKSWNQDDWSTPKNSSYEGSEDYIRWQFEDYL
                     SGLVLTVKLLDFTKKHKNNALVLKTVDDLATTEQTINQYNSTWVREWQHTNNYRIFTD
                     YTDDRLFDVFDSRHPYRGSDTMAIVQQRFNKLFPRREKGDDRHKGRNQDNENINKYNA
                     KEHNKAAWFKKKDKKGVSGENNSNIITASEMSTINDSVGASNQADKSLYSDMSEELVE
                     NPWK"
     gene            <431323..>433551
                     /gene="HPR1"
                     /locus_tag="KLMA_20191"
                     /db_xref="GeneID:34714671"
     mRNA            <431323..>433551
                     /gene="HPR1"
                     /locus_tag="KLMA_20191"
                     /product="THO complex subunit HPR1"
                     /transcript_id="XM_022822734.1"
                     /db_xref="GeneID:34714671"
     CDS             431323..433551
                     /gene="HPR1"
                     /locus_tag="KLMA_20191"
                     /codon_start=1
                     /product="THO complex subunit HPR1"
                     /protein_id="XP_022674526.1"
                     /db_xref="GeneID:34714671"
                     /translation="MDDLEASIAQIIDQTQATLFENPELSINDDILTIPLGVDSFPEK
                     LLSGEFSEDGATSLNRKELILKKILGDVVSGTGENSVQKVCLLLDLCYHLKCRSEDET
                     ESKMWASLFFDLTATCILTLPFPHELGNFYLYLNSRLPWYLEGLSKEPVPVGETNLKM
                     GIRPPAAKLFFSIDTLLKNLNSHSLFLTPAHFDLVHRLLWWISQVIPINDNCNINKRA
                     KIMEDYPESFWAPHLPALGSSATILSDWVSICDDWFLHPLHWVFSHPRDKLSIEPILH
                     RFLDEVLSFESDFYKMVKNKKEKNAKQQAAVNGKEYYSLNFINGDFGKIKDSRDSISE
                     SKIEFWKYFNSVAEKNENVIQLLPLELDLFDLKAFQDRIEAFEYGYFRKLVIIQIFLT
                     VSLFHEIISDSTLAHYCGKIFNQTVTTHSTKMRVEYGDNTLNKNEKPLKFLSAKKHRI
                     LTFYQTNDTPFYELLKSIVNNEVETLKQKVGDYADMKDIHWSSAALSKPVINDSFKKF
                     GWIKLGNKKLDSLWKVPSGLELAKKFSESNGKNPSELYKSIVSGYKENSELENNDSVN
                     VKQWQALRSLRSEYLFEFNKVSEKTTLNGFADETLVTKDIESKKEILANRAQKKKNIH
                     TQAVAEAEQYFKDIEQKRRDLLEAKIKSQREALESSKTENTSSADTGTENKTDAPKRE
                     LEGEPSESQEDSSPKKRKINPETSPETPEVATDGAEPTKVPETTDNSDAVENSEAPEA
                     AA"
     gene            <433861..>435195
                     /gene="NOP53"
                     /locus_tag="KLMA_20192"
                     /db_xref="GeneID:34714672"
     mRNA            <433861..>435195
                     /gene="NOP53"
                     /locus_tag="KLMA_20192"
                     /product="ribosome biogenesis protein NOP53"
                     /transcript_id="XM_022822735.1"
                     /db_xref="GeneID:34714672"
     CDS             433861..435195
                     /gene="NOP53"
                     /locus_tag="KLMA_20192"
                     /codon_start=1
                     /product="ribosome biogenesis protein NOP53"
                     /protein_id="XP_022674527.1"
                     /db_xref="GeneID:34714672"
                     /translation="MVESKNRPAQYKQSSRKGKKAWRKNIDISDVEKKLEEKHELETT
                     HGKQTLTEVSDDALFAVDTDGDQVLKQKLIKRKQIKKVLKSTEILESIKTKSKVPALT
                     SAKVANKKQDKVQGVSRKELDRLLALAGKKLGESKLKARVAKEGLVKSDTFDLWGGEP
                     KDEIVVPSGLKLKVNPENMEKVPKELLTQSTTGWSVAKVAPPTIKHSTVLVKERETIP
                     HAGKSYNPSKEEWESLISTEYESEYKNEQRRIALENYRQRIQHLMETADDKEEEDSES
                     DEESESESEDASVSEGADPSTLSLNPATKNKKKTKYQRNKQKRHEEKVKLQNEIKKLK
                     EKVKELEKLTDIEKEVEEKLAKSTTTSNKVRKNKKHKLGTKHSVMEDNLEVKFSDELS
                     DSLRKLKPEGNLLYDAVRSLQSSGKVETRVPVRKGRRYKQKITEKWTYKDFK"
     gene            complement(<435394..>437928)
                     /gene="PXA1"
                     /locus_tag="KLMA_20193"
                     /db_xref="GeneID:34714673"
     mRNA            complement(<435394..>437928)
                     /gene="PXA1"
                     /locus_tag="KLMA_20193"
                     /product="peroxisomal long-chain fatty acid import protein
                     2"
                     /transcript_id="XM_022822737.1"
                     /db_xref="GeneID:34714673"
     CDS             complement(435394..437928)
                     /gene="PXA1"
                     /locus_tag="KLMA_20193"
                     /codon_start=1
                     /product="peroxisomal long-chain fatty acid import protein
                     2"
                     /protein_id="XP_022674528.1"
                     /db_xref="GeneID:34714673"
                     /translation="MTDISVRTKVLKLLVQLHYQFLKLDLRKVQLKGYVPALLRHCWT
                     LLRSADVSDSRNRGFKRHARFVIWAFAAICGGSGISLAIAVNRVIKICTRRRTRNLVS
                     SSAKNQNLQNGTRELYIKEDGGKEKKVLVVPTDSDQYEHDRYLFKNLGNNVESQLFSS
                     KFLQQLNVLSPILIPKFLHKNSLLLASQIFFLILRTWLSLMVARLDGQIVKDIISRRP
                     KRFAYDMTCWLLIAFPASYTNSAIKYIQRKLSLNFRLRLTRYIHDMYLDKRLVFYKTS
                     FDHEATNSIIRNIDNSITNDVQKFCDAITNVFANIAKPMIDLIFFSIFLRDSLGTLGV
                     AGIFFNYFSTGYILRKYSPPLGKFVSLKSKSEGDYYNYNLNMINNSEEIAFYQGTEVE
                     HSKVNELYDKLMDHMLLVDRSKVEYNIVEDYILKYTWSAWGYAFASIPIVIQTWASDA
                     VNESGNMKEFIMNKRLMLSLADAGTRLMHSIKDISQLTGYTNRIFTLLKVLHRVHDSN
                     FDYGVLHDGEEPSAAELNSIIGNGVTKSSPAIRGTVQHDFGGIRFENIDIIVPSSKGV
                     NGSLLVKSLTFQIPQEIAPEPASSKQISLTNIRDPFDASKLINQRGMGSSLLILGPNS
                     CGKSSIERILTEIWPIYNKNGLLSVPPAHDLFCVPQRPYFTQGSTFRDQIIYPMSYEE
                     FYEKGFKDSYLKQILREVRLDYLLKRDRGLNYFDAVTDWKDILSGGEKQRVNFARIMF
                     HRPRFVVLDEATNAISTDMEDHLFTMLKRYRFNFISISQRPSLIKYHDYLLELTSGTN
                     WNLQTLGSDEAILTIEHEIDSIQQKLSNVKSSEKQRDEIQRKLNMM"
     gene            <438577..>439440
                     /locus_tag="KLMA_20194"
                     /db_xref="GeneID:34714674"
     mRNA            <438577..>439440
                     /locus_tag="KLMA_20194"
                     /product="UPF0613 protein PB24D3.06c"
                     /transcript_id="XM_022822738.1"
                     /db_xref="GeneID:34714674"
     CDS             438577..439440
                     /locus_tag="KLMA_20194"
                     /codon_start=1
                     /product="UPF0613 protein PB24D3.06c"
                     /protein_id="XP_022674529.1"
                     /db_xref="GeneID:34714674"
                     /translation="MSGKKVPGVLHLYSKSRVAFEFEPVGKSKVLIFVGGLTDGLLTV
                     PYVQGLAKTLEPLGFSVVQIQFSSSYLGFGTGSLKRDDSEIDQLVDYLRSDGRETILL
                     MGHSTGSQNTLHYLTNHPGKIEGGVLQAAVSDREFICSQFPETSLQKLNEEALALVKA
                     GKGDELVSEEHRKVIFGTPITAYRWCSLVLPGGDDDFFSSDISDDVLKTTFGVVQEPF
                     LVALSEKDEFTPENVDREKLLGRWEAASDPKRWSKNSGLIRGASHNVAQAESQKHLYK
                     MVAAFIQEFSL"
     gene            <439758..>440429
                     /gene="ppr1"
                     /locus_tag="KLMA_20195"
                     /db_xref="GeneID:34714675"
     mRNA            <439758..>440429
                     /gene="ppr1"
                     /locus_tag="KLMA_20195"
                     /product="acetyltransferase"
                     /transcript_id="XM_022822739.1"
                     /db_xref="GeneID:34714675"
     CDS             439758..440429
                     /gene="ppr1"
                     /locus_tag="KLMA_20195"
                     /note="rimL"
                     /codon_start=1
                     /product="acetyltransferase"
                     /protein_id="XP_022674530.1"
                     /db_xref="GeneID:34714675"
                     /translation="MSTANLRNGAVFSKPIVDKIEPLQFHLKDSDKVVTAFAVLSPEE
                     VPESLVDFLYSLFNKELDAGQTYPQVGPLTREQFVDYWFHSATVVLLDTTQKSIDPSW
                     NNWEELVLGTFYIKPNYAGRCSHNCNAGFLVNPVFRGKKVGYRLGQVYLKWAPLLGYK
                     YSVFNLVFVTNVASWKIWDKLKFSRIGYIPKVAVLKGFDEPVDAIMFGKDLTNVEPEL
                     FEDLS"
     gene            <440582..>443112
                     /gene="ABP140"
                     /locus_tag="KLMA_20196"
                     /db_xref="GeneID:34714676"
     mRNA            join(<440582..441003,441404..442062,442178..>443112)
                     /gene="ABP140"
                     /locus_tag="KLMA_20196"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822740.1"
                     /db_xref="GeneID:34714676"
     CDS             join(440582..441003,441404..442062,442178..443112)
                     /gene="ABP140"
                     /locus_tag="KLMA_20196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674531.1"
                     /db_xref="GeneID:34714676"
                     /translation="MSGLKVPQLVFKNTNVISAGTDIVYLPRIERLLLKYRASPRLNR
                     VLTKFMHQNEISHFNRLQQYEPLKSQVIYIAGIWAIKEALLKTLPAGFGKPPAIQIYT
                     KLLYKTNTPDGKPELHLDKDSFLNDETKNYWNKYLERTKMGVADLIKKFESIAKDPVE
                     GSPEPAQPKVELKKEADPEPVAAPEEPKDEPVTPEETAEEEPVTEEPVREEPVKEEPT
                     EEEPVKEEPTEEEAVKEEQTEEPVEEEQTEEPVEEEQTEEPVKEEQTEEPVEETTEEK
                     SSEEATEEKPSEETTEEPSEETTEEAAEEPSEDATEEATEEPSEEATEEHEPSTSSKK
                     KNKKKKNKKKKKSANAESEQPSASADIDARDTRLGRDSPFDFGKRVLKDDEEVWNHNA
                     WDNVEWGEEQIKAAEEKIQKQYENPVPEFDKNLYNSNPSRYWDIFYKNNRENFFKDRK
                     WLQVEFPSLYEATKPDAGPKTIFEIGCGAGNTFFPILNENENEQLKIVAADFAPRAVE
                     LVKESEQFNPKYGHATVWDLANTEGQLPDGIEPHSVDIAVMIFVFSALSPEQWETAMD
                     NLHKIMKPGGQILFRDYGRYDLAQVRFKKNRLLDDNFYVRGDGTRVYFFTEQELREIF
                     TKKYFVEDQIGTDRRLLVNRKRQLKMYRVWLQAVFKVPELEVKENSS"
     gene            complement(<443152..>443967)
                     /gene="ATG5"
                     /locus_tag="KLMA_20199"
                     /db_xref="GeneID:34714677"
     mRNA            complement(<443152..>443967)
                     /gene="ATG5"
                     /locus_tag="KLMA_20199"
                     /product="autophagy protein 5"
                     /transcript_id="XM_022822741.1"
                     /db_xref="GeneID:34714677"
     CDS             complement(443152..443967)
                     /gene="ATG5"
                     /locus_tag="KLMA_20199"
                     /codon_start=1
                     /product="autophagy protein 5"
                     /protein_id="XP_022674532.1"
                     /db_xref="GeneID:34714677"
                     /translation="MEELRERVWNGTINVEVVVSDAIVVPNTTLADKSCHIVMLRDAY
                     LGFYLPTVVRKLADTIKVPYESDYRNWWFEYNGEGVPWEYPCGVLFDLLNKKRKKQGN
                     ELDDTSLQMWELQLCHGDKYPRGILPLVDGHSQIKDYWRHQWKQACFILNGSAKRIMS
                     LSIPDFENFWVSILSRNRSDFMAVRSKLFSMNKAKSLPVRVWTSNYAVLQPTVPVTDK
                     ELSVAELLDSIKLSSDGVKSVIIQGIDVSIEDNIFELYDIFASIDGFLYLVTK"
     gene            <444190..>445713
                     /locus_tag="KLMA_20200"
                     /db_xref="GeneID:34714678"
     mRNA            <444190..>445713
                     /locus_tag="KLMA_20200"
                     /product="SGT1 super family"
                     /transcript_id="XM_022822742.1"
                     /db_xref="GeneID:34714678"
     CDS             444190..445713
                     /locus_tag="KLMA_20200"
                     /codon_start=1
                     /product="SGT1 super family"
                     /protein_id="XP_022674533.1"
                     /db_xref="GeneID:34714678"
                     /translation="MGVIKPERRVNDKWLWQSDESGLKDDIFDQENGTTLVFGVFYFD
                     ELVQDSEQLILKSQLQELISMLEPWNKSYPWNSFNGVTLEIREYLSGEYYIFGSLHMG
                     DNARDEEALVLSILLNFSRRVGPCTYIKVCDTDGEFILMEANDVIPEELEYPISNNRI
                     WITMGRLKYIPTTFYFDRGLSKIESISYLKKENSKLLPLPNIETKIRESFLNVFPNSA
                     LDKLNTTTITVSDPEVAAILKNDPKIVSLAVSHFMSSTYDIPISHSKEVLKDKINLTI
                     PSAHAALVKKYSKMTGKGENYEKTLSEILETSILHMLANGILEKTTTGKKSQEDLQTV
                     LRDNYIISQKYELKPIDWELLDTNEKSDIKVTSLDTLKTSLMSFLNEESDFTGILNDE
                     REVKHNNEGNPNAESESDLGLGSDPEIDEDDFFEFFLKEGLNLSDNYIENLRTQNENH
                     PKSTKEDRDTDIQRDLQSSSNEISEYEDSIEDLIKSLSVDGAPLGPLKTILENYNRR"
     gene            complement(<445772..>448315)
                     /locus_tag="KLMA_20201"
                     /db_xref="GeneID:34714679"
     mRNA            complement(<445772..>448315)
                     /locus_tag="KLMA_20201"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822743.1"
                     /db_xref="GeneID:34714679"
     CDS             complement(445772..448315)
                     /locus_tag="KLMA_20201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674534.1"
                     /db_xref="GeneID:34714679"
                     /translation="MFTSKAEQNNIKASIAASYDKLYSQFSSEVLSEVGNYKILKFIG
                     EGSFGKVYLAVHKLTHQKVVLKTGNKKDPNVVREVFYHRQFDFPYITKLYEVIVTEYN
                     VWMVLEYCSGHELYEHLLQERRLSLEESKKLFSQIASAVYYAHELKCVHRDLKLENIL
                     LDGNGHAKLTDFGFTREMATRSQLETICGTTVYMAPELIDRKNYDGFKTDIWSLGIIL
                     YTMINGYMPFDEDDENETKLKIVNEEPVLTQEWLSEDVEDLIKGMLRKDPNQRITMEE
                     ILTHPFLQPYGTVTMEKTDKLLAKQRGGSLHFHSKHEKRLLKRLKQCGFDTGSIKKSV
                     NKRKCDSLSGLWFLLLERESNKELGVPKRTRSVLSVRKVFESSVNMVMDDILLQSPEC
                     TKTNSLKKILSRKSVDQEVPHQVTPALAPKDSRKVNSNGNHEVAEPASIGSGDNISKK
                     KGFFQRMSSLFKSKKHTPQNDGESLTHRNSLHTLPPLSGKRRHKTGSNDSQVRSLPEV
                     KANQNSTDPNVQFEDITNKTEHRVKKPKSHSSIDIPNTPSGSELDRHRLSGSADEFLK
                     LPNGRGDRRSSIVSQHSAVSNDTFNSEYSTDAQSGSRSNITQYSSRIANTSDTGSNRK
                     NVRRTLSVLSTTSSNSELSSKTDSFYDITTASSPTTMDIRSNFNIRSESQFPKMNGNS
                     PWHIQRGKSPVGRHARMTNRSLNRKFRHSNNSGTQSVIQEEGSFDDENENAANRPEIS
                     EYDSAEITTHSDSETPSKANTPLYTLSEGHNESRPVAFLVRRSASEGSSWSHPHAELL
                     ETASIPIIKTNTKSFIEEDEYEASIAADDEDNSLEDDEHDNSKCAIAPV"
     gene            <449053..>450543
                     /gene="MET7"
                     /locus_tag="KLMA_20202"
                     /db_xref="GeneID:34714680"
     mRNA            <449053..>450543
                     /gene="MET7"
                     /locus_tag="KLMA_20202"
                     /product="folylpolyglutamate synthase"
                     /transcript_id="XM_022822744.1"
                     /db_xref="GeneID:34714680"
     CDS             449053..450543
                     /gene="MET7"
                     /locus_tag="KLMA_20202"
                     /codon_start=1
                     /product="folylpolyglutamate synthase"
                     /protein_id="XP_022674535.1"
                     /db_xref="GeneID:34714680"
                     /translation="MYLSLGLKMAKRNYQDAVQALNSLQSNYANIMAIRLSGDRKNMM
                     NIWEMQEWSRRIGYSVSDFNRLNVVHITGTKGKGSTAAFTQGILSQYRDQIGGKIGLY
                     TSPHLRSVRERIRLNGEPIDEELFSRYFFEVWDKLEETSSDETKFPHMTKGQKPGYFK
                     YLTLLSFHVFMQEGCKTCIYEVGVGGEFDSTNIIEKPTVCGVSALGIDHTFMLGNTIE
                     EIAWNKGGIFKNGAPAYTVTGQPPEGLKVLEERAVERNTSLTQVPTFNQLKSVKLGIA
                     GDFQVVNASLAVALAHEHLNSIGVLNEPLNLSESAEIPGKFVKGLETTIWEGRCQTIK
                     NGNITWYVDGAHTKESITAASGWFKKTVEGSDRKKVLLFNQQSRDARALLRYLYETVS
                     PEVHFDMAIFTNNVTWKSGDYSADLVSLNTSKEQVEKLEVQKSLHQEWSSLGSGTAEK
                     NIKVTSSIQAAFDEIKAIDEPVDVFVTGSLHLVGGFLVVMDKNLSQ"
     gene            complement(<450624..>451763)
                     /gene="SSP2"
                     /locus_tag="KLMA_20203"
                     /db_xref="GeneID:34714681"
     mRNA            complement(<450624..>451763)
                     /gene="SSP2"
                     /locus_tag="KLMA_20203"
                     /product="sporulation-specific protein 2"
                     /transcript_id="XM_022822745.1"
                     /db_xref="GeneID:34714681"
     CDS             complement(450624..451763)
                     /gene="SSP2"
                     /locus_tag="KLMA_20203"
                     /codon_start=1
                     /product="sporulation-specific protein 2"
                     /protein_id="XP_022674536.1"
                     /db_xref="GeneID:34714681"
                     /translation="MISEGSFLDPQAAANIYGQKKASDAGTMLTNSTNSKTSSLNFEL
                     FGFRRKAKQYFETTTQRFREYGIDKDLIRGSINSRPNSQDETGENNQSKIMMDMLFEK
                     ANNGAKQEIEKISGGGKYGVHISTTPKSVPELVCEAVYQDVHGEILLGSPGSELAEMS
                     TNEQRRIVIFNDLPKNIGVGALLAQIGGGPLEKVMYSYGDKHDSNNVSYVELHFLFPA
                     DAAHFMKFARFHLFKVNGVHLIPRWGQKDSGSPSDIQQYINPDLCGNIQNFDSTGARR
                     CLIMKKYSRKHKSLSKDLNPKSHIYDLDIQEIIKDFNQFGQILEISPLISRKICLQIN
                     FHDIRSAIEAMKSYETSNSYLNDRYSKDWSIWYGKDIVDKPCIEV"
     gene            complement(<452316..>454346)
                     /gene="PUS7"
                     /locus_tag="KLMA_20204"
                     /db_xref="GeneID:34714682"
     mRNA            complement(<452316..>454346)
                     /gene="PUS7"
                     /locus_tag="KLMA_20204"
                     /product="multisubstrate pseudouridine synthase 7"
                     /transcript_id="XM_022822746.1"
                     /db_xref="GeneID:34714682"
     CDS             complement(452316..454346)
                     /gene="PUS7"
                     /locus_tag="KLMA_20204"
                     /codon_start=1
                     /product="multisubstrate pseudouridine synthase 7"
                     /protein_id="XP_022674537.1"
                     /db_xref="GeneID:34714682"
                     /translation="MSKHTLTGESELVAEQHEVKRTKISDGINDGLNNGNITEEDVGI
                     TKYLNNDSSGFKGQIKQRYTDFLVNEITKKGEVVHLTDKGFNMPKKPKPTKEQIEQSQ
                     KEEHERRQNFKVDSEIRNELVALLEEENVQKIEEVYRTGKQIEIPKVFEDKLERTKIH
                     QLLRKGFENKLESVTTADNQFIIGMATRQTRVSKQELIEQTKDKNGVENWGYGPSKSY
                     IHFTVYKENKDTMDVANILSKYMRIPTRLIRFSGTKDRRAVTCQRMSISKIGLDRLNG
                     LNKGLKGIVLGGYKYEDEPLNLGDLQGNEFTIAIRDVTLKNESDDLESILSTGVKSLQ
                     ENGFINYFGMQRFGTFSVSTHQIGQALLSGNWKQAADLILAEQENVLPASKDARRIWA
                     ESRNPIAASRAMPRQCLAENAILNALCNEEKDDSTQDYTMASYHNAILKIPRNLRTMY
                     VHAYQSYIWNKIASKRIGLFGLEVVEGDLIVDGSEDVASVKQSEQEDEDFDEDLRESK
                     FIRARPVTAEEVASKKFTMEDIVLPTPGFDILYPNNEKLRQLYVDIMAKDNMDPFDMK
                     RKVRDFSLAGSYRHVIHKPTDIEFKVVSYENPTDQLINTDLEILNANRGKDNGQTYMK
                     AKLERYMKVKEGSKKAVIVKFKLGVSAYATMVLRELMKLETSRRGDMCNVSA"
     gene            <454629..>455912
                     /gene="PRP46"
                     /locus_tag="KLMA_20205"
                     /db_xref="GeneID:34714683"
     mRNA            <454629..>455912
                     /gene="PRP46"
                     /locus_tag="KLMA_20205"
                     /product="pre-mRNA-splicing factor PRP46"
                     /transcript_id="XM_022817809.1"
                     /db_xref="GeneID:34714683"
     CDS             454629..455912
                     /gene="PRP46"
                     /locus_tag="KLMA_20205"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor PRP46"
                     /protein_id="XP_022674538.1"
                     /db_xref="GeneID:34714683"
                     /translation="MDSKATGPVTELSGDDIYVKSRWNNEFKHADILDESYESETTGN
                     ELISTGLISRERNSNTAVTSLQTNSMVKFDATNKQGTQEPGSLLERYDKIRSYKPEWH
                     APWKLNKIINGHTGWVRCVSVDPVDNEWFATGSNDTTIKIWELATGKLRLTLMGHVMS
                     VRDIVVSNRHPYMFSASEDKLVKCWDLETNKAIRDFHGHLSGVHTVDVHPTLDIIATA
                     GRDAVVRLWDIRSRAEIIILPGHKSPINKVKCLPVDPQIISCSADATIRLWDIVAGKS
                     AKTLTHHSRNVRDLALCPNEFSFATASTNDVRSWKLPEGQLLTNFQSQDIGIINSVSI
                     NDDNILFAGGDNGTMSFFDYKTGHKYQTFKTPAVTGSLDSERSVLCSTFDVTGTRLIT
                     GEGDKSIKIWKQDPGATEESDPGLPWNPTLASQRF"
     gene            <456264..>457580
                     /gene="ESA1"
                     /locus_tag="KLMA_20206"
                     /db_xref="GeneID:34714684"
     mRNA            <456264..>457580
                     /gene="ESA1"
                     /locus_tag="KLMA_20206"
                     /product="histone acetyltransferase ESA1"
                     /transcript_id="XM_022817810.1"
                     /db_xref="GeneID:34714684"
     CDS             456264..457580
                     /gene="ESA1"
                     /locus_tag="KLMA_20206"
                     /codon_start=1
                     /product="histone acetyltransferase ESA1"
                     /protein_id="XP_022674539.1"
                     /db_xref="GeneID:34714684"
                     /translation="MSHGEESEPGIPHKVDSIDEIFVGCKCWVLKDGQDRLAEILSIN
                     NRRDPPKFYVHYEDFNKRLDEWITADRLEISKEVIFPRPKEVEDKKDSKKKKQQTKSA
                     TPQTSSISPEAGDMMDLDNLNVQGIPNEDISREDEIKKLRTSGSMTQNQNEVARVRNF
                     DKIIMGKYEIEPWYFSPYPIELTDQDVIYIDDFSLQYFGSKKQYERYRKKCTLRHPPG
                     NEIYRDDYVSFFEIDGRKQRSWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELG
                     HHIVGYFSKEKESADGYNVACILTLPQYQRMGYGRLLIEFSYELSKKEGKVGSPEKPL
                     SDLGLLSYRAYWADTLIKLLVEHGQEITIDEISSITSMTTTDILHTAKALEILRFYRG
                     QHIMYLNNDVMKRYTKLMNNKRRSIDPEKLIWTPPVFTASQLRFAW"
     gene            complement(<457630..>458721)
                     /gene="RRD2"
                     /locus_tag="KLMA_20207"
                     /db_xref="GeneID:34714685"
     mRNA            complement(<457630..>458721)
                     /gene="RRD2"
                     /locus_tag="KLMA_20207"
                     /product="serine/threonine-protein phosphatase 2A
                     activator 2"
                     /transcript_id="XM_022817811.1"
                     /db_xref="GeneID:34714685"
     CDS             complement(457630..458721)
                     /gene="RRD2"
                     /locus_tag="KLMA_20207"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 2A
                     activator 2"
                     /protein_id="XP_022674540.1"
                     /db_xref="GeneID:34714685"
                     /translation="MAVKRLINDKDMELWKASQTFQDLIGFITTLATSVEGRENGDYV
                     QPISDHVQKLIKLLDSVIDIIAKHEVIKDANTSRFGKIEFRDFYDELAENVSDMVVKT
                     LELGSDTVKSEQLSDLCTYLTESWGDRTRIDYGSGHELNFICFLYCLFELKVLELDKD
                     STNAVLVIFIKYLDIMRKLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLK
                     PKSIHNPEVVEMFQDRYLYFGCIAFINKVKTTASLRWHSPMLDDISGVKKWSKVAEGM
                     VKMYKVEVLSKLPIMQHFYFGVFLPCPDGVTEYSTERQHEIEESSCCSDGSSHPHSTW
                     ADCCGIAVPSAIAASEMSHRQHEKRIPFD"
     gene            complement(<459068..>460330)
                     /gene="DGA1"
                     /locus_tag="KLMA_20208"
                     /db_xref="GeneID:34714686"
     mRNA            complement(<459068..>460330)
                     /gene="DGA1"
                     /locus_tag="KLMA_20208"
                     /product="diacylglycerol O-acyltransferase 1"
                     /transcript_id="XM_022817812.1"
                     /db_xref="GeneID:34714686"
     CDS             complement(459068..460330)
                     /gene="DGA1"
                     /locus_tag="KLMA_20208"
                     /codon_start=1
                     /product="diacylglycerol O-acyltransferase 1"
                     /protein_id="XP_022674541.1"
                     /db_xref="GeneID:34714686"
                     /translation="MNTDAVTDGVRKRVVKNESGGDGDTGDRPSSVPSADDVEYERKK
                     MCYCSTNIPMKRRMQTLMVIWYTGSIVFMTILSLFAIVNPCLWWFVLPYGLYYCVDRT
                     PSNGNAVKRYSPWFRGLGIWWYLRDYFPVKLYQTAKLEPTFTSIDAKELETEAREPGY
                     LDSSEFVSPSKWWSPFKDKAETVKATGPRYIFGYHPHGVAAFGAFSAFATEACGWGEK
                     FPGINNCLLTLVNQFQIPVYRDYLLALGITSVARKNAMKILDNNYSITIVIGGASEAA
                     ISQIGSTDIILNKRKGFVKLALQAGNVSLVPVYGFGETSCYKIIQLNPESKLRRFQTW
                     VKSTFGFTIPVFFARGIFNYDFGLLPYRHPINVVVGKPIHIKEKIEHPTIEQIDHYHK
                     QYIAELQRLFDEYKGKFGYGDKTLNIVE"
     gene            <461245..>463668
                     /gene="RAD53"
                     /locus_tag="KLMA_20209"
                     /db_xref="GeneID:34714687"
     mRNA            <461245..>463668
                     /gene="RAD53"
                     /locus_tag="KLMA_20209"
                     /product="serine/threonine-protein kinase RAD53"
                     /transcript_id="XM_022817813.1"
                     /db_xref="GeneID:34714687"
     CDS             461245..463668
                     /gene="RAD53"
                     /locus_tag="KLMA_20209"
                     /codon_start=1
                     /product="serine/threonine-protein kinase RAD53"
                     /protein_id="XP_022674542.1"
                     /db_xref="GeneID:34714687"
                     /translation="MDVVTQPTQQATQATQKYLIDKFSQEQIDDDVVCRVICTSGQIN
                     LRDLKVKPEAVLKNPASIKKTWTFGRNQACDYYLGDISRLSNRHFVIMLGEEGTLMIK
                     DTSTNGTWLNGARIQKDTNHILTQGDEISVGVGVPKDVVSLVIFVNENFKRTLKELGS
                     ARRVGSPSSSETGRGLGEIELKGIHKKYSISDSIVGQGAFATVKKAVERSTGKTFAVK
                     IIHKRKVMDKFDGVKRELDILQKLDHPRIVKLKDFYEDDDNYYMLMEFVSGGDLMDFV
                     AAHGTVGEDAGREITRQVLEAVKYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLA
                     KVQNQNTFLNTFCGTLAYVAPEVIEGKNIEDKTNRDLYSSLVDMWSIGCLVYVILTGH
                     LPFSGQSQNELFKQIKRGSYHEGPLKDYRISEEARNFIDSLLNVDPKERMDAEKALQH
                     PWIKMAYTDSAESQISISQSLSQQKFVDSMNELEYGSYLAKKRSEASKKEPAQPLSKT
                     TNKDPVFKVPQIAPLKASQPQGLQFNSSKANPMKSHNNHNSDTSSNSQNNKRISRPLT
                     KVNGNGLFLTLHSLPNSSIKGKIEIKQGINPFFIGRSDECNCKIDDNRLSRIHCFILK
                     KRHAVGDSIYESPAQGLDDVWYCQSGTNSSYVNGKKVISGTKILLHEGDEVQIIWDKT
                     NGDTVSFQVEFNDTTGLFQKGKRDINEKNSKVLLHKQTQEELGLVPKFMEFMKSRSSH
                     HPRSQKEQQLSINYLSQNSDSADENTEQSTNNALKRVHSVSLSQSQPQTTKRAKLAQT
                     QKPDFEGFL"
     gene            complement(<463858..>464736)
                     /gene="SLD5"
                     /locus_tag="KLMA_20210"
                     /db_xref="GeneID:34714688"
     mRNA            complement(<463858..>464736)
                     /gene="SLD5"
                     /locus_tag="KLMA_20210"
                     /product="DNA replication complex GINS protein SLD5"
                     /transcript_id="XM_022817814.1"
                     /db_xref="GeneID:34714688"
     CDS             complement(463858..464736)
                     /gene="SLD5"
                     /locus_tag="KLMA_20210"
                     /codon_start=1
                     /product="DNA replication complex GINS protein SLD5"
                     /protein_id="XP_022674543.1"
                     /db_xref="GeneID:34714688"
                     /translation="MNIDIDDILAELDRDTTAVERESSSYDDVGNKTVGGNGVSQLGD
                     VEKQYSVQSSKSERISDFQKLVTQWRNERMSPELLPYPHELMTRTLHRIQERVELIET
                     LSMGYLEDDRESTVDSKLPLLCMEAELERLKFLVRSFIRCRLSKIDKYSIYLRQQSEL
                     PENPYYGRLDLLMSEEEVKYHMKHSEILLKLFNNSILKHLPEELQAVNDTEGSISMVD
                     EPNWHKTVFILVCGGVIDETGTDSKLTTDEDGKPCYSVIIEDLNEEIYLLIGAVYVIR
                     YSVIKDLMNEGRVILI"
     gene            <465002..>466708
                     /gene="PAC11"
                     /locus_tag="KLMA_20211"
                     /db_xref="GeneID:34714689"
     mRNA            <465002..>466708
                     /gene="PAC11"
                     /locus_tag="KLMA_20211"
                     /product="WD repeat-containing protein PAC11"
                     /transcript_id="XM_022817815.1"
                     /db_xref="GeneID:34714689"
     CDS             465002..466708
                     /gene="PAC11"
                     /locus_tag="KLMA_20211"
                     /codon_start=1
                     /product="WD repeat-containing protein PAC11"
                     /protein_id="XP_022674544.1"
                     /db_xref="GeneID:34714689"
                     /translation="MDKDDRIQLMKQKIQALQKQREKIDTDGSIPFVSHITKAINVND
                     NPVQAAKTTETVSISVQTDVIEETDSKLTEPSVITYDVGIQTDEYEDNENTDARNVNI
                     PVDIIPEKQEEQVQVIQQEENRLLKSEAAVINEKDMTFKKETFSLKESLEATLETSFK
                     QLNDDLQFNLVQKIETNIPIGDVSNVYSVDSDIFDNFLVSVIHIESKYVKSSSVQVSH
                     VLSGEVLDTVVFQGQNIMRCKFIHNSNSKITSILLTCYTGKIILYELRTIKINGNFKI
                     ERNIISKNYHNYPVFSIIPQKFNTHAVLLASTDGQLKSVSTLDLSLKSENNIKITPLP
                     RTDLLYSKENTDKDTRYMDHLITMSLYDELSILCMLTLPTDPSFIYLGCEDGFIFKIG
                     PLPLKADKKANYQISKDNNGFLPMSFQADYENDSLFHEGPVLGMCACKDIDGVFFSYS
                     LDGTCIFWDTINNKRIAVIEMDDTIISGHWIENDDAYFAGLLSPSSLRIFKVLPKTKE
                     KENLRLSDDNFSQVINISPNDTSLSEFRSVQFLTKDDTHLVLLSGDDNSVYCYVIKDL
                     NV"
     gene            469443..469516
                     /locus_tag="KLMA_R210"
                     /db_xref="GeneID:34718656"
     tRNA            469443..469516
                     /locus_tag="KLMA_R210"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:34718656"
     gene            <469869..>470939
                     /gene="HST2"
                     /locus_tag="KLMA_20212"
                     /db_xref="GeneID:34714690"
     mRNA            <469869..>470939
                     /gene="HST2"
                     /locus_tag="KLMA_20212"
                     /product="NAD-dependent deacetylase HST2"
                     /transcript_id="XM_022817816.1"
                     /db_xref="GeneID:34714690"
     CDS             469869..470939
                     /gene="HST2"
                     /locus_tag="KLMA_20212"
                     /codon_start=1
                     /product="NAD-dependent deacetylase HST2"
                     /protein_id="XP_022674545.1"
                     /db_xref="GeneID:34714690"
                     /translation="MTSEGVRSIKTLAKYLKENPEAKAIFMVGAGISTSSGIPDFRSP
                     ETGLYHNLSKLNLPYAEAVFDIDYFKKDPKPFYTLAEELYPGNFKPSPFHCLMKLFEE
                     KGRLKRIYTQNIDTLEREAKISQEYIVEAHGSFASNHCVECGKEFPRETFEKKLAFYK
                     GKEGEEEEELYAKCDECDGLVKPKIVFFGEGLPTEFFETWDLDSSLEDEKIVCIVGGT
                     SLSVFPFASLPMEAPEGWQRVLINREVVGDFKKSKGTKKSKGKLLEKSRRSSDLIYQG
                     STDDAAFLLASELGWLDELEKLSGKEFAKDIKESTTEEKEEEQKQEAEEQEKEEEEEE
                     EEEFVDASEDLVSELAGLSIKE"
     gene            <470936..>473593
                     /gene="MSH4"
                     /locus_tag="KLMA_20213"
                     /db_xref="GeneID:34714691"
     mRNA            <470936..>473593
                     /gene="MSH4"
                     /locus_tag="KLMA_20213"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817817.1"
                     /db_xref="GeneID:34714691"
     CDS             470936..473593
                     /gene="MSH4"
                     /locus_tag="KLMA_20213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674546.1"
                     /db_xref="GeneID:34714691"
                     /translation="MNRTVTTASFARWAFESSTVDSTSNSTEYGSNNSSRNTRSAVKT
                     REMNNTRRIISKQPTIDELTHSKYSKSYSCSVGRVLQTRQSKGSSRYTARSKKQNATA
                     TDLAAAPERTIFSLYESGKNADTRVGICIISFATAEMHVCEFIDTQVFIKTLNMLHVS
                     QPTDILIPSHSLSGKVTKLATLIKYNVSRSSKVTEGVSKVYKAQDGLDVVENLALTMM
                     NKSSVSFKEQLSGKEFALMAVSGAANYMEHISRLDPALDFKNFRVKVDNGENTMLIDL
                     KTIKSLELVENSLEPNGMSLLKALDFTVTKMGRRALRSNILQPLTDASSLNQRVAAIK
                     ELQTDMDLLNSVRSELKVLHDLDGLFSKLLSIDRMIISPEQKVNYVILIKESIETMAS
                     LNIVLENTDYESDILNEIFNVLKSRDIITISATINQFINEDTRWASTNIDLQNQKVYA
                     VKSGSNNLLDVLRQLYKSLTDDIMSEIQRLRDTFGLNFSHGYDYNRQFFLKIKRKDLE
                     NGHELDCCFINRIEKKSVVEFTTLNLMKLSNRLAELNSEILTLSEQVVTELLIKLSSY
                     MSVFFMLSEAVTALDLLCSFAKLGLEKAWCLPSFGSKLSLKSARHPILESVLPDFIPN
                     DMEAVPNLSSFQILTGCNMSGKSLYLKQVALLNIVAQIGCPVPCNEACFPIYHKLHAR
                     LCNDITEVNSSSFSTEMKEIAYYIDDVTDKTLMIIDELGRGSSINDGFSISLAISEYL
                     LSKKATVFLSTHFRDIAKILSAKPCVLHLEMKAEVDDSDLKMTYKASRNMQEIDGYGM
                     KLCKKLFADDIILEAAKISELLKASRKKGLKIVETEDQEDLEDNYSQLKHVHYLVEHL
                     KEIQSRKTPVNAQELIDLQNEFISTFEIV"
     gene            complement(<473654..>475321)
                     /gene="ULP1"
                     /locus_tag="KLMA_20214"
                     /db_xref="GeneID:34714692"
     mRNA            complement(<473654..>475321)
                     /gene="ULP1"
                     /locus_tag="KLMA_20214"
                     /product="SUMO protease ULP1"
                     /transcript_id="XM_022817818.1"
                     /db_xref="GeneID:34714692"
     CDS             complement(473654..475321)
                     /gene="ULP1"
                     /locus_tag="KLMA_20214"
                     /codon_start=1
                     /product="SUMO protease ULP1"
                     /protein_id="XP_022674547.1"
                     /db_xref="GeneID:34714692"
                     /translation="MSVSYHRKGQEPSVDHSRSTVITTDVSSKPYYFERKEIHGPETE
                     SNEVKNKVGWRSSPYNSVLSSIFSSAKSWFSWGEPGSDVSSSDSIKEGSVDENLKRNL
                     DENDGSRVLKRYHVDSILTEKEHLREQLEHSITPKKEILKLPKDPFKWSSDESGKANF
                     DQSPSKVQYGTRLYKKRAYKNKHSSNSLALRQSDELSYLKDIFNGEYRVPVEVQKERA
                     NQLRLLSNDANVSSRSSSSNSSNNIMNLTEKIKTLLLENRRLITGPEGKGTSSDDDVV
                     IIKERKIDPLEEKRKQIYRQTLKFDRSVLSFEEEFKSYSELIEERRKIAEEIRKLSKP
                     AKPEKLIPELSSKDVEAVKATLRRSDNSVLSSKYTLEVSVRDFKTLAPNRWLNDTIIE
                     FFMKYIENNTPKTVAFNSFFYSTLANRGYQGVRRWMKRKKVDILDLERIFIPVNLNDS
                     HWTLGIIDIKNKRILYLDSLSSGANSVSFLIMKNIQSYLIEESKNKLGKDFELCHLDC
                     PQQPNGSDCGIYVCLNTLYMSKNYSLDFNAQDAVNMRVYIGHLILSK"
     gene            <475939..>478308
                     /gene="BAS1"
                     /locus_tag="KLMA_20215"
                     /db_xref="GeneID:34714693"
     mRNA            <475939..>478308
                     /gene="BAS1"
                     /locus_tag="KLMA_20215"
                     /product="myb-like DNA-binding protein BAS1"
                     /transcript_id="XM_022817820.1"
                     /db_xref="GeneID:34714693"
     CDS             475939..478308
                     /gene="BAS1"
                     /locus_tag="KLMA_20215"
                     /codon_start=1
                     /product="myb-like DNA-binding protein BAS1"
                     /protein_id="XP_022674548.1"
                     /db_xref="GeneID:34714693"
                     /translation="MSLVSEGKVSSSGAGDESNDFGGDGSHGSMRKKMKKEPVNALEV
                     SESLGYQTFRRKMRKIWSKDEDELLRRLVNEALVKLGFVDGIKSIKNIEQSSEAAKKI
                     PWDELAEREEFENKRATDVKKRWTSSLDPVLRKGKWTPEEDELLLKSYEEHGPQWLKI
                     SYVLKHRTEDQCAKRYIEVLDPSTKDRLRPWDEEEDVLLIAKVKKYGTKWRQISTEMD
                     ARPSLTCRNRWRKIITMVVRGAASEKVKSAVQAGNTDAAQELMDLKAESDKEERNASR
                     SGSVSPSDEQKIPPPLPQQQLEPQPQPQPQPEPQPQSQPQSQPQSQPASQTASRPVSR
                     MASPQDSVRSAHSDSKKEESSPMVFSKTNAAASLLNSLKNSRSPAIPNANANTPDQSS
                     VLNSFRSPSPQFPSNQTHASLLSDHHGVKKDSALPSPGNFLHIPIAEPKRQQPETTVD
                     WKFTLKESSGHTLSNGVISDMYLVKQLIEHAKSNDLKISIHQHIHNHYLAPRQASPPP
                     LMVHQHPRAGTNSAQELPRIRSPSFSDLDADFLAKTPNFQTWSLEEENPSPYGLNDKL
                     QRFYHHHHHHHHDSQVQGNTNGNNVPVPMNTASSNTSYASPAPPEIREIGPSRHSHFN
                     YLPPTLKPQLGSSESTKPIELSRLLNPSPGSSYNNKKRRSKRKHKSDSRNSSAAGSTG
                     NTPGDDSASRNKVTPSSRSSLSVMEEDGNDFWENLRSLGGNIGGVQESPNMSNMNELF
                     QGNGNADTPSGYDAIFKLVEQGHSQSQSHSQDQQQGTEEASAEFTFNPS"
     gene            complement(<478457..>478977)
                     /locus_tag="KLMA_20216"
                     /db_xref="GeneID:34714694"
     mRNA            complement(join(<478457..478744,478960..>478977))
                     /locus_tag="KLMA_20216"
                     /product="DUF1748 super family"
                     /transcript_id="XM_022817821.1"
                     /db_xref="GeneID:34714694"
     CDS             complement(join(478457..478744,478960..478977))
                     /locus_tag="KLMA_20216"
                     /codon_start=1
                     /product="DUF1748 super family"
                     /protein_id="XP_022674549.1"
                     /db_xref="GeneID:34714694"
                     /translation="MLLFHRYTELLRIHRFVVFGENTASVLQSNQIGKTIHLAIDAVL
                     VSTCLAGIKRNTGLTPKVDQIGDETVREYSTKYLNLGESAYDYTVATLGSSSYFKRK"
     gene            <479107..>479649
                     /gene="COA1"
                     /locus_tag="KLMA_20217"
                     /db_xref="GeneID:34714695"
     mRNA            <479107..>479649
                     /gene="COA1"
                     /locus_tag="KLMA_20217"
                     /product="cytochrome oxidase assembly protein 1"
                     /transcript_id="XM_022817822.1"
                     /db_xref="GeneID:34714695"
     CDS             479107..479649
                     /gene="COA1"
                     /locus_tag="KLMA_20217"
                     /codon_start=1
                     /product="cytochrome oxidase assembly protein 1"
                     /protein_id="XP_022674550.1"
                     /db_xref="GeneID:34714695"
                     /translation="MLGRSIAGRLRIPVGRVSFQRFMASKEPEIVLKDKLRPLRIDRE
                     LPDPTKDVNKRRLQFVAFLGLMGASLAMIFNYEKTQSPVISNTLYHMRRSPKIREVLG
                     DQIDFDGLVPWVSGELNQVSGDVNIKFYLKGSKGKVGEVKLVADRENQRQEFLIHEWS
                     VQVDGKKYDLLAENGATRTL"
     gene            complement(<479897..>480967)
                     /gene="SKG1"
                     /locus_tag="KLMA_20218"
                     /db_xref="GeneID:34714696"
     mRNA            complement(<479897..>480967)
                     /gene="SKG1"
                     /locus_tag="KLMA_20218"
                     /product="suppressor of lethality of KEX2 GAS1 double null
                     mutant protein 1"
                     /transcript_id="XM_022817823.1"
                     /db_xref="GeneID:34714696"
     CDS             complement(479897..480967)
                     /gene="SKG1"
                     /locus_tag="KLMA_20218"
                     /codon_start=1
                     /product="suppressor of lethality of KEX2 GAS1 double null
                     mutant protein 1"
                     /protein_id="XP_022674551.1"
                     /db_xref="GeneID:34714696"
                     /translation="MTDGTVGIAVGCAVGIPIGVGILVALFFWYRMQQRFKQEMKEDQ
                     MSNYNYNYDEEMSLSGNGMLQTEVKEPQGVTHASSDETASSSEEKKACGLKDEGAGHG
                     QGQGQEQGESQGSGSQKQGKRRLYTPAYRKRLQQTVHSINNGARAGEFESNNSKSTST
                     SINSVDTPRKQSNSQVNIFDQMIPVLPDQTASASGSLFDQDSLPKRNTSNETLLKTIQ
                     GHGSGAYPRRGSSTLIHTANNAAPALSSRHSMTSLHTHLSSASLNSKAMPENVFETPK
                     SARVASPALPVPGTQQQNIETEADSQGDREQEQYRLQNNYDIRDATHIAEEDQYENEF
                     TNYSENKREFIDSLRPKIQDGN"
     gene            complement(<481557..>485510)
                     /gene="BNR1"
                     /locus_tag="KLMA_20219"
                     /db_xref="GeneID:34714697"
     mRNA            complement(<481557..>485510)
                     /gene="BNR1"
                     /locus_tag="KLMA_20219"
                     /product="BNI1-related protein 1"
                     /transcript_id="XM_022817824.1"
                     /db_xref="GeneID:34714697"
     CDS             complement(481557..485510)
                     /gene="BNR1"
                     /locus_tag="KLMA_20219"
                     /codon_start=1
                     /product="BNI1-related protein 1"
                     /protein_id="XP_022674552.1"
                     /db_xref="GeneID:34714697"
                     /translation="MAKDEESISILFPLRSASTNVPTANARMRFTNDSYDDLVIQGLN
                     LVGTGLKPRSKTLKYLKSNNFSTPNVDAIHEKRDENVFKSDDTGSSSPRDDVLPSHDE
                     IDAEFDALLDGHAFLGVAKQNLKTLSYTRKWELIKKEKRLHAPKEAQEDPRVRNLRMI
                     LGSLQRRTGVTETLYQLERQLRNSRFITLFVEGDGVGVLNECVDCIGKKSQYVYLCCY
                     KALLNDPEARSAVFRNTEWISYVFVLLVTLDADLRVRLLSTQIIILLTYSTEWSDSLL
                     ESLEPLYESWVQAVEKTLQDPDEHASNNALILPKPKQMLIEYSISTLLLIKSIQQLLP
                     SNESKLSCFKKLKTAGIHRVFRLMRELDHEDLIEQIDDYINLELKVQQKVFSNDSLPE
                     VSYGPQIKSLVESTKDTSLEKPVSNIIETVLDLVNSRTTAESMKLFSVFNSILKYLSD
                     HSLGDGSVDETDSEKIFMTSLDHIMDNLQSHQIANRAMEELDQKKKEIEDLKSELQLL
                     RDEKQVSKGDLLQELDIKEHALHSQQLLIKELQNRLKIVENQLKKEKKQLDLTIAHRD
                     SSDRTANRSVSLFETLKESNSPRRSASLSKSKRLTSLSALAHQGQTNTNTDNRKNKYV
                     NIRSPFNISNNNSDENLSISPISQPKHHRANLSSGIEQNGNDVASASETDVPSASTAF
                     SPASYGFSASESTSVPFAASKIPHDTKHSEAYGSVPAPTTASASATASAAVPAPPPPP
                     PLPPQLVSAATAAPPLPPPPPPPPPPPPLPPSLDKSKADTPEKGNESEKAKDDANVPP
                     APPLPPPPPPPLPILKDNNSVVAITEPKKAPKALKQIHWEKIDNIKDTLWNDSDIRSD
                     IKEDLDEKGVFNEITNLFEQKVVPIKKKQSRITNRGAAHVSILSRDLAQQFGINLHMF
                     SSYSVEQLLQKVLRCDDDIIKNHSVLEFFNKDDFESIPQSVVRSFEPYSTDWNTGKKP
                     QEDVTKLQRADRIFLELFYNMRYYWKIRSLALLTALTYEKDYYDVLYQLQKIDDATQM
                     LKKSSRLKRFFYIVVEIGNFMNHKQTAGIKLSSLTKLSMVKSSSDKNLSFLHVIERIV
                     REKYPDVYEFTGDLERLTDVGKISIESVEAEVRDFYDKIMRIRDSFERGKLSHTEMHH
                     PDDKFRKKISLKLPSAIRKADLLNNQCKLTIAEFTRVMKYCGEDPANPDSKNNFFNNF
                     SEFLALFQKVSQENKEKEAMDHVYHQRQLLLQKAASRSTPDEEQLTDTVDLLMKRLRK
                     ASTDSSISTTTTNNNNSSPTDSTSPEKRKTSRVSSEHDRTLLTRALTLKSGIQKL"
     gene            <486389..>487624
                     /gene="POT1"
                     /locus_tag="KLMA_20220"
                     /db_xref="GeneID:34714698"
     mRNA            <486389..>487624
                     /gene="POT1"
                     /locus_tag="KLMA_20220"
                     /product="3-ketoacyl-CoA thiolase"
                     /transcript_id="XM_022817825.1"
                     /db_xref="GeneID:34714698"
     CDS             486389..487624
                     /gene="POT1"
                     /locus_tag="KLMA_20220"
                     /codon_start=1
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="XP_022674553.1"
                     /db_xref="GeneID:34714698"
                     /translation="MASRLTQLQQHLTGQGNHGSHGSQKESVTGKTPDDVVIVAAYRS
                     AIGKGFKGGFKDVNSDYLLAQFLKEFLSKVDIDKSLVEEVACGNVLNFGAGATEHRAA
                     MLATGLPYGTPLVAINRQCSSGLTAVNDISNKILAGQISVGLAVGVESMSKNYGKTAL
                     GTISEELKSDKSAASCLIPMGFTNENVAKKFGISREEQDRFALESFRKAEKAVSNGLF
                     KDEILPIELPNGTKIDRDEGPRTGVTLESLQKIRPAFVKETGVTTAGNASQISDGVAG
                     VLLMRRSMAMKLGLEIIGKYVAFQAVGVPPEIMGVGPAYAIPKVLKQCGLGINDVDVY
                     EINEAFAGQALYCVKTLGIDNEKLNPKGGAIALGHPLGATGARQVATILRELKPGQIG
                     VVSMCIGTGMGAAAVLVKE"
     gene            <489233..>490897
                     /gene="THI72"
                     /locus_tag="KLMA_20221"
                     /db_xref="GeneID:34714699"
     mRNA            <489233..>490897
                     /gene="THI72"
                     /locus_tag="KLMA_20221"
                     /product="thiamine transporter"
                     /transcript_id="XM_022817826.1"
                     /db_xref="GeneID:34714699"
     CDS             489233..490897
                     /gene="THI72"
                     /locus_tag="KLMA_20221"
                     /codon_start=1
                     /product="thiamine transporter"
                     /protein_id="XP_022674554.1"
                     /db_xref="GeneID:34714699"
                     /translation="MGLLHRIDKFLELDGSNNMQNKDIVPIPINRRKWGYTGYISYWA
                     IMNLCPVTWSVGASLLTVGLNGAHAMGTVVVGNFIVCLATIIAAVYGSNYHIGFSVFQ
                     RVVFGIRGAYYGVLVRSILSVVWFASQSYLGGLCVNLVLSSWSKSYMNMKNHFPDSVK
                     MTSQELIGYVIYLIITVPSLMVPPEYYDYILATSSAATFFCGLGITIWAVKENGGSGT
                     LMNTPITLSSSDFGWMWMYGINSWYSSLVAGIANQSDFSRFNKKPIHFYLGTLIGNTL
                     SGFIVPLFGIICASALEEKYGVELWKPNDIGMFWLQNDYSPSRRAGAFFSGIALVYSQ
                     LAICGIGNAISGGMDLSTIFPRYINIRRGAMIILILVWPTQPWLFYNSSSVFISVMSS
                     FSVFVTPMVAVYICEYFLVRRCIIKLSDCYINSSKSIYWYHQGINWKGIVISILGSAP
                     GLPGLINAANPKIKISRGIENFYYGSFIFQFVTTFAMYAIVSFIWKPEVGTRDNVDYF
                     NTYTEEECMKLGIIPYNGQLPEDISETESDEYKKDLVVQTVKHQKE"
     gene            complement(<491702..>493708)
                     /locus_tag="KLMA_20222"
                     /db_xref="GeneID:34714700"
     mRNA            complement(<491702..>493708)
                     /locus_tag="KLMA_20222"
                     /product="cd12148 family transcription factor"
                     /transcript_id="XM_022817827.1"
                     /db_xref="GeneID:34714700"
     CDS             complement(491702..493708)
                     /locus_tag="KLMA_20222"
                     /codon_start=1
                     /product="cd12148 family transcription factor"
                     /protein_id="XP_022674555.1"
                     /db_xref="GeneID:34714700"
                     /translation="MDVSGFGKKRKTSYSRKGCLQCKKSHLKCDEGQPKCGKCIKRNI
                     QCTYQLSLVFQDVSELKMKTLPVVHSVMNNNVEGEIRLQELRQQQQQQQQQQTSSSSS
                     SSSFSDGQGLGRVGKRTHSSPYTRLVDMSDFKLQNFVYVSPSDASLLKLPSDDGKAGA
                     DAETDPETDPDTDADANANANANANANANVLARGSVPLLKEYNINWRNFAWVDMLQLL
                     EKEDPCQEVYQGPQPALPALLAADDDSLVNSPKLNSFIWRFATTTLIAGNFLLFPSDR
                     FDVLMSILWKLNQKHTIIQDAIRYDISVFMQDVYGKAHLSQFAQVWDQRVRAVSFKHV
                     LGIINERIKYSQDFVEYVCLTFTVFLMFFANSALRSNLWRTHLRGCQHLLIRASILMP
                     KGPLTELEQNAREVYTILRDWFCYAVTTASLASNYGITLIDISEFTRSTFLSKSSPLA
                     IAGNGFSILRGMSNNLNMVYFKVLTKTFDMRDNGIDITGLNIIVFKLNRTTSSLLPQL
                     SAFGRETLNELQHSAVLDENLEISLSDVNDLRLRFSMISSHNMFFLLLELYLKVYFID
                     KDPTTPEIKSILYKMVKTAYSNPYYSSCGVCCHPSLFIGGLTCILARDDFLYFHFIDL
                     LSKIADTGMAVAQNSIDKLNAIRSKIALGNFQNIIDPDHDFIPI"
     gene            <495745..>497121
                     /gene="DSD1"
                     /locus_tag="KLMA_20223"
                     /db_xref="GeneID:34714701"
     mRNA            <495745..>497121
                     /gene="DSD1"
                     /locus_tag="KLMA_20223"
                     /product="D-serine dehydratase"
                     /transcript_id="XM_022817828.1"
                     /db_xref="GeneID:34714701"
     CDS             495745..497121
                     /gene="DSD1"
                     /locus_tag="KLMA_20223"
                     /codon_start=1
                     /product="D-serine dehydratase"
                     /protein_id="XP_022674556.1"
                     /db_xref="GeneID:34714701"
                     /translation="MSGITPSQRYPLEKDVRETLLAAYNGKHYKELPTPALVVKKPQV
                     DANITSLLNAIDSINSHVARPVKYRAHIKTHKTIEGTRKQLGYDLPGYKGPIYSSIVV
                     STLREAYLVLDYQAQAQAQAKAQAQAQAETGGPNIVTDMLYGLPACVPDIVPELYAIS
                     EKVDHFRIFVDNVYHIEVLQKFAQETQLRDPKFKWSVFVKIDCGTHRAGVFSQHDLEI
                     LLRRLFEAKDYIELYGFYAHAGHSYAKTSLVDNEAVLKEEIEYVNRACESVLSLDASF
                     PVSSLVLSVGASPTARAFENSSNIPALVSYIDSLHGTLELHAGNLMISDLQQVATGSI
                     VEKNVASFVLGTVISQYPQRGNPVGEMLTNTGVLSMTKEVSSKAPGYGLVVSDPEYGQ
                     WYLQRLSQEHGILQPLDIDTCKLLPHGTKVDILMQHACITMACFGHYFVIDDKGIVID
                     VWIPCRGW"
     gene            <497643..>499286
                     /gene="CDC20"
                     /locus_tag="KLMA_20224"
                     /db_xref="GeneID:34714702"
     mRNA            <497643..>499286
                     /gene="CDC20"
                     /locus_tag="KLMA_20224"
                     /product="APC/C activator protein CDC20"
                     /transcript_id="XM_022817829.1"
                     /db_xref="GeneID:34714702"
     CDS             497643..499286
                     /gene="CDC20"
                     /locus_tag="KLMA_20224"
                     /codon_start=1
                     /product="APC/C activator protein CDC20"
                     /protein_id="XP_022674557.1"
                     /db_xref="GeneID:34714702"
                     /translation="MDKNSQLSAKHSMLSLTSPTKLHVIPNDNKVVKRKAKKTLGNIT
                     NSINRPKLINKGGIPPLLRRNSSFFREESPVHESLTGALYSTMEQSEANPDRFIPKVQ
                     HSQNTKCVDLEEDPEEIRPPPNASPSKHLSAQTKKMFKQKVANACGLDMNQRILQYMP
                     LPPQPSLDRPIFSIGSRQTYNFDSKSQRLAKLRKINTNPERILDAPGFQDDFYLNLLS
                     WSKKNVLAIALDNAIYLWDGDSGDVNLLVELNEKCSSLTWSDDSCHISIGKNDGNVEI
                     WDAETMTHVRTMRSGLGVRIGSQSWLDTLCVTGSKSGEMQINDVRIKNHIVQTWDRHQ
                     GEVCGLSFREDGIQLASGANDNTVMIWDTRQNNDPIWTKRNHKAAVKAISWHPEITNL
                     LASGGGSLDKHIHFWNTTTGNRLGSIDTGSQVSSLHWGQSYSKHSNSMNTEIVATGGT
                     PNNCITIYNYETKFKVAEIPQAHDSRIVSSQLSPDGTTIASVGGDENLKFYRVFEERR
                     RKRHLEDRTRGFTDKLDTKSHDDDDNTQRSPSKSTYIIR"
     gene            <500239..>501228
                     /gene="SNF4"
                     /locus_tag="KLMA_20225"
                     /db_xref="GeneID:34714703"
     mRNA            <500239..>501228
                     /gene="SNF4"
                     /locus_tag="KLMA_20225"
                     /product="nuclear protein SNF4"
                     /transcript_id="XM_022817831.1"
                     /db_xref="GeneID:34714703"
     CDS             500239..501228
                     /gene="SNF4"
                     /locus_tag="KLMA_20225"
                     /codon_start=1
                     /product="nuclear protein SNF4"
                     /protein_id="XP_022674558.1"
                     /db_xref="GeneID:34714703"
                     /translation="MPTNSGEVHHSVDEQAIAMEQKLAVQSIRVFLQSKTSYDVLPVS
                     YRLIVLDTSLLVKKSLNILLQNNVVSAPLWDAQTSRFAGLLTSLDFINVIQYYFHNPD
                     KFELVDKLQLNGLKDIERAIGVQPYDTRSIHPFKPLYDACVQMIESRSRRIPLIDQDE
                     ETHREIVVSVLTQYRILKFVALNCKEIRYLKRPLRDLNIISRNNIMSCQMSTPVIDVI
                     QLLTLAGGVSSVPIVDEKGKLINVYEAVDVLGLIKGGIYNDLSLSVGEALMRRSDDFE
                     GVFTCTENDKLSSILDSVRKSRVHRFFVVDSEGFLTGVLTLSDILKYILFAEA"
     gene            <501830..>504085
                     /locus_tag="KLMA_20226"
                     /db_xref="GeneID:34714704"
     mRNA            <501830..>504085
                     /locus_tag="KLMA_20226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817832.1"
                     /db_xref="GeneID:34714704"
     CDS             501830..504085
                     /locus_tag="KLMA_20226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674559.1"
                     /db_xref="GeneID:34714704"
                     /translation="MDGEDTSWDSKPWMKQVTLRSTIVGLVIGSLVLVSNFQFGLQTG
                     WVSMMSLPSALLACAIFKQVWPLVFPNDSEFSDVENVYVQSIAVAVGTGPLAYGFVGV
                     VPAIEKFLTTEESGGTRVMGQEFSLVELLIWSSALAFFGIFFAVPIRKQVIVREKLPF
                     PSGSATATLISVLNGSEILQEVSPKELVAMKERRLREYAEVLCNDTDYEDDSENNCES
                     TPLLRAGSDQMNAYASGDANESSSAGASGNAVTNATDNPNPDAIANPVPNQLSPSYSK
                     GVPTYKENVSILTKTFCASALYTVTSYFVPAVKSIPVFGNYAAKVYLWSIEPSPAYIG
                     QGIIMGLPTVSYMLLGCFLGWAVLAPLSRHMHWVDPNADVHDWESGFQGWIIWTSLSI
                     MVADSVVGFIVFTIRTVIRFVLLDDKMEMFNSVLDDSIQSMLLEEERVLNDSRGRHEN
                     TVKLVSTEVDHDVDSRHLVTYTTVLSGLVVSSLLCVIIMIYLFGIDIIPLYSIITALI
                     IALFLSILAVRALGETDLNPVSGIGKLSQLIFALIIPSNHKGNVLLNLVAGGVAEAGA
                     QQAGDLMQDLKTGHLLGASPKAQFIAQYIGATWSIVLSSLVYKLYNKIYTIPNQQFRI
                     PTAVVWIDCARLVTGKSLPDKAMECSLVFGIIFAILSLVKNTLRERGFKWLLWVPSGV
                     AVGVGIYNSPSFTIERFAGGLLAHIWLRKHRGNPDAKTKMIVFSSGLVLGEGIFGIVN
                     MFFTSIGVPHF"
     gene            complement(<504158..>505105)
                     /gene="SWC5"
                     /locus_tag="KLMA_20227"
                     /db_xref="GeneID:34714705"
     mRNA            complement(<504158..>505105)
                     /gene="SWC5"
                     /locus_tag="KLMA_20227"
                     /product="SWR1-complex protein 5"
                     /transcript_id="XM_022817833.1"
                     /db_xref="GeneID:34714705"
     CDS             complement(504158..505105)
                     /gene="SWC5"
                     /locus_tag="KLMA_20227"
                     /codon_start=1
                     /product="SWR1-complex protein 5"
                     /protein_id="XP_022674560.1"
                     /db_xref="GeneID:34714705"
                     /translation="MPEKEELKKTDDLPGLEFDEDSYHESEDEDFDPNKELDTSTGGL
                     PASNSIKGSDIGSPENSDSDADGSFNDEDNEEEKKYNSIVSESGGLIKTRRARLQEEQ
                     DALKNKYEKLDVGETSEGSLDLWAKLKQRAYERARFNGSVMDHEAGSVTDSTEETKIL
                     IERTYVFAGEVIKEKKWVPRHSAAAQEYLNSIKFKNDKKATNNGDQKQQSQQQSQQKR
                     PQGKNDSGLPLKRHLKRPPILEQIISGALKPKLTTLEKSKLDWATYVDKEGIHEELNL
                     HNKDGYLAKQDFLNRVESSKDEKYREIRKLQLLQSEQQK"
     gene            <505398..>506645
                     /gene="PBP2"
                     /locus_tag="KLMA_20228"
                     /db_xref="GeneID:34714706"
     mRNA            <505398..>506645
                     /gene="PBP2"
                     /locus_tag="KLMA_20228"
                     /product="PAB1-binding protein 2"
                     /transcript_id="XM_022817834.1"
                     /db_xref="GeneID:34714706"
     CDS             505398..506645
                     /gene="PBP2"
                     /locus_tag="KLMA_20228"
                     /codon_start=1
                     /product="PAB1-binding protein 2"
                     /protein_id="XP_022674561.1"
                     /db_xref="GeneID:34714706"
                     /translation="MVEEELETLEPVYSPNSLKRKPDRESLEAGIKRVALEDNECENE
                     TENGSKGEEISNYINMRMLCLMKQASKVVGGKGDRVNKIKAETNTRINVSDNINGVIE
                     RVIFVRGKCEEVARAFGKIVRAINNESDDDSNEKSLPLVVNLLIPHHFMGCIIGRQGS
                     RLHEIEDLSAARLIASPQQLPMSNDRILSLTGVADAIHIATYYIGQTILENEPKLKNK
                     KSIFYHPGPMHSVLVNNYQMYVVYPNGAPSNTSLAPISPDGIPISVPGAAHQEHHQYH
                     PMDKRMMNRRTKPVITKAPMNGSQRLAQPYADIIESCKHVRIPLQPSLHGMSPHLVTP
                     QEVFIDNKFVGNVIGKGGKNIQQIKQSTGCMIKINDPVDGLEERKLVLIGTPLATQTA
                     IMMINNRIDMDKRKRQESMMVIE"
     gene            <507010..>508899
                     /gene="SLD3"
                     /locus_tag="KLMA_20229"
                     /db_xref="GeneID:34714707"
     mRNA            <507010..>508899
                     /gene="SLD3"
                     /locus_tag="KLMA_20229"
                     /product="DNA replication regulator SLD3"
                     /transcript_id="XM_022817835.1"
                     /db_xref="GeneID:34714707"
     CDS             507010..508899
                     /gene="SLD3"
                     /locus_tag="KLMA_20229"
                     /codon_start=1
                     /product="DNA replication regulator SLD3"
                     /protein_id="XP_022674562.1"
                     /db_xref="GeneID:34714707"
                     /translation="MEPSEDPWVLVSSFVKLPPDFEVNRDSVNIIDISSPEFDRVKNQ
                     ISNADVVLKHLLRRGQQNILLERYFQDGWVRWDLQKLPVLDNVGHGIPNYKRQASNHY
                     DFKTLDEWSQLKIEAIFPYWKEDEHRIPDGDLYEQLPLIMKPPKLSNRTEDKSMEKDP
                     VAYVKKKYYEILYSLNIPLAHFVKSKLSRTKVLCKQQGSEYKDVLRSVLVDLSGFDTR
                     YTVDHNGLLNYDDIPEECKTFRKEIIQETLNVDNNVLSKNKDVTTDIASILKVRDIKL
                     QIIILLEIISENNLDGSMKQYEANYENKLSERSLNMVTAVTRFSRRRKKSKADAPKIA
                     KATSAVDYCQHMDILLDKLGIAEALISTEISMQSEQPPANKSIHEYKRGIVDKNKEMS
                     SKGFLGYVVIPYWYKKLPFVVTFISNKIKGPRIENKVPKGNNSSNSASNYNQLRSSSV
                     TSNTSDRSTSPQVPPLLRTRTNSNLIDFLEGETTKKKPTLASRSSSDIKLNHLEKRQM
                     SVQDLSLDEIMKQKQQVLQEFSAVRSVLVNGKSVSFTQSHSNSFQRVGKRKIDSTTLP
                     KTDEKSEDDIHVTATPMKPDEEIKISPIFVASPAVANTNMKSPVKESPIKNKPKRVRR
                     RLFAP"
     gene            complement(<508998..>510560)
                     /gene="TAF6"
                     /locus_tag="KLMA_20230"
                     /db_xref="GeneID:34714708"
     mRNA            complement(<508998..>510560)
                     /gene="TAF6"
                     /locus_tag="KLMA_20230"
                     /product="transcription initiation factor TFIID subunit 6"
                     /transcript_id="XM_022817836.1"
                     /db_xref="GeneID:34714708"
     CDS             complement(508998..510560)
                     /gene="TAF6"
                     /locus_tag="KLMA_20230"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 6"
                     /protein_id="XP_022674563.1"
                     /db_xref="GeneID:34714708"
                     /translation="MSQQQQQQQQQQQSYTIWSPHDTVKDVADSLGIANINEDVLRSL
                     AMDVEYRILEIVEQAVKFKRHSKRSTLTTSDVAKALRVLNVEPLYGFEEGSSRDEAIK
                     FNKLDNVNGQTLYYLDDEEVDFEKLINTPLPEVPRLPTFTAHWLAVEGIQPAIPQNPN
                     INELRLSQVPLQRGAIVSPLNENSVQTSLQTTDDEERQNTANRTVATQVKPGAANEAK
                     PLVKHVLSKELQIYFEKIVSALTNKDDDTNAQRMKAAALTSLKSDTGLHQLVPYFIQF
                     IAEQITHHLEDLELLTTMLEMIYSLLSNQSVFLDPYIHSLMPSILTLLLAKRLGGNGS
                     KSATEDKKSDEQNKKDFLEKTNAVRDFASSLLLHVLKKFPKVHKSLKPRVTRTLLKTF
                     LDINRSFGTYYGCIRGVSVLGNETIRFFLGNLQNWSKLVFEEYDSSPSESVKKGKNLT
                     ELEIKLLANLIVTTLENLKSDLPSSYDSKDEITEEEKTRLKERCGITVSNIILEKEDA
                     RKLYDAIFFGEL"
     gene            <510858..>511106
                     /gene="DAD3"
                     /locus_tag="KLMA_20231"
                     /db_xref="GeneID:34714709"
     mRNA            <510858..>511106
                     /gene="DAD3"
                     /locus_tag="KLMA_20231"
                     /product="DASH complex subunit DAD3"
                     /transcript_id="XM_022817837.1"
                     /db_xref="GeneID:34714709"
     CDS             510858..511106
                     /gene="DAD3"
                     /locus_tag="KLMA_20231"
                     /codon_start=1
                     /product="DASH complex subunit DAD3"
                     /protein_id="XP_022674564.1"
                     /db_xref="GeneID:34714709"
                     /translation="MSSEMTPLQKSVLERYQSLAESLRELKETLSDLNNTHENSKPEE
                     ILQEMREIEVKISLVSTLMKGAVYSLVLQRWADKNPQV"
     gene            complement(<511198..>512319)
                     /gene="ARC40"
                     /locus_tag="KLMA_20232"
                     /db_xref="GeneID:34714710"
     mRNA            complement(<511198..>512319)
                     /gene="ARC40"
                     /locus_tag="KLMA_20232"
                     /product="actin-related protein 2/3 complex subunit 1"
                     /transcript_id="XM_022817838.1"
                     /db_xref="GeneID:34714710"
     CDS             complement(511198..512319)
                     /gene="ARC40"
                     /locus_tag="KLMA_20232"
                     /codon_start=1
                     /product="actin-related protein 2/3 complex subunit 1"
                     /protein_id="XP_022674565.1"
                     /db_xref="GeneID:34714710"
                     /translation="MSDIAAQFKLVKGPIYSHCFNTDRSLLAITYDTDCYVYKIGASK
                     QPQLVAVLPDHDKTVTAVDISVHGRIVTCSQDRNAIVWEPLSNGTYKPTLVLLRINRA
                     ATCVSWASTGYKFAVGSSARIIAVCYYEQENDWWVSKHIKKPIKSTINALSWHANSVL
                     LACGGTDGYARVFSGFIKGLDSKEQVASSPWGEKFPFGSLVREWYQGAWIHDIKWRSS
                     IDHVAYVAHDGSLTIVDYTDSQYSIDNPEGLPFKTLCWINDHEILAAGFSNHPVLFSE
                     GSNGWKLSKILDAPAKAPVRTPAIGSDDADEDENANFGMSALRKFKELDLKGKVSQHE
                     EKSTHENAITELSPYAESNNNVTKVSSVALDGKLVIYKL"
     gene            <512896..>514194
                     /gene="NSA1"
                     /locus_tag="KLMA_20233"
                     /db_xref="GeneID:34714711"
     mRNA            <512896..>514194
                     /gene="NSA1"
                     /locus_tag="KLMA_20233"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817839.1"
                     /db_xref="GeneID:34714711"
     CDS             512896..514194
                     /gene="NSA1"
                     /locus_tag="KLMA_20233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674566.1"
                     /db_xref="GeneID:34714711"
                     /translation="MRVLVASDDSGSLKEIVFNKGTNTSVQTALQPFHLDMHLSQGLG
                     NRVDKMWQVGKLGYVVARHSGSLELISGKRVAKAVDESMSPKYDVSEFEVKDIISGLF
                     KQEVLDKLSSKSKKRTKIEDQFVDLYALPNKKNTLLAATKSGQIIVFKVDVKAWKLSV
                     LAKHEVKAPVEFLVLNDLLEDKEKYTLAYGGEENLVKLIEMSSDLKTVSQVWAAKNVP
                     FDKIGLRVPAWDMALRFIASEKEGVFQMLTVTKYAQYRKYSTDAEDCRPIQSVDLLPK
                     GEQLAYCKILGKTSALGNSVCSNFDDIEFLTADSRRDVYQFNGKGRLLRKIGKGDITG
                     FASCVTVTDKYILQGGLDRYFRVFGLSDYKLLAKIFTGGKISDILLLEEEDLELPLSE
                     KELKQKKKKLAKRKFTEDEEEAENEELWKKLTAKKKKSEK"
     gene            complement(<514283..>516214)
                     /gene="CUE3"
                     /locus_tag="KLMA_20234"
                     /db_xref="GeneID:34714712"
     mRNA            complement(<514283..>516214)
                     /gene="CUE3"
                     /locus_tag="KLMA_20234"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817840.1"
                     /db_xref="GeneID:34714712"
     CDS             complement(514283..516214)
                     /gene="CUE3"
                     /locus_tag="KLMA_20234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674567.1"
                     /db_xref="GeneID:34714712"
                     /translation="MTTMRRYQRVIEVNGREKVSLPIVKFPPFKLRAAMIEKDPVIWL
                     HLLEVYVSHIRYLLHGDNLDFISDQTYDHLCVFTRAYLHEMSDEEGKLLSLGMNSEVL
                     EQLRLLRAYMFQLIKSCGLLYLQISTETLWDIVRVYVAQNPYTVRKLVDGSLKPTINT
                     QKAQLDRTYQIQQHIRNLIEANKFSRVDLKTLELLLNAGPPSKNTFADNFVSTKWVDT
                     LESMYGKEPGSYLSDWGKKLGVLSYLSCSVGNLADLLKEMGVTNLQTLSMYPLLGSLL
                     IDPEFQKRVPMIKSKIGFIDVLESDDSESQSHSKASVKLNAVDESKLSMIKELFPDLN
                     THQITQLLLRYDNNTEIIINNLFENPSIIDSLEDEETVQQEQDIEQQQHQDQSKPYEI
                     SAQEHQRKKTALPTITPQDKIVKKEISFPVNDVPDSIRNKTLSRALALLYDATEDERD
                     DTYDEAEVKQASSSRVSIDIGTKSTGNNEEETHQPETTSKYDQIEGYLWELLKRDKVL
                     FTRQKRGSKQRSDMKKQTGWSDEQIEGWSRMIEKSPKRAQLLEEKYIFKGNVRQGKKN
                     KNYNNTRIEDADTENEEEESKDEKPGGKSKTGNKPNQPVSKEQQKRKNARNEKNKSSR
                     ANHNRKAGHDKKLARSGGP"
     gene            <516448..>519726
                     /locus_tag="KLMA_20235"
                     /db_xref="GeneID:34714713"
     mRNA            <516448..>519726
                     /locus_tag="KLMA_20235"
                     /product="transmembrane amino acid transporter protein"
                     /transcript_id="XM_022817842.1"
                     /db_xref="GeneID:34714713"
     CDS             516448..519726
                     /locus_tag="KLMA_20235"
                     /codon_start=1
                     /product="transmembrane amino acid transporter protein"
                     /protein_id="XP_022674568.1"
                     /db_xref="GeneID:34714713"
                     /translation="MSKFYDLPGSHLPAGSESSPLLTRRKSLTYFRYRDTPVGEQKSS
                     KYDLENPHRNKLGTFNGVFVPTALNVLSILMFLRFGFIIGQMGILGTFFLLGISFLID
                     LLTTLSISAISTNGIVRGGGAYYMISRCLGPEFGGSIGLIFFVGQILNSGMNIVGIVE
                     PLLYNFGATDGVLAQVLPEGHWYEFLYSTVLLLMCLGVALVGSQTVSRAGNVLFWLLL
                     ASTISIPVSVMFVKPFEFNGIIYTGPSFAVLKQNLYPKFTKGAAGSLMKGKETFNDLF
                     GIFFPATAGIFAGAGMSSELRKPSKSIPKGTLWGLLLTFVCYSSVILSLGCSVPRASL
                     HEDVQIIQTVSGFQSIILVGELSTSVFSVIVGMVGAAYVLEAISKDNILPGISIFGEK
                     PTLCLLSSWFLTQLCLFSDVNNIATFITMTFLMTFIVMNMACFLLEISSAPNFRPSFK
                     WFNRYTALLGAILAILAMYVVDNVSASAVISFLCLLFVIIHYFCPPKPWGDVSQSLIY
                     HQVRKYLLRLKQDNVKYWRPQVLLLVDNPRTSWNLIKFCNHLKKGGLYILGHVTVAAD
                     FQSEYQELNKQVRAWMNIRDMAGIKAFVQIGMGPTLAWGIRNVFMGSGLGGMKPNITV
                     IGFFDLKNYLNNKVPQRTGTPSPLRDDIYLKATKNNDRISIDIPSNPGFASLPTDECK
                     NEEKVKLQQWVQVIEDLSLMRSNIAIAYGFKNLQLPKKNETREHKGYIDLYPIQMSAT
                     IVNENSSGEVTTTNFDTYTLILQLGAILTTVPDWHKTHQIRVIVFVENETERSDERKR
                     IENLLSVLRIEAEVLVLSLDQFRVYNTIVKGDPISKQYVDDALKEDDWWNELTEERTR
                     QHPIRKFTSTEPTSVKIDGNHLEKRYDVSKLQRLGVSLTMTSSMPATDMPSNESEYES
                     DYVADTYGSTSTLLNTPGQNNNNLHPVRSMRLRDDASVRTSRPVFSSKAMPKTKVIEE
                     ATGEQPTLVPVVDNSTNGKLRPILHPLSPCQSSSDVIEDTDELTFNQLSSRAQHLVLH
                     DMMSQVSSKSKLLLSTLPLPPLGTHKSEHASLEYVQNIDLWLDGLPPTILINSQSMTV
                     TTAL"
     gene            complement(<519861..>521123)
                     /gene="ABD1"
                     /locus_tag="KLMA_20236"
                     /db_xref="GeneID:34714714"
     mRNA            complement(<519861..>521123)
                     /gene="ABD1"
                     /locus_tag="KLMA_20236"
                     /product="mRNA cap guanine-N7 methyltransferase"
                     /transcript_id="XM_022817843.1"
                     /db_xref="GeneID:34714714"
     CDS             complement(519861..521123)
                     /gene="ABD1"
                     /locus_tag="KLMA_20236"
                     /codon_start=1
                     /product="mRNA cap guanine-N7 methyltransferase"
                     /protein_id="XP_022674569.1"
                     /db_xref="GeneID:34714714"
                     /translation="MVLLPEKPVWMSQEQYDEQYGSLLRQKEAEKRMENEGQSTIQEV
                     SKQAPTPPGNIDGKDEEDKVNKARNRKHQRYDLEERKKKQRLQKTIEEQLKHHDIEMT
                     ANRIVNVDQVVREHYNERTFISKKHNRNYSPIIKLRNFNNAIKYMLIDKFTRPGDVVL
                     ELACGKGGDLRKYGAAGISQFIGIDISNASITEALKRYHSMKNLDYQVILITGDCFGE
                     SLGVAVEPFPECRFPCDVVSCQFALHYAFETEEKARRMLLNVTKSLKMGGYFFGTIPD
                     SEFIRYKMNKIPETVEKPSWGNPIYKVTFANNEYQKNDNEFPSPFGQMYTFWLEDAID
                     NVPEYVIPFESFRSLADEYGMELELQKGFNEFFVEEIPAWVNRFSPRMREGLKRSDGR
                     YGVEGVEKEPAAYFYTTFAFRKVREYQE"
     gene            <521606..>524059
                     /gene="PRP5"
                     /locus_tag="KLMA_20237"
                     /db_xref="GeneID:34714715"
     mRNA            <521606..>524059
                     /gene="PRP5"
                     /locus_tag="KLMA_20237"
                     /product="pre-mRNA-processing ATP-dependent RNA helicase
                     PRP5"
                     /transcript_id="XM_022817844.1"
                     /db_xref="GeneID:34714715"
     CDS             521606..524059
                     /gene="PRP5"
                     /locus_tag="KLMA_20237"
                     /codon_start=1
                     /product="pre-mRNA-processing ATP-dependent RNA helicase
                     PRP5"
                     /protein_id="XP_022674570.1"
                     /db_xref="GeneID:34714715"
                     /translation="MDQSEKLKLRQEKLAKWKKQKQEQSQQQPPPQQAKDGSLANERL
                     KRLEAWKKKKEKEKEKQVHQIKKNAPDQSQSSTSKSKKKTRNSKKRSAFGLSDDESND
                     ELPIPKIFKPNDDEVEQEVSTNETGDIESDSDPLEEYIQQLNKRNNGQSTAISIPIEE
                     DGSDTPSSVEEDEESDDDNNFGEFSSLNKNKKRIKPIDYSQVSDLIVLNKSLYREPNE
                     LSMMSEKEVGELRMSMDNIKVYGKDCPKPVTKWSQLGLSSDIMELITEELQFVTLTPI
                     QSQAIPAIMLGRDVIGISKTGSGKTIAFLLPLVRQIKAQPPLRPGETGPIGLILTPTR
                     ELAVQIQEEMLKFSKGSNISSICCVGGSELKQQIAQVKKGVDVIVATPGRFIDLMTLN
                     SGHLLSPTRISFVVMDEADRLFDLGFGPQVKQIMGCIRPDKQCVLFSATFPTKLKKFA
                     SHTLNDPIQISINSKSLINDNIEQRVQIFDEEHVKFEFLLKKLSDRFILHQDEDEKTI
                     IFVSSQQLCDLLYDELLLNGITTFAIHAGKPSAERLQNLQKFKDTPNGILICTEVLSR
                     GLNVPEVSLVIVYNAAKTVAQYVHTVGRTGRGINNGVALTFLMVDELASAYILVKCMK
                     EKELSSLPMEVYQKLKEMNDEFSKGLKTGKYRLIQGFGGKGLEHLDELNESKHSQELR
                     EYSAEQNDEDDTQQEDRTLTKLEYVRGKKEEGNNVTYYAHININDLPQLARWEATKTE
                     TISSIKQETGCNFENKGRFYPEGHAPQSDADEPKLTLIVESNNETDISLALELLEVKV
                     KEGVHKMAIKDMQSGKYRI"
     gene            complement(<524085..>524399)
                     /locus_tag="KLMA_20238"
                     /db_xref="GeneID:34714716"
     mRNA            complement(<524085..>524399)
                     /locus_tag="KLMA_20238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817845.1"
                     /db_xref="GeneID:34714716"
     CDS             complement(524085..524399)
                     /locus_tag="KLMA_20238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674571.1"
                     /db_xref="GeneID:34714716"
                     /translation="MGLCGSKVSKNEGKPLGASNNPGPQSNNNNRKASNKGRPVAEAG
                     TRTGGPNSEPKLSPREAARIAAEERAAKLEAANAKSELSKKLAQERAKSRKAHVMEIA
                     QK"
     gene            complement(<524960..>527008)
                     /gene="RMD9"
                     /locus_tag="KLMA_20239"
                     /db_xref="GeneID:34714717"
     mRNA            complement(<524960..>527008)
                     /gene="RMD9"
                     /locus_tag="KLMA_20239"
                     /product="protein RMD9"
                     /transcript_id="XM_022817846.1"
                     /db_xref="GeneID:34714717"
     CDS             complement(524960..527008)
                     /gene="RMD9"
                     /locus_tag="KLMA_20239"
                     /codon_start=1
                     /product="protein RMD9"
                     /protein_id="XP_022674572.1"
                     /db_xref="GeneID:34714717"
                     /translation="MFRLVQQQTLKTRVQVPNQFVSASRNSLNSQFRFNSAVALDINA
                     SQDPAAAAAAAAGLKSPSDRSSSKGFESNEVIERNVKKVRNLRKNIKFDNFKKSANYA
                     KLNALDDCLARGLEASMARQGDGRYTEHTNMFWDSVNTAMNLYRDLTSMNDLTAMRAS
                     RVIQLLHIALKINRTQLTSMNKKPDYDSQSFHKEMTNYLCESLREISADILGGRVGVT
                     EHGASHLLSSFKELLLYEETLNIWRSAVNSDNKDIVKPFMYPNVVGVVLPLLYENGTS
                     FDEIKTLYEKSANIVPHRQGPSPNLILGMIKTSLAANENEHALALFQEMCTAEGSAAS
                     PYAALTGTHLAFIGECKDLFVAKSFFERALSKEMPYKINLQVSSVKQLIQNIWDQTHD
                     FNEVVDVWVKATRYYGQKVSHGISSSLNSKFISIFFENYVNDKVAGLEHLKELINAYN
                     DMKAIDEPFLNIILTKCTVWKDKNIIESLEKLYELYHIPKTIVTYRIILKAMGSIDVS
                     NEVITDRWIQLIKKADQIGQTYIANADWAALRDATVTYAEKDFQANKKNISANGSAGF
                     GMTRQDSYNPALEAANASGAFDDFNEPCSTGNGQPQTLTGANNSSSSEQDKDDRVLLY
                     YKLVKRYGGYCRDAKQYSRITTGIASNFEVAVQYLPILNSLDVSSMYVPPLTNFQLKH
                     "
     gene            <528066..>528494
                     /gene="MLC1"
                     /locus_tag="KLMA_20240"
                     /db_xref="GeneID:34714718"
     mRNA            <528066..>528494
                     /gene="MLC1"
                     /locus_tag="KLMA_20240"
                     /product="myosin light chain 1"
                     /transcript_id="XM_022817847.1"
                     /db_xref="GeneID:34714718"
     CDS             528066..528494
                     /gene="MLC1"
                     /locus_tag="KLMA_20240"
                     /codon_start=1
                     /product="myosin light chain 1"
                     /protein_id="XP_022674573.1"
                     /db_xref="GeneID:34714718"
                     /translation="MSRINKDIFTLFDKQAKGSISKVQVGDYLRAIGYNPTNALVEEI
                     VANSGDEVTLSDLESLVKNNEEKLEQTTQGKVEDFVKAFQVFDKDGTGKVTPGDIRYL
                     LTGLGERLTDEEVDELMKGIEIDSDGLIDYKKFVEDVLRQ"
     gene            complement(<528543..>530045)
                     /gene="ERT1"
                     /locus_tag="KLMA_20241"
                     /db_xref="GeneID:34714719"
     mRNA            complement(<528543..>530045)
                     /gene="ERT1"
                     /locus_tag="KLMA_20241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817848.1"
                     /db_xref="GeneID:34714719"
     CDS             complement(528543..530045)
                     /gene="ERT1"
                     /locus_tag="KLMA_20241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674574.1"
                     /db_xref="GeneID:34714719"
                     /translation="MVSKRKVAVACVHCAKSHVTCNEGRPCSRCVKKGLQDSCVDAPR
                     KRVKYLQDVPEDQLPSVLRSSKSQAVSVEKKAKVEPAMGMESFGNGQNNPETQHTLSN
                     GQIAHKPRFLSNAADSEYSILSDIIHGDSLFNKIPVNFLYSNPLEQTPSPLNHRDPQS
                     TDAENELQLSFRLRAKQMNQIRGDVKAIYSTLFGPESSWLLNTDPMSIHSRLYTMHFP
                     LEPQKSMDGTLDFKRAAIGALTSHVTKFDKTINQYYLNFHNTFPEVHDSRQVPNLSYA
                     LEVEPPEMRDIPHDIDVPHTLRFTTPSEIYSLVQTAFPSTTGFHALLRYLKRRFGKTE
                     LVEMCRYLAELRPIFIASTIDLTDEDMIFMEKTHQRTLLEYDKFISQLGTPTCVWRRN
                     GQISYVNDEFSLLTGWNRLELLNKMTFMVELMDDDTVMEYFKTFTRVAYQDFKGAETM
                     RVCNLLTPIKGTVIKCRCLWTLKRDAFGLPMMIIGNFMPILSTPEDGNGY"
     gene            <530741..>531877
                     /gene="ARC1"
                     /locus_tag="KLMA_20242"
                     /db_xref="GeneID:34714720"
     mRNA            <530741..>531877
                     /gene="ARC1"
                     /locus_tag="KLMA_20242"
                     /product="GU4 nucleic-binding protein 1"
                     /transcript_id="XM_022817849.1"
                     /db_xref="GeneID:34714720"
     CDS             530741..531877
                     /gene="ARC1"
                     /locus_tag="KLMA_20242"
                     /codon_start=1
                     /product="GU4 nucleic-binding protein 1"
                     /protein_id="XP_022674575.1"
                     /db_xref="GeneID:34714720"
                     /translation="MSSDLLNKFSALSIAEPTLTQEQKGLQAQWDSVAKSGNVQGSID
                     ELNLHLRDHSFVLGTAKPSVSDVLLFEHVLPVVKEITHSSKDVKGNYAKYRHVLRWAQ
                     YLDSLLQLDDLKLNLDLDLPREVIEKKKKEASGEGAAAAPAGDKKDKKEKKEKKDKGG
                     DSKQPRGKPDEETLKKLREEAKAKKAAKKAANAQQEQAKAQEQAKISAGVIDFRVGFI
                     QKAIKHPDADSLYVSTIDVGDEEGPRTVCSGLVKYFPLEAMQERYVVVVCNLKPVNMR
                     GIKSTAMVLCGSDENSVEFVEPPAGSKAGDKVFFEGFGDEEPLKQLNPKKKIWEQLQP
                     HFTTNEQLEVIFKDDEDKDHPVRKLTNKNGDVFKVASISNACVR"
     gene            <533788..>534240
                     /gene="TRX3"
                     /locus_tag="KLMA_20243"
                     /db_xref="GeneID:34714721"
     mRNA            <533788..>534240
                     /gene="TRX3"
                     /locus_tag="KLMA_20243"
                     /product="thioredoxin-3"
                     /transcript_id="XM_022817850.1"
                     /db_xref="GeneID:34714721"
     CDS             533788..534240
                     /gene="TRX3"
                     /locus_tag="KLMA_20243"
                     /codon_start=1
                     /product="thioredoxin-3"
                     /protein_id="XP_022674576.1"
                     /db_xref="GeneID:34714721"
                     /translation="MLARTVYRSGMRPLGLGPSVGLRFAQLRLQSSTSSSSTISHISN
                     LQEFETAMKQQNISVVDFFATWCGPCKMVAPHLQKLSEKYPDVKFYKVDVDESPDIAG
                     ALGVSAMPTFMLFREGKGLGKIVGADPRGVEEAVKHFRKLHGSSSSSS"
     gene            complement(<535444..>536568)
                     /gene="COQ2"
                     /locus_tag="KLMA_20244"
                     /db_xref="GeneID:34714722"
     mRNA            complement(<535444..>536568)
                     /gene="COQ2"
                     /locus_tag="KLMA_20244"
                     /product="para-hydroxybenzoate--polyprenyltransferase"
                     /transcript_id="XM_022817851.1"
                     /db_xref="GeneID:34714722"
     CDS             complement(535444..536568)
                     /gene="COQ2"
                     /locus_tag="KLMA_20244"
                     /codon_start=1
                     /product="para-hydroxybenzoate--polyprenyltransferase"
                     /protein_id="XP_022674577.1"
                     /db_xref="GeneID:34714722"
                     /translation="MLMLNGLVRSSFRNSIKCGVKTLGSGYRSTGFQYQLARFQSVKS
                     GSSGGSAPAVFTEKELQEAREARLKGLGPYVSKLPAKWIPYAELMRLEKPVGTWLLYI
                     PCTWAITIAAIETHAPLGSTLWMLGLFGVGAVIMRGAGCTINDLCDRNLDNKVIRSVE
                     RPIASGRVSPGKAVAFLGAQTALGMGILAQLPADCWYLGLASLPIVFTYPLFKRFTYY
                     PQAALSACFNWGSLLGFPAMGIMDWSTMVPLYVSTYLWCMIYDTIYAHQDKKFDIKAG
                     IKSTALAWGQNTKKVCTSLGVVQMGALGLAGLNSGLLLGPGFLCGMGIFAYRLFDMIK
                     RVDLDDPANCWKWFQSNIKTGMLFSVALFFDYVLQLCGWL"
     gene            <537259..>538452
                     /gene="MVD1"
                     /locus_tag="KLMA_20246"
                     /db_xref="GeneID:34714723"
     mRNA            <537259..>538452
                     /gene="MVD1"
                     /locus_tag="KLMA_20246"
                     /product="diphosphomevalonate decarboxylase"
                     /transcript_id="XM_022817853.1"
                     /db_xref="GeneID:34714723"
     CDS             537259..538452
                     /gene="MVD1"
                     /locus_tag="KLMA_20246"
                     /codon_start=1
                     /product="diphosphomevalonate decarboxylase"
                     /protein_id="XP_022674578.1"
                     /db_xref="GeneID:34714723"
                     /translation="MTVYSASTTAPVNIATLKYWGKRDKVLNLPTNSSISVTLSQEDL
                     RTLTTATTSPEFEKDQLWLNGKEESLGSERTQHCLQDLRQLRRELEEKDASLPKFSEW
                     KLHIASENNFPTAAGLASSAAGFAALIKAIAKLYELPQSDSELSKIARKGSGSACRSL
                     FGGYVAWEMGELEDGSDSKAVEIGSLDHWPEMKAAILVVSADKKDTPSTSGMQLTVKT
                     SDLFQERINRVVPERFIQMKKSIVEKDFPTFAELTMKDSNSFHATCLDSFPPIFYLND
                     TSKKIIKLCHAINEFYNETVVAYTFDAGPNAVLYYLEQNEEKLFAFLHPLFQSVEGWE
                     SKYTKDQLSQFDAKFETLKNNVNFYLDYELHTGVTKVILTRVGPGPQDTDLSLIDTQT
                     GLPNK"
     gene            complement(<539028..>541115)
                     /gene="TUP1"
                     /locus_tag="KLMA_20247"
                     /db_xref="GeneID:34714724"
     mRNA            complement(<539028..>541115)
                     /gene="TUP1"
                     /locus_tag="KLMA_20247"
                     /product="general transcriptional corepressor TUP1"
                     /transcript_id="XM_022817854.1"
                     /db_xref="GeneID:34714724"
     CDS             complement(539028..541115)
                     /gene="TUP1"
                     /locus_tag="KLMA_20247"
                     /codon_start=1
                     /product="general transcriptional corepressor TUP1"
                     /protein_id="XP_022674579.1"
                     /db_xref="GeneID:34714724"
                     /translation="MSSVAAAQNKINDLLEAIRQEFANVSQEANSYRLQNQKDYDFKI
                     NQQLAEMQQVRNSVYELELTHRKMKDAYEEEINRLKLELEQKDRQLASLAHGGGVGGV
                     TPQVPQLGRNGAQGNQNQAPPNIPQPMVSQNVGGGMSSQMAPLNPQHTQQATSNAGEQ
                     AAANLAPVAQQQQQTLPSVPVPAQSAVQPQPQHPAQAQAQAPVQAPVGAVEPQGATVT
                     PNGTNTQQQQQQQPQQQQPASTASTAPATASTAPPTSAPSEQVAQAAAGGQTGQDHYL
                     VPANQRAVHAKPIPPFLLDLDSQLVPPHLKKQNNDYYVLYNPALPTDLDVELHMSLDH
                     SSVVCCVRFSSDGEYLATGCNKTTQVYKVSTGELVARLSDDSASQPQQPAQSGSGEAA
                     GANGNGAGSEEDASNNQNSAAATASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLES
                     KKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTV
                     AVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKG
                     VVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRG
                     VLFWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIWKYSKKN
                     PQQNSTQIKEIKE"
     gene            <541707..>542237
                     /gene="CSM1"
                     /locus_tag="KLMA_20248"
                     /db_xref="GeneID:34714725"
     mRNA            <541707..>542237
                     /gene="CSM1"
                     /locus_tag="KLMA_20248"
                     /product="monopolin complex subunit CSM1"
                     /transcript_id="XM_022817855.1"
                     /db_xref="GeneID:34714725"
     CDS             541707..542237
                     /gene="CSM1"
                     /locus_tag="KLMA_20248"
                     /codon_start=1
                     /product="monopolin complex subunit CSM1"
                     /protein_id="XP_022674580.1"
                     /db_xref="GeneID:34714725"
                     /translation="MDALAEYKESVQDRLDKADLAVQGVLNENVKLQRQLELKQQEIE
                     SLKEQLASERNRAETAESEKGDAEEQNEILKDLFEQLCGVRIHKTYEDDLGLWFDTSQ
                     GNKHGIMDYKLGFVKGKDEETEIVYVPLLKQRSVQELKQLQEQLPEYMFETLSFPLKS
                     LNQFYNKLSKGLSKDV"
     gene            complement(<542308..>542769)
                     /locus_tag="KLMA_20249"
                     /db_xref="GeneID:34714726"
     mRNA            complement(<542308..>542769)
                     /locus_tag="KLMA_20249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817856.1"
                     /db_xref="GeneID:34714726"
     CDS             complement(542308..542769)
                     /locus_tag="KLMA_20249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674581.1"
                     /db_xref="GeneID:34714726"
                     /translation="MVTFNCEVCNDTVPKKNTEKHYYRCPDAYYTCIDCNKTFDDGVS
                     YKKHTQCISEDEKYQKSLYKGKKNNQNKAAKPERSPKEKKAEEVSPQEKKKTEEAKPE
                     SKPKTSKSKSKTPLVKGESLYKILKTIKNKDEKKALLKKLIVKTEKEIELQ"
     gene            <543614..>545467
                     /gene="ABP1"
                     /locus_tag="KLMA_20250"
                     /db_xref="GeneID:34714727"
     mRNA            <543614..>545467
                     /gene="ABP1"
                     /locus_tag="KLMA_20250"
                     /product="actin-binding protein"
                     /transcript_id="XM_022817857.1"
                     /db_xref="GeneID:34714727"
     CDS             543614..545467
                     /gene="ABP1"
                     /locus_tag="KLMA_20250"
                     /codon_start=1
                     /product="actin-binding protein"
                     /protein_id="XP_022674582.1"
                     /db_xref="GeneID:34714727"
                     /translation="MAFEPIDTTTYSREIEAEYLKVVTGDEDTTWLIISPNAKKQYEP
                     ELVGTSFTEFLHSFDDTKVQYGLARVSPPGSDVQKLILIGWCPDSAPLKTRASFAQNF
                     GVISNQVLKTYHVQVTARDEDDLDESELLMKISNSAGARYSIQQQSSSGAKKPSSASS
                     FSKPTAKKPVSSFERKPVEKASSPSPAPAPAPAPARRTVSPKPSAGSTNEDGWDEPEL
                     EERDFHQKPLKPNSSSWKPIGKVDLQKVIAEEKGKEDPRLVVSAATYDKKIDPQSEIA
                     KLKEESKLKRDAAYDKVLGVKAPSPAATAVSDNSDRVIKGFKNEKSPSQLWAEKKRQK
                     SSLPAKTEAPKSTSSERFEDSEEEEKQEPEEEEEQEDVENIRSKFESMKTEEVPIIKP
                     RQTPARSIPEPPKEEEPTWAKKEQKFGQPLPGLHDQKKADSDGWSDDEEEEEDEGESR
                     IPVLPSRRNEEEPAPALPVRRNEPESEEEDEEPAPVLPSRRNEPEPEEEEEEEEPTPS
                     LPIRRNLPPPPQQQQQQEEEEDNFDEPEEPKARSPVPPPAPRRTQPAKPAAPSAIAEY
                     DYEAAEDNELTFQENDKIINIQFVDDDWWLGELESSGEKGLFPSNYVSLEQ"
     gene            complement(<545597..>546157)
                     /locus_tag="KLMA_20251"
                     /db_xref="GeneID:34714728"
     mRNA            complement(<545597..>546157)
                     /locus_tag="KLMA_20251"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817858.1"
                     /db_xref="GeneID:34714728"
     CDS             complement(545597..546157)
                     /locus_tag="KLMA_20251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674583.1"
                     /db_xref="GeneID:34714728"
                     /translation="MLYLTGVATLSENIKRLFPKDTEESPAEYTFRLVCTSCREEHDA
                     PVRINRFESHDMNGGRGNASFVMRCKFCGNDCSINLTRTAEDLYNLDEESNAEAIEQA
                     KKDRKKKGLRSVPVEKAVLLELDCRGCEATKFEPADTTFVAELTSKKQMDFQFEDGEN
                     EWYDYDEDAEEEVSVVDMTFEVIKGK"
     gene            <546552..>547847
                     /gene="YMD8"
                     /locus_tag="KLMA_20252"
                     /db_xref="GeneID:34714729"
     mRNA            <546552..>547847
                     /gene="YMD8"
                     /locus_tag="KLMA_20252"
                     /product="uncharacterized transporter C22E12.01"
                     /transcript_id="XM_022817859.1"
                     /db_xref="GeneID:34714729"
     CDS             546552..547847
                     /gene="YMD8"
                     /locus_tag="KLMA_20252"
                     /codon_start=1
                     /product="uncharacterized transporter C22E12.01"
                     /protein_id="XP_022674584.1"
                     /db_xref="GeneID:34714729"
                     /translation="MDRDTYRISVLIFGMYVAAITLTMYNKWMFDPNRTLHIAYPLFV
                     TSTHQAQLWVISYIYLRWKGHLTPQNLNHGDWKYYLKYIIPTAIATAGDIGLGNISFK
                     YVPFTVYTIVKSSTIAFVLFFGCLFKVEVPSWRLFAIVLTMFIGVVLMGLKPVNGHGG
                     GDTSSTSGSGSETLGVILVVISSALGGFRWVYVQVILNHKKNTFLAPPSDNEMVDISK
                     RTTKKNPVITLHQLALPMSIMLFTTSLLIERPFPGIFKSELMQWENHSTPITLLRGAG
                     LLILPSFLVFMLTICEFGILQIAPVLTLSITGIIKELFTVFLGMLVFKETLGLYNWMG
                     MAVVLVDVCYYNYYRFKQRIQSDALPGDYNPVAADELPETKPLPGNSELEQPSIDNGS
                     GDSATAWEMDFELESMHSKLSDNEPTTITEQTQTHVRND"
     gene            <548613..>550313
                     /gene="STP2"
                     /locus_tag="KLMA_20253"
                     /db_xref="GeneID:34714730"
     mRNA            <548613..>550313
                     /gene="STP2"
                     /locus_tag="KLMA_20253"
                     /product="transcription factor STP1"
                     /transcript_id="XM_022817860.1"
                     /db_xref="GeneID:34714730"
     CDS             548613..550313
                     /gene="STP2"
                     /locus_tag="KLMA_20253"
                     /codon_start=1
                     /product="transcription factor STP1"
                     /protein_id="XP_022674585.1"
                     /db_xref="GeneID:34714730"
                     /translation="MPSVQLLDTRRSAIKRFSQQVTRWLCALAGQLVGGTFGSSDAAC
                     EGESGSSVKSGNERKCEDVGDEQKSSLKSKGSDLETGKTEVEKRGLKENPVSLFPSSH
                     NVDKSLEFNASVVPCSLNVNGLQSPMSVARTPEGQMEWKMNINGESKMHQHSLSGSCS
                     PKSDKDKTSTQDITPKTDASAESVEAMKSTNSSQAGSPLIGGGSKNDNESEMKYVCHY
                     CDAEFKMRGYLTRHIKKHAVEKAYHCPFWDESLSPEKRCHTTGGFSRRDSYKTHLRSR
                     HFIYPGELKSVDRVKSHGHCAQCKRHFNSTNEWIEDHIESRECEAILPTFKGNLKKSK
                     KCGKLKMIMTSDGQSRFITSQITSHDISKASNSNSNSTSASTSTSTSPNNFEYNTAVP
                     SATTLDDKSKPPLDSTVSLTSIPLQYNTTIDVKSQSQPQLISTGTNSRANMRNVVLPL
                     DEFSSLNHSPVEDAALDSVRSISSQSSHEHTIPNKDMNFIHAGNDSEDNQDWMVLPLD
                     VEQAGLCSNDEIKTITDNDVPKINVTLQRQMNEYTLGERHFRETQQFMNFFNYTYNYQ
                     "
     gene            <550994..>554249
                     /gene="MCM6"
                     /locus_tag="KLMA_20254"
                     /db_xref="GeneID:34714731"
     mRNA            join(<550994..550998,551057..>554249)
                     /gene="MCM6"
                     /locus_tag="KLMA_20254"
                     /product="DNA replication licensing factor MCM6"
                     /transcript_id="XM_022817861.1"
                     /db_xref="GeneID:34714731"
     CDS             join(550994..550998,551057..554249)
                     /gene="MCM6"
                     /locus_tag="KLMA_20254"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM6"
                     /protein_id="XP_022674586.1"
                     /db_xref="GeneID:34714731"
                     /translation="MLQNSNIQGQQIPENNYLVMSAPSSPFQHQQQQSSQLPSSSGGY
                     GSSQFDEQSLGNRTPQFPSSSRGGIASTQQFGTDSADNGLQSDAHMEGVDEDSQEVTP
                     LVGIRQKNLNAIKKVDDKTGETVREAFEQFLENYTALNDETGEMEKVYRVQIEYMRWY
                     ELNTIYIDYKHLADVEEGALAVAILQQYYRFLPFLLAGLRNVVKKYAPGLLLTSDSVM
                     PSQQQSSQDASQHRSSQRGGTGLDSSLPDSQAATAGGTAPSTIATNPDQVERVLQISF
                     LNLPTVHRIRDIRANKIGSLMAISGTVTRTSEIRPELYKASFTCELCRAVIDNVEQVF
                     KYTEPTSCPNPTCENQSFWSLNVSRSKFLDWQKVRIQENSNEIPSGSMPRTLDIILRG
                     DCVERAKPGDRCKFIGTEIVVPDVSQLGLPGVKASSTPDSRGISRTTEGLNSGVSGLK
                     SLGVRDLTYKISFLACHVENVGTSFNGSRIAEEDADKTSKFDYINLRNYQNYEMAAET
                     DQEIFLTRLDSEEINELKEMVKDENIYDKLVKSIAPAVFGHETIKKGILLQMLGGVHK
                     TTVEGIKLRGDINICIVGDPSTSKSQFLKYVCNFSPRAVYTSGKASSAAGLTAAVVKD
                     EEGGDFTIEAGALMLADNGVCCIDEFDKMDITDQVAIHEAMEQQTISIAKAGIHATLN
                     ARTSILAAANPISGRYNRKLTLRSNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHI
                     VDLHMKRDSAINPPFTPEQLSRYINYAKTFKPVMTKEARDYLVKRYIELRKDDAQGYS
                     KSSYRITVRQLESLIRLSEAIARANCVDEIVPSFVAEAYDLLRQSIIRVDVDDVEIEE
                     DDDDDEEEGGPAAAATAAAESAAGAVSGADAEGEITAEGSHSPSHSHPPSAASAADAA
                     ASSAEDRPHGKRKVAISYEKYLDMMNLIVRKVVDREKNDEPEMTKTEIVDWYLQHKES
                     DINTEAEYWQERKLAFKVIKRLVKDRVLMQIHGQNNDDNLLGGGGGPGNLDTLGNPDQ
                     TQQPHTVYVIHPNCSVLDEILPDTTTTTSPRPENS"
     gene            <555025..>557736
                     /gene="GPH1"
                     /locus_tag="KLMA_20256"
                     /db_xref="GeneID:34714732"
     mRNA            <555025..>557736
                     /gene="GPH1"
                     /locus_tag="KLMA_20256"
                     /product="glycogen phosphorylase"
                     /transcript_id="XM_022817862.1"
                     /db_xref="GeneID:34714732"
     CDS             555025..557736
                     /gene="GPH1"
                     /locus_tag="KLMA_20256"
                     /codon_start=1
                     /product="glycogen phosphorylase"
                     /protein_id="XP_022674587.1"
                     /db_xref="GeneID:34714732"
                     /translation="MSSGTARRPSLSTSTSNDMITEEPHGVPRLSRRLTGFLPQEIKS
                     IDTMIPLQSREIWKKHAVQKFETPDEFQSKFIQHVETTLARSLYNCDDLAAYQATSQS
                     VRDNLVIDWNKSQQRQTARGSKRVYYLSLEFLMGRALDNALINLQDGTEEPGAQKRDQ
                     IKSAIDQLGFNLEDVLEQEPDAALGNGGLGRLAACFIDSMATGDYPAWGYGLRYKYGI
                     FAQKIIDGYQVETPDYWLNFTNPWEIERSEIQVPINFYGYVDRSNGNNGDGSTLSPSE
                     WIGGERVIAVPYDMPIPGFKTENVNNLRLWSARPTTEFDFAKFNSGDYKNSVEQQQRA
                     ESITSVLYPNDNFQEGKELRLKQQYFWCAASLHDIVRRFKKGKHPWEEFPDLVAIQLN
                     DTHPTLAIVELQRILVDLEHLDWHKAWDIVTKTFAYTNHTVMQEALEKWPIGLFGHLL
                     PRHLEIIYDINWFFLKAVEKKFPRDVDLLGRVSIIEESSGERQIRMAFLAIVGSHKVN
                     GVAELHSELIKTTIFQDFVKVYGLGKFTNVTNGITPRRWLKQANPDLAALISKTINDP
                     QDDYLLNMSKLTELAKYAEDTKFQTEWNTVKQHNKQKLADLIKKLYDGEDIIERDHIR
                     NTLFDIQVKRIHEYKRQQLNIFGCIYRYLRIKELLAEGVPIAEVEKKYPRKVSIFGGK
                     SAPGYYMAKTIIKLINSVSDVVNHDKEIGNIFKVVFIPDYNVSKAEIIIPASDLSEHI
                     STAGTEASGTSNMKFVMNGGLIIGTVDGANVEITREIGEDNIFLFGNLAENVDELRYQ
                     HQYHAKPLPKELEEVLQLIERGTFDGDFKPLVDSIRHHGDYYLVSDDFQSYLQMQSMV
                     DDVYHNNKKEWLKKSILSVANVGFFSSDRCIQEYADEIWNVEPLTAN"
     gene            <559051..>560637
                     /gene="JEN1"
                     /locus_tag="KLMA_20258"
                     /db_xref="GeneID:34714733"
     mRNA            <559051..>560637
                     /gene="JEN1"
                     /locus_tag="KLMA_20258"
                     /product="putative sialic acid transporter"
                     /transcript_id="XM_022817864.1"
                     /db_xref="GeneID:34714733"
     CDS             559051..560637
                     /gene="JEN1"
                     /locus_tag="KLMA_20258"
                     /codon_start=1
                     /product="putative sialic acid transporter"
                     /protein_id="XP_022674588.1"
                     /db_xref="GeneID:34714733"
                     /translation="MAESIASRQETVISLDKDEAKVVYLKPQSQINKHDIKQYLRTRI
                     PTLFPTRQSIRDARKQYPINPFPALRSLNWLQTQYFIVGFLAWTWDALDFFAVSLNMT
                     NLSKSLHRPVKDISNAITLVLLLRVVGALIFGYLGDRYGRKYPFCLTMVLIVVIQIGT
                     GFVKTFPAFLGCRAIFGIIMGSVFGVASATSLENAPVKARSILSGIFQQGYAFGYLLG
                     VVFQRAIVDNSSHGWRSIFWFSAGPPVLFIAWRLMLPESPQYVERVRLEKLENDGQNQ
                     FWKNMKLACSQYWLSMIYLVLLMAGFNFSSHGSQDLFPTMLTAQYHFSEDASTVTNSV
                     ANLGAIAGGISIAHFSSFLGRRLCICICCIGGGAMLYPWGFVSSKSGLNAAVFFLQFF
                     VQGAWGIVPAHLAELAPAELRALITGVAYQLGNMISSASSTIESTIGERFPIKGHEGT
                     GTYNYGKVMCIFMGCVFAYLMIVTMLGPENKGGESRLSTLLIDDDIESQNNVSFENAP
                     GLTEAQDMSFKPEVQYKERI"
     gene            complement(<560863..>562356)
                     /gene="ARO8"
                     /locus_tag="KLMA_20259"
                     /db_xref="GeneID:34714734"
     mRNA            complement(<560863..>562356)
                     /gene="ARO8"
                     /locus_tag="KLMA_20259"
                     /product="aromatic amino acid aminotransferase 1"
                     /transcript_id="XM_022817865.1"
                     /db_xref="GeneID:34714734"
     CDS             complement(560863..562356)
                     /gene="ARO8"
                     /locus_tag="KLMA_20259"
                     /codon_start=1
                     /product="aromatic amino acid aminotransferase 1"
                     /protein_id="XP_022674589.1"
                     /db_xref="GeneID:34714734"
                     /translation="MTQGVAKDFSYLYSDETKGRTPSQLKTIIHYFSDPNLIFLGGGL
                     PMSDYFPWDNLSVESPLPPFKNGIGAKPSGESSDTCHVSITKDLKESQAGIDIPLARS
                     LQYGHSKGQPEVMKFFKDHHEMIHDMQYEDWDICATVGNTGAWESTLRIFCNRGDSIL
                     AEEFAFSSSISAAEAQGVTLCPVPLDEHGIIPSKLEEVLDNWAAGVPKPKLLYTVPTG
                     QNPTGSSLSFDRKKEIYRIAQKHDFIIVEDEPYYFLQMEKYEKDPSKRVEKSYSNHKE
                     FIDSLEKSFVSIDVEGRVIRMDSLSKVLAPGTRFGWIIGSKDILLQYLRLQEMTIQAP
                     GGFTQSIIAGTLNRWGQEGYIDWLIGLRHEYTKKRDYCIDALHKYLPNVDFITVNPPI
                     AGMFFTVDIDASKHPEFTTTYKSDPKLVEKAIFDKAIASGVLVVPGNWFKVESLTNGK
                     QPEGFVKPAESSVIFFRGTYAAVPLEKMAEGLHRFGDSLYEEFQISR"
     gene            <563562..>565448
                     /gene="KEX1"
                     /locus_tag="KLMA_20260"
                     /db_xref="GeneID:34714735"
     mRNA            <563562..>565448
                     /gene="KEX1"
                     /locus_tag="KLMA_20260"
                     /product="carboxypeptidase KEX1"
                     /transcript_id="XM_022817866.1"
                     /db_xref="GeneID:34714735"
     CDS             563562..565448
                     /gene="KEX1"
                     /locus_tag="KLMA_20260"
                     /codon_start=1
                     /product="carboxypeptidase KEX1"
                     /protein_id="XP_022674590.1"
                     /db_xref="GeneID:34714735"
                     /translation="MTIPSFWILVAVLFRAVWCLNDAKDYYVAPDLLPGLSDVKDRER
                     IPEMHAGHIPVSEGDDDEKNYFFWKFHDLSNHSSVSAGNTLIFWLNGGPGCSSLDGAL
                     MESGPLRIDDDGEAYLNPGSWHTRGDIVFVDQPAGTGFSTVGDSDYDKDLKQVSKHFM
                     AFLKNYFTIFPEDLEKEMVLAGESYAGQYIPFFANEIVEYNDNRGEDDAEEKPYKLKS
                     LLIGNGWIDPDQQSLSYIPFALENNLISKTADYFPELLKAHTDCQKLIDSNTDSDKFS
                     FEECENILSKILAFTRRKTDEKGKKVPSNQQCTNIYDYRLHDSYPACGSNWPEDLPLV
                     TKFLSKPGVMDSLHLDVDKVPHWRECDSKVSKHLKNKGVKPSVHLLPNLLTRMQIFLF
                     NGDKDIICNNRGVEDLIKSLKWNNQTGFSKDVEYYDWQYYDQFTGDMIPAGYVKHERN
                     LTFISVYNASHMVPYDNALISRGIMDIYLKDVQLEHGDDNRDSIIVTKDFAVEVPPPN
                     DVNSDPSENDDQEHDSNDQDGSRESDKSKLQVLIVLLLLLSVCGTVAYYLLRVRFRKH
                     IHAILIDPENRPPSSHKSVAWADDLEIGDDNDDDFKFLVDEDPSKSNSSYPTDTDSFE
                     LENL"
     gene            complement(<565537..>566346)
                     /locus_tag="KLMA_20261"
                     /db_xref="GeneID:34714736"
     mRNA            complement(<565537..>566346)
                     /locus_tag="KLMA_20261"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817867.1"
                     /db_xref="GeneID:34714736"
     CDS             complement(565537..566346)
                     /locus_tag="KLMA_20261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674591.1"
                     /db_xref="GeneID:34714736"
                     /translation="MGRAKSFAGFVSTHGHHRGVKTRQHRPNRVFYSPTGALPHVNAE
                     SRKETITMLQLLLDICFVEQPRTSEEVNAWNYNNPEIDGLNNGAQILTLDLESDRKNI
                     QDNDYIFLHIHDADELNYLKILGILVTPENVSELLSDFRDHVTNAENYIGLTPHRNSI
                     STDVLIAAILRRENVTDASRKQRNYKHMLRKMLKFWKKSENEARSCGVSFESNHSATS
                     SDLFPLRTQTVQEDDVPFFNSSTDDFPSTKRKRSWFKQRAIKNFFQIQKDS"
     gene            complement(<567378..>568202)
                     /gene="CHO1"
                     /locus_tag="KLMA_20262"
                     /db_xref="GeneID:34714737"
     mRNA            complement(<567378..>568202)
                     /gene="CHO1"
                     /locus_tag="KLMA_20262"
                     /product="CDP-diacylglycerol--serine
                     O-phosphatidyltransferase"
                     /transcript_id="XM_022817868.1"
                     /db_xref="GeneID:34714737"
     CDS             complement(567378..568202)
                     /gene="CHO1"
                     /locus_tag="KLMA_20262"
                     /codon_start=1
                     /product="CDP-diacylglycerol--serine
                     O-phosphatidyltransferase"
                     /protein_id="XP_022674592.1"
                     /db_xref="GeneID:34714737"
                     /translation="MSSHDSDLPKQADASGGKNSSGSVLVSDGEDESFLSRRTPSRRT
                     SSIFSLDTTPLQPPNEIDIKKFTSDDFHFSMIRNLHLADFITLLNGFSGFYSIVSCLR
                     FTLTGKPHYVQRAHFFIVLGIFFDFFDGRVARLRNRSSLMGQELDSLADLISFGVAPA
                     SIAFAIGFRSTVDVLFLSFFVLCGLARLARFNVTVAQLPKDVSGKSKFFEGLPIPTTL
                     FLVGVMAFLVHKGLIEDNIPLGIYGSPEWYEFHPAVLLFFIQGCGMISKSLKIPKP"
     gene            complement(<568851..>571058)
                     /gene="POX1"
                     /locus_tag="KLMA_20263"
                     /db_xref="GeneID:34714738"
     mRNA            complement(<568851..>571058)
                     /gene="POX1"
                     /locus_tag="KLMA_20263"
                     /product="acyl-coenzyme A oxidase"
                     /transcript_id="XM_022817869.1"
                     /db_xref="GeneID:34714738"
     CDS             complement(568851..571058)
                     /gene="POX1"
                     /locus_tag="KLMA_20263"
                     /codon_start=1
                     /product="acyl-coenzyme A oxidase"
                     /protein_id="XP_022674593.1"
                     /db_xref="GeneID:34714738"
                     /translation="MTRQSTVDQKHPTHNAKRFISKERAESKLDIDQLNIFLENGPEE
                     AQLTQDLIEEIVHDPVLKTNTDHYDISKDQEREITARRIARMALYMEHDVKTKQKQFH
                     GDYIKTLEKQGSPLLSNGDFSIFDRRMSLTSNMDPGLGTRIGVHLGLFGNCIRGNGTD
                     EQIHYWLQEKGALFLKGIYGCFAMTELGHGSNVAQLQTTATYDAVSDTFKINTPDLLA
                     TKWWIGGAAHSATHTTCYARLIVNGKDYGVKTFVVPLREEKTFTLLPGVMIGDIGAKM
                     GRDGIDNGWIQFKNVVIPREFMLQRFTKVIPGSPPQVKTQPLLDQISGYSALLSGRVN
                     MVMDSFRFGSKFAIIATRYAVGRQQFGTAKNETQLIDYPLHQYRVLPQLAFCYLVSPT
                     AHKLMATYIQTLSELHQAGADKKKLFAVTDKLKDLFIDSASLKATNTWLVAKLIDELR
                     QTCGGHGYSSYNGFGKGYNDWVVQCTWEGDNNILSLSSAKSIVKKFVDISKGKKTTIT
                     TDSLRYLTPEFIGKSLSKDLTFKFDNLGDYTDIWAVVTVRLIHHVVELISKGTKMDSL
                     SKTLVQISKFHALHSMLLTYQEKLEESKSLVTDAYTRKYLEKLYVLFSLFFIDQNLGE
                     FLLLNVLTSEQMSQIIQPRLLELLPEIRKECIGLTDAFKFPDAMINAPIGYYDGDIYN
                     NYFNEVTNNNRPEPDGPGKPPYFSYLTNMLGREDFQARLGDTFSAETLDSLIK"
     gene            <572405..>577369
                     /gene="CHC1"
                     /locus_tag="KLMA_20264"
                     /db_xref="GeneID:34714739"
     mRNA            <572405..>577369
                     /gene="CHC1"
                     /locus_tag="KLMA_20264"
                     /product="clathrin heavy chain"
                     /transcript_id="XM_022817870.1"
                     /db_xref="GeneID:34714739"
     CDS             572405..577369
                     /gene="CHC1"
                     /locus_tag="KLMA_20264"
                     /codon_start=1
                     /product="clathrin heavy chain"
                     /protein_id="XP_022674594.1"
                     /db_xref="GeneID:34714739"
                     /translation="MSDLPIEFTELVDLTSLGISSQYLDFRSTTFESDHFVTVRESAN
                     GTNTVAIVDLTKGNEVTRKNMGGDSAIMHPSQKVISVRANGTIVQVFNLDTKSKLKSF
                     QLDEPVIFWKWLSEEVLGFITANSLYVSHVFDGNVSAKPVKLTDRHVNLNNTQIINFV
                     ANEKLDWFAVVGIIQENGKIAGKIQLFSKARGISQAIDGHVAIFSKILLDGNTEPVQV
                     FVTGNRNVTTGSGELRVIEIDPVQDQPVRYQKKIVDIFFPADAVNDFPISVQVSEKYG
                     IIYVLTKYGFIHLYELETGSNLFVNRITAESVFTATSYNHKNGIACINKKGNVLAVEV
                     DTNQIVPYVLNKLANVSLALTMASRGNLPGAEDLFSKQFDNLLAQGDYSNAAKVAASS
                     QQLRTQTTINKLKNIQAPPGSISPILLYFSTLLDKGKLNQYESIELTRPLLQQDRKQL
                     YEKYLKEDKLQCSEELGDIVKPFDTTLALATYLKAEAHAKVITCLAELQQFDKILPYA
                     AKVNFTPNFIVLISNLMRTNPDKASEFAISLLSNPEVASKLEIEKIADIFFSQNHIQQ
                     GTSFLLDALRSNTPDQGHLQTRVLEINLLNAPQVADAILGNNIFSYYDKPTIATLAEK
                     AGLYQRALENYTDIKDIKRCIVHTSAIPAEWLVNFFGKLNVEQSLACLKTLMDDNLEA
                     NLQIVIQVATKFSDLIGSQVLIKLFEDYRSNEGLYYYLASLVNLTTDKEVVFKYIQAA
                     VRAGHFQEVERVVRENNVYDPEKVKNFLKDAQLQDQMPLVVVCDRFDMVHDLVLYLYR
                     TKNFKFIEVYVQQVNPSKTAQVVAGLLDVDCDENVIISLLDTVVGQVPIDELTTEVEK
                     RNRLKLLLPFLEKTLQTGAQSQSVYNTLAKIYIDSNNAPEKFLKENDQYDTLNVGRYC
                     EKRDPYLAYIAYEKGQNDDDLIRITNENSMYKYQARYLLARSDSSLWNKVLSSENIHR
                     RQLIDSVISVGIPELTDPEPVSLTVQAFMSNGLKTELIELLEKIILEPSPFNDNPALQ
                     GLLLLSAIRYEPNKVSNLIEKLDNYDVDEIAPLCIENGLNEEAFEIYDKHGKHSKALT
                     VIVEDLLELDRAESYADKINTPELWAQLGTAELNALRIPEAIDSYIKAKDPSNFKNVI
                     KAAEDAGKFEELVPFLLMARESLKEPEIDGALILAYAELGKLNEIENLLTVSNVANLE
                     EVGDKLSEHNDYKAAKLCYSAVSNYSKLATTLVYLGDYQNAVDTARKASNVRVWKQVN
                     DACIANREFRLAQICGLNLIVHAEELDELVEVYETNGFFDELISLFEAGLGLERAHMG
                     MFTELAILYTKYNPSKTYEHLKLFWSRINIPKVIRAVEEAHLWPELIFLYAHYDEWDN
                     AALTMIEKSAFNFDHSYFKEIIVKVSNLEIYYKAINFYVKEHPSLLVDLLTVLTPRLD
                     IPRTVRIFSKSDNLPLIKPFLINVLPKNNSVVNQAYHDLMIEEEDYKALQDAVNSYDK
                     FDQLELAARLENHEIIFFKIIGAQLYRRNKKWAKSLSIFKEQQLWKHAIETAAISQSQ
                     EIAEDLLKFFIETDNKEAFIASLYSTYHLIRYDFVLEVAWLNNLETYIKPYEISVKKE
                     QNDAINKLSAEFKSKASTDSNSDGQPLLLTNGAIGSQTTGFSNY"
     gene            complement(<577582..>580677)
                     /gene="SPT16"
                     /locus_tag="KLMA_20265"
                     /db_xref="GeneID:34714740"
     mRNA            complement(<577582..>580677)
                     /gene="SPT16"
                     /locus_tag="KLMA_20265"
                     /product="FACT complex subunit SPT16"
                     /transcript_id="XM_022817871.1"
                     /db_xref="GeneID:34714740"
     CDS             complement(577582..580677)
                     /gene="SPT16"
                     /locus_tag="KLMA_20265"
                     /codon_start=1
                     /product="FACT complex subunit SPT16"
                     /protein_id="XP_022674595.1"
                     /db_xref="GeneID:34714740"
                     /translation="MSEGGIEIDFQAFHDRFVKLGKQFSGFDGSPDSLLFVLGSTNEE
                     NPYQKTTILHNWLLGYEFPATLAAFFKDKGVIITSSAKAKHLLPSIEKFESSDYKLEI
                     WQRNNKDAAHNKKLFEDLIKLITDSGKKVGVPLKDSYQGKFILEWEPIWEEAKKTHSL
                     EEVDCAVGLSNTWKDKDSKEQAYLSMSSKGSDKFMDLMSNEIVNAVDEELKITNAKMS
                     DKIENKIDDTKFLKKISGELNSLSPPNEKFDINFLDWAYSPIVQSGTKFDLKVSARSN
                     NDQLFGNGSILASCGIRYKNYCSNITRTFLIDPTEEMTDNYDFLLILQEKIINDLLKV
                     GANPNTIYEKTLEFIKEKKPDLLPHFTKNVGSLMGLEFRDAAGMLNAKPSTHKISENC
                     CYNISLGFGNLKDSKSGQVYAVQLADTVLLSENGEASILTKYTKASSQISFYFNNEED
                     DKDTSVKKERSKPPALPKPDGNSKILRSKLRGENRADDEEKEQIRKENQRKLHEKLQK
                     EGLMRFSDADAADDDEKPKHFFKKYESYVRETQIPSNVRDLKIHVDWKNQTIILPIYG
                     RPVPFHINSYKNGSKNEEGEYTYLRLNFHSPGAGGVGKKSEELPYEDNPDNQFVRSIT
                     LRSKDGARMSDVFKQITDLKKESTKREQERKALADVVVQAKLIENRSGRTKRLDQIFV
                     RPSPDTKRVPGTVFIHENGIRYQSPLRTDSRIDILFSNIKNLFFQSSKGELIVIIHVH
                     LKNPILMGKKKIQDIQFYREASDMSVDETGNSRRNNMKFRRYGDEDELEQEQEERRKR
                     AALDKEFRYFAEAIAEASDGLLDVDSPFRDLGFQGVPARSAVFCMPTRDCLIQLVEPP
                     FLVINLSEVEICILERVQFGLKNFDMVFVYKDFAKPVSHINTIPIEQLEFIKTWLTDV
                     DIPYTVSTINLNWSTIMKSLQDDPHQFFLDGGWSFLATGSDDERSDESEEEISEYEAS
                     DEDPSDEEVYSEEDYSEDEQFSDEGSEDFADESEEEAGEDWDELEKKAARADRGSKFN
                     E"
     gene            <581067..>581945
                     /locus_tag="KLMA_20266"
                     /db_xref="GeneID:34714741"
     mRNA            <581067..>581945
                     /locus_tag="KLMA_20266"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817872.1"
                     /db_xref="GeneID:34714741"
     CDS             581067..581945
                     /locus_tag="KLMA_20266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674596.1"
                     /db_xref="GeneID:34714741"
                     /translation="MSGDSGNETERADEQSGSNAHQSRWDSDKLTQVLQSKYPNLVMY
                     NGSTDLEHITKFYEGFRELIGKPISFSENVKSDFVFAFLRLDRSRRVLLMSLDLFENA
                     SDYLQTLKFNIDQWALRLEFLTLRVLGWAWDELREAKDKDKKLEEEFLETETLEGLSV
                     RYNICVTFIMDVIDEVIADKERAFEYLLSNRAGVDVYLKRLQYGFQMLAVVQDFCNKC
                     DSYPDLYQESLQTIALEARREQVMEKWGILEIIHEEYDNLAASMHKMAANNLINMMLD
                     KKNKLRDSTHLQLQHS"
     gene            <582393..>583985
                     /gene="NAB2"
                     /locus_tag="KLMA_20267"
                     /db_xref="GeneID:34714742"
     mRNA            <582393..>583985
                     /gene="NAB2"
                     /locus_tag="KLMA_20267"
                     /product="nuclear polyadenylated RNA-binding protein NAB2"
                     /transcript_id="XM_022817873.1"
                     /db_xref="GeneID:34714742"
     CDS             582393..583985
                     /gene="NAB2"
                     /locus_tag="KLMA_20267"
                     /codon_start=1
                     /product="nuclear polyadenylated RNA-binding protein NAB2"
                     /protein_id="XP_022674597.1"
                     /db_xref="GeneID:34714742"
                     /translation="MTSVPENIATNLKTVISERLKVVPNFNEDVNQVAEYVTLLMSNG
                     SSATDILQELSSLFDSVSPQELQDVVSIAFNAAELLKGGDDLNAVFAKLGNQGSNGPS
                     APVSESTSAPSSSGPVSAPASASANSESVPSSSPVSAFTGVVDVSSSKYNTAGNQARH
                     PAQRTRDPHGTVSRRGGSSSARGGISKTAAIPNRRTPNSRYGANQLAMALGIDEANAS
                     NEGSTHTVIKREGRCPDFPHCPLGRKCTRGHPTATCPSYPNCKNPPGTCTYLHPSEDA
                     ELMKEIERVREERRIKREEMEKKQQQRISGIVVCKFGTVCSNPKCPFGHPTPANEDAK
                     VTQFSWCESNLQCADPTCNKAHSSLSKIRSVEPLHKPTPKPVIAKPSNPKYVAGSMVP
                     PEEKTLEQCKFGPKCTNKRCPKRHARSPIMCREGANCTRIDCLFGHPVNEPCRYGAEC
                     RTYGCLFQHPPERVLPEKPRKGGDAGNNFNTTQGNGVWFNPQLIGSGNSSSNERPFAL
                     PESSVQSVHANQEVDGDSMMAN"
     gene            complement(<584471..>585244)
                     /gene="RPS2"
                     /locus_tag="KLMA_20268"
                     /db_xref="GeneID:34714743"
     mRNA            complement(<584471..>585244)
                     /gene="RPS2"
                     /locus_tag="KLMA_20268"
                     /product="40S ribosomal protein S2"
                     /transcript_id="XM_022817875.1"
                     /db_xref="GeneID:34714743"
     CDS             complement(584471..585244)
                     /gene="RPS2"
                     /locus_tag="KLMA_20268"
                     /codon_start=1
                     /product="40S ribosomal protein S2"
                     /protein_id="XP_022674598.1"
                     /db_xref="GeneID:34714743"
                     /translation="MSAPQAQGQAPRRGGFGGARGGRGGRRGGRRDTEEKGWVPVTKL
                     GRLVKAGKISSVEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFK
                     AVVIVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLVTK
                     TSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQFAGVEDVYTSSTGSTRTLENTLKAAF
                     VAIGNTYGFLTPNLWEVQPLTPSPLDVYADYASASKKKL"
     gene            <586531..>587052
                     /locus_tag="KLMA_20269"
                     /db_xref="GeneID:34714744"
     mRNA            <586531..>587052
                     /locus_tag="KLMA_20269"
                     /product="mitochondrial outer membrane protein OM14"
                     /transcript_id="XM_022817876.1"
                     /db_xref="GeneID:34714744"
     CDS             586531..587052
                     /locus_tag="KLMA_20269"
                     /codon_start=1
                     /product="mitochondrial outer membrane protein OM14"
                     /protein_id="XP_022674599.1"
                     /db_xref="GeneID:34714744"
                     /translation="MSSEKHDVKEAGKDVGKDVKETAKEVKAAAKDKASRAAKEAHGA
                     VDKAQDEFKKQVNNAEGILKPYWDKFVEFVSNVASTTAGATQAAVSNVAYGTSKAASV
                     VFHELQNPVVAVNAILGAASITTILNGYAHKKRFLKDKSDQDICLIVSGLSAFVAADA
                     YVSYKNYKKFDKK"
     gene            <587473..>589113
                     /gene="MON1"
                     /locus_tag="KLMA_20270"
                     /db_xref="GeneID:34714745"
     mRNA            <587473..>589113
                     /gene="MON1"
                     /locus_tag="KLMA_20270"
                     /product="vacuolar fusion protein MON1"
                     /transcript_id="XM_022817877.1"
                     /db_xref="GeneID:34714745"
     CDS             587473..589113
                     /gene="MON1"
                     /locus_tag="KLMA_20270"
                     /codon_start=1
                     /product="vacuolar fusion protein MON1"
                     /protein_id="XP_022674600.1"
                     /db_xref="GeneID:34714745"
                     /translation="MQRSTSFQIRQKPSKPTTSIDLTNHLSVPGVLYQDESSSNYNGR
                     LQAGDRRLANANDVDSASASASASASASASASASVSVSVSGDFNLDLQSLMASEISSV
                     YPATLNPDRSGKTPNTSKFISEKTGNDKQFFIFTSAGKLVFSQSENESHAMGLTGIMH
                     TVMNYFNINDNTVMKQFSTYDAKGVMTRFVFADRNHIKLMVRCSNNYETTAQLQQQLD
                     LVYSYIISSVSQRNLNKLMTKRSNFDLQHYFTDLDQQMIKLLCDSLATQPRISWFSSS
                     LQCLPMLPKKRNAINSVLSSTYLDFNISNYNGQILYTLVTSLDLKLISILRPSNHTLH
                     TMDLQILFELVRFQLADLLLNKVLWFPICFPKFNDNGFLYALIKVLPNNTIIMVISSQ
                     KDVFNTINEFVDKIGAKMVENKHCDNLEFPLLDWHRKFPYINHFIYKLKRTVQIYTPS
                     EPTNEMLQLYNHLKTICEDDQGRTLNKSSVTMLRWKSESFPGQLSGVYWVTEKFELYM
                     LLNDINISNQSVLKTAKRLIQQMRDMESYLFISRGVTF"
     gene            complement(<589056..>589817)
                     /locus_tag="KLMA_20271"
                     /db_xref="GeneID:34714746"
     mRNA            complement(<589056..>589817)
                     /locus_tag="KLMA_20271"
                     /product="zinc finger DNA binding domain-containing
                     protein"
                     /transcript_id="XM_022817878.1"
                     /db_xref="GeneID:34714746"
     CDS             complement(589056..589817)
                     /locus_tag="KLMA_20271"
                     /codon_start=1
                     /product="zinc finger DNA binding domain-containing
                     protein"
                     /protein_id="XP_022674601.1"
                     /db_xref="GeneID:34714746"
                     /translation="MVVSTTLAPIKCNDSKRCKLPPLKDLFAPTSLNTDAQIDRLREE
                     LLRNKEELQVILMKVKVLMEEFDYGSMVLLQAELKGIKQFTDQIRVKMIKHDCLDVHN
                     NEDIKMDQLVLPSWFQFKRDGPKYCVHCECLETIEWRNGPWGKSTLCNACGLWYRKLR
                     GTFSPEQSCLIMEDKRINSDKNDRKESLKFDMDEEKMSAVKSSLIDRMNQFIREVEIS
                     KSTKVKLGIIPKNSNKSQKVTPLEMNKYDSISRIC"
     gene            <590460..>593123
                     /gene="ROT2"
                     /locus_tag="KLMA_20272"
                     /db_xref="GeneID:34714747"
     mRNA            <590460..>593123
                     /gene="ROT2"
                     /locus_tag="KLMA_20272"
                     /product="glucosidase 2 subunit alpha"
                     /transcript_id="XM_022817879.1"
                     /db_xref="GeneID:34714747"
     CDS             590460..593123
                     /gene="ROT2"
                     /locus_tag="KLMA_20272"
                     /codon_start=1
                     /product="glucosidase 2 subunit alpha"
                     /protein_id="XP_022674602.1"
                     /db_xref="GeneID:34714747"
                     /translation="MKLVSFAFICWLLSLSIVNAFQDDLLKNCDQSGFCHRNRMYAGR
                     IQKTRNFYYSIDIDSLKFNYNTDAVRGIIHKTVKANQKEVQIPLYFTLRLLDDDKIRF
                     QLNEARDTVTIDKSGLNPVRYSKADEWAFDPEYNPWFWQGTVKPPGFWNKNQYTVQAK
                     KFTLQINVKRFSIKVLYDSREIVTINDQQMLNFEHYRSLEQNFESLNEEEEPFNMFQD
                     SFKDSRADSIPFGPESVALDFKFHGINNLYGIPEHADSMRLRDTSNSDPYRLYNVDVF
                     QYNLNSTMPMYGAVPFLIGVKEKISVGIFWINPSDTWVDIRYNKNAASSHWMSESGVI
                     DFIIIVQDTPKHVTESYVNITGKPLLPLMSSIGYHQCRWNYNDEKDVLTVDSLMDKWQ
                     VPYDFIWLDLEYADEKKYFTWKPDAFPNPKRLLTKLDKLKRNLVTLIDPHIKSNYKIS
                     NAILSAGVAVQNALNKPFHGQCWPGESIWIDTFNPAARELWSKFVHTFVNAASNLHIW
                     NDMNEPSIFDGPETTAPKDLLHYDGYEERSVHNLYGLTVHQATYDSFIEMNPNKRPFI
                     LTRSFFSGSQRTAASWTGDNVANWDYLELSIPMVLSHNIVGMPNTGADIAGFFGDPDD
                     ELLIRWYQAGIWYPFFRAHAHIDTKRREPYLLNEPTRSIVRETIKLRYQLLPTFYTAF
                     HDSHERGIPIMNPMLYEHPDMKIFYNIDDQFYLGEQGILVKPVTKPNVDQVSVSFPSG
                     RFYDLYTLKIVHDGKARTQTVSAPLEKVPAFIKGGHIISRKDRYRRSSSLMKNDPYTL
                     VIAPSSKSTAKGRLYIDDGETFEYKSGQYLEVEFELKNGILTNTVIHKPTLNPESFVD
                     IPIEKVIMTGLRTTTITDLNLKIGEDWELRL"
     gene            complement(<593171..>594034)
                     /gene="SLX1"
                     /locus_tag="KLMA_20273"
                     /db_xref="GeneID:34714748"
     mRNA            complement(<593171..>594034)
                     /gene="SLX1"
                     /locus_tag="KLMA_20273"
                     /product="structure-specific endonuclease subunit SLX1"
                     /transcript_id="XM_022817880.1"
                     /db_xref="GeneID:34714748"
     CDS             complement(593171..594034)
                     /gene="SLX1"
                     /locus_tag="KLMA_20273"
                     /codon_start=1
                     /product="structure-specific endonuclease subunit SLX1"
                     /protein_id="XP_022674603.1"
                     /db_xref="GeneID:34714748"
                     /translation="MSKQHCVPDFYCCYLLRSIPKPNSFYIGSSPDPVRRLRQHNGDV
                     SRGGAFRTKRMGTRPWKMVCFVYGFTSKIAALQFEHAWQHSYKTRFIEDDERLVTKKN
                     TRNGIATKLGNARLLMKHAYFDTMGLRIRFFDRLAWDCWETNKFRIQYNVTVCEVDEC
                     VLTDDSELDDLNELNLERIKAFYEDHIASEQVVFQRYQHQLTYDTQNCMLCDATFDYV
                     HDQGTQMIAFCIDDDCNFISCLRCLYKNFTKNSNVIIPKWGNCPKCHTNLHWSEVVKY
                     STVIRRSLVGE"
     gene            <594400..>595905
                     /gene="MCX1"
                     /locus_tag="KLMA_20274"
                     /db_xref="GeneID:34714749"
     mRNA            <594400..>595905
                     /gene="MCX1"
                     /locus_tag="KLMA_20274"
                     /product="mitochondrial clpX-like chaperone MCX1"
                     /transcript_id="XM_022817881.1"
                     /db_xref="GeneID:34714749"
     CDS             594400..595905
                     /gene="MCX1"
                     /locus_tag="KLMA_20274"
                     /codon_start=1
                     /product="mitochondrial clpX-like chaperone MCX1"
                     /protein_id="XP_022674604.1"
                     /db_xref="GeneID:34714749"
                     /translation="MIRTGTRRISHSRVLLNASAKLIEGEHFKVPSPKKLKSFLDEYI
                     VGQTDGKKVCSVAVYNHYLRVNDKQKKIEARMQKELLEQQKRESAGKFESSEAEQGYR
                     NLQRQLALRLQLEEKDEDLELSKSNLMVVGPSGSGKTLLATTLARMLDVPIAITDCTQ
                     LTQAGYIGEDVEVCIERLLVNADYDVSKAEKGIIVLDEVDKLAKPAASVGTKDVSGEG
                     VQQSLLKILEGHRVELTLKRPISKKKDDKNNQSVAKKEETFVVDTSNILFMLMGAFVG
                     LDKHIVKRINRSKSEDHEGSESDKETDSQKLRFSNTIEHIDVGGGKTVSALNFVTPAD
                     LVSYGLIPELIGRVPIVTALEPLKQKDLYHILKEPRNALLHQYEYIFKQFGVTLGVTE
                     KALKKVAEFALKEGTGARGLRGIMERLLLNVNYECPDSGVSYVLVNEDTVISLNRSEE
                     HSLSTKVKAKYYSRGEQDQFMMDIYEEDEKLGKEFDKRFGRVGTLEKQGKS"
     gene            complement(<596057..>597919)
                     /locus_tag="KLMA_20275"
                     /db_xref="GeneID:34714750"
     mRNA            complement(<596057..>597919)
                     /locus_tag="KLMA_20275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817882.1"
                     /db_xref="GeneID:34714750"
     CDS             complement(596057..597919)
                     /locus_tag="KLMA_20275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674605.1"
                     /db_xref="GeneID:34714750"
                     /translation="MSALPLSLQMQPVSSKSPISRETDSKNKGVTLPRKSKSNNTRTG
                     AAGGSRGSNVKWNVLPKIGETLHPRKHSMNVTYTDSTHVFYDPRYNRRLNKVDVFMQF
                     NEQCPLEDVVTMAHTRLESFAKFLNYYYESRKFMMSDTDKFTESSHFPGEIDGINFQE
                     VDYLVQLWHLQCLRFLNQTKSLLFSSGVVKSLLQRRQNMKHGFGHGQFDDTDILVIRS
                     DMSDSFWGWQVAYDEPSLNVIDYVLDVSLLSRNVERGLTRQSSTKKLSVRDIMGRSAE
                     DIADSSSSTDSLEHQNQSDSDISSTNTTESPERDSFAAARQPPASSSKFFKAAHAGSS
                     GIVHFFKKKSTSGLSTTPSMVDIGTTPNTDPLSTPPPSADGTSTFTLKNKWLENHYSR
                     KLSNFLSVHTPPHYHAPTPSSSEEDVDEKKMIDYKLQYLKIKLPFNDNSIPSILCPSL
                     WFHLRFDKWKTVLEEFYRCLIPGGSLQTENFDFKGSSIDSEDQCSLGTTRELRKILEA
                     ASLEAMKDNIQVLPMRHLVFLLNEIGFVNVKCCVMSLTRGDMTNDLECVYEFLSMYHY
                     DTIIRRHLWDPSLFPENTNPATFPLRYFNEHNGKVDTHVGALRLVCITAEKPLK"
     gene            complement(<598642..>600489)
                     /gene="MET13"
                     /locus_tag="KLMA_20276"
                     /db_xref="GeneID:34714751"
     mRNA            complement(<598642..>600489)
                     /gene="MET13"
                     /locus_tag="KLMA_20276"
                     /product="methylenetetrahydrofolate reductase 2"
                     /transcript_id="XM_022817883.1"
                     /db_xref="GeneID:34714751"
     CDS             complement(598642..600489)
                     /gene="MET13"
                     /locus_tag="KLMA_20276"
                     /codon_start=1
                     /product="methylenetetrahydrofolate reductase 2"
                     /protein_id="XP_022674606.1"
                     /db_xref="GeneID:34714751"
                     /translation="MRISQKLQRAHEDSNQDATFSFEFFVPKTAQGVQNLYERMDRMY
                     QTQPEFIDITWNAGGRLSMLSTDLVATSQGVLGLETCMHLTCTNMPVSQIDEALQKAY
                     DAGCQNILALRGDPPINSLGEEEEWKPCENGFRYAKDLVSYIREKYGDHFDVGVAAYP
                     EGHPECESESDLLQHLKEKVDCGADFMITQMFYDVDKFLDWCAKVRAAGISIPIIPGI
                     MPITSYPAFIRRTQWCQINVPEKFIAKLEPVKDDDQLVRELGTELMVELCTRLLESGY
                     VNHLHLYTMNLEKASLMILERLGLLKSSASARSSTSSSSGSHSIEEPLEPLPWRKSLN
                     PKRKNELVRPIFWQKRPYSYVARTSLWNEDEFPNGRFGDSSSPAYGDLDLCGHSLIRQ
                     SVKKSIELWSTPSNLDDISSLIISYLEGKLKCLPWSDVPLNHEVDDILLGLIDINKHH
                     IFTINSQPKVNGKPSTDPVVGWGPTKGYVYQKQYLEFLLPRDKLPRFQELCSKHDDHL
                     TYFAIDANDDLSTNHPEETRANAVTWGVFPGSEILQPTIVEKVSFLAWKEEFYTILKE
                     WKLTFQEHKAAQSINLVNELIDNYVLVNVVDNDFISPNNHIFDVLQQLY"
     gene            <601363..>602853
                     /gene="TDP1"
                     /locus_tag="KLMA_20277"
                     /db_xref="GeneID:34714752"
     mRNA            <601363..>602853
                     /gene="TDP1"
                     /locus_tag="KLMA_20277"
                     /product="tyrosyl-DNA phosphodiesterase 1"
                     /transcript_id="XM_022817884.1"
                     /db_xref="GeneID:34714752"
     CDS             601363..602853
                     /gene="TDP1"
                     /locus_tag="KLMA_20277"
                     /codon_start=1
                     /product="tyrosyl-DNA phosphodiesterase 1"
                     /protein_id="XP_022674607.1"
                     /db_xref="GeneID:34714752"
                     /translation="MSARDKVREHWASLGTAGKRVGRTTAPRPAGGPAGSPSASPAAP
                     TYTPFKLVHSAVFDGPGSSPNCPTFSLETILASPNLTEIWLFSFGFQTDLFMPLVKDH
                     VQVHIVGQLNTIQSDVPLHHFQNLSVHKVDIGARYGCHHAKIIFAFYKNGHMQMHLPS
                     FNLAREEINLVQQVAWSSPVLYERVGTVPATESGLFYHELIQFLKSYPDYCALSPLIA
                     SLARYKWHVLDHQNCQFVYSTPSNGGLQQLKKCLQRSSSSINAHDDESSSYPNLFVQV
                     SSMGNPFRKNRDLLQDVFIPYLYTDWFEHDDFDKKLKSPNYTSPFLAHSTILWPTTNE
                     MNRCMTQGLSAGWFFYNKSHQTASKVLPCLRKHPPLRPNASQSQANRHMVPSHTKYYI
                     QYTDENSIHCPDWLLLTSHNLSQAAWGPTPLRKPMNYECGVLYTSTLGPHRVNLALHS
                     AFESANPRPTPKPNNQSHPTVNIITPYPLKLDRYSSTDTPHTTTMA"
     gene            <603392..>604450
                     /gene="PDB1"
                     /locus_tag="KLMA_20278"
                     /db_xref="GeneID:34714753"
     mRNA            <603392..>604450
                     /gene="PDB1"
                     /locus_tag="KLMA_20278"
                     /product="pyruvate dehydrogenase E1 component subunit
                     beta"
                     /transcript_id="XM_022817886.1"
                     /db_xref="GeneID:34714753"
     CDS             603392..604450
                     /gene="PDB1"
                     /locus_tag="KLMA_20278"
                     /codon_start=1
                     /product="pyruvate dehydrogenase E1 component subunit
                     beta"
                     /protein_id="XP_022674608.1"
                     /db_xref="GeneID:34714753"
                     /translation="MLSKTFKRAMPSVAQSLRFASTKTMTVRDALNSAMAEEMDRDDD
                     VFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEF
                     MSFNFSMQAMDQVINSAAKTYYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGS
                     VPGLKVLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEEALSTDFTLPYK
                     AKVEREGADISIITYTRNVQFSLQAAEILSKQYGVDAEVINLRSIRPLDVEAIINTVK
                     KTNHLITVESTFPAFGVGSEIIAQIMESEAFDYLDAPIQRVTGAEVPTPYAKELEDFA
                     FPDPETIVRAAKRVLSIE"
     gene            <605880..>607433
                     /locus_tag="KLMA_20279"
                     /db_xref="GeneID:34714754"
     mRNA            <605880..>607433
                     /locus_tag="KLMA_20279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817887.1"
                     /db_xref="GeneID:34714754"
     CDS             605880..607433
                     /locus_tag="KLMA_20279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674609.1"
                     /db_xref="GeneID:34714754"
                     /translation="MALPPHDRRQFYLLVILYLLQGIPVGLTFGTIPFILKSSQRQTS
                     YVTIGLFSMATYPYSFKILWSPIVDSLYSSKIGRRRSWIIPVQFVTGLTLIALGYCIS
                     KDMILPKDVSKVDMTALTSVFLFLVILCSTQDIAVDGWALNILSKESLSYASTAQTIG
                     LNIGYFMSFTIFLSLSSNEFMQKYFHRDALFELSSYLVFTGLLYIVITVYVILFTREN
                     VPMEELAYRKKDDDEEKVEYQKDEQGTAESHDLLNVYRLFIRVLKLPSVQTLSIVHLI
                     SKFAFQCNDAATNLKLLEKGLKREDLAITVLINFPFELLFGFYVAKLSRTGNTFNNKI
                     IRAIAGDSGVLTAWMIGYLGRLFSAILGSIVVYLFPEDEKAMSKSFFLLILFQHLLGS
                     FMNTFQFVSMSAFHTQIADPVIGGTYMTLLNTLSNLGGTWPRLIIMTMIDKLSTTECS
                     GITLKQGTHLTPKQCIDMGARLVNTRDGYYTTNLFCIVSGIFLYTLYLRPVAAKLCKV
                     PLENWRVSR"
     gene            <608282..>610675
                     /gene="YRM1"
                     /locus_tag="KLMA_20280"
                     /db_xref="GeneID:34714755"
     mRNA            <608282..>610675
                     /gene="YRM1"
                     /locus_tag="KLMA_20280"
                     /product="zinc finger transcription factor YRR1"
                     /transcript_id="XM_022817888.1"
                     /db_xref="GeneID:34714755"
     CDS             608282..610675
                     /gene="YRM1"
                     /locus_tag="KLMA_20280"
                     /codon_start=1
                     /product="zinc finger transcription factor YRR1"
                     /protein_id="XP_022674610.1"
                     /db_xref="GeneID:34714755"
                     /translation="MSSKVDKKEGQGGCCDGIERAMRPNNTPDGAKDMENPGDDGYSG
                     AESGNGNEKGQDEAHGHGNGNGNGNKSHSNEARVKKSNPKRRRKLIRSCTFCRKRKLK
                     CDRARPMCTGCRMRGLSECVYTDGLNQQTSPDGRFSGAPNEELLQEIARLKSIMHENE
                     EYSLQRTSAPARAISYGVQSKEKNPLSEYTYVMIKRERTVRYGCTSFRTIAKLSGGSV
                     AKYLREVAGIHKNERGRIKARTGNSMLYELQRIERPWSLGMLISELPKYSELCATVEH
                     AFNYKGFRLHKIFSKDRVRRYLNECFKVRDDRIIELIPHAKLNYYPIGIVLHLYITLM
                     EDAPASFISFFLMLLGQTTAKIYYVERVQFILLHYIWKAGRFQNGGDNSHLAPLVELM
                     VSSALDIGLHDCAGELLQDRKLLNSMWLWILFYDIVVSFDMGRSVLVSGELFDSEKLL
                     NDQEFQVPVDGVNDEFGPAFMLSLRKFVYYGRITIIGLYSRNKIPDLDLYINHFEKLI
                     DEIWPSKRDFFEDTNTMLNHLSFAGSVICLPATNIVSTLRALKRLVFKDYSTENYMMN
                     AKMLLMSVDLIYGSIIECYHSDLQEAPEELASPLTTPSNIRCVIEVISSHWVRSIFLC
                     YQFLFTLAMNLNNSSDIEGASSSIQDTTVLENLLNKFNKAHQICFDQLRSSPALLPLH
                     QYLSSRHPFIHMLFYERTARMMLGKLTNSKVTEDLQTDNEASNSKNDFQENPGTFALT
                     DAYFPPLDQTDIENIFNEMFRDSGISEQDMVEISSANTTNASCSTNNNSSSNTNNAD"
     gene            complement(<610847..>611851)
                     /gene="SCS3"
                     /locus_tag="KLMA_20281"
                     /db_xref="GeneID:34714756"
     mRNA            complement(<610847..>611851)
                     /gene="SCS3"
                     /locus_tag="KLMA_20281"
                     /product="FIT family protein SCS3"
                     /transcript_id="XM_022817889.1"
                     /db_xref="GeneID:34714756"
     CDS             complement(610847..611851)
                     /gene="SCS3"
                     /locus_tag="KLMA_20281"
                     /codon_start=1
                     /product="FIT family protein SCS3"
                     /protein_id="XP_022674611.1"
                     /db_xref="GeneID:34714756"
                     /translation="MNYTFFLLCPVLFVIGYVFPIIPTTVDKDGLLNVYFVKFGWFWT
                     SVVSGLCIVRYSRLANHWKRYILLSLWWLVFTQEVFGLTPLMDLVFLKSGGYCSFDVL
                     DQSDNVHHLNLKFHDNEYRRLRGLRRMIKWLDSVDGSDSLKNALRSIIKDDKLDYNPG
                     LIGELSGLSRLVRSSSGCSRAGGHWVGGHDPSGHIFLITLMLMLMFGELSRYQERAFR
                     HLSRTYKRFFKRVGQFCIQLFDNGGLVNVLMQDGGSQWWYKLFVKPPLACYKTLASLA
                     YLVVKFVIWENPILLLLTLTLMWSYSFVVTVMLFHTLPEQLSGFLAAYVVCIIVYQLV
                     "
     gene            612302..612424
                     /locus_tag="KLMA_R211"
                     /db_xref="GeneID:34718657"
     tRNA            join(612302..612335,612387..612424)
                     /locus_tag="KLMA_R211"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718657"
     gene            complement(<612840..>614564)
                     /gene="HSP60"
                     /locus_tag="KLMA_20282"
                     /db_xref="GeneID:34714757"
     mRNA            complement(<612840..>614564)
                     /gene="HSP60"
                     /locus_tag="KLMA_20282"
                     /product="heat shock protein 60"
                     /transcript_id="XM_022817890.1"
                     /db_xref="GeneID:34714757"
     CDS             complement(612840..614564)
                     /gene="HSP60"
                     /locus_tag="KLMA_20282"
                     /codon_start=1
                     /product="heat shock protein 60"
                     /protein_id="XP_022674612.1"
                     /db_xref="GeneID:34714757"
                     /translation="MLRSSVRPANVGLKRTTQLLSSRCYSSHKELKFGVEGRAALLKG
                     VETLAEAVSATLGPKGRNVLIEQPFGAPKITKDGVTVARAITLEDKFENMGAKLLQEV
                     AAKTNEAAGDGTTSATVLGRAIFTESVKNVAAGCNPMDLRRGTQAAVEKVIEFLSQNK
                     KEITTSAEIAQVATISANGDAHVGKLLASAMEKVGKEGVITIREGRTLEDELEVTEGM
                     RFDRGFISPYFITNAKSGKVEFEKPLILLSEKKISSIQDILPSLELSNQTRRPLLIIA
                     EDVDGEALAACILNKLRGQVQVCAVKAPGFGDNRKNTLGDIAILSGGTVFTEELDLKP
                     ENATIQHLGSCDSVTITKEDTVILNGNGPKENIEARIEQIKNSIDMTTTNSYEKEKLQ
                     ERLAKLSGGVAVIRVGGSSEVEVGEKKDRYDDALNATRAAVEEGILPGGGTALLKASR
                     VLDEVKTDNFDQKLGVDIIRKAITRPARKIIENAGEEGSVIVGKIIDEYGSEFTKGYN
                     AAKGEYTDMLSAGIIDPFKVVRSGLVDASGVASLLATTEVAIVDAPKPAAAPSMPGGM
                     PGGMPGMM"
     gene            <615759..>617372
                     /gene="ATG22"
                     /locus_tag="KLMA_20283"
                     /db_xref="GeneID:34714758"
     mRNA            <615759..>617372
                     /gene="ATG22"
                     /locus_tag="KLMA_20283"
                     /product="autophagy-related protein 22"
                     /transcript_id="XM_022817891.1"
                     /db_xref="GeneID:34714758"
     CDS             615759..617372
                     /gene="ATG22"
                     /locus_tag="KLMA_20283"
                     /codon_start=1
                     /product="autophagy-related protein 22"
                     /protein_id="XP_022674613.1"
                     /db_xref="GeneID:34714758"
                     /translation="MDGDMSEITPLLESSTSVSKSKSTVDVSVEEVEEATNDEVFDVK
                     ELSKWDTRKTYFIWLLVCFSTGPTAAMMRAYVPAIIQTTAHRLGHPKGSSGPCALRGD
                     DCYVRFGFGEVQYTSYSLYLKAIYTSLEGVLAILLMAFADYSDYRKWLMVGATAFYGV
                     FAIPFFWLADTEHYGTLVQQSVLYCLMLCFSTVYQITESSYIPVFMNARRVSLRTGDD
                     DNNKPQQGAVISRGLNVSTWGLVVGNIGGLLASLVGVIITHVNNKPDGKDFLLAVTIA
                     GIVTAVISFICAGLVPSLKGKEIEIKGFKNLLLAPIVRFKKILSDLIEYKEALKFCVA
                     WVIWNVAYSNFLAVFGLLFRSTLGIGSSDAEFTVWQFTNLIIACVGPLFWTYVYSRKC
                     YNMPSTYSTLYMKRSLCAMLTIGMLANFWGCLGANSNSKVGFKNRWEFWTFQILFVGT
                     STGIRMINRVIYSAVLPLGKENQYFGFEIMLGLCTGWSESLFVALIQDKTGNSRMPFI
                     PNTVLYLVALVILIYVDIEAGMKKVKKWY"
     gene            complement(<617581..>619299)
                     /locus_tag="KLMA_20284"
                     /db_xref="GeneID:34714759"
     mRNA            complement(<617581..>619299)
                     /locus_tag="KLMA_20284"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817892.1"
                     /db_xref="GeneID:34714759"
     CDS             complement(617581..619299)
                     /locus_tag="KLMA_20284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674614.1"
                     /db_xref="GeneID:34714759"
                     /translation="MGSVVVWYSHYLNSFVAYTTQETKDTMSRLSSEKTTTIVNEEGI
                     SVSTYDVESGVENSKGFGHNPFKDPKVAEYYRELYESSGYECRAAFDPEFTWTESEEK
                     KLVRKLNWRVAMTACFLFVALQLDRGNLAQAVADNLLKDMHMNTNDYNVGNQIFYVSF
                     FVAELPSQLISKRLGPDRFVPFQMCAWSAVAMSQAAMHNKTGFYICRCLLGLLEGGFI
                     ADLVLWLTYFFTSKELSLRLSWFWTSLSIVQIVSALMAYGILRMRGKHGLTGWQWLFL
                     LEGIITFLIGLAGFYLMVPSAVQTKNWMHPKGWFTEREEKIVVNRVLRDDPSKGDMHN
                     RQPLSFKLIWEALKDYYLWPIYAIGLVAYAAYNTLGAYLTLTLKSVGFGTLNVQLLSI
                     PYQVIHIILLIGITWLSERLNERAYMGIIAAVWNSLFVGILRWWSGSLVNAWPTFALC
                     TLLLGAPYIHAICVSWVSRNSNSIKTRAVSSALYNMAVQVGSIYCTQIYRNDDKPLYH
                     RGNTVLFVFAIGTIPLYLFTKWFYHSINTKREKIWSEMTDEERKEYIATTEDKGNRRL
                     DFRFAE"
     gene            complement(<620164..>620952)
                     /gene="RNA15"
                     /locus_tag="KLMA_20285"
                     /db_xref="GeneID:34714760"
     mRNA            complement(<620164..>620952)
                     /gene="RNA15"
                     /locus_tag="KLMA_20285"
                     /product="mRNA 3'-end-processing protein RNA15"
                     /transcript_id="XM_022817893.1"
                     /db_xref="GeneID:34714760"
     CDS             complement(620164..620952)
                     /gene="RNA15"
                     /locus_tag="KLMA_20285"
                     /codon_start=1
                     /product="mRNA 3'-end-processing protein RNA15"
                     /protein_id="XP_022674615.1"
                     /db_xref="GeneID:34714760"
                     /translation="MNRGNPSRTVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPT
                     TGKSKGYAFIEFKDLATSASAVRNLNGYQLGSRSLKCGYTTGSGINGSGANSGPGDDE
                     ENGPSSMADDVKFPWLPVGVDVNINMTTPAMCISSELSKLQKDQQIELIKVIQTFCKD
                     DKETFVNLLEEAPQLSYAVAELLLSNGVCSVDELTQLAMASKQKTEEPMENNIEDGLD
                     EEKVDLLRQVLQLQDSDIAMLPQEEKMAVWDLKQRAMKGEFGHL"
     gene            <621317..>622210
                     /gene="DST1"
                     /locus_tag="KLMA_20286"
                     /db_xref="GeneID:34714761"
     mRNA            <621317..>622210
                     /gene="DST1"
                     /locus_tag="KLMA_20286"
                     /product="transcription elongation factor S-II"
                     /transcript_id="XM_022817894.1"
                     /db_xref="GeneID:34714761"
     CDS             621317..622210
                     /gene="DST1"
                     /locus_tag="KLMA_20286"
                     /codon_start=1
                     /product="transcription elongation factor S-II"
                     /protein_id="XP_022674616.1"
                     /db_xref="GeneID:34714761"
                     /translation="MDTKEVLEAVKGLEKNKNNSEVVLKILQSLDKDLKDVNEKLLRE
                     TKVGVVVNQFKKSSNPEIVKLVKKMILSWKEAVAREKKSRLSGAGGAGSGASPSPANA
                     QNSNEAVKKEKYVSKAPRNAKNDGVKTDVYGVKIRDMAVKALYDALAKESEHPPAAIL
                     DTVLNIEKEMVALFNPETDEKGYREKYRVIYSNIISKNNPELKHRITNGEISPKHLVN
                     ADPKELAPEHLKKKLEEIEKQNLFNAQGATLERSVTDRFQCGKCKQRKVSYYQLQTRS
                     ADEPLTTFCTCEVCGNRWKFS"
     gene            <622593..>623012
                     /locus_tag="KLMA_20287"
                     /db_xref="GeneID:34714762"
     mRNA            <622593..>623012
                     /locus_tag="KLMA_20287"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817895.1"
                     /db_xref="GeneID:34714762"
     CDS             622593..623012
                     /locus_tag="KLMA_20287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674617.1"
                     /db_xref="GeneID:34714762"
                     /translation="MLSRTIIRSRFTSAASIFVRGSTLRSVPSLQSKRFASSWDKSPE
                     DLDAHIKVQKLMEEIHSHPSIVESLEKLNTVMREKKLIDPESNEPPSIMQMVKLMMDK
                     DVREAMQGFKSEMEKSGIQLGPDQLGPLMKVLGIEKK"
     gene            complement(<623148..>624629)
                     /gene="CYS4"
                     /locus_tag="KLMA_20288"
                     /db_xref="GeneID:34714763"
     mRNA            complement(<623148..>624629)
                     /gene="CYS4"
                     /locus_tag="KLMA_20288"
                     /product="cystathionine beta-synthase"
                     /transcript_id="XM_022817897.1"
                     /db_xref="GeneID:34714763"
     CDS             complement(623148..624629)
                     /gene="CYS4"
                     /locus_tag="KLMA_20288"
                     /codon_start=1
                     /product="cystathionine beta-synthase"
                     /protein_id="XP_022674618.1"
                     /db_xref="GeneID:34714763"
                     /translation="MGYDTRHDVIDLVGNTPLIHLQKLPKAMGIKPKVFAKLELYNPG
                     GSIKDRIAKSMIEAAEEEGLIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEK
                     MSNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVAKRLEKEIPGAIILDQYNNMKNPE
                     AHYHGTGKEIHHQLQDLSLFSKLNAVVAGAGTGGTISGIARYIKEQNKDIQIVGADPV
                     GSILAVPEKLNETDVTEYKVEGIGYDFVPHVLNRDLVDHWIKTEDKSSFKYARQLISN
                     EGVLVGGSSGSAFAALVQYCEEHPELTEDDVIVVIFPDSIRSYLTKFVDDEWLKTNGL
                     WDDAIATPIVQKETDVFEDATVKDLNLKPVVSVDEDASIATVVKILTDNSFDQLPVLT
                     KDGKLCGLVTLSQLLKKLSTSKDVTSIKGLFYDFRKLNNFDDISSYNANKSHKKRFVR
                     FDVNTTLTELNSFFEKNSAAIITDGLSPVHIVTKMDLLSYLAK"
     gene            <625806..>626474
                     /gene="VPS20"
                     /locus_tag="KLMA_20289"
                     /db_xref="GeneID:34714764"
     mRNA            <625806..>626474
                     /gene="VPS20"
                     /locus_tag="KLMA_20289"
                     /product="vacuolar protein sorting-associated protein 20"
                     /transcript_id="XM_022817898.1"
                     /db_xref="GeneID:34714764"
     CDS             625806..626474
                     /gene="VPS20"
                     /locus_tag="KLMA_20289"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 20"
                     /protein_id="XP_022674619.1"
                     /db_xref="GeneID:34714764"
                     /translation="MGQQGSRIKVTEADKAMLQLKMAKDELHRYSRRTETLINTERNE
                     LKGLCSRLKGKQLKEDPRARLLLKRMHYQQRLLEQCTDQIINLETMVQSIEFKLVEKS
                     FIDGLQKGNQLLKKLNSELNLEKVENIMDAAAEQIEIQREIDDTLSNAIVGSTINDEI
                     DKELEQLDRETNGVEKVASAPGVQDKLEQLPSTEKLGKFKASEPELEEEQPQRRAQNE
                     PLLA"
     gene            complement(<626790..>627821)
                     /gene="HEM2"
                     /locus_tag="KLMA_20290"
                     /db_xref="GeneID:34714765"
     mRNA            complement(<626790..>627821)
                     /gene="HEM2"
                     /locus_tag="KLMA_20290"
                     /product="delta-aminolevulinic acid dehydratase"
                     /transcript_id="XM_022817899.1"
                     /db_xref="GeneID:34714765"
     CDS             complement(626790..627821)
                     /gene="HEM2"
                     /locus_tag="KLMA_20290"
                     /codon_start=1
                     /product="delta-aminolevulinic acid dehydratase"
                     /protein_id="XP_022674620.1"
                     /db_xref="GeneID:34714765"
                     /translation="MVHVAKFLDERPTEIPSILAGGYNHPLLREWQNERQLTKSMFIF
                     PLFISDQDEEETLIPSLPNIKRFGINKLKDYVAGLVAKGLRSVILFGVPLKPGAKDEV
                     ATAADDPDGPVIKAIKLLRKEFPDLYIICDVCLCEYTSHGHCGILYEDGTINREKSVQ
                     RIAAVAVNYAIAGAHCVAPSDMIDGRIREIKMGLIEHGLAHKTFVMSYSAKFSGNLYG
                     PFRDAACSQPGQGDRKCYQLPPGGRGLARRALKRDLAEGSDGIIVKPSTFYLDVMSDA
                     AEICRDIPVCAYHVSGEYAMLHAAAEKGVVDLKSIAFESHYGFLRAGARLIISYLTPE
                     FLEWLDEVN"
     gene            <628349..>629092
                     /locus_tag="KLMA_20291"
                     /db_xref="GeneID:34714766"
     mRNA            <628349..>629092
                     /locus_tag="KLMA_20291"
                     /product="UPF0424 protein P35G2.02"
                     /transcript_id="XM_022817900.1"
                     /db_xref="GeneID:34714766"
     CDS             628349..629092
                     /locus_tag="KLMA_20291"
                     /codon_start=1
                     /product="UPF0424 protein P35G2.02"
                     /protein_id="XP_022674621.1"
                     /db_xref="GeneID:34714766"
                     /translation="MSGHNCEDEYHSHNHDHDNDHGHDHGHSHDTPIETFSQQSLYAY
                     IDTTKVQVRNGVSSDRITELPKCFLKPQGEKYDTSRYVESDADCQLLIQIPFTASVKV
                     FTMLLRVNKSGAGYSTPKAIQLYKNYNKNLDFDTISDLKADYTFEFPNNIGVEPDYSG
                     ESLTDENTFMKFDLPRNIFQNCESVTMFIKDNWSDDEDDLDRIYYCELRGEVTGKLRN
                     LGAPIVTVYEAAPNPVHAKLESQNLHYTA"
     gene            <629375..>629758
                     /locus_tag="KLMA_20292"
                     /db_xref="GeneID:34714767"
     mRNA            <629375..>629758
                     /locus_tag="KLMA_20292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817901.1"
                     /db_xref="GeneID:34714767"
     CDS             629375..629758
                     /locus_tag="KLMA_20292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674622.1"
                     /db_xref="GeneID:34714767"
                     /translation="MSEDVIKNSEALDQLAKLILSNSKKNPSSLASIKEDYENKLKNL
                     NELISMITSVELDKAKFSELVSKKIEIINKDGHDYALIPVLKPQERVKTGKKKSKPNN
                     IQCSYCKETGHLRSKCNKKLLGLPP"
     gene            complement(<629863..>630150)
                     /gene="LSM2"
                     /locus_tag="KLMA_20293"
                     /db_xref="GeneID:34714768"
     mRNA            complement(<629863..>630150)
                     /gene="LSM2"
                     /locus_tag="KLMA_20293"
                     /product="U6 snRNA-associated Sm-like protein LSm2"
                     /transcript_id="XM_022817902.1"
                     /db_xref="GeneID:34714768"
     CDS             complement(629863..630150)
                     /gene="LSM2"
                     /locus_tag="KLMA_20293"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm2"
                     /protein_id="XP_022674623.1"
                     /db_xref="GeneID:34714768"
                     /translation="MLLFSFFKTLVDHEVTVELKNDITLTGTLKSVDQFLNLKLDNIS
                     CNNNEKYPHLTSVRNMFIRGSTVRYVYLKKSMVDTNLLQDATRREIMSERK"
     gene            complement(<630572..>631909)
                     /gene="GDI1"
                     /locus_tag="KLMA_20294"
                     /db_xref="GeneID:34714769"
     mRNA            complement(<630572..>631909)
                     /gene="GDI1"
                     /locus_tag="KLMA_20294"
                     /product="rab GDP-dissociation inhibitor"
                     /transcript_id="XM_022817903.1"
                     /db_xref="GeneID:34714769"
     CDS             complement(630572..631909)
                     /gene="GDI1"
                     /locus_tag="KLMA_20294"
                     /codon_start=1
                     /product="rab GDP-dissociation inhibitor"
                     /protein_id="XP_022674624.1"
                     /db_xref="GeneID:34714769"
                     /translation="MDENYDVIVLGTGLTECILSGLLSIEGKKVLHVDKQDHYGGESS
                     SVTLSELYAKFKQHPLGKEEIESKFGKDRDWNVDLIPKFLMANGELTNILVHTDVTRY
                     IEFKQVAGSYVYNRGKVYKVPANEMEAISSSLLGIFEKRRMKKFLEWISAYNEEDVAT
                     HQGLNLDQNTMDEVYYKFGLGNSTREFIGHAMALWTNDDYLQQPARPTVERIILYVQS
                     IARFGKSPYIYPMYGLGELPQGFARLSAIYGGTYMLNTPIEKVLYTDDGKFEGIVTKE
                     GTARAPIVIADPTYFPEKCKSTGEKVIRAICITKQPVPNTSGADSCQIIIPQSQLGRK
                     NDIYIATVSEAHKVTSKGHYLASVSTIIETDKPHIELEPAFKMLGPIEERFMGISEIF
                     EPIEDGSKDNIYISKSYDSSSHFESMTDDVKDIYFRITGQPLVLKKREDTADE"
     gene            <632755..>634023
                     /locus_tag="KLMA_20295"
                     /db_xref="GeneID:34714770"
     mRNA            <632755..>634023
                     /locus_tag="KLMA_20295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817904.1"
                     /db_xref="GeneID:34714770"
     CDS             632755..634023
                     /locus_tag="KLMA_20295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674625.1"
                     /db_xref="GeneID:34714770"
                     /translation="MQKPWILFVQQPEYNLPEYDSLTQEFNTVEYILKRDTDGSGKEA
                     FLEFISQHTKEKGPIVGIFGGYPQFAPLGGLNASILNDPRWPNTIKCICLCSVGYNGI
                     DLDLLQEKGIHLYNYDDTIQDAGIVANDVADCVLWHVLEGFRKFSSQMHALRSAGDTI
                     KARSQIVQEEGGAAAAPRFEFGQRWKRGKSIESCRGKRCLIMGLGRIGVQCGKKLEAG
                     LGMEIHYTQRNPVSAAKLGISNNDDDNTAFQKWQFHPIDKLVGGKIGLFDCIVICLPG
                     TPATKHLIDAEFLAQCKSDVVICNVGRGFIIDEKAVHEVMKNDPLKIRHIAMDVFHDE
                     PLVEQSLCEDYHFATITPHIASSTRAVWESSNRLALQVLSHVCASTDTRPGSSSGSCP
                     PVEPNPSSEFTDSSYPGNSGDKLHRLPRVI"
     gene            <635239..>636309
                     /gene="GPD2"
                     /locus_tag="KLMA_20296"
                     /db_xref="GeneID:34714771"
     mRNA            <635239..>636309
                     /gene="GPD2"
                     /locus_tag="KLMA_20296"
                     /product="glyceraldehyde-3-phosphate dehydrogenase 2"
                     /transcript_id="XM_022817905.1"
                     /db_xref="GeneID:34714771"
     CDS             635239..636309
                     /gene="GPD2"
                     /locus_tag="KLMA_20296"
                     /codon_start=1
                     /product="glyceraldehyde-3-phosphate dehydrogenase 2"
                     /protein_id="XP_022674626.1"
                     /db_xref="GeneID:34714771"
                     /translation="MPNMTHESSSKIPQINIGINGFGRIGRLVLRAALSHPEIKVRLI
                     NNPSTTPEYAAYLFKYDSTHGKYPGEVEFDDERIIIQNDEVSAHIPLSHFREPERIPW
                     SSYQVDYVIDSTGAFKELDTASRHKGIKKVIITAPSKTAPMYVFGVNHKKYDPTRDNI
                     VSNASCTTNCLAPLVKALDDEFGIEEALMTTIHATTASQKTVDGTSSGGKDWRGGRSC
                     QGNIIPSSTGAAKAVGKILPELKYSITGMSIRVPTINISLVDLTFRTRKPTSYDEIIS
                     ALELKSRREMKGVLGVTKDAVVSSDFTSDSRSSIVDAKAGIQLNDHFFKVLSWYDNEY
                     GYSSRVVDLTMYMAQRDFEAGI"
     gene            complement(<636683..>638041)
                     /gene="HOS2"
                     /locus_tag="KLMA_20297"
                     /db_xref="GeneID:34714772"
     mRNA            complement(<636683..>638041)
                     /gene="HOS2"
                     /locus_tag="KLMA_20297"
                     /product="probable histone deacetylase HOS2"
                     /transcript_id="XM_022817906.1"
                     /db_xref="GeneID:34714772"
     CDS             complement(636683..638041)
                     /gene="HOS2"
                     /locus_tag="KLMA_20297"
                     /codon_start=1
                     /product="probable histone deacetylase HOS2"
                     /protein_id="XP_022674627.1"
                     /db_xref="GeneID:34714772"
                     /translation="MSSDTLKYDEKTEAEQPLFDCDFGMSYEPRVSYHFNPKVSQYHY
                     GVKHPMKPFRLMLTDHLVSSYGLHKVMDLYETRSASKEELMSFHSEDYVNFLAKVTPD
                     NLNKLPRGSLEKFNIGDDCPIFQGIFDYASMYAGASLDASRKLINGQSDIAINWSGGL
                     HHAKKNNPSGFCYVNDIVLAIVNLLRYHPRVLYIDIDLHHGDGVQEAFYTTDRVFTVS
                     FHKYNGEFFPGTGDLDEIGCSRGKHFALNVPLQDGIEDDSYINLFKSIIDPIITSFKP
                     TVIIQQCGADSLGHDRLGCFNLNIKAHGECVRFVKSFGIPMLVVGGGGYTPRNVSRLW
                     TYETGLLNGVLLKPNIPEEIPFRDWFGPDYSLHPTLDDLYENKNSKKFLENIRIRCLE
                     NIKYLQGAPSVRMDAELIPTQDITGLTEEEEELIKELNEENDMARLEQIEKDNYKVGE
                     LY"
     gene            <638853..>640460
                     /gene="IME4"
                     /locus_tag="KLMA_20298"
                     /db_xref="GeneID:34714773"
     mRNA            <638853..>640460
                     /gene="IME4"
                     /locus_tag="KLMA_20298"
                     /product="N6-adenosine-methyltransferase IME4"
                     /transcript_id="XM_022817908.1"
                     /db_xref="GeneID:34714773"
     CDS             638853..640460
                     /gene="IME4"
                     /locus_tag="KLMA_20298"
                     /codon_start=1
                     /product="N6-adenosine-methyltransferase IME4"
                     /protein_id="XP_022674628.1"
                     /db_xref="GeneID:34714773"
                     /translation="MSLNWGLVDFMVDNHLNIMGFPVQGRLQDAFVVYSMFMQNFLWK
                     DAEFTETYADFCRCLSEISDACGGCIQVEQAGHEHTFSDIISYLDVDSLKILQKVHYD
                     QAIKLSMKCSSRGIVKEDPRLLEGKETQKQIAVKATTTTTTAEKHALYGKLLQVLDQS
                     ENISPNAQYLKHLNDLLSKELGSTQLSKERAKLNTERAPFIPLCSNSEHISLLSTVVN
                     TSNNKIVSLQNDKLKRLEFDYPGIVECSETHIHFIPNLKPQTDLTLGDCSYLDTCHKL
                     NSCRYVHYFQYYPESLLKQKRKQEQNQNQNKTKTQSFYTQGECCSSSFKQIVPAQWIK
                     CDVRKFDFNILGKFSAVIADPAWNIHMNLPYGTCNDNELLQLPFDILQDEGLLFLWVT
                     GRAIEVGKESLQNWGYEVVNEISWIKTNQLGRTIVTGRTGHWLNHSKEHLLVGVKGNP
                     AWLNKKIDIDLIVSATRETSRKPDELYGIIERLVGTHARKLEIFGRDHNIRPGWFTIG
                     NQVTGSCIHEVDVKRKYKAAFPDQNRL"
     gene            <641078..>641461
                     /gene="COX13"
                     /locus_tag="KLMA_20299"
                     /db_xref="GeneID:34714774"
     mRNA            <641078..>641461
                     /gene="COX13"
                     /locus_tag="KLMA_20299"
                     /product="cytochrome c oxidase subunit 6A"
                     /transcript_id="XM_022817909.1"
                     /db_xref="GeneID:34714774"
     CDS             641078..641461
                     /gene="COX13"
                     /locus_tag="KLMA_20299"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 6A"
                     /protein_id="XP_022674629.1"
                     /db_xref="GeneID:34714774"
                     /translation="MFRQSIRRASTLPKHALEPAFGKPDLAAAQAYKEYIKNSTAHAQ
                     HTSNLWVKISLFVAAPAIALTAVNTYFVEAEHAKHREHLKHVPDEDWPRDYEFQNIRT
                     KPFFWGDGDKTLFWNPVINRHISHD"
     gene            complement(<642032..>643390)
                     /gene="CDC55"
                     /locus_tag="KLMA_20300"
                     /db_xref="GeneID:34714775"
     mRNA            complement(<642032..>643390)
                     /gene="CDC55"
                     /locus_tag="KLMA_20300"
                     /product="protein phosphatase PP2A regulatory subunit B"
                     /transcript_id="XM_022817910.1"
                     /db_xref="GeneID:34714775"
     CDS             complement(642032..643390)
                     /gene="CDC55"
                     /locus_tag="KLMA_20300"
                     /codon_start=1
                     /product="protein phosphatase PP2A regulatory subunit B"
                     /protein_id="XP_022674630.1"
                     /db_xref="GeneID:34714775"
                     /translation="MAQHGFDFKFSQCFGDKADIVVTEADIITASEFDHTGDYLATGD
                     RGGRVVLFERNNTKHCEYKFLTEFQSHDAEFDYLKSLEIEEKINQIKWCRPTNQSHFL
                     LSTNDKTIKLWKIYEKNIKLVSENNLSEGTKSYNRRSTGNGSARAVISLQTLKLPKLS
                     LHDRIIAAAPKKIYSNAHTYHINSISLNSDQETFISSDDLRINLWNLDIPDESFNIVD
                     IKPANMEELTEVITSAEFHPQQCNLFMYSSSKGTIKLCDMRQNALCDYRAKVFEEYLD
                     PISHNFFTEITSSISDVKFSPDGRYIASRDYLTVKIWDVNMDNKPLKTINIHEQLEER
                     LNDTYENDAIFDKFEVAFSGDSSSVMTGSYNNNFMIYPNVVKTGDYQAPAGMDEIVLQ
                     ADKTAFKTKRLSSLQQQSARNKEWGDDIDFKKSILHFSWHPRENSVAIAATNNLFIFS
                     AL"
     gene            complement(<644807..>649594)
                     /gene="RIM15"
                     /locus_tag="KLMA_20301"
                     /db_xref="GeneID:34714776"
     mRNA            complement(<644807..>649594)
                     /gene="RIM15"
                     /locus_tag="KLMA_20301"
                     /product="serine/threonine-protein kinase RIM15"
                     /transcript_id="XM_022817911.1"
                     /db_xref="GeneID:34714776"
     CDS             complement(644807..649594)
                     /gene="RIM15"
                     /locus_tag="KLMA_20301"
                     /codon_start=1
                     /product="serine/threonine-protein kinase RIM15"
                     /protein_id="XP_022674631.1"
                     /db_xref="GeneID:34714776"
                     /translation="MSQEFDETASISSSNYDKYLRLATDKNPSILLELDLDGNVKHVS
                     KVWNSVVGTNRALILNKPISNIIIGTEYDKSVFQRALNMMLQDDNSYRVKFQTETGYL
                     MGDTENMGLSSSSSSSINNESINSDDDSNHKDQHNSSSDQQAQLQDNSKNKINEDDEW
                     YGNGESIELEAQGILVHDLYTQEPSHTMWIVKPFYDVDELDNLPYDLVKRLGFGAKIF
                     SQYLQKIEDMMVLDEADLPNPNFELCRVCETMIPTWWLETHSQICVCEHRLESVVQSA
                     QDELQEHRDLLESIITSLSKQRNLPINEYKGLPLPQNSSRVQSPSPLFQDITDCSDTT
                     DSLDSTPPPPPQCNIGTNFKPLYLLKDLCDEALEVNISHLKTIDQNSKGTGLLNPTAS
                     FFQFSPNTEAHIDHVLNWNSTFDVMDPSINLLIQDTINLCRHKVETVIRMDNTLKYSL
                     KVKNEVDLSISQLIKERIHSNRLNVSYTLDITPNNISGPPTTETLCSPQADMKLATPL
                     PQRLSASSNLFSESYMGTDMIPEPHTFNNTTSEAALSQSYFENSRSNSAQLSKSVTPK
                     QTVAESSQNSDAVSMETVSGVSTGSRSNPSTPKFSLNNYLHLPKLTSSISLTPRRGSP
                     VNFHTPNASISQSNSQIHPTFFSSSNIMGALSTTKSVNENSPMLSPFISGSEGLPHSE
                     QQQKVTPLSPLLLPTTGKSIVPSIKDYEVIKPISKGAYGSVYLAKKRVTGEYFAIKVL
                     KKSDMIAKNQVTNVKSERAIMMVQSDKPYVAKLYATFQNRENLFLVMEYLSGGDMATL
                     IKMMGNLPEKWAKQYICEVIVGVDDMHQNGIIHHDLKPDNLLIDSLGHIKLTDFGLSR
                     MGLLRRHKEKRRNSQLHTSRKTSVPSDGSLSRKNSSTDSLHSASAGGSLFEVLKKTER
                     SHSTSSSHSQPFSAIAEAPYLQRSGSHVSFTMAGLSRSGTPPLTATSNSNADHSIFPN
                     QPHNHHSRTSSILSEVVHDSPKDFALFNPNDSKNFFGTPDYLAPETIQGIGESDTCDW
                     WSVGCIFFEFLFGYPPFHGATADEVFENILAGTIDWPDFPDQETELEYISPEAKNLIL
                     KLLTLDPEKRLGANGSEEIKKHPYFKDVDWEHVYEEQPSFIPQVDNPEDTDYFDLRGA
                     SLQDFASSNYSDNDPDDYTMLDGTTGGKIIDAHLNRRLSNHSSGRNTPKQRLSISSVL
                     EMVNNNNNNPESPIANNSPTTKHMPLAIPPHMRDRRTSKLNESASPEFGSFNYRNLNA
                     LDKANKDAITRLKSEHLSEFMHQRTSSSSISSSSSDNSGRLKHTNTGSTQASIPTSLS
                     NRRSNSPLVLKLNSTSNSSPSRRNSVDTMNSQQQQLQQQQQQPIISKRNSDLSPYLAE
                     ESTTGGSSISSPLASKYKSPLSPPSVNVTPIGSSKTRKVSRNSLSSSTEDDERLSALS
                     KVNSVRELRRRSGRKSSSNKEDIQYKLDVLLCEPIPIHRYRVAEDLESIGCSVVSVGA
                     GDEMVRRATTGVKFDLIITAMKLSKIGAVDIAKLIRHTNSINCTTPIVALTVYYNDAK
                     EAKVFDEVLEKPVSVQQLRKLVSKYALLKSQSEEDTLLSDTDF"
     gene            <650367..>651236
                     /gene="REX2"
                     /locus_tag="KLMA_20302"
                     /db_xref="GeneID:34714777"
     mRNA            <650367..>651236
                     /gene="REX2"
                     /locus_tag="KLMA_20302"
                     /product="oligoribonuclease"
                     /transcript_id="XM_022817912.1"
                     /db_xref="GeneID:34714777"
     CDS             650367..651236
                     /gene="REX2"
                     /locus_tag="KLMA_20302"
                     /codon_start=1
                     /product="oligoribonuclease"
                     /protein_id="XP_022674632.1"
                     /db_xref="GeneID:34714777"
                     /translation="MSATEPSSSIDASKANNNVTPEKGANSIASQVPGKLYKPIVWID
                     CEMTGLDHINDKIIEICCIITDGHLNIVDENGYESVIHYDNSVMDKMGEWCTNQHGKS
                     GLTQKVLDSTKTRDQVEDELLNYIKKWIPEERKGVLAGNSVHMDRLFMIREFPRVIDH
                     LFYRIIDVSSIMEVARRHNPQLSKVSYKKKGAHTAKADILESIEQLKFYQNHYFKNET
                     ETKEFVDMRTAEIQKEQLLEQQKEIEDAKVSTAAAEITTDKSEGNKRNTDSVIELGQQ
                     SESLHAKKKTRNE"
     gene            <652024..>652935
                     /locus_tag="KLMA_20303"
                     /db_xref="GeneID:34714778"
     mRNA            <652024..>652935
                     /locus_tag="KLMA_20303"
                     /product="basic-leucine zipper (bZIP) transcription
                     factor"
                     /transcript_id="XM_022817913.1"
                     /db_xref="GeneID:34714778"
     CDS             652024..652935
                     /locus_tag="KLMA_20303"
                     /codon_start=1
                     /product="basic-leucine zipper (bZIP) transcription
                     factor"
                     /protein_id="XP_022674633.1"
                     /db_xref="GeneID:34714778"
                     /translation="MAGKNSVCDIPADFKPILPPRKRARTQEEKEQRRIERILRNRRA
                     AHQSREKKRLHLQHLEEKCHLLERILKTVDIEKLSLKDAKLGGMVNRWKELDCQTQSY
                     NAAAKQEMDSAMRSPESLTSSSPEHKENLLSCTTNSLDVSAGSVLSSGPVSTEEMSST
                     SPFVLPFEENGCSVLDEAENSSISNSGNADILGQNYYQLTSTPFVKVEDDYSVFVGGE
                     LNGNQHIAEESLIDTNPVVLFDNHNTTTTTNNNINKNVASETNEGWNLLLTSSPELKP
                     ELADSESFDLVDPIGLDTWRNPAVIVT"
     gene            <653946..>655019
                     /gene="AGX1"
                     /locus_tag="KLMA_20304"
                     /db_xref="GeneID:34714779"
     mRNA            <653946..>655019
                     /gene="AGX1"
                     /locus_tag="KLMA_20304"
                     /product="alanine--glyoxylate aminotransferase 1"
                     /transcript_id="XM_022817914.1"
                     /db_xref="GeneID:34714779"
     CDS             653946..655019
                     /gene="AGX1"
                     /locus_tag="KLMA_20304"
                     /codon_start=1
                     /product="alanine--glyoxylate aminotransferase 1"
                     /protein_id="XP_022674634.1"
                     /db_xref="GeneID:34714779"
                     /translation="MVSSGVREAMGIQSLAHTSPEFIKIFQQVLQKLRKVFQSTNPSD
                     QPIVLSGSGTLGWDIAGTNLVSSGDNVLTVSTGFFSDSFAQCLESYGTNVDVLKSEPG
                     KVVPLEKIESQLKSKTYQVITLTQVDTSTATLLDVASVAKLVQKVSPQTFIVVDGVCS
                     IGCEEFKFSEWGIDYVLTASQKALGVPSGLSVSLISERALKYALNKKSTQGFFTNLKR
                     WTPIMQAYEAGQGQYFATPSIQLVNALNVSLGEILDYGLDARVAKHKQTSDKFKQSLK
                     DLGLTLVSDDACSAHGLTAVYVENPGHVIQTLKSANGIVIAGGILPEIKSKYIRVGHM
                     GISATDDSLHHIDNVLTAIKNAI"
     gene            <655823..>657232
                     /gene="SHM2"
                     /locus_tag="KLMA_20305"
                     /db_xref="GeneID:34714780"
     mRNA            <655823..>657232
                     /gene="SHM2"
                     /locus_tag="KLMA_20305"
                     /product="serine hydroxymethyltransferase"
                     /transcript_id="XM_022817915.1"
                     /db_xref="GeneID:34714780"
     CDS             655823..657232
                     /gene="SHM2"
                     /locus_tag="KLMA_20305"
                     /codon_start=1
                     /product="serine hydroxymethyltransferase"
                     /protein_id="XP_022674635.1"
                     /db_xref="GeneID:34714780"
                     /translation="MPYALSESHKQLVSAHLTETDPEVEQIIKDEIDRQKHSIVLIAS
                     ENFTSTSVFDALGTPMCNKYSEGYPGARYYGGNEHIDRMELLCQKRALEAFNLTADKW
                     GVNVQTLSGSPANLQVYQALMRPHERLMGLFLPDGGHLSHGYQTENRKISAVSTYFES
                     FPYRVDPKTGIIDYDTLEKNAILYRPKILVAGTSAYCRLIDYKRMREIADKVGAYLMV
                     DMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGIRSVNPKTGKEIP
                     YDLEGPINFSVFPGHQGGPHNHTISALATALKQANTPEFKEYQVQVLKNAKVLEEVFK
                     KLGYRLVSDGTDSHMVLVSLREKGVDGARVEYVCEKINIALNKNSIPGDKSALVPGGV
                     RIGAPAMTTRGFGEPEFAKIVEYIDKAVQFAAKTQQSLPKEANRLKDFKAKVNEGSEE
                     LDQLKNEIYQWAGEFPLPV"
     gene            complement(<657608..>659746)
                     /gene="MNL2"
                     /locus_tag="KLMA_20306"
                     /db_xref="GeneID:34714781"
     mRNA            complement(<657608..>659746)
                     /gene="MNL2"
                     /locus_tag="KLMA_20306"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817916.1"
                     /db_xref="GeneID:34714781"
     CDS             complement(657608..659746)
                     /gene="MNL2"
                     /locus_tag="KLMA_20306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674636.1"
                     /db_xref="GeneID:34714781"
                     /translation="MFIKILIHLWRKCRSILLLLVTASILFYYTFENEIEHLNSFAYT
                     DSLPLIQNSVAHNSQTNHASAKSNEEEVSKGLTDKSSINEKNKYFPILLETEDEAVQY
                     QQENHIEKESFHPFHPFYERKAPIPYKQINIEYPKLNQITSIRANARFKDTLLERWIA
                     RLKKVEDFAELDLHSNASIVSTNFLLQSHNHDALTPVEIVPKLSHFDDPIEQRLWSSE
                     ILASVLSVLNQTNSEDHNNDVEIDTQSQYFRNLASKIGEMLLQSYDTPNNLPQIPFFW
                     KSPIKNRYAFRRTKSSLLATNILEFLKLSHVTNDPQFDSVIQHILLSFSKSAKSFDID
                     YLVPAVVDASGCLPLSDERISKGEHLRESHVLKSIHKGKYIHCKVTKSLLPTHNAVDN
                     VFVLDTIDLYLTIVKAYHLNNGNLYERKHTKISSVKTIMRSIKMLNETILFQPWLPSD
                     SEDLLLPTSIKSKAHFDVLEDSNEVALGKEFLVSPEGAKLSSLFAISGMLFNDSSLIE
                     QSKAITKGYYELYNLLGEIPDIVALDNKNDSTGPFEPLKKIELIKNSHYKLDTLALGV
                     KLDKPSENKPKHYLFSEAYPYIPQIEDVDEERQCWKFHSWPFYVNYMKASSRPPFEFV
                     ESLIYLYKITEDYQWKLIGEDLMKRTDWSQLSIPDTGKMIRLLFALFDDNVSIDDYVI
                     NSEYNFMSRDFKFMPTYQRKYLTFQDLEDK"
     gene            complement(<660247..>661200)
                     /gene="CAK1"
                     /locus_tag="KLMA_20307"
                     /db_xref="GeneID:34714782"
     mRNA            complement(<660247..>661200)
                     /gene="CAK1"
                     /locus_tag="KLMA_20307"
                     /product="serine/threonine-protein kinase CAK1"
                     /transcript_id="XM_022817917.1"
                     /db_xref="GeneID:34714782"
     CDS             complement(660247..661200)
                     /gene="CAK1"
                     /locus_tag="KLMA_20307"
                     /codon_start=1
                     /product="serine/threonine-protein kinase CAK1"
                     /protein_id="XP_022674637.1"
                     /db_xref="GeneID:34714782"
                     /translation="MSIKLQTASADLELFPDFVVKKVDLELQRPPHNAHTELEILNTL
                     SHKNVMRLIDHSITTGYVTFKFPRYRCDLNQYMDEHWKSKYNPYLLDNNSKKSYSNTL
                     PLDDSLLILKQVSEALSYIHANGIIHRDIKPHNIMMNSCNEVVLGDFGISYNRNIDNP
                     AKTCDCSTSIYKAPELLFSISDYQYEIDIWALAIMLSQLWNDKAESKSSTSKLINIDL
                     EECSDIKLVLTLFHQLGKPSTEDWPQIARNDSFHGMFGNLTSDNYIDRLPLETKLQKV
                     FEWMPLIKDNSKLALMWLSMVKFNREQRISAKHILEIMATI"
     gene            complement(<661751..>662809)
                     /gene="ERG3"
                     /locus_tag="KLMA_20308"
                     /db_xref="GeneID:34714783"
     mRNA            complement(<661751..>662809)
                     /gene="ERG3"
                     /locus_tag="KLMA_20308"
                     /product="c-5 sterol desaturase"
                     /transcript_id="XM_022817920.1"
                     /db_xref="GeneID:34714783"
     CDS             complement(661751..662809)
                     /gene="ERG3"
                     /locus_tag="KLMA_20308"
                     /codon_start=1
                     /product="c-5 sterol desaturase"
                     /protein_id="XP_022674638.1"
                     /db_xref="GeneID:34714783"
                     /translation="MDLLLEYCDTFGLDHLYAKLFPANLLPADVPKNVIQLLDLQLPG
                     FNSSVKPPGDVYGYEPFLLDFTEYTFQSLFPRHNLFRQTLTMFVLMTIFGWLLYFSVA
                     TVSYLFVFDKAVFNHPRYLKNQMSLEMKQAFSAIPTMVLLTIPFFLLELNGYSKLYLD
                     VDYRSWSGVRQLATEVFCFIMFTDCLIYLVHRWLHWPNVYRWLHKPHHKWLITTPYAS
                     HAFHPVDGFMQSLPYHLYPMLFPLQKLSYLILFTFVNFWTVMIHDGEYLANDPIINGA
                     ACHTVHHLYFNYNFGQFTTLWDRLGGSYREPDQELFNKSLKKSKQTWEIQVEKMEAIK
                     KQVEGDHDDRVYVSTKSC"
     gene            complement(<663708..>664553)
                     /gene="CAF16"
                     /locus_tag="KLMA_20309"
                     /db_xref="GeneID:34714784"
     mRNA            complement(<663708..>664553)
                     /gene="CAF16"
                     /locus_tag="KLMA_20309"
                     /product="CCR4-associated factor 16"
                     /transcript_id="XM_022817921.1"
                     /db_xref="GeneID:34714784"
     CDS             complement(663708..664553)
                     /gene="CAF16"
                     /locus_tag="KLMA_20309"
                     /codon_start=1
                     /product="CCR4-associated factor 16"
                     /protein_id="XP_022674639.1"
                     /db_xref="GeneID:34714784"
                     /translation="MSDKNIKDNNNLAVEVKNLTYTFPEGKAASIIDLSLSIKWNKKV
                     LVVGNNGAGKSTLLKLLSGKHLCLGGDIRVGGRNPFAPNNDQESVTLTTYLGTEWASM
                     SIIHRDIGVLELLESIGLEHYRERGERLIQILEVDTNWRMFKLSDGQKRRVQLCMGLM
                     KPFKVLLLDEVTVDLDVVARDRLFQFLDDETKQRECTVVYATHIFDGLAQWADEVIHL
                     QDGRIAKMLDYGRDIEFTKDIEGVQEQSASDNKPYKVVLGYMKSLYPLALHWLSRDQD
                     AHHAA"
     gene            <664893..>666809
                     /gene="SPT8"
                     /locus_tag="KLMA_20310"
                     /db_xref="GeneID:34714785"
     mRNA            <664893..>666809
                     /gene="SPT8"
                     /locus_tag="KLMA_20310"
                     /product="transcription factor SPT8"
                     /transcript_id="XM_022817922.1"
                     /db_xref="GeneID:34714785"
     CDS             664893..666809
                     /gene="SPT8"
                     /locus_tag="KLMA_20310"
                     /codon_start=1
                     /product="transcription factor SPT8"
                     /protein_id="XP_022674640.1"
                     /db_xref="GeneID:34714785"
                     /translation="MDDVDEILNENNVQNTQDDDVDMEDELEDGIEDVDVPHVDEDEP
                     MEDDEEPEDEGEDDEEDEDDEEEDDDDDDDDDDDDDDDDDDDDDDDDQDGDHAEDNGD
                     TKQSKTTNDDNSLANGSENKGNKDSGLGADDEDGDKVDDEDEDLKEADSSPDGKPAEM
                     SKLDKIHQYYTHLHQSASIADSYNILPTAAIPIQTNVQALTMSKGLRYLFLGGADGFI
                     RKFDFLNTVDGKLSLTIQQKNALVDSIINAGILTSYWENEVPQPLSKVKWVKQKTDYI
                     PLVSPVHSLAVQSECLYILAGQESGGIVMQGVRYFEGRTSHYFKGHSSIVNHLLINDD
                     ETKFLSGSWDKTVIEWDLETGAQLSKFNATSQLSSLEYRPINATYKLPEPSIDANEPS
                     SKGDTSTNMDDIDIDTNSLFGDDDDEEEDEQKEEQKEKEEEGEGEKAKEENKESEDSN
                     SQRDELDKKHESEIISKNTLSLKTDESIFLTSCIDGNIQIWDKRQPSSHILKLGRNLS
                     TPPWCMSACWSADGNKIIAGRRNAVVEIYDLRKPELPESKLKLPSISGPVSKVKAMPN
                     NHHVIAASNDNIRIFDINNIDKTPLIIPGHHGGCISNLYVDPTCRFMISTSGNRGWQG
                     NTTDVTIIYDIELN"
     gene            complement(<666984..>668189)
                     /gene="GYP8"
                     /locus_tag="KLMA_20311"
                     /db_xref="GeneID:34714786"
     mRNA            complement(<666984..>668189)
                     /gene="GYP8"
                     /locus_tag="KLMA_20311"
                     /product="GTPase-activating protein GYP8"
                     /transcript_id="XM_022817923.1"
                     /db_xref="GeneID:34714786"
     CDS             complement(666984..668189)
                     /gene="GYP8"
                     /locus_tag="KLMA_20311"
                     /codon_start=1
                     /product="GTPase-activating protein GYP8"
                     /protein_id="XP_022674641.1"
                     /db_xref="GeneID:34714786"
                     /translation="MNSEWEETETSFDMASLSFISDLDQSKLKRVIISNALQNEDVKG
                     LEQLGVSKFGFVNAQLRGKAWLSLLKSRVKGSSENKPLRQPHKDEYQVKLDVNRALSF
                     ISDEKRKLKLRVLLYDTIVKVLRKFPQLHYYQGYHEVISVFVLTCDPEILDTVVELFT
                     LLYLRDYMMDSLQCTLEQLDVLSQFIIGRDEQLANVLQLTKRKPIFAIASVLTLLTHN
                     FEYFEQDSPIFSIFDIIISTNNLSNIFVIYTELLVYFKEEILKQIKAFEADFENDMDV
                     IHSVVQQTLLKLLRISAWDEILAQSRLRFDEESPKKYNFTKYVNRYSSLLPLVNSDES
                     ELIDILGKEIEWNESRKITKVSIKISPIIKWSLVIGIIAAVVKVGSSHTNTMHGSSLI
                     ESLKKVLST"
     gene            <668629..>668937
                     /gene="coa6"
                     /locus_tag="KLMA_20312"
                     /db_xref="GeneID:34714787"
     mRNA            <668629..>668937
                     /gene="coa6"
                     /locus_tag="KLMA_20312"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817924.1"
                     /db_xref="GeneID:34714787"
     CDS             668629..668937
                     /gene="coa6"
                     /locus_tag="KLMA_20312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674642.1"
                     /db_xref="GeneID:34714787"
                     /translation="MGWFSKQKEMDDPTKAPSRSSRKQCWESRDLFFACLDKIDVVNA
                     LDPKHQKVIKSNCSSEEAKFEHDCATSWISYFKEKRVVDFKREKFLKQMEEQQQQQGK
                     "
     gene            complement(<669436..>670500)
                     /locus_tag="KLMA_20313"
                     /db_xref="GeneID:34714788"
     mRNA            complement(<669436..>670500)
                     /locus_tag="KLMA_20313"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817925.1"
                     /db_xref="GeneID:34714788"
     CDS             complement(669436..670500)
                     /locus_tag="KLMA_20313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674643.1"
                     /db_xref="GeneID:34714788"
                     /translation="MVSVRNLTYLWYSSLVLAKTPSKKPDSYHHVHAHDHAKKLGKNI
                     EGKEVTHLFRRGGTCQFPNGDGMVAVQTSGKNAGWAMHNDQECSYGSWCPYACEPGQL
                     MNQWDPDVTSYTYPGSQYGGLYCDDSGNLQKKRSGGYCYSGKGTVVAKNNAGGEVAFC
                     QTVLPGNEEMLIPTSVGGGSSQTLAVPGPEYWAGTAAHYYVNPPGTSADDGCQWGTNA
                     KAIGNWAPYVAGANMDASKSTFVKIGWNPVYLEQGSSFRNDKPSYGIKITCDDESKCV
                     GLPCSIDPSKQNVNEVESSLKSQGDGASFCVVTAQNGAKANIEVFEVGGGGNQKREHH
                     EHKENNVITTTKYKTVTVNV"
     gene            <672121..>673449
                     /gene="ZRC1"
                     /locus_tag="KLMA_20314"
                     /db_xref="GeneID:34714789"
     mRNA            <672121..>673449
                     /gene="ZRC1"
                     /locus_tag="KLMA_20314"
                     /product="zinc/cadmium resistance protein"
                     /transcript_id="XM_022817926.1"
                     /db_xref="GeneID:34714789"
     CDS             672121..673449
                     /gene="ZRC1"
                     /locus_tag="KLMA_20314"
                     /codon_start=1
                     /product="zinc/cadmium resistance protein"
                     /protein_id="XP_022674644.1"
                     /db_xref="GeneID:34714789"
                     /translation="MKSGKEVRILTLLVIDTTFFFIELISGYAVHSLALIADSFHMLN
                     DIISLVIALWAVNVAKNKDPDAKYTYGWKRAEILGALINSVFLVALCVSILIEAIQRF
                     FEPQEITNPKLVLVVGCFGLLSNFVGLVLFHSDGGHGHGHSHGGLDDVEHGHGGSDDD
                     SDEHSHSHGHGHSHLHMNNGFDQESSDYEPDNIEDMLPHSVVERTLSPKTHHLDSSYD
                     DDNESTALLNEQHLNANLSKGDNKRKKSKKQRSMNMHGVFLHVLGDALGNIGVISTAL
                     FIWKTNYSWRFYTDPAVSLFISIIIFSSAIPLSMKASRILLQATPSNISADDVKMDIL
                     ALPGVISIHDFHIWNLTESLYIASLHVEVKSKPEEFMHIAKVIRSIFHKYGIHSATVQ
                     PEFVGPDAVTDDIARRFSRIAGGGVYGSTTNLTGCTVDETAQCNTETCLE"
     gene            complement(<674376..>675431)
                     /locus_tag="KLMA_20315"
                     /db_xref="GeneID:34714790"
     mRNA            complement(<674376..>675431)
                     /locus_tag="KLMA_20315"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817927.1"
                     /db_xref="GeneID:34714790"
     CDS             complement(674376..675431)
                     /locus_tag="KLMA_20315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674645.1"
                     /db_xref="GeneID:34714790"
                     /translation="MIQPPSTPQHKLTRECNTMPFPEFKFGFNSKFQFPIQNKTTESP
                     CKSHSEVFRNQTLPLQINVPSVEEIYLEDDLTFSSHISIPLIRAQQDDEYEENGCTLN
                     DESEENSESCEDDSITSSILSSRSDFESSTPSSSPILGTDFLKPAIPDEIFKNTTAFN
                     ADSLFKSPASNKMRFKPNRSLKPKKAILKRTNGLNYIMNSLNGNFKDATIFATEVNSY
                     LSENVPYPTCPLERVTIPVNSEIKRKYKEERNELLGGYYNSSDDECDQNSPSFLQEEA
                     TESSSNTNKTKIGSDAAVIRAYEFTFGSPTSSTSSEKDSDRLTLKLGIDPSNQVMNVK
                     KDSGKEKRLRWCDSIEW"
     gene            <680412..>682805
                     /gene="isp4"
                     /locus_tag="KLMA_20316"
                     /db_xref="GeneID:34714791"
     mRNA            <680412..>682805
                     /gene="isp4"
                     /locus_tag="KLMA_20316"
                     /product="sexual differentiation process protein isp4"
                     /transcript_id="XM_022817928.1"
                     /db_xref="GeneID:34714791"
     CDS             680412..682805
                     /gene="isp4"
                     /locus_tag="KLMA_20316"
                     /codon_start=1
                     /product="sexual differentiation process protein isp4"
                     /protein_id="XP_022674646.1"
                     /db_xref="GeneID:34714791"
                     /translation="MERIKKFFDTDAPVTEKELITVTDDNLGAPVVDSSEDNSQDDEK
                     KFGLKAVISPVRSDDFLANQLSKEIVEDEYAGIVVEDDSPYPEVRASVPSTDDPTIPQ
                     NTVRVWVIGMVMATIGSALNMLFSLHAPSITLSSFITGIIAWPVGKAWEKYVPNVRMF
                     GRYGGPYLNPCPFGLKEHTLIQVMSDVSFGGGAAYATDIFLAMNNYFGKDFGWGFEIV
                     AILATQCIGFSLAGLVREILVTPPEMIWPGNLVTTTFLTNLHVNENHVANGWKISRLK
                     FFFIVFMAGFVYYWLPGFLFQALSYFAWITWIKPNDVIVNQVFGASTGLGLFPLTFDW
                     NQIAGYVGSPLVPPIGTIVSILISMVFVFWIAVPAVHYSNVWYGKYLPISDSGSYDRF
                     QAPYNVSKIVTSNLSFDKKAYKEYSPLYLPTTFAISYGMSFASNAATIVHTFLFHGKE
                     VKNAFKTLDKREQDVHNRLMKEYKEIPWTWYFAVFLVFFGLSIACVRGWETEMPVWAL
                     VFALIIAFVFLVPIGIIAAITNMAVGLNVITEFIIGYILPGRPIAMMFFKTFGYITNA
                     QAITYASDMKLGHYMKIAPRMMFSAQFIATMWSCIVQVAVLKWAQGNISEMCSKHQKS
                     HFTCPGARVFFNAAIIWGVIGPQRMFSAGQLYNKVLYFFLIGALTPLANWLILKKWPN
                     SPVKYLHWPVFFSGTGSIPPATPYNYGAFCMVGIAFGYFIKKKWFHWWSKYNYSLSAA
                     LDIGLAWSSLIIFFSLQLTNKNAPSWWGNNVINTVEYNGEAIQKILPEGESFGRTSW"
     gene            <684114..>685169
                     /gene="SPS4"
                     /locus_tag="KLMA_20317"
                     /db_xref="GeneID:34714792"
     mRNA            <684114..>685169
                     /gene="SPS4"
                     /locus_tag="KLMA_20317"
                     /product="sporulation-specific protein 4"
                     /transcript_id="XM_022817929.1"
                     /db_xref="GeneID:34714792"
     CDS             684114..685169
                     /gene="SPS4"
                     /locus_tag="KLMA_20317"
                     /codon_start=1
                     /product="sporulation-specific protein 4"
                     /protein_id="XP_022674647.1"
                     /db_xref="GeneID:34714792"
                     /translation="MSIFRKKHSHQTTQEPAPVQPHESEPAQEGAHEGHQESQPVSFK
                     TVDHINGYPLVQQTKDILDSIAVARVVKANTLPTANAILASKPVKLVEPVTKVVDTVA
                     DSGLTLTEKVIPSLKTKTYQRLGEEAMIPYNLTSKAVNKTVDTTVSAAESYIYEPTHN
                     QILKFRQYYNEKVYDTHGKPLIRGSLDPIVSPVNKWYESLIKYSFPEGKEVPTNGYSN
                     ELDRSFALTFNAIQRAASALNKKTVETVWAPCNYVKHVNEVLNVNLDKQEDLSLPKSW
                     VATKDSVQELNKETLDYLKSLSPIGAIPTFKKKKSTTEEAEPAVAAESTEITHEQANN
                     EQAPALESNHAEAIPAN"
     gene            <686397..>687403
                     /gene="RPL20B"
                     /locus_tag="KLMA_20318"
                     /db_xref="GeneID:34714793"
     mRNA            join(<686397..686411,686900..>687403)
                     /gene="RPL20B"
                     /locus_tag="KLMA_20318"
                     /product="60S ribosomal protein L20"
                     /transcript_id="XM_022817931.1"
                     /db_xref="GeneID:34714793"
     CDS             join(686397..686411,686900..687403)
                     /gene="RPL20B"
                     /locus_tag="KLMA_20318"
                     /codon_start=1
                     /product="60S ribosomal protein L20"
                     /protein_id="XP_022674648.1"
                     /db_xref="GeneID:34714793"
                     /translation="MNLRKEYQVIGRRLPTESVPEPKLFRMRIFAPNDVVAKSRYWYF
                     LQKLHKVKKASGEIVSLNVIHEAHPTTVKNFGVWVRYDSRSGTHNMYKEIRDVTRVGA
                     VESLYQDMAARHRARFRSIHILKVVELEKTADVKRQYVKQFLTKDLKFPLPHRVQKTN
                     KVYAYKRPSTFY"
     gene            <687978..>688823
                     /gene="DGK1"
                     /locus_tag="KLMA_20319"
                     /db_xref="GeneID:34714794"
     mRNA            <687978..>688823
                     /gene="DGK1"
                     /locus_tag="KLMA_20319"
                     /product="CTP-dependent diacylglycerol kinase 1"
                     /transcript_id="XM_022817932.1"
                     /db_xref="GeneID:34714794"
     CDS             687978..688823
                     /gene="DGK1"
                     /locus_tag="KLMA_20319"
                     /codon_start=1
                     /product="CTP-dependent diacylglycerol kinase 1"
                     /protein_id="XP_022674649.1"
                     /db_xref="GeneID:34714794"
                     /translation="MVDHKSKDSFKESDIKQRGISSTKIQGSISDANLGSSSSDVHLP
                     LKEIHLKSHEWFGDFITKHEIPRKVFHSSIGFITLYLYTQDVDYKKVKFPLIVGFTVV
                     FTLDVIRLNFPGFNKLYCRCVGALMRKREIHAYNGVLWYLLGLTFAFTFFSKDVALIS
                     LFLLSWSDTAASTIGRKYGHLTPKVAKHKSLAGSLAAFLVGQLTCYAFYGYFVPHYSW
                     VNKPGEISWSEETSKLNLHQFSLFGGFVAALSEGIDIFNWDDNFTIPVLSAIFMSSVI
                     RFFKK"
     gene            <689440..>690981
                     /gene="NOP58"
                     /locus_tag="KLMA_20320"
                     /db_xref="GeneID:34714795"
     mRNA            <689440..>690981
                     /gene="NOP58"
                     /locus_tag="KLMA_20320"
                     /product="nucleolar protein 58"
                     /transcript_id="XM_022817933.1"
                     /db_xref="GeneID:34714795"
     CDS             689440..690981
                     /gene="NOP58"
                     /locus_tag="KLMA_20320"
                     /codon_start=1
                     /product="nucleolar protein 58"
                     /protein_id="XP_022674650.1"
                     /db_xref="GeneID:34714795"
                     /translation="MAYVLTETSAGYALLKASDKKIYKSSTLIEDLNSSEKVLKQFKI
                     AAFSKFSSAANALEEANSVIEGKVSSQLEKLLEECKTDKKATLVVSETKLANAINKLG
                     LNFNVVSDAVTLDIYRAVKEYLPELLPGMNDEDLSKMSLGLAHSIGRHKLKFSADKVD
                     VMIIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRVNA
                     AETDMSEILPEEIEERVKTAAEVSMGTEITPVDLENIKCLAEQIVEFAAYREQLSNYL
                     SSRMKAIAPNLTQLVGELVGARLIAHAGSLISLAKSPASTVQILGAEKALFRALKTKH
                     DTPKYGLLYHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLECRA
                     KVESRLSQLEGRDLRTTPKVVREHKKVEITEARAYNADADAVTTAAPSADSDDESEEE
                     EETKEKSKKEKKEKKRKRDEDEDESKESKKSKKEKKDKKEKKEKKDKKEKKDKKEKKE
                     KKSKK"
     gene            <691339..>692982
                     /gene="SNU66"
                     /locus_tag="KLMA_20322"
                     /db_xref="GeneID:34714796"
     mRNA            <691339..>692982
                     /gene="SNU66"
                     /locus_tag="KLMA_20322"
                     /product="U4/U6.U5 small nuclear ribonucleoprotein"
                     /transcript_id="XM_022817934.1"
                     /db_xref="GeneID:34714796"
     CDS             691339..692982
                     /gene="SNU66"
                     /locus_tag="KLMA_20322"
                     /codon_start=1
                     /product="U4/U6.U5 small nuclear ribonucleoprotein"
                     /protein_id="XP_022674651.1"
                     /db_xref="GeneID:34714796"
                     /translation="MGDITSISLEETNKIRASLGLKLIPIPVNNVPIEHDKEVHTLKK
                     KVRTSHPETTTYETQHTYEHERLRNRIQESKKHLDSSHGNREIEDVESIDDWLANVGK
                     ESTNKGNTLPPAVKSKNTFGVSENVTDITIPNELKTLVDEKPIILTLKDTTENDTNGE
                     DGYEDILENEKHSHDKQDAENLKLRQLNKNRRLGKVSLYDYEREENEDDVLREMESIA
                     GTQSSSNKIRIESDSSDEDNVIQDYAPIKLKKRKKISANQTKPRKIDNNKMMKVDLVN
                     LDDDVTEEPPQILFKVKRKPQKAEENEANIQQVNHHDNAKKMGIHILNNSKDGFIFDD
                     TDEFLDSLKGDVLKRESETRPIKIDLKNPQRTQSEMTPETSTSEWKEGKEKELDFSEG
                     VAGMISFLKEKNILKSQNGSGQTSGSKTVRSGMVNLEEAKTLRSIDTSSKELSSHLNS
                     QAMDLSEEESRKVQLSNEENIASKLHRIQSEKLQNYNPNVELSYRDSEGNELTTKEAY
                     KKLSQSWHGTKSNRKTIEKQRKKIAQRRNVMEKESLFDD"
     gene            <693524..>694855
                     /gene="SLY41"
                     /locus_tag="KLMA_20323"
                     /db_xref="GeneID:34714797"
     mRNA            <693524..>694855
                     /gene="SLY41"
                     /locus_tag="KLMA_20323"
                     /product="uncharacterized transporter SLY41"
                     /transcript_id="XM_022817935.1"
                     /db_xref="GeneID:34714797"
     CDS             693524..694855
                     /gene="SLY41"
                     /locus_tag="KLMA_20323"
                     /codon_start=1
                     /product="uncharacterized transporter SLY41"
                     /protein_id="XP_022674652.1"
                     /db_xref="GeneID:34714797"
                     /translation="MIVTAKSVTSKRRPSINKLGSEASFSVQAQKVSQESFRGHKHTN
                     SFNEVRRLQNRTWKQKIVELFPQNAQEYLPEINIHVSILCVIWYMTSSISSNLSKAIL
                     SQFPHPVGLTELQFFLSASLCLAFVIFANHLHKPKSSSSQLRDAVLNFPEGILPNYLN
                     GSFSTCISKTFLVPSKVIWCTTFPMGIFQFVGHITSHKSTSLIPVSLVHSVKALSPIA
                     TVCYYRFSKGKQYNNMTYYTLIPLILGVMITCWTSHNNKNSLAQTDRLSFIMGLAFAF
                     ISMIIFVSQNIFAKGILTVKSKDILPSKNKSQLDLTQIKMEERSMMKLDKITILFYCS
                     CVGFILTFPIFVTNELFSGSASVFGDLTFKILILVIIHGVAHFFQAMLAFQLIGMLSP
                     VTYSIANIMKRIMIIGVAFIWESNLSINQLFGLSLTIIGLYGYDKWGNKKL"
     gene            complement(<695340..>696266)
                     /gene="YHM2"
                     /locus_tag="KLMA_20324"
                     /db_xref="GeneID:34714798"
     mRNA            complement(<695340..>696266)
                     /gene="YHM2"
                     /locus_tag="KLMA_20324"
                     /product="mitochondrial DNA replication protein YHM2"
                     /transcript_id="XM_022817936.1"
                     /db_xref="GeneID:34714798"
     CDS             complement(695340..696266)
                     /gene="YHM2"
                     /locus_tag="KLMA_20324"
                     /codon_start=1
                     /product="mitochondrial DNA replication protein YHM2"
                     /protein_id="XP_022674653.1"
                     /db_xref="GeneID:34714798"
                     /translation="MSQQPVELKKKPISFSNILLGAGLNLCEVTTLGQPLEVIKTTMA
                     ANRQFSFLQAIRHIWARGGVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYHFKKLGL
                     NNFGAGIMGGISGGVAQAYLTMGFCTCMKTVEITKKKSAVGGVQQSSLAAFKEIYKKE
                     GIRGINKGVNAVAIRQMTNWGSRFGLSRLVEEGIRKVTGKTSPEDKLTAWEKIFASAI
                     GGGLSAWNQPIEVIRVEMQSKTEDPNRPKKLTVGKAFKYIYSTNGIKGLYRGVTPRVG
                     LGIWQTVFMVGFGDMAREFVGRLTGETPTAKH"
     gene            <697500..>698972
                     /gene="MCH5"
                     /locus_tag="KLMA_20326"
                     /db_xref="GeneID:34714799"
     mRNA            <697500..>698972
                     /gene="MCH5"
                     /locus_tag="KLMA_20326"
                     /product="riboflavin transporter MCH5"
                     /transcript_id="XM_022817937.1"
                     /db_xref="GeneID:34714799"
     CDS             697500..698972
                     /gene="MCH5"
                     /locus_tag="KLMA_20326"
                     /codon_start=1
                     /product="riboflavin transporter MCH5"
                     /protein_id="XP_022674654.1"
                     /db_xref="GeneID:34714799"
                     /translation="MDTDRIEQPDVLSPQASRSLLMRKSQVKPDIEKNDLCDINTHTE
                     QTRPVKSGKKMPSFIEDDGIVYPEGGLKAWIVIFGCFCGFIPVFGMLNTIGVIETYVG
                     KNQLSDVSSSTVGWVFSIYSFVNFASCIFSGTYFDRNGAKLPLVVGSLFHVGGLFGMA
                     NSTRLWHFILSFSILTGLGNGILMSPLVSVPSHYFLARRGTATAVATTGGSIGGIMYP
                     LILRKFFAMHQGSSDFYGFVWGIRTLAFINMFLLLIAMSLARERLPHKDLSEEEKAIP
                     VWRRILNTYFVRSFDIFAFKELKYAFCVFGTLFGEISIITGITYFGSYAMKQGMKEST
                     TYLLFMVINIAGIPGRWLPGIFSDIFGRFNVAIFTLSILTLLTFVMWLPFANSEGVLF
                     AFSALYGFFSGSIFSILPVCCGQISKTEEFGRRYSTMYFVVAFGTLVAVPISGAIIGT
                     DKSSAGYDHYVIWCGVTSFVSASCYFISKTIAVGFNRSRF"
     gene            complement(<699211..>699918)
                     /gene="RRG7"
                     /locus_tag="KLMA_20327"
                     /db_xref="GeneID:34714800"
     mRNA            complement(<699211..>699918)
                     /gene="RRG7"
                     /locus_tag="KLMA_20327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817938.1"
                     /db_xref="GeneID:34714800"
     CDS             complement(699211..699918)
                     /gene="RRG7"
                     /locus_tag="KLMA_20327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674655.1"
                     /db_xref="GeneID:34714800"
                     /translation="MSWKGLLKGSFPKDTIQRYIVANEGIANSTVFQGTLYELTVMRE
                     LMEKLRMEHMQVVGGSYDGGVDIRGRWDVTPIITEVDRHIHFEELPKRIKVNNTTIKP
                     WRHRVKPSKYLDCYVQCKAFNSEKITGRQVRELIGVFAMQVPLSKRSSSIMIMSAPTL
                     FTKDGITLFNEAQIPMIFTRVEMISALGNGNFDVENSGKLLQYYENDYASKLLANCGI
                     KEWLKLRAYEAINKNEL"
     gene            <700155..>700364
                     /locus_tag="KLMA_20328"
                     /db_xref="GeneID:34714801"
     mRNA            <700155..>700364
                     /locus_tag="KLMA_20328"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817939.1"
                     /db_xref="GeneID:34714801"
     CDS             700155..700364
                     /locus_tag="KLMA_20328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674656.1"
                     /db_xref="GeneID:34714801"
                     /translation="MSTQPIITSNSKDSKDSSEHPTSDVPTVFDVASDIQQSLQDLLR
                     KVNEDDAVFNKSVNSIYDKLKKMEE"
     gene            <700565..>702028
                     /gene="CUS1"
                     /locus_tag="KLMA_20329"
                     /db_xref="GeneID:34714802"
     mRNA            <700565..>702028
                     /gene="CUS1"
                     /locus_tag="KLMA_20329"
                     /product="protein CUS1"
                     /transcript_id="XM_022817940.1"
                     /db_xref="GeneID:34714802"
     CDS             700565..702028
                     /gene="CUS1"
                     /locus_tag="KLMA_20329"
                     /codon_start=1
                     /product="protein CUS1"
                     /protein_id="XP_022674657.1"
                     /db_xref="GeneID:34714802"
                     /translation="MAKKSKNHRRRSKHQQATQVNEEAEKKKKLASLLDQAEAQNQDK
                     DTIRNLDPIDIKDETLNKVIQKFTLSAEDSRQKPIVIRTIKDTNDKEEREEDDTASHL
                     EDDEDFEERQPISKRQQRISNKPSIAILKASVPYPELIEWFDCDAEWPFFNAAIKTSH
                     NVVGVPKHWQMKRGYLSGRSVLERRPFELPEIIKQTDIETMREAIPQGNENGTDNKKL
                     KEIARARVQPKLGTLDLDYKRLYDAFFTLGKNWKPELLPFGDLYYENRQLEAELEWKK
                     IKSKYRPGFLSEELREALQLQEGMLPPWCHEMNKLGLPKSYPDMKVCGINWDISNLSS
                     SQYGYWPGDKSLEKSKKNLFGSLVSFDELEHGDINVDWNNSYSSDNDEDDEDGEDGVD
                     NLASTNDGASFEVDETPKEVLANIADDPAKSYKYDENKPLFTVLSESKSYEVDGSDIS
                     GLTRTYDTSHKRSKPDDQNDTKESKKQKLEEEPDFRF"
     gene            <702341..>704863
                     /gene="NAT1"
                     /locus_tag="KLMA_20330"
                     /db_xref="GeneID:34714803"
     mRNA            <702341..>704863
                     /gene="NAT1"
                     /locus_tag="KLMA_20330"
                     /product="N-terminal acetyltransferase A complex subunit
                     NAT1"
                     /transcript_id="XM_022817942.1"
                     /db_xref="GeneID:34714803"
     CDS             702341..704863
                     /gene="NAT1"
                     /locus_tag="KLMA_20330"
                     /codon_start=1
                     /product="N-terminal acetyltransferase A complex subunit
                     NAT1"
                     /protein_id="XP_022674658.1"
                     /db_xref="GeneID:34714803"
                     /translation="MYKKKVPSRGVPALGMGRSKYDNNMLEALQMYESKNYKKSLKML
                     DAILKKNSSHIDSLILKGLNLQFCGTPEEASSYIEKALSKIDGTVVSPIGGHLLGIYY
                     RQVKNYADAVKWFKAALENGSTNTQIYRDLATLQSQIHDFKGALESRKMYWENYRGYR
                     ANWTSLAVAHDLNGNLQEAVNLLSKFEELAAGKLGEPEMYENSECAMYKNDIMYRQAG
                     NDKQALELTLKKLEDIYDDVYDKYGWLERKASILMKLGQTKEASLVYRQLIKRNPDNF
                     RYYKLLEVALGTLGNEKLRIALYEKLAKFYPKSEPPKFIPLTFIKDKAVLTDKLQSYI
                     LGQLNRCVPATFNNIKPLYKKEGIADIVESIVLPYYEGLSSTDQPLQYVWSTYFLALH
                     YLHRKQFEVANNYADKALAHTPTLVELYILKARVMKHLGLLEEAAEIMNNGRKLDLQD
                     RFINAKTVKYLLRADNNDEATEIVSLFTKNDHTQNGVPDLHLLEASWFIIEQAESFYR
                     SFKKATKELDALKSVDVESIADEEAVAEHDKSLKEAEFNAKLYEGLALKRFMAIPKIY
                     KQFDDDQLDFHSYCMRKGTPRAYLEMLQWGNSLFTLPMFVRAMEGASKISFRRFDLMQ
                     TLGSSDTAEKADTSSKKKNNKKAKKEAAALNKKKEELKSKYQAYTDDKDAFGEALLDD
                     PKPLELFDKEFMTLYTSHVTDATRRHLLEFEFNLRTGKLALALGALIKYVKRYGKTSV
                     AASMALVLSENTKDSYPHDAIAKKVALKGLEKEFPELLEESDHKLELVKEKFGFSLPS
                     LLILYHHAGDESLHSEEIKEEIMSVLKNEEPVVQHNILEYEF"
     gene            complement(<705235..>706353)
                     /gene="GAL7"
                     /locus_tag="KLMA_20331"
                     /db_xref="GeneID:34714804"
     mRNA            complement(<705235..>706353)
                     /gene="GAL7"
                     /locus_tag="KLMA_20331"
                     /product="galactose-1-phosphate uridylyltransferase"
                     /transcript_id="XM_022817943.1"
                     /db_xref="GeneID:34714804"
     CDS             complement(705235..706353)
                     /gene="GAL7"
                     /locus_tag="KLMA_20331"
                     /codon_start=1
                     /product="galactose-1-phosphate uridylyltransferase"
                     /protein_id="XP_022674659.1"
                     /db_xref="GeneID:34714804"
                     /translation="MSFDLTDHSHARYNPLTDSWVLVSPHRAKRPWLGQQEKPGKNDA
                     PEYDPKCYLCPGNTRATGGENPKYTSTYIFQNDYAAVKLEQPEPDASVNGNDPLKQRL
                     FQLKGVKGNCFVICFSPNHSLSLPQMSPKDITNVVSAWTDLYLKLEKEAKEEHKPFKY
                     LQIFENKGTAMGCSNLHPHGQAWCLDSVPNEPAKEFVSFAKYEAKNGTHLLQDYVTLE
                     EREKERIVYENDSFLVVVPYWAVWPFETMVVSKRRIPSLKQFTDKEREDLAATIRNLT
                     IRYDNLFETSFPYSMGIHQAPLNASEEELKNAWFHMHFYPPLLRSATVRKFLVGFELL
                     GEPQRDLTPEQATDRLKVLDGEEHYLKKLEREEQEQKK"
     gene            complement(<707859..>709934)
                     /gene="GAL10"
                     /locus_tag="KLMA_20332"
                     /db_xref="GeneID:34714805"
     mRNA            complement(<707859..>709934)
                     /gene="GAL10"
                     /locus_tag="KLMA_20332"
                     /product="bifunctional protein GAL10"
                     /transcript_id="XM_022817944.1"
                     /db_xref="GeneID:34714805"
     CDS             complement(707859..709934)
                     /gene="GAL10"
                     /locus_tag="KLMA_20332"
                     /codon_start=1
                     /product="bifunctional protein GAL10"
                     /protein_id="XP_022674660.1"
                     /db_xref="GeneID:34714805"
                     /translation="MSQDQEKYCLVTGGAGYIGSHTVVELCDAGYKCIVVDNLCNSNY
                     ESISRMELLTGKEIKFAKIDLCDGKALDKLFDEYKIDSVLHFAGLKAVGESTEIPLTY
                     YHNNIVGTLNLLNSMQTHGVKKLVFSSSATVYGDATRFENMIPIPEECPTGPTNPYGK
                     TKLAIEDMMRDLHFSDKSFSFAILRYFNPIGAHPSGVIGEDPLGIPNNLLPYMAQVAI
                     GRREKLYVFGNDYDTVDGTPIRDYIHVVDLAKGHLAALKYLEENPGTCREWNLGTGHG
                     TTVFQMYRAFCDAIGFDFLYEVTGRRDGDVLNLTAKCDRATNELKWQTELDVARACID
                     LWKWTQDNPFGYQIKGVDAQFFGKPDDYSSRVISLGKGTPFEVKVANLGATIVDIVVN
                     GCSVVASLDSEDEYKDPSNPFFGAIVGPYANRIAKGSFEIDGKKTQLTVSADSANVCH
                     SGKNSYHTKKFLGPIVKNPEPHVWTADFLYVDEEDSEFPAPLYTIVKYRVDSENKTLT
                     TEIESKNLGKVPTPANITNHTYFNLNKFNSPTIKGSKLQLIDNTGLEVTEDLLPTGNT
                     KQYKEVATFKDEPTVLTETGPALDFDFISGLPANLDTRSSPLTPVFKLSNDEAKLALE
                     VATTEPTFQVYTGDYVDVKDKYEKRAGICCEPGRYIDAVNNPQWKSSVILPPGETYAH
                     KFSYTFKDL"
     gene            <711526..>713046
                     /gene="GAL1"
                     /locus_tag="KLMA_20333"
                     /db_xref="GeneID:34714806"
     mRNA            <711526..>713046
                     /gene="GAL1"
                     /locus_tag="KLMA_20333"
                     /product="galactokinase"
                     /transcript_id="XM_022817945.1"
                     /db_xref="GeneID:34714806"
     CDS             711526..713046
                     /gene="GAL1"
                     /locus_tag="KLMA_20333"
                     /codon_start=1
                     /product="galactokinase"
                     /protein_id="XP_022674661.1"
                     /db_xref="GeneID:34714806"
                     /translation="MSVPIVPIDFSEVPALEQLKKEFVEAYGADESRSIFISRSPGRV
                     NLIGEHIDYCQFSVLPMAIENDLKLAFRLSDASENPSITLTNYDSNFAKRKFDLPLDG
                     SLIEIDPSVSDWSNYFKCGLLVAQEFLKKKYKFEGPIKGMEIYVKGNIPTGGGLSSSA
                     AFICAVSLAVIYSNIPEGTPILKDELTKITAVAEHHVGVNNGGMDQAASICGKDGHAL
                     YVEFKPQLKATPFKFPDGLPISFLIANTLVVSNKAETGPVNYNLRVVEVTVAANVLAQ
                     KYGVTLETEGNLGKGTLRNFMDAYYMKYDPSCHKPWDGDIETGVERLTKMIELVDETL
                     DQNGYTLDQAVELCGCESISQFTDLYLTNFPVRFQKLKLFQRAKHVYTEALRVLKALI
                     MFQKGESNFFEEFGKLMNESQQSCDKLYQCSCPETDLICDIALKNGSFGSRLTGAGWG
                     GCTVHLCSTDTVESVKNALIKNYYNVKYPNLTPEQLSEAIIVSKPRVGSVLYKEKS"
     gene            complement(<713616..>715481)
                     /locus_tag="KLMA_20334"
                     /db_xref="GeneID:34714807"
     mRNA            complement(<713616..>715481)
                     /locus_tag="KLMA_20334"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817946.1"
                     /db_xref="GeneID:34714807"
     CDS             complement(713616..715481)
                     /locus_tag="KLMA_20334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674662.1"
                     /db_xref="GeneID:34714807"
                     /translation="MEEYLDLSDDLDSQPNLDMELNAFFNFNHEPNNRPGLNSVDRYL
                     GFGDQLGTPFQLAPKMSSGSEPPLGSISDLLSDTPMNKDIDYSTTTETPTPQFTYVAE
                     NFLANDCSLNEELILPNGINNNANTNTNNTNNTNNTNNTNNNPKNNFKQKAVHFLAKE
                     GHFVRTNEESSQSLMNLNNDIFDGRRESFVSDTVTPINSRANSPRNNPLSFHNKQHIV
                     QNNGVGITNNSMQSQQAKLNVDFGFNTSPAFQLNNDANMNDLYLNNIFPLSPLKKTFK
                     ESPKIKQRKTSSSSMSSNSSLSLPLESQSMKDKKCVFKPAPRKKSELYFRPERRCPKF
                     EFGIRSEDNVVNVSFHGGFIRNTIMDWYFPPNSPLPTNFQDVTIRYDHQYYENILSSI
                     DQQIRLQGDPNISTFRSYWKLLKTQVGPHIKLEFVPESLDCDVNFSKTQYYFNIVSRI
                     VRPNSFGPIESGARYRAKMVNDMKLDDSTGNPRWCHFITSAEMKGILDFIFDGLDYIA
                     NDDTLPNKLAKGIKPNPFKQHESRIRSHMVGYVSGKKCMRNATNILFGERKVFAEEMY
                     QQVIGYDDKKRPYNTLKEFAVMEVKYMMDNIEDLFEKFYWVDPQTVPPGGYKVRF"
     gene            <717076..>717504
                     /gene="MRPL51"
                     /locus_tag="KLMA_20335"
                     /db_xref="GeneID:34714808"
     mRNA            <717076..>717504
                     /gene="MRPL51"
                     /locus_tag="KLMA_20335"
                     /product="54S ribosomal protein L51"
                     /transcript_id="XM_022817947.1"
                     /db_xref="GeneID:34714808"
     CDS             717076..717504
                     /gene="MRPL51"
                     /locus_tag="KLMA_20335"
                     /codon_start=1
                     /product="54S ribosomal protein L51"
                     /protein_id="XP_022674663.1"
                     /db_xref="GeneID:34714808"
                     /translation="MVVKVLKQTSIARNGVGAFILPCKKITLQYCNWGGSSQGLRDFL
                     TSKRMIQWAEKYPQIQFEIVRKSGHPVIKGDYINGREKAICVKNLNIDNVENKLKLIR
                     DSSGEQLRHRTKNDNVETMNDSVRGIWSPLHVDPSVRHRV"
     gene            complement(<717713..>719554)
                     /gene="GCD2"
                     /locus_tag="KLMA_20336"
                     /db_xref="GeneID:34714809"
     mRNA            complement(<717713..>719554)
                     /gene="GCD2"
                     /locus_tag="KLMA_20336"
                     /product="translation initiation factor eIF-2B subunit
                     delta"
                     /transcript_id="XM_022817948.1"
                     /db_xref="GeneID:34714809"
     CDS             complement(717713..719554)
                     /gene="GCD2"
                     /locus_tag="KLMA_20336"
                     /codon_start=1
                     /product="translation initiation factor eIF-2B subunit
                     delta"
                     /protein_id="XP_022674664.1"
                     /db_xref="GeneID:34714809"
                     /translation="MSEGAVESKEPKEPVKVETNAEKAVNQKTTVSSTSGKALTNKEL
                     KELKKKEKAAKRAANKQSIGISLEKQQQQAAAKREKKQQQRELLAAKKNKSVEVVKHN
                     DKKSTLFGHLETTEERRTSLLALLSVITSLGASKITAMGLVLPMLSTTLAAASSQPTS
                     GSQLSAGLSGSNTNLQSLAHSEDYEAQQMLNSLSLDESSTLVPGTSSIIPNTIASQFT
                     SQQSLASVKELIANRDMLHPAISSLTLDYALYKIIGSIPRCIAMMEAFEAVIKDYKTP
                     EGTTLSRNLTSYLSHQIDFLKKSRPLSVTMGNAIRWLKQEISLIDPSTSDSKAKEELC
                     DKIALFAREKVELADQLIIETASQHIEEGSTILTYGCSKVLTDLFLHNAINLGKKFQI
                     VIVDSRPLFEGRKMAESLKNHGLDVLYVPITALGTVFNMDIKYVFLGAHSILSNGFLY
                     SRVGTAQIAMLANRRNIPVLVCCESLKFSQRVQLDSVTSNELADPNDLVIIDSANPVQ
                     RHSNQGFLLQQFIKERESVQKEVENNTKQKNKSGSGSANTESVDDTKSNKHKPILADW
                     EKQPNLNIFNIMYDLTPPDYIKKIITEFGSLPPSSVPVVLREYKGSA"
     gene            complement(<719899..>720855)
                     /gene="MRP13"
                     /locus_tag="KLMA_20337"
                     /db_xref="GeneID:34714810"
     mRNA            complement(<719899..>720855)
                     /gene="MRP13"
                     /locus_tag="KLMA_20337"
                     /product="37S ribosomal protein MRP13"
                     /transcript_id="XM_022817949.1"
                     /db_xref="GeneID:34714810"
     CDS             complement(719899..720855)
                     /gene="MRP13"
                     /locus_tag="KLMA_20337"
                     /codon_start=1
                     /product="37S ribosomal protein MRP13"
                     /protein_id="XP_022674665.1"
                     /db_xref="GeneID:34714810"
                     /translation="MYSRVFTRSVSSGVESRQIFDDFLRFVKTPKNLRPFIYRKKNAN
                     KLLAMDLIDPETKRPIQPREPVHVPGASVYNDIIFNTSSAQELESFMREWRNITPRRK
                     EFWGYFNSTHLQNALLASTFRFDSLRSTLNLLYQLQPFFVKSKQMDAFDVDVWFNSVL
                     MCQLHRNEFKNVKDSSMVASGLKKLSSTVTKKEDTTGLAKELIGALAHQQGATVEKLP
                     RFCKTSEVILQSIDVQQASASQLNVYLAKNRSNYLLSRTILRYGSSSPVEVSKFVENY
                     QLALKQADKTDPYDRYLSFYEKCKNEKESEPQEEEQPKEEDK"
     gene            <721219..>721716
                     /locus_tag="KLMA_20338"
                     /db_xref="GeneID:34714811"
     mRNA            <721219..>721716
                     /locus_tag="KLMA_20338"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817950.1"
                     /db_xref="GeneID:34714811"
     CDS             721219..721716
                     /locus_tag="KLMA_20338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674666.1"
                     /db_xref="GeneID:34714811"
                     /translation="MKDEELSYDEYLQKIITETSKGYGSEDTIHPEVNKIISKSPKLR
                     ESLLEPYNIYEELAGEADAWREKVWTQKQKPSPEIEYAYLKHQELALERLISKTLPKQ
                     LALRNEFLRTGVLQAENAVTTQEQQLRQLEQHRAAMEASQQQQLDLLHDRWRETLNEN
                     LKSTL"
     gene            complement(<721849..>722373)
                     /gene="RPL11"
                     /locus_tag="KLMA_20339"
                     /db_xref="GeneID:34714812"
     mRNA            complement(<721849..>722373)
                     /gene="RPL11"
                     /locus_tag="KLMA_20339"
                     /product="60S ribosomal protein L11"
                     /transcript_id="XM_022817951.1"
                     /db_xref="GeneID:34714812"
     CDS             complement(721849..722373)
                     /gene="RPL11"
                     /locus_tag="KLMA_20339"
                     /codon_start=1
                     /product="60S ribosomal protein L11"
                     /protein_id="XP_022674667.1"
                     /db_xref="GeneID:34714812"
                     /translation="MSSKAQNPMRELKIEKLVLNISVGESGDRLTRASKVLEQLSGQT
                     PVHSKARYTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRNRNFSATGNF
                     GFGIQEHIDLGIKYDPGIGIYGMDFYVVMGRPGARVTRRKRCQSKIGNSHKTSKEDTI
                     AWFKQRYDAEVLDK"
     gene            <723145..>723999
                     /gene="PRE2"
                     /locus_tag="KLMA_20340"
                     /db_xref="GeneID:34714813"
     mRNA            <723145..>723999
                     /gene="PRE2"
                     /locus_tag="KLMA_20340"
                     /product="proteasome component PRE2"
                     /transcript_id="XM_022817953.1"
                     /db_xref="GeneID:34714813"
     CDS             723145..723999
                     /gene="PRE2"
                     /locus_tag="KLMA_20340"
                     /codon_start=1
                     /product="proteasome component PRE2"
                     /protein_id="XP_022674668.1"
                     /db_xref="GeneID:34714813"
                     /translation="MQAIADQFSSSSVFAELNDEQTLKENFVLGDSQFKQLAPSLSMP
                     PISTPQEFLRAHTDDSKNPDCKIKIAHGTTTLAFRFQGGIIVAVDSRATAGQWIASQT
                     VKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVY
                     EYKGAGLSMGTMICGYTKKEGPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYKW
                     DLTVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWVYHGNHNVDTLFWEIKEKE
                     QSFNNVVG"
     gene            complement(<724316..>726937)
                     /gene="FHL1"
                     /locus_tag="KLMA_20341"
                     /db_xref="GeneID:34714814"
     mRNA            complement(<724316..>726937)
                     /gene="FHL1"
                     /locus_tag="KLMA_20341"
                     /product="pre-rRNA-processing protein FHL1"
                     /transcript_id="XM_022817954.1"
                     /db_xref="GeneID:34714814"
     CDS             complement(724316..726937)
                     /gene="FHL1"
                     /locus_tag="KLMA_20341"
                     /codon_start=1
                     /product="pre-rRNA-processing protein FHL1"
                     /protein_id="XP_022674669.1"
                     /db_xref="GeneID:34714814"
                     /translation="MDTERSSVGISPAAANVPLEGSKHEADMTGSILREEELKLEQIP
                     DNLDHPDFSKLLELDEKNDDDLFHGIDILDQHMKSDQEKEDTELHAEVPIREERKHDS
                     EKASSVEVPQAARKDNVLREDVNLEVPQSPKSSSVGVEEKNPVKDVQPAQPVQQVVPM
                     PPVEPVQPIQPVIKHDENSPAAIIQERLAYNARRNNSLTPMMFPIKQLNELKLEQKQI
                     KPLEAGSKDGLQEDPIKGKGPDHKEGSAADTQPLSQLPGGSVSLTGEAAADNKSLEEQ
                     SKISAYARLDFHDFTFYVQTLQVIIGRRSENDYSHKVDVNLGPSKSISRRHAQIFYNF
                     GTGRFELSIMGKNGAFVDDNFVERGSTVPLKNKTKIQIGQIPFQFVLPDHEGNITKET
                     STATTAPATTAAKTKGSTGASQPPKKKNKKEKETKEKKAPKPQKPPKKVYSLHEIPPE
                     YRTKPTCSYSNLITSCLRKYSTEKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLS
                     LNKSFCKVSKEGKGWLWGLDEEYIAERERQKKKQAEAQAAKARLAELKQQQQQQQRIK
                     KQQQQQQQASAAKQPNMAQTLAANRSDRKPNGMDDNQRTMKYLQEQLMIITKDRKGLD
                     KTVMAQILTQALAMTINQVTQAAKQKGITGNPLTALIDKNPQHLNLILAAAVNAATVK
                     VTKGKVSQLVNMSSPAVKGSQQPIKKEVPVKKTVTPKPPTPSVVNPSSSSSLNKNQSF
                     DPTSLSKFFQPKQQGSRPVSSTGKTVSPPPISMAAKSNASGNGSSAISVSPQPSTILP
                     KKRAASDTESSDSDDSNSSDSGDQNGNGDSGAESSDDSSSSGDSDSGSGSDSDSDGSD
                     SDSNSDDSDDNEDANSD"
     gene            complement(<727170..>729512)
                     /gene="COG4"
                     /locus_tag="KLMA_20342"
                     /db_xref="GeneID:34714815"
     mRNA            complement(<727170..>729512)
                     /gene="COG4"
                     /locus_tag="KLMA_20342"
                     /product="conserved oligomeric Golgi complex subunit 4"
                     /transcript_id="XM_022817955.1"
                     /db_xref="GeneID:34714815"
     CDS             complement(727170..729512)
                     /gene="COG4"
                     /locus_tag="KLMA_20342"
                     /codon_start=1
                     /product="conserved oligomeric Golgi complex subunit 4"
                     /protein_id="XP_022674670.1"
                     /db_xref="GeneID:34714815"
                     /translation="MDLDELHLDSKLSKFENLIGKLSTKSQLPKLLHLIESDYNQTNL
                     ALNNYIKTSNSNINRSVRSLELEKTNLTSTLSVFHEALESLSNSNVQATSISTRLNAI
                     KTEYAHINQLADFVDSVKLLKNNLQIINDVLNSKEHNYPMIAQCIYEIDQLPESLLNS
                     KFVQRCVPTSELPDPPAQLVKKWKSQLSEVFTERFTRASQEQDVNTLTECFKLFPKIG
                     ASDLGIDLYSKYICDIIAQQSRSLMTHTSDDPLFYSKSTLHLFKIVSTMINDHSKIIL
                     QNYSTAYMLETMQKVQLETDLQACLIWDTFFDSVSLPKIRSSLSDYTDMKRLQAIVLQ
                     ISNFLQNWSMYCQFFSMKWLEWSKEPVNPLQIVPCLTNGKFNSKLQENIDTFHSMALH
                     YTTYCFKSSLKTSQLGNLNESLHEEQSRTSNGDEQQVISPVLEDLAILVKSYLVWTLN
                     TGQTALVTKSLDSISQMIQNEYLISFLQSRLTKLIPRLIPSLRLQKYISDTENAAQNQ
                     HHTNSIGVTAAQKKFTSQFAAFNLKETDMESVLNLHHYIIYVNTISTNESIFTDLLEN
                     EIIKINPHFLIDNFKFNNEHEIVKSKLLSVLKYLLDNNKKLWNWSLMMLYQNVLQENL
                     QRLISVLFQKNTEFVSTLQDFEDFEKLHTFVQEWNKIIIPYKQVLSAASFNELLTAIV
                     KDLCPMIETKFRSLQFNELGSIKIEKQLSVIIKTICMDNYQLRERFKKLTQMCLLLGF
                     EDDQFDPTTEDLKEDVLNSLNWLLTVSERISVRQQRIDKR"
     gene            complement(<730468..>731394)
                     /gene="PIL1"
                     /locus_tag="KLMA_20343"
                     /db_xref="GeneID:34714816"
     mRNA            complement(<730468..>731394)
                     /gene="PIL1"
                     /locus_tag="KLMA_20343"
                     /product="sphingolipid long chain base-responsive protein
                     PIL1"
                     /transcript_id="XM_022817956.1"
                     /db_xref="GeneID:34714816"
     CDS             complement(730468..731394)
                     /gene="PIL1"
                     /locus_tag="KLMA_20343"
                     /codon_start=1
                     /product="sphingolipid long chain base-responsive protein
                     PIL1"
                     /protein_id="XP_022674671.1"
                     /db_xref="GeneID:34714816"
                     /translation="MHRTYSLRSTRAPTASDLQNPPPPPSSTKSRFFGKGGLAYSFRR
                     NAAGAFGPELSRKLSQLVKIEKNVLRSIELAANERRDAAKQLSLWGLENDDDVSDITD
                     KLGVLIYEMSELDDQFIDRYDQYRLTLKSIRDIEGSVQPSRDRKAKIADKIAYLKYKD
                     PQSPKIEVLEQEMVRAEAESLVAEAQLSNITRSKLRAAFNYQFDSIIEHSEKLALIAG
                     YGKALLELLDDSPVTPGETRPAYDGYEASKQIIIDAENALNQWTLDSAAVKPSLSIRN
                     FDDAYLDEEEQWDEEQPQHEEEEEEHHQQVAA"
     gene            complement(<732215..>732847)
                     /gene="YTH1"
                     /locus_tag="KLMA_20344"
                     /db_xref="GeneID:34714817"
     mRNA            complement(<732215..>732847)
                     /gene="YTH1"
                     /locus_tag="KLMA_20344"
                     /product="mRNA 3'-end-processing protein YTH1"
                     /transcript_id="XM_022817957.1"
                     /db_xref="GeneID:34714817"
     CDS             complement(732215..732847)
                     /gene="YTH1"
                     /locus_tag="KLMA_20344"
                     /codon_start=1
                     /product="mRNA 3'-end-processing protein YTH1"
                     /protein_id="XP_022674672.1"
                     /db_xref="GeneID:34714817"
                     /translation="MSLIHEDTSKYEFKFEPFLRKEYSFSLDPDRPVCQFYNSREGIK
                     SCPNGALCPHKHVLPIFQNKIVCKHWLRGLCKKNDQCEYLHEYNLRKMPECVFFTKNG
                     YCTQSPECQYLHVDHKSQVEECQDYNMGFCPLGPQCTKKHIKKVYCPRYMVGFCPLGA
                     DCDWSHPKFTVPSEHSKLRIKKDEHINTRKLDEERERRLNAIINGDVTVM"
     gene            complement(<733110..>733628)
                     /locus_tag="KLMA_20345"
                     /db_xref="GeneID:34714818"
     mRNA            complement(<733110..>733628)
                     /locus_tag="KLMA_20345"
                     /product="protein FUN14"
                     /transcript_id="XM_022817958.1"
                     /db_xref="GeneID:34714818"
     CDS             complement(733110..733628)
                     /locus_tag="KLMA_20345"
                     /codon_start=1
                     /product="protein FUN14"
                     /protein_id="XP_022674673.1"
                     /db_xref="GeneID:34714818"
                     /translation="MFRTAVRNLASPLRRGVYVGCSGSLLIGGGALMHAIQPSQYILN
                     DSIVGVQQRGDLQQELGLPTRSELRTVQGGKGTKVNYRQMCYGSIMGLFFGVIVGKIS
                     SLLVFITGVGLLGMQFLQNRGVISSDSTRALSKYAITVGKEKIDLNTLLWDRPSFKVS
                     FLLTFVLAAFNV"
     gene            complement(<734116..>736134)
                     /gene="RTS1"
                     /locus_tag="KLMA_20346"
                     /db_xref="GeneID:34714819"
     mRNA            complement(<734116..>736134)
                     /gene="RTS1"
                     /locus_tag="KLMA_20346"
                     /product="serine/threonine-protein phosphatase 2A 56 kDa
                     regulatory subunit delta isoform"
                     /transcript_id="XM_022817959.1"
                     /db_xref="GeneID:34714819"
     CDS             complement(734116..736134)
                     /gene="RTS1"
                     /locus_tag="KLMA_20346"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 2A 56 kDa
                     regulatory subunit delta isoform"
                     /protein_id="XP_022674674.1"
                     /db_xref="GeneID:34714819"
                     /translation="MMRGFKQKLIKKTTGSTSSSSSQKRKEKEREKEKEKEKKSPSNS
                     GTSSARSSLDKSGHRSSGNSGSGSGSSRRAESKTGGGSGSGSGSGSGGSTTASGGKSG
                     SNGQGETGSSRSAAIPVSKGSPENPSKPTLIGAASQVTPPPTSPKAQPATVNVTSSAA
                     GGTALMMKDAQHSPSSIEIPRSSHSFERLPTPTKLNADSDLEMIKTPQRHSSSRFEPS
                     RYTQIVKLPRFEEVLPEEQIPLFITKVDQCNTMFDFNDPSFDIQGKEIKRVTLQELIE
                     FIVTNRFTYTEEMYEHVVNMFKINLFRPIPPQVNPVGDVYDPDEDEPVNELAWPHMQY
                     VYEFFLRFVESPDFNHQIAKQYIDQNFILRLLELFDSEDIRERDCLKTTLHRIYGKFL
                     SLRSFIRRSINNIFLQFTYETERFNGIAELLEILGSIINGFALPLKEEHKVFLVRVLI
                     PLHKVRCLSLYHPQLAYCIVQFLEKEPLLTEEVIMGLLRYWPKINSTKEIMFLNEIED
                     IFEVIEPLEFIKVEVPLFVQLAKCISSPHFQVAEKVLSYWNNEYFLNLCIENAEVILP
                     IIFPALYKLTTQLDKNDPLSLENGDNEEDPYLMVEQAINSGSWNRAIHAMAFKALKIF
                     LETNSVLYENCNALYLQSLKENNRRQKEREMNWKQLEDYVSKLKIAES"
     gene            complement(<737533..>738402)
                     /gene="SPO7"
                     /locus_tag="KLMA_20347"
                     /db_xref="GeneID:34714820"
     mRNA            complement(<737533..>738402)
                     /gene="SPO7"
                     /locus_tag="KLMA_20347"
                     /product="sporulation-specific protein SPO7"
                     /transcript_id="XM_022817960.1"
                     /db_xref="GeneID:34714820"
     CDS             complement(737533..738402)
                     /gene="SPO7"
                     /locus_tag="KLMA_20347"
                     /codon_start=1
                     /product="sporulation-specific protein SPO7"
                     /protein_id="XP_022674675.1"
                     /db_xref="GeneID:34714820"
                     /translation="MMSSGGVSDEDSIKDLKLSITSTPVHGASSSSESVNDSPWARRG
                     QAGSSATPTSNRRRRSSSRASSKNLKSSEISPISMIFRNLLILEDDLRNQSREQRMLK
                     WQFTLFLAGLAGIAAFSFYELYFTSERVTGLYRVGLQFLLIFISVTIVLFHLSGEYKR
                     TMVIPRRFLVNANKGMRQFNMKLVKVKSTWIQKYADTVRLVVRRVAKWNMKLLIMMGA
                     SNTSIYAFWSSLSIRCLPRLGAVDVKLVLNAKAFSAEIREGWEIYRDEFWKRETVRRR
                     KQESQNNTHLKKE"
     gene            <739436..>740407
                     /gene="MDM10"
                     /locus_tag="KLMA_20348"
                     /db_xref="GeneID:34714821"
     mRNA            <739436..>740407
                     /gene="MDM10"
                     /locus_tag="KLMA_20348"
                     /product="protein of unknown function DUF3722"
                     /transcript_id="XM_022817961.1"
                     /db_xref="GeneID:34714821"
     CDS             739436..740407
                     /gene="MDM10"
                     /locus_tag="KLMA_20348"
                     /codon_start=1
                     /product="protein of unknown function DUF3722"
                     /protein_id="XP_022674676.1"
                     /db_xref="GeneID:34714821"
                     /translation="MYVKRFSRNYQLMLKCLSAKTGPSILTMYLQKNTGANCQELILS
                     TNEALLGYRFVHNFVSAGSKSNLSLYNNSSLSIGSELWCALLNLSPGCSTTLRYCSHA
                     TNTGKPLIFTLSLNPLYGHVSSTYSIKTHENLTFSTKYDFNIYSIQSNLTLGMELWKY
                     RFGQRGKNVQQQEQDQLGSEQALASESIDDWSQITTHDKTPMYYHLLSQTEKSSHSSQ
                     KLLQDLNLTFQSSLQKIDKEREVIESFNDRYNEADFTQVFKASTSLRDRSLRFLWEGK
                     IKGFLISAGVELTQPPEIAINGLDSLEHQNWTLISPSKFGIQLQYSA"
     gene            complement(<740507..>742855)
                     /gene="SWC3"
                     /locus_tag="KLMA_20349"
                     /db_xref="GeneID:34714822"
     mRNA            complement(<740507..>742855)
                     /gene="SWC3"
                     /locus_tag="KLMA_20349"
                     /product="SWR1-complex protein 3"
                     /transcript_id="XM_022817962.1"
                     /db_xref="GeneID:34714822"
     CDS             complement(740507..742855)
                     /gene="SWC3"
                     /locus_tag="KLMA_20349"
                     /codon_start=1
                     /product="SWR1-complex protein 3"
                     /protein_id="XP_022674677.1"
                     /db_xref="GeneID:34714822"
                     /translation="MSKKRSRRQAKENLNNDYELDTYGLADGDDKSRPYYMVEDLPSS
                     IEVPRYDTLNYPLSVKDSAVLYTSLLSSRRTWVKGEMFQLYWAKQYMNIKEREELKKE
                     GIDPDSIDQSAARERMNKLCDCMMQGGPHQFPIRLFILKNDEVEKAWVEAKEAKKRDR
                     EVRKKQQEEEKRLKKERKLLRKKLKQEALEREKEKNKNKEKVKKPRKPYKKSAKRLEA
                     EKNAKKNESAKQTPITTPKPTKPSTTSAEGSAAKKKKMKAVVRPKPYEEQVMILNLNK
                     MARNDKQLNDLMIKVAGGHASLAEITLFKKYIEKAKAMPPPSGTWKPMLEEVDVTDDE
                     DSDEEQKKDTGDPEKCDTVEEQTTESKEEQKIEKSEEQITTSKEEQKIENPEEQKNES
                     KAEQKIENSEEQTTESKEEQKVDKIEEQKPYEDTKSKDANDGEPEVSQEKQQDSSNSE
                     NNQSRDVPSTGEERVSDDKEIEKESRSPSLSSNQEDSAKTVSSTENDNKSTKSDSDSD
                     SDSDSSSDSDSSSDNDEKEDDEKASHESKMEGVQENKVNNEQNEGNKTVSSETSNNSS
                     QTSKPEGETDAPRPKRKYRKRTKVKTEEEEEEEKAMQLTTFQQKYSNGADIVFEYVEN
                     ANVRFLLPKYSILEQLEDEESYLLSFIVIHNRREVSLFKTRKLKELNKKKSGEDIIKP
                     EDYNPFDDARCPDPLFSPITLKLTGIPKKFSNIILNSFHPQEKVQQYMKSILDRGSRL
                     SGYNLWYQLDAYDDKDLAESLRVNLRDYEQNFKSKRQKKQIL"
     gene            <743115..>746453
                     /gene="SMC5"
                     /locus_tag="KLMA_20350"
                     /db_xref="GeneID:34714823"
     mRNA            <743115..>746453
                     /gene="SMC5"
                     /locus_tag="KLMA_20350"
                     /product="structural maintenance of chromosomes protein 5"
                     /transcript_id="XM_022817964.1"
                     /db_xref="GeneID:34714823"
     CDS             743115..746453
                     /gene="SMC5"
                     /locus_tag="KLMA_20350"
                     /codon_start=1
                     /product="structural maintenance of chromosomes protein 5"
                     /protein_id="XP_022674678.1"
                     /db_xref="GeneID:34714823"
                     /translation="MTSIINFADYVDSESFTSQKEGSNSNRPSNSYNSSSKKLRIQRS
                     NIDEFKPGAIVKLKVTNFVTYALTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKP
                     EYIGRSKKVEEYIKNGTDQGTIEITLKNSELLSPSSFPMINESDDVVHIKRVMVRGRK
                     KSEYFVNNVSVDETVVRSLVQSLNIQLDNLCQFLSQERVEEFAKLKPDTLLNETIRSV
                     EAGLLEKLNQLKSLQFEGDDLKKELESNEANLGKLISQRDTLEGQVHALELYEEKTRQ
                     LELHEKLLNYAYVKEHKERNKDLKAKCTTLTKEIKKMEKEKKPYVDLGSKLREDEDRC
                     KITLEELDRERYSTKASFNRTREKLNAIAKKLQDGNQRVSYLKTRNKNLKEEIKDCQE
                     KIKTLEASKADIQLPDPSLIESVDRKIEELREGRAILNDTLTDVDNKITTIKYSIESA
                     KKEYALTQRLLSGNDKLHLLDEFGQNNNTIFLEMKDAIQYVRSLPDARGKIFEPPILS
                     IAAKSQTYAAYLASCVDFHTSMSLTMLDKETYDQFSEDIVSKFKVNIREVSNQTTEPP
                     MSREELRKYGFEGYLVDFIDGEENVIRMLCQQQKIHMIPVTRQDLSASHLERLKRPDN
                     NGNIPFPRFIAGKYIHTIKKSEYGSRQSFSSSTAIDMKNRFYLGSAMSATESSRLRST
                     IDNLTNRIKDLEKELRKFKDKRASKENELADLNHTMNNFNTQKSELTKGAKKLNQIDV
                     KIGQFKEKMQGNTEKLRVDTTETMKMLEESLKKMYEEERALILDLPRYTARLQQLDVE
                     MLTKSMEKLDITIKLNSLSHVCLKLEEALQLKREERADAIEEYKNGKDTSDYKKWTDT
                     IKRFSESEKNILNEIATNYHEQSQFNSEYIESIIDRLTSELSLINNDASVIEILNKTV
                     ESIKSLEKTIPIQRTKIGANAQLIEDIRRELEPSLDTIIQQISKKFASLFVYVGSAGE
                     VKLVKPEKFSDWRIEIRVKFRDNSELQQLNPHIQSGGERAVSTVLYMIALQQFTSAPF
                     RVVDEINQGMDQSNERIVHKIMVENACAANTSQYFLITPKLLTNLYYHERMRIHCVFA
                     GSWIPDPIANPERVHFGETSSYIL"
     gene            <746740..>748347
                     /gene="MSE1"
                     /locus_tag="KLMA_20351"
                     /db_xref="GeneID:34714824"
     mRNA            <746740..>748347
                     /gene="MSE1"
                     /locus_tag="KLMA_20351"
                     /product="glutamyl-tRNA synthetase"
                     /transcript_id="XM_022817965.1"
                     /db_xref="GeneID:34714824"
     CDS             746740..748347
                     /gene="MSE1"
                     /locus_tag="KLMA_20351"
                     /codon_start=1
                     /product="glutamyl-tRNA synthetase"
                     /protein_id="XP_022674679.1"
                     /db_xref="GeneID:34714824"
                     /translation="MSSISGYRRLYSSLSKSKLGNILNGSGKKSLFVKKPVKDVHPKY
                     PVRTRFAPSPTGFLHMGSLRTALYNYLLAKNTGGEFLLRLEDTDQKRLVPGAEESLYD
                     TLKWCNIEYDEGPGINEIHGPYRQSDRTEIYQKYINILLEKGHAYRCFCPKERLDTLR
                     SSARRLQPPTTVSYDRHCYKMSQEDIAKHLDANVPFTVRFKSPQKYPPFEDLLHGKLD
                     MQPQVNVMDVRYDDPILMKSDYLPTYHFANVVDDHLMKITHVIRGEEWLPSTPKHIAL
                     YEAFGWTPPHYVHIPLLTSTSDKKLSKRKGDADVRTMRAKGILPEALINFSALFGWAP
                     PRELAAANHECFELKELVKIFDLNHLTKGNAKVDDKKLYYFNKHYLSKRLKNPVDFEE
                     QLQIAYDYMKPNYHDLDIEQLRKALNSIGGYLTTIYDIDSEFYYLFKDPQYENENALN
                     FLKSHDTAQVHKVLAFMNGKIEESNISELIKITEAELSVPKKVIFESVRFALAGSIPG
                     VKLPVLVQIITPNESNRRLEYALHQLP"
     gene            <748625..>749377
                     /gene="OPI10"
                     /locus_tag="KLMA_20352"
                     /db_xref="GeneID:34714825"
     mRNA            <748625..>749377
                     /gene="OPI10"
                     /locus_tag="KLMA_20352"
                     /product="protein OPI10"
                     /transcript_id="XM_022817966.1"
                     /db_xref="GeneID:34714825"
     CDS             748625..749377
                     /gene="OPI10"
                     /locus_tag="KLMA_20352"
                     /codon_start=1
                     /product="protein OPI10"
                     /protein_id="XP_022674680.1"
                     /db_xref="GeneID:34714825"
                     /translation="MFAAIASGNPLQLSTEVPNSNGLQHTIVLSSTKPKSYSHITLFI
                     LPNVTFPQEFLATVYFKLNPAEDFKLFGYLGNEKPSAIFKVKLPQLNASAGAGTMPNV
                     TDGLGEIDMEDDSALNNGDGGFAGINENGSNNISELIIGISIEPRVDALNKLNQWKAE
                     QAALNSGVGPGTMVLSRNSAQILTAGALAKQYPIVTQDLAAKIVQHAYNYLTGFVDPQ
                     GNVSIKRFDTWWDKFKTRLKSDASFLDEVTKD"
     gene            complement(<749413..>750663)
                     /gene="SIL1"
                     /locus_tag="KLMA_20353"
                     /db_xref="GeneID:34714826"
     mRNA            complement(<749413..>750663)
                     /gene="SIL1"
                     /locus_tag="KLMA_20353"
                     /product="nucleotide exchange factor SIL1"
                     /transcript_id="XM_022817967.1"
                     /db_xref="GeneID:34714826"
     CDS             complement(749413..750663)
                     /gene="SIL1"
                     /locus_tag="KLMA_20353"
                     /codon_start=1
                     /product="nucleotide exchange factor SIL1"
                     /protein_id="XP_022674681.1"
                     /db_xref="GeneID:34714826"
                     /translation="MRFKSVHRVLTLLLVMFLAKSTATSLSDSEQEPKIDIKQDDEEA
                     GLVIGDHLICNAEECYPKVFEPTNEWKVIKPAQRLPPGLDIRISLEKGVKEAKLGENQ
                     ESAQNELVIAETNKHSELSTKEEHEFSKEFAKIRDVIEQSNSQNWVDVESVLDDLAEF
                     AHDYKKGFKIISNEYQTLESFAFNESVPTQVRELAARIILSSLRNNPPSIDFINENYP
                     ESTTKIYNELSKLGDSADNALLVKRFLSMLDVIFSRSEKVTINDEILWRHYQAMDPVS
                     KIKVLEIISKYYNKNNVNTVNGPDKNLVVVQKWTNELTNFLQVPELDEFHLREFFNCV
                     CFIKENFKESIKIDTDFINWLIVEIESRREKSKDEVYKRDVDQLEFDDQLAQSRHMVF
                     GNPNAARLKERLYDEDSNLGADEL"
     gene            complement(<751151..>752323)
                     /gene="CYS3"
                     /locus_tag="KLMA_20354"
                     /db_xref="GeneID:34714827"
     mRNA            complement(<751151..>752323)
                     /gene="CYS3"
                     /locus_tag="KLMA_20354"
                     /product="cystathionine gamma-lyase"
                     /transcript_id="XM_022817968.1"
                     /db_xref="GeneID:34714827"
     CDS             complement(751151..752323)
                     /gene="CYS3"
                     /locus_tag="KLMA_20354"
                     /codon_start=1
                     /product="cystathionine gamma-lyase"
                     /protein_id="XP_022674682.1"
                     /db_xref="GeneID:34714827"
                     /translation="MGLLPTDKFATKAIHAGAHVDVHGSVIEPISLSTTFKQTAPAQP
                     IGEYEYSRSQNPNRKNLEDAIAALENGKYGLAFSSGSATTAVILQSLPQGSHAVSIGD
                     VYGGTHRYFTKVANAHGVDTTFTNNLHEELPSLVKENTKLVWIESPTNPTLKVTDIEK
                     VAKAVKAINSDILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATN
                     DQAIYERLQFLQNAIGAIPSPFDAWLAHRGVKTLHLRVRQASLTAQKIAEFLAANDNV
                     VAVNYPGLPTHESYEVVKKQHRDSLGGGMISFRIKGGAAAASKFSSSTRLFTLAESLG
                     GIESLLEVPAVMTHGGIPKEQREASGVYDDLIRLSIGIEDADDLLEDIKQALAAAN"
     gene            complement(<753293..>753616)
                     /locus_tag="KLMA_20355"
                     /db_xref="GeneID:34714828"
     mRNA            complement(<753293..>753616)
                     /locus_tag="KLMA_20355"
                     /product="60S acidic ribosomal protein P2-alpha"
                     /transcript_id="XM_022817969.1"
                     /db_xref="GeneID:34714828"
     CDS             complement(753293..753616)
                     /locus_tag="KLMA_20355"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2-alpha"
                     /protein_id="XP_022674683.1"
                     /db_xref="GeneID:34714828"
                     /translation="MKYLAAYLLLNAAGNTPSSDNVKAVLESVGIEVEEEKVSTLLSA
                     LEGKSVEELIAEGNEKLASVPASSGAAASGAAASGASAEAAAEEAAESEKEESDDDMG
                     FGLFD"
     gene            <754488..>754916
                     /gene="RPS15"
                     /locus_tag="KLMA_20356"
                     /db_xref="GeneID:34714829"
     mRNA            <754488..>754916
                     /gene="RPS15"
                     /locus_tag="KLMA_20356"
                     /product="40S ribosomal protein S15"
                     /transcript_id="XM_022817970.1"
                     /db_xref="GeneID:34714829"
     CDS             754488..754916
                     /gene="RPS15"
                     /locus_tag="KLMA_20356"
                     /codon_start=1
                     /product="40S ribosomal protein S15"
                     /protein_id="XP_022674684.1"
                     /db_xref="GeneID:34714829"
                     /translation="MSEAAAPRKRSFKTYSYKGVDLEKLLEMPTEEFVKLAPARVRRK
                     FARGLSEKPAGLMKKLRAAKLNAPENEKPAVVRTHLRNMIIVPEMIGSVVGVYNGKVF
                     NQVEIRPEMVGHYLGEFSITYTPVRHGRAGATTSRFIPLR"
     gene            complement(<755672..>757552)
                     /gene="DEP1"
                     /locus_tag="KLMA_20357"
                     /db_xref="GeneID:34714830"
     mRNA            complement(<755672..>757552)
                     /gene="DEP1"
                     /locus_tag="KLMA_20357"
                     /product="sds3 super family"
                     /transcript_id="XM_022817971.1"
                     /db_xref="GeneID:34714830"
     CDS             complement(755672..757552)
                     /gene="DEP1"
                     /locus_tag="KLMA_20357"
                     /codon_start=1
                     /product="sds3 super family"
                     /protein_id="XP_022674685.1"
                     /db_xref="GeneID:34714830"
                     /translation="MELHREAEETKQGINGADVDKEGSRNGSSETGDRIDSGSTTKLT
                     KEVLDRIVSDSDSGNSNPNLNLAATSYSNKLKSRSLSKAGDLDYEDNSSSGLSKVTSP
                     EHPNSVSLSDIYVSSDAETEKMDLEEDESRVKLSEMVVANGDDSTKPVAEDSNKDGHE
                     DKQEILQEVDNGTAPSSDAGVEHNNDKSEVEEAGNAAVKGFSDEDKNDNLEHLGSAKE
                     KEPTLPEQENNSAEKEELPEEEHASENGKTTADSPESGEEKSGVPEKRKLDEEPVKAE
                     DETKGSDDNESTSIKTEQVFKKPKLPSDLKPGTYENEQETHRNGEHEGDIDADAEAEE
                     EEVEDDGVLESELDDNNEDEEELEPEMEEEDDEDDTESKKKQDTENEDSAQSENGLSP
                     MEIEKLRQEALSELTKIEVEFAKLRQSLYENKLAKLQNELQMCLDGSHPQLQTYYQKI
                     DSIRDFKLKRMYQRQKYELECIDKETRATRTFIHQDFYRKVSDLKHKLLSDTTQKWYD
                     INKERREMDVVVPEVNYHVPIKIANKSLSCITGYAAPAHPRRPGDVLSEDLLCENINF
                     RYHNNPVDKLEVIVDRMRFNNELSDLDGLKRYYGGFPGAPELGSLKESEIHEDLTGIQ
                     HR"
     gene            <758392..>759738
                     /gene="NOP12"
                     /locus_tag="KLMA_20359"
                     /db_xref="GeneID:34714831"
     mRNA            <758392..>759738
                     /gene="NOP12"
                     /locus_tag="KLMA_20359"
                     /product="nucleolar protein 12"
                     /transcript_id="XM_022817972.1"
                     /db_xref="GeneID:34714831"
     CDS             758392..759738
                     /gene="NOP12"
                     /locus_tag="KLMA_20359"
                     /codon_start=1
                     /product="nucleolar protein 12"
                     /protein_id="XP_022674686.1"
                     /db_xref="GeneID:34714831"
                     /translation="MSALNQLFGAASETKATSSVASLFAKPNHVDELKVKAKARTVLP
                     EIPVEEEEEQTGVEAEAEVEAEAEDEEAEVEQPKKKKKKTKKTETDENDDLETKYYAK
                     VLGEGETVEEKGGDDNNDSGSDSDEEVSEKTAETGSADSSSAKVIDLKEKELEKAERT
                     IFVGNVPNEVITSKKLYKEFKKLISTDPRSEEELLAANSDSIDFKVESIRFRSIAFEE
                     ALPRKVAFVQQKLHKSRDSINAYAVYSKPAPVKIMCQYLNGRVFHDHHLRIDSITHPA
                     PHDKRRSVFVGNLDFEEIEENLWKHFESCGDIEYVRIVRDSKTNMGKGFAYVQFKDFQ
                     SVNKALLLHDKKIHEGKKARKLRISRCKNMKKSQNTRQSPLPNRKLNEQQKTKLGRAK
                     KVLGKADRSKLGEELTIEGLRASKGETTPLLKRVKKRSKTGRVTKRSLAFKKQNPL"
     gene            <760108..>760887
                     /gene="SYN8"
                     /locus_tag="KLMA_20360"
                     /db_xref="GeneID:34714832"
     mRNA            <760108..>760887
                     /gene="SYN8"
                     /locus_tag="KLMA_20360"
                     /product="syntaxin-8"
                     /transcript_id="XM_022817973.1"
                     /db_xref="GeneID:34714832"
     CDS             760108..760887
                     /gene="SYN8"
                     /locus_tag="KLMA_20360"
                     /codon_start=1
                     /product="syntaxin-8"
                     /protein_id="XP_022674687.1"
                     /db_xref="GeneID:34714832"
                     /translation="MNILKIEYEIDTLLEIVDERIRLIDVLHMQPSKNDNMKLKKHLN
                     QCIDLLKEYENDVMSSEQEKFEELVSKYNEAVESLPDGVVDRMIYHFELKPHFKEQKK
                     VRFKEQLLEEYEQHEPSKSFKPYKDHEEDTDDSLDAKKQELLGNQEAGTPQLSISKHV
                     SNHDIFIQQQQQLMEQETHLSGLSDSISRTHGISLEINQEVGHQNEGLLTDLERQVDR
                     SEGNLQRAGRRLDAYRANSREKNTCFIIVILTVILFILLII"
     gene            complement(<761152..>761766)
                     /locus_tag="KLMA_20361"
                     /db_xref="GeneID:34714833"
     mRNA            complement(<761152..>761766)
                     /locus_tag="KLMA_20361"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817975.1"
                     /db_xref="GeneID:34714833"
     CDS             complement(761152..761766)
                     /locus_tag="KLMA_20361"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674688.1"
                     /db_xref="GeneID:34714833"
                     /translation="MNHLLLQTLNKDVSSPLAKHQTMMPIQQQGRSNVGPNSNMAFLI
                     ADPVVRDARIRLDSKKLFFDDLMFYPENKPAWSVIVNNNSTSGYAPAVMHSYGLTTYN
                     QRVSQHTNLSVGMGLSDTNSNAMTGPAPLHNLHSRTGQTYGNIEQYKQSRTDVNPYLV
                     SGNAHQSYVVNDNTNPQNYYTRGSKGQGNNNNNNVFNAGNTNKW"
     gene            complement(<762146..>763261)
                     /gene="NGL1"
                     /locus_tag="KLMA_20362"
                     /db_xref="GeneID:34714834"
     mRNA            complement(<762146..>763261)
                     /gene="NGL1"
                     /locus_tag="KLMA_20362"
                     /product="RNA exonuclease NGL1"
                     /transcript_id="XM_022817976.1"
                     /db_xref="GeneID:34714834"
     CDS             complement(762146..763261)
                     /gene="NGL1"
                     /locus_tag="KLMA_20362"
                     /codon_start=1
                     /product="RNA exonuclease NGL1"
                     /protein_id="XP_022674689.1"
                     /db_xref="GeneID:34714834"
                     /translation="MFGRRLLPVLKKFPNKAVAKSPSCASNGPSNDRFTMLTYNMLSP
                     HYMWPQVYTYVQEKYKDWGYRHQLLETELFYKYKADIICLQELTGTDYNEFWKDQMKN
                     RINYGSNFAIKPPPTYWTKSEKDMDGVGIFYNLDKFTYLFSNQIYLNDLVGTFDQQEL
                     NYLHNQNITLTNGAGDVIGQDNVYNVSKARNQVCLFVLLRHKETKSIIVVINTHLYWK
                     YDEVKLVQCLTIMRKLQRIIKGLLMGLEDVTYSNVKILFSGDFNSTRDSLVIKFLNGE
                     MINHGDINLQNPMRAYLSHSIYDEIPDDSYIHTCYSGKLKGIFDYIWFHQGDFEVVKV
                     LSGAEVSKELDSLQQFGLPNENHPSDHIPVLTELRIL"
     gene            <763585..>764685
                     /gene="NTG2"
                     /locus_tag="KLMA_20363"
                     /db_xref="GeneID:34714835"
     mRNA            <763585..>764685
                     /gene="NTG2"
                     /locus_tag="KLMA_20363"
                     /product="DNA base excision repair N-glycosylase 2"
                     /transcript_id="XM_022817977.1"
                     /db_xref="GeneID:34714835"
     CDS             763585..764685
                     /gene="NTG2"
                     /locus_tag="KLMA_20363"
                     /codon_start=1
                     /product="DNA base excision repair N-glycosylase 2"
                     /protein_id="XP_022674690.1"
                     /db_xref="GeneID:34714835"
                     /translation="MGSLKRPRVKIEVEIETVSKYFKQEQKDGLVKRENEHGLGIQDV
                     DIDSIKRMGAREYFKYINRFTKDDISGEKLKIEDNPNIPANFIPIYSQVRLMRSLIKT
                     PVDSVGCAMLPITINSTFGIEQEKMKPKNYRLQLLISLMLSSQTKDETNAKAMHNLME
                     YCIEELGDPEGITLDALLKCDEKNLDNEIHSVGFHTRKASYIKKAAVMLRDQFDGDVP
                     TTIEGFISLPGVGPKMGYLALQKSWAKIDGIGVDVHVDRLAKMWGWVDSKLCKTPEHT
                     RKQLETWLPKSLWYEINPVLVGFGQVLCMPRGKKCNLCLVKDICPGVDKKLLKRIKET
                     QLDDDPVKDSIRGDYSELVSFLKEQKKQSKEE"
     gene            complement(<764850..>766694)
                     /gene="TPD3"
                     /locus_tag="KLMA_20364"
                     /db_xref="GeneID:34714836"
     mRNA            complement(<764850..>766694)
                     /gene="TPD3"
                     /locus_tag="KLMA_20364"
                     /product="protein phosphatase PP2A regulatory subunit A"
                     /transcript_id="XM_022817978.1"
                     /db_xref="GeneID:34714836"
     CDS             complement(764850..766694)
                     /gene="TPD3"
                     /locus_tag="KLMA_20364"
                     /codon_start=1
                     /product="protein phosphatase PP2A regulatory subunit A"
                     /protein_id="XP_022674691.1"
                     /db_xref="GeneID:34714836"
                     /translation="MSENSNNNSSSKEDLYPLALLMDELKHDDISNRVEAMKKLDTIA
                     LALGTQRTRDELIPFLTEVAQDDEDEVFSVLAEKLGSFVPFIGGRKYATLLLPALEIL
                     ASTEETLVREKAVTSLNEIAEQLSEEQLLHDFVPLIENLATNEWFSSKVSACGLFKAV
                     FVRIQDDKFRKDLLSLFLQLIQDDTPMVRRAAGRNLPTLIDQLTEHPELSTDDEWDYI
                     SSMFQRLVNDTQDSVKFLAVDVLISILKFFNMKQDFTHTKDLLQSSIQLIGDEAWRVR
                     YMAADRFEELASQFTSNPQLINELLEPFLALCQDNESDVRKAIAKQIPGYAKLINDPS
                     VVLNRIIPAVQNLSIDETESVRASLALEITNLAPLLPKQDAMDSLVPILLHMLKDEFP
                     DVRLNIIAKLKVVNESVGISFLSENLLPAITELAKDVNWRVRLAIIEYIPLLAEQLGL
                     EFFDSKLSDLCLSWLYDGVYSIRSAAISNLNKLTEIFGSDWARDEIITRLLKSDNQLL
                     KNFNYRITLLFALTGLVPVVDTDVIVEKILPFVNHLSTDNVPNIRFNVAKFYAVAVEA
                     LTKDTKDKHIELINKTVIPTLEKLCQDPDVDVRYFSEQSLEQCKSFLS"
     gene            complement(<767071..>768135)
                     /locus_tag="KLMA_20365"
                     /db_xref="GeneID:34714837"
     mRNA            complement(<767071..>768135)
                     /locus_tag="KLMA_20365"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817979.1"
                     /db_xref="GeneID:34714837"
     CDS             complement(767071..768135)
                     /locus_tag="KLMA_20365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674692.1"
                     /db_xref="GeneID:34714837"
                     /translation="MTQKSVRFAKTKKLDQLLDDSRFRIESEPIDEERLNAQECLDLF
                     VKGDLKGCIELMYLNGLLSDEKMGNSMESWQLMMDCISQLENVSLLGTSIERTLTQWF
                     SQEHELQRLVMKQPLNEQLNTMYQFYYSSLRFWKQNMKRYYEHIDAISISCRELVLQT
                     SRRCTTPQEIQQLAQLLDFLIFDVQVDTLKKAVNLSMYTRFCQLDNQLESKFKNNKLE
                     TASTDIDAYFRQKIQFRMPKQKQKKTIIPVKSPNITTLSSHTDPKFNSTQSETLQKNP
                     EKGIIQSSFMVPILRQIRRYIPNWSPHFVASIILFAISVILPVARRSVTFNVLWKHSK
                     DKVATALTLLTNVLNTLASL"
     gene            <768650..>770191
                     /gene="MUP1"
                     /locus_tag="KLMA_20366"
                     /db_xref="GeneID:34714838"
     mRNA            <768650..>770191
                     /gene="MUP1"
                     /locus_tag="KLMA_20366"
                     /product="low-affinity methionine permease"
                     /transcript_id="XM_022817980.1"
                     /db_xref="GeneID:34714838"
     CDS             768650..770191
                     /gene="MUP1"
                     /locus_tag="KLMA_20366"
                     /codon_start=1
                     /product="low-affinity methionine permease"
                     /protein_id="XP_022674693.1"
                     /db_xref="GeneID:34714838"
                     /translation="MVTSERSELGEHIEMQDLFLVNSRDGQNHHKLDTYHTISLIINR
                     IIGTGIFSTPALIFTLCQQSIGISIVLWMLGGIFTFAGLSVYLEFGLKIPKSGGEKNY
                     LSRTLPTPKHLIECVYAFTIVLLGFSSGNSYAFGKYIIYVLGLNSQLSDSIIDKLSRY
                     IGSAVVISCTLWHIYFPTGAKKSILYLGFVKVLILASIVLLGLVAIIAPSVIEPHWDN
                     FENSFSHGSQSIDWYSISVALLQVIYSFKGWENANYVLEELEDPHKTLMIAAPVSVGL
                     TTFLYIAIVISYYIVIPKDEISNTGILISGVFFEKIFEKYSKSLAAQIVSRFLPFCIT
                     LSNYGNVMAVSFSNARVNQELAKEGIFPFTHIFSKLNYALFLHCFVTILVLIIPPNGN
                     VYQLIIDLYAYPSGWFNLIIGVGLVYMHWTNNDNWNDIPTPWTSWYVLTGIFIVSNLF
                     LAVVPFVPPNGSVENDGYAYWVFPVSGIAVMAVGAVYWYFFVKKNYSEYTVALNSEDY
                     EVYNE"
     gene            complement(<770483..>774103)
                     /gene="PSK1"
                     /locus_tag="KLMA_20367"
                     /db_xref="GeneID:34714839"
     mRNA            complement(<770483..>774103)
                     /gene="PSK1"
                     /locus_tag="KLMA_20367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817981.1"
                     /db_xref="GeneID:34714839"
     CDS             complement(770483..774103)
                     /gene="PSK1"
                     /locus_tag="KLMA_20367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674694.1"
                     /db_xref="GeneID:34714839"
                     /translation="MPFIGASTNSDNGFQTLMDKISRAATPAPSPTPVSSISTSASIS
                     STSNSGANMGMSTLSNNEDTTNGDTTTETDKKRLPTAAQLPDASFELRKSSTVSTVSS
                     VGSSMVCSSIFTDSDMKELMRFPNSSTHAYSYNPLSPFSLSVRLSILKRSVEIMLNNP
                     SLLDDSDPSCTYVHMKEQQNNQMQLPVAPKMLRNASSAALSAFFTTKNQQKRPDLRKG
                     SSSTNVLHTTWEIGSHDDSENSSEATSRRSSLVSNLRSSISAQKLDSAAVASAAALVD
                     FEEKKRNDLGQLLELLNKALENNKEDAASSLHKMSLFNINKLDIPSSPSHSTNDGEQP
                     NSTSDTVIYDPHDLAIKKQLIESLAQPFHEAYNTREALMDERDLESKVEEYSKDPNAL
                     MAGNRILHTFTSQKNSSPKAIFTCSQQNPWKFRAANDLACLIFGISKNAMRALTLLDL
                     IHSDSRNFVLDKLMSTEGQEQVFTGEIVGIKQPGHSSSSSGLIWSSIWAKRKNGLIVC
                     VFEKVPCDYMDVLLNLDDYSVENIIGGEGLKYGIHGEPSKRTEQQTDDSGKKSVKFEN
                     DLPDVKSISESLWTLINDVKSGKITGPDDDLLPMPLRIVNALNEVRYFTLNFSEFNIP
                     CAVSCSILDTELKMKIHSLPYQTGVFILNLHSYEMLSFNKSISKNMFGLHYAELVDKS
                     IATVIPSFPAMISYIREKYPEWDIYLPSNRGLVLTEHFFRKIDCEMKGRPEDFYDSNG
                     LDAVHRDGRFIKVDIQLRVISRDYMVLWITYSRDLFAKEYSSNPSQLKILNESDINVV
                     TGTSSEASSKTPTQKISVADFKEMHDSLEKLSLSLEGSTVGSHMDSKVAQAKVVADDS
                     SEDSPNDVPKDDLELTAKLEVAKRFHKDKSLFVKDENFKLDKELIANITSSSPTLRPE
                     GSGSESSLKQLSNSSAPYEIGSMKHKKKFSDFIVLQKMGEGAYGKVDLCMHKKDRYIV
                     VIKRIYKERILVDTWVRDRVLGTIPSEIQIMVTLNKKPHDNILQIRDFFEDDDYYYLE
                     TEMHGETGSIDLFDLIELKTNMTEYEAKLLFKQIASGIKHLHDNGIVHRDIKDENVIV
                     DNKGFVKLIDFGSAAYVKSGPFDVFVGTIDYAAPEVLGGEPYEGKPQDVWAIGVLLYT
                     IIYKENPFYNIDEILDGDLRIQSTHEVSAGCVNLIKKILNRSVAKRPTINEIVEDPWL
                     AL"
     gene            <776381..>777310
                     /locus_tag="KLMA_20368"
                     /db_xref="GeneID:34714840"
     mRNA            <776381..>777310
                     /locus_tag="KLMA_20368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817982.1"
                     /db_xref="GeneID:34714840"
     CDS             776381..777310
                     /locus_tag="KLMA_20368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674695.1"
                     /db_xref="GeneID:34714840"
                     /translation="MSFAGTLLCCGVGGLIFKYGDQKHEKVELPEEMGIQDYTIGFAQ
                     KQFSVVKGRFDDALKSILPGFSTPGLYLYPFRAYWEVLKTPEYWKSTIPIMILYGILY
                     ILVTVVYALSILPVYTPISVFLGPLGLLVAWVHMFLHTNMLTMMSIRMSQMNTFTMSQ
                     ALKLRKIEQGVVASEIQTGTDQPVKYYYSVWSRYYLLNHLPWKMGEYLLGFVVLCVLL
                     AFSAIPIVGPIGFNVLVSPVITRIYWAPYLRFRNVNNLEREQRFYKNFGHYTAFGATA
                     ALVESIPVVSAFAYAAHAIAICDWAQEEPLVLP"
     gene            <778796..>781978
                     /gene="GAL11"
                     /locus_tag="KLMA_20369"
                     /db_xref="GeneID:34714841"
     mRNA            <778796..>781978
                     /gene="GAL11"
                     /locus_tag="KLMA_20369"
                     /product="mediator of RNA polymerase II transcription
                     subunit 15"
                     /transcript_id="XM_022817983.1"
                     /db_xref="GeneID:34714841"
     CDS             778796..781978
                     /gene="GAL11"
                     /locus_tag="KLMA_20369"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 15"
                     /protein_id="XP_022674696.1"
                     /db_xref="GeneID:34714841"
                     /translation="MDDWRSSISAQERTQFVTELAQILADMSRINGGEKANFNLEKLK
                     KSAEQFESSLYASCNSKELYLDAMRKRIAAMDSAKRKSIEAQRQKLAQAAQAAQRQQQ
                     QQQQQQLQKQQGNNGIPANINAQMFLNQQAQARQQAQRQIRSSLTGQQMQQLQQQQQQ
                     QQQQQQQQQQSPNMMRPQLTLQQQQQLANELKVTEIPRELLQKIPNLPAGITTWPQIT
                     DWAQKNRPSQNDLIITKKVYQLHQQLLIKSKLQQSNVNRMNTSAQQVMGMQQMPTNQR
                     MAMNQQMQPQPQPQSQPQPQPQPQPQPQPQLQQPQPHHQEAPAVLNRLNQVFTQAEQK
                     MLYEAGKKMIENLQRSGKLPPNLDNQQQLLYIKKYMNQMVLKKMQQLGIPIPMPGSAQ
                     RQTHQPQPQPQSQPQPQQRQPQQQPQLQQPQPQLQQPSIQQQPNQQVPQAQQAQARRQ
                     AMAMKSNPVGGVMNLQSQQAQQAQQAQQSPQMTQQPMMQQAQQQAQQQQQAQQSQPPK
                     ISIPRPTEQDMLALKKLNAEVTKNPVKLNDITNRLTNEQKQQIRSKLHANQQLFSSVE
                     SFIPTLYMLTRNEEHIRQLLQIRMLTREIMEKAVRGIFLVEPNVVDKVIFRYQKYYEY
                     TKEQLLRRQQQLMAMRQMQNNNPNLTANELMKQQQMLQARKQSMGVQQQQQQQQQQQQ
                     QQQALKQNQLNIQQQQQQKMAGTGNNPNVGIVLDSSMNAASRSGTNMEFLNSPEFNAI
                     SPAVPSPNKDKKTPASRAVKGKKNLQPGIPTSNPQSNSNPSVVNSRTTTPSMVPGSSP
                     MVNNKSLAPGQLSTPSPKTVVTSPIRQDNPYKNDELVLKKMAIRKAELMSRYKHRKEV
                     FASSAIDLFLSTFADCLDIKDDAVDLVQKSPQPIIDQINGTGKKKLSKAAQKAREQDP
                     VEISVKNNKLLMPSKSEKALRSFKIPISDITACFKPFVDPKHLILTSTPNPDDRKRKL
                     DDLEISPTDSSSELMSESKKVKFDSPDDMFLNDPSSVHDIKPLVSSDLGVNSNNLKNA
                     VPSMTSQNPTTNGSTDSSTNIWDWNYWENL"
     gene            <782361..>783824
                     /gene="GSH2"
                     /locus_tag="KLMA_20370"
                     /db_xref="GeneID:34714842"
     mRNA            <782361..>783824
                     /gene="GSH2"
                     /locus_tag="KLMA_20370"
                     /product="glutathione synthetase"
                     /transcript_id="XM_022817984.1"
                     /db_xref="GeneID:34714842"
     CDS             782361..783824
                     /gene="GSH2"
                     /locus_tag="KLMA_20370"
                     /codon_start=1
                     /product="glutathione synthetase"
                     /protein_id="XP_022674697.1"
                     /db_xref="GeneID:34714842"
                     /translation="MSSLKGYPKFPDVTKEKLERELLPEVFQWAISNGLTIYPPDFKI
                     SEAQVAPITLFPTPLPRKAFEDAIDVQKSFNSLYAKISQNHNGWLEEESEKLAKSDPE
                     FTGKLWEIYKRAKEHGISQDLALGVFRSDYLINDNDNQIKQVEFNTVSVSFAGLSTKV
                     GQLHQYLNDSGRYSADGESFFNEEIPVSPSAELLAEGLTKAIQHFKPAASDKKPIVAF
                     IVQEGERNVFDQSVLAFNLLSKHGIQSCRLTMQEIHLKTTLDKSTKRLYLNSTGKEIG
                     LVYFRSGYAPNDFVTQQDWENRFTLEISYAIKAPNLLTQLSGTKKIQQLLTNKNILTK
                     FLPDANSADALLQTFVRIYPLDSSELGEMGKKLAFTNPENFVLKPQREGGGNNIYKED
                     IPTFLKSIDEKDWPAYILMELINPRPTEENIVIRGEQTFQVPILSELGVFGTILFDNK
                     TVHSNDYAGWLLRSKFSASNEGGVAAGFGCVDSVVLY"
     gene            complement(<783871..>784359)
                     /locus_tag="KLMA_20371"
                     /db_xref="GeneID:34714843"
     mRNA            complement(<783871..>784359)
                     /locus_tag="KLMA_20371"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817986.1"
                     /db_xref="GeneID:34714843"
     CDS             complement(783871..784359)
                     /locus_tag="KLMA_20371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674698.1"
                     /db_xref="GeneID:34714843"
                     /translation="MLLLIPPFLVIAVFQVNTWTVFIMRHLLLKNQTYLARKIDETYK
                     IEILNSIKLISKDDENEFDLFGFSGKLIQLLMMLTTSFFPLVPQLLMIPSISWQYLNA
                     IYLPKELPDDRFWKNKSSFLSFGLMAACLEAIPFVSGLTFTTNYLGGTMMAVDMDELH
                     FA"
     gene            complement(<784770..>787895)
                     /gene="FUN30"
                     /locus_tag="KLMA_20372"
                     /db_xref="GeneID:34714844"
     mRNA            complement(<784770..>787895)
                     /gene="FUN30"
                     /locus_tag="KLMA_20372"
                     /product="uncharacterized ATP-dependent helicase FUN30"
                     /transcript_id="XM_022817987.1"
                     /db_xref="GeneID:34714844"
     CDS             complement(784770..787895)
                     /gene="FUN30"
                     /locus_tag="KLMA_20372"
                     /codon_start=1
                     /product="uncharacterized ATP-dependent helicase FUN30"
                     /protein_id="XP_022674699.1"
                     /db_xref="GeneID:34714844"
                     /translation="MDHRVPKSPQNKMDEVQVPSSSPILNSNQESSPLRPDSTTDNKT
                     TEQHLPINATTSLLRDRFTYQPTSKAKQIFSQNDQSHEQALKTLILEYKDLSPTLINA
                     IFKQNSLSLAASRRRLDHIVASRSGGSWRFPSKSNASSSNSNPVNSASGSPVDSSRSR
                     LTSLSRNSLQNVATRNIPLNLTSRTPTSKITIEKQKSSIFDRYSHVMKKSQPTEMRPL
                     VDRNSVSSKKGKLVRGDAIKKQKIKLSDDEEDEVTDGSNAGSDLDSEPDYQETTPESS
                     FVQVLKFLNEADPRDLADLGEISIEKANLVIKERPFESLEEFQQLDFQNKSVSPPGGK
                     TRKTQQRKDGIKILDKIEQSIKGYNAIESLIRKCSRYGDIIADQMKDWGVSFDPSKDA
                     ELDILDVDVDSTDENPKRNTSELDIVSISSVSSSQNDANGSSKRKRHEEDDISDVDYD
                     ESDDDFDLNPSSRSRHHKPSITKLKSTRVPFIRQKPKFLSQEVELKDYQQTGINWLHL
                     LYQNNLSCILADEMGLGKTCQVISFLAYLKQINQEGPHLVVVPSSTLENWLREFNKFC
                     PHLKIEPYYGSQQERAELRDILEENEGQYDVIVTTYNLAAGSKYDVSFLRNRNFNVVV
                     YDEGHMLKNSMSERFNKLMKINAQFRLLLTGTPLQNNLKELMSLLEFIMPNLFVSKKD
                     DLATVFKQKTKTSDADKGYNPLLAEQAIERAKTMMKPFILRRKKDQVLKHLPRKHNHI
                     MYCEMRDAQNAIYQQEIKQVMEHRRKIREGVKMDKASYNVSKNLIMALRKASIHPLLF
                     RHIYNDDKISKMSKAIISEPEYYENGNIEYIREDMSYMTDFELHKLCCKFPSLNKFKL
                     QSEEWMNSGKVDKLKSVLHDIVDKKHEKALVFSLFTQVLDILEFVLSTLNIKFLRLDG
                     QTQVNDRQSLIDRFYQDDSIPVFLLSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAA
                     DRAHRVGQTKEVHVTTLISKGTVEEKILHLAKNKLALDSHISQEDKKSEDDLENKVTD
                     LLEDIIFDENK"
     gene            complement(788193..788264)
                     /locus_tag="KLMA_R212"
                     /db_xref="GeneID:34718658"
     tRNA            complement(788193..788264)
                     /locus_tag="KLMA_R212"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:34718658"
     gene            complement(<788553..>791474)
                     /gene="RAT1"
                     /locus_tag="KLMA_20373"
                     /db_xref="GeneID:34714845"
     mRNA            complement(<788553..>791474)
                     /gene="RAT1"
                     /locus_tag="KLMA_20373"
                     /product="5'-3' exoribonuclease 2"
                     /transcript_id="XM_022817988.1"
                     /db_xref="GeneID:34714845"
     CDS             complement(788553..791474)
                     /gene="RAT1"
                     /locus_tag="KLMA_20373"
                     /codon_start=1
                     /product="5'-3' exoribonuclease 2"
                     /protein_id="XP_022674700.1"
                     /db_xref="GeneID:34714845"
                     /translation="MGVPSFFRWLSRKYPKIISPVLEEHQVVEDGVKLPIDYSAPNPN
                     GELDNLYLDMNGIVHPCSHPENKPPPENEDEMLLAVFEYTNRVLNMARPRKVLMIAVD
                     GVAPRAKMNQQRARRFRSARDAKLQNEAREQVLREREDYGEVIEESVKNKKTWDSNAI
                     TPGTPFMDKLATALRYWTSFKLATDPGWRNLQVIISDATVPGEGEHKIMNFIRSQRAD
                     TQYNPNTTHCIYGLDADLIFLGLATHEPHFKILREDVFANNNYKKPKPHNMINLSEEE
                     KQQLIQQDSEKPFLWLHISVLREYLAAELAIPHLSFQFDFERAIDDWVFMCFFCGNDF
                     LPHLPCLDVRENSIDILVDIWKNILPRMKTYLTCDGNLNLEPVEALLGQLGEREGDLF
                     KKKYIQEVRKQEAFERRKKLKNNPNVTKGKVDRNFMIPLENMPVFDVDGNAAEGSLNL
                     SNKDFANMRKEMNKANEGDDEAAKALKERSEKNNGSSEFSTEELDNSILLSKSANYDT
                     ATSLQEKLLSKKLAMKEEEETNLKRKIDEINTPEESESSNVEDDLEEEEESSVVPEVV
                     HTGTVKSGFVDTDESVKLYESGYHDRYYQQKFHVSAKDIPALQKDVVKCYVEGISWVL
                     LYYYQGCASWTWYYPYHYAPFAEDFVNIKGLDIKFDLGEPFLPYEQLMSVLPAASGHA
                     LPEIFRPLMSDPNSEIIDFYPEEFPVDMNGKKMAWQGIALLPFIDEKRLLKAVREQYS
                     KLTDAEKARNVRKKEVLLISNKNVNYDLFIKNLYSENPVEVLEFKHFKSGLSGFVSQD
                     EEGFQLNSKLMCPINEGGLPDLSTNLFLRVAYTMPKIVEKCKSLILNGYIPPQPMLTP
                     QDRDCIMYKYSNRWNPSMMKYNIVPVGPYGITQYQPRVGGYRSFFFHREQVNNTQQHT
                     SHKTQYYAQQKPQASRYQQSRFNGGNYRNNYNNNGNSNNNGNNGSRYSNHNDHRRGFR
                     N"
     gene            complement(<791920..>794847)
                     /gene="CCC2"
                     /locus_tag="KLMA_20374"
                     /db_xref="GeneID:34714846"
     mRNA            complement(<791920..>794847)
                     /gene="CCC2"
                     /locus_tag="KLMA_20374"
                     /product="copper-transporting ATPase"
                     /transcript_id="XM_022817989.1"
                     /db_xref="GeneID:34714846"
     CDS             complement(791920..794847)
                     /gene="CCC2"
                     /locus_tag="KLMA_20374"
                     /codon_start=1
                     /product="copper-transporting ATPase"
                     /protein_id="XP_022674701.1"
                     /db_xref="GeneID:34714846"
                     /translation="MSDFQALLSVQGMTCGACVDTVHKQVSGVKGVEDCDVSLLTEEC
                     HVKFDSKLTSTSELVETIQDCGFDATLIAEEPLKLIGSVSEQHSGTILVGGMTCGACV
                     QTVTTQVLKISGVLECTVSLATEECNVKFDPNLTSIAAIAECIEDCGFDAKIISEERS
                     TVPTKEKQLCLKIFGLDPNDGAVVVEAKLSQLKGLLSVDVSMSEEEAKIVYDASEIGI
                     RDIVDCIQSLGCETVISNALDNSTQLALLSKVREIHFWRGNCIRAAVSAVLIMSLYMC
                     VPFLFPHRMGHFPYTMTPIKGFFYRDIFGIIITIYVQLYVGSYFYRAAWTSLKHGSGT
                     MDTLIGISTACAYIFSFYSIASNIYHKSSTMPKVIFDTAIMLITFISLGKLLENRAKS
                     ETSTAMSKLISLTPSSCTIVLPDQTSREIPIELLQPNDIVEVVPGMKIPADGVIIRNE
                     TEVDESLITGESMLVEKTVGSQVIGGSVNGPGHFYFKATRVGEDTKLASIISTMKKAQ
                     LSKAPIQRYADRMAGVFVPFVLSLALLTFVIWMCVSYSLKNPPAIFNNDNGKFFTCMQ
                     ISISVIIVACPCALGLAAPTAIMVGTGVGASNGVLIKGGEILEKCNSLQTFLFDKTGT
                     LTTGRMSVENFIPLGDELKELHWKMIALCESIGDHPVAKAIVNFAENNINPSTTFDLQ
                     MSNEEVIIGKGISCKIYDKNSSETYDIVIGNKKLLPDGNAGNSPPSCLTESFVSINGN
                     IVGKFEIADRVKVDSHLVIRYLQDMGIRCCMVTGDVHESALKVAEQLNIPASNVFSEV
                     TPEEKRNIVIQLQNEGTERVAFVGDGINDSPALVEADLGISISSGTDIAIEAADIVIL
                     DSNNNNDTLKGLIYALDISRKTFHRVKLNFFWAFCYNTFMIPVAMGVLVPWGITLHPM
                     LSGAAMALSSVSVVCSSLMLKRWTPPSLNTKPLKDSSGLSWMRFGRRRARNDDIELQE
                     RLV"
     gene            <795879..>796082
                     /locus_tag="KLMA_20375"
                     /db_xref="GeneID:34714847"
     mRNA            <795879..>796082
                     /locus_tag="KLMA_20375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022817990.1"
                     /db_xref="GeneID:34714847"
     CDS             795879..796082
                     /locus_tag="KLMA_20375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674702.1"
                     /db_xref="GeneID:34714847"
                     /translation="MARGNQRELARQKNLKKQQEQAKGQKKQGDPKKRMESDAEILRQ
                     KQQAANERKEKERMEKLLAEKRR"
     gene            complement(<796296..>797339)
                     /gene="TIF34"
                     /locus_tag="KLMA_20376"
                     /db_xref="GeneID:34714848"
     mRNA            complement(<796296..>797339)
                     /gene="TIF34"
                     /locus_tag="KLMA_20376"
                     /product="eukaryotic translation initiation factor 3
                     subunit I"
                     /transcript_id="XM_022817991.1"
                     /db_xref="GeneID:34714848"
     CDS             complement(796296..797339)
                     /gene="TIF34"
                     /locus_tag="KLMA_20376"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3
                     subunit I"
                     /protein_id="XP_022674703.1"
                     /db_xref="GeneID:34714848"
                     /translation="MRPIVLKGHERPLTQVKFNRDGDLVFACSKDSVASIWYSINGER
                     LGTLDDHSGTIWSIDVDENTTYCLTGGADFCFKIWEVATGVAVHSVSTRSPVIRVEFS
                     PDGTKLLIVLDAVMGHVGSIVVYSLIRNENGEIVKVNEEPEYEINTIEEATKVFVASW
                     SYNGKYIVAGHDDGQISTYNGESGEFIQVKKIHEKSIKDIQFSPDRTYFITSSRDSAA
                     CLIDVNTLDVLKTYKADCPLNSACITPLKEFVILGGGQDAKDVTTTSAREGKFEARIY
                     HKVFEDEIGRVKGHFGPLNYVAVSPTGTSYASGGEDGYIRLHHFDKSYFDFKYDVEKT
                     FEVERRQQLQKQE"
     gene            complement(<797807..>798619)
                     /locus_tag="KLMA_20377"
                     /db_xref="GeneID:34714849"
     mRNA            complement(<797807..>798619)
                     /locus_tag="KLMA_20377"
                     /product="putative carboxymethylenebutenolidase"
                     /transcript_id="XM_022817992.1"
                     /db_xref="GeneID:34714849"
     CDS             complement(797807..798619)
                     /locus_tag="KLMA_20377"
                     /codon_start=1
                     /product="putative carboxymethylenebutenolidase"
                     /protein_id="XP_022674704.1"
                     /db_xref="GeneID:34714849"
                     /translation="MLIKQSFKDLATSFDSTIRIHVVEPTVKGYPNAKFPAVLVFSEI
                     YQVTGPVLRFAQTIAAQGYIAVLPSSYHNFIDSTPLAYDVEGTDLGNELKITKPLESY
                     DEDVTLSLKVLEDMPNWNGRVGATGMCLGGHLAFRAQLDPRIKATTCFFPTDIHSHSL
                     GKGKNDDTLEKVTANWQNDQECILIFGTKDTHVPWEGRDQIRKAVKDKPVTFLEINGA
                     QHAFIRDEFSKGRYDATITKACLGFMFEQFDRKLKSELGDFVDDNAPIEHVC"
     gene            <798916..>799713
                     /locus_tag="KLMA_20379"
                     /db_xref="GeneID:34714850"
     mRNA            <798916..>799713
                     /locus_tag="KLMA_20379"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817993.1"
                     /db_xref="GeneID:34714850"
     CDS             798916..799713
                     /locus_tag="KLMA_20379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674705.1"
                     /db_xref="GeneID:34714850"
                     /translation="MSSQCLGITQKGTPCKLNAKQGGRYCRHHEVQETSEGYIYIYTF
                     EELYENAILSRKERNQISWLAIDESKLNKAKKVGITPWQHQGDEILIKIGMTTRDDVS
                     IRLAEWRKQCKREIIPINPSRALQFYSLDSNTRHSKKSNIIDKVSRLFSKLDLSGGST
                     SSKTSSTATQTLNLSTYKRNGFRCTHPRDVEREIHEWLWHKYGKGNVLCEACHKTHHE
                     WVRVPVREMVSIMYTIEGICSRSEYAAATSKRERPYKLKRAAEQKTS"
     gene            <800882..>801154
                     /locus_tag="KLMA_20380"
                     /db_xref="GeneID:34714851"
     mRNA            <800882..>801154
                     /locus_tag="KLMA_20380"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817994.1"
                     /db_xref="GeneID:34714851"
     CDS             800882..801154
                     /locus_tag="KLMA_20380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674706.1"
                     /db_xref="GeneID:34714851"
                     /translation="MSTFAEDRFNEQFEQGMIDQFECIRDSELAQGYQYLEDSYYKMC
                     DTCKKQLDAVVEEHPYISDHVRRYSIMLKKRYDHYMGTTAGTAGTA"
     gene            <801959..>802462
                     /gene="OSW5"
                     /locus_tag="KLMA_20381"
                     /db_xref="GeneID:34714852"
     mRNA            <801959..>802462
                     /gene="OSW5"
                     /locus_tag="KLMA_20381"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817995.1"
                     /db_xref="GeneID:34714852"
     CDS             801959..802462
                     /gene="OSW5"
                     /locus_tag="KLMA_20381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674707.1"
                     /db_xref="GeneID:34714852"
                     /translation="MNPKSLAQFAFHLAAFVSIAFVASMFVLPFITVSFVLSSMTVGL
                     SFASRSFFQVGMFFYDRFVMFLQVQLRSMIEQMPSNQPTGYNLKKPAKPAAATAAAAA
                     ATATATPSSANAAENVPVVTTESLIAEEPNIDRLLIKKSQPPVPTETLGANIPLHSIE
                     ESLLDTA"
     gene            <802708..>803505
                     /locus_tag="KLMA_20382"
                     /db_xref="GeneID:34714853"
     mRNA            <802708..>803505
                     /locus_tag="KLMA_20382"
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit SWP1"
                     /transcript_id="XM_022817997.1"
                     /db_xref="GeneID:34714853"
     CDS             802708..803505
                     /locus_tag="KLMA_20382"
                     /codon_start=1
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit SWP1"
                     /protein_id="XP_022674708.1"
                     /db_xref="GeneID:34714853"
                     /translation="MKLQSLIVLFLALFECCVATGIVLKDVVLSFDSRTPSIQLDQVD
                     IDSKAKSNETPVSLSETLTLSFETEDELSQANILVGVPSKGLEAGYTLKKKNSGDHSK
                     YVANVPLSKYAGTFEGFSQLAITVLAANEETSLVKEIFQLNINTTETQSTSSKKANRF
                     GPLDEIHHVFQQPPKTVNAFIAQVFSAIIAGALLVLLAAWVGFGVISFNLKSVSSYVF
                     VALISGFEFIFYKYYFGSSIFDTLFKASLLLLPALLFGSATLKSFKH"
     gene            complement(<803563..>804072)
                     /gene="IMP1"
                     /locus_tag="KLMA_20383"
                     /db_xref="GeneID:34714854"
     mRNA            complement(<803563..>804072)
                     /gene="IMP1"
                     /locus_tag="KLMA_20383"
                     /product="mitochondrial inner membrane protease subunit 1"
                     /transcript_id="XM_022817998.1"
                     /db_xref="GeneID:34714854"
     CDS             complement(803563..804072)
                     /gene="IMP1"
                     /locus_tag="KLMA_20383"
                     /codon_start=1
                     /product="mitochondrial inner membrane protease subunit 1"
                     /protein_id="XP_022674709.1"
                     /db_xref="GeneID:34714854"
                     /translation="MSWLKISSYVVRTVCLVHITHAHFYEFTETRGESMLPTLNSVND
                     YVHVLKWYKDGRDLSIGDCIVAMKPTDPQCRVCKRITGMEGDLILVDPSQNDDEEAFD
                     TFIKVPKGHVWVTGDNLSHSLDSRTYNSIPMGLIKGKIVAANDFNKPLSTLWGFRYIT
                     NNFVDETEG"
     gene            complement(<804185..>804808)
                     /locus_tag="KLMA_20384"
                     /db_xref="GeneID:34714855"
     mRNA            complement(<804185..>804808)
                     /locus_tag="KLMA_20384"
                     /product="hypothetical protein"
                     /transcript_id="XM_022817999.1"
                     /db_xref="GeneID:34714855"
     CDS             complement(804185..804808)
                     /locus_tag="KLMA_20384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674710.1"
                     /db_xref="GeneID:34714855"
                     /translation="MNEPFSALIIGGTENDSCVRVCRELIFKYGINVTIVGVFDTRDE
                     ILYGLEEYYKSSDIRVKSWFSTFDSHIDLINSRRNNYRFISIYTQNWAKYLVGVNVVI
                     NLTQYYEPSFGSLLTTPVTEVQEGIERWCHVVELLNQVMFQTKCCIATLVQKDMEFER
                     GHRVLVNSMLQYLDGSCCNSPQNFNVFFTEAQLFQQFENGTYIDIMR"
     gene            <805123..>805923
                     /gene="LUC7"
                     /locus_tag="KLMA_20385"
                     /db_xref="GeneID:34714856"
     mRNA            <805123..>805923
                     /gene="LUC7"
                     /locus_tag="KLMA_20385"
                     /product="protein LUC7"
                     /transcript_id="XM_022818000.1"
                     /db_xref="GeneID:34714856"
     CDS             805123..805923
                     /gene="LUC7"
                     /locus_tag="KLMA_20385"
                     /codon_start=1
                     /product="protein LUC7"
                     /protein_id="XP_022674711.1"
                     /db_xref="GeneID:34714856"
                     /translation="MSAILEQRKLISQLMSSAATSHGLSSPSTCKSFVVGHCPYELFQ
                     GTKQPMGQCTRIHSLSHKMQYERDLKKGKTYPEFDLEHYSILKKIVHDCDVQIEMAHK
                     KLQHHEEHHKLTAMLQELNQLESKCALMLSEIDMLIQHGEVMKAMVQSCKYNKLQKER
                     DALSERCRNMNENIGQSAQQKLQVCRVCGAFLSRLDTDRRLADHFMGKVHLGYVIMRK
                     ELEMCRKRLHEQGRDVNSYTHYTRKPHRHGNAHSNHQMHAYTRKSYRS"
     gene            <806216..>807484
                     /gene="ASM4"
                     /locus_tag="KLMA_20386"
                     /db_xref="GeneID:34714857"
     mRNA            <806216..>807484
                     /gene="ASM4"
                     /locus_tag="KLMA_20386"
                     /product="nucleoporin ASM4"
                     /transcript_id="XM_022818001.1"
                     /db_xref="GeneID:34714857"
     CDS             806216..807484
                     /gene="ASM4"
                     /locus_tag="KLMA_20386"
                     /codon_start=1
                     /product="nucleoporin ASM4"
                     /protein_id="XP_022674712.1"
                     /db_xref="GeneID:34714857"
                     /translation="MMSSVFGQQSQQPKQPFQENRFSNLQINYPQQQQQQQQQQNNTQ
                     SLAQTSTSNGKEESWYNIARKRNIPQTVIKRPSKPTSSGDNSSTDTSTHRSGFSSVQF
                     GTKNPTFNSSQPSQPTDIATYVESNEAPPTKSLYDWQREDEFGSVSTNMSLPETSHQI
                     NLSQRFPKNSRNAFDRNSEATHTRVGKDEINDSSRPKSEESAVIVFGYPESISNQVIL
                     HFSKFGNILEDFEILRGVTGNNISSATIRLRTQNKDSKAQKKYPIFTGDGWIKITYDS
                     PSAALRALQENGTVYGGCLIGCVPYNKAAVEQLASCKIDKSDDIGNIPFSLSMKPNGS
                     SSADAQNRSEDDNDSRKHGSRFSFSTRKLDVKDGKELFVHNGNSSHSGQNFLKSLENK
                     LKEQEQQGGNQQPTDIVGKLNNWLFGWNDL"
     gene            complement(<807606..>809237)
                     /gene="NUR1"
                     /locus_tag="KLMA_20387"
                     /db_xref="GeneID:34714858"
     mRNA            complement(<807606..>809237)
                     /gene="NUR1"
                     /locus_tag="KLMA_20387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818002.1"
                     /db_xref="GeneID:34714858"
     CDS             complement(807606..809237)
                     /gene="NUR1"
                     /locus_tag="KLMA_20387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674713.1"
                     /db_xref="GeneID:34714858"
                     /translation="MALWKRERKSPTASAQLSPTESAAEEENGDVHNDDLQERKGWFG
                     SLSSMFALPYDWYLSINEDIAVIDWDKKSNTLAWPLGNMLTCVFFAIRLLQDNVISPN
                     IHKLNHSDDAFDFSKSKNLQKYDYFQQYLGTNAAGDSLYYRMLRVLHRIFGFLTYFLL
                     VINLGITYKFLFSYYQTYSIFYWKTIPKSKNVTKKSLHDLNHTYVEDAKRDSLWGMIK
                     YLIFNKNDTAEISKKEHYFELRKWAPSKFLTSLFVSFSPIAYCFLWMTDVTFKTLIPL
                     LVHQYVLWFIVLERYEQKLKDEQILSMSNLAELNSKVIQPKMNVLKQDAMVDATPYND
                     NLVFFYPAYTTTRSRVFATHSLGGKLIKEKYNFRTNSFEDTEPRRTENFVRFSHQQSL
                     LNGQYARDPYHHSRQPSPRLSPSRYSNAYGGNTPSAPSTPLLAPSQPLHFDHSTMANA
                     SRNQNTNMMFNSRRNSHSPMRPQFSNKLHRYADETGYSVSDYPDESNLRGRQSYIDSS
                     PQPNNHELNDERIYDNENNTGNNSPYRNLSRSPFK"
     gene            complement(<809446..>811539)
                     /gene="RIM13"
                     /locus_tag="KLMA_20388"
                     /db_xref="GeneID:34714859"
     mRNA            complement(<809446..>811539)
                     /gene="RIM13"
                     /locus_tag="KLMA_20388"
                     /product="calpain-like protease palB/RIM13"
                     /transcript_id="XM_022818003.1"
                     /db_xref="GeneID:34714859"
     CDS             complement(809446..811539)
                     /gene="RIM13"
                     /locus_tag="KLMA_20388"
                     /codon_start=1
                     /product="calpain-like protease palB/RIM13"
                     /protein_id="XP_022674714.1"
                     /db_xref="GeneID:34714859"
                     /translation="MSLESSFVAEQHTRPLWKELYEICWSFYVKNHWNADKFKEIIRD
                     VQKSDDPQLIRFLLWFNDARTRTNFNDRFEWLTSFHRGRRYPPLRSDLEVREAWNNLS
                     ELDTLVRYGNEPISLYKFDSLVTESFEKITQNVKVNDCSLVCSLINAREKGQLHYYYS
                     KDIMNITFYFNGCSRLVSVLSNSSFPKLTHDGSILTLYSNKIEDRLIELAYFEIKNDR
                     DYNYNGSNTAADTYLITGWIPEIFDIRSTTPGDLRKLVDTDNSMLAIGSEATTNANIP
                     GFHDFVISSIDWDDNSINISNPHTSEPPVSYTWTELLHKFKWLYVNWNPSAKYTTHKR
                     LHDRYLESFNKYPTWTQKPLIKVTNNSSSIQACHLFLERHLYDKDPPNSDLILGELPR
                     SGFTTVEARGNNTGFYNIELTLEPNETRTFFYHSDTKCNLTFHLLANSDNVLISKTKS
                     DITTIESSWNITNNSYPIESSELFKNPAFKLNVNGSDDIFLDLELVSQHLAKVNFEVF
                     ETMDYAFQKPLSRNKHYAPQICSESSLRLIPGIEYYVLCSLEYPVETPFILTLRGSSP
                     EYKFNITPYSLAFGGLRYNKSIHFKQKLIIDIQNFTKTYFIIYQSNFAASQKLPTPQL
                     LRIQLYDSETKTIIHDNTLQSHDLSLNPYVLPNIELRPSIYTLEVDCNNSVLTANVGS
                     SHKIDIQSSVTGYGL"
     gene            <811727..>813016
                     /gene="RAM1"
                     /locus_tag="KLMA_20389"
                     /db_xref="GeneID:34714860"
     mRNA            <811727..>813016
                     /gene="RAM1"
                     /locus_tag="KLMA_20389"
                     /product="protein farnesyltransferase subunit beta"
                     /transcript_id="XM_022818004.1"
                     /db_xref="GeneID:34714860"
     CDS             811727..813016
                     /gene="RAM1"
                     /locus_tag="KLMA_20389"
                     /codon_start=1
                     /product="protein farnesyltransferase subunit beta"
                     /protein_id="XP_022674715.1"
                     /db_xref="GeneID:34714860"
                     /translation="MTASLMVKVQKRMSYINRNVLGRKRETIEQEVIEEEEELPEIGN
                     MKINLMTETLQDRETLIEDCLELYDKTSEKPNVLLKGLHKIFLDYAFTHPLPSGFKSL
                     DASQPWLLYWIGNSLKLLNRNWLTADYQKRILSKLWSISPTGGPFNGGKHQLPHLTTN
                     YAAINAIALCDVEHRDDKQEINKQAIYDWLISLKTDGGAFYTVKPVGEQDVRGVYAAL
                     TVASLLGIMDEKLIDGVTDFLIRCQSYEGGFGGCPGDEAHGGYTFCAVASLALLDALD
                     KINIQTLMSWCSSRQAREERGLNGRSNKLVDGCYSFWVGGTAAILEAYGYGVCIDKHA
                     LKQYILRCCQEEGVPGLRDKPGKQPDYYHTNYVLAGLSICEYSFEATKKNECCTFDIT
                     ATPLSSSCDVEPINPIFGLPEQDVRRLILQNATSNTM"
     gene            <813345..>814604
                     /gene="UBX3"
                     /locus_tag="KLMA_20390"
                     /db_xref="GeneID:34714861"
     mRNA            <813345..>814604
                     /gene="UBX3"
                     /locus_tag="KLMA_20390"
                     /product="UBX domain-containing protein 3"
                     /transcript_id="XM_022818005.1"
                     /db_xref="GeneID:34714861"
     CDS             813345..814604
                     /gene="UBX3"
                     /locus_tag="KLMA_20390"
                     /codon_start=1
                     /product="UBX domain-containing protein 3"
                     /protein_id="XP_022674716.1"
                     /db_xref="GeneID:34714861"
                     /translation="MAFNFFNSSSRGNGVPVAFTPLPGTFSDEADNEDNLESNSNTNG
                     SASDIPRLIKVCLYVPLTILYYVLNLLLTLVGMFKPVSNIFHFYTKKDNHFGDDMATQ
                     FVNVIDSLSAYTAANERSGYTFEVLYNIENGVLSKNMLKGGYTDILHKCSNDAKIAIL
                     YFFDPLLYDPYEYISKILTTTEFVECVKKYNCLVWFCDVTTPQGLQTANALKVRQFPF
                     LGALAPRSSNKMKLIARVEGPLFDYDFSRFESKLSTYYPTLLEIRRQRQYEEVQRLLR
                     EQQDSRFQDSLRRDQERDRAAEEVALKSQWLIWRKSTLAPEPASGGCRVNIRLENERV
                     IRRFDENLPIEEIYAYIALKRAGLLSPNDTNSDEVEGEVQRPNYDYQFDFELYSPVPR
                     TYLEPSTLIKDEDAIYPSGTIIVESAE"
     gene            complement(<814675..>815100)
                     /locus_tag="KLMA_20391"
                     /db_xref="GeneID:34714862"
     mRNA            complement(<814675..>815100)
                     /locus_tag="KLMA_20391"
                     /product="signal recognition particle subunit SRP14"
                     /transcript_id="XM_022818006.1"
                     /db_xref="GeneID:34714862"
     CDS             complement(814675..815100)
                     /locus_tag="KLMA_20391"
                     /codon_start=1
                     /product="signal recognition particle subunit SRP14"
                     /protein_id="XP_022674717.1"
                     /db_xref="GeneID:34714862"
                     /translation="MTEVHQGNKPLTQDAFLEKLPKLFEVSNAQNKTLNLRLKRCIKH
                     DGVTKPAELDAHSHPHSDISKMAESKQLKKQYKANKKTYKLLVMATVGKGTHRTKCVT
                     VVDASELDAFWKRTVSVTKSSMSGLIKKKTKKKKKGKKN"
     gene            <816359..>817594
                     /locus_tag="KLMA_20392"
                     /db_xref="GeneID:34714863"
     mRNA            <816359..>817594
                     /locus_tag="KLMA_20392"
                     /product="delta(12) fatty acid desaturase"
                     /transcript_id="XM_022818008.1"
                     /db_xref="GeneID:34714863"
     CDS             816359..817594
                     /locus_tag="KLMA_20392"
                     /codon_start=1
                     /product="delta(12) fatty acid desaturase"
                     /protein_id="XP_022674718.1"
                     /db_xref="GeneID:34714863"
                     /translation="MSQSQYVTDAETVTENTCRVAVDTHGNVFKVPDYSIKDILGAIP
                     AECYNRSLPRSLSYVARDIIAMVTIGYLTHVVGYPYVKDLHIAARFAYWFAYAFVQGL
                     FGTGLWVLAHECGHQAFSDYGAVNDFVGWILHSYLLVPYFSWKYTHSKHHKATGHITR
                     DMVFVPKTKEKFIKARGVYEDIEEFSEDSPIRTLVELIVQQLGGWLYYLLTNVTGQEY
                     PEVSKWKWNHFWPSAPIFDSKDYIYILLSDLGIITQSLVLKMWYDKFGGWSLFINWFV
                     PYLWVNHWLVFITYLQHTDATMPHYEADQWSFAKGAAATIDRQFGFIGPHIFHDIIET
                     HVLHHYCSRIPFYNARPASEAIKKVMGEHYRYNDENMWVSLWKSARACQYIDDEGSKG
                     VYMFRNVNNIGVGTGKKKN"
     gene            complement(<818465..>819937)
                     /gene="STP3"
                     /locus_tag="KLMA_20393"
                     /db_xref="GeneID:34714864"
     mRNA            complement(<818465..>819937)
                     /gene="STP3"
                     /locus_tag="KLMA_20393"
                     /product="zinc finger protein STP4"
                     /transcript_id="XM_022818009.1"
                     /db_xref="GeneID:34714864"
     CDS             complement(818465..819937)
                     /gene="STP3"
                     /locus_tag="KLMA_20393"
                     /codon_start=1
                     /product="zinc finger protein STP4"
                     /protein_id="XP_022674719.1"
                     /db_xref="GeneID:34714864"
                     /translation="MDVLTHSNISPTDNAQAIQLPPISSFDSLIKSGAKHTNNSRSGL
                     NTNGNANVNANVNVNVNVNASMRIGPHSPASSITTPINCASGSYAHRASIASIMTNNS
                     MSPRTSTDHVANLNGPNFNDSSVSGTPVLPGKPNSTSSGSGKGLSDNLLSYQFGSTGS
                     SPSAQAYRASVSLSHSNSFVLPHDQSQSQSQAQSQQTVPKLNAGFSNLDVLLDQNGHN
                     TQVHQFVSVRNAHSLPGTHQIIPPIPLIQNHSTSSPTSCSTTSSSVVSTPSVSTASSS
                     ITGDVSSSSSLLANDSTAKLSTGTTSSPNMVVKKQPRKKKQCPLCGLFFSNLSTHKST
                     HLSPETRPFKCEVCSRGFARSNDLIRHKKLHWKDELNQESMDFVEKLKCLHELKGTYK
                     CPFNSNLINLDLGLKGSGVETSDLPFETSNCHSTGIFSRCDTFKNHLKALHFEYPPGT
                     KKKDRSKVAGHCKHCGQKFDNIEIWLKNHVGKECGYNFKD"
     gene            complement(<822894..>823874)
                     /gene="ARC35"
                     /locus_tag="KLMA_20394"
                     /db_xref="GeneID:34714865"
     mRNA            complement(<822894..>823874)
                     /gene="ARC35"
                     /locus_tag="KLMA_20394"
                     /product="actin-related protein 2/3 complex subunit 2"
                     /transcript_id="XM_022818010.1"
                     /db_xref="GeneID:34714865"
     CDS             complement(822894..823874)
                     /gene="ARC35"
                     /locus_tag="KLMA_20394"
                     /codon_start=1
                     /product="actin-related protein 2/3 complex subunit 2"
                     /protein_id="XP_022674720.1"
                     /db_xref="GeneID:34714865"
                     /translation="MLYLKPYNLLIQKTLTEALDAYRSGSPLTLDRIVSDFDYTTLHI
                     CNNAGDKENLLVSIRTKATQSSNESGGELFGFLRTKFEKFPGLSLSSDQKEAGYDFTL
                     VVNLATITAESIVQVSLFKILVMAYPFYLAFGQSAELSQLNEFEQVEKSKEAKAMVIK
                     YRDDENIYIKPSFDRITVIFETIFQDETDKVFGKVFLQEFVDARKRNRSIQSAPQVLF
                     SHEPPLEIQGVVRHEPAAAGKKKSSRRFITFVLFPRHYASEELMFSSVSQLALFRNYF
                     HYHIKCAKAYMHSRMRYRVDTFIKVLNRAKLDDENENDSRRTITGRKMVY"
     gene            complement(<824201..>824704)
                     /gene="MRPS12"
                     /locus_tag="KLMA_20395"
                     /db_xref="GeneID:34714866"
     mRNA            complement(<824201..>824704)
                     /gene="MRPS12"
                     /locus_tag="KLMA_20395"
                     /product="37S ribosomal protein S12"
                     /transcript_id="XM_022818011.1"
                     /db_xref="GeneID:34714866"
     CDS             complement(824201..824704)
                     /gene="MRPS12"
                     /locus_tag="KLMA_20395"
                     /codon_start=1
                     /product="37S ribosomal protein S12"
                     /protein_id="XP_022674721.1"
                     /db_xref="GeneID:34714866"
                     /translation="MFRRVFGLGGGLSRVSHSFSSTVSTVPRMMQQRSFAQTSPIQAT
                     LNQIKRGVKPPSRKKVTESPHLDNCPVRKGVVLRVMVLKPKKPNSAQRKACRVRLTNG
                     NVISAYIPGEGHNAQEHSIVFVRGGRCQDLPGVKYHVVRGAGDLAGVVNRITSRSKYG
                     VKKPTKE"
     gene            <825325..>826818
                     /gene="PTC6"
                     /locus_tag="KLMA_20396"
                     /db_xref="GeneID:34714867"
     mRNA            <825325..>826818
                     /gene="PTC6"
                     /locus_tag="KLMA_20396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818012.1"
                     /db_xref="GeneID:34714867"
     CDS             825325..826818
                     /gene="PTC6"
                     /locus_tag="KLMA_20396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674722.1"
                     /db_xref="GeneID:34714867"
                     /translation="MGKTQSFIHLKPATISSGMATGRKALAANLNGSKSTAAGGSATG
                     ASRVAMTSHMLRVHLNKFPSLIGHATSRINRLYNEDTYSINILKLPSASAELSLLNSK
                     RSIANKMKLWEELPLHRNLLNISIFDGHGGDRVSKMLASELHEHLVKMVPLKQEFESV
                     LKQYKTLVGGKYWTNIYKNRKQYYDKYIKHCNTKVEQVLLTDGVPPPSGSRMIFDKWG
                     NIIDKTSLLNEHERLRLYSTYLKYDLNEICGFASDLEQEAAMKEYYGGSTASSIFLTA
                     YDEQESSDESFFVAPQGLLKLAVTQIGDTKIILCDKNGIAHSLSKVHHPSSSRESRRL
                     GGHFQSDSFGDTRFLNNFANTRSFGDRIGKRDGLTCEPDIYSYLIGPTRMLPHAEKSK
                     LQFGGDECFICLVSDGVTTLMSDQEICDLVTSTVNNRGLKTASPQYCAQEVLQYIMAI
                     GSKDADNATCIVLRLPNWGNWPVIDRTGAIREEKLLSGVSGGDRSTA"
     gene            complement(<827091..>827366)
                     /gene="RSM19"
                     /locus_tag="KLMA_20397"
                     /db_xref="GeneID:34714868"
     mRNA            complement(<827091..>827366)
                     /gene="RSM19"
                     /locus_tag="KLMA_20397"
                     /product="37S ribosomal protein S19"
                     /transcript_id="XM_022818013.1"
                     /db_xref="GeneID:34714868"
     CDS             complement(827091..827366)
                     /gene="RSM19"
                     /locus_tag="KLMA_20397"
                     /codon_start=1
                     /product="37S ribosomal protein S19"
                     /protein_id="XP_022674723.1"
                     /db_xref="GeneID:34714868"
                     /translation="MIPTLRLLSRSVWKGPNIVPLPIKEALEKGTPIRTNARSATILP
                     QFVGLKFQVHNGKEYVAFEVTEDMVGSKLGEFVPTRKRFSYTQTKNK"
     gene            <827654..>829585
                     /gene="DBP6"
                     /locus_tag="KLMA_20398"
                     /db_xref="GeneID:34714869"
     mRNA            <827654..>829585
                     /gene="DBP6"
                     /locus_tag="KLMA_20398"
                     /product="ATP-dependent RNA helicase DBP6"
                     /transcript_id="XM_022818014.1"
                     /db_xref="GeneID:34714869"
     CDS             827654..829585
                     /gene="DBP6"
                     /locus_tag="KLMA_20398"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DBP6"
                     /protein_id="XP_022674724.1"
                     /db_xref="GeneID:34714869"
                     /translation="MFASRFDPTKVVVNTTATEDVSAKEVVLPLKRKREVVREDSKDG
                     DESESDSESESEITSESEDSEDNESSSESEADSEADSDNDSAQVSENPEIDTDKKHSS
                     ILNRFQQTLSLQSSLKTSEKVDSEAENEDEDVSMQDVHSLTPIPQPAKVRDNTLKLLD
                     SSMYKSTAWDSATKINYDNSMIKPFESYKDELDSRLLKNIINNFSENTFPIQTVLFDT
                     ILPILNSSFQINKTRFTRQVGDILVNASTGSGKTLAYSVPLVQILRNRTVNTVRAVIL
                     LPTKILIHQVYECISKLSQGTSLIVSMSKLENSLKEEHSKFLQNCPDILIITPGRLVD
                     HLQMKSFDLKNLKFLVLDEADRLLNQSFQNWNKVLFQHLSAVKQDKRPGNIIKMIFSA
                     TLTTNAEKLYNLHLHNPKIFLTDSVKLYTMPKTLQELNLRIPTAKSLFKPLVLLRVIN
                     ELKNLDTIKSNSKILVFVKSNESSIRLTSLLQVMLEAGLAGSDNISLASINSNNSKGT
                     NKKLIQEFASSTQSKSVLISTDVMARGIDINEITHVINYDVPISSQQYVHRCGRTARA
                     TTEGIAINLLVGKGEYKFWSDHIDCDLSRDVDGYQPAPYKNDEETLQLLNLDEQQEAN
                     YKQCIKSLQLKNNDQSDSK"
     gene            <829867..>833835
                     /gene="SRB8"
                     /locus_tag="KLMA_20399"
                     /db_xref="GeneID:34714870"
     mRNA            <829867..>833835
                     /gene="SRB8"
                     /locus_tag="KLMA_20399"
                     /product="mediator of RNA polymerase II transcription
                     subunit 12"
                     /transcript_id="XM_022818015.1"
                     /db_xref="GeneID:34714870"
     CDS             829867..833835
                     /gene="SRB8"
                     /locus_tag="KLMA_20399"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 12"
                     /protein_id="XP_022674725.1"
                     /db_xref="GeneID:34714870"
                     /translation="MPPSKYLLTPPDDLHPLTDSEQPIYPDFDPWVHTREEDKVLNEF
                     VAKGYYTASKVNFETISARSALQGSLPKISSLLGEELSKIIQIREEEINKIGTFDSDE
                     SARFTKWAGQDYHLPNRVTLTDQKRNLWLQELSSSSSSLQSLTKSVPHGFRKRYILEQ
                     CYIQFVPIYRFIWLIKSCYAIEWKGMVSKAKGEISSDELLRTLYKDWTDSMVVVLEKL
                     VFEVTKYYNDPSQLKLWKLRIAHYLKMLGSCYERELLNKNAMHQWIVDFVSKVESFEF
                     YPMALHILSIFWNGILGTTEEDAETESSFLVIKLSEILLRKYHIVSESKCMINDSKYI
                     INDIQRNSRLKESVLQRLKQFIAHIFHTQSLEAFIMPKQNWNIYKNYLYHILLQNVPE
                     RDAQKLKKKLKLISYRNESLRLGSLDMEPSRESSPYNSELALEDVFSGSILNLKNVNP
                     ELLSMLDSGLSGSEWGVFVDQKITRMEQVIEIILWSINPSKKHRYDSCHLVAKILVLK
                     MNSQESFQEYGIEDVIWSLIFHFSKLSKLELRKTVWLPKLHQLLNVFIGYGIIKVPTY
                     IRRLISSGVLYLPESENKNFHCKLLINLKISPVMKSQYNMVLKNVSEYAPHFYQQYNF
                     DELVSVFESLKVKLLNGDFEGLEKYPGSIRIMCSEWYLSQICFNQGEMQKIDKKKIID
                     TFNLFCNTLGELHHFFGWAEYIVYHQLIDDLEILEVFTDILLYLDKAFLLLINDPILF
                     MKTLLHSYTRDLKNKDKAAFELLSYKNFWKFFVKNCSNIIEMDSALQSLIAEVFEIER
                     TKKEKFMKTPSESLAVFLELTGNKHTKLEDQNFPSVIQQNIKKLLHNPEDESTSRKIL
                     LLCKASNSTEYNKFLSIFVKRGDFTADELVKLISLRLLSFEVIQKTSHDDILCELVSE
                     NNFTYGLNFENEKNAFIRRNFKYVCLQLFPNPQYRQTLVKLLVEYGPNSSFTEKSASV
                     VSHILMEENNMSIIREILLYGMNIQNDPTDNVMDLYQYLNFTNTWLFQILTEFNVNHS
                     ESESLSSFFSNIVKTIGCNSLLPKIFSNISDSSSVFTMLTVIEGQFLSKVLDTDKSSM
                     TFLQIMMDTEIVLSRQHINVMTLEMDSSVLELFKERISQFAKMSSDELKQYDENLNEL
                     LKMVITHEKFILRHCFESVKLRDTSMIENFYILFQKTSKDLKLKLLLYDLLTSLKSYI
                     LDGMKEQSSANIKMPAVLTNLPKFAISSFLGSENSDEDFVERDQPELIHLGLYDAENK
                     KASNKKYFVFNKKTSQFDSAFRIEPFQYLVNYQEPLEGCLNNTSLSLGLFDARLEKTN
                     PS"
     gene            complement(<833923..>835821)
                     /gene="ZRG17"
                     /locus_tag="KLMA_20400"
                     /db_xref="GeneID:34714871"
     mRNA            complement(<833923..>835821)
                     /gene="ZRG17"
                     /locus_tag="KLMA_20400"
                     /product="protein ZRG17"
                     /transcript_id="XM_022818016.1"
                     /db_xref="GeneID:34714871"
     CDS             complement(833923..835821)
                     /gene="ZRG17"
                     /locus_tag="KLMA_20400"
                     /codon_start=1
                     /product="protein ZRG17"
                     /protein_id="XP_022674726.1"
                     /db_xref="GeneID:34714871"
                     /translation="MERGRDFTDSAPHTPVRMNCIEEEESGNSPPVLNLSLGEDVKDD
                     GPVNSPFNNNSSSNSNARLSMFVADTPPTGRPNSFYNLQGENSSSSSLVATKGFTFGA
                     SSGAAAGSPAVTAAQAQGQGQAQGPGQSQEFHSHNKRHSFKYIPGPKLPPMSRTRSPV
                     RKTRSPSPDRSSKRNSLLVENPFNFSSSTLQPPLLSSSSTITTANNSSSSAGANPNGG
                     GSRSAMFRKGHRYKHSSVSMNFFQEPEVKEPLNIIKSLPVPDFKDLRNNLTWPKTHIQ
                     IFICVVELLVSLFVFQLGQVKEWKSLSTLSHFLSYDVLGGIFAILTELLSKFEIWKTG
                     TITLPFGLNRIDVLLSFAFAISICFAGLDLIFHVLEEIAVLFAENSTSSDYHKEINEK
                     IPHSHHTHVHEDQLLQWYSIIGLAAFISSLSYHFIFKSTQYKIKSSLITLSYLLYMSL
                     YPILSHYHRGWDMIATTLMSTFISSYGIKVAKWTSTILLMGFSTTSLNDSFIADANIP
                     DSKTNDVSEKMILKRSLSVSASTSHATPEVAAQNTLTPTQLNPMFVKSKIYDSILSLP
                     IFKNTCSLKNQDLLISKVNFQLFIVIMRIEMKNGSNEEELELRIAVDKLIREYLPNVE
                     TTIEIERM"
     gene            <836826..>837224
                     /locus_tag="KLMA_20401"
                     /db_xref="GeneID:34714872"
     mRNA            <836826..>837224
                     /locus_tag="KLMA_20401"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818017.1"
                     /db_xref="GeneID:34714872"
     CDS             836826..837224
                     /locus_tag="KLMA_20401"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674727.1"
                     /db_xref="GeneID:34714872"
                     /translation="MNTDSCDDAGSHSEPFQQQFQQQALDESMDYRVLQQYRTHLNNT
                     LTLKQHLLKQLTLLYSQLDECRNMQELMDVLMTQRQLLQSIFTLEKNTGASQAAPTVK
                     WSKYGLDVEQYLVEMGRADLVERSGYPFHD"
     gene            complement(<837769..>839361)
                     /locus_tag="KLMA_20402"
                     /db_xref="GeneID:34714873"
     mRNA            complement(<837769..>839361)
                     /locus_tag="KLMA_20402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818019.1"
                     /db_xref="GeneID:34714873"
     CDS             complement(837769..839361)
                     /locus_tag="KLMA_20402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674728.1"
                     /db_xref="GeneID:34714873"
                     /translation="MSADDHLLSDQRSNVELYDVEETAGRKGVTVTLHLLLSMIVACL
                     GSLQYGYHMGELNAPQDYITCKAGSDPRYRDSFLGRFGLSECIEMSESQFGLVTSVFS
                     IGGLIGSLVAGPLADKYGRKPISYWNCGFGMLGSALLFISNSYYEMLFGRLLVGVSCG
                     SLIVVTPLFINEMSPSSLKGSLGSMNQVSINCGILVTQSLAMAWANMLQWRWILLFGG
                     IISFVNFVLLFRISESPKWLVSRGNITDAEDVLSQLRGGSRQESRQEINGWIQGSQPQ
                     PVRSFRDLEAHTNAQQDLGVTQNLARPSSTRSSLRDYETVSLLEYFNDPKYRYPRRVI
                     STILMAQQFCGVNSIIFYGVKVIKKAFPNTAIIINFGVSIVNVLVTFFSSPLVDRWGR
                     KPLLICSSTLMALCSFMICIGIVNSIPLILAVFVVLYITAFACGLGPIPFLIISELSH
                     PETVGTAQSYGTTMNWIATFIVGYGFPALNSVIDGYVFLLFSGVAACFSLYVYRFVPE
                     TKGKLDYTDIWKSIDPRVAYSQ"
     gene            <840046..>841146
                     /gene="RPL28"
                     /locus_tag="KLMA_20403"
                     /db_xref="GeneID:34714874"
     mRNA            join(<840046..840094,840746..>841146)
                     /gene="RPL28"
                     /locus_tag="KLMA_20403"
                     /product="ribosomal 60S subunit protein L28"
                     /transcript_id="XM_022818020.1"
                     /db_xref="GeneID:34714874"
     CDS             join(840046..840094,840746..841146)
                     /gene="RPL28"
                     /locus_tag="KLMA_20403"
                     /codon_start=1
                     /product="ribosomal 60S subunit protein L28"
                     /protein_id="XP_022674729.1"
                     /db_xref="GeneID:34714874"
                     /translation="MPTRLTKTRKHRGHVSAGKGRVGKHRKHPGGRGMAGGLHHHRTN
                     LDKYHPGYFGKVGMRYFHKQQAHFWKPVLNLDKLWTLVPEEKREEYLKSASKSAAPVI
                     DTLAAGYGKVLGKGRIPSVPVIVKARFVSKLAEEKIKAAGGVVELIA"
     gene            <841634..>842410
                     /locus_tag="KLMA_20404"
                     /db_xref="GeneID:34714875"
     mRNA            <841634..>842410
                     /locus_tag="KLMA_20404"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818021.1"
                     /db_xref="GeneID:34714875"
     CDS             841634..842410
                     /locus_tag="KLMA_20404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674730.1"
                     /db_xref="GeneID:34714875"
                     /translation="MLIKIVTKNFSHFSKQTLLSIGSSHASLLKKQYSIQSRTIATYK
                     RSVMTERWNPKDHVPIEVKEILAETQPNYVLAFMHIVEQLKLQKRTGWLDHDIKPCES
                     ISDHMYRMGVTAMLIKDPKVDVKRCVRIALVHDIAESLVGDITPFDPVTKEEKHQREL
                     DTITYLCDEIIKPYNEEAATEILNDWLAYENVSSLEARYVKDIDKFEMLVQCFEYEKR
                     HKGTKDLSQFYSAVDSIKTEEVKSWTADLMRRRTQFFENL"
     gene            complement(<842547..>843890)
                     /gene="ALG7"
                     /locus_tag="KLMA_20405"
                     /db_xref="GeneID:34714876"
     mRNA            complement(<842547..>843890)
                     /gene="ALG7"
                     /locus_tag="KLMA_20405"
                     /product="UDP-N-acetylglucosamine--dolichyl-phosphate
                     N-acetylglucosaminephosphotransferase"
                     /transcript_id="XM_022818022.1"
                     /db_xref="GeneID:34714876"
     CDS             complement(842547..843890)
                     /gene="ALG7"
                     /locus_tag="KLMA_20405"
                     /codon_start=1
                     /product="UDP-N-acetylglucosamine--dolichyl-phosphate
                     N-acetylglucosaminephosphotransferase"
                     /protein_id="XP_022674731.1"
                     /db_xref="GeneID:34714876"
                     /translation="MLPYLLLVIALSIIVYFKDISPIGSAIGFSIIGYVTVDALIPRV
                     SDSFIKIGLFGKDLSKPGRPVIPESIGSVSATVYLFIMFFSIPFMFYKYLVTTSGGGY
                     RDVVAQQQTQEQLFPHGKLSEFLSALLCLESTILLGAADDLFDIRWRHKFFLPAIAAI
                     PLLIVYYVDFSVTYVLIPRFVQEFLNTTMTSVDLGALYYVYMASVAIFCPNSINILAG
                     VNGLEVGQSIVLAFIFLINDILYLTMGVNEHAQESHLFSLLLIIPFLGVSIALFKWNR
                     WPAKVFVGDTYCYFAGMVFAVVGILGHFSKTTLLFFLPQIFNFLYSAPQLFGLVPCPR
                     HRLPKFHEEDWLMYTSRAEFKEKKPKKIVSTMLKILYKFKLIDINIDPKTNEILDCSN
                     MTLINLIIVWFGPMREDKLCNTVLLLQFSIGLAAICLRHLLGSLLFGNDNLWKVV"
     gene            <844224..>845231
                     /gene="SEH1"
                     /locus_tag="KLMA_20406"
                     /db_xref="GeneID:34714877"
     mRNA            <844224..>845231
                     /gene="SEH1"
                     /locus_tag="KLMA_20406"
                     /product="nucleoporin SEH1"
                     /transcript_id="XM_022818023.1"
                     /db_xref="GeneID:34714877"
     CDS             844224..845231
                     /gene="SEH1"
                     /locus_tag="KLMA_20406"
                     /codon_start=1
                     /product="nucleoporin SEH1"
                     /protein_id="XP_022674732.1"
                     /db_xref="GeneID:34714877"
                     /translation="MKPFLTGHADLVHDVSYDFYGRHVATCSSDQQIKVFKLDKETNE
                     WELSDSWKAHDSSVVSLDWAAPEFGRVIASVSYDKTIKLWEEDPDVSELSGKRWQKLC
                     TLNDATGPLFCVKFAPSHLGLRLAALGNDGKLRMYDALESSDLRSWTLTSELSVLPDP
                     PASHLQSDFDLSWCPSRFSTERLAVSAMDRAVIYQRNKQGKLVPAGELPGHKGLIRSI
                     AWAPSIGRWFQLIATGCQDGKLRIYKITENPEADTISSVTEGAVNGNAPGTTESDSTV
                     PLSIELIGEHADHQGEVWSVSWNLTGTILSSSGDDGKVRLWKASYSNEFRCMSVVQAS
                     R"
     gene            <846400..>846885
                     /gene="HYR1"
                     /locus_tag="KLMA_20407"
                     /db_xref="GeneID:34714878"
     mRNA            <846400..>846885
                     /gene="HYR1"
                     /locus_tag="KLMA_20407"
                     /product="peroxiredoxin HYR1"
                     /transcript_id="XM_022818024.1"
                     /db_xref="GeneID:34714878"
     CDS             846400..846885
                     /gene="HYR1"
                     /locus_tag="KLMA_20407"
                     /codon_start=1
                     /product="peroxiredoxin HYR1"
                     /protein_id="XP_022674733.1"
                     /db_xref="GeneID:34714878"
                     /translation="MSKFYELCPKDSKGEPFPFSQLEGKVVLIVNVASKCGFTPQYKE
                     LEALYKKYEDKGFVVIGFPCNQFGHQEPGSDEEIVQFCQLNYGVSFPVLKKIDVNGSN
                     ADPVYNFLKNEKSGLLGFKGIKWNFEKFLVDKKGKVVERYSSLTKPSSLEATVEKLLN
                     A"
     gene            complement(<847172..>850453)
                     /gene="ISW1"
                     /locus_tag="KLMA_20408"
                     /db_xref="GeneID:34714879"
     mRNA            complement(<847172..>850453)
                     /gene="ISW1"
                     /locus_tag="KLMA_20408"
                     /product="ISWI chromatin-remodeling complex ATPase ISW1"
                     /transcript_id="XM_022818025.1"
                     /db_xref="GeneID:34714879"
     CDS             complement(847172..850453)
                     /gene="ISW1"
                     /locus_tag="KLMA_20408"
                     /codon_start=1
                     /product="ISWI chromatin-remodeling complex ATPase ISW1"
                     /protein_id="XP_022674734.1"
                     /db_xref="GeneID:34714879"
                     /translation="MDSPEYVEKLKPFQDGIPNSIEENKKRYLLPMHELAAGKKRFDT
                     EGTLKRFEHLLGVSNLFRHFIEKKAEKDPKFREVLDIIDNVDNKARGRGKKNANSRTR
                     KSEKEEDAELMKDEEEEDDFEDVDFQFRESPAYINGELRPYQIQGLNWLVSLHKNQLA
                     GILADEMGLGKTLQTISFLGYLRYIEKINGPFLVIAPKSTLNNWLREINRWTPEVNAF
                     ILQGDKEERAKLCQNKLLACDFDICVASYEIIIREKASFKKIDWQYVIIDEAHRIKNE
                     ESMLSQVLREFSSRNRLLITGTPLQNNLHELWALLNFLLPDIFADASTFDDWFSSETS
                     EEDKEKIVKQLHTVLSPFLLRRIKNDVESSLLPKKELNVYVGMSSMQKKWYKQILEKD
                     IDAVNGTNGQKESKTRLLNIVMQLRKCCNHPYLFDGAEPGPPYTTDEHLVYNSAKLKV
                     LDKLLKKFKEQGSRVLIFSQMSRVLDILEDYCYFREYEYCRIDGSTAHEDRITAIDEY
                     NAPDSKKFIFLLTTRAGGLGINLTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVH
                     VFRLVTDNSVEEKILERATQKLKLDQLVIQQGRVNTKKKENKNDSKDALLSMIQHGAV
                     DVFKSNDSSAVTSKTGTPHPEDKDEDIDLDALLAKSEDKTKSLNNKYATLGLDELQRF
                     NQDSAYEWDGKNFKKKVTKDIINPLFIPPTKRERTANANYSVDNYYKDVLNPGRNNQY
                     TVPPKMPKLQPVNSHQLLRPQLKAIYEKERMWIAKKNNYVPNLDDVATTYGEVKDEAE
                     KKDKLELLKLSIANAEPLTEEEEKNKVEWEKEGFHNWNKLDFRKFITASGKHGRNSIQ
                     AIASEFGGSKTEEEVRAYAKAFWANLERVEDYERYVKNIETEEERVRRVKLQQESLRR
                     KISLCSNPLFELKLKFPPSTNNKRTFSEEEDRFILLMLFKYGLDRENVYEMIRDEIKH
                     HPLFELDFFFQSRTPIELQRRAITLLQCLEKEFNTGIEKTEEVKERMKKEDEEGEKLR
                     EKLKEENKKRREEEEEEEQEKQKAEGDAQTNGDSNGTSGVPEASEASEAAGTDEPNNK
                     KVKTE"
     gene            <852138..>854087
                     /gene="LSG1"
                     /locus_tag="KLMA_20409"
                     /db_xref="GeneID:34714880"
     mRNA            <852138..>854087
                     /gene="LSG1"
                     /locus_tag="KLMA_20409"
                     /product="large subunit GTPase 1"
                     /transcript_id="XM_022818026.1"
                     /db_xref="GeneID:34714880"
     CDS             852138..854087
                     /gene="LSG1"
                     /locus_tag="KLMA_20409"
                     /codon_start=1
                     /product="large subunit GTPase 1"
                     /protein_id="XP_022674735.1"
                     /db_xref="GeneID:34714880"
                     /translation="MPPKETPKKWKPPKGPKPIQRKNKNTIGLGRTIQQARRKENEVQ
                     YLPDGEERFTTEKHEANWVKLRSITQESALDEFLSTAELADKDFAADRHSNVKIIRMD
                     NGGDAARSQGFTLSNEQKSKINEKQRLHARELIVPRRPKWNESMTKFELERLEKEAFL
                     EWRRKLAFLQEDNEDLLLTPFERNIEVWRQLWRVVERCDLVVQIVDARDPLLFRSTDL
                     EKYVKEVDDRKQNLLLINKADLLTRKQRIIWAKYLLSRNISFTFFSAAKANEILEKQE
                     ELGEDYVEEKDDDDEYNGSEEEITELDGEKVDKEILEKIKILKIEQLESLFLEKAPSN
                     PLLPPLPGQESLLQIGLVGYPNVGKSSTINALVGAKKVSVSSTPGKTKHFQTIKLSNR
                     VVLCDCPGLVFPNFAYNKGELVCNGVLPIDQLRDYIGPSTLVAERIPKYFLEAVYGIH
                     IQTKSVEEGGNGEVPTAQELLVAYARARGYMTQGFGAADESRASRYILKDYVNGKLLY
                     INPPPHMDDETPYTREECKEFNKDLYTFDKLPLNRQEQLAEAAKNKGIQELDLARDLS
                     QLTFSAHIGGDGDKLQAKSVNHGGKQAALYNAADELDKNFFHLNSVQGKLTNPFHKQS
                     LNSGNGKKHNKKNKKGKKKAAMYAD"
     gene            <854945..>855718
                     /gene="USE1"
                     /locus_tag="KLMA_20410"
                     /db_xref="GeneID:34714881"
     mRNA            <854945..>855718
                     /gene="USE1"
                     /locus_tag="KLMA_20410"
                     /product="protein transport protein USE1"
                     /transcript_id="XM_022818027.1"
                     /db_xref="GeneID:34714881"
     CDS             854945..855718
                     /gene="USE1"
                     /locus_tag="KLMA_20410"
                     /codon_start=1
                     /product="protein transport protein USE1"
                     /protein_id="XP_022674736.1"
                     /db_xref="GeneID:34714881"
                     /translation="MPVELDILGDSLQSSFQKDNTLLRDEDDPFYHYLISTKAATNLD
                     IIRKSAIKDSIHDSTANTINEYQTRLSRLEDLANSLNFSAESKLKQKYDSYVEDQKTR
                     RYSVDFDMPAEGSMDSEDIASGMESREEDDSLRNLRQRLMGKRRDSFEGENESFDKQM
                     QIQDDLQKELVQDMSQLVTGLKQGAEAFQNALEHDSTVLKAAEIGLHVTSRSLSTLGS
                     NLKKYHKEKIGFFMKLGLLSFVILGLLITYLVIKVFPDL"
     gene            complement(<855972..>857393)
                     /gene="ENP1"
                     /locus_tag="KLMA_20411"
                     /db_xref="GeneID:34714882"
     mRNA            complement(<855972..>857393)
                     /gene="ENP1"
                     /locus_tag="KLMA_20411"
                     /product="essential nuclear protein 1"
                     /transcript_id="XM_022818028.1"
                     /db_xref="GeneID:34714882"
     CDS             complement(855972..857393)
                     /gene="ENP1"
                     /locus_tag="KLMA_20411"
                     /codon_start=1
                     /product="essential nuclear protein 1"
                     /protein_id="XP_022674737.1"
                     /db_xref="GeneID:34714882"
                     /translation="MGKVMSNNGRKQRHDPLLKDLDSQHGNLKKQGKKKVENKSQDDN
                     TKDEEFVDAQQSRKILQLAKEQQEEIEQEDEQALKTSQQVLNRFRVSHYDEDDEEDEA
                     QDGNISDFDPEDGDEAYEGFEEEEVVEIDEEDAEMFDQYFKTSADFNSSNGSYNLADK
                     IMASIREKEMELEANGEEVVSNEPAAPADRSEGVALPPKVIKAYLAVGQIMKTWRHGK
                     LPKLFKVLPSLNNWQDVLYVTNPEEWSPNAVYEGTKLFVSNLSAKEAQKFVISVLLTR
                     FREEIEFNEDHNLNYHVYRALKKSLYKPAAFFKGFLFPLVESGCNVREATIAASVLSK
                     VSVPALHSAAALSYLLRLPFSPATTVFIKILLEKKYALPYQTVDECVFYFMRFREVSD
                     GSNGQDAVRVLPVVWHKAFLAFAQRYKNDITQDQRDFLLETVRQRGHKDIGPEIRREL
                     LAGESREFVSDVGNKADLMLDIL"
     gene            <857996..>859435
                     /gene="SRM1"
                     /locus_tag="KLMA_20412"
                     /db_xref="GeneID:34714883"
     mRNA            <857996..>859435
                     /gene="SRM1"
                     /locus_tag="KLMA_20412"
                     /product="regulator of chromosome condensation"
                     /transcript_id="XM_022818031.1"
                     /db_xref="GeneID:34714883"
     CDS             857996..859435
                     /gene="SRM1"
                     /locus_tag="KLMA_20412"
                     /codon_start=1
                     /product="regulator of chromosome condensation"
                     /protein_id="XP_022674738.1"
                     /db_xref="GeneID:34714883"
                     /translation="MSKRSASVGNTPVKRKHLHSTLNHKFVSINSQDDYKHFYKSVVP
                     LDIFVWGTGSMCELGLGPLAKNKEVKRPRLNPLLPKDEAKIVSFAAGGMHTLALDSDN
                     NIWSWGTNDSAALGRDTSGAAENLKDMDADASDDEDGDLNELESTPTKIPRESLPLDE
                     LKCVQIAATDNMSAALFENGDVYAWGTFRCNEGILGFYKDQIKIQKEPWKVPNFSKKA
                     KIVQLAAGKDHILFLDETGIVYAWGNGQQQQLGRKILERSRLRTLDPRPFGLDNIKYI
                     ASGENHSFALATDGKLYAWGLNQFGQCGISTEIEDGSLVSVPTEVILPEDVQVDSVAA
                     GEHHTLILSKSGDLYSCGRLDMFEVGISKDKLPEYTYKDAHGKARSIPLPTKLEDVPK
                     FKAIAAGSHHSLAIAKNGIVYSWGFGETYAVGLGPAGEDIETPTRIKNTATQDHSIVF
                     VGCGGQFSISGGIKLSDEEAEKRADEMDD"
     gene            complement(<859567..>861225)
                     /gene="HIS7"
                     /locus_tag="KLMA_20413"
                     /db_xref="GeneID:34714884"
     mRNA            complement(<859567..>861225)
                     /gene="HIS7"
                     /locus_tag="KLMA_20413"
                     /product="imidazole glycerol phosphate synthase hisHF"
                     /transcript_id="XM_022818032.1"
                     /db_xref="GeneID:34714884"
     CDS             complement(859567..861225)
                     /gene="HIS7"
                     /locus_tag="KLMA_20413"
                     /codon_start=1
                     /product="imidazole glycerol phosphate synthase hisHF"
                     /protein_id="XP_022674739.1"
                     /db_xref="GeneID:34714884"
                     /translation="MSLVHIIDVESGNLQSLQNAINYLGYETKLIKSASDPELLTAER
                     LILPGVGNFGHFLDNLASRGFEQPIKDYIASGRPLMGICVGLQSLFDGSVESPKSKGL
                     GLIPGTLSKFSTTDGKSVPEIGWNTIVPEEDLFFGLDPYKRYYFVHSYAMIVNDNQLD
                     VLRGNGWKTALTKYGNEKFVAAVQKDNVFATQFHPEKSGEAGLKVIDNFLKGIHPVTQ
                     YTDEQKAILANDYTNFGLTRRIIACLDVRTNDQGDLVVTKGDQYDVREKSEEGNVRNL
                     GKPVELAQRYYKQGADEVTFLNITSFRNCPLKDTPMLDVLRLAAKTVFVPLTVGGGIK
                     DVVDTDGTKIPALEVAGMYFRSGADKVSIGTDAVFAAEKYYANGEKGDGTSPIETISK
                     AYGAQAVVISVDPKRVYVKDPSETKNKCFETVFPSEDGKKWCWYQCTIRGGRETRDLG
                     AWELAHACEALGAGEILLNCIDKDGSNSGYDLELIDHVKSAVSVPVIASSGAGIPAHF
                     EEAFEKTKADACLGAGMFHREEYTVKQVKEYLASKGLKVRLDEF"
     gene            complement(<861613..>862707)
                     /gene="ARO4"
                     /locus_tag="KLMA_20414"
                     /db_xref="GeneID:34714885"
     mRNA            complement(<861613..>862707)
                     /gene="ARO4"
                     /locus_tag="KLMA_20414"
                     /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
                     /transcript_id="XM_022818033.1"
                     /db_xref="GeneID:34714885"
     CDS             complement(861613..862707)
                     /gene="ARO4"
                     /locus_tag="KLMA_20414"
                     /codon_start=1
                     /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
                     /protein_id="XP_022674740.1"
                     /db_xref="GeneID:34714885"
                     /translation="MSATPQPMFHEQEDVRILGYDPLVSPALLQAQVPASPECLATAQ
                     RGRKESVDIITGKDDRVLVIVGPCSIHDLDQAQEYAKMLKALSDELKDDLCIIMRAYL
                     EKPRTTVGWKGLINDPDVDNTFNINKGLQVSRQLFVNLTSLGLPIGSEMLDTISPQFL
                     ADLLSFGAIGARTTESQLHRELASGLSFPVGFKNGTDGTLGVAVDAVQAASHPHHFMG
                     VTKHGVAAITTTKGNEHCFVILRGGKKGTNYDPASVAEAKAQLPEKGVLMIDYSHGNS
                     NKDFRNQPKVNDVVCEQIANGEDKIIGVMIESNINEGKQCIPPEGKAGLKYGVSITDG
                     CISFETTTEVLRKLAAAVRARRELKKKAAK"
     gene            complement(<863246..>864490)
                     /gene="BBP1"
                     /locus_tag="KLMA_20415"
                     /db_xref="GeneID:34714886"
     mRNA            complement(<863246..>864490)
                     /gene="BBP1"
                     /locus_tag="KLMA_20415"
                     /product="protein BBP1"
                     /transcript_id="XM_022818034.1"
                     /db_xref="GeneID:34714886"
     CDS             complement(863246..864490)
                     /gene="BBP1"
                     /locus_tag="KLMA_20415"
                     /codon_start=1
                     /product="protein BBP1"
                     /protein_id="XP_022674741.1"
                     /db_xref="GeneID:34714886"
                     /translation="MWGDDSSSENTGGLFKWTVDALFRRDASPSVKYKDNDRGTYVDS
                     AKVRSRPRERSSSFSDLDIYSKFELLPDEEDPELLRPVSTNGLFDEKQNTNTFHTRRN
                     RRDRPVGDTPSIRRAPNPDDPVISALFGEAPTRGTAAPAAPAATDYLPGRTDRDEFLP
                     GKFPSPTRPMSNRQTGREDEFAPQAQRVHDYTPEYVSILDKLSLNSKALRDLKLDVQQ
                     KQKYGMERETELKDKYLQIRQELIQELKQSKMIYDNYCKLYFKYKELKKRPLMPNQPL
                     VSNTSMLEKIRSLESKVVDLSIENDRLEKEAEQQRLSFELKQQELQNKFEVERLVYER
                     RIQELQDKVHEMSTGIAVGTDIGTGTGASNNNNDNSFYRNHLHTSSTTATTATPLSDS
                     TASPYKEYNNTIDTQFLRNLVK"
     gene            <864637..>865515
                     /locus_tag="KLMA_20416"
                     /db_xref="GeneID:34714887"
     mRNA            <864637..>865515
                     /locus_tag="KLMA_20416"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818035.1"
                     /db_xref="GeneID:34714887"
     CDS             864637..865515
                     /locus_tag="KLMA_20416"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674742.1"
                     /db_xref="GeneID:34714887"
                     /translation="MDALKYQIDPMGHRETIPTEPAESAEPTGPCHNNCYRTHNMEVY
                     NVEADTGSLYVYRDGKLQVKYEVEAMRSLLWDDCKDHLVILANHGRRIDVYTFDKNTL
                     AVGQDTVLAVGYEIENFYAVWSRSTLLIQDAARRMLNVYNVDKRQDMGYITLDCENSD
                     VLIIDDRIVQLVATYYDKQLKTLSRYCNSYEFEPSGRLVLRTSVPLPPGYHRYTPVAV
                     SEGTSQVYCVVMNTLGQDKHAVYFLLEGSVVPYKSITGKGVVTSAWIDTQSETLYIEK
                     NLSPRRLHISLFQDAL"
     gene            <866848..>868443
                     /gene="CLN2"
                     /locus_tag="KLMA_20417"
                     /db_xref="GeneID:34714888"
     mRNA            <866848..>868443
                     /gene="CLN2"
                     /locus_tag="KLMA_20417"
                     /product="G1/S-specific cyclin CLN2"
                     /transcript_id="XM_022818036.1"
                     /db_xref="GeneID:34714888"
     CDS             866848..868443
                     /gene="CLN2"
                     /locus_tag="KLMA_20417"
                     /codon_start=1
                     /product="G1/S-specific cyclin CLN2"
                     /protein_id="XP_022674743.1"
                     /db_xref="GeneID:34714888"
                     /translation="MDHATNHVDGSSSLGLIVTAKQTYYPIELSNAELLAHYETVQDY
                     HQEISMNCITQSCRLKPDAKLIDQQPELDPRKTRHYVVNFFFELALKTRVTNGIFYQS
                     VRLYDRYCSKRIVLREQVKLVVATCLWLAAKTWGGCNHIINNVSVPTGGRFYGPNPRA
                     RIPRLSELIHLCNDSQTFDESMFTQMERHILNTLGWEIYEPMINDYILNADENCSIQY
                     ELYKRQLEHNRKWLNNKDKDSSANKESDSTDEEQELGCEADEEDDDLTQKIQLINVKK
                     FLIDLTSWQYVLLKFEQFEITHGMFQLINKFTNQELGPLLQTPIPAAATSDKIVDIYI
                     DAILDCPEQLWEHYKEFDGVAQFIGAIKDYQRQLEYLSQQKQMQYSTPTRIYQVPSAQ
                     QNFPSPPYSQQNFSPSSSRKVSTQSDNSLFSTYATSNSSPLTPQLHSFTHNKLTPSSA
                     NSNSQLSLHSTNTSINRTYEDKENIDPASMATCHKVNSYIVPPRAKFVGQSSSVFSSG
                     GSISNGNSNRSSLISLSLGNTVV"
     gene            <869118..>869843
                     /gene="ROT1"
                     /locus_tag="KLMA_20418"
                     /db_xref="GeneID:34714889"
     mRNA            <869118..>869843
                     /gene="ROT1"
                     /locus_tag="KLMA_20418"
                     /product="protein ROT1"
                     /transcript_id="XM_022818037.1"
                     /db_xref="GeneID:34714889"
     CDS             869118..869843
                     /gene="ROT1"
                     /locus_tag="KLMA_20418"
                     /codon_start=1
                     /product="protein ROT1"
                     /protein_id="XP_022674744.1"
                     /db_xref="GeneID:34714889"
                     /translation="MRFLILLSIFAVAIRGQDDKLEGTWSSKSNQVFTGPGFYDPVEE
                     LLIEPALPGISYSFTADGHFEEALYQVSGNPQDPGCPVAVLIYQHGTYEVLQNGSLVL
                     TPFEVDGRQLLSQPCDDKGISTYTRYSQKEVFKSYLVQIDEYYGKQSLQLYGSDGSPL
                     QPLYLAYKPPMMLPTITLNPTDGSEAAPTGKSKRDTIQQVKRSIENRHKTNAVKKTAP
                     NVEKYWWGSVALIGVGTIAFFLS"
     gene            <870273..>872087
                     /gene="VPS27"
                     /locus_tag="KLMA_20419"
                     /db_xref="GeneID:34714890"
     mRNA            <870273..>872087
                     /gene="VPS27"
                     /locus_tag="KLMA_20419"
                     /product="vacuolar protein sorting-associated protein 27"
                     /transcript_id="XM_022818038.1"
                     /db_xref="GeneID:34714890"
     CDS             870273..872087
                     /gene="VPS27"
                     /locus_tag="KLMA_20419"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 27"
                     /protein_id="XP_022674745.1"
                     /db_xref="GeneID:34714890"
                     /translation="MALPTISVQEFDALIKRCTNEMIPNGEVDLPVALEISDVIRSRR
                     IPPKEAMRCLKKRAMETRNNQNLQFSVWRLVEVCMKNGGVPFLKEICSREFMDCLEQV
                     ILSESTDYELEQYCSRLVAELYLAFKNDSQLNYVVKVYQKLMARGIDMDNLKPNENLN
                     AMFDAKTPADWIDSDACMICSNKFTLLNRKHHCRSCGGVFCQIHSSKSIPLPDLGIFE
                     AVRVCDNCFDDYDLKRSSSKGKKRKNKKKAPNQSDNEDEDLRRAIELSLKENGPNVDT
                     FIPEIPTTEPVRNAEEDDDPELKAAIEASLREHQEQERRRAFQQSPQSVNVAPTAPNI
                     TTQPNYDLSSADEEDIHLFASLVERMKNQPPTAILEDTQLQQLYQKVLGVRPKLNYTL
                     NDTVSKYNSVYEMNGKISDIMNMYDSMLERQLRNISISQQYSVPEPIQSPYSYYQNVP
                     QTNKPSYQRETEPAIAPQPQPQPPSTLQHPDSVSQEPQILPNGVVNVPNQPSLLSNPQ
                     LSPIGNPSVASQLDGLILDQPSEPPYPDDSINTEQKEQNNSAERPYPDDDRVKQDNIT
                     AFDFPTVPQRKLSLHESEPEVTEEPEQEIEQEQLLIEL"
     gene            complement(<872265..>873415)
                     /gene="RAD14"
                     /locus_tag="KLMA_20422"
                     /db_xref="GeneID:34714891"
     mRNA            complement(join(<872265..873221,873383..>873415))
                     /gene="RAD14"
                     /locus_tag="KLMA_20422"
                     /product="DNA excision repair protein"
                     /transcript_id="XM_022818039.1"
                     /db_xref="GeneID:34714891"
     CDS             complement(join(872265..873221,873383..873415))
                     /gene="RAD14"
                     /locus_tag="KLMA_20422"
                     /codon_start=1
                     /product="DNA excision repair protein"
                     /protein_id="XP_022674746.1"
                     /db_xref="GeneID:34714891"
                     /translation="MNLTEQQKKQINDGLSQANIKDSNTRKSFEPTPEQKQLIKENRE
                     KALERLKQRQNNLRDASKSESPAFEKDKRPLDKIRPSVRRQDYIEYDFSTMKNSYGGF
                     INTEDTAEGENNKRAKTLEDWQEEQKNRRMLFEEEMPAFNISSAPRCTECQVNIEMDP
                     LMKKVFKLQVCKTCVKNHPEKYSLLTKTECKEDYFLTDPELSDTTLLDRLDKPNPHSG
                     TFSRMQLFVRCQVEAYAFEKWGGEEGLDKEWQRREEGRTARREKKYQQKLKEMRLKTR
                     AQEYTTRLKELKHGKKHVHEFSDAIDGGLNEDNVKVQKRRCMTCGLEIEEIGL"
     gene            <873705..>875153
                     /gene="MCH1"
                     /locus_tag="KLMA_20423"
                     /db_xref="GeneID:34714892"
     mRNA            <873705..>875153
                     /gene="MCH1"
                     /locus_tag="KLMA_20423"
                     /product="probable transporter MCH1"
                     /transcript_id="XM_022818040.1"
                     /db_xref="GeneID:34714892"
     CDS             873705..875153
                     /gene="MCH1"
                     /locus_tag="KLMA_20423"
                     /codon_start=1
                     /product="probable transporter MCH1"
                     /protein_id="XP_022674747.1"
                     /db_xref="GeneID:34714892"
                     /translation="MTLSSLEHRLTYHIRTWLTNSFKWSTIHSSTFIISLFACISAGL
                     LNMVSVYTIPWQLRLGYSSLDVNLISAAANLGAYLTPPILGVLSDSHGPVILSWLSFI
                     GYVPSYLYLSHVFRSGHDPNFIVSVVAFAVVGISTSSLYFGALVTCAKLYPDKKLLSI
                     SFPTTCFGISSLIGLQVLKLPFFHSKKEGYLDLGVVFGTFAVFYSFVFILTWISTSTI
                     SIMKLRLALAEEQEQEQEQEQCLGSEESPLLGPQRKKDQFYIKIRNFATDYLAYSFLA
                     VMLLGLGVLEMFNTNMVNLSSLILGPESSYNVLTQFSIFSTCSRLVSGCLVDLFTKWQ
                     WPRITLIFFILSVAILAQVAIIHAMNVVDVTYLSIASAICGLSYGGLFTVFPSLTLNL
                     WGDQVFGTAYGTFMLGPAMGSAFFGIAYARVHDSNCKSTSTSSHQHPNHNPLAESPNC
                     IVPVFKISTAALSFAMGIILIATIMSKRLRNA"
     gene            <875546..>876988
                     /gene="SEC61"
                     /locus_tag="KLMA_20424"
                     /db_xref="GeneID:34714893"
     mRNA            <875546..>876988
                     /gene="SEC61"
                     /locus_tag="KLMA_20424"
                     /product="protein transport protein SEC61 subunit alpha"
                     /transcript_id="XM_022818042.1"
                     /db_xref="GeneID:34714893"
     CDS             875546..876988
                     /gene="SEC61"
                     /locus_tag="KLMA_20424"
                     /codon_start=1
                     /product="protein transport protein SEC61 subunit alpha"
                     /protein_id="XP_022674748.1"
                     /db_xref="GeneID:34714893"
                     /translation="MSGRVLDLFKPFEAYLPEVIAPERPVPYKQKLIWTGVSLLVFLV
                     MGQIPLYGIVSSETSDPLYWLRAMLASNRGTLMELGVSPIITSSMIFQFLQGTQLLQV
                     SMENKQDRELFQIAQKVFAILLTFGQAVVVVLTGNYGKPSDLGLAISLLLIFQLIFAS
                     FTVLLLDELLSKGYGLGSGISLFTATNIAEQITWKAFAPTTVNVGRGEEFEGAVIALF
                     HLLAIRKDKKRALVEAFYRENLPNMFQVFATIGVFLSVLYLQGFRYELPVKSTRTRGQ
                     YGNYPIKLFYTSNTPIMLQSALTSNVFLISQILYQRFSTNPLVKLLGVWGTRSDAPMG
                     QQVAISGLSYYIQPPFSLTDALLDPFKTVVYVTFVLGACALFSKTWIEISGTSPRDVA
                     KQFKDQGLTINGKRETNVYKELKKIIPTAAAFGGAVIGALSVGSDLLGTLGSGTSILM
                     ATTTIYGYYEIAAKEGGFTKNLVAGFTEMM"
     gene            complement(877277..877366)
                     /locus_tag="KLMA_R213"
                     /db_xref="GeneID:34718659"
     tRNA            complement(join(877277..877313,877331..877366))
                     /locus_tag="KLMA_R213"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34718659"
     gene            complement(<877598..>878356)
                     /gene="RSM26"
                     /locus_tag="KLMA_20425"
                     /db_xref="GeneID:34714894"
     mRNA            complement(<877598..>878356)
                     /gene="RSM26"
                     /locus_tag="KLMA_20425"
                     /product="37S ribosomal protein S26"
                     /transcript_id="XM_022818043.1"
                     /db_xref="GeneID:34714894"
     CDS             complement(877598..878356)
                     /gene="RSM26"
                     /locus_tag="KLMA_20425"
                     /codon_start=1
                     /product="37S ribosomal protein S26"
                     /protein_id="XP_022674749.1"
                     /db_xref="GeneID:34714894"
                     /translation="MFMNKVFRRGIHTVPRLPGVSRLLESGIPHVMSANTFKATWTDQ
                     QQLLCDKLSLASAGTTLESYLPFHLVLHTAKKPYLTNIFNLASALHNNHLFVENILPM
                     EQVTQPSREFLQRVETQYGMPWENFKDEMVRRSEEDVLGQGWLFLVENDAKELHILTV
                     QNNGTPYYFARNQSFDLNSALSLEDMEQFVTMRDLLATDPNVKDWTMPVIAISLWDHA
                     YLKDYGVKGRSQFVRKCLDNLNWSAVNNRLFSKM"
     gene            <878780..>880048
                     /gene="RAD55"
                     /locus_tag="KLMA_20426"
                     /db_xref="GeneID:34714895"
     mRNA            <878780..>880048
                     /gene="RAD55"
                     /locus_tag="KLMA_20426"
                     /product="p-loop NTPase super family"
                     /transcript_id="XM_022818044.1"
                     /db_xref="GeneID:34714895"
     CDS             878780..880048
                     /gene="RAD55"
                     /locus_tag="KLMA_20426"
                     /codon_start=1
                     /product="p-loop NTPase super family"
                     /protein_id="XP_022674750.1"
                     /db_xref="GeneID:34714895"
                     /translation="MSLGVPLSQIIQGRSERVRSGIKGLDAALNDGFQPQSIYEVYGV
                     PGIGKTKLGVQLMNENCEKTKCLWIDTVEQAPLSLIEDSETCYFTRVKKFTQLWYMFQ
                     HLEKSYGLIVIDGFSQLVVEYLRVYEKNSGKRVSLHDFKVKSLIHIFAIMTKYATANN
                     TVIVLLNDAMNTGYQDYSDEAVTSYQGDASSGSFLVKSVKKRHIQVLKSGLIANAAVG
                     GKDGRWEVFLRSRIGLFWVWDPASESKVPDVLRQFVVWKRSSSQPQIVYVKTNERGKF
                     CDGPVAPPVKMASTSTPSITPSVTTPSVTTSPPISSTEIGKESTTPRTESENESELDS
                     ASESSIRKRRRILRAVVRTDPGPTSNSELIKSHSQPPTPTFSQNIIQFTPRIVYSDAP
                     VEFTTPEVSTSSIGSLQTSDDLDIVYNSEG"
     gene            <881113..>881802
                     /locus_tag="KLMA_20427"
                     /db_xref="GeneID:34714896"
     mRNA            <881113..>881802
                     /locus_tag="KLMA_20427"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818045.1"
                     /db_xref="GeneID:34714896"
     CDS             881113..881802
                     /locus_tag="KLMA_20427"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674751.1"
                     /db_xref="GeneID:34714896"
                     /translation="MKLFVVPVLFASSAFAAFSNVTSSSIPVVTSVAPSSSSEAPASN
                     GTADSTVWTTEVDTVTALTTYCPLPTTITTNGKTYTVSEATTLTITDCPCEVTKSSPV
                     GPVSPESTVWTTEVETVTELTTYCPLPTTITTNGKTYTVSEATTLTITDCPCEVTKTS
                     PVPPATESSKSTPPAETPKTSTGAPKESVATVVKPSSSASSATIETFNNAGNRVTAGL
                     TGMLSFLAFLL"
     gene            complement(<882644..>886060)
                     /gene="MUC1"
                     /locus_tag="KLMA_20428"
                     /db_xref="GeneID:34714897"
     mRNA            complement(<882644..>886060)
                     /gene="MUC1"
                     /locus_tag="KLMA_20428"
                     /product="flocculation protein FLO11"
                     /transcript_id="XM_022818046.1"
                     /db_xref="GeneID:34714897"
     CDS             complement(882644..886060)
                     /gene="MUC1"
                     /locus_tag="KLMA_20428"
                     /codon_start=1
                     /product="flocculation protein FLO11"
                     /protein_id="XP_022674752.1"
                     /db_xref="GeneID:34714897"
                     /translation="MKFQLFCLFAYLWQAVFVAAAGNSPNFVQGDQGSVSVKATNGCP
                     CLDFSFHAQNTGTIQYNVDVTDVKWVQDNIYTVTIHTYGSKQIPLKSLWSLKIIGVNS
                     PDGGTFQLYGFNEKTFKIDNPTDWSATFRVYGQPDGSDPSIVWMPSFQIQFEYCQGNT
                     DCSNWSYGATSFDLMTGCNNYDNMKRSQTDAPSYFWPAHGSGDVKYPKNYPCEKPKTT
                     SSTTTSKTTSKTTSKTSSKTSSSTTTSKTTSKTTSKTTSKTTSKTSSSTTTTTSKSSA
                     SSKTTLQPKQQTATLPKSSTSAPSSSAIVSNTTTAQPTTKSSSAIVSSTASSNTETSA
                     TVSSAVVSNTTTVQPTTKSSSPIVSSTASSSTETSATVSSAIVSNTTTAQSSSQLSSS
                     TSSSVGLSSTIVNSSSSSSTSSGPSNWYANSSTTLNPKQGTATVPGQNPTPFGNTGFG
                     PVPTGPAPTGPAPSGPAPTGPAPSGPAPTGPAPSGPAPSGPAPSGPAPSGPAPSGPAK
                     SGPAPSGKRTSAVVSSSVVISSSASTSTSVSSPAFYGNITSHTVPPNPITTARTPGKP
                     PANFPITHGTPIANTSVSAFSSTTTLAVPPESQSETAGITTDSEGETTSTVIPTPDGQ
                     GTPGKPRGGNQPPSNPTGDVVTSYQTGPNGETTGTAEVPQPTTAFETTLTSGSNTVVT
                     TMTPPSNPKGGNQPPSNPDGGVVTSYQTGPNGETTGTAEVPQPTTAFETTLTSGSNTV
                     VTTMTPPSNPKGDNQPPSNPNGNQPPSNPNGNQPPANPKGNQPPANPKGNNQPPANPD
                     GGVVTSYQTGPNGETTGTTEVPPPTAAYETTLTSGSDTVVTTMTPPSNPKGNNQPPSN
                     PDGGVVTSYQTGPNGETTGTTEVPEPTTGYATTVTSGSSTFVTTMTPEGPSGPSDPSD
                     PSNPSGGVVTSYQTGPNGETTGTTEVPEPTTGYATTVTSGSSTFVTTMTPEGPSGPSD
                     PSNPSGDVITSYQTGPNGETTGTTEVPEPTTGYATTVTSGSSTFVTTMTPEGPSGPSG
                     PSGTANPSDGIVTSYLTGSDGETTGTTEVPEPTTAYATTVTSGSSTFVTTMTPPSNPN
                     GGSPTTIQQYTPSGYSGEPTASVFEGAAPSVGSGRFISTVLPLVLAAFML"
     gene            complement(<888583..>890946)
                     /gene="UBP3"
                     /locus_tag="KLMA_20429"
                     /db_xref="GeneID:34714898"
     mRNA            complement(<888583..>890946)
                     /gene="UBP3"
                     /locus_tag="KLMA_20429"
                     /product="ubiquitin carboxyl-terminal hydrolase 3"
                     /transcript_id="XM_022818047.1"
                     /db_xref="GeneID:34714898"
     CDS             complement(888583..890946)
                     /gene="UBP3"
                     /locus_tag="KLMA_20429"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 3"
                     /protein_id="XP_022674753.1"
                     /db_xref="GeneID:34714898"
                     /translation="MDGRDYSGSMYPPQEPGQDMGNMAYMAPPSQFGFANMYMDMGGY
                     SAPAGHYPPYPMAIYAPTMDAMAHQQPHIQQPKKKMTFNKNANFKPNAYNNYMPMNTN
                     VPNTSPNSSKVSEKGLEYRFEVGNSNYFNKESLKETYPFYINTDYDEFSKARSKREQL
                     QSEKKAALTKQLETSTNTTQTEAKKKTTSKSVTDSKLDEPNNYEGSEESERSEGSEEL
                     DKTSQVDNLKTEKQNAANQKPIETENTATARSSSASPERPVQSLSPKPVPAQNLPVKS
                     WSKLAAGGLSKTKAHQTAPNLATAKKDKKYIPPTVKSLEPLGSVALRVCFDQEFTSHT
                     LQNSKAEKLITELVPRGIYNKGSICFISSVLQLLIHCRSFVNILNVIHMTSVQKSTSV
                     SPLLEACMEIFKCFDRATVNQELAQARENSKTKSNSSNSNSNIKSIDPEHFYKSISNL
                     PKFKDLTWGRQEDAEEFLTHMLDQLHEEFIHSINILSSNDILNIVQSLQDNDQKAYFL
                     RYITKYKNATFTEKPDQALKVLLEKYKQPGDLTDVDDKEWKEVSKKGKKSKSASKRIT
                     EVESSPISTIFGGQFRSVLDTPQNKESQSITYDPFQTIQMDISSPDVVDLETAFQKFS
                     EHEIIEVKSSSGNEVEAMKQTCIDKLPNVLVIQLKRFSFVSQSTKGDLSNYNTYNGRI
                     EKIRKTVKYGHELIIPNKSISPNLASTATSEDQFKYTLSGVIYHHGVSPSGGHYTCDV
                     YDKGLNKWFRIDDVNVEEIKNREDVLAGNDNSAESRTAYILLYEKVK"
     gene            complement(<891453..>892106)
                     /gene="SHU2"
                     /locus_tag="KLMA_20430"
                     /db_xref="GeneID:34714899"
     mRNA            complement(<891453..>892106)
                     /gene="SHU2"
                     /locus_tag="KLMA_20430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818048.1"
                     /db_xref="GeneID:34714899"
     CDS             complement(891453..892106)
                     /gene="SHU2"
                     /locus_tag="KLMA_20430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674754.1"
                     /db_xref="GeneID:34714899"
                     /translation="MELCQERFLNYSSLLSSLVNEDGTGLNDTTVAFLHQLFPNDMFV
                     KAFSLLETHNIFLYVWSSSEGSNNGIYDVSALAETLYDDNLGSTTLLRMIVQSIDQEF
                     SKEPIYVDVSAWFCSCSEYSECLQDLTSITIADEDPLDKYFEIYSHSTGDCFSRIREN
                     MYMNTSKTLCQHLLAGAILLQTSAKVLKYFTAVKQTVSLICISNKDDWLKLHLNIVE"
     gene            complement(<892693..>894048)
                     /locus_tag="KLMA_20431"
                     /db_xref="GeneID:34714900"
     mRNA            complement(<892693..>894048)
                     /locus_tag="KLMA_20431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818049.1"
                     /db_xref="GeneID:34714900"
     CDS             complement(892693..894048)
                     /locus_tag="KLMA_20431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674755.1"
                     /db_xref="GeneID:34714900"
                     /translation="MTTHPKTTATSKPINFFKGHPSFRLLPREAIIEATTQLLSPEVR
                     DFDDKNEDRHPLTYGPDEGSLWVRTAIADFNNTCFQLAEEKMKSKAEYINLTAGASYG
                     VMNILQQTTLPHTGYTRQAFLVSPTYFLINETFIDSGFGGKLTAIEELGHGRIDLETL
                     EKKIKYFDSISVDHPSDLDLITAPNSSKKVYRYVIYLIPTYSNPGGQTYSLETRIKLI
                     ELARKHDMLIISDDVYDLLKYDDPLDKLPRPLPRLTHLDRLSYENGESGYGNTVSNAT
                     FSKLIAPGLRFGCQETVNRNLAWQLSQGGANVSGGTPSQLNSMIVGTLLNSGKATEVI
                     GNLRKEYLLRSTTLYEAIKKYLPRDTKYDMQLGGYFSWCTLPEGYNCKEIQDELEKRY
                     NVILANGSSFEVIGDEKNWGQRSVRLSISFLESQDIEKGIKLWGSICEEYAIKHNLSF
                     R"
     gene            complement(<894439..>895263)
                     /gene="PET122"
                     /locus_tag="KLMA_20432"
                     /db_xref="GeneID:34714901"
     mRNA            complement(<894439..>895263)
                     /gene="PET122"
                     /locus_tag="KLMA_20432"
                     /product="translational activator PET122 family protein"
                     /transcript_id="XM_022818050.1"
                     /db_xref="GeneID:34714901"
     CDS             complement(894439..895263)
                     /gene="PET122"
                     /locus_tag="KLMA_20432"
                     /codon_start=1
                     /product="translational activator PET122 family protein"
                     /protein_id="XP_022674756.1"
                     /db_xref="GeneID:34714901"
                     /translation="MMLDLPAITRKCLRGNLGEVLREVRKVPKESIDKSFMQFYLAQS
                     TKYVHWPSISFIWNTFVVRRELMVVRPNILADIAKISVHENKYGFTRTVLRHYNRYYI
                     SQRGIRWDGYRYLLLNAHIEIYAKRPNTKANFKKKWHAYIVELDNELTHYPVSVYDFP
                     NLTASMRNIPIERLKKWLLNDCKEGSMNPYSMPMLLNMILLQPHVSGAEKIDVFKEFV
                     QKTSVDLSRYLQDSVQILFHECDGVSMRDLVEELQALHMTFDEKTTRKLQSLGLLE"
     gene            <895779..>896894
                     /gene="OXA1"
                     /locus_tag="KLMA_20433"
                     /db_xref="GeneID:34714902"
     mRNA            <895779..>896894
                     /gene="OXA1"
                     /locus_tag="KLMA_20433"
                     /product="mitochondrial inner membrane protein OXA1"
                     /transcript_id="XM_022818051.1"
                     /db_xref="GeneID:34714902"
     CDS             895779..896894
                     /gene="OXA1"
                     /locus_tag="KLMA_20433"
                     /codon_start=1
                     /product="mitochondrial inner membrane protein OXA1"
                     /protein_id="XP_022674757.1"
                     /db_xref="GeneID:34714902"
                     /translation="MPLYQSNLIGRSGIAGASFIGLRFKSDVPLTNVAQEASAKVSEI
                     QTQLPSFDESTVEAASQVGQMVSDASNQIGYLSSIGMAKSWLWPPDLIQNVMEYIHVY
                     AGLPWWGTICVTTVLARVVLFPLYVKYSDTLGRTSKIKPEMDKVNADLMACSDTTKAQ
                     QIALRRRKLLSENGIKNRYLIVPIVQIPIAISFFTSIRQMCLYPVEGFSTQGTAWFQD
                     LTLADPYLGLQCLTAAMFVALARKGGESGAQQFSPQMKKVFTYLPILSIPVTMNLSAG
                     VVLYLAVNGVCSMTQTLLLRNKAVRKFLNIAEVVNHPTPPGQGPPKGVFESFRESVQK
                     ARDQAEKRALMKEEEDKKKELAKKEKQNQRIKIVRRK"
     gene            complement(<897038..>903166)
                     /gene="BEM2"
                     /locus_tag="KLMA_20434"
                     /db_xref="GeneID:34714903"
     mRNA            complement(<897038..>903166)
                     /gene="BEM2"
                     /locus_tag="KLMA_20434"
                     /product="GTPase-activating protein BEM2/IPL2"
                     /transcript_id="XM_022818053.1"
                     /db_xref="GeneID:34714903"
     CDS             complement(897038..903166)
                     /gene="BEM2"
                     /locus_tag="KLMA_20434"
                     /codon_start=1
                     /product="GTPase-activating protein BEM2/IPL2"
                     /protein_id="XP_022674758.1"
                     /db_xref="GeneID:34714903"
                     /translation="MKGLRWTNRSKRNEEKSKNSGNSSGSAFSAGPYSQQRGSANSSN
                     SSSSLSRPSSLSKQANNMYMSDSQAHSQRSLSSSGSRHDSKTGLDEDSFDSTSGHSGK
                     LSTVKSSNKDSTSSGSVSTTTFASTTNALDDSTSGTLISTLGNDSNKVEISHGHSSQH
                     KHHNVNNTNNNTNTNTNSTNAHNNSNAPVPTLQLNSDNFDSMVFKTGWVNKSHGTIQT
                     SPMNSSSSTSVASQRSNRESRVYGTDSLSMSSPRSTTHYMQEYRLYKAQLKGCVLSLY
                     KSGINNVKFFDPSLDPPNTKHEHEDDHYLPTPPIMADISSGGPKESPQSSKSSSSNTL
                     SGSKQASSINSHSSTESSPNLSKNIKELKYVNDAYPHPNLKIDKHGQIIYGDVESICH
                     TILFSVDLETKKALDLILMLPLIEDIKLHFQCFCLYGINFTKNNEKLTKDSKQWYKVT
                     PAVDELMTQRLALVVKTVLDVFPGFLLDDTTFNQVIQLLDVISLHNDEISNSLKLTVA
                     EYHNKLNELVAFTKKPLDQKALSQFADVKEFLKLDNEVLADQIHSINLRFNKVWSPQT
                     DYSLLYDSVFNKRYIDFNPLVFNNKTNVHYVSRLLIEHLFKKIDGVALHPKERAVILT
                     KWVQLGCTFEKIGDMVSWLAIATVICSMPILRLSLTWQYISEQTLKIIFKDWVPTIVQ
                     LDRRQLSYRTTNSVFILAPPNLNEQSIRENVIPYFGDLTIHTNDLTPDTMFRYLEKKI
                     YRTKNAFQKWQQRLPPHRKTDSDILQKSSDIPFYHYLNYHVSQPRLNIDRLMELSLKL
                     EPPILDKFAPALHVSKRSPLLSGSYLPILFNEVLPNYSLFSQNALIGAAGVQYNRQSV
                     IRNNAMTRSGKTLSVSGPLEVMKPDDKSVVTGLEGVDELTVRELSTKQSNKQMLLKSI
                     RDVFSINMDLFHVLDDLSFKSVEDWDKNSRPTSIVIENPKRFSVRSSRDSQDVMNRLS
                     VGVENMEFFKNISKDTETWDEVVINVVLKSASLDKLFDVLVLTSSVFSRLVTISDISA
                     YFKNHQEKFNDGTGTGLLDYGVVKLCMDNDLYTKTFFSTYRSFTTTVSLLENLAKRFI
                     GAKSCAISIEKMVKHESDKKKNGEEPNSPNYKFPCWDTSAASEFDTPHFVHAAKIQIG
                     TAEALFYLIKEHYSDFNDDLHNSKLLLDIIKIMDQEVIDEWESRISSLSSRAEESVEQ
                     KQLLAELELLHAKLKDILQKIKLSYQRQLYRPVGVSRHNRNTMKILNSFTTLTMEDLN
                     KLIYENSYDDSMISSFQKLKADSYSDILKWMYKLDDLTLSHLKLATVKEWMMVAQLLE
                     GFSYESLTSLFRYPQLEQNYSQIISGKAQIEDLEIMNIFTWLVSLKGVNNELFVKRLP
                     YSIQLIINLHISLTNFFIIQIAQLEKTYESRLETCTILLQMLGFARWKNNSIDLFQTN
                     LETDSKLSPHLPSFLESALLNAILSPESRKFELSWKHAAENLDGSSSLKSINNILDCT
                     ETSIKNFIEFDGIESKRKNFCPCPGWFIGRLLEISQLVTNMSIENSKLINFDKCRFTF
                     NLVLNYQQLLLIDDQDEHPEPSNFGSSLNHLVVDPLHSFRTRAKELAANEMKLMKYQV
                     RGVFNEVLIAEMHKIKREQKKREHLNSQEKEQKRSQSLQEVMKQKTIDMQTSLLSQVQ
                     NQPQNHSAQSRVKRSSVANNSRNSVLYNAASSGNGVGRKIGGFFKRPFSIGGFSSSVS
                     SNGINSMLINSIHNNGSVAPIDLPRINKEEINDQKPILSLKTFDIKKCIDVSSFSNDP
                     SMIYCFKIVMENGQEHLIQAIDYHDLCLWIKNITLSKRYSFHSRKYKGKTSNKVFGVP
                     IEDICEREGTLTPTIVHKLLEEIELRGLDEVGLYRVPGSVGSINMLKNAFDDEGAVNN
                     VFTLEDDRWFEINTIAGCFKLYLRELPESLFTNERLPEFLQLVEQVHSDLISEDEFDE
                     LMREKLRTLPIYNYHMIKRIFQHLHKVHAHMDTNRMDANNLAIVFSMSFINQDDLANS
                     MGPSLGLLQNLLQRFIRDPDIYFVYE"
     gene            <905200..>907374
                     /locus_tag="KLMA_20435"
                     /db_xref="GeneID:34714904"
     mRNA            <905200..>907374
                     /locus_tag="KLMA_20435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818054.1"
                     /db_xref="GeneID:34714904"
     CDS             905200..907374
                     /locus_tag="KLMA_20435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674759.1"
                     /db_xref="GeneID:34714904"
                     /translation="MESFISFVPLKASAIVRPSEDTFIFSSISKWSKLEGKECVYEVP
                     TEFNIVRTAENRDGSIDLYCLLETKNLQDVSKWDPLSSTEVDLSVNIDEHEWIPLLES
                     LVDDWNKNGYHADIIVVKKQNHRRATGSRNEYMDKTAILIGLKSKLAIMEIELKCAFA
                     MKSNKHIDFINTKAVSMLPLLAGQNGSNWRHLSECFDTNIIYSELGLAGYDYPDTLFL
                     EGSQKCSLLCAKHYLQNKLNSFVDGGLYATTIASISPLKLSYLRSIFSSKHIMNLMKK
                     YPSYILLTSDGIQFQSYSAALLDIVRKRFVRNILADISELRFWFSSAEGTSEVMTSKR
                     TKFKQIAIDHQVIFSYDEANNFISFTGSNESIQRAYNDIIIERLPGVKNIRFTLELDT
                     IYKDFISGKKNGKLMKIMDLTKCAISLENDHSGNMLVVLQGDNIEQLKDSFTLLLQEL
                     PCEKSFFIPEAYHRPVIGAGGSVIQTIMRKYNVYIQFSNSFQLPQTDWAFIRYDNVII
                     RCPSKNKANIQAAEEQLLNLSEQYSQIQNTVYVQMSPGQYKYLTHARENLSFISEIEK
                     TYSCYISFPQSLPNGNFHLTIKGNDNGPEQAANALTSHFGREIEINVKDPISNKIISN
                     GLLLPLTLNEVQLTHYDQTIRLTFSSEMTAKKLEKVFFLIETYIKDTNNRINSKKEIS
                     PYSSVAPLYGVGKTITDMPQVQSHSHSHTNVPMLNEYSQIRM"
     gene            complement(<907463..>908029)
                     /gene="IRC19"
                     /locus_tag="KLMA_20436"
                     /db_xref="GeneID:34714905"
     mRNA            complement(<907463..>908029)
                     /gene="IRC19"
                     /locus_tag="KLMA_20436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818055.1"
                     /db_xref="GeneID:34714905"
     CDS             complement(907463..908029)
                     /gene="IRC19"
                     /locus_tag="KLMA_20436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674760.1"
                     /db_xref="GeneID:34714905"
                     /translation="MVHISSNKAVVTATNILIKITPKYYITQEQINKLDDLSFIKASY
                     RRFLRLRPFVSKRQTIKHSYTIYLRYKFRVENYESKRRECLSESELTDIDFRSSVQRS
                     LQMMIKAFSNTNGFSRSMEKDTHMCRRIVKNILTVDYHKTRLIRNSGKMYKYYRKDLK
                     YLTDDQHIGLRQFEENLIRFNECFGTML"
     gene            <908468..>910837
                     /gene="RIX7"
                     /locus_tag="KLMA_20437"
                     /db_xref="GeneID:34714906"
     mRNA            <908468..>910837
                     /gene="RIX7"
                     /locus_tag="KLMA_20437"
                     /product="ribosome biogenesis ATPase RIX7"
                     /transcript_id="XM_022818056.1"
                     /db_xref="GeneID:34714906"
     CDS             908468..910837
                     /gene="RIX7"
                     /locus_tag="KLMA_20437"
                     /codon_start=1
                     /product="ribosome biogenesis ATPase RIX7"
                     /protein_id="XP_022674761.1"
                     /db_xref="GeneID:34714906"
                     /translation="MLDEKSLEKQRLNAKKRELLERGDIQSDDSSVEDIGDELADIYL
                     AKDLRFPEVVAFCQSKDLSLQRVKKVLLEKTIQKVLVQVIDDELQEMGPLIQEEETVV
                     SKETELEEKNLMVTPECNDLNKDIISQWQVPKSKEDTPEAKKSNKKRPKEDPKEKAKR
                     QKKDDRSPPSSNLSTLGGMDDVVAQLMELIGLPILHPEIYAATGVEPPRGVLLHGPPG
                     CGKTSIANALAGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLIFFDEI
                     DAITPKRDGGAQREMERRIVAQLLTSMDELSFEKTEGKPVIVIGATNRPDSLDPALRR
                     AGRFDREICLNVPNETSRYFILKKMASSLKIDGEIDFSKLSKLTPGFVGADLKALTTA
                     AGTCAIKRIFQTISASDDVDMDADIESEIKLKNTANLIDPLPLSTIQKFIDNFPEPLT
                     PDQLQDLSIKYEDFLKALPTIQPTAKREGFATVPDVTWASVGALDKIRIELNMAIVQP
                     IKRPELYEKVGISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGE
                     SERAIRQVFNRARASVPCIIFFDELDALVPRRDTSLSESSSRVVNTLLTELDGLNDRR
                     GIFVVGATNRPDMIDPAMLRPGRLDKSLFIELPNFEEKVDIMKTLLRANGTPVAEDVN
                     ITKIVSDARCNNFSGADIAALVREAAVLALKRSFFKTDEIQSVGENDLDKEFEDLTTN
                     VTTDEVLVHMKDFENALKKVKPSVSDKDRIRYDRLNKKMGWNESGDSSN"
     gene            complement(<910873..>912765)
                     /gene="GRC3"
                     /locus_tag="KLMA_20439"
                     /db_xref="GeneID:34714907"
     mRNA            complement(<910873..>912765)
                     /gene="GRC3"
                     /locus_tag="KLMA_20439"
                     /product="protein GRC3"
                     /transcript_id="XM_022818057.1"
                     /db_xref="GeneID:34714907"
     CDS             complement(910873..912765)
                     /gene="GRC3"
                     /locus_tag="KLMA_20439"
                     /codon_start=1
                     /product="protein GRC3"
                     /protein_id="XP_022674762.1"
                     /db_xref="GeneID:34714907"
                     /translation="MSEDILQYSSNTDSDDSDFESAQPRNVVIQSKESSIVATYDEDD
                     DNDVLNTDGKSTEGNISTNLSKWYSPIPNENMFFLSHESTEVLVGLTKNQQLLLCGQF
                     NLQIVKGGITYNNVHYNSSWRTWEIWHPVCNAVSPIISSFYAGWESKLFLGEKYKHLE
                     SSLEKFNCVLRISNGSNIALLTNSVPDLRDIWGPISSFPLPGFHKKQLTFTVVPESST
                     IVRILNISQEWSKVIDEMCLFHSNSSQDMRVMVIGGKNSGKSTLMRLLLQKFLHSDNE
                     LSDELVHYIDIDPGQTEYSAPESISWNKLDAKTMALGQHLCQGNYTTVKQHFLGSSSP
                     QDLPTTYSNAVESLLKSWEDENFMGTSFLNIPGWIKGFGVKIINHALSHFKPTHIIFL
                     SHNGKPFSSEIMIPETFSTTQRSSYKPIILELHSPPLDKHISPALQRFNAAKIRQFKI
                     TAFLHRRHDRSYNISPLLLQTPLVVPIGNGGIAGIKFLQSNGPIHEEDINLSLDGTLV
                     ALHNMEGVPEVKKIGSYPIMNRLPTTGLKFVTLALIHSINIDDSSIRVYVPDFAINCV
                     KRSEPTNWIILRGKTETPIHELFPTKNFFSESQEIPYISLYRKKRNEHVWKVRKNVMR
                     RGHHMK"
     gene            complement(<913187..>914662)
                     /gene="RIM101"
                     /locus_tag="KLMA_20440"
                     /db_xref="GeneID:34714908"
     mRNA            complement(<913187..>914662)
                     /gene="RIM101"
                     /locus_tag="KLMA_20440"
                     /product="pH-response transcription factor pacC/RIM101"
                     /transcript_id="XM_022818058.1"
                     /db_xref="GeneID:34714908"
     CDS             complement(913187..914662)
                     /gene="RIM101"
                     /locus_tag="KLMA_20440"
                     /codon_start=1
                     /product="pH-response transcription factor pacC/RIM101"
                     /protein_id="XP_022674763.1"
                     /db_xref="GeneID:34714908"
                     /translation="MAPIDNLLNSTNVPEVGQNNQSFNKENYNYQTSAGSSPLSAAGQ
                     RSSSSSSSSDDDTVQMHPCKWKDCSLEFTSAEILYHHLCQDHVGRKSQKNLQLNCQWD
                     QCHTKTVKRDHITSHLRVHVPLKPFSCSTCSKKFKRPQDLKKHLKVHNEELSLLKKKR
                     GPKPYNKVGKMASGDSVNRNYAHQKFTLPSISLEKFIHDEVKTQPPVYSQQLAEKMAF
                     VPLMRSNSINTVNNNSNQNSNTSNSPSSPALSPASSVAVSPSSLPQHNPVGYHVQPPS
                     TVGHGTDLRYAVGFFNNLSMDMSRNYSNKLPHPAFVSGTPVSAPQSYPVIPKLPSISS
                     TLNVGPPAPMLPVFNRFDTYHSLASSTSSAFHPHSYSNSYSLQQKSSLHEASSVSAKQ
                     VDALQDSLKSLDLSDKKKEEDAAANDDEDDLFALTYSTVNLLKDYLLCELMEELDEFS
                     ELKQNSQSLDDSINLQQESSSLDGKAYSDKLALPRYPQVVV"
     gene            complement(<916107..>917624)
                     /locus_tag="KLMA_20441"
                     /db_xref="GeneID:34714909"
     mRNA            complement(<916107..>917624)
                     /locus_tag="KLMA_20441"
                     /product="cell wall integrity and stress response
                     component 4"
                     /transcript_id="XM_022818059.1"
                     /db_xref="GeneID:34714909"
     CDS             complement(916107..917624)
                     /locus_tag="KLMA_20441"
                     /codon_start=1
                     /product="cell wall integrity and stress response
                     component 4"
                     /protein_id="XP_022674764.1"
                     /db_xref="GeneID:34714909"
                     /translation="MKWFNWFAAVLSVRCVSGLVQNYCSSENTGSEEVTNTWQSNGYC
                     SDYCRGKSYDYAIVQDYSCWCSNDLPSSDEPVSSCSHICPGYSVEHCGNPDSGLYGYL
                     YLGSGTPPSITSSSGSSGSSSTGTFGSSTSEQGSSTTLSSSGTSSPSVTSATTSTSST
                     SSTSSTSSTSTTSTSTSASTSSSSTSSSSSSSSSSSSPSPSTSTTSTLVETTATSASE
                     DSDESALTSTNPGTRTITSASTSKATTTTLQPSVSVIISIATITAQPTGSGKNSASGS
                     GSNQVVTTKVITTVYSTPSAAAGIAVNTNHGKSGDGEVSNKSHSGFWDSAGKVAGTFT
                     AVGVVVVLLLIALVILFMRYRRRKEQQDFEKTYDVVKRSATDAYSTSISSQNDPSGNS
                     STGMAPFVYADEKGILTPTVKNLSLRPVTNSGTASSVSTPASATAPTSATGNPPTPSS
                     PTNGVGIVPNSTDAVVLDQRLDPQHLMSQWESNGSRLSLADDVDYSRKVLRVINE"
     gene            <920320..>921468
                     /gene="UBI4"
                     /locus_tag="KLMA_20442"
                     /db_xref="GeneID:34714910"
     mRNA            <920320..>921468
                     /gene="UBI4"
                     /locus_tag="KLMA_20442"
                     /product="ubiquitin"
                     /transcript_id="XM_022818060.1"
                     /db_xref="GeneID:34714910"
     CDS             920320..921468
                     /gene="UBI4"
                     /locus_tag="KLMA_20442"
                     /codon_start=1
                     /product="ubiquitin"
                     /protein_id="XP_022674765.1"
                     /db_xref="GeneID:34714910"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
                     KSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST
                     LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK
                     QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKI
                     QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGQL"
     gene            complement(<921756..>927308)
                     /gene="ECM29"
                     /locus_tag="KLMA_20443"
                     /db_xref="GeneID:34714911"
     mRNA            complement(<921756..>927308)
                     /gene="ECM29"
                     /locus_tag="KLMA_20443"
                     /product="proteasome component ECM29"
                     /transcript_id="XM_022818061.1"
                     /db_xref="GeneID:34714911"
     CDS             complement(921756..927308)
                     /gene="ECM29"
                     /locus_tag="KLMA_20443"
                     /codon_start=1
                     /product="proteasome component ECM29"
                     /protein_id="XP_022674766.1"
                     /db_xref="GeneID:34714911"
                     /translation="MSGFVQLSETQEKSLVDRVDLKLVLAKDDRKFEETLNTFLPPLL
                     LKLASPYQSVRSVVYESIKHVNSRVNANKDIKLPVLKLLDQLRKPSLNQGQDATNVIT
                     YSALFLSKGVERLNDEEAMKILPNLIQGISELPELASSRVFHIICKVLLTYKAPSKNM
                     NKDKDNCALLNVAHNDLEFLLEKILKFFLLVPKRTDMLSGTASYSCPGLSISDVSFFI
                     YSPAISFTKDVLNQYKRAIFDFLTSGLDIDDTELIPILIVISTQSIDISDNAITLLKR
                     VAIPYEDENFICMLSNMFCGDNTRQLPPVNEKLQEKILGILERSAIVTKLPDLPTKIS
                     MLGINSDSVRVQLSTLSFIRHVCKFNEDAFKQSLDVDSTSIISSIQNNIKLNGWPKYN
                     APTANHLSGIKLRASQYETVGELLKHDIKSVNDFKNIQFLLKSLEGDLSEFRSTIKDA
                     LGSLVCHFPLLPLEAKSELKKFLANVLVDNYKIFNGSADEKDALMSLRFVAIKFSNAA
                     FDFEDVDARIFNILGTNQVNRFDVIQESFKGLNPYHFRMNKASLQSGYVSTDALLAKK
                     ITETKFPEFASMTERLLQEVRQTSEYSSIKSCIPTAVRLLQQTLISNSVYGKTTTIVQ
                     DENWAMRIEKCLEIDELVRNLVQKFISDISEKTIGSLCLFLQNEILHLNSISSKDDVV
                     LTNLLLLLIEYCSPAAVDQCEGLLATALNHVSSNRIIANVYLDRFTNAIGILGARKGT
                     KCPVVSQFLTSLTGYGSDAIHQGQQSLFLLYSHLIPRICLLESVHMEEEISFIAMTAI
                     DSLKIGAMDRTCFKVLSQLLKFLVLNSLDSESRSKFLSEIKKCIEEKLKNDELAILLW
                     GLLSMNSQQDDFNGFLDVYENLHSSKHIDFLFSAGEALTIILGGWNSKYLQMHLDIDV
                     DISVLKEQTSTRNLSSGLKTILSFCSSANPSLQKASCIWLLCIVQYLGHLKEVSENFR
                     SIHSAFRIFLAHRDEFVQESASRGLSIVYDMGDADMKEMMVKGLFKTLTNSNSALSLQ
                     SGSVSADTELFEPGILSTKDGSVSTYKDILNLANEVNDPGLVYKFMALAKNSSLWSSR
                     KGVAFGLSAIMAKVSLQDLLINNKTLSKKLIPKLFRYRFDPSTTVANSMNNIWDTLFP
                     DGAQALDQYFNDVLEELLLNSSNKEWRVREASSSALLYLVQTYPLANFEGKVEELWTV
                     TFRLMDDIKDTVRTSGTQLARSLSKLLIKSLNSSQGKSDGNRSQKLLDVILPFLLGTK
                     GLNSDAEEVRSFAIKTLLELIKESKESLKPYIPTLVFEMTVLLSVLEPQVINYLTLNA
                     DKFNVKASEIDQHRVHGVSNSPIMQAIESLVDISEYNDKALSELVDVCVRASKKSVGL
                     PSNVGASRVLQLVCVRHSILLKPYSGKLLKACYNGLENRNIAIASSYATAFGRIFKVS
                     KLEKQVKYSKKIVDKYFETDSVDNQKIVGLTIESIYKYSAEDFDNVATILMPLIYIAK
                     HGSEESVSSIFQDIWVESSKSGSSSLNLCFPEIIDLVNVHMKSNIFSIRKTCAVALCD
                     ACKVYSGVLNAKKIEKVFDILLEACSSRSWDGKEFVVSGVINSFKKFSVQASLDETVG
                     NKIDKMLQIELSKKNRTYVKKLIQPFTEYVFFRNDEKLYEKLTHVIEEAFNELEIEDD
                     KEDRDDSRGHSKKPKLVEDVHKSSSQENIDKENFKIGIIKSVAKELHEMVHKENGIKY
                     EDVLRLVYSFMKGMFENSSIEYTWRSQLAYFETAITLISPLDANFLTSHNASDIFIDM
                     WKYGYDFCKTKEIIESVKIKCIRYGGLLKAKLPDTNIMVNFDISELLRVDHSSVLKAE
                     AVKIGISP"
     gene            <927625..>929463
                     /gene="TFC6"
                     /locus_tag="KLMA_20444"
                     /db_xref="GeneID:34714912"
     mRNA            <927625..>929463
                     /gene="TFC6"
                     /locus_tag="KLMA_20444"
                     /product="transcription factor tau 91 kDa subunit"
                     /transcript_id="XM_022818062.1"
                     /db_xref="GeneID:34714912"
     CDS             927625..929463
                     /gene="TFC6"
                     /locus_tag="KLMA_20444"
                     /codon_start=1
                     /product="transcription factor tau 91 kDa subunit"
                     /protein_id="XP_022674767.1"
                     /db_xref="GeneID:34714912"
                     /translation="MVSRKQKTRTSKASNVNSKKIDVTEQLKSVASSKETPTVQIEEV
                     PKDASKVLIDIPENNDSSVNVMDMPELDKEEKKVLKKRGRPKGSKNGTASGKTKAVKI
                     KASSPKKVDKNKIVRVSKHLTSVKDKLVRIYGNNQDKLLGLAKQKEKFETAVFDFKEE
                     QLTPFNLKFNSIDLKLSDFAAVEISEDELNEMIKLNKNEIKFNIGNDHFATMKNEYIQ
                     LPAFNFGIRQGFIFNTGGFVSDMAWTRLPGSDIQYLAVSVSDTQDAADPDLRLSGTPT
                     PRSALINIYEFDKNQAKMSLFYQLVHDAGLSWDLKWHPAPVTDEKCIGILTGVFQDGC
                     IKFLPIMRSVEGHIHHLQNPCINIKGPESAITSFDFISSDYIVCGFQNGYYGEYSITE
                     SIFCNYKQLFESYVISTIALRSNFENTAVCMSAIDGNCCIFDPKDIRLTKTFSTRTRG
                     SNTLPLVYMPQLYTVLRTDSLSSVKAFTPRAIFVDHNICQHDNTVVCLGSSSLHPMLL
                     SGSADGSLLLNNIVRRMLQGLKNNTDIYRYVRLWKWDFNAKTKQYRLNPQYKIFKFTN
                     TETSNVKLDYPGINIQSVKWIEEMNCGKWYSFANAAGFVVVEKLGN"
     gene            complement(<929529..>930863)
                     /gene="UBA4"
                     /locus_tag="KLMA_20445"
                     /db_xref="GeneID:34714913"
     mRNA            complement(<929529..>930863)
                     /gene="UBA4"
                     /locus_tag="KLMA_20445"
                     /product="adenylyltransferase and sulfurtransferase UBA4"
                     /transcript_id="XM_022818064.1"
                     /db_xref="GeneID:34714913"
     CDS             complement(929529..930863)
                     /gene="UBA4"
                     /locus_tag="KLMA_20445"
                     /codon_start=1
                     /product="adenylyltransferase and sulfurtransferase UBA4"
                     /protein_id="XP_022674768.1"
                     /db_xref="GeneID:34714913"
                     /translation="MTNINGDTSSLLEELERLREENARLKKTLDEQRHHQDDLSLPMS
                     LEEFQRYGRQMIVEETHGLSGQIKLKNAKVLVIGAGGLGCPSLPYLAGAGIGTIGIVD
                     NDLVDTSNLHRQVLHDSTKVGMLKCESAKLVLNKLNPHVSVITYPVRLTNSNAFQIFE
                     GYDLVLDCTDTPVTRYLVSDVAVNLNIPVVSASALRTEGQLSIFNFANIGPCYRCFYP
                     NPPTPTSVSSCQEGGVLGPCVGLVGVAMVVETLKILLGTYTVENFKPFLLQYSGFPDQ
                     TLRKFKMRGRKSDCLACGANRIVTRQSIESGEINYETFCGSRHYNVLTEEERVDVFEF
                     EKRYKMKAEDKSFLLLDVRPSLHYSISHLPDTHNITVNELRDMKSDFDALKSRIPSID
                     ADSEVFVICRYGNDSQLATRLLKEKFKIKNVKDVKGGFFKYIDDINPALPKY"
     gene            complement(<931205..>931846)
                     /gene="ERP5"
                     /locus_tag="KLMA_20446"
                     /db_xref="GeneID:34714914"
     mRNA            complement(<931205..>931846)
                     /gene="ERP5"
                     /locus_tag="KLMA_20446"
                     /product="protein ERP5"
                     /transcript_id="XM_022818065.1"
                     /db_xref="GeneID:34714914"
     CDS             complement(931205..931846)
                     /gene="ERP5"
                     /locus_tag="KLMA_20446"
                     /codon_start=1
                     /product="protein ERP5"
                     /protein_id="XP_022674769.1"
                     /db_xref="GeneID:34714914"
                     /translation="MRSDILLRIFFLLLQCSLGKCLHYYLRSGETKCFYENLDKGELL
                     AATFLGQVEQEDGTYDEDEALTFHITIFETFDNNHCILDQKSVPPGPFAFSGIDKGEH
                     KICLQPHHIDSSKRVKITHDVNFGDAVSIQSKRNSAMLSLKERIRQLNERLLTIKNEQ
                     EEIKLKEPKFRSTTEETNQKVMYLSIVVSVVLVLTCKFQLRYLKTLLVKKKQK"
     gene            complement(<932140..>933675)
                     /gene="CTM1"
                     /locus_tag="KLMA_20447"
                     /db_xref="GeneID:34714915"
     mRNA            complement(<932140..>933675)
                     /gene="CTM1"
                     /locus_tag="KLMA_20447"
                     /product="cytochrome c lysine N-methyltransferase 1"
                     /transcript_id="XM_022818066.1"
                     /db_xref="GeneID:34714915"
     CDS             complement(932140..933675)
                     /gene="CTM1"
                     /locus_tag="KLMA_20447"
                     /codon_start=1
                     /product="cytochrome c lysine N-methyltransferase 1"
                     /protein_id="XP_022674770.1"
                     /db_xref="GeneID:34714915"
                     /translation="MDHAITWILENKSIIKHDALTIDKSAVDGDAGGYGIFADLSLID
                     DRKDERKVELLRIPRDATISMAMIRQILTSDTRDKTLTSLKDHLAAFLTEESHQIYIN
                     ETNIIVVFLIIKAIISNSEMSSPGSKDFASFYTDEVLLKTLVPLPVNKYQEDSHNWEQ
                     YYAEYMSFPQQQFIEVLEEFIQKRFPGEDHSKEIILIYCSVISRILEIPEAVEPGSDD
                     YVVNPTLVPLLDFANHSNDKKNAYFDVDRNNNDIVLYLDLENSPESKLIQVFISYSPF
                     EELVHFEQIYGFLPNSKKPQIFCYRFDENFMKHYVYKDVNVSKFYRCMNIRPYLEVVL
                     KDDDVLLNDCIMEFAEIILPFSQHIKRSDLTPFNYNEDLKTYTSTIVNENGLEKQVNL
                     TKEEAIEYIFGDQDETENYERTLKEWILHFLKEYINFRLSKMLQVKPDSETSSFNIFL
                     TKELWILQKLKASIDKNQHITWYEKFAERSSELPDVPFPPPCRIDYENLSRTEIQEYI
                     DTD"
     gene            <934013..>934825
                     /gene="BCP1"
                     /locus_tag="KLMA_20448"
                     /db_xref="GeneID:34714916"
     mRNA            <934013..>934825
                     /gene="BCP1"
                     /locus_tag="KLMA_20448"
                     /product="protein BCP1"
                     /transcript_id="XM_022818067.1"
                     /db_xref="GeneID:34714916"
     CDS             934013..934825
                     /gene="BCP1"
                     /locus_tag="KLMA_20448"
                     /codon_start=1
                     /product="protein BCP1"
                     /protein_id="XP_022674771.1"
                     /db_xref="GeneID:34714916"
                     /translation="MVGVIKLSELSKKRAVDDESDIDIFSTDSENGQGSDQEQEIVNI
                     DFDFFNGNPDVDFHALKNLMRQLFGAQESNKIQLSELADLILESPTTTIKTDGKESDP
                     YCFLSFIDYKANKDSDYAKYLRKTDSKLASFLQTIDQSDKTCSLVMSERLINMPPEVV
                     PPLYNITMEDVKQVLGDDKNYDFYVIVSRKYEVNFDMDEDDLTSNQATRKKVRQTNEV
                     DYFHEEDRFFEKVAKVHVDSESRKGLITSYMVLDHAGLVKSIQDLDAAIKTW"
     gene            <935388..>938369
                     /gene="EAF1"
                     /locus_tag="KLMA_20449"
                     /db_xref="GeneID:34714917"
     mRNA            <935388..>938369
                     /gene="EAF1"
                     /locus_tag="KLMA_20449"
                     /product="chromatin modification-related protein VID21"
                     /transcript_id="XM_022818068.1"
                     /db_xref="GeneID:34714917"
     CDS             935388..938369
                     /gene="EAF1"
                     /locus_tag="KLMA_20449"
                     /codon_start=1
                     /product="chromatin modification-related protein VID21"
                     /protein_id="XP_022674772.1"
                     /db_xref="GeneID:34714917"
                     /translation="MSSLKRGSNGSQGSQEQLLEERRNLLVQLFCISHISELKSIENH
                     ERIGKEIQQFLEQHDLARGKPVDIGSLPKFRPRDPVNDKKLNRSKCPSPAETKRELKK
                     RSKDSTPNSNDDHEMDSQPLPPSTNRPVSRIQSQQTTFQSFKQVPQPQGSKQPQQAQL
                     QQQIPNNRSVSPTQKVTAPSDKTSNVVVESRTAKKQIAYAEAQSKPSSSEKHSRDEQG
                     ENGTPQEMVKRQKIESTATNSSVSTARNESTIELPPNPYSHMIEMSQLHADPTPIQIK
                     EPQPFIIDSILENLSTEERKTYCDNDINVKETVYMITKENVPTKLAKAMPIQEIKYVS
                     QTLPLLRLIPQSQKALTTDLINTALNEGRITVVASRIEELRRLNLWSLRQPKKFIDPI
                     TANKPVTHANVLLEEAKWMREDFRESLNYKIAMCTEIAQSISDYWTYGKICCVKRKPI
                     SDTANKTEHVNSSQDIEVKIQTDGLENTDMQISNSSQNEPGSNAKDDAAVNHPADPIV
                     DNTEESAGVEDMEIEQQVQEEEPSIDISKLLKRTDPQDEIPTPSLPIVSAEEYLSKKT
                     KPRFRAYVDISSLSTLGAAISKSVRVYEGLDEENLKSRKSLPFEPVSKAIAPVDDDHF
                     MKLVEKQLIEEEPSLVPLSKRRGMFYGNRRSHYLRPPVAPSLRYLKFRTPTIWLPEDD
                     QELVKNINQYAYNWDLISSQMSNRHKRMYVSNIERRTPWQCFERFVQLNEKFNIADMK
                     GPRAHNAQVWLYEAHKLQQQQKRRISPLGVGSESIQRGHRRLRWASMFEAMRKCIKKR
                     ENAPRPNPSQPRKPLDVKNMSVPTPQEMSELKAQRDDALRRDMQIKRAAKQRMQMAQM
                     QAGKLPLTAASSPNLPAISNGSSKELKNKSRQSTPQSAPPLGEKTKVTSQQLPPRNVK
                     PSNEREIIEGYAKKILLQKPNFTPELALIAAENIYRNVTLPEQGRARSEAASSSNNRV
                     SEIKNTSPTPQEILQRAQKHD"
     gene            complement(<938557..>940305)
                     /gene="GGA2"
                     /locus_tag="KLMA_20450"
                     /db_xref="GeneID:34714918"
     mRNA            complement(<938557..>940305)
                     /gene="GGA2"
                     /locus_tag="KLMA_20450"
                     /product="ADP-ribosylation factor-binding protein GGA2"
                     /transcript_id="XM_022818069.1"
                     /db_xref="GeneID:34714918"
     CDS             complement(938557..940305)
                     /gene="GGA2"
                     /locus_tag="KLMA_20450"
                     /codon_start=1
                     /product="ADP-ribosylation factor-binding protein GGA2"
                     /protein_id="XP_022674773.1"
                     /db_xref="GeneID:34714918"
                     /translation="MMSIHLDEGPVRRPQQHSDPLIRKIQRACRISLPEPDLALNLDV
                     ADYINEKQGATPREAAISIVRLINSRDSHTAIFALSLLDVLVKNCGYPFHLQISRKEF
                     LNELVKRFPERPPVRFSKVQRLILTAIEEWYQTICKHSPYKDDMGYIRDMHRLLKYKG
                     YTFPKINSEDLAVLKPSDHLKTPSEIQKEQEIAQAAKLEELIRRGRPEDLREANKLMK
                     VMAGFKEDNAIQSRQILNEELTKLKRKADLLNEMLGASESPDMENETIAELYNALKSS
                     QPRFQKIIEEEQDDDQFIQDLLHFNDTVNQLVEKYELLKAGRVGEVNQINIPNISTTV
                     NNSGALANEINLIDFDDEEEDTGAASSNNNGTASNNTEDDLLSDLNNLSFSDNKSNNN
                     FGFGGSIALGSTTPAAPVTTTTTTTTSNNNFDLLGDLSSPSPVQTQQTNSFSNDLLSD
                     LSSAPPSQPQNQTASSNNRQLVSQSDILKFEFLITRESESTIKVTSFFSNLSISQISD
                     LTLMLAVPKAQSLRLLPQSNTTLSSFSTDGIYQESWIDNAVKDAPKPLRVKWKVSYKV
                     NGTPKEESSVFTFPNI"
     gene            <940661..>940993
                     /gene="CLN1"
                     /locus_tag="KLMA_20451"
                     /db_xref="GeneID:34714919"
     mRNA            <940661..>940993
                     /gene="CLN1"
                     /locus_tag="KLMA_20451"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818070.1"
                     /db_xref="GeneID:34714919"
     CDS             940661..940993
                     /gene="CLN1"
                     /locus_tag="KLMA_20451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674774.1"
                     /db_xref="GeneID:34714919"
                     /translation="MSEGDNDPFKIDKLIVDYDYVLYKIQDELESIRLETLEVCEKQN
                     QLVENGIIEDVIDANIAMTKELLEKCDELDKHYDQLDAVEGIVVSFKSRLKNVITQYK
                     KYVDMKKP"
     gene            complement(<941036..>943678)
                     /gene="SPC110"
                     /locus_tag="KLMA_20452"
                     /db_xref="GeneID:34714920"
     mRNA            complement(<941036..>943678)
                     /gene="SPC110"
                     /locus_tag="KLMA_20452"
                     /product="protein NUF1"
                     /transcript_id="XM_022818071.1"
                     /db_xref="GeneID:34714920"
     CDS             complement(941036..943678)
                     /gene="SPC110"
                     /locus_tag="KLMA_20452"
                     /codon_start=1
                     /product="protein NUF1"
                     /protein_id="XP_022674775.1"
                     /db_xref="GeneID:34714920"
                     /translation="METPHVDRMKDYEFTPIGYVDERRRRGSDPSEKGLKRSLEPATE
                     ERLTENKRLRNPSFADETFNSTRLFNDTSFDETIPEAIVQERRPNTRKTLSGDLLMKD
                     DEASDKLTSNPLKETESSLKKLQLENYNLRIKCTSLLKFLNNISDDGKIMKNLEILDE
                     LHDLKFRHQQLTQEYRELQKKYDALEDQNENREHQENDEELIDLKETNKRLQEELNSS
                     KQELEDTLETLHQSKDKIASLEEKISRLNSERSEIENQHKMKVDLLQSKINEVTTSLN
                     LKERECDHLNEKVSTLVAQLQEFDHQSGSLLDLQSTMDSKNEAIRNLESQLQRNERQR
                     QSLEKEVNLLQDELNSLRETQNRIIEHKDKQIKQLTESVSSNDSERLRQINELSSERD
                     SLLEANRRLQFSENDLKESVKSLQSQLSSCQEELKNLQDKHRQKVDELLKSKAKYTSD
                     EMESLRQELLEMRKNNDLLKNENNSLSSRLDNLIRQSPSRKSVEVELLKKNNEIRALH
                     SSIKDLEQELGNATTTISNLKDNHRREIERIRREADVATKATITGTSPVNNVTMSDHE
                     ERAKLQNKISMLQMEYESIKDTKEKELAMWKRKYETIQRTNEELLQEKEGQNRYLSGA
                     LREKDKEISELQSRYNNILAERTSMLNDLSKVKHHKEDYKIQLKKTQSRLEYITKEFV
                     KLKETSKTAPISDESKELLNSKWFTKYQTMKGKFLDELKSLQDENLELQKTLLKQKND
                     SNTKASGNVGSYDNASSTGTLQDEIDYYRLKYTIAIKKQNDLRVMNEYLNKVLKASSQ
                     HVKLDILKLENEVPNYNPYADISFYNLPIPRTRKRRLRFKTVALLVLSCVRMKSAMNA
                     VTWDKQRLEYLKRKIIMSQDRISW"
     gene            complement(<943942..>945141)
                     /locus_tag="KLMA_20453"
                     /db_xref="GeneID:34714921"
     mRNA            complement(<943942..>945141)
                     /locus_tag="KLMA_20453"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818072.1"
                     /db_xref="GeneID:34714921"
     CDS             complement(943942..945141)
                     /locus_tag="KLMA_20453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674776.1"
                     /db_xref="GeneID:34714921"
                     /translation="MVDLFDPLDFISTDHNRRPSHDILDDAQQIQEHLNHEANTDATS
                     LKESDNDYDDIPIQPMDLPYIQYASSTVILTVLKLLQPEIQVNFKSTHLNPSDSWEKV
                     CKEKDITENMMQETLNYFLQWGNQHLQSYSQICSKIPSLLYSRSFDFEMLNYFTSIIS
                     KYDSHPDDEIVSQILQHASLRISERCGRTAQPSMTRVFLIDGLDTEIKLHEPALTSDN
                     LGLKTWGSSLVLSKKIINIPTAKRVLELGSGTGLVGITYALSHKNSTIFLTDLPEIVP
                     NLQKNIELNKLNDVHGKVLDWTDPSSFTQEFGTEPFDVILIADPIYSPQHPTWVVNMI
                     DKFLSECGKAYLEIPIRPKYEAERLLLWRLLEERNLAVVKEIHDEGKDDWGNVEYLYK
                     EIIRVTK"
     gene            complement(<945382..>946578)
                     /gene="TRP4"
                     /locus_tag="KLMA_20454"
                     /db_xref="GeneID:34714922"
     mRNA            complement(<945382..>946578)
                     /gene="TRP4"
                     /locus_tag="KLMA_20454"
                     /product="anthranilate phosphoribosyltransferase"
                     /transcript_id="XM_022818073.1"
                     /db_xref="GeneID:34714922"
     CDS             complement(945382..946578)
                     /gene="TRP4"
                     /locus_tag="KLMA_20454"
                     /codon_start=1
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="XP_022674777.1"
                     /db_xref="GeneID:34714922"
                     /translation="MLFPQINLWAKDDSCIQTTQHPLSNQAVNQPMKLADCTKKLLQQ
                     PPVLTPGELHDAIVYTIEALSKDSSENTMVPIACFFTALRATGLDHKAEYIASAASAV
                     LQFSSVVDSSQLLKASTNDEISIIDIVGTGGDGQNTFNVSTSSAIVASGIPGIKVCKH
                     GGKASTSNSGAGDLINVLGCDSSKVTASTLPQIWNDNSFTFLLAPYFHDGMKHVALLR
                     KLMGIPTIFNVLGPLLHPVSHVQKRVLGVFSKQLAPEYAKAAKIIYPSSETFVVFGEV
                     GLDEVSPIGDTLVWHVKPSEEEIEVFRVNPSDFGLQEHPLSECPSLGPHKNADILYQQ
                     ILAGKFKKGDNSIYDYILLNTALLYCLSSGTKDWKSGVQAAEQSIHSGAAKRSLDHFV
                     QSVAAL"
     gene            <947020..>948102
                     /locus_tag="KLMA_20455"
                     /db_xref="GeneID:34714923"
     mRNA            <947020..>948102
                     /locus_tag="KLMA_20455"
                     /product="NASP-related protein sim3"
                     /transcript_id="XM_022818075.1"
                     /db_xref="GeneID:34714923"
     CDS             947020..948102
                     /locus_tag="KLMA_20455"
                     /codon_start=1
                     /product="NASP-related protein sim3"
                     /protein_id="XP_022674778.1"
                     /db_xref="GeneID:34714923"
                     /translation="MTDKIQELLTEGSKQYASENFELAVDAYAEVNELHDAENDSPNP
                     DYLFLYGKALYQLALSKSDVFGMGSGVTKQGNLEEEAEEGSSGPGLVMLGEEEEEEEE
                     AEEEEEEEEEEEEEEEEEEEEEAEEGKEVEQKAQGEEEGEDEEEQHDHANCQGHCHGE
                     EKDDFENAWEILELARSFYEINLNNNPDDDTKLKLADCYDLLGEVSLENENFQQASQD
                     FEQCLKLRKELHESKDPTDRSIIESHYKISLAYEFDPENFEKCKANLVKCIELLKKRC
                     ETVDKENDDQKDLLKELQAKLKDLEDSEAQMQTLKNDLLSTIHSVTASSSSKDAPVND
                     LTSKIVKKRKANSDKSDADRNKQAKK"
     gene            complement(<948722..>950383)
                     /locus_tag="KLMA_20456"
                     /db_xref="GeneID:34714924"
     mRNA            complement(<948722..>950383)
                     /locus_tag="KLMA_20456"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818076.1"
                     /db_xref="GeneID:34714924"
     CDS             complement(948722..950383)
                     /locus_tag="KLMA_20456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674779.1"
                     /db_xref="GeneID:34714924"
                     /translation="MWKDSKTRSGKKENTANISSVLQEEDKNLESKSDIETKSTVGSS
                     STENNNKDSNMLNSKTNQKKDTQTVPTGSPTVAKTIKGLWSAEEDRMLLSLIEVYGAS
                     RWVEISHQLKTRTAKQCRERYHQNLRPNLNKTPISREEGEAIKSLVTKHGFRWTLIAK
                     LLNTNRSDNSIKNWWKTNVKKRQRNVFRDSNPSRGMMKEAEMMAGPDVNQNHRSHHNR
                     NQQNPHPNDLYSSSDSLSPRSDSSYISDSTITHRNHPQHLDHYENNRHILHSHSSSTQ
                     LLPMGSSFITPVPKTYQQQYQGHNYQTNGISLQPYVSSYAPYSTGSRVPINMYPTLMS
                     VPNTHIIRADTKGNSVSVNSNENIDPQNADSQRQKQQHSQDNPAYNEITPMNSYMGSI
                     LQHNTMQPPPSHGIIAGTGSLPIRQEEAVPSQHLIIQPLNIPTQQNPVAIHQRNTSGA
                     QNQLGTVALLSPYRNTSSDNNATYIPQASQLPPLSTKSPEGTPLTRPKVYDNNENPNS
                     TPQGNNIETSIKNSSSNKLPSFEELTQKMKLNNQKYMVSGDKSNQ"
     gene            <955924..>956748
                     /gene="POM33"
                     /locus_tag="KLMA_20457"
                     /db_xref="GeneID:34714925"
     mRNA            <955924..>956748
                     /gene="POM33"
                     /locus_tag="KLMA_20457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818077.1"
                     /db_xref="GeneID:34714925"
     CDS             955924..956748
                     /gene="POM33"
                     /locus_tag="KLMA_20457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674780.1"
                     /db_xref="GeneID:34714925"
                     /translation="MSSNVGSSTPTSRFLALAKTTKFTWFLGHFLVVLSSTFYWLSFR
                     VTSLTEVWYRLIFVGALESFGVLVYQSYGKYFKKKTEATKSEKQADDAIQLRLLFRDE
                     NVLYLLLSTTWLVLSPRIAVATVPFFIISLFHVLTYTVNDFASNVLLVNDVKSHPYLK
                     FIDSLVTQNHENSLNAICNSEILCLFYNILRLLTFRSRSLITLAAIFLFVGFKCQCSA
                     HMKRAVAKLEVRLDGLIAHPSVPPTVKSRYTSIKLFIRRYFVTATSTAPVQEKKST"
     gene            complement(<957608..>958300)
                     /locus_tag="KLMA_20458"
                     /db_xref="GeneID:34714926"
     mRNA            complement(<957608..>958300)
                     /locus_tag="KLMA_20458"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818078.1"
                     /db_xref="GeneID:34714926"
     CDS             complement(957608..958300)
                     /locus_tag="KLMA_20458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674781.1"
                     /db_xref="GeneID:34714926"
                     /translation="MSVTSGSLNFEDTVFDGQQRNIESTTTQVKDQNVLFTFVLLVQT
                     VSNGSGGWFVDDSQNVQTSNGTSILGCLSLGIVEVSWNGNNGIVDLATQVGFSSFLHL
                     GQDHRRDFFWSEDLGFTLVFDLDLWLTRNLDNLEWEVLDITLDFRVREVSTDQTLSVE
                     NGVSWVHSSLVLSSITNQSFGVSEGNERWSGSVTLVVGQNFNTIVRKVGNTGVGGTQI
                     NTNSLRHICLIY"
     gene            <957626..>959548
                     /gene="SSA2"
                     /locus_tag="KLMA_20459"
                     /db_xref="GeneID:34714927"
     mRNA            <957626..>959548
                     /gene="SSA2"
                     /locus_tag="KLMA_20459"
                     /product="heat shock protein SSA2"
                     /transcript_id="XM_022818079.1"
                     /db_xref="GeneID:34714927"
     CDS             957626..959548
                     /gene="SSA2"
                     /locus_tag="KLMA_20459"
                     /codon_start=1
                     /product="heat shock protein SSA2"
                     /protein_id="XP_022674782.1"
                     /db_xref="GeneID:34714927"
                     /translation="MSKAVGIDLGTTYSCVAHFSNDRVEILANDQGNRTTPSFVAFTD
                     TERLIGDAAKNQAAMNPANTVFDAKRLIGRNFSDPEVQGDIKHFPFKVVEVSGKPQIQ
                     VEYKGETKVFTPEEISSMILTKMKETAESYLGCKVNDAVVTVPAYFNDSQRQATKDAG
                     TIAGLNVLRIINEPTAAAIAYGLDKKDEGEKNVLIFDLGGGTFDVSLLTIEDGIFEVK
                     ATAGDTHLGGEDFDNRLVNHFVQEFKRKNKKDLTTNQRALRRLRTACERAKRTLSSSA
                     QTSIEIDSLFEGIDLYTSITRARFEELCGDLFRSTLDPVEKVLRDAKLDKSQVHEIVL
                     VGGSTRIPKVQKLVSDYFNGKEPNRSINPDEAVAYGAAVQAAVLTGDQSSKTQDLLLL
                     DVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVYEGERARTKD
                     NNLLGKFDLTGIPPAPRGVPQIEVTFDVDANGILNVSAVEKGTGKSEKITITNDKGRL
                     SKEDIERMVSEAEKYKEEDEKESARIAARNQLESTSYSLKNTLSEAADKIEEADKQTL
                     TAKCDEVIAWLDANTQATTEEFESQLKELQEVANPIMTKMYQAGGAPEGAAPGGFPGG
                     APPAPEAEGPTVEEVD"
     gene            960136..960252
                     /locus_tag="KLMA_R214"
                     /db_xref="GeneID:34718660"
     tRNA            join(960136..960170,960207..960252)
                     /locus_tag="KLMA_R214"
                     /product="tRNA-Val"
                     /db_xref="GeneID:34718660"
     gene            <960553..>961488
                     /locus_tag="KLMA_20460"
                     /db_xref="GeneID:34714928"
     mRNA            <960553..>961488
                     /locus_tag="KLMA_20460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818080.1"
                     /db_xref="GeneID:34714928"
     CDS             960553..961488
                     /locus_tag="KLMA_20460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674783.1"
                     /db_xref="GeneID:34714928"
                     /translation="MDLKALAKKESSIAFVAGGIAGAVSRTVVSPFERVKILLQVQSS
                     TSAYNGGIFNAVGQVYKEEGVKGLFRGNGLNCIRIFPYSAVQFVVYEWCKKHIFHVDG
                     FFGKEQLQNWQRLVAGGLCGGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKP
                     PGVWELLVKTFKEEGGIKGLYRGVYPTSLGVVPYVAVNFAVYEQLKEFMPTTDANLAH
                     LYKLTMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFQYKSVTDALVTIGKTEGL
                     KGYYKGLTANLFKVIPSTAVSWVVYEFCRDAMNAW"
     gene            <962280..>962498
                     /locus_tag="KLMA_20461"
                     /db_xref="GeneID:34714929"
     mRNA            <962280..>962498
                     /locus_tag="KLMA_20461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818081.1"
                     /db_xref="GeneID:34714929"
     CDS             962280..962498
                     /locus_tag="KLMA_20461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674784.1"
                     /db_xref="GeneID:34714929"
                     /translation="MRATQFVLNQAKKKSGISVPVELTPLFIAMGVALASGSWFTYKK
                     LFYDDSLRVGRKNPEQSALQQILEEKTE"
     gene            complement(<962891..>964747)
                     /gene="uapC"
                     /locus_tag="KLMA_20462"
                     /db_xref="GeneID:34714930"
     mRNA            complement(<962891..>964747)
                     /gene="uapC"
                     /locus_tag="KLMA_20462"
                     /product="purine permease"
                     /transcript_id="XM_022818082.1"
                     /db_xref="GeneID:34714930"
     CDS             complement(962891..964747)
                     /gene="uapC"
                     /locus_tag="KLMA_20462"
                     /codon_start=1
                     /product="purine permease"
                     /protein_id="XP_022674785.1"
                     /db_xref="GeneID:34714930"
                     /translation="MDQALQEAVEQENVPRESWKDTVQSIRKKWTTKEGLLGDYNYAF
                     LFTPSYPFQDYIARKRGLEPVHRDQPFFSLNSDIPVVLGFILGLQHSLSMLAGVITPP
                     ILIAGVAKMDTKIQEYLVSVSLIVSGIMSAVQITRFHIPYTPYYIGSGVISVVGTSFA
                     TITLVNNVFPMMYNTGYCPVAADGTQLPCPDGYGALLGTSCVCALLEILIAFTPSSLL
                     QKMFPKIVTGPVIVCIALSLIESGFQDWVGGSGCVDAICPSKGAPMAGEWGSARFIGL
                     GFLVYTTIIIFEKYGAPIMRSCAVILGLLVGCIVAAACGYFDKTSIDAAPAGTFMWVH
                     TFKLSVYGPAVLPMLVVYIVLATECIGDVTATCEVSRLEVEGAQYESRIQGAVLSDGL
                     SGLLSGLCTITPMSTFAQNNGVISITKCASRQVGYWCCFFMIIMGIFAKFGAALVAIP
                     KPVLGGMTTFLFTSVAVAGIKIISTTPFTRRDRFVLTCSLLPGIGATLVPTWFSKFFT
                     YSGSNNTLQGFLNAIELIMESGFAVCAIVGIVLNQFLPQELDEELMDDVELQQENLSV
                     FDERNDPEMISHILSSKAKEAEASESQNPQSYELKDSIRVTEEASSSDTERR"
     gene            complement(<965721..>966527)
                     /gene="HAH1"
                     /locus_tag="KLMA_20463"
                     /db_xref="GeneID:34714931"
     mRNA            complement(<965721..>966527)
                     /gene="HAH1"
                     /locus_tag="KLMA_20463"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818083.1"
                     /db_xref="GeneID:34714931"
     CDS             complement(965721..966527)
                     /gene="HAH1"
                     /locus_tag="KLMA_20463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674786.1"
                     /db_xref="GeneID:34714931"
                     /translation="MLGTRNGLQCARRCFHLTRFTGAGHSKWANIKHTKAKNDAERTK
                     IYNKMANQITVAVKLGGSADPAMNIRLATAIELANKNNVTKKVIENAIKKGAGTSDGV
                     GAGAEPCTYEGIGPGGVAFVVEALTDNKNRTVGLVRSTFNKFNGNMAPTLYLFERKGY
                     VVIEPSENQPTDFDSIMDIVLEIDGVEDLEQNDALFEVLTEPQQTNKVAETLRSHGFH
                     IREMGVEYVPNEDTAMPPVTEEELQTKLDKFVNQLEEIDEVTQIYTNIKQ"
     gene            <967113..>967469
                     /gene="VMA7"
                     /locus_tag="KLMA_20464"
                     /db_xref="GeneID:34714932"
     mRNA            <967113..>967469
                     /gene="VMA7"
                     /locus_tag="KLMA_20464"
                     /product="v-type proton ATPase subunit F"
                     /transcript_id="XM_022818084.1"
                     /db_xref="GeneID:34714932"
     CDS             967113..967469
                     /gene="VMA7"
                     /locus_tag="KLMA_20464"
                     /codon_start=1
                     /product="v-type proton ATPase subunit F"
                     /protein_id="XP_022674787.1"
                     /db_xref="GeneID:34714932"
                     /translation="MADERNLIAVIADEDTTTGLLLAGIGQVSKDTKEKNFVVYNEGK
                     TTKPELSDAFINFTEKRSDIAILLINQHVADQIRPLVDGFTNAFPAILEIPSKDHPYD
                     PEKDSVLRRVRRLFGE"
     gene            complement(<967648..>969378)
                     /gene="CHS5"
                     /locus_tag="KLMA_20465"
                     /db_xref="GeneID:34714933"
     mRNA            complement(<967648..>969378)
                     /gene="CHS5"
                     /locus_tag="KLMA_20465"
                     /product="chitin biosynthesis protein CHS5"
                     /transcript_id="XM_022818086.1"
                     /db_xref="GeneID:34714933"
     CDS             complement(967648..969378)
                     /gene="CHS5"
                     /locus_tag="KLMA_20465"
                     /codon_start=1
                     /product="chitin biosynthesis protein CHS5"
                     /protein_id="XP_022674788.1"
                     /db_xref="GeneID:34714933"
                     /translation="MVEVSLTVGKVDASLAILTTSDHYVIEFPTVLLPENVEAGSVVK
                     ISVEQDLEQEKEQKRKFESVQEQILSKYGSDPPSEPVLHLLNATQTSCVINWDPIHLG
                     SSQLKSLILYKQGNRHLVLTQDAWGKQQENGHGANPWELENDQHNTLKVSGLSVDVEY
                     EFQLLLNTTSGKFWSNVLKVHTHKMTDMSGITVCVGPNTVLDGTATREQIKRSLSKIG
                     ANPLQDHVTLETTHFVAVELQDNDEELARARNNNIPIVRPEWVKACELEKRIVGVRDF
                     YLDSAPDTFSQYKFTDESAETEPALETVREESVEQPVEEPVEESVKEPVEEPVEAKEG
                     TVEVPIDAPAEPTTDTTESNDVQESEIPVEEPEKTEQPAEQFDEVPIENTSEPAEQLD
                     EVPIEQPEDVSEATPVEKISEETPADEAPKETPVEEAPKETPIEEAPKETPVEEAPKE
                     TPIEEAPKETPVVEAPKETPIEETPNETPVEEAPEETAAEEAPEETPAEKAPEETAAE
                     EAPEETAAEEAPNTNPAEVESGEESEVQVDNTEETSPEAVETENKPSSAPASSSSSKK
                     KNKKKKKGKK"
     gene            <971090..>972997
                     /gene="SDH1"
                     /locus_tag="KLMA_20466"
                     /db_xref="GeneID:34714934"
     mRNA            <971090..>972997
                     /gene="SDH1"
                     /locus_tag="KLMA_20466"
                     /product="succinate dehydrogenase [ubiquinone]
                     flavoprotein subunit"
                     /transcript_id="XM_022818087.1"
                     /db_xref="GeneID:34714934"
     CDS             971090..972997
                     /gene="SDH1"
                     /locus_tag="KLMA_20466"
                     /codon_start=1
                     /product="succinate dehydrogenase [ubiquinone]
                     flavoprotein subunit"
                     /protein_id="XP_022674789.1"
                     /db_xref="GeneID:34714934"
                     /translation="MQLCRRNAARTFSNSVVLRHAYAAKDDVDGQQQESAQSGQYNIV
                     DHEYDCVVVGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNMHK
                     DDWKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHFGVPFSRTEEGRIYQRAFG
                     GQSKEYGKGGQAYRTCAVADRTGHALLHTLYGQALRHNTHFFIEFFAMDLLTHNGEVV
                     GVMAYNQEDGTIHRFRAHKTIIATGGYGRAYFSCTSAHTCTGDGYAMVSRAGFPLQDL
                     EFIQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAIT
                     MEIREGRGVGKEKDHMFLQLNHLPPSVLHERLPGISETAAIFAGVDVTKEPIPILPTV
                     HYNMGGIPTKWNGEALTIDEETGEDKPIPGLLACGEAACVSVHGANRLGANSLLDLVV
                     FGRAVAHTIADTLQPGLPHKPLPADLGKESIANLDKLRNATGSKPTAEIRLAMQKTMQ
                     KDVSVFRTQESLDEGVKNITAVDKTFADVKTTDRSMIWNSDLVETLELQNLLTCATQT
                     AKSAAERKESRGAHAREDYPERDDVNWMKHTLSWQRDSGDEVTLKYRNVIATTLDEKE
                     CPPVPPTIRAY"
     gene            <973803..>974957
                     /gene="DBR1"
                     /locus_tag="KLMA_20467"
                     /db_xref="GeneID:34714935"
     mRNA            <973803..>974957
                     /gene="DBR1"
                     /locus_tag="KLMA_20467"
                     /product="lariat debranching enzyme"
                     /transcript_id="XM_022818088.1"
                     /db_xref="GeneID:34714935"
     CDS             973803..974957
                     /gene="DBR1"
                     /locus_tag="KLMA_20467"
                     /codon_start=1
                     /product="lariat debranching enzyme"
                     /protein_id="XP_022674790.1"
                     /db_xref="GeneID:34714935"
                     /translation="MKKIHIAIQGCAHGQLRRIYESVNSLKNKPDILLILGDFQSLLT
                     KYDFKTCAIPPKYAKLGDFHLYYTGQLKAPVLTVFIGGNHENMGQLTKLPYGGYVAEN
                     IYYMGACNVINFMGIKLGGISGIYNEYDHLHERTEWDQIDWNREKRNTYHVRDSELVP
                     LAMMKSPISLIMSHDWPTEIAKYGDLKKLLKQKPYFKDEINDNTLGSPLNFYLLKKLR
                     PEWWVSAHLHVFFTAEYKHDRKLNEDEIDLDLDLDMNVSTNKDGGKVADDDQNQCTET
                     KFMALDKCKGADTTKHLTQISLEYDENHPTCKDRALYWDPEFLANLKYCTSIKDSLLG
                     KKLENIDVESLQSNIKTPTINDWDQYKIPIPKSFRSMVKQTDYIKETHLQ"
     gene            complement(<975136..>976023)
                     /gene="MCR1"
                     /locus_tag="KLMA_20468"
                     /db_xref="GeneID:34714936"
     mRNA            complement(<975136..>976023)
                     /gene="MCR1"
                     /locus_tag="KLMA_20468"
                     /product="NADH-cytochrome b5 reductase 2"
                     /transcript_id="XM_022818089.1"
                     /db_xref="GeneID:34714936"
     CDS             complement(975136..976023)
                     /gene="MCR1"
                     /locus_tag="KLMA_20468"
                     /codon_start=1
                     /product="NADH-cytochrome b5 reductase 2"
                     /protein_id="XP_022674791.1"
                     /db_xref="GeneID:34714936"
                     /translation="MFARVTKSNKFLPIAFGIGAAAIASAAFYNKSVLMNESSKAFVG
                     DNQWIDLKLSKIETLSHDTKRFTFALPQKDQVSGLITASCVLAKFVTPKGSNVIRPYT
                     PVSDINDKGEIEFVIKHYEGGKMTSHLFSLKENDTVSFKGPIVKWEWKPNSFDSITLL
                     GAGTGITPLYQLVHHIATNPADKTKVHLYYGNKTPSDILLKTELDNLQKKYPDQVKVT
                     YFVDKSEGKFEGETGFITKDFLSHNAPKPSEKNQVFVCGPPPFMNAYSGPKVSPTDQG
                     ELTGILAELGYSKSNVFKF"
     gene            <976762..>977760
                     /locus_tag="KLMA_20469"
                     /db_xref="GeneID:34714937"
     mRNA            <976762..>977760
                     /locus_tag="KLMA_20469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818090.1"
                     /db_xref="GeneID:34714937"
     CDS             976762..977760
                     /locus_tag="KLMA_20469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674792.1"
                     /db_xref="GeneID:34714937"
                     /translation="MNGLKAHQRELINLSRRCIPLLKPELYKGQCGKICVVGGCEEYT
                     GAPYFSAHAASTFGSDLVYVLCERKAGLPIKAYSPNLMVHPYLVDSYSATREPKEEPD
                     FEKILGVVQRCHVLVIGPGLGRDKKIREQVIQIVQEAASIGGDHNRCLILDADALFVL
                     STEDSEKFQEALKKYGENRVIITPNAVELKRIMKALNVDTVEEVSKRLGCITVAKGHH
                     DIIINSKGKRWENDVEGSMKRCGGQGDTLTGVIASMLGFSRAVHDWKLQPLSVPGKES
                     VLPWDQMAMLSCYVGSTATKMASKAAYEKVGRQMQTTDMNYIVGEIFEKLYDTEGE"
     gene            complement(<977911..>978849)
                     /gene="RPC34"
                     /locus_tag="KLMA_20470"
                     /db_xref="GeneID:34714938"
     mRNA            complement(<977911..>978849)
                     /gene="RPC34"
                     /locus_tag="KLMA_20470"
                     /product="DNA-directed RNA polymerase III subunit RPC6"
                     /transcript_id="XM_022818091.1"
                     /db_xref="GeneID:34714938"
     CDS             complement(977911..978849)
                     /gene="RPC34"
                     /locus_tag="KLMA_20470"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC6"
                     /protein_id="XP_022674793.1"
                     /db_xref="GeneID:34714938"
                     /translation="MNSLFSSTIKLSDPAKELHEKMCAQEAGRLFSQQELTAILDNCT
                     LSVLMQYVQELLDKNLLKLVKQNKELKFQAVDAAEAEKKSGMSSDEALVYSYIEASGR
                     EGIWTKTIKAKTNLHQHVVLKCLKSLESQRYVKSVKSVKYPTRKIYMLYNLQPSIEVT
                     GGPWFTDSELDVEFINSLLTIVWRFTAERTYPNGFNNFSNEQGKEVLYASNVKSYTTI
                     EEILEFISESGISTEQLTKPDIRSLCEVLVYDDKLEKVALDCFRVTLPSVLQMTQPVG
                     GQQTSKKEEYSIFNYNNAIAASSTDKDVLYFDEWTL"
     gene            complement(<979225..>982293)
                     /gene="ADP1"
                     /locus_tag="KLMA_20471"
                     /db_xref="GeneID:34714939"
     mRNA            complement(<979225..>982293)
                     /gene="ADP1"
                     /locus_tag="KLMA_20471"
                     /product="probable ATP-dependent permease"
                     /transcript_id="XM_022818092.1"
                     /db_xref="GeneID:34714939"
     CDS             complement(979225..982293)
                     /gene="ADP1"
                     /locus_tag="KLMA_20471"
                     /codon_start=1
                     /product="probable ATP-dependent permease"
                     /protein_id="XP_022674794.1"
                     /db_xref="GeneID:34714939"
                     /translation="MMLRISMSALLVYMWLTLAANAKLMNNEGVFDQVSVPPRNRRPP
                     SDDQCPPCFNCMLPIFECKQFSECNSFNGRCECIDGFGGDDCSVPLCGALSSGNSKRP
                     LRSNETNTCECESGWGGINCNICEEDYVCDAFMPSGLKGTCNKNGMIAKSLHQGCDVT
                     NPKILEILKGSKPQVTFACNKTSELCNFQFWIDQVESFYCGLDTCSFEYDLQQNTTHY
                     KCDNVKCKCVPGQMLCGKKGSIDISDFLTETIKGPGDFSCDLESKKCQFSEPSMNDLI
                     LTVFGDPYITLKCESGECLHYSEIPGYKTPDKSKLSTGSILVLVLSSAGVLVAISISV
                     YFISKSPIFANSPIMLPDDSSDDDFDLYKTNSTATLTFENITYKVFPTKNTSTTILNE
                     VTGSVKPGEMLAIMGGSGAGKTTLLDILAKKNKTGKVTGSIKVNGTEIDKEEYSKIIG
                     FVDQDDYLLPTLTVYETVLNSALLRLPRQLSFKAKQKRVYDVLEQLRIYDIKDRVIGS
                     EYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVIECLVRLANHYNKT
                     LVVSIHQPRSSIFQLFDKLVLLSDGEMVYSGEAYKVSEFLKNEGYVCPQDYNIADYLI
                     DVTFEPSKFITKATIDDVNATIPSTEAQNPIHRVEHARRSLTGTATQTEWEHLAIHRD
                     EFRGLLAQSENEEQTIGEVNSQLLHSLFKDGQYFQKLKFEINELSSSGTEEELRIPHA
                     YKAATFMQQVSILSSRTFKNVYRNPKLLLGNYMLTIFLGFFLGTLYYDVDNDISGFQN
                     RLGLFFFILTYFGFLTFTGLSSFALERLIFIKERSNHYYSPLAYYMAKVISDILPLRV
                     VPPILLGLIIYPLVGLNMANNGFGRFTLILVLFNLAVSLEILTVGIIFEDLNNSIIVS
                     VLIILASLLFSGLFINTKDIENYFFKYLKNLSVFYYAYESLIINEVKSLMLREKKYGL
                     NIEIPGATILSTFGFIVQNFVFDIEILVLFNVLFLVLGYLALQLIVVEQK"
     gene            complement(<982761..>983771)
                     /locus_tag="KLMA_20472"
                     /db_xref="GeneID:34714940"
     mRNA            complement(<982761..>983771)
                     /locus_tag="KLMA_20472"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818093.1"
                     /db_xref="GeneID:34714940"
     CDS             complement(982761..983771)
                     /locus_tag="KLMA_20472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674795.1"
                     /db_xref="GeneID:34714940"
                     /translation="MKLFYIFAIVLWYVRCSRCGSLFASYYESTLHSQMSLNETHTGS
                     LLAPFNRTRTPGSLGSSQVRDFVINEFKSMTQNWVIELHEFEENGYNFTNMVFSLGAN
                     DSNYLALAAHYDSKLSPEGFIGGIDSAAPCGMLLYVSHFLDHVLTNDMQSIDTLLLDK
                     FTGVKFIFFDGEEAINEWTATDSLYGSRYAAKKWAQEGTLKKMDMLVLLDLLGGEEDI
                     TIPNYKANSRVFFKNLLQIEKAYNKEHNLTHRMLRDTSRVRVHISDDQEPFLDHGITT
                     LHLIPYPFPSTWHTINDNFSNLNEKNIHKWCVLMCEFVFKYWKPDNIPLRPHKPYVKP
                     LN"
     gene            <984051..>990221
                     /gene="FAB1"
                     /locus_tag="KLMA_20473"
                     /db_xref="GeneID:34714941"
     mRNA            <984051..>990221
                     /gene="FAB1"
                     /locus_tag="KLMA_20473"
                     /product="1-phosphatidylinositol-3-phosphate 5-kinase
                     FAB1"
                     /transcript_id="XM_022818094.1"
                     /db_xref="GeneID:34714941"
     CDS             984051..990221
                     /gene="FAB1"
                     /locus_tag="KLMA_20473"
                     /codon_start=1
                     /product="1-phosphatidylinositol-3-phosphate 5-kinase
                     FAB1"
                     /protein_id="XP_022674796.1"
                     /db_xref="GeneID:34714941"
                     /translation="MSQVNREVGPVADLGDGDGSNSHLNIIDNNGISNGTSGTNKMEM
                     PEFMTQKPLISRTTTDVDTNPVISDMQVPTPLDIAISNDEHESMTDELSGDDIISTIP
                     AVSEQLSNTRSNDISSSALKLGSFPSNDLVGGTQPITKSDSDNPSLGRGERPASLHFS
                     IGNSARTKRSSIYESKSTVTAIPIRTPSKSNRNGLNQTHPHSYSDRDDAVSLKSVSSS
                     LTASFSRNFLFGFYDKKQNGKAKVKNILSKEYWMKDESAKECFNCAKPFTTFRRKHHC
                     RICGQIFCSNCSFLISGENFGYSGRMRICEKCYEHSVNYEDSSEEESEEEMSHDQGST
                     RNLEEDAFSLNNDDIQSIITHADDHKVHLTTPEPLPRMAIPATKQGESLEISFHDKSN
                     NYGYRKNRPRRGTQDRYTLHDLDMLSPIPQEYIDSKNSPDKAIMGNKSSQLGHIRQSF
                     SNYLGQKNANILRQDTPNKLNVMKTLANNNFKFEFNYDMNNFQSYLNKERQPPILHDS
                     RQMPLISNHNSSPNFQTGVLSSDEGSEDEASMSLYTALNDTHKHDKNRTRTTRNSTNS
                     TQRAQASLQRMRQRRKSKSRSGVFTNNGRGEFSFLNLSAPNLVTVVNNDAIFSKNHNP
                     QSKQKFESSLKDLRKSSANMSSWRRVSLEKREELNDACKLHINTLLRQALDDQEIQNK
                     EDWTAIFEKMISLIQGIPLDARKSGDLDFKQQHVKIKRLPGGKVLDSMLLNGVLYSKG
                     LPLKTMPRTVLNPRILLIMFPLEYQKHNNHVISIESVVAQEKEYTKKLVLRLLSLNPD
                     IILIGTTASGYALQLFQEAGIVVQCDVKPQVIERISRFTNCDIVITMDKLSNNVRLGT
                     CEKFEVRTYIYGNLSKNYTFITGCKTNDGITLVLRGDTSEALRKVKDVAEFMAYAVFS
                     MKLESSFFNDNFLQPNIEAYKNVQLLKKKSTNTVGYCADFIKKFHQRVLSVSPIVEFP
                     VPYLLEKARNVEKLLINKRELVMKLPSNSDILTFKDSVDLSKMQLETALTQRDLKYLI
                     KFIHTKECDELLLLFERLKKQWEIYSSLSRNMLGTGSHQSISVLYSVISKKTTTPCIG
                     PEIVTIDFFWENDLSIGQFIENVAATALRPCVDGCGGLMMDHYRSYAHGNGKVDVIIE
                     SLQSKLPMLKNLIFTWSYCKKCGLSSPTLQLSEKSWSYSLGKYLELMFWSSPKNINSI
                     GNCDHDVAKDHLKYFSLNDIIVRMEYSEIDVHQLITPSTTITWNPNKDIKLKVELYYQ
                     ILEKIDAFYGSVLERLNKLKIDSITDIKLNAAKERIDELKKNVEEEKSVLLSNIENVY
                     TGTEGDQHLKLNSVIRALHDNAAGWDTEFVEFEKEYLPTEKDIARITALQLKKMFTDF
                     NKISEENVNREHAEEVETNEKKPETDDTPVKEGKPEEEPTNIQKRPVLTQNATMPVIN
                     KSSHTFGDPVGQHVTPRRQSVGSSFADTSNLRKMSINSNNSNYTQYSKDRNSDTKVGQ
                     LANFFDQIHFDAVTKEFELQREMERLNMNKTKYQAMRAKSLKPIVEVYKNVQAAVQEP
                     INVEKGAKSQYWNSKTENTKGGSDKARLLNKGLENELEQSIHQWSERILKNQNNEQNN
                     DLTTKPSNEPLPPVTTITNANKDGTKLQTEHVVIPSQKSSLLTALSNFWADRSASFWK
                     PLAYPTSPTEHIFMDNDVIIREDEPSSLIAFCLSSNDYQKKVNSMIRNIRQPPGSFDS
                     SEEKTDSNTSKTEVATSNTGDFDDIPIKASNTDLEMIMTKKTGMHLRYQFQDGYTVMS
                     CKMFFFEQFDAFRKKCGCGEENFIQSLSRCIKWDSSGGKSGSAFLKTLDNRFVIKELS
                     HSELDAFINFSSSYFEYMSQALFHDLPTALAKILGFYQIQIKNSTTGKSFKMDVIIME
                     NLFYETKTSRIFDLKGSMRNRHVEQTGKENEVLLDENMVEYIYESPIFVREYDKKLLR
                     ASLWNDTLFLAKMNVMDYSLVVGVDNESHSLTVGIIDCIRTFTWDKKLESWVKEKGLV
                     GGSTKEPTVVTPRQYKNRFREAMERYILMVPDPWYQDTDT"
     gene            complement(990364..990461)
                     /locus_tag="KLMA_R215"
                     /db_xref="GeneID:34718661"
     tRNA            complement(join(990364..990415,990429..990461))
                     /locus_tag="KLMA_R215"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:34718661"
     gene            <991161..>992702
                     /gene="ATG18"
                     /locus_tag="KLMA_20474"
                     /db_xref="GeneID:34714942"
     mRNA            <991161..>992702
                     /gene="ATG18"
                     /locus_tag="KLMA_20474"
                     /product="autophagy-related protein 18"
                     /transcript_id="XM_022818095.1"
                     /db_xref="GeneID:34714942"
     CDS             991161..992702
                     /gene="ATG18"
                     /locus_tag="KLMA_20474"
                     /codon_start=1
                     /product="autophagy-related protein 18"
                     /protein_id="XP_022674797.1"
                     /db_xref="GeneID:34714942"
                     /translation="MSDLPIINFINFNQNGTCISIGTSQGFKIFNCEPFGRFYQDDEG
                     GCGIVEMLFSTSLLAVVGMGENPAMSPRRLRMLNTKRHSVICEVTFPTTILSIKMNKT
                     RLAVLLQEQIYIYDISNMRLLHTIETSMNAQGLMSMSPNSENNYLVYPSPPKVINSEI
                     KDHATTNNINIKKSDAAEDPLRKDHFAYDPSDHSHPQSTTESTSNNHNRTYSSGNNNN
                     TNSNPNKIIKNGDVIVFNLQTLQPTMVIEAHKGEIAALKLSADGTLLATASEKGTIIR
                     VFNVENGSKVYQFRRGTYSTKISSLSFSKDNQFLAVCSSSKTVHIFKLGEKIIDNTKP
                     NELNSDDDMDDDLLPQFENGDDEEEVDEETLDEEATSLNSSHSNKEPIVDSSRSTVGR
                     MIRKSSQRLSRKAAKTLGAYFPIKVSSILEPSRHFASLKISTTTNQPIKAIAAIDDPI
                     SLNTNEYPDLFDTSNQADHQNTDGLKMIPVRVLSSEGYMYKYILDPERGGDCILLEQY
                     SLLSE"
     gene            <994042..>996372
                     /gene="ROD1"
                     /locus_tag="KLMA_20475"
                     /db_xref="GeneID:34714943"
     mRNA            <994042..>996372
                     /gene="ROD1"
                     /locus_tag="KLMA_20475"
                     /product="protein ROD1"
                     /transcript_id="XM_022818097.1"
                     /db_xref="GeneID:34714943"
     CDS             994042..996372
                     /gene="ROD1"
                     /locus_tag="KLMA_20475"
                     /codon_start=1
                     /product="protein ROD1"
                     /protein_id="XP_022674798.1"
                     /db_xref="GeneID:34714943"
                     /translation="MGKPTKGISLFEIRLEGTDHDVIVVKGSANDAPSVLLSGNVVLS
                     VTEPIQAKKISLLLYGVIKMNVSTVVQSARGTATRTLKHDKRFYEFHFDDIDLSPYMV
                     DSSTVKKSLSRSSSSSSLGGLASFSRSTTSLKNFATGASHSLVLPEGNYVLPFSAILP
                     GSLTESVEGLPNASVFYKLRATLERGKFASDLSTKKHVRVVRTLTPDALELFETVAVD
                     NTWPKKVDYSISVPSKAIAIGSASSVNIMIVPLLKGLKLGPIKISLLEYISYSAPYNN
                     PNTAERTIMKMKIRDPLHNNANTTDSDFQDKWEVNTSVRVPPNLSKCTQDCVIMSNIK
                     VRHKLKFVIALINPDGHVSELRASLPVQLFISPFVTIAVQRPENIESSTNNSANNTDN
                     EAAEGDDFMFANTNSEVNLNAINMAPNDSNAPSTSLFAPPNYGNHVYDRLWNDISVDD
                     TALNSGTQSPIESTHTPLLSEPNEMRELQKSLQRVRIEREMEEADSIGLSFDPQVPSR
                     SALATPLSLHDIPSQLRVGDYFAAANHSSRSNLNLLNVPPYLRSPSQMDSPGFDFMSR
                     ANSFESRAGSPSRKDWEISSLSRVPSYDNAMKTSSVMGDLPPAYPDEDEQRDKNQSTV
                     GSLEKPRELHHRGHQPDGSQYTSSKLSSLLLSNHDSQSTNALNMYTNDVHEREMDDSQ
                     TGKLFSKPILTRSTSTSALKNTASKHFGFSMTPLSQLARAATPPASMINTSHHSSSSI
                     QIPKAASKGPKSNAPLRNGNSFASLSGILHKRESNE"
     gene            996612..996683
                     /locus_tag="KLMA_R216"
                     /db_xref="GeneID:34718662"
     tRNA            996612..996683
                     /locus_tag="KLMA_R216"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:34718662"
     gene            <997915..>999279
                     /gene="STP22"
                     /locus_tag="KLMA_20476"
                     /db_xref="GeneID:34714944"
     mRNA            <997915..>999279
                     /gene="STP22"
                     /locus_tag="KLMA_20476"
                     /product="suppressor protein STP22 of
                     temperature-sensitive alpha-factor receptor and arginine
                     permease"
                     /transcript_id="XM_022818098.1"
                     /db_xref="GeneID:34714944"
     CDS             997915..999279
                     /gene="STP22"
                     /locus_tag="KLMA_20476"
                     /codon_start=1
                     /product="suppressor protein STP22 of
                     temperature-sensitive alpha-factor receptor and arginine
                     permease"
                     /protein_id="XP_022674799.1"
                     /db_xref="GeneID:34714944"
                     /translation="MNNVPVPQQVLDWLFKVLQPTYKDPKSTFHDVVQVLAHFKLRPR
                     TRVFTFPDGSSALLLSLYGTLQGVPIVIWVPKTYPETIPYVYLDIDSIPIHQKLSVNQ
                     YMDSNGKFYLPIFSEWKGTPGTMLKLTQQLLEIWKTAYPLVNNIINASNVPPIPAKVP
                     EPSNPTVTKLVDNNLENREEETRKPEIPAKPISLQPISTNFKSHEQNIPPKVPIRPFQ
                     STVEYSAPNSPSPPKIPPRDYESTNPAITSPTGKTPHALSHKALSPPISQKEETSFTF
                     TLPPDLIDDFIDVNPNSSHNELLDALHGLIEKLTIQDSKELHTNIRRHEQHIKAVLDK
                     YSSHLGFERNVLLQLRQTLQDNTEIVTEEIKQLDMEIKKAQLLENELDPALIAIPETP
                     AFVQLYNLVAKDHALHDAIEVVSQLFHRKKISITMMVRKTRELSSEQFKTRYLISRIT
                     ALLD"
     gene            <999558..>1002290
                     /locus_tag="KLMA_20477"
                     /db_xref="GeneID:34714945"
     mRNA            <999558..>1002290
                     /locus_tag="KLMA_20477"
                     /product="chromosome segregation ATPase"
                     /transcript_id="XM_022818099.1"
                     /db_xref="GeneID:34714945"
     CDS             999558..1002290
                     /locus_tag="KLMA_20477"
                     /note="COG1196, smc"
                     /codon_start=1
                     /product="chromosome segregation ATPase"
                     /protein_id="XP_022674800.1"
                     /db_xref="GeneID:34714945"
                     /translation="MQPLKTLENEVQKLNQSKDCMIEQNDDDKLLSFRPFCPTTADIS
                     DKDGWLKRKIRSAGSTLSKLRGSSNKSECSKKNSEVESPSLINTSDMAFEQGSKSAES
                     KEAIKIISYSSVRSDSSIPSLRTSVNDDSVTESKGLSTHVLTTRKVTSKNLKGIVNIE
                     SPPKKNTETPELQSVTSKSSDEFLNKLSVIERLLAKDKDYKSYVETCSSVAHKLSNSV
                     EFSYEGVAQECQFNPDTFNIHEPSCLEKIRISNSKENTTRVPIIHDKSFRSKKEEKEK
                     KVEFAPSKENDLQEYDSNMPPSATERGKINNVSGRKNGILINAKNRGTAEQAIDKSWE
                     EISKLGPIPFTDCDIKEKVVALFELMGAPEEFKQCNDLRLSLACLHPCLSKLLNFFWS
                     IINNGLEENKWIKETAKQLEKQNLIDAGIYEMKNREFHNLASIHVSNLNELERTVENL
                     KIEIAQQQSHNDKTFEEVNNAMVGMTGVLKNFFSQDFYQEWKDDTKYRIDSLMVYLNA
                     ICDYFCTIQQNMALDLESCAEKDALRDQLDFYADNCRILERENESLRAVAHAYHCLQD
                     VITKKNVIINSLKSDNYLLNKEVEKKTRELELSLVKHENEIAKLASISLNERRRVLDI
                     WEKSDYEQALMANEEEILELKNRIDILDSIIHNKDAKRKNSTNRLNFLETKVATLSKE
                     NTILAAKYEKTIEQKRDALRAFDLEFKKRLEAMRSELEKKTDIYNDEIKKYKRQYENT
                     LNNALKVTLKAESIFQALSNNKNISSNKALRYFTKKRAMFKSVKETILSNTSIDSHCD
                     SEESKYKSASNHRPIGYPALDSNKNIENEDVEYFSLRRKDFNDSLIELREVNVNNRLY
                     KGKSNAKQIIKKLREWKKCQEQSKNSPNSMEFSLELPHTTERPTDSTYATCSAT"
     gene            <1002724..>1004160
                     /gene="CBF5"
                     /locus_tag="KLMA_20478"
                     /db_xref="GeneID:34714946"
     mRNA            <1002724..>1004160
                     /gene="CBF5"
                     /locus_tag="KLMA_20478"
                     /product="centromere/microtubule-binding protein CBF5"
                     /transcript_id="XM_022818100.1"
                     /db_xref="GeneID:34714946"
     CDS             1002724..1004160
                     /gene="CBF5"
                     /locus_tag="KLMA_20478"
                     /codon_start=1
                     /product="centromere/microtubule-binding protein CBF5"
                     /protein_id="XP_022674801.1"
                     /db_xref="GeneID:34714946"
                     /translation="MSDEFIIKPENVSPTSNTSEWPLLLKDYDKLLVRSGHYTPIPAG
                     ASPLKRDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLI
                     VCIDRATRLVKSQQGAGKEYVCIVRLHDALKDDKELGRALENLTGALFQRPPLISAVK
                     RQLRVRTIYDSKMIEFDNKRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRV
                     RSGALSENDNLVTLHDVMDAQWVYDNTRDESYLRKIIQPLETLLVGYKRIVVKDSAVN
                     AVCYGAKLMIPGLLRYEEGIELYDEVVLITTKGEAIAVAIAQMSTVDLATCDHGVVAK
                     VKRCIMERDLYPRRWGLGPIAQKKKQMKADGKLDKYGRTNENTPEEWKKSYVSLENAE
                     APAPAPKSEDKPLIKEVEKKEAKEEAKEEPKTESKVEVEEKKEKKEKKEKKEKKDKKE
                     KKEKKEKKEKKRKADDDESSEKKKKSKK"
     gene            complement(<1005035..>1006102)
                     /gene="DNAJB13"
                     /locus_tag="KLMA_20479"
                     /db_xref="GeneID:34714947"
     mRNA            complement(<1005035..>1006102)
                     /gene="DNAJB13"
                     /locus_tag="KLMA_20479"
                     /product="protein SIS1"
                     /transcript_id="XM_022818101.1"
                     /db_xref="GeneID:34714947"
     CDS             complement(1005035..1006102)
                     /gene="DNAJB13"
                     /locus_tag="KLMA_20479"
                     /codon_start=1
                     /product="protein SIS1"
                     /protein_id="XP_022674802.1"
                     /db_xref="GeneID:34714947"
                     /translation="MVKETKLYDLLGVSPSAGEAEIKKGYRKAALKYHPDKPTGDTEK
                     FKEISEAFEILSDPQKREVYDTYGLEAARGNGPQFAGAGGPGGGAGFGPGGGFSSGGH
                     AFSQDDAFNIFSQFFGGGGGASPFGFSASGGSGDDFGFGGSSFHSSSGGMPGGMPGGM
                     PGGMPGGMPGGFGGRQQAKPEEETVQVNLPVSLEDLFSGKKKSFKITRKGAGGVSEKK
                     QIDIQLKPGWKAGTKITFKGEGDYNPRTGGRQTMQFVLQEKPHEFFTREDNNLVYTLP
                     LSFKESLLGFSKQVKTIDGRTIPITRSQPIQPTQTSTYPGQGMPLPKNPSQRGDLIIK
                     FKIDYPTSLTPQQRQAIMENF"
     gene            <1006637..>1007548
                     /gene="LST8"
                     /locus_tag="KLMA_20480"
                     /db_xref="GeneID:34714948"
     mRNA            <1006637..>1007548
                     /gene="LST8"
                     /locus_tag="KLMA_20480"
                     /product="target of rapamycin complex subunit LST8"
                     /transcript_id="XM_022818102.1"
                     /db_xref="GeneID:34714948"
     CDS             1006637..1007548
                     /gene="LST8"
                     /locus_tag="KLMA_20480"
                     /codon_start=1
                     /product="target of rapamycin complex subunit LST8"
                     /protein_id="XP_022674803.1"
                     /db_xref="GeneID:34714948"
                     /translation="MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDK
                     KYLAAAGHLHVRLYDIRSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVW
                     DVRSPSVQRNYKHNAPVNEVAIHPNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNT
                     PLQSLSVASDGSMLVAGNNKGNCYVWRMPHHTDASTLEPVTKFKSHTKYITRVLLSAD
                     VKHLATCSADHTARVWNIEDNYQLETTLDGHQRWVWDCTFSADSAYLVTACSDHYVRL
                     WDLSTSEIVRQYGGHHKGAVCVALNDV"
     gene            complement(<1008138..>1010618)
                     /locus_tag="KLMA_20481"
                     /db_xref="GeneID:34714949"
     mRNA            complement(<1008138..>1010618)
                     /locus_tag="KLMA_20481"
                     /product="RFX-like DNA-binding protein RFX1"
                     /transcript_id="XM_022818103.1"
                     /db_xref="GeneID:34714949"
     CDS             complement(1008138..1010618)
                     /locus_tag="KLMA_20481"
                     /codon_start=1
                     /product="RFX-like DNA-binding protein RFX1"
                     /protein_id="XP_022674804.1"
                     /db_xref="GeneID:34714949"
                     /translation="MSSQQEQWVNHQNTLLQLASASAINPPMIPRPESSQSNLNLSST
                     ASTAQLHHMLQHSLYPPHPPPPGQLTHLHSSSPVNMSNTPTSHPNANSGSSSNGGISS
                     HPGNANIQYSQGFLPNSLPPITDPLSGGAVNRQSPQPQQQQQQHQLAQQLPQHHHQQQ
                     HHHPHHQQQQRQSVVRSMTPISVMSSNGVLSSLPNQVYHYQHIQDMQQHQQHQQHQQQ
                     QQQQQQQQQQFMLQDPNLRLKKRKAEEVTQSVQMGAKGGSKRTTQENILKLVALKNKD
                     KPLSEYASIVRSAEIQVLNMDASTHAKSEIQTAEQHRERERQVYALIWLMNSCITDAE
                     SYVPRGRIFAQYAASCAQNQLKPLSQATLGKLIRALFPYLKTRRLGMRGQSKYHYCGL
                     KLVTNLVAPNDLTPNTSSANDTPGTIVSNSGTASSQSNADNITIKYESEPQGSLDSQS
                     DNSAAMKSIQTDEILGTTSNSSENSLNNLSGTISLGSHNISEQDNNVKIVTSSASDFN
                     LYYDEGYALLPDFFAVTCESKVELPIKFPDLQKYLPLNQSIDPDIASSVNSLYQVYCN
                     TLFENIRFMKFDDLLATLQSFSSGSISSQMYNLFISEELYEWVRQSDLLTHRALTKML
                     SSLIVDFDEVPDVVLNKLSDFSNDYLNTVEQSTMDLPLPMVTSKKNIAHSFALLVKRL
                     VKVIEASKNLANVLSKQENRLSMMYGWEQHVRVSSIVNQEFSFFNYPSLEKDIQELFS
                     IQLLELLKKNDDEFDLIQFVKSVFQTLSRRNVPARLLVLAFNSLTSAFVKEISSKSTD
                     SFGLWWMFKTFLDEWVFWYAEAGGFLKE"
     gene            <1012335..>1013300
                     /gene="RLP7"
                     /locus_tag="KLMA_20482"
                     /db_xref="GeneID:34714950"
     mRNA            <1012335..>1013300
                     /gene="RLP7"
                     /locus_tag="KLMA_20482"
                     /product="ribosome biogenesis protein RLP7"
                     /transcript_id="XM_022818104.1"
                     /db_xref="GeneID:34714950"
     CDS             1012335..1013300
                     /gene="RLP7"
                     /locus_tag="KLMA_20482"
                     /codon_start=1
                     /product="ribosome biogenesis protein RLP7"
                     /protein_id="XP_022674805.1"
                     /db_xref="GeneID:34714950"
                     /translation="MSQAQAQPLNSNPEILLRKRRNADRTRLEKQELAKKKKEQEEKR
                     KRSKKNRFVRAESIVATSLATEREKTRIRRIRDLENKKTIKDLSHVPSDRNFILRITE
                     RTKDSANGEDELVDVDEDDEEDDGLLREKIVYNGEPTLLFVIRVKGPTAVKIPAKAFK
                     VLTLLRLVELNTGVFIKLTKDVYPLLKLVSPYIVIGQPSPASIRSLIQKRSRIMWQRP
                     EDKEPKEIILNDNNIVEEKLGSEGIICIEDIIHEISTLGESFAKCTFFLLPFKLNREV
                     SGFSAISRLNKLKSREQDKKTRQISNAATAPVIQVDIDAMISKLN"
     gene            <1013888..>1014976
                     /gene="LEU2"
                     /locus_tag="KLMA_20483"
                     /db_xref="GeneID:34714951"
     mRNA            <1013888..>1014976
                     /gene="LEU2"
                     /locus_tag="KLMA_20483"
                     /product="3-isopropylmalate dehydrogenase"
                     /transcript_id="XM_022818105.1"
                     /db_xref="GeneID:34714951"
     CDS             1013888..1014976
                     /gene="LEU2"
                     /locus_tag="KLMA_20483"
                     /codon_start=1
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="XP_022674806.1"
                     /db_xref="GeneID:34714951"
                     /translation="MSKNIVVLPGDHVGTEITNEAIKVLNAISEARPSIKFNFEHHLI
                     GGAAIDATGVPLPDEALEASKKADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELGLYA
                     NLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKY
                     SVPEVQRITRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPQLTVQ
                     HQLIDSAAMILVKSPTKLNGIVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTN
                     KAFGLYEPCHGSAPDLPANKVNPIATILSAAMMLKLSLDLVEEGRAVEEAVRKVLDSG
                     IRTGDLGGSNSTTEVGDAVAKAVKEILA"
     gene            complement(<1015510..>1016988)
                     /gene="NFS1"
                     /locus_tag="KLMA_20484"
                     /db_xref="GeneID:34714952"
     mRNA            complement(<1015510..>1016988)
                     /gene="NFS1"
                     /locus_tag="KLMA_20484"
                     /product="cysteine desulfurase"
                     /transcript_id="XM_022818106.1"
                     /db_xref="GeneID:34714952"
     CDS             complement(1015510..1016988)
                     /gene="NFS1"
                     /locus_tag="KLMA_20484"
                     /codon_start=1
                     /product="cysteine desulfurase"
                     /protein_id="XP_022674807.1"
                     /db_xref="GeneID:34714952"
                     /translation="MLRNIGMMRVVPVLGGRVPYAMRRANGLQKYVRTYASAKVALKD
                     DLALETHTDTQAAAIEQANERAAAHPEVLESGVTSLQHAYRESGDYGTRPIYLDMQAT
                     TPTDPRVLDTMLKFYTGLYGNPHSNTHSYGWETNKEIETARKYIADVIRADPKEIIFT
                     SGATESNNMALKGVSRFYKKTRKHIITTRTEHKCVLEAARAMKNEGYEITFLNVDEQG
                     LINLKELEEAIRPDTCLVSVMAVNNEIGVMQPLAKIGEICRKHKVYFHTDAAQAYGKI
                     PIDVDAMKIDLLSISSHKIYGPKGIGALYVRRKPRVRLEPLISGGGQERGLRSGTLAP
                     PLVAGFGEAARLMKKEYDNDSAHIKRLSDKLMKGLLSIDHTILNGSPDHRYPGCVNIS
                     FAYVEGESLLMALRDIALSSGSACTSASLEPSYVLHALGKDDALAHSSIRFGIGRFTT
                     EEEIDYVIKAITERVEFLRELSPLWEMVKEGIDLNSIEWSGH"
     gene            <1017527..>1018351
                     /gene="PET8"
                     /locus_tag="KLMA_20485"
                     /db_xref="GeneID:34714953"
     mRNA            <1017527..>1018351
                     /gene="PET8"
                     /locus_tag="KLMA_20485"
                     /product="putative mitochondrial carrier protein PET8"
                     /transcript_id="XM_022818108.1"
                     /db_xref="GeneID:34714953"
     CDS             1017527..1018351
                     /gene="PET8"
                     /locus_tag="KLMA_20485"
                     /codon_start=1
                     /product="putative mitochondrial carrier protein PET8"
                     /protein_id="XP_022674808.1"
                     /db_xref="GeneID:34714953"
                     /translation="MDSHMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANG
                     GYKGVYRGLGSAVVASAPSASLFFVAYDSMKCWSRPIIGRMLPEGDEQLADTVSHMFS
                     SSVGEISACMVRVPAEVIKQRTQTHKTNSSWQTLQELLRNENGEGLRRNLYRGWSTTI
                     MREIPFTCIQFPLYEYLKKKWAQVQGKDHAAPWQGSVCGCIAGGIAAAATTPLDVLKT
                     RIMLHHKSVSALHLARNMLKEEGVSVFFRGVGPRTMWISAGGAIFLGVYETVHSLF"
     gene            complement(<1018564..>1019676)
                     /gene="DCC1"
                     /locus_tag="KLMA_20486"
                     /db_xref="GeneID:34714954"
     mRNA            complement(<1018564..>1019676)
                     /gene="DCC1"
                     /locus_tag="KLMA_20486"
                     /product="sister chromatid cohesion protein DCC1"
                     /transcript_id="XM_022818109.1"
                     /db_xref="GeneID:34714954"
     CDS             complement(1018564..1019676)
                     /gene="DCC1"
                     /locus_tag="KLMA_20486"
                     /codon_start=1
                     /product="sister chromatid cohesion protein DCC1"
                     /protein_id="XP_022674809.1"
                     /db_xref="GeneID:34714954"
                     /translation="MSVNLYNKLNSENGYKLLQLPNDLIEAFEKGPVKFKSLSNENSN
                     VVLCSEDKTWLLKQRNHSNTVMLLREFAPNATIEAEVAEKVNTFGLPKPTADWAGFTT
                     LDSELEPKLVSGSIDVTQLDIYDGTDVPLTRKLSLEEFKNMCPCSEKEFTEKWFDVAG
                     CVVDGSACLLSERFMLKALHIILITCMAESFDINELSIDKVVDALQKDTTDGKPNVYT
                     KNVITTVIRKFSSPAASEDGYFKINMPLVAKWYGVSALKIYASKEPISEQEFMVQWKA
                     QFPPYFHCDLDICMLRGYFVRPLKDKIRYISKDTLSPDPKERFKQLFHWQSVWELDDM
                     VPYIQELNTKNLKPDVFVMKYARRKRVGNKFIISAR"
     gene            <1020217..>1024584
                     /gene="BUD3"
                     /locus_tag="KLMA_20487"
                     /db_xref="GeneID:34714955"
     mRNA            <1020217..>1024584
                     /gene="BUD3"
                     /locus_tag="KLMA_20487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818110.1"
                     /db_xref="GeneID:34714955"
     CDS             1020217..1024584
                     /gene="BUD3"
                     /locus_tag="KLMA_20487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674810.1"
                     /db_xref="GeneID:34714955"
                     /translation="MENVDQNSENSSVYQNDESDWQIEIPLSLVRGKTKDADFSEKTD
                     EEWLSIFEKSVFFQGNDPLLWGHYLACVYLDPETNKFGVFYLDKLGVTHFKHVNLNEK
                     SEYYPAVLNLSDEYKKSNVRKVLACSLLQKYATLDEIEVKKITNGVALKFDYDQTHAG
                     DLANACKIVEYCTPKNLGKSLMLHGLMHKKAVQSLMVDVVYENKQETIDANNELVYYL
                     GEQLEQLFDPLTEYSPEQTERVYISPEYSPDQQQEKDEPLIDSICQELLTLQSNFTLS
                     IIGFLQKFLIPLRIDVLNEDIPGLSAAKLNRLFPPTIDEVTRINCIFLDALKSATPYG
                     AVEVLKACSITIPYFYKAYSRHEAATKNFSKDVKLFLQKFKDVIPNRNIYTEIKIETI
                     IKGPQEKLMKIKLILERLWQSKSWSTPESQNEAKRDFDNVMEIIDSFGKMDATTMSAY
                     NTRVFTPSGKILTELAKGWPLELQYKWLKRRIVGVFDVIDIDNNKKRDLIVIFSDYIV
                     ILNVVDAEKYYVEAENKPLISDVLMNSLINEVALPPKIPKLQVVSHCYINKILVSTTT
                     ENAISFTFMDEKNPQHFVYKLASPKMKASYIEELCTKAAILDKVTAFHLFKSSSSNFN
                     IYFTAHELEAYKDESIKSRFTLFLNHPPDISYVEEHGIDLAFFASLIDGKVTLTKMLA
                     NGETDEVEISVDELVTVLTKELIDNYASRTYSFSSPYFKDLMRANEQLAKQLGHGFNL
                     IDIPKPASIIKHATQPDSNNGSNAMHKKEKSYGTITTFRSSVSDLKDIQPVNTNAKVT
                     KPPPRKMMDKREIVKNTPKKAQKRSFLAKLFSVFRKRKPEQQKQRATETNQETEITTS
                     NQYPKTSAKKVVEQKPEERIGSVVHNKNINNQYHTAATENPYAESITPPNSPSIATAP
                     SSMEMENVQSPVPSQKSETEYHDGAIYKQQELARQSQVFNDDLFGDVIGPPVPPKDRT
                     VTPVIVPQPEKFNEEQNVEVLPNTVNEMVEQNNSYSSLEPNTRNVSEVYSLPTSITDI
                     GKKSEIIGEEADMEVNNAVKESIAPIFPKIDKFELPKINFTKSPSFAELFQEMRLVLD
                     DSDETVNWRRLSSEVSLNEKYAINKPKNDNCKTSKPLEVPAEVPEQEEPTLKTNHIPV
                     NFQENITLRPQTSKSPRNSPVFNVIKSSPPKIVSRNDLGKGDASRSINSINDVPSFSP
                     LQNNANTRLVELSFHSQDDVSENPFYTPRTEPVMTFESFEEERQKEPEKEPRQTKDTN
                     KAIEKAVPDEKGQDVETTALSNGKNVHSAPLLDELEFSFFHMSFDDTNNTSTRESTTD
                     TGDIFEKNNITSQKPSEPIFYKFDNFNKSESSFYSANAAVDYNVADVSNEAIWVSPSK
                     LQIYDITEKSDTFFRSLRSPTSKRVGNPGNIFSNLKRNTEVEKTDEPSFLKDSSYNYL
                     GNFVVEKEEEKKSTRLEFK"
     gene            complement(<1024710..>1026466)
                     /gene="HRB1"
                     /locus_tag="KLMA_20488"
                     /db_xref="GeneID:34714956"
     mRNA            complement(join(<1024710..1026059,1026455..>1026466))
                     /gene="HRB1"
                     /locus_tag="KLMA_20488"
                     /product="RRM (RNA recognition motif)"
                     /transcript_id="XM_022818111.1"
                     /db_xref="GeneID:34714956"
     CDS             complement(join(1024710..1026059,1026455..1026466))
                     /gene="HRB1"
                     /locus_tag="KLMA_20488"
                     /codon_start=1
                     /product="RRM (RNA recognition motif)"
                     /protein_id="XP_022674811.1"
                     /db_xref="GeneID:34714956"
                     /translation="MDSYTNERSRSRSPAGRLGQEDPRRGGYPDRSIREDRRLSNTYR
                     SDPRRSDDHPRERYPRDRGRGRDNYAGRSGARGYRSYPRDRDREGYGHGQGSNFRHTA
                     HHSTHEGGRYGSNRHSRYDQAAAKGDYGPKLARELDSPYDEKVNRNYAHSIFIGNLTY
                     NTTPEDLKEYFGKIGEVRRADIITSRGHHRGMGTVEFNNSTDVETAIRECDGALLNGR
                     AIFVRQDNPPPSEMSRSQSNNGPPPPPKRAHDEGYEVFVAQLPFSVNWQELKDMFKPC
                     GDVLHADVVIDRDGKSRGFGTVYMATKEQQEEAIRRWSGTEYKGRVLDVKLGKGTFTS
                     TPVSGGDTYIPSRPANNTPPAPKVAPLDIDPVTVVSGGDKNSVVFCENMPSSTTESDL
                     YDLFGSIAPVVKAQLQINSEGDFTRNSVCQFETAEDAEVCVEKLNKYTYGDHELKVSY
                     ARY"
     gene            <1026808..>1028736
                     /locus_tag="KLMA_20489"
                     /db_xref="GeneID:34714957"
     mRNA            <1026808..>1028736
                     /locus_tag="KLMA_20489"
                     /product="GAL4 domain-containing family protein"
                     /transcript_id="XM_022818112.1"
                     /db_xref="GeneID:34714957"
     CDS             1026808..1028736
                     /locus_tag="KLMA_20489"
                     /codon_start=1
                     /product="GAL4 domain-containing family protein"
                     /protein_id="XP_022674812.1"
                     /db_xref="GeneID:34714957"
                     /translation="MTGEFKRQKRKYSKNGCVECKRRKVKCDESKPMCWQCAHLSKEC
                     VYKTKEFQFLVSGVEGGLKRHTDDKRSDGPFKKKRPKNNIKIDDDNDLNALLNDALVF
                     ANDLFSRMGDNGISSDSVVVPVFDKWEEIELALSNVERSELEYLKVFYEKVSYWLMPL
                     AYSPDSNICNHILFHHLIRANQKNEGNRERSFLQSSMVSISAKYMYNVHGNEKDNTVR
                     RLFLKKALQQLYQEFESLSQESMGLAQIDSLNLCVLMLTLDSSTFGTQEWKYHLRGAK
                     NLLLKYHYNHNDMENKTDTLTDTKNMDHMDTRLLHERTVALARNWFSAIAIVAYIAKD
                     SHFFNESEMEEMLSMGSTEDSSTSVLLKDMGFITEDCQYNIFLGYSKEGLELLKVVMR
                     SMDSDISKRGYGYDEDNDNFLRVCSLLQKSREFTFHSNVYGRVSDEAVESLVYTNNSK
                     DAASIVFYKKNAYSLYDTIQQVHLEVLFVKFLTKSVKLDESCTLVQNSCKRAWKMVEW
                     MFSDCDLTVTEINAFIEKIELGEIQNYSTLKQKLTFDLVSRCIISPLQQDFRLMMFQT
                     GMVLCAGKLTSFDPHSLRLVRCKILAYFLAMADNLGTESARTSMEYLIRKWYPNANRG
                     VIASSLQSTPDNDALPFS"
     gene            <1029475..>1031154
                     /gene="TPN1"
                     /locus_tag="KLMA_20490"
                     /db_xref="GeneID:34714958"
     mRNA            <1029475..>1031154
                     /gene="TPN1"
                     /locus_tag="KLMA_20490"
                     /product="vitamin B6 transporter TPN1"
                     /transcript_id="XM_022818113.1"
                     /db_xref="GeneID:34714958"
     CDS             1029475..1031154
                     /gene="TPN1"
                     /locus_tag="KLMA_20490"
                     /codon_start=1
                     /product="vitamin B6 transporter TPN1"
                     /protein_id="XP_022674813.1"
                     /db_xref="GeneID:34714958"
                     /translation="MTNPNAESDIEIVSNLNSDSGRETKTELDVETKAEVETNTHLDV
                     GDQSFFQSLVRTAREISRKIDALGVETRGIQRIEPYEREHQSSGQLLHIIGLWLSASG
                     GLSSMSSYFLGPIIYELEFRQALTCGLISMWIGCFFAAYLATMGPQSGCRQLVTARYL
                     FGWWLVKFVGLIAIIGGMGWSVVNCVVGGEMLAAISDGKIPIWIGIIIVTLVSFFVAI
                     FGIKHVLKAETLFSIPVLTSFLLLYISASDKFKYANDYKNDFLDSRTYTGNYLSFFSL
                     CYSITSTWGSVTADYYILFPEDTPKMQVFMITFLGIGIPATFVGVLGLLLASCAMSYQ
                     PWMDLYDSYGMGGLLHAGFERWGGFGKFCVVILVLSLISNNILNTYSAAFSIQLAGEI
                     LFKVPRWFWAIACTVFYFVCALVGRNSFSDILGNFLPMIGYWVSLYFILQVEENLIFR
                     SFFHHLYTKEFPNVTKPAQRWSLKNIPKRTHNWNNWNDPNVITRGLAATAAFWIGVVG
                     AVMGMCQTYYVGPISSKIGDNGGDLGSWLGMAFACVVYPPLRYLELKKFGR"
     gene            <1031861..>1032325
                     /gene="COX4"
                     /locus_tag="KLMA_20491"
                     /db_xref="GeneID:34714959"
     mRNA            <1031861..>1032325
                     /gene="COX4"
                     /locus_tag="KLMA_20491"
                     /product="cytochrome c oxidase subunit 4"
                     /transcript_id="XM_022818114.1"
                     /db_xref="GeneID:34714959"
     CDS             1031861..1032325
                     /gene="COX4"
                     /locus_tag="KLMA_20491"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 4"
                     /protein_id="XP_022674814.1"
                     /db_xref="GeneID:34714959"
                     /translation="MLSLRQSLSKLFTPAARVFSTTKVAGQQQVVKTAQNLAEVNGRD
                     SLIGPGAKEGEVPTELEQATGLARLEMLGKLEGIEVFDTKPLDSSRIGTMENPIIIES
                     YDDYRYVGCTGSPAGSHPTMWLKPTKDQVARDWETGTVYKLKVVGVPQEGHH"
     gene            <1033858..>1034217
                     /gene="RPS26A"
                     /locus_tag="KLMA_20492"
                     /db_xref="GeneID:34714960"
     mRNA            <1033858..>1034217
                     /gene="RPS26A"
                     /locus_tag="KLMA_20492"
                     /product="40S ribosomal protein S26-A"
                     /transcript_id="XM_022818115.1"
                     /db_xref="GeneID:34714960"
     CDS             1033858..1034217
                     /gene="RPS26A"
                     /locus_tag="KLMA_20492"
                     /codon_start=1
                     /product="40S ribosomal protein S26-A"
                     /protein_id="XP_022674815.1"
                     /db_xref="GeneID:34714960"
                     /translation="MPKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNI
                     VEAAAIRDLSEASVYAEYALPKTYNKLHYCVSCAIHARIVRVRSRTDRRNRAPPARPR
                     FNRDNKVSPADAAKRAL"
     gene            <1034745..>1036532
                     /gene="FRS1"
                     /locus_tag="KLMA_20493"
                     /db_xref="GeneID:34714961"
     mRNA            <1034745..>1036532
                     /gene="FRS1"
                     /locus_tag="KLMA_20493"
                     /product="phenylalanyl-tRNA synthetase beta chain"
                     /transcript_id="XM_022818116.1"
                     /db_xref="GeneID:34714961"
     CDS             1034745..1036532
                     /gene="FRS1"
                     /locus_tag="KLMA_20493"
                     /codon_start=1
                     /product="phenylalanyl-tRNA synthetase beta chain"
                     /protein_id="XP_022674816.1"
                     /db_xref="GeneID:34714961"
                     /translation="MPTISVNKKQLFELLGKNYTNEEFDELCFEFGVELDEDTTEEAL
                     KNGEEPELKIEIGANRYDLLCIEGIAQSLNEFLGRAETPEYKLSKPTTKLYIEEPTSQ
                     IRSYACAAILRNLTFTEANYASFISLQDKLHSNLCRNRTLVAIGTHDLDTIKGPFHYR
                     AQKPTDIKFVPLNQTKEYNGAELIELYKQPEQKNNLGRFVHIIENSPVYPVIYDDNGV
                     VCSLPPLINSEHSKITLDTKNVFIEVTATDRTKAEIVLEQIVAMFSRYCAEQFTVEPV
                     EIVSEHNNESRITPNVKPRTMDVKVDYINSCLGLTLSPEEISKYLKKLSLKATPSAED
                     KNILHVDIPITRSDILHPCDIMEDAAIGYGYNSLPKGNQLSNANFVASPLPINKISDI
                     LRIASSQASWLEVLPLTLCSHDENFKNLRIEDDNTKAVKLANPKTLEYQVVRTSLLPG
                     ILKTVKENRKHSLPIKVFETGDIVLKDDKLERKAFNQRHWGAIYVGKTASFEIIQGLL
                     GKIMQTFRTQWLPDYGANSTGRGYWIEKDESLKTYFPGRGAKIMFRHKEGEQAKEIGH
                     IGVLHPEVMINFDIPYAGSYVELNAEAFL"
     gene            complement(<1036650..>1039373)
                     /locus_tag="KLMA_20494"
                     /db_xref="GeneID:34714962"
     mRNA            complement(<1036650..>1039373)
                     /locus_tag="KLMA_20494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818117.1"
                     /db_xref="GeneID:34714962"
     CDS             complement(1036650..1039373)
                     /locus_tag="KLMA_20494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674817.1"
                     /db_xref="GeneID:34714962"
                     /translation="MAKGKEKDGEEDLGFALKELKITRRHKSVDIPQESPNVDVIETN
                     NNIPELSNDTTSDKETGEPTSTELRRTETVEQSVKDEGVESGAESDSSLEWQPVTTIA
                     SYDIYDESGNLVLEGMTKPPNSVSVNEQNQPPQTPNSTFGYTKVDGEEQAQRSFMTNK
                     RTDFLFNHKKLGGSNVSLPRSETKSTASTDLKLLSDDDEEDDEEEAIHTKDITTSEQL
                     SVTKELLNEKEKFAYVASVTVLINDMCTWLVSIALSSNNVTSKKKLAKRLQVLQKNMG
                     HWKSLILNRLYTHLDVDPEEIKMLSRLSNDGIELSDLCKCLKVVQRIQNPLPKAEEVP
                     ELKTESQSDKGIMNSENLDIDVAWTIICDLFLLLVQDSHYDARSRSLLIRFGELLNIE
                     PIEICQFEKRIIDALELEQCTEDQVWDEKTHMDKRRKAVKRKKMCYIGLATLGGSLVL
                     GLSGGLLAPVIGAGFAAGLSTIGITGAAGFLTGAGGTTVVAVSSTAIGAKIGTSAMQR
                     RMGSVRTFEFRPLHNNRRLNLIISVSGWMNGNEDDVRLPFSTVDPINGDLYSLYWEPD
                     MLRSTGQTMSILASEIVTQTIQQILGATVLTALMAAITLPNMLSKLGYLIDNPWNVSL
                     DRAWAAGLVLADTLMAKNLGDRPITLVGFSLGSRVIYSCLVELAKHGAIGIVENVYLF
                     GSPVVYKRDEMILARSVVSGRFINGYSNRDWILGYLFRATGGGLSTVAGISPIKNIPD
                     IENVDCSEFVDGHMSYRKMMPKILKSVGISVLSEEFVEIDDPIDPEQVARERKLVAEL
                     ESAQEKLSDQSNSKKKKHKWYSRSSWFKPPKNEWQQMYEQTLKDKTTESSEVGVNAEA
                     KFNSSNEEPINDNDNDNDNDNDNDKLEKESSESAEIPQKNRDHSPNENINV"
     gene            <1039881..>1040598
                     /gene="RPL22A"
                     /locus_tag="KLMA_20495"
                     /db_xref="GeneID:34714963"
     mRNA            join(<1039881..1039892,1040248..>1040598)
                     /gene="RPL22A"
                     /locus_tag="KLMA_20495"
                     /product="60S ribosomal protein L22-A"
                     /transcript_id="XM_022818119.1"
                     /db_xref="GeneID:34714963"
     CDS             join(1039881..1039892,1040248..1040598)
                     /gene="RPL22A"
                     /locus_tag="KLMA_20495"
                     /codon_start=1
                     /product="60S ribosomal protein L22-A"
                     /protein_id="XP_022674818.1"
                     /db_xref="GeneID:34714963"
                     /translation="MAPNTARKQKITKTFTVDVSSPTENGVFDPASYAKFLIDHIKVD
                     GHVGNLGQAITVEEDGSVVTVVSTTKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNE
                     YKLAFYQITPEEEEEDEE"
     gene            complement(<1041148..>1041607)
                     /locus_tag="KLMA_20496"
                     /db_xref="GeneID:34714964"
     mRNA            complement(join(<1041148..1041471,1041605..>1041607))
                     /locus_tag="KLMA_20496"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818120.1"
                     /db_xref="GeneID:34714964"
     CDS             complement(join(1041148..1041471,1041605..1041607))
                     /locus_tag="KLMA_20496"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674819.1"
                     /db_xref="GeneID:34714964"
                     /translation="MDSDEFKPINPKPFLHQLIDKDVIVSLKFNKMQYKGKLVSVDTY
                     FNLQLTDAEEIVNDVSSGTVGDIFIRCNNVLYVGEDVEKSRKQDAAAVEDVSQNTSSE
                     VEKTEV"
     gene            complement(<1041941..>1043119)
                     /gene="GAB1"
                     /locus_tag="KLMA_20497"
                     /db_xref="GeneID:34714965"
     mRNA            complement(<1041941..>1043119)
                     /gene="GAB1"
                     /locus_tag="KLMA_20497"
                     /product="GPI transamidase component GAB1"
                     /transcript_id="XM_022818121.1"
                     /db_xref="GeneID:34714965"
     CDS             complement(1041941..1043119)
                     /gene="GAB1"
                     /locus_tag="KLMA_20497"
                     /codon_start=1
                     /product="GPI transamidase component GAB1"
                     /protein_id="XP_022674820.1"
                     /db_xref="GeneID:34714965"
                     /translation="MVSHEWEVIWVCLLSRLAVSYLFPSLQQQLDRTVEFSTPVTSYR
                     SLKEGAYLLGHQLPVYNGGVVHHPPILVSFMAFLQPMEFLVPVLFAAMDTLIACQLMI
                     IARIYRRQLKMDSYIPGILYVLNPMVLLSCVSQSTSLFVNLSICSSLLFAIQKKSLLS
                     AIFIAFAGYLSPYAYLLLIPLASICRSNYVGVVLKSILISILLQLISFELNNGNWNYV
                     TSTYWAMITFSKMTPNLGLWWYFFIEMFEFFIPFFKSVFNIFVVSFIPPFTIRFYEQP
                     IYAFILCLGWLTLTKGYPTLGDGGFFLSFVPFFKPLFGYLRYPVISTLLFIHAIILSP
                     TFYYLWVGLGSGNSNFFYAISLVYALAIASVLVDLVWAMLRIEYDSGKPNLSLKLTQI
                     "
     gene            <1043566..>1045848
                     /gene="SEC23"
                     /locus_tag="KLMA_20498"
                     /db_xref="GeneID:34714966"
     mRNA            <1043566..>1045848
                     /gene="SEC23"
                     /locus_tag="KLMA_20498"
                     /product="protein transport protein SEC23"
                     /transcript_id="XM_022818122.1"
                     /db_xref="GeneID:34714966"
     CDS             1043566..1045848
                     /gene="SEC23"
                     /locus_tag="KLMA_20498"
                     /codon_start=1
                     /product="protein transport protein SEC23"
                     /protein_id="XP_022674821.1"
                     /db_xref="GeneID:34714966"
                     /translation="MDFEENEDLNGVRFSWNVFPASRTDANKNVVPVGCLYTPLKERE
                     DLAVAAYNPVVCGNISCKSVLNPYCEIDVRSNCWICPICKTRNILPQHYANLTQDNLP
                     LELTNTTIEYITSVPVQVPPIFFFVVDTTAEEENLQALKESIITSLSLLPANALVGLI
                     TYDNVIQLHDLSSSTIDKCNVFRGDREYQLAQVVEMLTGEKMNAAQAVNINAPAKVTP
                     FSLNRFFLPLEQVEFKLTQLLENLKPDQWDIKSGFRPLRATGSALNIASLVLEGCYKH
                     VAARVILFSSGPGTVGPGLVVSPELKDPLRSHHDIDSDSAKHYKKACKFYNHLAQRVA
                     DNGHTMDIFAGCYDQVGMSEMKKLTDSTGGVLLLTDAFSTAIFKQSYLRFFSKDEEGY
                     LQMAFKGNLSVKTSSDLKLQGLIGHASPVKAKTEASNVSDSEIGISGTSTWKMSALSP
                     RHTYAVFFEIVNPGASAEVISDRPKLAYTQFITSYEHASGTNRVRVTTVANQMLPFGN
                     PAIASSFDQEAAAVLMARIAVDKAESDDGADVIRWIDRTLIKLCQKYADYNKNDPSSF
                     RLSPQFSLYPQFTYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTSF
                     SMEEEPQPVLLDSVSVKPNTILLLDTFFYILIYHGEQIAQWRKAGYQDDPQYADFKSL
                     LEEPKLEAAELLIDRFPLPRFIDTEAGGSQARFLLSKLNPSDSYQNGAAAGSTIVLTD
                     DVSLQNFMSHLQQVTVNGQT"
     gene            complement(<1046029..>1047042)
                     /gene="AOS1"
                     /locus_tag="KLMA_20499"
                     /db_xref="GeneID:34714967"
     mRNA            complement(<1046029..>1047042)
                     /gene="AOS1"
                     /locus_tag="KLMA_20499"
                     /product="DNA damage tolerance protein RHC31"
                     /transcript_id="XM_022818123.1"
                     /db_xref="GeneID:34714967"
     CDS             complement(1046029..1047042)
                     /gene="AOS1"
                     /locus_tag="KLMA_20499"
                     /codon_start=1
                     /product="DNA damage tolerance protein RHC31"
                     /protein_id="XP_022674822.1"
                     /db_xref="GeneID:34714967"
                     /translation="MSIDEIALYDRQIRLWGMAAQANMRSSSVLLINLGAIGNEVAKN
                     IVLSGIGSLTILDSNVITEEDLGSQFFIGKEDVGTKRLDAARPHIEDMNPRVKLSIDT
                     DNVLSKDTEYFSQFSLIVATDLTPAEIKELNKKTRDVKVPLYAAGINGFSGYIFADLI
                     QFLSVDEKLKSARPAELGQTSPNKVIVELDERKDEEKNVVYQVITTKHTFKPLDELLH
                     SAILTNQLSRRQLKRMTPKVPLTLTLLKQDTKYDSLDLETFHSQYHSTCKQLGLQIEE
                     VSTETIKQFIDQISVELSPVAAVIGGALSQDVINVLGKRQSPLNNFVVFDGVTLDMWV
                     FEL"
     gene            <1047522..>1049432
                     /gene="HDA3"
                     /locus_tag="KLMA_20500"
                     /db_xref="GeneID:34714968"
     mRNA            <1047522..>1049432
                     /gene="HDA3"
                     /locus_tag="KLMA_20500"
                     /product="HDA1 complex subunit 3"
                     /transcript_id="XM_022818124.1"
                     /db_xref="GeneID:34714968"
     CDS             1047522..1049432
                     /gene="HDA3"
                     /locus_tag="KLMA_20500"
                     /codon_start=1
                     /product="HDA1 complex subunit 3"
                     /protein_id="XP_022674823.1"
                     /db_xref="GeneID:34714968"
                     /translation="MDLLKILDTAPDPAIVDAQTMGVSGDTSGDYWLPAPMCLYQKEL
                     TDQIVSLHYSDILKYFETSDYKEDIVIGSMKSMCLNSEYVATHPYLLIDHFMPKSLIT
                     KDIPGHLAETSGKFAVLRDLMSLVQEYETHTLIMARPGRTMDLLEALLLGNKVNIVRH
                     DGQTIKTKNKPKNFSCTCHLVSSNNTRKMPIEFPKNITVDMVICLDPTCDPEDPTIMR
                     IRKQNRPKRGTDTCAPAIRLTTIDSIDHCELYFGKYLKKDSREYLVKVAAAVVVLRDI
                     VGTLPPDLRPIYSQNLKYLSSWLDNPNMPWPLPDVYPISEYTSMDVEKSLLTEVSYSQ
                     TGNDLKEQFINDRKRRNRGNLKERSSLLYYKSKRIKNDYSTNPLKQDMAVLTWVSASG
                     QQKGEIDYHLATDILTHKMIQSIENIYDKNEKQIQELKDFEKMEPIQQQHYEKAKQDY
                     DDIKGKLDNCEQKLRDDESKVKNFLDQADIKHKKIENINSEINDLLEQLSSKSESHKE
                     LKTLLIDIANLNESHDKEQRNLDAKLSERAYMEKEISRAEQAINDSKVEESKLQEEIK
                     NLQDQIEEKMLKNEEEVKNAKQKVDLLQSQIEQESHNFSVLHSKLGYITDRLSKIQPS
                     RGRQVTNGRSKK"
     gene            complement(<1049509..>1050876)
                     /gene="PRP4"
                     /locus_tag="KLMA_20501"
                     /db_xref="GeneID:34714969"
     mRNA            complement(<1049509..>1050876)
                     /gene="PRP4"
                     /locus_tag="KLMA_20501"
                     /product="U4/U6 small nuclear ribonucleoprotein PRP4"
                     /transcript_id="XM_022818125.1"
                     /db_xref="GeneID:34714969"
     CDS             complement(1049509..1050876)
                     /gene="PRP4"
                     /locus_tag="KLMA_20501"
                     /codon_start=1
                     /product="U4/U6 small nuclear ribonucleoprotein PRP4"
                     /protein_id="XP_022674824.1"
                     /db_xref="GeneID:34714969"
                     /translation="MVDLDNVRVDIDYKNHDGENVGEALKRLEFQRQERLNLVPTLKE
                     DVIHALELLGQPSSIDKEDDYARRDRLADIILKSDEARDKIVKYMSSTSDTHIEDKHS
                     IADEEEFYTPASENLIAFRKFLITFSLNRAKLRVKNERRQLSTQSVKDVISKRRRLEC
                     NLKKYSLNGTKVVDEKPVSEIRSSSNGEFIACGSWSGNLSIFKTSMEKAYVNKALEGT
                     KISGLDWSADDRNIVVCTYDGKIAMYDTSSENTVDILHSNNVRFAKIRYHPCNNVVGS
                     TSFDKTWVLFDTEKKAVLLKQEGHANEVFSLVFNTDGSLACTGGLDSVALVWDLRSGK
                     TIMSLQGHSKPIYSLDWAKNGYQLASGSGDGTIKIWDIRKKEKAETILAHNSLVSQVS
                     FSRDGSDFLVSSGYDKKVNIFNGGNWIKEKTLEGHLDKVMSVDIVNSDIYSAGWDRSL
                     NKWSF"
     gene            <1051090..>1052064
                     /gene="BET2"
                     /locus_tag="KLMA_20502"
                     /db_xref="GeneID:34714970"
     mRNA            <1051090..>1052064
                     /gene="BET2"
                     /locus_tag="KLMA_20502"
                     /product="geranylgeranyl transferase type-2 subunit beta"
                     /transcript_id="XM_022818126.1"
                     /db_xref="GeneID:34714970"
     CDS             1051090..1052064
                     /gene="BET2"
                     /locus_tag="KLMA_20502"
                     /codon_start=1
                     /product="geranylgeranyl transferase type-2 subunit beta"
                     /protein_id="XP_022674825.1"
                     /db_xref="GeneID:34714970"
                     /translation="MSEKALLREKHIEYVASLDEKTNDLEYWLSEHLRLNGVYWGLTA
                     LYLLDSMETFKKEDVIDFVLKCRDRKSGGFAAFPGHDGHLLTTLSGLQILATYKALDR
                     LSNEDKDEIVRFILSNQKEDGSFQGDKFGEVDTRFVYTALSCLSILHRLTKDVVEPAV
                     SYILKCYNFDGGFGLNPGAESHAAQAFTCVGALAIVGRLDALTSSQQNNIAMWLSERQ
                     VPEGGLNGRPSKLPDVCYSWWVLSTLAILKKADWIDFDKLTEFILNCQDPKKGGISDR
                     PDNEVDVFHTVFGLAGLSIMGYDSLKPIDPVYCMPYYATETFQRSCDS"
     gene            complement(<1052125..>1054242)
                     /gene="DPB2"
                     /locus_tag="KLMA_20503"
                     /db_xref="GeneID:34714971"
     mRNA            complement(<1052125..>1054242)
                     /gene="DPB2"
                     /locus_tag="KLMA_20503"
                     /product="DNA polymerase epsilon subunit B"
                     /transcript_id="XM_022818127.1"
                     /db_xref="GeneID:34714971"
     CDS             complement(1052125..1054242)
                     /gene="DPB2"
                     /locus_tag="KLMA_20503"
                     /codon_start=1
                     /product="DNA polymerase epsilon subunit B"
                     /protein_id="XP_022674826.1"
                     /db_xref="GeneID:34714971"
                     /translation="MAGVVLPASIQPQLLRPLAYRILTRKFGLNIKSDGLAALASYIG
                     ATFGLNWRQNSETTIFLEQFAAIWREQGRGLFVDEINVQQVISEIKEREKAEQSQIRE
                     KSHHSARKNNLEAFLKKSKSPGTEAEAQVLSQGSIASNSPNVLEEGSPLNSDSESSAG
                     DHPITGYTNVGSELDWTDYFKVISTFKQQKFTYDHVKRHYVYVPQTTESHKNLLTMAK
                     LKLPNVESQVSLFTTRYHIVKDKVLRNENFQNNDIFNPMSSVVEMGKQLGDTENSALN
                     SATYMKITQIKNLLGHDGKNFLLLGLLDRNSKGNWSLEDPSGTIELDIQQAIPTKGTY
                     YVPGCIVLVEGIYFTYNNTFVVSSITHPPGEKRDVTLEAIGNLDLLGAFNPSNENYTA
                     RLDDDLKIRMHYLEQELSDHKFVLLGGDIFLDETSTMDGLKKTFDKLNRDPPVAIVFN
                     GSFVSVPVHPSLTSKNVSATVSYKNNFDELATLLSNYENLINDTHMIFIPGPNDPWSS
                     MVGLGTTTLWPQKEIPSSFVQKMNRICRKIHWGSNPLRIAYLSQEIVLTRDDLANRFK
                     RYNIIFPAMEEEKYMENVELQEQYSRNPDVSVGQLIALKNNLPVHVLESRKLVKTLLD
                     QQHLSPFSSRIRPTIWDLDFTLQLSPLPSSIMLCDSSAPAFDVTYNGCKTINPGRFIH
                     KRMAKYVEFYPATKAVVEEEIPF"
     gene            <1054680..>1055696
                     /locus_tag="KLMA_20504"
                     /db_xref="GeneID:34714972"
     mRNA            <1054680..>1055696
                     /locus_tag="KLMA_20504"
                     /product="NAP1-binding protein"
                     /transcript_id="XM_022818128.1"
                     /db_xref="GeneID:34714972"
     CDS             1054680..1055696
                     /locus_tag="KLMA_20504"
                     /codon_start=1
                     /product="NAP1-binding protein"
                     /protein_id="XP_022674827.1"
                     /db_xref="GeneID:34714972"
                     /translation="MDNLKQYWNSWWYENDGRKYEDYPIKRNRYQPTKLPERYRVQKP
                     KTSLRSVRVQPERKREREREREREPEVKEYRIPKTNVNVRSTWEKVKSLFETDKRDLK
                     QMKQAYVDYKLPSTEANATQEAINNVIANERFKKKLLERRYEKHMLDELRRGRRMHKR
                     GRSSGRGVADDAPLYERTINHADEVILLRKKIDELEQRLSDTIEELVITKKKLEFSQE
                     KNALLEELFDDGNMETEYVKSRRHMANLQNSSRKPELKQLPRSPSPVLHVNPMFTSSP
                     IRATTTTATEGQQDNFYEKYPRIPETENLANYRSPTPANGNDHNDTSLSPVRVDYSKY
                     SNGL"
     gene            <1058851..>1061961
                     /locus_tag="KLMA_20505"
                     /db_xref="GeneID:34714973"
     mRNA            <1058851..>1061961
                     /locus_tag="KLMA_20505"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818130.1"
                     /db_xref="GeneID:34714973"
     CDS             1058851..1061961
                     /locus_tag="KLMA_20505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674828.1"
                     /db_xref="GeneID:34714973"
                     /translation="MSATRNSSFSISQQGQGQGQGGARNRKFSFQMGPTSTYLGRSYV
                     GSFISPPFEGSNEMYESKLPISGDSPANSRMIHETGNLHKQTAMLSNTFDAGSDGVNE
                     LSVLSPEEQEELDRQALDIDKTLDGQNRGDMLQDSRPIVSGDVDDDINFSSSYMQDDT
                     SLLEMSDTGENLALLPSNSHNSFYLEYGTYDEESQSQGMGGHYVSLLPDGPNTNSVQM
                     GRSARSHYDAAKDLTYRIVQYTPAVGLGLLLNILDALSYGMIIFPITEPLFSHLGPTG
                     LSMFYVSTVICQLCFSLGLSSFPSAIGSEMIEITPFFHTMAISIMNSIPEGNDAKVIS
                     TTIVCYALSSVVTGITFFLLGKLKLGKIVGFFPRHILIGCIGGVGYFLVITGLEVCTR
                     VPEFKYSWSFLVSLFTDSDILFKWLTPVILTLILIAVQSRIHNSLVLPSFYIIALLLF
                     HFIVALIPNLSLDKLRDSGWIFPKVSAKENWYDFYKLYDINNIEWGLIPKQIPTMLAL
                     TFFGILHVPINVPALAMSLNVDKYDLDKELIAHGYSNLISGLMGSIQNYLVYTNSVLF
                     IRAGADSPIAGIMLTIGTFIVMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWG
                     KLQPFEYLTILIIVVTMGVVDFVVGIIVGILLACFSFLVNSTKLQTVNGEYDGKVAKS
                     TVYRDYIQSKFLRNIGEQIYVLKLQNLLFFGTIISIEEKVNSLLEKSDADASKKRIKY
                     LILDFKNIRAKSIDYSAAEGFNRIKRFLEKEKIYLIISSIDKNDQIYIAFDKIGLLEN
                     VELFNDLNGALEWCENEFLARYQKLRTKTRAKKLAQMKRTQNRLSKLPINTPRNHQFV
                     SEVRNIYTEEMEIQKLSASDSKERPHFLSILLMSIRKFRTDIQSQDEVKRRKELDLWK
                     RLVPYFEQKKLPPHTQIHHENNMFIVLESGALNLTHHLTQGEFYETMSSKTAYGVLNN
                     NTQYDPQAVTITTDTECVISFLNSETLSKIKSMDPELYTELILLIMSIYRERFRELLG
                     YSLISM"
     gene            <1062329..>1062766
                     /locus_tag="KLMA_20506"
                     /db_xref="GeneID:34714974"
     mRNA            <1062329..>1062766
                     /locus_tag="KLMA_20506"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818131.1"
                     /db_xref="GeneID:34714974"
     CDS             1062329..1062766
                     /locus_tag="KLMA_20506"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674829.1"
                     /db_xref="GeneID:34714974"
                     /translation="MASHSNSTSSPVSKVVTPRDVEEYVKENALIDDTESVTSLKASN
                     IDLKKKAIPDFNQPAIDGAEFPEEYEVETRTGLVKVSTLHKLNRQDTRVTQHSSKKGI
                     EKEHEPHGYNAEKLQKRIEQNQKEIDNYHNRSGFKKLLDKIFG"
     gene            <1062934..>1063857
                     /locus_tag="KLMA_20507"
                     /db_xref="GeneID:34714975"
     mRNA            <1062934..>1063857
                     /locus_tag="KLMA_20507"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818132.1"
                     /db_xref="GeneID:34714975"
     CDS             1062934..1063857
                     /locus_tag="KLMA_20507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674830.1"
                     /db_xref="GeneID:34714975"
                     /translation="MCILFATTGHPDYKLIVISNRDEFFERKTHSTCWNHDNFILSPY
                     DLAVEREKHGYGTWLGINKRGKIAVILNSKLNQSQEHAKETARKRLRSRGIVPIKFLE
                     KEEDGTSFEDWDSWDKFNSHHNYLEHTGPFTLFYGDIKSEKFNVIDYLKHSTNPFNDN
                     KHMVVSNDIFYCSEGLHNARWNKTKQGYELLDKLVRSTHGISRESLVEKCFELASNSH
                     YNDEANIDEITMSNVYVPPLKVVENPDAICTSIPIGKYYGTRSQIVILVDKENNVTFE
                     EHVLFESDSDQVHYSANKPKEIIKFQFKIEE"
     gene            complement(<1063928..>1065865)
                     /gene="UTP8"
                     /locus_tag="KLMA_20508"
                     /db_xref="GeneID:34714976"
     mRNA            complement(<1063928..>1065865)
                     /gene="UTP8"
                     /locus_tag="KLMA_20508"
                     /product="U3 small nucleolar RNA-associated protein 8"
                     /transcript_id="XM_022818133.1"
                     /db_xref="GeneID:34714976"
     CDS             complement(1063928..1065865)
                     /gene="UTP8"
                     /locus_tag="KLMA_20508"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 8"
                     /protein_id="XP_022674831.1"
                     /db_xref="GeneID:34714976"
                     /translation="MASISQPFRLSALPKIPSLGNYASNKEYLQTIDGLNPSANKVNI
                     GISGSSVSQYLINPTPKLVFNLSIPSTNIITACDVKEIADDQEVWCYALATKTSHLHL
                     AIKPVIQDAMSSSNADITAQFKFKLQDKAVSIKVYPEAEKVLVVLKNGLIQTFDFQLK
                     LVNTIDIAYDNLEFVQFFEDGKGSEFLFVLCQLKSNKICYKLFQVNDSKVCVELNSII
                     LENNSLEDAKLCYQFGKLYMLKDSNELSIYQLPHLQLQSSIQLPFIEKGAIVSIKPVS
                     SNRVLITSDNIIYLVDLLYNAILFKKELRNIKCIQLLSTAVIAENSDSNRKTIALGVS
                     TKNGANPSSYLDVINIDVGTGTLKDCMGKGFMVKQKQRLQKLFNESNDEDDAELPSPD
                     YEDIIKSLKACKKADNFDAIFFKKLSLNKEYYTDNDRFLNDSELLTKIIDCLFSKFQD
                     EYPKALTYLLTHPLFPPAHAKGLLVRLKNNPRLFKQAIVTCPNLPLDDLLTELFNITN
                     AELCLDITRRVLQDYKKESIKLGIKKLEKIDITNILDMILNSEKQETDLQLNKPQIFQ
                     LMSLIIDSIGLFSLDDEYLERLSSFVNRQVSKVEQNVELLHLLDNDTRHAAYMNNKNS
                     SSSHSANTQPISAYTVEYLDC"
     gene            <1066161..>1066802
                     /gene="SYF2"
                     /locus_tag="KLMA_20509"
                     /db_xref="GeneID:34714977"
     mRNA            <1066161..>1066802
                     /gene="SYF2"
                     /locus_tag="KLMA_20509"
                     /product="pre-mRNA-splicing factor SYF2"
                     /transcript_id="XM_022818134.1"
                     /db_xref="GeneID:34714977"
     CDS             1066161..1066802
                     /gene="SYF2"
                     /locus_tag="KLMA_20509"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor SYF2"
                     /protein_id="XP_022674832.1"
                     /db_xref="GeneID:34714977"
                     /translation="MSSKYIEGTLPTGRQGLLDQYHIDMSEIDELERKLKQLQKQKKD
                     VLLRNQKALLADKKQNSGQRVHGVVDTEESIKSQNKRYQLGNLSESAINYSIREYEEW
                     ETRTHHSRNNRAVMGDFQSIAKNSYKKEVQNLPKGTAHELQGTITEKGTVVVEDNPEL
                     IDNIAKSLNEQAKKRYMVRKQKLEKQNKVDINDGFVNDSNKRFNLKLKDELNK"
     gene            complement(<1066855..>1068117)
                     /locus_tag="KLMA_20510"
                     /db_xref="GeneID:34714978"
     mRNA            complement(<1066855..>1068117)
                     /locus_tag="KLMA_20510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818135.1"
                     /db_xref="GeneID:34714978"
     CDS             complement(1066855..1068117)
                     /locus_tag="KLMA_20510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674833.1"
                     /db_xref="GeneID:34714978"
                     /translation="MFSKLSFNNITDSISNAAHRTQEQFSSAIEKIHLDDPETRLSIL
                     KRRHQLQETLGTVHDISQLPVQYKFLEQKSDALEKICKRLLMVTKTFEVEGYDYPPNL
                     TESFNDWWSGNKDFFSFSKKKQEAASKKAKAEGAENGLLPRSFAQALSKATADSAVVL
                     KQLKEEESKKVDETTATSQASGNVEESETPKKDVETDKAEDAEDAEDDEDDEDIEALI
                     KVFESWTKCQLSMDQSKAEMDSLMVKEFNAKLTKLIEEDFKKGHELRAKVQDARLKFD
                     TLRHEIKIKEQEKEAQQKAKEEAKELETTKEETKEKTKEPNSEEKEKPEKAAESKETE
                     QTTEQKGSEKVQETEDADSKLFEELEDQFVSVTSETVEFLGELTDSTEIISLVKLFHN
                     FQLLHYKQCVKSLEENLEVLNSLDSGEN"
     gene            <1068489..>1068959
                     /gene="RSM18"
                     /locus_tag="KLMA_20511"
                     /db_xref="GeneID:34714979"
     mRNA            <1068489..>1068959
                     /gene="RSM18"
                     /locus_tag="KLMA_20511"
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /transcript_id="XM_022818136.1"
                     /db_xref="GeneID:34714979"
     CDS             1068489..1068959
                     /gene="RSM18"
                     /locus_tag="KLMA_20511"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /protein_id="XP_022674834.1"
                     /db_xref="GeneID:34714979"
                     /translation="MFSRSSVGLRLFSSTRRMANSIDQKLLKDGMNGSKTPTVKKLEG
                     KLIRNFQPGSVYNPFDFSLERIRLDKKYGVRPGSYDPFDRLKINPLDLYTNPEFLSKF
                     VSSTGKILHRDVTGLSAKNQRRLAKAIRRCQAIGLMSKVHKDVSMLPQRTMTKN"
     gene            complement(<1069084..>1070298)
                     /gene="PKP1"
                     /locus_tag="KLMA_20512"
                     /db_xref="GeneID:34714980"
     mRNA            complement(<1069084..>1070298)
                     /gene="PKP1"
                     /locus_tag="KLMA_20512"
                     /product="[Pyruvate dehydrogenase [lipoamide]] kinase"
                     /transcript_id="XM_022818137.1"
                     /db_xref="GeneID:34714980"
     CDS             complement(1069084..1070298)
                     /gene="PKP1"
                     /locus_tag="KLMA_20512"
                     /codon_start=1
                     /product="[Pyruvate dehydrogenase [lipoamide]] kinase"
                     /protein_id="XP_022674835.1"
                     /db_xref="GeneID:34714980"
                     /translation="MASARLFLRKEAFWKVKNGYRSFSNFNNCVMSAKHTNNHHKLAA
                     LSFREMYDIRSNIQHLIKDYSSYDVPKIDWAFLMQHKPPLKDNEQYFLTIKTLNILLT
                     LTCHRLAALQELPYIALVNPNIEQSNRLYLKTLESLLSIEYPYDLYDTAKMQNLTKEF
                     LNDHQDTLLTLSNGLQEISNFYDHEKIFKFLNNHLHDRILMKLLTTNYLELLKQDENT
                     RDKIGVIHKDLHISDLVLRTNEFVNDLTFIKYDKTVPVKIMDGADVKFSYIPTDLEYV
                     LQEVLKNSSRAHIENNVEREVEVTIVKSYEQLEIRIRDFGGGINPQVEDLIFDYSFST
                     TEKDAKDTGMSAYILPGQEVQNVAGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDVYI
                     KLQGPSNKLFVR"
     gene            <1071488..>1072393
                     /gene="GVP36"
                     /locus_tag="KLMA_20513"
                     /db_xref="GeneID:34714981"
     mRNA            <1071488..>1072393
                     /gene="GVP36"
                     /locus_tag="KLMA_20513"
                     /product="protein GVP36"
                     /transcript_id="XM_022818138.1"
                     /db_xref="GeneID:34714981"
     CDS             1071488..1072393
                     /gene="GVP36"
                     /locus_tag="KLMA_20513"
                     /codon_start=1
                     /product="protein GVP36"
                     /protein_id="XP_022674836.1"
                     /db_xref="GeneID:34714981"
                     /translation="MSQYFGTFSKKVQELSSSVSQKAQEAQLDQKFKDLKTNTSLFAN
                     STQRLIQEKLGQVTDISQLPDEYTQLENRVDKIKLIYENFLKVTKIYENESYDYPGNI
                     KESVDEFSKTVGGKLHELSKATNREQAQSALLSSQLKEPKTLNYALSKVALTSSEHVE
                     DDVLANFLAKYSDVQTKIAQLRLQQDTMIQTKFNKAIKEKLDQEIAASTKARKLVEQK
                     RLQYDVVRSNRLKNTKPEKQAALQVEESTYEEEFAKATDDAIIAMSKVVELADFTTNL
                     QELVAAQLAYHKNSAELLEELVNES"
     gene            complement(<1072760..>1074604)
                     /gene="TPA1"
                     /locus_tag="KLMA_20514"
                     /db_xref="GeneID:34714982"
     mRNA            complement(<1072760..>1074604)
                     /gene="TPA1"
                     /locus_tag="KLMA_20514"
                     /product="PKHD-type hydroxylase TPA1"
                     /transcript_id="XM_022818139.1"
                     /db_xref="GeneID:34714982"
     CDS             complement(1072760..1074604)
                     /gene="TPA1"
                     /locus_tag="KLMA_20514"
                     /codon_start=1
                     /product="PKHD-type hydroxylase TPA1"
                     /protein_id="XP_022674837.1"
                     /db_xref="GeneID:34714982"
                     /translation="MTRLEAKRPAEDHHSGRSEKARSLNKGAVASASFNPKIWDKKFQ
                     KDLKQQIHDAKPYNWGTIRDLVDPELLLNVRREIETYIHFTQKETDIYKVNQSGDLAN
                     LSGLDDSDLSKLPNLVKLRELLYSEKYRDFIGDVTQSGKLSGSKTDISINTYDKGCHL
                     LTHDDVIGSRRVSFILYLPEPERVWKEHYGGALRLFPSIVPNVPYSDHSAKLVPQFNQ
                     IAFFKVQPGFSFHDVEEVKVDKHRLSIQGWYHIPQKGEPGYIPGEEEEWIDTNISTLS
                     QLVNSPLQDYEFPKVEKVPVSHFESKKLVESEDLLTEEDTKYLSQFLNPDYLTPELMK
                     NLSDKFLENSFINIESFLNEEYSKLLLQLIKDKEFNYECPYESKDVKHPWKTSLPPHK
                     WRYLYMDGKSYTNFQNEKDIKEALNKTELPNFYQTLDAISNQKELNCEAKLCELVTFL
                     QSLSFKKWIVQLTKLIILSEQILVRRFRPGKDFTLATTTEINELLKNVPGFVEAVLEC
                     TLCLTPTKGWESGEVGGYELYMNNQSEDADDDAAVYRTDDTGESVLINKPASWNSLNL
                     VLRDENVLQFIKYVSWAAKSSRWDISIQWDVKSNDEDDDEDDDDVDEN"
     gene            complement(<1075506..>1075781)
                     /gene="ISD11"
                     /locus_tag="KLMA_20515"
                     /db_xref="GeneID:34714983"
     mRNA            complement(<1075506..>1075781)
                     /gene="ISD11"
                     /locus_tag="KLMA_20515"
                     /product="protein ISD11"
                     /transcript_id="XM_022818142.1"
                     /db_xref="GeneID:34714983"
     CDS             complement(1075506..1075781)
                     /gene="ISD11"
                     /locus_tag="KLMA_20515"
                     /codon_start=1
                     /product="protein ISD11"
                     /protein_id="XP_022674838.1"
                     /db_xref="GeneID:34714983"
                     /translation="MSAPAPTRTQILHMYKDFIRNANKIQNYNFRHYFLRRAKESFRE
                     NKNVQDPKKVNELLTEAEKDLGVLKRQSIISNMYTFDKLVVEPLKKR"
     gene            <1076134..>1076583
                     /locus_tag="KLMA_20516"
                     /db_xref="GeneID:34714984"
     mRNA            <1076134..>1076583
                     /locus_tag="KLMA_20516"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818143.1"
                     /db_xref="GeneID:34714984"
     CDS             1076134..1076583
                     /locus_tag="KLMA_20516"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674839.1"
                     /db_xref="GeneID:34714984"
                     /translation="MDHYEEFQKLQELLNDPKYKPFINVAKKVVYYTSVYLIWALQTI
                     QSIVLRYPQISDWLGYLFSLYMVYQTLKRTVRMVRSSGYLIFLLLGIYVWRRGISQVV
                     LMDMPYLIDRLKKYVKNLPNDSKVHRTFAQDISSPVLELYYAIQDLF"
     gene            <1077120..>1078391
                     /gene="CAJ1"
                     /locus_tag="KLMA_20517"
                     /db_xref="GeneID:34714985"
     mRNA            <1077120..>1078391
                     /gene="CAJ1"
                     /locus_tag="KLMA_20517"
                     /product="protein CAJ1"
                     /transcript_id="XM_022818144.1"
                     /db_xref="GeneID:34714985"
     CDS             1077120..1078391
                     /gene="CAJ1"
                     /locus_tag="KLMA_20517"
                     /codon_start=1
                     /product="protein CAJ1"
                     /protein_id="XP_022674840.1"
                     /db_xref="GeneID:34714985"
                     /translation="MVKDTTYYDILQVSYDATPAEIKKSYRKLAIKTHPDKNPNDPDA
                     QTKFQELAKAYQVLIDEDSRKKYDQFGLDESNGEIPMDQDPYEMLMAVFGGDSFTAWI
                     GEYGLLKNFLSESDLFQEEDESEGDKSDSAAPANAENGSSSELTKHNGKKASVEREKE
                     REKEKAKRDKMREFEERRMEDQRKQVEILVNNLNKKYEEYTACIKSGSEDEFFNKLQK
                     EIDDNLKYESFGLELLQLIASVYKRKAKNFIMSKKTKGISKIFTGTREKGKTVKSMYK
                     TVSAAMDAMKTQQLTEDIDWEAMDPFERANVETQIQGKSMGLFWALNKFELEQKLKLV
                     VDKLLDDKSVPSKTRIDKANFLIMLADRFSSAKRNPEDMDPVILEFEELVRNAKHIKV
                     NAPLKPKSAEVHPVENTNHAGAIHPPQENAN"
     gene            <1078813..>1080195
                     /gene="TED1"
                     /locus_tag="KLMA_20518"
                     /db_xref="GeneID:34714986"
     mRNA            <1078813..>1080195
                     /gene="TED1"
                     /locus_tag="KLMA_20518"
                     /product="protein TED1"
                     /transcript_id="XM_022818145.1"
                     /db_xref="GeneID:34714986"
     CDS             1078813..1080195
                     /gene="TED1"
                     /locus_tag="KLMA_20518"
                     /codon_start=1
                     /product="protein TED1"
                     /protein_id="XP_022674841.1"
                     /db_xref="GeneID:34714986"
                     /translation="MALPRLLKRFTLFLTAVTLIFNIYIYTYPSIHPKACSWKCHEES
                     ALSADETNPLVSYFKDLLSSHKDKNKDDIRLMAFGDPQIKGIWPSTPYMTRLDTFGND
                     YYLGHIFRMMYNRLRPSHVAVMGDLFSSQWIGDSEFFNRTVRFTKRLFNRDPSWLYDI
                     KEKHHNDQGKYASDWISWADNMTAIREKGRPMDLGFGYENVYNWTASDDYLFINISGN
                     HDIGYSGDATYQHVARYNELFGKDNYWIEYDAGTDRAWRLVVLNDLLLEGPALQPELL
                     DINWEFLYQLIERKFEGSTVLLTHVPFYKPAGLCYDGPEFRYYPDDYEREPYKAKLLR
                     SQNHLSDSISNRVLNLIFDRNYPGIILTGHDHEGCETFYNKNAEDGTWSASSTPSSDS
                     LTIKEITVKSMMGQYHGNTGLVTGHFNENTKQWEWHFSLCPFSIQHIWWFTKVVTIIT
                     GFLWSLALFL"
     gene            <1080520..>1082853
                     /locus_tag="KLMA_20519"
                     /db_xref="GeneID:34714987"
     mRNA            <1080520..>1082853
                     /locus_tag="KLMA_20519"
                     /product="protein SAP1"
                     /transcript_id="XM_022818146.1"
                     /db_xref="GeneID:34714987"
     CDS             1080520..1082853
                     /locus_tag="KLMA_20519"
                     /codon_start=1
                     /product="protein SAP1"
                     /protein_id="XP_022674842.1"
                     /db_xref="GeneID:34714987"
                     /translation="MENHGLLMKFSKIRKKPQQPLNALAELYSRIANETIHYLDLEKK
                     HEYKAAIQGWKIMATDAMYKLNMIDRQYPNFASYTPEELNLQSGIRDLCEKALKNLER
                     VQSLYEDVTKTESSTNTRTPSISSNGRFKVHTLRDGVHRMRYNRGGSGLGLKSDKNTS
                     TSNNNTVNFSASKSLPAVIVSDPFADFDDDEMNLIDLSDAETAPSAPPIPPPAPPPVP
                     PRAPTYGHSPKSTFNISSAEIRQQDNYFDYMDISEEDLTRLKTLDSLNGTTNAFSTLS
                     LDSSETSAQPQTPRRPSEPVPQSQRPVGITRPKKSTDNITLKSHNSPQTKKNYPVQRR
                     NTSINAALAASNLQTNKLKSKSASSKKSAATHLTPSARSSPGTNSIPKPRATTSKSSP
                     SLLNTATTRSNSPSKRRMGSTSSVSSANNTNTNTNNYNNNNNNASSPPPGDIQPSDQI
                     DVVAQTKEELEDAIIDSLPGVDRTAAKQIFSEIVVHGDEVYWDDIAGLDTAKNSLKEA
                     VVYPFLRPDLFRGLREPVRGMLLFGPPGTGKTMLARAVATESKSTFFSISASSLTSKY
                     LGESEKLVRALFAVAKKLSPSIVFVDEIDSIMGSRNNDGENESSRRIKNEFLVQWSSL
                     SSAAAGKGSSATDSDDRVLVLAATNLPWSIDEAARRRFVRRQYIPLPEPETRKIQLKR
                     LLLHQRHTLSEEDFDELVCLTENYSGSDITSLAKDAAMGPLRELGDKLLFTETDKIRS
                     VSLDDFRNSLKYIKPSVSQDGLARYEEWAAQFGSSGV"
     gene            <1083399..>1084520
                     /locus_tag="KLMA_20520"
                     /db_xref="GeneID:34714988"
     mRNA            <1083399..>1084520
                     /locus_tag="KLMA_20520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818147.1"
                     /db_xref="GeneID:34714988"
     CDS             1083399..1084520
                     /locus_tag="KLMA_20520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674843.1"
                     /db_xref="GeneID:34714988"
                     /translation="MPVTVTPLEDKPVGAIINLPEGCDDPSTLSEEDFKTVYDALMTY
                     SVVVIPGMENLKPESQWKLTTMFDPTCDQTGAAYGHGKEFRHEKSVLRRDGMTIPYQP
                     QVQVLGQGSWPAGHHGMGELTLRHPVHFDFHKDPLTDKEAFEEDKTRFYRWHIDSALY
                     GLSPPVATTLLGIHVPPNSRKQYIHYDDTGDVLEVTQGATAFVSGANAFDLLSDEDKE
                     RALKTTVVYAPHPYIFISPARATSDGLTMVSEGKEMSLDELPPWEESKIKRLPLVWTN
                     PVTKKHHLQVHGCCIHKLELPDGTVLELEDARKEVYRLMRPAIDPKHVYAHSWNKGDL
                     VIFHNRGVWHSVTGQFKEGEKRLMHQCNIASGEDPITVF"
     gene            complement(<1084707..>1086998)
                     /gene="NOT3"
                     /locus_tag="KLMA_20521"
                     /db_xref="GeneID:34714989"
     mRNA            complement(<1084707..>1086998)
                     /gene="NOT3"
                     /locus_tag="KLMA_20521"
                     /product="general negative regulator of transcription
                     subunit 3"
                     /transcript_id="XM_022818148.1"
                     /db_xref="GeneID:34714989"
     CDS             complement(1084707..1086998)
                     /gene="NOT3"
                     /locus_tag="KLMA_20521"
                     /codon_start=1
                     /product="general negative regulator of transcription
                     subunit 3"
                     /protein_id="XP_022674844.1"
                     /db_xref="GeneID:34714989"
                     /translation="MAHRKLQQEIDRVFKKINEGLEIFDMYYERHENCINNPSQKDKL
                     ESDLKREVKKLQRLREQIKSWQSSPEVKDKDALLNYRRSVEVAMEKYKAVEKASKEKA
                     YSNISLKRSDVLDPQEKERREVEDFLSQQIEELERQFDLLEIEVDRLILLQKKRKTAT
                     PENEKELQRLKDLQGRYRYHQQQMELALRLIANEELEPQQVRDIEEEILYFVEENQTE
                     GFIEDDSMYEGLDLQSNEAIAHEVAAAFASRAAGDVSGDDVEGKDGKLSKKEQRRLER
                     EAKKNAKAAAKSSVLDVNPTPVITGKKISEASSDADESESNAHTSVPETQTPPPSSKS
                     VSLSPPVTAGSVESPLPNTASTTAPSKPHTPLSKLAILSSSTGAQTANNETQPHGFTH
                     IHQSLNGLTTTTLKPAPVKPVSENKWALATEKKLASLKAKSLGSVPMTPTMSASSSSA
                     AANSTGLPALSNTPNSSNVKLNESALSKQNYTKPVPSDLTNNNNNKQSSTSGSEPDLI
                     EDDYEIESTDDELENEPVPVEISKEELASKSELLNNVQNNLCADLELLTLPAGIKDFV
                     MGSVISKDKLYKNDGKLGGYRRFYDLCQPCRLNEIPSTVFPPQPLDVARCVQQWDQTL
                     LSLNVDELTLANVAKKFEGLETFTLFYYYYFSILPLEQRICGLLLRNRDWKLLTSGDC
                     WFLRQGEPKFVNEFFEIADYKIFKMDIWTVVDKLNFKLDYSVIAKEEPFAELSEQDNA
                     GNVPTFGKQLLETLKQRKAEEKP"
     gene            complement(<1087376..>1089148)
                     /locus_tag="KLMA_20522"
                     /db_xref="GeneID:34714990"
     mRNA            complement(<1087376..>1089148)
                     /locus_tag="KLMA_20522"
                     /product="pheromone-regulated membrane protein 3"
                     /transcript_id="XM_022818149.1"
                     /db_xref="GeneID:34714990"
     CDS             complement(1087376..1089148)
                     /locus_tag="KLMA_20522"
                     /codon_start=1
                     /product="pheromone-regulated membrane protein 3"
                     /protein_id="XP_022674845.1"
                     /db_xref="GeneID:34714990"
                     /translation="MVQPIKFVSLKVRLLHRVTDPIILFPTLTVIFIVWFMHVINLFT
                     ESILENSNTPQITVTKTISSTITKTAEASITSSTTSSISTPVNTLDANTIDATFKFYI
                     NSTLNQNQELINQDISQRITPLIQSYIQNWNYSFINVRSLLNNAENDLNQLKNKIVDS
                     LDTQAKRLNESVSTLKESGLIVASSSDQTDALNNIYLDYSGINADFTELSQSLNGSSK
                     TRENLNLPNISFTRFKFNISLQSDPIESFISDVNSKLSEKLPENNKQKRSLSTERKVK
                     KPSSKFVNLTVIFLCIYPALIVGVMIIEWFSHVIRMQLTLSTIDQQLIEWTETKNKLE
                     RYNIWKPMVLDLCESFQNSITTKFFNLVQATIRRIRHTSEDDDNNESNNKISKLIWWF
                     TNTCVMQWYLLLFILIVWSIVITLLPNTDLYSTTLSTVNKRYGEGSISTRSMTGEFNE
                     LVDICQSFDSKINDLIESQISDFYNNTLNVSLDRWNAQMSSIVSSLPSPISDYVPWEN
                     MTSITKIEPIFLNISELANIIWSPLNEINNTSSRSAMVSLFRRSSSRPNTFPLKSYVD
                     KLFKNSIIVWVCIHLAQLALSIII"
     gene            complement(<1089536..>1090387)
                     /locus_tag="KLMA_20523"
                     /db_xref="GeneID:34714991"
     mRNA            complement(<1089536..>1090387)
                     /locus_tag="KLMA_20523"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818150.1"
                     /db_xref="GeneID:34714991"
     CDS             complement(1089536..1090387)
                     /locus_tag="KLMA_20523"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674846.1"
                     /db_xref="GeneID:34714991"
                     /translation="MLNGIDQERVIEHQRGVCLFGYPFFSEKLLVPGYDPPRFLAMIG
                     NEEDGFKSLPVMIPHGKRGNSNTKNLRKMIPLPFEGDENKAVRSRMRSTRSANTADNG
                     LEESRDYHPHYPRDGEEWYVMMEHGVSDVDDQGWMYSWSFKSRQWKGRYGFVRKRIWI
                     RLPSTTPELVQIHDLGSRRERMESQQSHVEEEMQQDETQDTVVDRNTALPEPNEKTDA
                     LINELKTCTLDRKRFELLNEVLHSWSKYDLMELTKEPILSSILGTFQFETSRERFRNE
                     ILDGLAK"
     gene            <1091597..>1093138
                     /gene="CST6"
                     /locus_tag="KLMA_20524"
                     /db_xref="GeneID:34714992"
     mRNA            <1091597..>1093138
                     /gene="CST6"
                     /locus_tag="KLMA_20524"
                     /product="basic leucine zipper domain-containing protein"
                     /transcript_id="XM_022818151.1"
                     /db_xref="GeneID:34714992"
     CDS             1091597..1093138
                     /gene="CST6"
                     /locus_tag="KLMA_20524"
                     /codon_start=1
                     /product="basic leucine zipper domain-containing protein"
                     /protein_id="XP_022674847.1"
                     /db_xref="GeneID:34714992"
                     /translation="MNSDNRDPLIKVEMESSGRLNGALGSVDVPISFPDDILGGGVGT
                     GSTNSPAITDAIPSASATAPISQVGNRIVKNGEDNSKQRSDVDGSSGVISPNAAAVAA
                     VVANSSNFVTGPGPVPNSAPPNLNFGTSDGMVVDENTKFANSRMTNANFAMFPSYMQA
                     HSLMDPSIQESLSPFFQPFGVDSSHFPMTNPPIFQSALATDSFNPRRRRISISNGQIG
                     QLGEDEDNVESIYYSQPPPMPPMRSSQMQTNNSRVKMESPLTHGNSNNNDNNNSNSNS
                     GNGNDNRNVSNSGNNNNNSDGRSVAYNMTLGANSGNFAPSTSQLYASKMSFQQLQQES
                     KSFGQSVEEPPSGPMTREFGQNSAYAMEMSTQGSDASSVKSNGSHKSSDRHALPGTAA
                     WKRARLLERNRIAASKCRQRKKIAQEQLQKDVVVLKNSNKIMKSKLEFYQKLVTKFKR
                     FMELHMESCGGNKDGLTMIEEMLKIDHDLQQDDQGNLVKSNSSSDSHSNTNTNTNPNT
                     YSYKN"
     gene            complement(<1095206..>1096327)
                     /gene="CKA1"
                     /locus_tag="KLMA_20525"
                     /db_xref="GeneID:34714993"
     mRNA            complement(<1095206..>1096327)
                     /gene="CKA1"
                     /locus_tag="KLMA_20525"
                     /product="casein kinase II subunit alpha"
                     /transcript_id="XM_022818153.1"
                     /db_xref="GeneID:34714993"
     CDS             complement(1095206..1096327)
                     /gene="CKA1"
                     /locus_tag="KLMA_20525"
                     /codon_start=1
                     /product="casein kinase II subunit alpha"
                     /protein_id="XP_022674848.1"
                     /db_xref="GeneID:34714993"
                     /translation="MRSKVWSEARVYGNANEVRGQRYWDYENTSIEWKANNSQYEVEC
                     KVGRGKYSEVFQGVQLSTREQIVIKMLKPVKKKKIKREITILANLSNEKNPPTAQPFD
                     REKYYTNKREEVLKYARDAVYDLPHDGHQNIVTLLDVVRDPVSKTPALVFEYINNTDF
                     RTLYATFTDLDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQRKLRLIDWGLA
                     EFYHPSMEYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGAMLASMVFLKEPFFYGSS
                     NTDQLVKIVRVLGSDDFEKYLQKYQITLPDEFVDMDQYIRRPWQRFVNDANKHLCGND
                     EIIDLIDNLLRYDHQERLTCKEAMAHPWFAPIRNNEYSY"
     gene            complement(<1096769..>1097608)
                     /gene="CAP2"
                     /locus_tag="KLMA_20526"
                     /db_xref="GeneID:34714994"
     mRNA            complement(<1096769..>1097608)
                     /gene="CAP2"
                     /locus_tag="KLMA_20526"
                     /product="F-actin-capping protein subunit beta"
                     /transcript_id="XM_022818154.1"
                     /db_xref="GeneID:34714994"
     CDS             complement(1096769..1097608)
                     /gene="CAP2"
                     /locus_tag="KLMA_20526"
                     /codon_start=1
                     /product="F-actin-capping protein subunit beta"
                     /protein_id="XP_022674849.1"
                     /db_xref="GeneID:34714994"
                     /translation="MSVEEKFDAACELLCRLDPTKVKAQIQNIIALEPEIAGDLLSTI
                     DVPLTVKKDPEANNKEFLCCDYNRDIDSHRSPWSNKYFPELSATDLEESPFPSEPLRQ
                     LELTCNDSFELYRDLYYEGGITSTYLWDVDESTDFAGVVLFKKAESDDAKWDSIHVIS
                     ATHDEDGTEVTYSITTTVILHLENMSKEQQLSLSGNLTRETSKTIKMRNVTTVEQIVN
                     AHSANLGSMVEDIESKLRSMLEVVYFEKTLDIYNALRENSSQSEKLQKEQHSELIENL
                     QKL"
     gene            <1098325..>1098774
                     /gene="ERG28"
                     /locus_tag="KLMA_20527"
                     /db_xref="GeneID:34714995"
     mRNA            <1098325..>1098774
                     /gene="ERG28"
                     /locus_tag="KLMA_20527"
                     /product="ergosterol biosynthetic protein 28"
                     /transcript_id="XM_022818155.1"
                     /db_xref="GeneID:34714995"
     CDS             1098325..1098774
                     /gene="ERG28"
                     /locus_tag="KLMA_20527"
                     /codon_start=1
                     /product="ergosterol biosynthetic protein 28"
                     /protein_id="XP_022674850.1"
                     /db_xref="GeneID:34714995"
                     /translation="MLTLQQVTDYMQDVVKSLAPGYLPKWLLFISIVSIFNSVQTYVN
                     LELTRRVYENKPEETTALSARTFGTWTLVSCIIRLYGALYITENHVYQLTFISYIIAL
                     FHFGTELVVFRTCKIGKGFLGPLVVSTTSLVWMYNQKEFYTGIPFPF"
     gene            complement(<1099085..>1100485)
                     /gene="PKAR"
                     /locus_tag="KLMA_20528"
                     /db_xref="GeneID:34714996"
     mRNA            complement(<1099085..>1100485)
                     /gene="PKAR"
                     /locus_tag="KLMA_20528"
                     /product="cAMP-dependent protein kinase regulatory
                     subunit"
                     /transcript_id="XM_022818156.1"
                     /db_xref="GeneID:34714996"
     CDS             complement(1099085..1100485)
                     /gene="PKAR"
                     /locus_tag="KLMA_20528"
                     /codon_start=1
                     /product="cAMP-dependent protein kinase regulatory
                     subunit"
                     /protein_id="XP_022674851.1"
                     /db_xref="GeneID:34714996"
                     /translation="MSDFKTELNLFSREVEQKQPVDFLQFAANYFNKRLEQQRTFVRN
                     QESLALSKGIVLFPSTTKHDSVAASSASISQGGSKAGTAPPENLVDEDVMFKSPFGDR
                     GPHSKDTVEDASVDSGAPDAPDSNVGLAGGRNSPGLFKGGFNVGTESGKKANASLDPM
                     APEPAYQQHNRPRKSVVNPKPLPINFNAQRRTSVSAETLQPDHLDNWKPENFQEKTPE
                     QIKRLEKAVGRNFLFNKLDSDSKKLVINSLEEKHVAKGEEIIKQGDEGDYFYIVEDGT
                     VEFYVNNQKVNTSSSGSSFGELALMYNSPRAATVIAATDCVLWALDRLTFRRILLGGS
                     FKKRILYDDLLKNIPILKSLSTYDRAKLADALDTEYYEAGDVIIKEGDTGENFYFIEY
                     GEAEVSKENQGVITKLGKGDYFGEVALLNDLPRQATVTATTRTKVATLGKSGFQRLLG
                     PVVDVLKLNDPTRSDH"
     gene            complement(<1101019..>1103514)
                     /gene="IRC5"
                     /locus_tag="KLMA_20529"
                     /db_xref="GeneID:34714997"
     mRNA            complement(<1101019..>1103514)
                     /gene="IRC5"
                     /locus_tag="KLMA_20529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818157.1"
                     /db_xref="GeneID:34714997"
     CDS             complement(1101019..1103514)
                     /gene="IRC5"
                     /locus_tag="KLMA_20529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674852.1"
                     /db_xref="GeneID:34714997"
                     /translation="MALDIVEMMKRSKPVVRNCNKAAVNYKEKSENDLSADVYLESDS
                     DSDEKKGVNMSETPVWLDGSDDDDTMLDSDDSDESDKELDELLEEKQKDEKNKNKEEE
                     KDLGKDVNFENDAHTVSLKIKKLQEFVKQSQVYSGIIADTLLERAGQSNEVAEPAKKK
                     QKKDVIQAVTEASNSTSNSSSTSTQPSLLKNCQLKPYQQEGLNWLITLYENGLNGILA
                     DEMGLGKTIQSIALLAFIYEMDTKGPFLIAAPLSTVDNWINEFGRFAPDIPVLKYHNS
                     EGQASRHRMLKKFFKQNNNEGVIVTSYEIIIRDIEMILSYQWKFLIVDEGHRLKNINC
                     KLIRELKRINTSNRLLLTGTPLQNNLSELWSLLNFILPDIFSDFEIFNKWFDFSELDL
                     ESSSEKLTKLINDELEKNLISNLHTILKPFLLRRLKKNVLAGSLPPKREYIIECPVTP
                     LQKKFYKQALKKNLKTSVTKQAIKEFFTLNSKHIGRVSNKAIREFIDWKLGTTDGDSL
                     QLQDPEHDKTMQKMDILYKEHIHRELLNKRLQNMMVQLRQVVNSTYLFYFPFLDAADM
                     TLENLLKTSGKLQVLQKLVPELIKQNHKVLIFSQFVSMLDLIEDWCDLNNFKSCRIDG
                     SMQNDSRKDQIHEFSKRGSKANIFLLSTRAAGLGINLTAADSVIIFDSDWNPQVDLQA
                     MDRAHRIGQTKPVIVYRLYCDNTIENVIMTRAVNKRKLEKLVIQMGKFNTLKKLAFNE
                     QSFLKMNGPSSSTKQPGNKDLVKELSQLLMSNETNIGQTDTSRIESSGDILDDNEMHE
                     LLDRTASAYLPHDNKKTSFNHIRLFETTSGFDN"
     gene            <1103913..>1105574
                     /gene="RSC8"
                     /locus_tag="KLMA_20530"
                     /db_xref="GeneID:34714998"
     mRNA            <1103913..>1105574
                     /gene="RSC8"
                     /locus_tag="KLMA_20530"
                     /product="chromatin structure-remodeling complex protein
                     RSC8"
                     /transcript_id="XM_022818158.1"
                     /db_xref="GeneID:34714998"
     CDS             1103913..1105574
                     /gene="RSC8"
                     /locus_tag="KLMA_20530"
                     /codon_start=1
                     /product="chromatin structure-remodeling complex protein
                     RSC8"
                     /protein_id="XP_022674853.1"
                     /db_xref="GeneID:34714998"
                     /translation="MSVERADTDNDVKSGSPGTEVKGSGPVFPHLQQQQQQLVVENSK
                     IDYEAEAKKLEEKANRFLAKQTHPVIIPSFAAWFDFDDIHELEKRALPSFFNESSRFK
                     TPKAYKDVRNFMINTYRLSPYEYLTVTAVRRNIAMDVASVLKIHQFLEKWGLINYQID
                     PRSKPSLVGPSFTGHFQVVLDTPQGLKPFVPPEVVEDTESTSQTPAAESADGSSAPVT
                     VKEEKKLEFKKPETFPVNLSLRKNVYDNLHDFNALRQLNLQSKHINRQYICFTCGNDA
                     TTIRYHNLRSKNVNICSRCFEEGHFGANFHSADFIRLTENSAASTSSWSDQELLLLLE
                     GLEMYEDKWDKIVDHVGGAKTLEMCIEKFLSLPIEDKYINEILPKPAASQSDNKTKSI
                     STTEAVDATIKSLLDGLNDKVLNEDIPKAASNISEKYVQEAQLVVQDLVEATLDKLDL
                     KLKKVDQIEKSMKAERDIYIKETERLVNERLKLSKQIKDINAHLAELQITKRIVLSSD
                     QKSETDISLMEKADAEHENELKKNEDIDIQSISKAEPQLYKKWSL"
     gene            <1105837..>1106397
                     /locus_tag="KLMA_20531"
                     /db_xref="GeneID:34714999"
     mRNA            <1105837..>1106397
                     /locus_tag="KLMA_20531"
                     /product="protein SRN2"
                     /transcript_id="XM_022818159.1"
                     /db_xref="GeneID:34714999"
     CDS             1105837..1106397
                     /locus_tag="KLMA_20531"
                     /codon_start=1
                     /product="protein SRN2"
                     /protein_id="XP_022674854.1"
                     /db_xref="GeneID:34714999"
                     /translation="MIPELPPRPDRPQSEEILPCQEISLPPNVELLTTEDIQHLLQQR
                     EKLKDYSKRFNDPALSNVVDESAEWRKDSQELLKAFEALSGEKKELKSQLDVYKKLEF
                     DYLKKWQDLDHIISNKFDNEALKKQLRHKIIDLDEKSSRMVNDIPVNDESLDVFLEQF
                     ILERTDYHLQREKLATWEYQDILKKP"
     gene            complement(<1106535..>1107653)
                     /gene="PEX7"
                     /locus_tag="KLMA_20532"
                     /db_xref="GeneID:34715000"
     mRNA            complement(<1106535..>1107653)
                     /gene="PEX7"
                     /locus_tag="KLMA_20532"
                     /product="peroxisomal targeting signal 2 receptor"
                     /transcript_id="XM_022818160.1"
                     /db_xref="GeneID:34715000"
     CDS             complement(1106535..1107653)
                     /gene="PEX7"
                     /locus_tag="KLMA_20532"
                     /codon_start=1
                     /product="peroxisomal targeting signal 2 receptor"
                     /protein_id="XP_022674855.1"
                     /db_xref="GeneID:34715000"
                     /translation="MLKYHMKGYSGYGVAYSPFYDNKLAVASGSNFGLVGNGRLTILD
                     IMPNGQLMESNSFLTQDGLFDLAWNESHENQCLVAQGDGSLRLFDIKLKDYPVAIFKE
                     HSREVFSCNWNMIQKQLFVSSSWDGKVKVWSLMRPHSMLTLSPNDTNAAATLNKTSTV
                     APVRVPMSNQKDHQNADGNKECIYQATFSPHDPNIVLCCSGNSFVSLFDLRVPNNGLP
                     QHQFLGHGGFESLTCDFNKYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEI
                     QGHELAVRKIAWSPHHSNMLLSTSYDMTCRIWTDLSDDGHRLTGKTNSIDPAHGCRFI
                     FMEHTEFVFGADWSLWGTPGFVASTGWDGQVCIWNGLR"
     gene            complement(<1108147..>1110351)
                     /gene="SAN1"
                     /locus_tag="KLMA_20533"
                     /db_xref="GeneID:34715001"
     mRNA            complement(<1108147..>1110351)
                     /gene="SAN1"
                     /locus_tag="KLMA_20533"
                     /product="protein SAN1"
                     /transcript_id="XM_022818161.1"
                     /db_xref="GeneID:34715001"
     CDS             complement(1108147..1110351)
                     /gene="SAN1"
                     /locus_tag="KLMA_20533"
                     /codon_start=1
                     /product="protein SAN1"
                     /protein_id="XP_022674856.1"
                     /db_xref="GeneID:34715001"
                     /translation="MSNANERPEENMAGRGNMENGSNGGDPGSNGSGGSRSHFTIAIN
                     YATLSGNGEQNGASAGTGVFPPMIFRFADVPSDTSSGRLNEVIALASEYIFQTLTRDQ
                     RRQRGLTREAFEKLELRDVDTLEDNTCAICYDELTNDPKDFANLSSKRSREGENGDGN
                     DDEGNAEESVPDSPRKRQRTVESEEEDLNVDVNSDPFQVPGPTPTPTPTPISTTATEP
                     AESAGPANTTTTEPNLDSAPNTNNSPNSQGEDASNYGHSATVLPCGHIFGRDCLFTWT
                     TEHNSCPICRASILSEDELNDVHNRENESAGAAMNNGNGPDAAQQSTFESIRRLLYER
                     SPEPAVANNIAERNTNTNVNNTGEQSTSSDNSEHPTTGDSSNTSTNTGATDSRQAGDA
                     TQDITNTNNNTSRSFSTSFIFFLSDIHAHPRTTATMPNSDTTGANQSAGRAASPSPAT
                     NISQGSFLDARNERSNTNTNTDTNTNTNTNTDTTTERASTGTTTGNNTNNINTGVNGP
                     TITHFNDLPEDNRRLLGNIRAILRRAQEERNSTGRPTDNNEQTANSQNNTGAHDLGQN
                     TRRFFNLLPLLGRRQQSPGNNETNTTTPSNSQPPSTDLHTDPALENRYSAYLEHLNTL
                     RNGNRPPTESTGSRFRLPSFFRLGRQQAAHRHEGGRRPSDEQNNVTNNPLLNPNANLF
                     SSGVASYRHANGVRTVNFTGDIPEPPTATNTPQANQQQENDDEQQQQHQDQE"
     gene            complement(<1110896..>1112701)
                     /gene="YPS1"
                     /locus_tag="KLMA_20534"
                     /db_xref="GeneID:34715002"
     mRNA            complement(<1110896..>1112701)
                     /gene="YPS1"
                     /locus_tag="KLMA_20534"
                     /product="aspartic proteinase 3"
                     /transcript_id="XM_022818162.1"
                     /db_xref="GeneID:34715002"
     CDS             complement(1110896..1112701)
                     /gene="YPS1"
                     /locus_tag="KLMA_20534"
                     /codon_start=1
                     /product="aspartic proteinase 3"
                     /protein_id="XP_022674857.1"
                     /db_xref="GeneID:34715002"
                     /translation="MRLSDVCVGTLLASVVSGGSISRRDVSEVGESNRKHLVMSFDKL
                     RGNDATDASHEKRQLGRFVKRDNGHVEVEIDNQQTFYSVDLSIGTPSQNVSVLVDTGS
                     SDLWVPGSGNPYCSNSKGKRQNADFISSLAGEFTSLFGGGGGGDFTSTVILSGSGIGG
                     GGGTFTDSDVPDASGTDLPTGTQSVPSSEATLDCSKYHTFNSAKSSTWKSNKTKFYIS
                     YADNTFAEGVWGIDKMHLDDVDVSGLSFAVSNLTDSQFGVLGIGLTGSESTYSGALSR
                     SDRYQYDNFPLVLKRNGVIDKTAYSVFLNKLEAKSGSILFGAVDHNKYSGTLYTVPLV
                     NSLKSKGYDTVIRLSVTLQGVGITTSDSKTTITQTKYPALLDTGATFCYFPEDLASAI
                     ADKVNASYDSKSGYYLVDCNSGDDYTVAFDFGGFHINSPLSDYMISTSGSSKTCIMGI
                     LPQQDNEISLGDAFLTSAYVVYDLEDEEISLAQANYNSNSEDIEVISSAVPSAQKAPG
                     YSSTWVSAQSMSSGGNIFTTQDNSNNSSTTTTASSSGFNSNSGSGSGSASATSTTKSD
                     SSKNGKSSGAAAGLKLPSIPVLIALILGLTVPALF"
     gene            <1113602..>1114120
                     /locus_tag="KLMA_20535"
                     /db_xref="GeneID:34715003"
     mRNA            <1113602..>1114120
                     /locus_tag="KLMA_20535"
                     /product="ubiquitin-conjugating enzyme E2-21 kDa"
                     /transcript_id="XM_022818164.1"
                     /db_xref="GeneID:34715003"
     CDS             1113602..1114120
                     /locus_tag="KLMA_20535"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2-21 kDa"
                     /protein_id="XP_022674858.1"
                     /db_xref="GeneID:34715003"
                     /translation="MNRLAKEYKGIQRRLAESEWLEEMWPVMEEEEEEAETGNSEGGN
                     LSEWVARFWGPEGTPFEGFLLEVTLSVDVRRYPLTAPRVAFRRRTVAHPNVQYESGEI
                     CLDVLKEAWTPVYGLVDLVDAVRRLLGEPGLESPLDVDMARVYAEDYAAYGQVVRYRL
                     MEASAGVRRADS"
     gene            <1114370..>1114786
                     /locus_tag="KLMA_20536"
                     /db_xref="GeneID:34715004"
     mRNA            <1114370..>1114786
                     /locus_tag="KLMA_20536"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818165.1"
                     /db_xref="GeneID:34715004"
     CDS             1114370..1114786
                     /locus_tag="KLMA_20536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674859.1"
                     /db_xref="GeneID:34715004"
                     /translation="MKQITWKDVGVENGFPLISPGYVTDPSSKLLFSSGCVGTDANNE
                     LPEDLEQQARNAMRNLQTVLETSGSSLSHVLKVLLFVSDPGYAGVVNKVFKEFFPNQP
                     ARSCIVVSFPNNKLKVELECIAEIPKQKKKKRWFKL"
     gene            complement(<1114966..>1115550)
                     /gene="SUE1"
                     /locus_tag="KLMA_20537"
                     /db_xref="GeneID:34715005"
     mRNA            complement(<1114966..>1115550)
                     /gene="SUE1"
                     /locus_tag="KLMA_20537"
                     /product="PET20 super family"
                     /transcript_id="XM_022818166.1"
                     /db_xref="GeneID:34715005"
     CDS             complement(1114966..1115550)
                     /gene="SUE1"
                     /locus_tag="KLMA_20537"
                     /codon_start=1
                     /product="PET20 super family"
                     /protein_id="XP_022674860.1"
                     /db_xref="GeneID:34715005"
                     /translation="MPFLKSKAGQMYRQLPRVPTTRFLSPQELTSDILFSGYRPIVCP
                     LRENPLFQAKVKEAEAKSRQEAESQAQAQAKAQAKETKDPQEEEHPFMAGPNGTGGIL
                     SGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEYYPEWNAIPSKVSASLKPFQLDSDME
                     TRPGVKLQDELQDDKTVDQYEQVVQEYLQQWRGK"
     gene            <1116441..>1120079
                     /gene="CAF130"
                     /locus_tag="KLMA_20538"
                     /db_xref="GeneID:34715006"
     mRNA            <1116441..>1120079
                     /gene="CAF130"
                     /locus_tag="KLMA_20538"
                     /product="protein CAF130"
                     /transcript_id="XM_022818167.1"
                     /db_xref="GeneID:34715006"
     CDS             1116441..1120079
                     /gene="CAF130"
                     /locus_tag="KLMA_20538"
                     /note="intron?"
                     /codon_start=1
                     /product="protein CAF130"
                     /protein_id="XP_022674861.1"
                     /db_xref="GeneID:34715006"
                     /translation="MVVNKSLYRLVREDAEQNEFALVEKVFLALFTTVPGKSITSGLI
                     KVAMGQHEEDCSDLKSCDPCWQNLYKSWRSNRHILDLFLNWMIMIETDEIDLSKYNRP
                     TFKNALRFLLLGADPGFTVPLWDESNLVEEYLQHASPLIQKHLLAMNGERMAHIISKY
                     RRLYEFCGVFSVFDVDPQFQDYYALKCLPNSGIALLEKYCTVILDSRTMDNDIRPFLM
                     EQFEALFAAGILPTSMVSSTVMSTMTDAAASASASASSSQCILPDIKHWLPKKEPPKK
                     QPLEGPFPMFEALGLDQFNTPLMLPQFSLLISFSHPKNHPPPNDKNIISLDLLHEMYI
                     GALSKHISKLSICYQPIWRDLACSNLEIIITRILVYLKLWDYEQLQEIEIRTESDPES
                     CFENLSEWVPNNITYADVEIYYMVLAMCFYSLYKLNSDQLPKLNPSLPLLLRAWKCLT
                     TILMIGLELDRYQESQVNYRTPVVVRSIIRSASAVRALVATILNGHMDKRAHDFKHEP
                     FSAFMSPHGRKVCNGALFTSQLALFTALWPLNDDFEETVDLINEVQRGDRIDEDVRYM
                     FDYEYYDFNDADIDRLDEDDAMFLSTKQELEDRKRFRLLRGFYKRCHCKFSNDDEEED
                     GDDRESIENNDRNNDNDYDENNNNTNNNNNNSNNNNNYNDKNRNNRDNRNGVDLNDDE
                     EDENGFTLDVFKRIIASGNKTRLTPRPENQEQERTSENSAVSSESQGPGKHLKQNIDA
                     SLTNPHINSKGEDWRDIPRGSNLYYNENFSFATKVLKDGMLWGLKTLSLGTLQKDESL
                     ELIRGIATVVRVEQEQLLAKRFGKTSEFFDSTEVEVTSEEIIEATFKNGSKENLSFIP
                     WNESLGWKILDELLMSHNHRRLLIYRLAHAHHSYDSVHYIYELLFGLRGNTLKKYESE
                     SSKNKQLDFASGVNMGSFDRCADIEFSRQGVIQLSMIEKKMLLQEFFMTIIRSVHNGW
                     KHAESQDTTIPAAQRMANKEFLAPAVYMKACILGMVKMVCFILEELLNDKEYEFVAQE
                     DYVFELESFLTTWSSLSPEACSVYSLLKAKMTGRSPGNSEKDDTSALDLEEYEQSLSI
                     DLSRVDLDSVETATGLSDTYNFKGRTIPMKSIAKQFSRILPVDFIEGKPAEKVYKYLS
                     NTYPLTASAPVYGKEVIEYHDEILPMDPKNDHLLYREFLALFGINYMDVLESQQQEAE
                     EESDDIII"
     gene            complement(<1120072..>1121406)
                     /gene="URN1"
                     /locus_tag="KLMA_20539"
                     /db_xref="GeneID:34715007"
     mRNA            complement(<1120072..>1121406)
                     /gene="URN1"
                     /locus_tag="KLMA_20539"
                     /product="pre-mRNA-splicing factor URN1"
                     /transcript_id="XM_022818168.1"
                     /db_xref="GeneID:34715007"
     CDS             complement(1120072..1121406)
                     /gene="URN1"
                     /locus_tag="KLMA_20539"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor URN1"
                     /protein_id="XP_022674862.1"
                     /db_xref="GeneID:34715007"
                     /translation="MSQWKRFKDPSGSYYYFNAVTKVSSRNKPKEYEAWEQQKQALTS
                     PVFCLPLCNSWHLVICFNGSKFYYNGDTGVSQMKLADEESETLLGKMDRSLLSLLVGV
                     ARGFTPRDGRDVYQEVYNMLVELARENKGVAEAQELETQDSEAQELETQKLETQELET
                     QKPEAPEKPQNVLISGYLSSSDDEDEDEDEAEDEGERSDNAPDAESPEKEHANEMVFM
                     DLLNDKDIDPYSTWPLQAKKLLDDPRYHLIPDEKREELFQEWCTQRFEQQKNTPQEEH
                     HPDGDGNDDDESTDLNPTKYHYLAHIISKATITPTTIFSDIKKENKRLFKKLQINDQL
                     SKKEQEQFTSKILAYYKRMDLAEREKVFKTIIKRKLNFPPKSDHLSSLVLKETPTDSF
                     ELETQLLEIENELLILDEQKNSSIQNEVMYYVLGIKDKLHALKQVLKDNYSI"
     gene            <1121669..>1122424
                     /gene="PRE9"
                     /locus_tag="KLMA_20540"
                     /db_xref="GeneID:34715008"
     mRNA            <1121669..>1122424
                     /gene="PRE9"
                     /locus_tag="KLMA_20540"
                     /product="proteasome component Y13"
                     /transcript_id="XM_022818169.1"
                     /db_xref="GeneID:34715008"
     CDS             1121669..1122424
                     /gene="PRE9"
                     /locus_tag="KLMA_20540"
                     /codon_start=1
                     /product="proteasome component Y13"
                     /protein_id="XP_022674863.1"
                     /db_xref="GeneID:34715008"
                     /translation="MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEKGI
                     VLAAERKVTSKLLEQDTSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQNYLKTY
                     NEEIPVEMLVRRLSDLKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGW
                     KAISVGANTQAAQTLLQMDYKDDITLEGAVELALKTLSKTTDASALTYERLEFATISK
                     DSEGNIRQKIYKPTEIAALLEKTEIVKKDEEEE"
     gene            <1122657..>1123170
                     /locus_tag="KLMA_20541"
                     /db_xref="GeneID:34715009"
     mRNA            join(<1122657..1122661,1122753..>1123170)
                     /locus_tag="KLMA_20541"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818170.1"
                     /db_xref="GeneID:34715009"
     CDS             join(1122657..1122661,1122753..1123170)
                     /locus_tag="KLMA_20541"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674864.1"
                     /db_xref="GeneID:34715009"
                     /translation="MKTFFLTGDIPVGYKIPKFPSLYWPIGNDKFNVAYLYYLPDIWR
                     FTVFWTMIFFAAVYGSAGVIAWMTHKNLLFGIWVVPFYILIGLVQAFVSGTVAGIVLA
                     IIYKAGLFSMTTWIPFCCGALQILFNVSTSYSMTSPII"
     gene            <1123752..>1124435
                     /gene="PIN3"
                     /locus_tag="KLMA_20542"
                     /db_xref="GeneID:34715010"
     mRNA            <1123752..>1124435
                     /gene="PIN3"
                     /locus_tag="KLMA_20542"
                     /product="[PSI+] inducibility protein 3"
                     /transcript_id="XM_022818171.1"
                     /db_xref="GeneID:34715010"
     CDS             1123752..1124435
                     /gene="PIN3"
                     /locus_tag="KLMA_20542"
                     /codon_start=1
                     /product="[PSI+] inducibility protein 3"
                     /protein_id="XP_022674865.1"
                     /db_xref="GeneID:34715010"
                     /translation="MPSVEESVATIKAELKYLKEQGALDESAYRDIESLLPRPAPKPV
                     ESSNMSQNLEVVEALYAFAPQQEGDLALQPNDRIEILEKLSPEWYKGRCNGKVGVFPS
                     NYVKPVEKREVVVNRPIPAPVPTPPQYAAYTPPPPQQQQQQQPTQPFPPQFSGYYQQP
                     PPPQQQMQPYVQQYPQAQVVQQQPVPQQQGSGSGGSDALKKFGSKLGNAAIFGAGATI
                     GSDLVNSIF"
     gene            complement(<1124591..>1126399)
                     /gene="NCA2"
                     /locus_tag="KLMA_20543"
                     /db_xref="GeneID:34715011"
     mRNA            complement(<1124591..>1126399)
                     /gene="NCA2"
                     /locus_tag="KLMA_20543"
                     /product="nuclear control of ATPase protein 2"
                     /transcript_id="XM_022818172.1"
                     /db_xref="GeneID:34715011"
     CDS             complement(1124591..1126399)
                     /gene="NCA2"
                     /locus_tag="KLMA_20543"
                     /codon_start=1
                     /product="nuclear control of ATPase protein 2"
                     /protein_id="XP_022674866.1"
                     /db_xref="GeneID:34715011"
                     /translation="MLNESLIAQRLNHVTESLEVQFALWGRDSEVSQSRLSLPLNEFV
                     LELKQEADQVAHAINSNARHNIRWDSLQDKLSTLNAQLSHPEGQKNAGVIGTGADAEA
                     NTESNAPANAHAHVHAGSGSGMHVPMSPVSSDTDKYLLETIVQYMDILQFYHKMQLSM
                     DHYHALVETKDYYSKLRGSVWKYTVIPLQFWRHGFQVSTLKSMFTAKTMKVGDLVNAK
                     DLLATPTRLINYHMDDVSKKLTSEIDALLVSTGEQLSQFESASQAPSESQLSHTNSNS
                     LNIVMSQIQSISKLEFSIPADIRIPPWYERQWFQLSFVSLYGPTLLRRLVQNGQSMWQ
                     LVSQGAYQFVSGLVENWIWTPLTQIWDTISYDSGNLLVTSPENLTSELNSLIRMIVEF
                     LRDRSEHAGSSIDVDELTRQIMDGNLQQFMQIYEHQIESPVRSILFDNMARSLLIQLQ
                     KVKVDGSMAMNGINRLLKSQQLLFSIVSLMPALIIVWALRNFVLSTISSGVEWAKNVE
                     HTKYVINRSLNEVERILNVSESRGALESHDEQMKSLALLNLEIATLRMVMAKYLPKGY
                     RSIWMRDCNDLGDHKLTNEAKVQVINRIHHMYGKFM"
     gene            complement(<1127437..>1129272)
                     /gene="TPO3"
                     /locus_tag="KLMA_20544"
                     /db_xref="GeneID:34715012"
     mRNA            complement(<1127437..>1129272)
                     /gene="TPO3"
                     /locus_tag="KLMA_20544"
                     /product="polyamine transporter 3"
                     /transcript_id="XM_022818173.1"
                     /db_xref="GeneID:34715012"
     CDS             complement(1127437..1129272)
                     /gene="TPO3"
                     /locus_tag="KLMA_20544"
                     /codon_start=1
                     /product="polyamine transporter 3"
                     /protein_id="XP_022674867.1"
                     /db_xref="GeneID:34715012"
                     /translation="MDNEELQSIDSYEEQFPQSYVPAEPTPYDGAGTGSGTEQGSSHL
                     RLVPTETVKSLQDMGLTSDVPIPDVNAPTFSVSKNAIFPEEYTLETPTGLVPVATLHS
                     IGRTPTVISRTRTRQIDRQDGSSSIDDKNEEEGDDEFPSHLDKDIEFVTFVTNDPQNP
                     HNWPLWVRWTYTILLSILVISVAYGSACITGGLFTVEDKFHVSEEVAILSCSLMVIGF
                     SLGPLIWSPVSDLFGRRVAYFISLGLYVIFNIPCALAKNIGTLLVCRFLCGVWSSSGL
                     CLVGGSIADMFPAETRGRAIAFFAYAPYCGPVFGPLVNGFISVSTKRMDLIFWVNMAF
                     AGVMWIITSCIPETYAPVILKRRAKRLRVELSNPKIMTEQEAQGMSVSEMVRECLLRP
                     LYFAATEPVLDLMCFYVCLIYSLLYAFFFAYPVIFGKLYGYKDNLIGLMFIPILIGAS
                     GALATTSYCESKYVALTHKRKPTPEDRLVGAMIGAPFAAIALWILGATSYKHIIWVGP
                     ASSGLAFGYGMVLIYYSLNNYIIDCYAMYASSALATKVFLRSAGGAAFPLFTSQMYDR
                     LGLQWASWLLAFISTAMIAIPFAFYYYGKTLRSKLSKKDYSADAM"
     gene            <1131263..>1133545
                     /gene="CBF2"
                     /locus_tag="KLMA_20545"
                     /db_xref="GeneID:34715013"
     mRNA            <1131263..>1133545
                     /gene="CBF2"
                     /locus_tag="KLMA_20545"
                     /product="centromere DNA-binding protein complex CBF3
                     subunit A"
                     /transcript_id="XM_022818175.1"
                     /db_xref="GeneID:34715013"
     CDS             1131263..1133545
                     /gene="CBF2"
                     /locus_tag="KLMA_20545"
                     /codon_start=1
                     /product="centromere DNA-binding protein complex CBF3
                     subunit A"
                     /protein_id="XP_022674868.1"
                     /db_xref="GeneID:34715013"
                     /translation="MAKIESLLKELPTRTAHLYRSIWHKYTQWLQEQNQDEVANDLEY
                     VLSYKLITTYIVSHDDISKDPSLVCEALIWFARALEVDEQTVTQLREWLHCLVKVLSY
                     DSSNMVHVLQKISINLWNPNTDSLQSKHFKTCQDKLKLLLDFQWKFSTNLSFEDRTSV
                     SLKEIKCIHDPENRKCGLAHTSQPNFVLIPNFDSPFTCPVFTMAVYYYLRFQGVKKYY
                     KGDGYDVLSEFEHIPIIRGKSLDQYPRELTVGNWYPTIFKYCELPYTKKNWFQRNPEW
                     PEFPDMSKIRSTPLERSSRGQGQNESGVSFTDSDSGSDTEYTFGIPNFMIEKMNRSKF
                     QPCPNVRIQLFPTDLPANLQPVFDLLNSVLVTNLPLLYKVFPSHDIFMDPTLKTPQNI
                     AFLMGNRTLDIESQQSILSMVIDKKGIASELAPTLIKSDPNENGLLTYRSPEVPENIT
                     NSLDEIKSELQNMIQLQSSVGFSQLITVLLEIFQKLDIKRSSKQFVIELLQSCKNDMK
                     RALSNPDPNYILLKSDDNGNNLGALNDSSPELENENNIFESMDEQGPLRKKSRPNYAE
                     DPPSDDENMEELAQLVNQLITRKLNENLAQQTDRIISSIQPMLRDMVREEISLALNTS
                     NTEHYSESNNDTKEKTSNKSKNSISPSFSTENDFEMKPECNDIQSIILEWFTPNPECV
                     HSMNKKYGNKWRLSDPNKSLYKMRKPIVQYYIHLINEEKLNKFDAFKRLELLLDRYGT
                     IQTLSEILESEKKNSYASVT"
     gene            <1133713..>1134999
                     /gene="VPS62"
                     /locus_tag="KLMA_20546"
                     /db_xref="GeneID:34715014"
     mRNA            <1133713..>1134999
                     /gene="VPS62"
                     /locus_tag="KLMA_20546"
                     /product="vacuolar protein sorting-associated protein 62"
                     /transcript_id="XM_022818176.1"
                     /db_xref="GeneID:34715014"
     CDS             1133713..1134999
                     /gene="VPS62"
                     /locus_tag="KLMA_20546"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 62"
                     /protein_id="XP_022674869.1"
                     /db_xref="GeneID:34715014"
                     /translation="MEVFLLLCLLFSATVTAVYLNDPFTNLNFTPPIKSPNELLRHER
                     SLADGEIPDYVLDNCPLIHLYSEERYFPGDIASFLPHFRLATGNNETLIDKPLKISDL
                     KSKYKVSGEEYSSDSLYLDTTERFEEDPSWLLGTHPEYGTGLTRDASSILIAVDKGNG
                     WVDAYWFYFYPFNLGPFIMGYGPWGNHIGDWEHSLVRFYKGQPQYIWMSAHGGGASYT
                     YNCIEKKDRWKVTPDGKFDKTQVIKRPLLFSARGTHANYASVGQHAHDVPFFFSALSD
                     FTDRGPLWDPSLRFYGFTYDGHAFHEKKGQNIGTSWLYFLGHWGNKKLKASDPRQKWC
                     PVQWRYIDGPRGPAAKNLVRTALCERSKWWNFWHGCPVRRMIKRGQGLDAERNDLVGD
                     NCGIALYRIRPKWLRSLLRLITWRGAFCFFMDYFTG"
     gene            <1135480..>1136601
                     /locus_tag="KLMA_20547"
                     /db_xref="GeneID:34715015"
     mRNA            <1135480..>1136601
                     /locus_tag="KLMA_20547"
                     /product="protein BTN2"
                     /transcript_id="XM_022818177.1"
                     /db_xref="GeneID:34715015"
     CDS             1135480..1136601
                     /locus_tag="KLMA_20547"
                     /codon_start=1
                     /product="protein BTN2"
                     /protein_id="XP_022674870.1"
                     /db_xref="GeneID:34715015"
                     /translation="MFACTIPETSPFIFTQNCPYKRRRTVYQYAKTNVRYQVANLPNE
                     ILVELKKSVPKATIEKHVLSNVRSYQDTIPRYRVVSDWFGNQYYVENKVDQETIFNDV
                     LRSIDWNQLGKSISRKLFSDYKIELKHDGKELKVSSKKDEIDQIFELDEEVDDVEVTK
                     ICLTEDMNDAVLGLRLIKKVTVEEPIRSVDCHSDEDQPTSYDILMTEDCDSREEPEEE
                     SKEEPKEEPKEEQVEEPKKEHKKRHRHRHHRHHHHHHRSESLSNDESLKQDQAVSSPN
                     KESLLASEPKGTNGTYKIDIDFKDLQNASRESDSGSEEFVEKESQIADDNNKPQISRR
                     GSSSSSGSVVLEEVEDEEHKRWQRSLSASPSGHSVLEDV"
     gene            1136937..1137011
                     /locus_tag="KLMA_R217"
                     /db_xref="GeneID:34718663"
     tRNA            1136937..1137011
                     /locus_tag="KLMA_R217"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718663"
     gene            <1137892..>1138788
                     /locus_tag="KLMA_20548"
                     /db_xref="GeneID:34715016"
     mRNA            <1137892..>1138788
                     /locus_tag="KLMA_20548"
                     /product="kpsF-like protein"
                     /transcript_id="XM_022818178.1"
                     /db_xref="GeneID:34715016"
     CDS             1137892..1138788
                     /locus_tag="KLMA_20548"
                     /codon_start=1
                     /product="kpsF-like protein"
                     /protein_id="XP_022674871.1"
                     /db_xref="GeneID:34715016"
                     /translation="MDFSDLLYHHALAFEEAARFYYDEAELEKLHEALRGMSNGLGSG
                     GKLVFVGCGKSYKIVCKTVAMLTSMGIPARDLHPIEAMHGDLGYCGPADVLVFCSTSG
                     ETDEVIHLLRYMKAENSPWERNLRIAVTGNRQSTLAQSCHNTIMVPQSDRFKEQTLQA
                     GLRAPTVSTTLMIAVLDCICIELSKQWFKNDLAARETFFNQRHPGGGIGKVTSSANLA
                     QLVQPSQTTPDTNNTPTFHTYVVKHVLTETEFLSILITYDYIQFNNKNGTPTLTPTCL
                     LREEYKGAVRSGNLSEWYARYL"
     gene            <1140219..>1142495
                     /gene="KRE6"
                     /locus_tag="KLMA_20549"
                     /db_xref="GeneID:34715017"
     mRNA            <1140219..>1142495
                     /gene="KRE6"
                     /locus_tag="KLMA_20549"
                     /product="beta-glucan synthesis-associated protein KRE6"
                     /transcript_id="XM_022818179.1"
                     /db_xref="GeneID:34715017"
     CDS             1140219..1142495
                     /gene="KRE6"
                     /locus_tag="KLMA_20549"
                     /codon_start=1
                     /product="beta-glucan synthesis-associated protein KRE6"
                     /protein_id="XP_022674872.1"
                     /db_xref="GeneID:34715017"
                     /translation="MNGDSYYGGNNDDHYNMQDPGSSRNPFLDDAELNQFSSDNSGRN
                     SESSLLHRESSLASGDSRSQNDTIEQDSRAHVQPVSDYKGFYARNNNSTTGNNNSINN
                     NSNNAGPHGTTNSAAGGGLRAAAAAQAHNMVHSASTPSGAAAARQSALLPPSNSTPNH
                     GFPSSTSMASNAISTSDITSPPAFDRYPQVGNSRTASTHIGGITPLHGSSSGNNSNSN
                     SSINSSNPFLSDQDFSPFGGYPASSFPLKMDEKEDDDYLHNPDPEEDLKLDKKRFELD
                     LKNMDRRSAGGLFGVLFLFLGAIVVFIVLPIVTFTGAGTHYSPDVVELLTLYQYPQLS
                     AIRTSLVDPDTPDKDKTVKALNGDEWELVFSDEFNAVGRTFFDNEDQFWTAPNLHYDA
                     TKDLEWYSPQQVITSNGTLKLRMDAFKNNNLYYRSGMLQSWNKLCFTQGRLEVSVNLP
                     NYGTVTGLWPGVWTLGNLGRPGYQATTDGVWPYSYEGCDAGITPNQSSPDGISYLPGQ
                     RLSACTCDGEDHPNLGTGRGAPEIDIIEIEADTKLHGVGVGVASQSYQVAPFDIWYIP
                     DYDFVEIYNHTVTTMNTYCGGPFQQAISAVSTLNASWYEFGQDAGYYQKYAIEYLNDN
                     ENGYIRWFVGENPTYTMYAKAMHPNGNVDWRRVSKEPMSIILNLGISNNWAYIDWQSL
                     FFPVTMSIDYVRLYQPKDSVSVTCDPEDYPTYDYIQSHINAYTNVNLTSWEDAGYSFP
                     KNSLTGNCKSSKYKPPSN"
     gene            <1143067..>1147281
                     /gene="SPP41"
                     /locus_tag="KLMA_20550"
                     /db_xref="GeneID:34715018"
     mRNA            <1143067..>1147281
                     /gene="SPP41"
                     /locus_tag="KLMA_20550"
                     /product="DUF3020 super family"
                     /transcript_id="XM_022818180.1"
                     /db_xref="GeneID:34715018"
     CDS             1143067..1147281
                     /gene="SPP41"
                     /locus_tag="KLMA_20550"
                     /codon_start=1
                     /product="DUF3020 super family"
                     /protein_id="XP_022674873.1"
                     /db_xref="GeneID:34715018"
                     /translation="MPSEQGTELNLNELVGNLLAETEGIPSLEETHTTDDHDNLKQDG
                     SDNKEINNNDNVDHNNNDIGNDDILPDLLPMSQLPPMSQLPPVEHTSDHDLASMVSQA
                     IHSMNDNADNIHDNGDLEGENDTDLHSKEQEWANILRQGILQADQEMQEHQQAQHEQH
                     NTSEYQESAAQPTDDQVLDQDDENLRLAILDSLQHLEQEKKTKKHSKKDKKSKEKKKS
                     SKKTEKEKDKSKEKEKSKKKEKKSKGKKSATANDSDILNFEDVIKGFMEQTESVQPPA
                     VTQVENNAPMGDAETQALVEATLKAFENQLLGNSASTKPKTTVKKTQKTSSHKFTKSL
                     PPPLPMPFFPITQKRKVKPKSAKKASKEKHDKEPKAEDTSTKKKKASKKKSSPKDDYN
                     EDEFSKALAEMVNQVVNTSLVDSAQPSQTQTTDVSKTAKTSKKKSKQKSKDKKTESSS
                     EKAKSKESKSSSKKESSPKKKQDTKVIPLDPELFKESVPHVDTNNESSKDTTDVSNLN
                     NDDTLDLHQIMQNAMSMAFQEQVQNPLPSSVMERFDKELAANQYLEPLSRKSVTDRSV
                     IRSRYVPPKKKKKEKKKGELKFNNIHGGLTSTKFNLSKKHAIGSKIVLFKPQKIKQEL
                     ESNSPKTEKDRWRKKFSRICKECAKKGKKWSIERRKKLKDEEKAERNRLKLQRKELKE
                     EQKAKRELEKKELEEIVAKGPPYPEDLCLTSSGRPRKPYRRYTPEEMMQRAAMSSEEL
                     IAFDRSNDDIAQEKREQQKNNSVMKLKQLTLFNPNLAYSGQRLNDLKSSIKKVRKSSS
                     GTISSQKKSKRRHASVFDPTAKTVVHREKIPFHPPWQIPVNPPFALPVARRKKHHSLE
                     KMSRRKRALYQRTLISNTLLPILHTLRAAAKATASAGVDPERSREHLRSMLYQARLTI
                     ADTLQKARSANKTAETPEEAKENNDKLAEKPNIPIPIMRATLKVKKEEPVTNLFNSNS
                     DLSEKSTKELKSDDVQIISESDDTSTTKARKIDEKDSLKIGSKRTLNDAADDSDIRQN
                     VTEVINKLSTLIPSLSKANSLPLMAPPKKKPKSMLNMDEVKIPLNKPKSSSTPNSTSI
                     TNSGAPRPIPIVKMEENTNNDSSLLSEDSEGMIPSTINSDQPKNEDTKVRFKSPAMQV
                     PKKTADLFNKYSFSLPTTNAVGKTVKSIQVMKRVKDYLPAEDITRLKKVKETYRKRKW
                     RLANSDKNKDLELRTRIKMAARKQFGDSDSEEKQKWIAKEYEIRKVKLELDPTTKSNS
                     AVMVTDEEILNIIAVSLDKLDVARTIEHDIQEEVKNNGVLQRKKPSKKPNTKIQTSIN
                     DSVKLPIIPMAQKNTTASSTHIDKSITSASLVAAEHLAEHVSEQVPENRIDPSLAAKR
                     PREDEESETSLNKETLPSPKKACMNI"
     gene            complement(<1147594..>1149174)
                     /gene="CYP707A7"
                     /locus_tag="KLMA_20551"
                     /db_xref="GeneID:34715019"
     mRNA            complement(<1147594..>1149174)
                     /gene="CYP707A7"
                     /locus_tag="KLMA_20551"
                     /product="lanosterol 14-alpha demethylase"
                     /transcript_id="XM_022818181.1"
                     /db_xref="GeneID:34715019"
     CDS             complement(1147594..1149174)
                     /gene="CYP707A7"
                     /locus_tag="KLMA_20551"
                     /codon_start=1
                     /product="lanosterol 14-alpha demethylase"
                     /protein_id="XP_022674874.1"
                     /db_xref="GeneID:34715019"
                     /translation="MSTSESFVGKLFEVLQGLLLQFWALTITQRVSIVILLPFVYNIV
                     WQLLYSMRKDRVPLVFYWIPWVGSAVTYGMRPYEFFEECRQKYGDVFSFVLLGRVMTV
                     YLGPKGHEFVLNARLADVSAEAAYTHLTTPVFGEGVIYDCSNSRLMDQKKFVKGALTK
                     DAFRKYVPLVTEEVQKYFKNSANFKIGEKDHGKINVMVTQPEMTIFTASRTLLGKEMR
                     EKLDTGFAYLYSDLDKGFTPLNFVFSHLPLDNYRKRDHAQRTISATYMSLIKERRANN
                     DIQDRDLIDTLMKSSTYKDGTKMTDKEIANLLIGVLMGGQHTSAATSAWAILHLAERP
                     DVQQELYEEQMRVLDNGKKELTYDLLQEMPFLNQTIKETLRLHHPLHSLFRKVMNDMP
                     VPNTSYVVPKGHYVLVSPGYCHLQDRYFPNAKEFNPHRWDNDAASSYASGEQVDYGFG
                     AISKGVSSPYLPFGGGRHRCVGEHFAYMQLGTLLSNFVRTLTWKYANDKDTVPVPDFQ
                     SMVTLPLAPGEIEWTLRK"
     gene            complement(<1149807..>1151063)
                     /gene="RMT2"
                     /locus_tag="KLMA_20552"
                     /db_xref="GeneID:34715020"
     mRNA            complement(<1149807..>1151063)
                     /gene="RMT2"
                     /locus_tag="KLMA_20552"
                     /product="arginine N-methyltransferase 2"
                     /transcript_id="XM_022818182.1"
                     /db_xref="GeneID:34715020"
     CDS             complement(1149807..1151063)
                     /gene="RMT2"
                     /locus_tag="KLMA_20552"
                     /codon_start=1
                     /product="arginine N-methyltransferase 2"
                     /protein_id="XP_022674875.1"
                     /db_xref="GeneID:34715020"
                     /translation="MSDLHHLLTFPKRPLERSFYVPEVTRLLSAGIPATYTLEQAAAY
                     EKGEDVTEEDSNTTPLHILCRSLPVFESDSKLVEEEEKVVLELMDTLFEYGAGWNFLD
                     YEGKHIGDLVLERGYPQSHRIYQRIVDAGVSAELLLRKIDGGEIEFIDGPDGSDGESA
                     EPKEQELAASGADKTTSSESAPAPADNVDDDATAADQATYLKTELEYTDDALVTKENR
                     DGVMMDWETDIMAMAAKSLVSTASQEEEEECIVLNIGFGMGIIDNFIQNEKAVTKHYI
                     CEAHPDVLKRMKQDGWFEKPNVVVLAGRWQDRLNELLDQGNVFFDGIYYDTFSEHYQD
                     MLDLYDVVVGLLKPQGTFSFFNGLGADRPVCYDVYHKIVQLDVANYGMECKYTNVDLK
                     TLPNWTNVKRSYFNCNYYYHPEIRFV"
     gene            complement(<1151392..>1152078)
                     /gene="SOD2"
                     /locus_tag="KLMA_20553"
                     /db_xref="GeneID:34715021"
     mRNA            complement(<1151392..>1152078)
                     /gene="SOD2"
                     /locus_tag="KLMA_20553"
                     /product="superoxide dismutase [Mn]"
                     /transcript_id="XM_022818183.1"
                     /db_xref="GeneID:34715021"
     CDS             complement(1151392..1152078)
                     /gene="SOD2"
                     /locus_tag="KLMA_20553"
                     /codon_start=1
                     /product="superoxide dismutase [Mn]"
                     /protein_id="XP_022674876.1"
                     /db_xref="GeneID:34715021"
                     /translation="MFAAKSIARRGLQLQPATLLAKRTKVTLPDLDWDFGALEPHISG
                     QINELHYTKHHQTYVNGFNAATEQFEELKTKLDSDPTVAKQLIALQQNIKFHGGGYTN
                     HCLFWKNLAPTSQGGGEPPTGALAKQIETQFGSLDNLIALTNSKLAGIQGSGWAFLVK
                     NMENGGQLEVVQTYNQDTVTGPLKPLLAIDAWEHAYYLQYQNKKVDYFKAIWNVINWK
                     EAAKRFDAAA"
     gene            <1153145..>1155214
                     /gene="PKH3"
                     /locus_tag="KLMA_20554"
                     /db_xref="GeneID:34715022"
     mRNA            <1153145..>1155214
                     /gene="PKH3"
                     /locus_tag="KLMA_20554"
                     /product="serine/threonine-protein kinase PKH3"
                     /transcript_id="XM_022818184.1"
                     /db_xref="GeneID:34715022"
     CDS             1153145..1155214
                     /gene="PKH3"
                     /locus_tag="KLMA_20554"
                     /codon_start=1
                     /product="serine/threonine-protein kinase PKH3"
                     /protein_id="XP_022674877.1"
                     /db_xref="GeneID:34715022"
                     /translation="MSMSRKRTPQDFLFKEQLGHGSYSTVYKAVDRSTGQVFAIKVCS
                     KKHIISEKKVKYVTIEKNTMNLLANGNHPGIIKLYYTFHDPENLYFVLDLAPGGELLQ
                     LLQTQGRFSEAWSRHFMCQLVDSLEYIHSCKVVHRDLKPENLLLSSEGRLMITDFGVA
                     SNLDSSNDNLSSSSSFVGTAEYVSPELLLQNKSNYCSDVWALGCMLYQFSQGTPPFKG
                     ENELATFEKIVNLDYRWICSVSPLVMDLVSNILVIDPAVRYTIPQIKKHAWFNEVDWN
                     NKEAIWKGIWQVYRKSDRVPANAAPLPASSPSSLIANKQLHVIDTPIKNIPIQPRKRK
                     PMKVTQTTSSIVEWRKTLGIAPVAGSIGSNGLPKRPKTPVSHQQPRPPHSNPQFHVAR
                     PPSQEKLTSARNTVGANLHLVSPKAPPITPVSPSRNSSNTLPSPVKYSNSKRPLTPPT
                     SPTPLKQGWVKILEIPYIASPQKIFSHKEYSFIDDKLITKFIAEEKSHIVKESMLCLL
                     TLEPSGQFSYTPKGGATKQMISIIDEELSIYDLEFNEAKNSGYLIFEKFKSILWLIAL
                     PKSAPNDFTVNSGKTWISSLFKIKAMLESEKLSKKVDNLSLKSDSTPSSASSPSPPQS
                     QPPPPPTPTSSSSSSSRHPKASNNRMFVSSSRAEVLYTLNRGRNGSTDAANGASAAFK
                     NMHSERA"
     gene            complement(<1155932..>1157527)
                     /gene="TDA3"
                     /locus_tag="KLMA_20555"
                     /db_xref="GeneID:34715023"
     mRNA            complement(<1155932..>1157527)
                     /gene="TDA3"
                     /locus_tag="KLMA_20555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818186.1"
                     /db_xref="GeneID:34715023"
     CDS             complement(1155932..1157527)
                     /gene="TDA3"
                     /locus_tag="KLMA_20555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674878.1"
                     /db_xref="GeneID:34715023"
                     /translation="MSSNTEFIDKLKFSTKPSGKAEGKHHIVIVGAGIIGVCTAYYLT
                     RHPSFNKDTHHITVIESKRVAGGASGKAGGLLAMWAFPQQIVPLSFQLHQELSDEYDG
                     ENKWDYRRLTTVSLEANVQDDNVSLDPRETGRSREEDDQEEQEQQPQEQQQQQPRKQR
                     PKGKLPAKRKDKKICAVVNNDPVTRVGTTEDDEDYEYSYEEDEDEEEEDDDEEDDEGN
                     ENKVTGDSKRPDGDVSGGLDSKSSIALSKDPTQLPADLNWIKKHLVRDWSSLGGTDST
                     AQVHPYKFTHYLLLKAMESGAVDLILGKVSQLHFNDQCAASGISYIPTIDDPEEQLQQ
                     KPVDIMDVDQIVLSMGPWTSRLLPDCPISGLRAHSITIKPSTGTVSPYAIFTELKISQ
                     NKYFSPEMYARKDEVYVCGEGDTLVELPETSDAVEVVKEKCDELYHYVSKLSPNLSRG
                     HILKRQACYLPVLNVPTSSGPLIGETNVEGLYIASGHSCWGINNAPGTGKVMSELLLE
                     GEAKSADISALDPSLYFDASIFE"
     gene            complement(<1159710..>1161167)
                     /gene="UGO1"
                     /locus_tag="KLMA_20556"
                     /db_xref="GeneID:34715024"
     mRNA            complement(<1159710..>1161167)
                     /gene="UGO1"
                     /locus_tag="KLMA_20556"
                     /product="mitochondrial fusion and transport protein UGO1"
                     /transcript_id="XM_022818187.1"
                     /db_xref="GeneID:34715024"
     CDS             complement(1159710..1161167)
                     /gene="UGO1"
                     /locus_tag="KLMA_20556"
                     /codon_start=1
                     /product="mitochondrial fusion and transport protein UGO1"
                     /protein_id="XP_022674879.1"
                     /db_xref="GeneID:34715024"
                     /translation="MDEIKDSSALRPYYDPETFNVGYSAVFRPDKGVIDQDGLNIASK
                     LSIANQSPAGSLKSLNERFSGGGGLRELTTGVKKKLLDSVTSTRQGIGAKSLNDLEWN
                     DLLNVNIWKQLLEKLMRQLSSKYFHHLVRQPFKVANLLLQVGDFDYVTGDAKSGGLSE
                     PYNDSDECDDSQIDGDGDDDDDENDETEPNFFVTESEARLIDRKVKKRKSDVAENNAL
                     IRPDSIRTIDILNSVMDKEGIQGVWRANNTEFIYNFLSISLDAWFTGLLSPLLQIPDP
                     YFIDIIHSPDVTKTASLILLASCMTSLVLLPLDLIRVRLMITRVNSADEERSLRKLLK
                     KWSWRDNFSKLNKELIFLNVIHSLIGTGFTKLTGAVLYQEFGIDKYTNAVLYNTMKFC
                     SKVVGFFVKLPIENLLRRCQVKFLLSGSALKVERKSLIVKPREYRSIYHTVFHERDRI
                     GELWRGWRLGMMSILCGYGLKILNKPSEALEEEKF"
     gene            complement(<1161571..>1162428)
                     /locus_tag="KLMA_20557"
                     /db_xref="GeneID:34715025"
     mRNA            complement(<1161571..>1162428)
                     /locus_tag="KLMA_20557"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818188.1"
                     /db_xref="GeneID:34715025"
     CDS             complement(1161571..1162428)
                     /locus_tag="KLMA_20557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674880.1"
                     /db_xref="GeneID:34715025"
                     /translation="MTGGKNSVRIVPQPKIRNKDAVDEDLVGGGLYSMSDNDISEISI
                     TLKKLHDVNKSIRERVDAVDDQVRQTQMELENLVSRSSNNNKHLQSLLLSSQDVKELH
                     QLLEKLSVQQQEQMDKNRDVESVLSRIIAEQSVELKESMQSGRIKELEQKIDELESKY
                     GHLESLDARVIEKEKQLTELEVKLQHRQLKFEELRSRAKEMQSQLQEDLLTRYKAVQD
                     SVTLSMTNFANTSSIPSNSTSRTASLLRNKYMNEKFNDKSRRVISLNEPRPVSAFESI
                     PNNNSDFEE"
     gene            <1163415..>1164408
                     /gene="RPL27A"
                     /locus_tag="KLMA_20558"
                     /db_xref="GeneID:34715026"
     mRNA            join(<1163415..1163445,1164029..>1164408)
                     /gene="RPL27A"
                     /locus_tag="KLMA_20558"
                     /product="60S ribosomal protein L27-A"
                     /transcript_id="XM_022818189.1"
                     /db_xref="GeneID:34715026"
     CDS             join(1163415..1163445,1164029..1164408)
                     /gene="RPL27A"
                     /locus_tag="KLMA_20558"
                     /codon_start=1
                     /product="60S ribosomal protein L27-A"
                     /protein_id="XP_022674881.1"
                     /db_xref="GeneID:34715026"
                     /translation="MAKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGTKSHPFGHALVA
                     GIERYPLKVTKRQGAKKVAKRTKIKPFIKVINYNHLLPTRYTLDVEAFKSVVSTETFE
                     EPSQREEAKKVIKKAFEERHQAGKNQWFFTKLNF"
     gene            <1164726..>1166060
                     /gene="DIA4"
                     /locus_tag="KLMA_20559"
                     /db_xref="GeneID:34715027"
     mRNA            <1164726..>1166060
                     /gene="DIA4"
                     /locus_tag="KLMA_20559"
                     /product="seryl-tRNA synthetase"
                     /transcript_id="XM_022818190.1"
                     /db_xref="GeneID:34715027"
     CDS             1164726..1166060
                     /gene="DIA4"
                     /locus_tag="KLMA_20559"
                     /codon_start=1
                     /product="seryl-tRNA synthetase"
                     /protein_id="XP_022674882.1"
                     /db_xref="GeneID:34715027"
                     /translation="MISKRLLHCTGILNAVRKPAFNIKSIINKLDEYTDSINSRELVN
                     GEQLSSSLKEIPQLYGELKEIDYKISHIQQTRKGIEQQVKQDKSTAKEYGLELKSLKK
                     QYQDLVDAQRRIKDVVTETCGSLPNLMHPTVPKTGSPIIDQWINKKDKYIADESREHL
                     NIMVRKEMIDFQTASNVTGSSWYYLCNDGALLEQALVRYATDKARKCGFRVVIPPSVV
                     RNEVIDACGFRPRDMNDEQQIYRLENTDLGLTATAEIALAGMGLNSTLDLSQGPKKLC
                     GVNRAYRAEAGARGKDTKGLYRVHEFTKVELFVWSKPDESDKILEDLKQFQIDIVKDL
                     NLSAQVLNMPSNDLGSPAYKKYDIEAWMPGRGSFGEITSTSNCTDFQSRRMQTRFRNE
                     QGELEYVHTLNGTAIAVPRVILALVENHYDSTTDKIAIPPALQPYMNNVAYI"
     gene            <1166455..>1167276
                     /gene="VPS29"
                     /locus_tag="KLMA_20560"
                     /db_xref="GeneID:34715028"
     mRNA            <1166455..>1167276
                     /gene="VPS29"
                     /locus_tag="KLMA_20560"
                     /product="vacuolar protein sorting-associated protein 29"
                     /transcript_id="XM_022818191.1"
                     /db_xref="GeneID:34715028"
     CDS             1166455..1167276
                     /gene="VPS29"
                     /locus_tag="KLMA_20560"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 29"
                     /protein_id="XP_022674883.1"
                     /db_xref="GeneID:34715028"
                     /translation="MPLKFKKLLSVPNKIQQVALLGNCNKSASFLKFVNSISENLVLV
                     RGEFDTPTIPTSKNPAEEIPLNTVIVQGSFRIGLCNGYTLVPKNDPLSLLTLARQLDV
                     DILLWGGTHNVEAYTLEGKFFINPGSCTGAFSTDWVQEGIEENYKAGDNNEEHTATEP
                     KTETQEDNDQEAKESVNGEAVAKGSAEDEEKDQPTKQSEQPAAGDQEPPKTSNGEGHA
                     EEDDSSDEEFDDIDINGGGIPSFCLLDIQDITCILYIYTYVDNEVKVDKVVYKKD"
     gene            complement(<1167835..>1168524)
                     /gene="ARD1"
                     /locus_tag="KLMA_20561"
                     /db_xref="GeneID:34715029"
     mRNA            complement(<1167835..>1168524)
                     /gene="ARD1"
                     /locus_tag="KLMA_20561"
                     /product="N-terminal acetyltransferase A complex catalytic
                     subunit ARD1"
                     /transcript_id="XM_022818192.1"
                     /db_xref="GeneID:34715029"
     CDS             complement(1167835..1168524)
                     /gene="ARD1"
                     /locus_tag="KLMA_20561"
                     /codon_start=1
                     /product="N-terminal acetyltransferase A complex catalytic
                     subunit ARD1"
                     /protein_id="XP_022674884.1"
                     /db_xref="GeneID:34715029"
                     /translation="MPITIRHATIDDILAMQNANLHNLPENYMLKYYMYHILSWPEAS
                     FVATTTDDVDDVMDTLVEDEEDVKSLPLPQEPKLDPSYIAHSGEKLVGYVLAKMNDDA
                     DSKETEPNGHITSLSVMRTYRRMGLAEKLMRQALFALCEVHKAKFVSLHVRQSNRAAL
                     HLYRDTLAFEMLSVESSYYQDGEDAYAMEKRLELDQLLPSSFQNAQEEDDLKSDLLAD
                     IASEAIQQASV"
     gene            <1168783..>1169520
                     /gene="TRS31"
                     /locus_tag="KLMA_20562"
                     /db_xref="GeneID:34715030"
     mRNA            <1168783..>1169520
                     /gene="TRS31"
                     /locus_tag="KLMA_20562"
                     /product="transport protein particle 31 kDa subunit"
                     /transcript_id="XM_022818193.1"
                     /db_xref="GeneID:34715030"
     CDS             1168783..1169520
                     /gene="TRS31"
                     /locus_tag="KLMA_20562"
                     /codon_start=1
                     /product="transport protein particle 31 kDa subunit"
                     /protein_id="XP_022674885.1"
                     /db_xref="GeneID:34715030"
                     /translation="MADQIINPSTTHTAKPAGQGYDYTMGPTQTLPNIPSPFNTGAST
                     VPNSSIYDESLIAKDKQVSLSAYSFLFQSMVQYERESSKNVHDIERKLNGLGYKIGTR
                     LTELLNFRDSVPNKPAHTNMDSVANSISSMKRRHIKILETLQYIHLTVWQYLFSRPSN
                     DLVKSSERDNEYMIIDNEPVISQFINQPAVQCESFTCGIIEGFLDMAGFPCHVTSHTV
                     EEAGFTNRTIYLIQFDNAVVERETLRQ"
     gene            <1170633..>1172972
                     /gene="ELG1"
                     /locus_tag="KLMA_20564"
                     /db_xref="GeneID:34715031"
     mRNA            <1170633..>1172972
                     /gene="ELG1"
                     /locus_tag="KLMA_20564"
                     /product="telomere length regulation protein ELG1"
                     /transcript_id="XM_022818194.1"
                     /db_xref="GeneID:34715031"
     CDS             1170633..1172972
                     /gene="ELG1"
                     /locus_tag="KLMA_20564"
                     /codon_start=1
                     /product="telomere length regulation protein ELG1"
                     /protein_id="XP_022674886.1"
                     /db_xref="GeneID:34715031"
                     /translation="MSKREGLLITNILNGYRRQDKALEPDREPETEREPDSTIDDIAI
                     DPALTDDVEEVPSSPLRDFDEQPIAVSSQISETIETNPKKRVNLKTLLSGYSKKPKQE
                     SKQEPKQRSTQQEQYTRSGVSDIIVVEESPVKSKSNVHVISDSVDSNSNLTAAKNSNI
                     ASFLNMERGTAQKRSKISKQKEAPARFPKIQHTPRYHFEDYRPLQLQRKKTLKNETKW
                     SFDESEYVSFFNATKDHELPADSDMFEPISYLDDTTNTQLWTSLFKPKTLEDVLIDAD
                     TKFNVKQWFDKAFELLTKKTDRSALYSRKIEAELDNFIVDNSFLGSDDDSTVTPFIPL
                     IILYGDVGKNTLVDVIMTENDAQVFEINCSMNRAKKDIYEMLHDFATTKYVKDTRSKG
                     IILFDDVDVLLTESDKFFWNSVHATLLVSRRPVAITCRDYRFIPSNLLEIAEEQNSIF
                     NIKTSSKKQVKNYLRRCLQQKGIEVDNNTLNLVIKRNNFDIRKCLMDLQWICTKPGAP
                     IVREHNELIQKENSGNETNDIKNITDAYSRLELTSSYDFIVSNIEGKSFLKGERDPTL
                     NYAKHQFESDQDTIYDIIWDFAEYLWDPNHNNLLPWEKQVYSSIQEKSRQLLEMKGIE
                     DDTSSVSQDRLSMCMEEMFKFLRTRVNTFPQGNILNMVGTTRSSRRKTAKLKDYRLKS
                     EDEDDSFDYESMKMAQREFHATHKSKDIGSLYLPTVYQIAYNESEIKRKNISLFNRLK
                     EHHGPDCNANDIINEMVTKRLILAAYYKGSPQPFIDAYI"
     gene            complement(<1173066..>1174055)
                     /gene="SPT3"
                     /locus_tag="KLMA_20565"
                     /db_xref="GeneID:34715032"
     mRNA            complement(<1173066..>1174055)
                     /gene="SPT3"
                     /locus_tag="KLMA_20565"
                     /product="protein SPT3"
                     /transcript_id="XM_022818195.1"
                     /db_xref="GeneID:34715032"
     CDS             complement(1173066..1174055)
                     /gene="SPT3"
                     /locus_tag="KLMA_20565"
                     /codon_start=1
                     /product="protein SPT3"
                     /protein_id="XP_022674887.1"
                     /db_xref="GeneID:34715032"
                     /translation="MSDKYKYRVEIQQMMFVSGENNEPPVETTSLIEDIVRGQVVEIL
                     LQATRTANCRGSKSIVPEDVIFLIRHDKAKVNRLRTYLSWKDLRKNAKDQDAQQAAAA
                     GAGGAEGSGGAGIDDDDAAKKDKDGAGVNMKVKKSSIKLPWELQFMFNEQPLENADED
                     DMDDDEREANIATLKRLKMADDRTRGMTKEEYVHWSDCRQASFTFRKSKRFKDWSGIS
                     QLIDSKPHDDVIDILGFLTFEIVCAITETALKIKTRYERIRSMKTQSQLQEYSVGVNR
                     RKKRLFDGPDNVVNPLKPEHIEEAWRVLQTVNMKYRALSNYKGGRLTSRTVIM"
     gene            <1174293..>1175231
                     /gene="THI80"
                     /locus_tag="KLMA_20566"
                     /db_xref="GeneID:34715033"
     mRNA            <1174293..>1175231
                     /gene="THI80"
                     /locus_tag="KLMA_20566"
                     /product="thiamine pyrophosphokinase"
                     /transcript_id="XM_022818197.1"
                     /db_xref="GeneID:34715033"
     CDS             1174293..1175231
                     /gene="THI80"
                     /locus_tag="KLMA_20566"
                     /codon_start=1
                     /product="thiamine pyrophosphokinase"
                     /protein_id="XP_022674888.1"
                     /db_xref="GeneID:34715033"
                     /translation="MNRWFKRHNSTSNMSRVIENADREDIRIEGDYDGTIELDQWFNP
                     KAEHSVLLILNQKIELDHSVFEKLWNRYSVKVCADGGANRLYDYFCGDNGERYMPDVI
                     AGDMDSIREEVRLFYETHGKTVVIEQKTQYSTDFSKSINAATLVLLGVDLNAVEIGGY
                     DGVHKLYEQADKSKLTSVPLLILNGIDGRFDQTIHSMVQFYSLQKHDPYYKVCFLTTS
                     DMIILIPSSEKGYWIKVNKMRPMIGNCGLLPLAGPTNIKRTRGLKWDVENWCSSIAEG
                     QVSSSNRFVGDSCCIACDVPIVMNIELRWNKIIVEL"
     gene            <1175489..>1175602
                     /locus_tag="KLMA_20567"
                     /db_xref="GeneID:34715034"
     mRNA            <1175489..>1175602
                     /locus_tag="KLMA_20567"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818198.1"
                     /db_xref="GeneID:34715034"
     CDS             1175489..1175602
                     /locus_tag="KLMA_20567"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674889.1"
                     /db_xref="GeneID:34715034"
                     /translation="MCMCTLYIWEVYARPFFYGDGGGYGGCLMDVQWMDKY"
     gene            complement(<1175765..>1176721)
                     /gene="LSC1"
                     /locus_tag="KLMA_20568"
                     /db_xref="GeneID:34715035"
     mRNA            complement(<1175765..>1176721)
                     /gene="LSC1"
                     /locus_tag="KLMA_20568"
                     /product="succinyl-CoA ligase [ADP-forming] subunit alpha"
                     /transcript_id="XM_022818199.1"
                     /db_xref="GeneID:34715035"
     CDS             complement(1175765..1176721)
                     /gene="LSC1"
                     /locus_tag="KLMA_20568"
                     /codon_start=1
                     /product="succinyl-CoA ligase [ADP-forming] subunit alpha"
                     /protein_id="XP_022674890.1"
                     /db_xref="GeneID:34715035"
                     /translation="MLRTIGRRFFSREATPYDSTIKNLLLSKDTKVIFQGFTGKQATF
                     HAKISQEYGTNVVGGTNPKKAGQTHLGQPVFASVAEAVKQTGATASGIFVPPPIAAPA
                     IREAIEAEIPLAVAITEGIPQHDMLYIAEMLKSQDKTRLVGPNCPGIISPTARVRIGI
                     QPTSIFKPGKIGIVSKSGTLTYEAVQQTTITDLGQSLVIGIGGDAFPGTDFIDALTLF
                     MNDPQTEGIILLGEIGGTAEIEAAEYLKAYNLTREKPLPVASFIAGTVAGQMKGVRMG
                     HSGAIVEGSGTDAESKKKALRAANVAVVESPGHLGKALLEQF"
     gene            <1178101..>1180479
                     /gene="ARP8"
                     /locus_tag="KLMA_20571"
                     /db_xref="GeneID:34715036"
     mRNA            <1178101..>1180479
                     /gene="ARP8"
                     /locus_tag="KLMA_20571"
                     /product="actin-like protein ARP8"
                     /transcript_id="XM_022818200.1"
                     /db_xref="GeneID:34715036"
     CDS             1178101..1180479
                     /gene="ARP8"
                     /locus_tag="KLMA_20571"
                     /codon_start=1
                     /product="actin-like protein ARP8"
                     /protein_id="XP_022674891.1"
                     /db_xref="GeneID:34715036"
                     /translation="MTMDSDHNELESPSKEPSKEPVIGSDGKVSKDIPSKKVPQHLLE
                     KRRLGRIKAAEEFAKKLKIIGIERHENEHIAQPITLKPVSVINQKNYSSNYLKNDDQI
                     FYMRERKHLRQQGQSNGPSTTTTTTAAGTGTATEEGTPALENDENMDAEDDELDCIII
                     HPGSSYIKIGPNYDIFPQQIPNLVAVPTRNGSVPPRQEDVSENEAFQQLKNNIQFDFK
                     ERMRYYKRRIMPNSNEQAATFNAKSEPELVPDLNDFGRIDWIKDQSKSYYGHDAMKCL
                     PSDFKLRSPFINGSFNLNERNYASFQEILSDVEQLIIQALAAEKIGIQKSQFSNYRVV
                     LIIPDLFDKKFVESMIQLLLVELNFQSVALIQESLASCYGAGLSNSTCVIDIGAKQTK
                     VACVDDGVVVRNSSLRLNYGGDDITRLFAHMLLQNRFPYPEWNLNEPNGWMLAESLKK
                     QCITFQDADIAVQLYSFIKRDPYARKYTQSHKYEFKLFDEVMCAPMGIFFPEIFEVIK
                     PKEHEPNEYVINQCPRSRDIYTFKPNDTKSLTQMLCLQEPNKWYSNLSRDIDIVQKLL
                     NLDADDVNDANDSQDEENGNEPQIKENVEDINHRQYNNLAMPLEKAIIESITNASMLL
                     GDNMSKLNVFYSNILIVGGSSKIPALDFILTDRINIWRPKLLSISALSTLMEKIGEVI
                     KTYETENKADLESEDPQAAIAYKKKLSKLIKAEIEAYWDSLQTLHGDEDLLPINILPP
                     PHDMDPSMLTWKGGSVFSKIKLLEELNITKQDWNMLGNRILQYKCIFEYFDH"
     gene            complement(1178923..1179012)
                     /locus_tag="KLMA_R218"
                     /db_xref="GeneID:34718664"
     tRNA            complement(1178923..1179012)
                     /locus_tag="KLMA_R218"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34718664"
     gene            complement(<1180655..>1182982)
                     /gene="SFL1"
                     /locus_tag="KLMA_20572"
                     /db_xref="GeneID:34715037"
     mRNA            complement(<1180655..>1182982)
                     /gene="SFL1"
                     /locus_tag="KLMA_20572"
                     /product="flocculation suppression protein"
                     /transcript_id="XM_022818201.1"
                     /db_xref="GeneID:34715037"
     CDS             complement(1180655..1182982)
                     /gene="SFL1"
                     /locus_tag="KLMA_20572"
                     /codon_start=1
                     /product="flocculation suppression protein"
                     /protein_id="XP_022674892.1"
                     /db_xref="GeneID:34715037"
                     /translation="MSEIEREKSASQEGDRTEEPSSDPAGGSAKGTDPAGEHKNASSA
                     GGSGSNNNVSNSSSTVVVKTEGQQNTTTTTGSSPQNPHFIHKLYSMLEDDDLKDLIWW
                     SPAEDSFLIRPTERFSKALSAYFKHTNIASFVRQLNMYGFQKVSDHKSNWHVTTATTG
                     GSNSSEDPEDSTINLWEFKHSSGYFRKGDKESLKAIKRRSSKYHISGNRKNSGSSVAS
                     NTGPSGVLSSIATSGGSMNVGTGGSHDSASWADYPPPSNRSHSYTSAEAMNAIPTPVF
                     NNIQGPPTSYPVGVNYPVGLVPPAEYVNQPHNQFKSQPIDMKVHELNQSINGLRNENI
                     DLQHRYELAVEELRATNLDMIKMLDLLQKTLMEKMAASTNPTSTNVTTSTSTSSTGEE
                     TSEQPKNVPRPHTPLDKIARKGSILSPRTKVSKDSSSNDQQQHPSSLAEINKFREAIY
                     SRFQKFHETVQNSISVMDLKQQQSSFASMSHHNSGSAPTSSVNLLQAQYNSYNNNGTV
                     PQGQMMTQQPFQTSARSSIADQHVNLMMNPFERRKSSSSSSKKRHMSVLMDPLAPAPQ
                     QQHHHTSGHNIQHQQQQQQQQSVPPQQQAHNGSQSSAPPNVISYKPYYPYGTVPVSNY
                     RASQLYSTTPINSVSGHSSAPSEYGLAIETQNNFITNGPQTPVNIIKPIPAKAPYIEL
                     SGDSTPNGLGSQHASSTQLPQVMPQYANQTFQSAHSMTPVQSQPQGQNTSQGAQSSNG
                     SQYSPSNQKQTQLQTQSHTNSTSGLHSLLSHDSRT"
     gene            <1184064..>1185803
                     /gene="RUP1"
                     /locus_tag="KLMA_20573"
                     /db_xref="GeneID:34715038"
     mRNA            <1184064..>1185803
                     /gene="RUP1"
                     /locus_tag="KLMA_20573"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818202.1"
                     /db_xref="GeneID:34715038"
     CDS             1184064..1185803
                     /gene="RUP1"
                     /locus_tag="KLMA_20573"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674893.1"
                     /db_xref="GeneID:34715038"
                     /translation="MSGPPDMILNNDLSLGTLQDVGSDSSRASDGAAPSDSSDSVLDA
                     EPVSKFTSILDCPVDECIKDDSSQLVNIVPAGFSALLESYFSLFALCIAINVPSQFLK
                     PDFRELPYNEQWFKGDTVAASPYCLVHRDSGPQFVEKSEVVGNELLETQPQLIPRFQR
                     LIAVANSLDSKRSFVSAKLISSGVDVNVTQALRSFDHLSEVFPQFIMNLHTENDMCLK
                     GPNATSKLFNSRALHRPSVAEPFQPTSLSVLNFSPENYAPTLYEMFNPMLLPEEEDEE
                     EEEDEQVDGNSPGNGGSRTRYAIENAFDFLAPVFTIIFDDMDESTEEVNLSHGVEMPM
                     EFYPQLYTKNALEQVVIPVLQERQELRDTNKAKLNKMTSLQSFQGKQIKSFLNSSINY
                     LDEIQLGDDPTRSKELRDHLQHISDELSTKKRELLVQYTELQKQITQLSFERPSDRII
                     ELARQRGVIDEPYVLRLAALSPYDYLIARNVSNNDKHSSSGSNSAESPWLRVVTDFGS
                     TTITQHPLTETEAQDVIKSATRHASETPILFVYIKKDSIEPVSEIRRALAGNQPLADF
                     LQKDFDFLSRLML"
     gene            <1186637..>1188376
                     /gene="SIA1"
                     /locus_tag="KLMA_20574"
                     /db_xref="GeneID:34715039"
     mRNA            <1186637..>1188376
                     /gene="SIA1"
                     /locus_tag="KLMA_20574"
                     /product="protein SIA1"
                     /transcript_id="XM_022818203.1"
                     /db_xref="GeneID:34715039"
     CDS             1186637..1188376
                     /gene="SIA1"
                     /locus_tag="KLMA_20574"
                     /codon_start=1
                     /product="protein SIA1"
                     /protein_id="XP_022674894.1"
                     /db_xref="GeneID:34715039"
                     /translation="MTVRNVKLSLLIKRLTVIWVLVTIITLWSDIHKHLRNWARSGEK
                     FPELGDDVRVKDVRVSRCYSWYRSCDAIWDYNMRDELVTWFRVDRDKRQDTAVGRGLL
                     WRTYVYWQPTGPLDASAVVDLAMSHEGLPLGLVNERYNKIRNKDIDGYHVHSKTKTDY
                     NFFIKTDRKSYEGASGSDLKWSAKFGNHLEEWFWKGDGLWCKYGPKSQGVKKIKAFIG
                     SDFMESRPMWSEMVHCMPRQGFSKPISFSFLKSTSNSDSGKNHQFPREPHLLVKQNDF
                     KILQLTDLHFGANANDAWAGSSSDYESGQPNSVYRFDSPNVQFVQTAIRNELPDLVVI
                     TGHLFKGFNKHLDYETQILKIVAPIITHGIPFVIAWGEDDLANEYKTQILNFIKELPF
                     CLNKFDPNNSTNIMLPILSSVQGRQKRIGTIYAFDTNVTESYNFLKESPVPPESVFNF
                     AFQHYPLQEYRPKGTFALIGSYEEKGSLDYLPPTIEFRNLLGKKNVKAFSCGHEHGND
                     CCILSDGKQQNLNNNMWLCYGGIAGYDPLYESKTRLFKIDLEKTDITSWKRTLKDRNR
                     VFDYQYIWTQSPN"
     gene            complement(<1189099..>1190205)
                     /gene="IDH2"
                     /locus_tag="KLMA_20575"
                     /db_xref="GeneID:34715040"
     mRNA            complement(<1189099..>1190205)
                     /gene="IDH2"
                     /locus_tag="KLMA_20575"
                     /product="isocitrate dehydrogenase [NAD] subunit 2"
                     /transcript_id="XM_022818204.1"
                     /db_xref="GeneID:34715040"
     CDS             complement(1189099..1190205)
                     /gene="IDH2"
                     /locus_tag="KLMA_20575"
                     /codon_start=1
                     /product="isocitrate dehydrogenase [NAD] subunit 2"
                     /protein_id="XP_022674895.1"
                     /db_xref="GeneID:34715040"
                     /translation="MFKQSFLKQSCRFLATKKQPSIGRYTGKPDPKTGKFTVSFIEGD
                     GVGPEISKSVKQIFAAANVPVEWESCDVTPIFVNGLTTIPDPAVASINKNLIALKGPL
                     ATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVDLVLIRENTEGEYSGIE
                     HVVAPGVVQSIKLITQDASERVVRYAFEYARAVGRPKVLVVHKSTIQRLADGLFVNVA
                     KQLSSEYPDIELQTELLDNTVLKTVQTPEAYRDVVVVCPNLYGDILSDLNSGLSAGSL
                     GLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEK
                     AVLTTIASSAENRTGDLGGSASTSSFTEAVINRL"
     gene            <1191207..>1193102
                     /gene="UBA2"
                     /locus_tag="KLMA_20577"
                     /db_xref="GeneID:34715041"
     mRNA            <1191207..>1193102
                     /gene="UBA2"
                     /locus_tag="KLMA_20577"
                     /product="ubiquitin-activating enzyme E1-like protein"
                     /transcript_id="XM_022818205.1"
                     /db_xref="GeneID:34715041"
     CDS             1191207..1193102
                     /gene="UBA2"
                     /locus_tag="KLMA_20577"
                     /codon_start=1
                     /product="ubiquitin-activating enzyme E1-like protein"
                     /protein_id="XP_022674896.1"
                     /db_xref="GeneID:34715041"
                     /translation="MPRESNLVKCIGEESYQRVRNTKVLLVGAGGIGCELLKDLILLE
                     FGEIHIVDLDTIDLSNLNRQFLFRQRDIKQPKSVTAVKAVQRFNNSNLIAHQSNIMDT
                     DKFPLSWFDQFDIIYNALDNLAARRYVNKMCQFTGKPLIESGTSGFDGYIQPIFPRDT
                     ECFDCTTKETPTTFPVCTIRSTPSQPIHCVVWAKNFLFGQLFSDSAEESADNQDFGTD
                     DEQEIARIKEETNELHALQKLIKSGDTSRIPDILKKLFVDDINKLLKIENLWKTRTKP
                     DPLTVVHPTDDVPNDLAQVWTLQQNVNKFVEATKKLMARLKNEPFIEFDKDDEDTLLF
                     VSCAANIRSYIFHIPAKSVFDIKQMAGNIIPAIATTNAIIAGLSSLVSLRVLNLLKTV
                     SNKPLEIPMAFTARASNITTNRYLSNPTLAPKNPNCAVSSNTQRAVLKLSKSVISEMT
                     LYELNQKIIKKYGFSGEFSVLDTNSNSLIYDFDFDDLEGRKLSRFNFKTGTALLYKDE
                     ETEEGAELRQSIEFYLELLPDEEVIEDLELPDLERATYIYHSPYSNDEDEDGESISDS
                     KPEEDIQETDIVILDSPEPEKDDENVLKRSLSNGSQLPPAKSTKLNPSEEVVVEDEEE
                     EDLILLD"
     gene            complement(<1193598..>1195487)
                     /gene="SAC7"
                     /locus_tag="KLMA_20578"
                     /db_xref="GeneID:34715042"
     mRNA            complement(join(<1193598..1195272,1195324..>1195487))
                     /gene="SAC7"
                     /locus_tag="KLMA_20578"
                     /product="GTPase-activating protein SAC7"
                     /transcript_id="XM_022818206.1"
                     /db_xref="GeneID:34715042"
     CDS             complement(join(1193598..1195272,1195324..1195487))
                     /gene="SAC7"
                     /locus_tag="KLMA_20578"
                     /codon_start=1
                     /product="GTPase-activating protein SAC7"
                     /protein_id="XP_022674897.1"
                     /db_xref="GeneID:34715042"
                     /translation="MGTVEGHGHGHGHSQSPSKNQLTNWWRQFRSNPKSASSETLSES
                     RRKRHDKGAGIGDNSNVNVNSESFKEYRDAFLNERHGFTGQVFNVPLSQSLSVASAEV
                     IVQTELSSFGRIPIVVAKCGAYLKQQGLETSGIFRIAGNSKRIKELQYIFSTPPHYGA
                     KFNGWDEFTVHDVASLLRRYLNHLQEPLIPLALYDSFRKPLIDRPRIIQHLKKVADEE
                     STAALPLGGTPAQPQAQVQTPEETTGTGAGAEAEVDADAEVDADTDALAAAAADEELR
                     RQKKQKSKKRLTKDIKNAIKDYDQLFELLPDDPRQLFIYLLDLLSLFAQQSDKNLMTG
                     ANLAAIFQPSIISHPDHDMDPREYEISRLVVEFLLRYSYKLLPHLLKLKKRKPQTISV
                     SDSFETDDTNQGGSNAATIQGNDNQNRTETGTGAGNGNVNANTNGNKNNDENNPPDQD
                     KDYVEVNATAVPVTPVEKTKFTDKQNIGSLTPPDPHYLDVPKTRPYSKSLSSANAPSD
                     MITSRANSKIPLLNKLFSSDTEDEYESSSRPSSPMLRKTGSSNSGKMLQLPVITGKGV
                     NDQTFRVMKSDNEIDETHNDQRQPRSKKRESWLHRLKSRSRSSLRE"
     gene            complement(<1196899..>1198299)
                     /gene="RVS167"
                     /locus_tag="KLMA_20579"
                     /db_xref="GeneID:34715043"
     mRNA            complement(<1196899..>1198299)
                     /gene="RVS167"
                     /locus_tag="KLMA_20579"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818208.1"
                     /db_xref="GeneID:34715043"
     CDS             complement(1196899..1198299)
                     /gene="RVS167"
                     /locus_tag="KLMA_20579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674898.1"
                     /db_xref="GeneID:34715043"
                     /translation="MSFKGFTKAVQRAPQSFRQKLNMGQQTSDPVYEDAERRFKELES
                     ETKKLSDESKRYFNAVNGMLQHQIGFSKAMSEIFKPISGKMSDPNATVPEDNPEGIEA
                     SEQYCSIVAELQTTLKPDLTLIDEKIVKPAQELLKIIDRIRKMATKRNHKKLDLDRAL
                     NTFNKYDQKANPTPKDEEKKYKAEANVQVAQQEYDYYNDMLKNELPYLFQLEGEFVKP
                     LFVSFYYMQLNIFYTLYNKFQDMKIPYFDLDTDILEAFQAKRGNIEEQTDSLTITNFK
                     LGYSKAKLDMTRKRYGVNDSRPGSPGSPVGQPPAYGAGLGSPGAPGAPGAPGAPGAAG
                     AAGYNYGAQQPAYGAQQPAYGAQQPAYGAPAAGAAVGAGVGAGVGAAAAAGGYGYNSP
                     SATATQASYTPPTSVGTETCTALYDYTAQTEGDLSFPAGAVIQVVDRSDAAGWWVGIY
                     NGVQGVFPGNYVELSK"
     gene            <1199708..>1201465
                     /locus_tag="KLMA_20580"
                     /db_xref="GeneID:34715044"
     mRNA            <1199708..>1201465
                     /locus_tag="KLMA_20580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818209.1"
                     /db_xref="GeneID:34715044"
     CDS             1199708..1201465
                     /locus_tag="KLMA_20580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674899.1"
                     /db_xref="GeneID:34715044"
                     /translation="MLDDMHETQPASAGTNTGSGSSLGANGVPGSRSPLLPALVSRDA
                     DSVEDVYSDLYSTVSQLTTTTANDIEQQPYPLTWRSSVMLVSATIGGLLFGYDTGVIS
                     GVLVSMNPSDLRLVELYDWQKEVITSITCAGSFVGSMVAYPLADRCGRKYTLTVCSVV
                     FAVSSILMALSVTLGMLVAGRLVVGIAVGIAAQCIPVYLSEISPARIRGTVLALNSIS
                     ITLGQLVAYVMAYVLVDPVDPYNKTPAAWRYLFGLGCLPALVFVLTLDFVPESPRWLL
                     SQLRIHDAEMALHTIYPKASANEVRYALRKLVHNLNKIRLHNDETDPLILPASAKRRS
                     VASSRTGRSSLDALLFSSLNEPENSNALGTGLKRKRHRWEARSKRALLVGCVLMFFQQ
                     ITGFNAFMYYSATIFKQAGFTNPTVPSIIVALTNFTFTLLALQLIDTVGRRMMLLMTI
                     WIMTIGLLLCSVGFELQNLSLLIVSVIIYVGAYAAGMGVVPWSSVEFLPLNRRAVGGS
                     IISCTNWLTNSVVSMSYLSVMKRIGNENTMLIFALFTILNWLFVYIWYPEVKGLSLEE
                     IGQVFENGVDVHFIYRNYY"
     gene            complement(<1201590..>1203443)
                     /gene="MUS81"
                     /locus_tag="KLMA_20581"
                     /db_xref="GeneID:34715045"
     mRNA            complement(<1201590..>1203443)
                     /gene="MUS81"
                     /locus_tag="KLMA_20581"
                     /product="crossover junction endonuclease MUS81"
                     /transcript_id="XM_022818210.1"
                     /db_xref="GeneID:34715045"
     CDS             complement(1201590..1203443)
                     /gene="MUS81"
                     /locus_tag="KLMA_20581"
                     /codon_start=1
                     /product="crossover junction endonuclease MUS81"
                     /protein_id="XP_022674900.1"
                     /db_xref="GeneID:34715045"
                     /translation="MSIPDNAKELYVNFLQEEVNERTAAHQEKLVMVLNRALFALKQY
                     QECLHHPKDLLKVKGIGQTTMNKLSKKLKEYCDKNGLLFPEETNAPEDTQNSTQTDSN
                     STVTQRSRVRTLEPVDDESQNRRKRRKKQYIPRNRSGGFGILLGLLELGCDRDGMTCT
                     RRQLIKEAAKYCDQSYEKNPSTKEFYSAWNSIKSLKSNNLVVEQGRPLQYSLTEEGKI
                     LAESLKSANDINFDPSSAYERRKSRHEAGNTSLMTDDELMNSVNYSNLMNNANISADK
                     SLDSSRLFLDATIQSSRIEGNTESEHVPISSTPVAAEQGSKGRWKGVKYELWKPGTYD
                     VILYIDHREVRSKDDRGFFLRKLSQKGIKAESASLTIGDMIWLAKHKKSGKQCALNFI
                     VERKRLDDLVISIRDNRFAEQKNRLQKTGCKHIFYLVEETTGANVSDSAEMMKTSIWT
                     TVIYNDFHIKRTRNADTTVQWLTDMSLIISNLYSKKSLVVINHDNITNQDIYLTSLKL
                     FRKEFERNKEIECCHNYESMQSAMVKTNLMTVKELYLRALMSVKGISLEKALMIQSRY
                     PTFKSLLKAFRNCQTESDGKLLIQHELRDAPGNRKIGKTLSNILWETFGKM"
     gene            complement(<1203861..>1206389)
                     /gene="EFT1"
                     /locus_tag="KLMA_20582"
                     /db_xref="GeneID:34715046"
     mRNA            complement(<1203861..>1206389)
                     /gene="EFT1"
                     /locus_tag="KLMA_20582"
                     /product="elongation factor 2"
                     /transcript_id="XM_022818211.1"
                     /db_xref="GeneID:34715046"
     CDS             complement(1203861..1206389)
                     /gene="EFT1"
                     /locus_tag="KLMA_20582"
                     /codon_start=1
                     /product="elongation factor 2"
                     /protein_id="XP_022674901.1"
                     /db_xref="GeneID:34715046"
                     /translation="MVAFTVDQIRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAG
                     IISAAKAGEARFTDTRKDEQERGITIKSTAISLFSEMTDDDVKDIKQKTDGNAFLINL
                     IDSPGHVDFSSEVTAALRVTDGALVVVDTVEGVCVQTETVLRQALGERIKPVVVINKV
                     DRALLELQVSKEDLYQSFSRTVESVNVIISTYADEVLGDVQVYPQKGTVAFGSGLHGW
                     AFTVRQFANRYSKKFGVDREKMMDRLWGDSYFNPKTKKWTNKDRDADGKPLERAFNMF
                     VLDPIFRLFAAIMNFKKDEIPVLLEKLEIVLKGDEKELEGKALLKVVMRKFLPAADAL
                     LEMIILHLPSPVTAQNYRAEQLYEGPSDDPACIAIKNCDPKADLMLYVSKMVPTSDKG
                     RFYAFGRVFAGTVKSGQKVRIQGPNYVPGKKDDLFIKAIQRAVLMMGRFVEPIDDCPA
                     GNIIGLVGIDQFLLKTGTLTTFEGAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGL
                     KRLSKSDPCVLTYMSESGEHIVAGTGELHLEICLQDLENDHAGIPLKISPPVVAYRET
                     VEGESSQVALSKSPNKHNRIYLKAQPIDEEVSLAIESGKINPRDDFKARARIMADEYG
                     WDVTDARKIWCFGPDGNGPNLVVDQTKAVQYLNEIKDSVVAAFQWATKEGPIFGEQMR
                     SVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAV
                     GGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVF
                     DHWSTLSTDPLDPSTKAGEIVAAARKRHGMKDEVPGWQEYYDKL"
     gene            complement(<1207066..>1208748)
                     /gene="VPS17"
                     /locus_tag="KLMA_20584"
                     /db_xref="GeneID:34715047"
     mRNA            complement(<1207066..>1208748)
                     /gene="VPS17"
                     /locus_tag="KLMA_20584"
                     /product="vacuolar protein sorting-associated protein 17"
                     /transcript_id="XM_022818212.1"
                     /db_xref="GeneID:34715047"
     CDS             complement(1207066..1208748)
                     /gene="VPS17"
                     /locus_tag="KLMA_20584"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 17"
                     /protein_id="XP_022674902.1"
                     /db_xref="GeneID:34715047"
                     /translation="MASSVPYDPYDDMDNNPFAEPEEHPPLPQVPDNIVNHEPGQDAF
                     ASWNSDKENSVDNDHEHGNPTPRAASAEEPAETPAESDEQDPIALEELLPERKNTKYT
                     LFVQVTGIERAGSLTNKKENPTVKFDCTTNLPTFRKPKHKKLKKTYNEFYKLFKYLNA
                     AIPETFVPALPSPSTSYGINNEEDAIKTAANFQVWFNRITSDPLIIRSDELAIFIESD
                     FNTYTPLKKATSITGIRRKTLKQLTPPYDENLTLAEFRPLIKSLYLSTQDIKAKLLKM
                     STIRRQLSQEVNQFGQAFQPLSIDSSDLYHKFGRVITAIGDVDSIVANLDMATLYDPL
                     EGIERDSYIIKEALTNRHFIMRELLQAQQLSKQRQENARKLRAKRDINPLKVDDSIRQ
                     LKEATKNEHELTLKLKRITANMLIERQRWLTYFEEALSQAIREFVLRKIEYDRKKLSL
                     LERIRITVRTADGKGGLSRLGRSSLLTISTLSSSQSNSGDSWTGDKTRTPHLVGSVVT
                     TEFDNVALPKSQNPNQSSLPQGGAQTSRRSTFSESAGILARQAATLLGDGTF"
     gene            <1209209..>1209841
                     /locus_tag="KLMA_20585"
                     /db_xref="GeneID:34715048"
     mRNA            <1209209..>1209841
                     /locus_tag="KLMA_20585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818213.1"
                     /db_xref="GeneID:34715048"
     CDS             1209209..1209841
                     /locus_tag="KLMA_20585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674903.1"
                     /db_xref="GeneID:34715048"
                     /translation="MWKLKNTDKCIKGVVFDMDGTLCLPQTWMFKDMRDAIGCQDPKI
                     DILTFIEELPTAEEQAEAERKITVVEKKAMEEMEPQPGMIELFRFLKENGISKSICTR
                     NLIGAVTYLVESFVPTDLNDFECIVTREFYPPKPKPDPLLHISKQLKLKPEEMIMVGD
                     SADDMKSGAAAGFTTILLNNDVNKLLRDDKKLVTYSVDKLFDIIDLLEPL"
     gene            <1211856..>1212761
                     /gene="ATO2"
                     /locus_tag="KLMA_20586"
                     /db_xref="GeneID:34715049"
     mRNA            <1211856..>1212761
                     /gene="ATO2"
                     /locus_tag="KLMA_20586"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818214.1"
                     /db_xref="GeneID:34715049"
     CDS             1211856..1212761
                     /gene="ATO2"
                     /locus_tag="KLMA_20586"
                     /note="accumulation of dyads protein 2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674904.1"
                     /db_xref="GeneID:34715049"
                     /translation="MTDYRKEGAKQLPNVTPQETSNTLYTEGDNSSEAPRGLTDDKEY
                     NSSSSETDSHLKKRSGGNGNAEYVKIGGKTYMTSDLEEWLARDRDLEKQQPETEEKPA
                     DKGFANPMPVGLSCFAFCCLLLNMVNAHFRHVTNNKIVLGGALFYGGVIELLMGMLCY
                     PLGDTFGMTVLCGYSGFWFSWAWLLTDQSHIMESYGTDAQMLRSAIGLYLICWVVFTT
                     ILWVCTMKSTWGLFLCFTFLEMMFILLAAGEFTNKVKVSKAGGWFGIFSALTAFYIIF
                     SGLSNKDNCYIPLRQYALPKANFPR"
     gene            <1214463..>1215275
                     /gene="ATO3"
                     /locus_tag="KLMA_20587"
                     /db_xref="GeneID:34715050"
     mRNA            <1214463..>1215275
                     /gene="ATO3"
                     /locus_tag="KLMA_20587"
                     /product="ammonia transport outward protein 3"
                     /transcript_id="XM_022818215.1"
                     /db_xref="GeneID:34715050"
     CDS             1214463..1215275
                     /gene="ATO3"
                     /locus_tag="KLMA_20587"
                     /codon_start=1
                     /product="ammonia transport outward protein 3"
                     /protein_id="XP_022674905.1"
                     /db_xref="GeneID:34715050"
                     /translation="MSTNSSQDLEKGVPETQNLENTGATTTHPYQHHIHNVSFDGDFV
                     RLGDQTYRRSELLNAFAGDLNPGIHPRPPRNLANPVPLGLASFSFCCLVLSLINAQVR
                     GVTNNKILVGACLFFGGAIELFAGLLCYPSGNTYGMTVFGAFGGFWISYGCIFTDQFH
                     IVSSYADDPKMFNNAMGFFLAGWTVFTFLMLMCTLKSTWGLFLLLFFLELTFLMLTIG
                     TFTAKEHVTKAGGYFGIFSSVCGWYSLYSGVADETNSYIPIKAYFMPNAPTV"
     gene            <1215701..>1216333
                     /locus_tag="KLMA_20588"
                     /db_xref="GeneID:34715051"
     mRNA            <1215701..>1216333
                     /locus_tag="KLMA_20588"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818216.1"
                     /db_xref="GeneID:34715051"
     CDS             1215701..1216333
                     /locus_tag="KLMA_20588"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674906.1"
                     /db_xref="GeneID:34715051"
                     /translation="MDLEADISQLIKQNLRPRFSSLTAEQQAQLDSIFPYNFDHDLFK
                     HELMESLDDWKREEYTKVHNSIGDLQRLELGHLLDESSITFEKLNADIQKLPKFRLVD
                     NDNDSDKGLLEEYDRLRTSLVTKCRVILKVRSEQASDINTQVIESVSSVVDVKQLRDE
                     ISLELKSLGQNLETILKSWPSLAEQDKAKIVQLIQSSELNLLLPKQKQIE"
     gene            complement(<1216587..>1216916)
                     /locus_tag="KLMA_20590"
                     /db_xref="GeneID:34715052"
     mRNA            complement(<1216587..>1216916)
                     /locus_tag="KLMA_20590"
                     /product="60S acidic ribosomal protein P2-B"
                     /transcript_id="XM_022818217.1"
                     /db_xref="GeneID:34715052"
     CDS             complement(1216587..1216916)
                     /locus_tag="KLMA_20590"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2-B"
                     /protein_id="XP_022674907.1"
                     /db_xref="GeneID:34715052"
                     /translation="MKYLAAYLLIAQGGVEAPSATEIKAVLESVGIEAEDAKIDALFA
                     ALEGKSINELIAEGQTKLASVPAGGAAAAAGSSGAAAASEEAAAEEKEEEAKEESDDD
                     MGFGLFD"
     gene            <1217553..>1218407
                     /gene="ORT1"
                     /locus_tag="KLMA_20591"
                     /db_xref="GeneID:34715053"
     mRNA            <1217553..>1218407
                     /gene="ORT1"
                     /locus_tag="KLMA_20591"
                     /product="mitochondrial ornithine carrier protein"
                     /transcript_id="XM_022818219.1"
                     /db_xref="GeneID:34715053"
     CDS             1217553..1218407
                     /gene="ORT1"
                     /locus_tag="KLMA_20591"
                     /codon_start=1
                     /product="mitochondrial ornithine carrier protein"
                     /protein_id="XP_022674908.1"
                     /db_xref="GeneID:34715053"
                     /translation="MSELESALKDIAYGSIAGAIGKVIEYPFDTVKVRLQTQPAHLFP
                     TTWSCIHSTYVNEGIWKGFYQGIASPLFGAALENAVLFVSFNQCTNFLNTYTSLNSLM
                     KTIVSGAFAGACASFVLTPVELIKCKLQVSNISNSSSATLRHTEVWPTVKSVIRERGI
                     LGLWQGQFSTLIRECIGGAVWFTTYEVMKLKLLALHPLEQENKTWELLAAGATAGVAF
                     NASIFPADTVKSVCQTEHTNIVNALKIILRNHGFNGFYRGLGITLIRAAPANATVFYT
                     YETLKKLF"
     gene            complement(<1218482..>1219870)
                     /gene="PMP47A"
                     /locus_tag="KLMA_20592"
                     /db_xref="GeneID:34715054"
     mRNA            complement(join(<1218482..1219410,1219747..>1219870))
                     /gene="PMP47A"
                     /locus_tag="KLMA_20592"
                     /product="peroxisomal membrane protein PMP47B"
                     /transcript_id="XM_022818220.1"
                     /db_xref="GeneID:34715054"
     CDS             complement(join(1218482..1219410,1219747..1219870))
                     /gene="PMP47A"
                     /locus_tag="KLMA_20592"
                     /codon_start=1
                     /product="peroxisomal membrane protein PMP47B"
                     /protein_id="XP_022674909.1"
                     /db_xref="GeneID:34715054"
                     /translation="MALLTTIGMGSLYVAKGKNDERKTEHAKRTPKTWEEIAEEHENL
                     VNMSDINPNDVDQLVHAIAGSLGGAASIAVTYPLVTITTNLQTKENEGTPKLEAIKAI
                     YKKNGVAGYFLGLESAVYGMATTNFVYYYFYEWCAKTARTLASKQYLSTWESILASTI
                     AGSMTAVASNPLWVANTRMTVNKSKSSTLGTMVEIVKSDGPMTLFNGLKPALVLVSNP
                     IIQYTVYEQLKNLVLHIQKKKVLSPSWAFLLGAIGKLAATGTTYPYITLKTRMHLMQN
                     SKKEQKSMWALILEIVKKDGISGLYNGVSVKLVQSIMTAAFLFFFKEGFIQWSLKLIK
                     ILRLVSKRKNIKSLSI"
     gene            <1220380..>1220703
                     /locus_tag="KLMA_20593"
                     /db_xref="GeneID:34715055"
     mRNA            <1220380..>1220703
                     /locus_tag="KLMA_20593"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818221.1"
                     /db_xref="GeneID:34715055"
     CDS             1220380..1220703
                     /locus_tag="KLMA_20593"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674910.1"
                     /db_xref="GeneID:34715055"
                     /translation="MSNPFQNIGRNFAYLCIGLTASVIIVKTVVRDSKVSKFDPQNLA
                     SAQTSAEDAHYANLAEIKPGFPLKKGDEESQIKRKSEFEGAGLSYVTRKRGDRLGFLD
                     RRKEE"
     gene            complement(<1221112..>1223086)
                     /gene="YRA1"
                     /locus_tag="KLMA_20594"
                     /db_xref="GeneID:34715056"
     mRNA            complement(join(<1221112..1221525,1222832..>1223086))
                     /gene="YRA1"
                     /locus_tag="KLMA_20594"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818222.1"
                     /db_xref="GeneID:34715056"
     CDS             complement(join(1221112..1221525,1222832..1223086))
                     /gene="YRA1"
                     /locus_tag="KLMA_20594"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674911.1"
                     /db_xref="GeneID:34715056"
                     /translation="MSALDQSLDEIIGSAKQARRNNKTGPKKVSKNINRNRPRPGTGP
                     AKGPKKGPTAAALVPALLRAPLSTRVNVEGLPRDINQDAVKEFFNHQVGGVQKALLSY
                     NERGNSTGMATITFKNVEQANLAVKKFNNAPIDGGKSKLRLTLIVDPSQKTLLDRIRP
                     VQNVAAKNAAKKQVPAKAQPKKKTAGPNKKAIAAKQKKRAKPEKKSLEDLDKEMADYF
                     EESK"
     gene            <1223725..>1226490
                     /gene="AFI1"
                     /locus_tag="KLMA_20596"
                     /db_xref="GeneID:34715057"
     mRNA            <1223725..>1226490
                     /gene="AFI1"
                     /locus_tag="KLMA_20596"
                     /product="ARF3-interacting protein 1"
                     /transcript_id="XM_022818223.1"
                     /db_xref="GeneID:34715057"
     CDS             1223725..1226490
                     /gene="AFI1"
                     /locus_tag="KLMA_20596"
                     /codon_start=1
                     /product="ARF3-interacting protein 1"
                     /protein_id="XP_022674912.1"
                     /db_xref="GeneID:34715057"
                     /translation="MKPSYRVKNGLNSHLRQSQKEHAQSNPNVQFIVAAEFDNKSGPV
                     IKHQYPKTIPGFRTVGNDSLGSHLASLMIPNSVENHPGKADFTVFVLYKYQNMYQLFP
                     VSSNKDAEKALDAASIIEEEALDEEQEDSFPNGNLDSGLANNGKQTHEPPLFFLSVVN
                     TLLDKNNDRGAYIKAIALGTTMTNFYTFKPLLTMVLDYYMSSNTNDVRILIDCFDMIN
                     SLDLSLVTRFHSNTILQSILNSINDEDITSKIFDPQDSSLPNILRVNELPRKDRYGNE
                     IQFKKRVLQYKFSTFIPKVLPAYFTKIPLQIDLIKHDNIKIETNYNHSILKLLLRLIP
                     MFKELNDSEYSWRLMINSTQSSKDELCQFVIALSNLINGFCSDYFDGSSICIFPYMEI
                     SIIDVFRENFTGEFTKGKFFSVAGVSNPIFQYQVDVWDYYYDMDTDILIKSKSLSPEE
                     KNKVKTQGIRSIFSRYTSSQEQVNKQNRAKLHTKEGLMTIIINLLIKGQHDNETVLNT
                     LKRASILQLLHLINNGRDGINGVEMTLKDQYIINYKDLIVFADIFEYNSLKVLNLLNN
                     LELDISKIFWPNITNTYQIKKRLLLDLYKHLKQLHKFISVNKKNLGKFLNIAMNYPLV
                     SAFDGINIAQDDLADLNIEKLLASERSSMKSIDSLYDGSAPNDTIDHFNTYKAFNLLL
                     LPLFLNPQLEHDDSSFLGGLGPPAPLMRLSTGRNYNYQSDSSLSMISSIYETNDIMSH
                     DVNYENSLIDDATTIFTTKSNIPDLSSLINKCRQMSIKILYRIQRHHIGRLIVNSKLN
                     PLFRVTYQTAKQELFNSSDNTSTLNSNGHTLPQPNQYLPSTPPVSADAIKPRNSLRHS
                     TASSPKLESSMKLSVSRRDLLKDLSLINVDSETNGLPALTNTPNRHDLLESLAKLEIS
                     PKQQNNL"
     gene            complement(<1226806..>1228698)
                     /gene="ARO10"
                     /locus_tag="KLMA_20597"
                     /db_xref="GeneID:34715058"
     mRNA            complement(<1226806..>1228698)
                     /gene="ARO10"
                     /locus_tag="KLMA_20597"
                     /product="transaminated amino acid decarboxylase"
                     /transcript_id="XM_022818224.1"
                     /db_xref="GeneID:34715058"
     CDS             complement(1226806..1228698)
                     /gene="ARO10"
                     /locus_tag="KLMA_20597"
                     /codon_start=1
                     /product="transaminated amino acid decarboxylase"
                     /protein_id="XP_022674913.1"
                     /db_xref="GeneID:34715058"
                     /translation="MAPVVLDDKSASESPRSDSPVHGLSSVVKDITLGRYVFERLLNC
                     GSKTIFGVPGDFNLPLLEYLYEEELVQNGLQWVGTCNELNAAYAADGYSRYTSKIGCV
                     ITTFGVGELSALNGISGAFAEDVKVLHIVGVSPTKFRKNDKFRSHNVHHLVPDLDGDK
                     EPNHEVYFDMIKDRVSCSSAFLHDVESAPEKIDKVIADIYKYSKPGYIFIPADFADEM
                     VSNKNLVETPVIDLPYVIENTTSKDATKKAGDKILQWLYESKTPSVFSDALVGRFNLN
                     KDIRELINKVDMWNFTTAMAKSSLDEHHPKHLGVYKGAETGKEMQSIVEMSDLILHFG
                     PCKNEINFGYYTFRYNDNARVVELSKDKITFFETKANGSVEVQEANFAAVLKYMNENL
                     DVSKISTAYPSVSRTREHIEFGEDDEISQQSLKRIVENFYNPGDVLVVETGSFQFNLI
                     NMKFAPEMKYMTQTFYLSIGMALPAALGVGCGMRDYPRSHIINQSAVPADYVPKLILC
                     EGDGAAQMTIQEFASYIRYKIPMNILLFNNNGYTIERAILGPTRSYNDIAPVKWTALL
                     NAFGDFENKFSETVTVSKNKEIIEVLNEWKKEKVPSKIKLAEVMLPVMDIPSELDAML
                     VNGKPK"
     gene            <1230394..>1232103
                     /gene="ADE2"
                     /locus_tag="KLMA_20598"
                     /db_xref="GeneID:34715059"
     mRNA            <1230394..>1232103
                     /gene="ADE2"
                     /locus_tag="KLMA_20598"
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /transcript_id="XM_022818225.1"
                     /db_xref="GeneID:34715059"
     CDS             1230394..1232103
                     /gene="ADE2"
                     /locus_tag="KLMA_20598"
                     /codon_start=1
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /protein_id="XP_022674914.1"
                     /db_xref="GeneID:34715059"
                     /translation="MDQRTVGILGGGQLGRMIVEAAHRLNVKTIILDAENSPAKQINA
                     LSEHVNGSFSKPEDIKKIASMCDVLTVEIEHVDVPTLKQVQIDHPNLKIYPDPETIAL
                     IQDKFTQKQYLIKNNISVAESVSVESDEKSLAEVGSQFGYPFMLKSRTLAYDGRGNFV
                     VKSKDSIPEALSVLKDRPLYAEKWAPFVKELAVMVVRSPENAVFSYSTVETIHKDNIC
                     HTCYAPARVPDSVQLKAKLLAEQAVAAFPGAGIFGVEMFYLEDGELLINEIAPRPHNS
                     GHYTIDACVTSQFEAHIRSILNLPMPKEFTSLSTTNTNAIMLNILGDNEVKNNELKIC
                     ERALNTPGASVYLYGKESRPKRKMGHINIIGSSMVECERKLNFIQYGEETYKNSEASK
                     SAVPGTSSKPLVSVIMGSDSDLPVMSKACDILNDFNVPYEVTIVSAHRTPHRMSKFAI
                     EAGNRGIKAIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSCLDGVDSLHSIVQMPRGI
                     PVATVAINNSTNAALLAIRILGAYDSSYFVKMQKFLMKQEEEVLTKAEKIENIGYQEY
                     LRK"
     gene            complement(<1232252..>1235428)
                     /locus_tag="KLMA_20599"
                     /db_xref="GeneID:34715060"
     mRNA            complement(<1232252..>1235428)
                     /locus_tag="KLMA_20599"
                     /product="GAL4 domain-containing family protein"
                     /transcript_id="XM_022818226.1"
                     /db_xref="GeneID:34715060"
     CDS             complement(1232252..1235428)
                     /locus_tag="KLMA_20599"
                     /codon_start=1
                     /product="GAL4 domain-containing family protein"
                     /protein_id="XP_022674915.1"
                     /db_xref="GeneID:34715060"
                     /translation="MTDSIDDVMDKTGSIYNKKRRVAKRACLACREKKIKCDGEMHPG
                     PDGGPGRCTNCANTGGTCVFVASNRGGRRVFGKMKHQQQRQNSPTSTSSYSRRDSGHN
                     SSVSSNASFTAPNTVVSSSAPKLVNSSTLNASGENPASPAPNSATTTNNNNNNNNNNN
                     NNNSNNNNINTSPSASIQSIPTPTSHILPFPPLEKNGQFIIERRALGANPAINSKDDS
                     GNQNEYYKNPLNNYGIPKQVQYHGISMPGFMLPVNNAENNNMYQNAVPGQKLYDGVHI
                     HTIYNQYPPMTSFLPIQHAGNVNNVSSVGVMQNRNYGPNPNMSAIPLVNPTVNLQNGQ
                     HNSASPIQMGNWVSPVGPRNRGNSISIPSPNTQGDLKDDNAVADPHTKKISENTNTIP
                     KDHVVTEKSDGSSNELSPVANIVQESSTVTHPSLIKVASPLSDRQSEKYCSASNPSQE
                     EQQFHVIHDSMIHARHFPNFPSVSTALVLVDLFYDYVHSKINILQPKEEQIYVVISRM
                     DISLTYAIFLCAMPYIHMQKKNDKRKVESLPTPKECLRIISENWEDLDYLQSLQTLNI
                     LVYYFTCIKIDKISVTAYLDKLIKTIAYSNVVSEYRTCSDLAELFEISTIKTLVQSRL
                     LLMNLWVGFSQLCHVRFFFMDHNLLHDSLNLLCSTDERLENRILPFGLLIFFWYRKNK
                     QQDFPDEIPALAKSSEDTKKLFLLHLKDLEDNFTPDAMSSSLYHFYLCKIFHDWRNKK
                     LSNFTALNKVDTLETSVQGKLFELKNDKTVMLINWDVLNTLSISESVKLTLRDTPPTL
                     EILHFDVFAPEIKFIEISELDAAVAKKIPLFEAFYVMQCFQSLLQVLDIVALIEIALG
                     KLPVCTSGVQQVRYVTMSLFEKYSNDNKQGNVLGDDSAGVQTDKLDDDTSRSLQECDL
                     DFNERKVQLWMKYPTVFYGLVRFALPKLLNYIVFFKFMKFVPFDNKCALVYANKSLLL
                     DEGQFNLKNLLARAKDTMYFGGANLSDSELLSKLVSTLELAYLKEKLNVLIEFTKNVS
                     SVMDSKEQIHKNLQDLEQYISDILGFAF"
     gene            complement(<1238990..>1240630)
                     /gene="ugcg-b"
                     /locus_tag="KLMA_20600"
                     /db_xref="GeneID:34715061"
     mRNA            complement(<1238990..>1240630)
                     /gene="ugcg-b"
                     /locus_tag="KLMA_20600"
                     /product="glycosyltransferase family protein"
                     /transcript_id="XM_022818227.1"
                     /db_xref="GeneID:34715061"
     CDS             complement(1238990..1240630)
                     /gene="ugcg-b"
                     /locus_tag="KLMA_20600"
                     /codon_start=1
                     /product="glycosyltransferase family protein"
                     /protein_id="XP_022674916.1"
                     /db_xref="GeneID:34715061"
                     /translation="MAGNLLPFWCCFSIIALICLARASDISATFNEYTPVVPEVPVEH
                     INIRVDSNLYAGIVLTIWYIVVILLGYSGWIEIERKFSSEKELPKEELQELEPVTIIR
                     PCKGVDTEMMTCLESCVKQDFPKDRFEVIFCVENNKDPSIEIIQQIIAKHPDHQLSLL
                     IGDMDYFGPNPKINNLSKGYRMAKYDIIWVLDSNVWCSPGTLARSAMSLQKSLDNGRR
                     TNKPVVLTHHVPLGTSIDNQSYSGLLDEMFLFSSHAKFYVAFNYVSIAPCVNGKSNLY
                     RRSHLEKAVRMIGDGTRRSNMFANNEIKRLAHRTMSKGTDPQCVPNRVTKVTFDAKAD
                     ELKKEEIEGADQGKYHAIEFFSTYIGEDNMIGTALWDMLRGRTGMTGDVVIQPFKFNR
                     AEDTWHSYIARRIRWLRVRKYMVLAATLLEPTTESIVIGLMGSTGLKNLFQLSLSTAL
                     KIFVCHMTLWCISDWIQYRTLSKNTVTDNAVKENDRFSYPHFTPGLHPRTFPEWIGIW
                     CLRELLALPIWIKAMCGSVIQWRNRPFRIKPDLTAEEL"
     gene            complement(<1241964..>1245077)
                     /gene="RGA1"
                     /locus_tag="KLMA_20601"
                     /db_xref="GeneID:34715062"
     mRNA            complement(<1241964..>1245077)
                     /gene="RGA1"
                     /locus_tag="KLMA_20601"
                     /product="rho-type GTPase-activating protein 1"
                     /transcript_id="XM_022818228.1"
                     /db_xref="GeneID:34715062"
     CDS             complement(1241964..1245077)
                     /gene="RGA1"
                     /locus_tag="KLMA_20601"
                     /codon_start=1
                     /product="rho-type GTPase-activating protein 1"
                     /protein_id="XP_022674917.1"
                     /db_xref="GeneID:34715062"
                     /translation="MSASTHEAVETPVCVRCTDRITMGHAYELGGNRWHTHCFSCYKC
                     DKPLSCDSDFLVLGTSDLICFECSDSCKSCGKKIDDLAIILASSNEAYCSDCFKCCKC
                     GEKIKDLRYAKTKKGLFCISCHERLLARRKYHEEKKRRLKKELPIVPKEPDSSATSSA
                     MESETATSQTSHTLDPMIKTESGVLETTNSNLGQNGNSTPESDPFSVLSPSNAADKLE
                     SANIQQKQTPNYEDIEQPKVFTAPIDFSKKESIVKSSSNSVIAQFLDDEYHNDNVSVT
                     TTEHKHSSSQLDKILQNTLDNSEEDTLQISSNDIASLSYNNSNPDIPEINPHRTPVRS
                     SERSPPLAIPNSKSPDGHRNAIIFDAESPENEVVYATKENHLNTPNRRNTSAGDESFL
                     HTPNSSGNDHKPAGLGISTPRSLQKFKLNGSLAIISPRSEVVKNTSTVGIPYDSTEER
                     PSSHNSDMAHTVNNSAPDHHRRTSSGAKNITRSLSFRSKNIISTFRNKAKSSVSPGRP
                     LDKDFDTHSGWGVSASHPSIEESLSSQTAHQPRRRVSGRGQSDSTIYSPFSNDSTQQS
                     QNQGQGHIRSQSGSNKVSMFRTPPLGSIDSGRYTRNKSLSIDANQTLLAEDEKGTDGG
                     DTGDYTPVAKEFFEKDLASASLQLRKLNMEIKELQLTKAQLNADIEKLKSSKESLTIE
                     VEKLKNEKKGLRSGTTSQESFQDDAYYTDYHGSSGNGYSPTKNPHSATSASASIAKPR
                     FWKLFGAGSGSGNGNGNGNGYGNVKQVTPNSSKSIEISAPMLQNPNEFDDMKLLPIQN
                     STSSDSGTRNSASSAMSEGQNLYGSTLSARCNYERRDVPLIITTCIDYIESDEEHMKT
                     EGIYRKSGSQIVIEQFEKMFADEEKVDFVKINADVHAVTSVLKRYLRKLPNPILSYQC
                     YEALINLVRDNNLLIEYPLSKSTKPSTLYHNTVERLVGIMQTLPVQNLIVLRLLCQHL
                     DQIIKYQDDNLMTLHNLALVFAPGLIKDYSGEKDIVDMKERNYLIGFILQNYRDIFSM
                     ILQQRTE"
     gene            <1246371..>1246613
                     /gene="LSM6"
                     /locus_tag="KLMA_20602"
                     /db_xref="GeneID:34715063"
     mRNA            <1246371..>1246613
                     /gene="LSM6"
                     /locus_tag="KLMA_20602"
                     /product="U6 snRNA-associated Sm-like protein LSm6"
                     /transcript_id="XM_022818230.1"
                     /db_xref="GeneID:34715063"
     CDS             1246371..1246613
                     /gene="LSM6"
                     /locus_tag="KLMA_20602"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm6"
                     /protein_id="XP_022674918.1"
                     /db_xref="GeneID:34715063"
                     /translation="METKTTASATFLENIIGKPVYVKLFSGILYQGKLESIDGFMNVS
                     LSQVSEHYETEENGTLHKYAEEVFLRGSQVLYISER"
     gene            complement(<1248371..>1249807)
                     /gene="ARH1"
                     /locus_tag="KLMA_20603"
                     /db_xref="GeneID:34715064"
     mRNA            complement(<1248371..>1249807)
                     /gene="ARH1"
                     /locus_tag="KLMA_20603"
                     /product="probable NADPH:adrenodoxin oxidoreductase"
                     /transcript_id="XM_022818231.1"
                     /db_xref="GeneID:34715064"
     CDS             complement(1248371..1249807)
                     /gene="ARH1"
                     /locus_tag="KLMA_20603"
                     /codon_start=1
                     /product="probable NADPH:adrenodoxin oxidoreductase"
                     /protein_id="XP_022674919.1"
                     /db_xref="GeneID:34715064"
                     /translation="MVRRCISIIGSGPSGFYTAHHLLQNAKVPLEVTIWEKLPVPFGL
                     SRYGVAPDHPNVKNCEETFTDTVNKVRNDKDSIHKFNFIGNCEVGKDVQLSDLLKKQD
                     AVVLSYGCATDNKLGIPGENDTDGVFTSRQFVNWYNGHPDFALHPKFMDFDWKSVRNV
                     GIIGNGNVAIDIARLLLSSTVSSIWGSTDINPLALEKLRQAPIENVKIIARRDFPNSK
                     FTNKEIREMWQLESYGVKGHIDSKFFTPEKWNMKEQARTFKRCVDLFSEYVKPYEERS
                     AKYKKLPQPENGVFTKHWELDYLKTPLEIIKDGSSNRIKSLKLCNNTMSESNRVNAHP
                     DKTLEYNLDLLITSLGYKGSPMSGFEELKIKFDRNKIANSQGRVLDTQENTIPGLYAT
                     GWIGKGAEGVILATMTNSFAVAENILKDLHSLPPKTTSIPSLENVNSTTWEDAEKILS
                     FEEQEGKMKDKPREKLLTVQEMLRVVQH"
     gene            <1250369..>1251094
                     /gene="IAH1"
                     /locus_tag="KLMA_20604"
                     /db_xref="GeneID:34715065"
     mRNA            <1250369..>1251094
                     /gene="IAH1"
                     /locus_tag="KLMA_20604"
                     /product="isoamyl acetate-hydrolyzing esterase"
                     /transcript_id="XM_022818232.1"
                     /db_xref="GeneID:34715065"
     CDS             1250369..1251094
                     /gene="IAH1"
                     /locus_tag="KLMA_20604"
                     /codon_start=1
                     /product="isoamyl acetate-hydrolyzing esterase"
                     /protein_id="XP_022674920.1"
                     /db_xref="GeneID:34715065"
                     /translation="MALVYKKFLLFGDSITEFSFNTRMSNVEGKDEFSFGAAMVNAYT
                     RKLDIVQRGFSGFNSRWALKLLPKILEQENNVAIATLFFGSNDACQHEHQHVPLPEYK
                     ENTKKLIEMFKKNGIKVVVIGPALYDVDKWYPSHGAEVDKGYVRSNELFAQYSEAAQE
                     IANAQEVAFVNLHEAFKKQDDWKSLLCDGLHFSGKGYEVMFNEVIKTVEEKYPEFAPK
                     AVEYKLPNWRLVKSDGSTLDPLL"
     gene            <1251391..>1252731
                     /locus_tag="KLMA_20605"
                     /db_xref="GeneID:34715066"
     mRNA            <1251391..>1252731
                     /locus_tag="KLMA_20605"
                     /product="mitochondrial chaperone BCS1"
                     /transcript_id="XM_022818233.1"
                     /db_xref="GeneID:34715066"
     CDS             1251391..1252731
                     /locus_tag="KLMA_20605"
                     /codon_start=1
                     /product="mitochondrial chaperone BCS1"
                     /protein_id="XP_022674921.1"
                     /db_xref="GeneID:34715066"
                     /translation="MATNAGSGLPPIDFEKIKKDSDGSVSSMAKGLFNQFIEGNPYFA
                     AGGGLMILGTSLALLRKGIISTSRLAYRQLIVDLEIPSKDKSYLWFLQWMSKYPQRSS
                     RHLSVETNFLQHNNGSVSTQMNFVPGVGNHLIRYKGAFMLITRERSGQIANFSNGTPF
                     ETVKLTTLYRDRHLFQELLMEAKELAVKAQTGKTVIYTSWANEWRPFGQPKAKRNLKS
                     VILDKGLKEGILRDVKDFLQNGKWYYDRGIPYRRGYLLYGPPGSGKTSFIQALAGELD
                     YNICIMNLADPNLTDDRLNYLMNNLPERSIMLLEDIDAAFVKRNKNEEGYVNGVTFSG
                     LLNALDGVASSEEIITFMTTNHPEKLDPAVMRPGRIDYKAFVGNATEYQIRQMFLRFY
                     PEETELCEQFVQKAIQLDIPISTAQLQGLFVFNKSDPKNAVLMVESLRYPNHVF"
     gene            complement(<1252813..>1253073)
                     /locus_tag="KLMA_20606"
                     /db_xref="GeneID:34715067"
     mRNA            complement(<1252813..>1253073)
                     /locus_tag="KLMA_20606"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818234.1"
                     /db_xref="GeneID:34715067"
     CDS             complement(1252813..1253073)
                     /locus_tag="KLMA_20606"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674922.1"
                     /db_xref="GeneID:34715067"
                     /translation="MSEYTGDYVVNELLRRVEAGKKKNTNLNNPNNTEKTLLGCLFID
                     AIDKLLTEAKLQAEKDGTRTISIENLREAEEILLSMARDEEG"
     gene            <1253367..>1254167
                     /locus_tag="KLMA_20607"
                     /db_xref="GeneID:34715068"
     mRNA            <1253367..>1254167
                     /locus_tag="KLMA_20607"
                     /product="YTH super family"
                     /transcript_id="XM_022818235.1"
                     /db_xref="GeneID:34715068"
     CDS             1253367..1254167
                     /locus_tag="KLMA_20607"
                     /codon_start=1
                     /product="YTH super family"
                     /protein_id="XP_022674923.1"
                     /db_xref="GeneID:34715068"
                     /translation="MTNTQFDLWTDLVLLNASSRFDFEDETAAKVIAWSDSTLFDKEK
                     MSPEDAINDDFNDTSGSSFVGSLISNMDSFISTASSVVEAISSQKDYSLNLEFNGFNG
                     FNIPQHSKFFVIKSFNERNVSLAVQHQVWSSTRRGNKKLQKEYQSLRPGAKIFLLFSV
                     NKSGKFCGMAEMCSDLIQNDPRSNIWETHTHSYTFPNLFQIKWLYVKDVQVRRFNHLA
                     WDVNLGGNENSPKMVGQCRDTDSVPFDIGCQIVSIFSDAPLKSSLSYQ"
     gene            <1254626..>1255474
                     /gene="COQ7"
                     /locus_tag="KLMA_20608"
                     /db_xref="GeneID:34715069"
     mRNA            <1254626..>1255474
                     /gene="COQ7"
                     /locus_tag="KLMA_20608"
                     /product="ubiquinone biosynthesis monooxygenase Coq7"
                     /transcript_id="XM_022818236.1"
                     /db_xref="GeneID:34715069"
     CDS             1254626..1255474
                     /gene="COQ7"
                     /locus_tag="KLMA_20608"
                     /codon_start=1
                     /product="ubiquinone biosynthesis monooxygenase Coq7"
                     /protein_id="XP_022674924.1"
                     /db_xref="GeneID:34715069"
                     /translation="MPKPKNALHIPINSADSAILTIVFLNHQHTLNPPLLRNIQLTWM
                     ITMIRSSARALKPNRHFSVLSNLGKKHSAKEVAHPDEEPKPLTKFKPMSEAQLAYLDR
                     VVRVDQAGELGANYIYAGQYFVLANRYPHLKPVLQHMWDQEIHHHNTFNDLQFKRRVR
                     PSLLTPLWKLGAFVMGSGTAILSPEAAMACTEAVETVIGGHYNDQLRVLSNQYELETE
                     DGKEKGQSVELKNLQSTIKEFRDEELEHLQTAIDYDSHKAVPYMLLTEGIKGVCRVAI
                     WTAERI"
     gene            complement(<1255660..>1256232)
                     /gene="FRQ1"
                     /locus_tag="KLMA_20609"
                     /db_xref="GeneID:34715070"
     mRNA            complement(<1255660..>1256232)
                     /gene="FRQ1"
                     /locus_tag="KLMA_20609"
                     /product="calcium-binding protein NCS-1"
                     /transcript_id="XM_022818237.1"
                     /db_xref="GeneID:34715070"
     CDS             complement(1255660..1256232)
                     /gene="FRQ1"
                     /locus_tag="KLMA_20609"
                     /codon_start=1
                     /product="calcium-binding protein NCS-1"
                     /protein_id="XP_022674925.1"
                     /db_xref="GeneID:34715070"
                     /translation="MGNKTSTLSKNDLTSLKQSTYFDRREIQQWHKGFLRDCPNGQLT
                     REEFIKIYKQFFPFGSPDEFATHVFSVFDRDNNGSIDFKEFITALSTTSRGSLEEKLV
                     WAFQLYDLNHDGVITYQEMLTIVSSIYKMIGNMVKLSDDEATPELRVEKIFRLMDKDK
                     DGQITLDEFRDGSKIDPSIVGALNLYDGLV"
     gene            <1257380..>1261051
                     /gene="UBP2"
                     /locus_tag="KLMA_20610"
                     /db_xref="GeneID:34715071"
     mRNA            <1257380..>1261051
                     /gene="UBP2"
                     /locus_tag="KLMA_20610"
                     /product="ubiquitin carboxyl-terminal hydrolase 2"
                     /transcript_id="XM_022818238.1"
                     /db_xref="GeneID:34715071"
     CDS             1257380..1261051
                     /gene="UBP2"
                     /locus_tag="KLMA_20610"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 2"
                     /protein_id="XP_022674926.1"
                     /db_xref="GeneID:34715071"
                     /translation="MSSEQPLDNIICQPKEPATQSIQENSGPADSLACDLVDDGKKLL
                     YPNVSNIFPFKTCDRILDDIRISPWFIRSLGSSVIKTPMLQYSRERQQVEPWHIVHLI
                     DQVNLKSRYEYDSLTCPAKNTISVMFAMLVDPQFIPEDFDSITEFPYHFYHLKVTVKR
                     RSHLENFNRHVGITHYHPIEPEDLHPFDKRDIFIMDKNDPRLVDQSIFVSTDTNKLLI
                     VEIIKPEFDSEHLSEFQTSRIKERYEKACNDFDLLDPSDVPNQAECLKTLFMIFKNPL
                     QRKSPSSEFKIISKDSVALNSQVNTEWLTNIFGFTLQKSPTVDNIESGEEFKPPDLVD
                     YVTDFKIREIRESYVRKSMEIILIGKQSMQLEESVDIEKRTVAKCFSNQHLGINHTWW
                     FNMLNHAHIEFSPYDINYNFINLSVAFKYSDKDIVKNYETQISLDPENIGFYFDALQY
                     VTNAKGSYQLIAYAGKQDVVGYEDLNNALQVFGLDPTEIDVHLIDGDAMIEYYNSNLL
                     KCSESQKKDLRNALRILGKYLKNRKMLFLVEYEPYHSVQQAYSLLKVDETVDDDIIQT
                     AYTINTADAPGLKKDFDRAVFTIGIERRSMFLLNVLLEECPEFSEYYNFSDLSYEDAL
                     KIIEIDINASDDVILEVFQKKWNHGIIPEPDYLLKLKMALENIGYTRNSKLINHFLST
                     GVVDVSCLPLATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILTYNNDSAKSLENSK
                     YYSKRRIGGREVSKQEEVRSIQFVYHLRDLFHDMIHTNSRCVTPSKELVYLAFAPSNI
                     EVEFENECEGQGNTELIDLTSINTDESTGANHLKQDEDDDIIMCQTPIALPDDSEEAV
                     QDAYKRQASVQVAKISADQLENTLEIGRQQDVTECIGNVLAQLEIASEPLNLEDDLEQ
                     NDLVKQLFYGKIKQDLIPKNDQTSVRTKYERFLSLLVNVGDHPKDIYDALDLYFQNDF
                     LNLEEYGDVKRVISISDLPSVLQIQIQRVYYDRERFMPFKSIEPLPFNNKLYMDRYMT
                     TEDPKLIAENNRCSALKQELQKLKQRERKLLSQNELGFTYKNSLLETKKFLESETLSK
                     HDIETEQVPKSISYIDELIKIIDEEINTLGKRISDLEAEISRCFQDFKHIGYSLFAVF
                     IHRGEASYGHYWVYIKDHTRNNIWRKYNDDSVTEVPESEVFNFTEGNTATPYFLVYVR
                     EGQEKETIEPLKRIIQQEA"
     gene            <1261429..>1262409
                     /gene="VPS74"
                     /locus_tag="KLMA_20611"
                     /db_xref="GeneID:34715072"
     mRNA            <1261429..>1262409
                     /gene="VPS74"
                     /locus_tag="KLMA_20611"
                     /product="vacuolar protein sorting-associated protein 74"
                     /transcript_id="XM_022818239.1"
                     /db_xref="GeneID:34715072"
     CDS             1261429..1262409
                     /gene="VPS74"
                     /locus_tag="KLMA_20611"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 74"
                     /protein_id="XP_022674927.1"
                     /db_xref="GeneID:34715072"
                     /translation="MSSLQRRRVNKSDTTESVPTTNDNEHDHKVVYDEEEAKIRENTS
                     VPKLTLMEEVLLIGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRY
                     DVSERLVEVIDSTKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQ
                     VRERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNADLTY
                     NSYFPENVAFKYIRTLALICGAYGANVLENVLATLDYEVRDTGFSRADEILAQFSEFP
                     FPLDKQTTTGVSVNLNKEVAEELKNHPGTDLQLEVVAGVFEVFSRMDTLL"
     gene            complement(<1262561..>1264003)
                     /gene="CTS2"
                     /locus_tag="KLMA_20612"
                     /db_xref="GeneID:34715073"
     mRNA            complement(<1262561..>1264003)
                     /gene="CTS2"
                     /locus_tag="KLMA_20612"
                     /product="sporulation-specific chitinase 2"
                     /transcript_id="XM_022818241.1"
                     /db_xref="GeneID:34715073"
     CDS             complement(1262561..1264003)
                     /gene="CTS2"
                     /locus_tag="KLMA_20612"
                     /codon_start=1
                     /product="sporulation-specific chitinase 2"
                     /protein_id="XP_022674928.1"
                     /db_xref="GeneID:34715073"
                     /translation="MLRWFKVTKLQIKIWIIIILIAFIAEMCTVPKLFLDRLKHGKSK
                     DRKPPQPPSDVPIVQDPSNITDGYSVGTYYSNWSPYKARNYKPSDLPFDSLTHVYYAF
                     FAVNGRTGEIQPNDNWSDFELPMSKGVKGCIKELQKIKIESNHNFKTILSVGGWSNRE
                     AFKKISNSDDKVKTFVKSTVENMFKYGFDGIDLDWEFPEEDTDEPMVYLDMMKGIRKE
                     MADLEERIFGPDDATGAHSHFQLSVATPAFEEKLNIMPISEMANYIDIWNMMCYDYHG
                     EWSDLTGYHSNLYASHHSHKRNIKDRSTNATFSADAAIRIMIEKYNVPATRISLGMAA
                     YGRGFTNVKTNDNNFLGKKYHGVGGESEGEPGIWLYNQLPIEGTTEEFDSNAVSAYCF
                     DPKSKTFVGYDNVRSMSYKGKYIKDMNLQGGFWWEACGDSRSAERSLVNAFVKEVEPS
                     NSFVSMFKNPKVREYHLQTYPKDYLTDLFK"
     gene            <1264411..>1265652
                     /gene="LEO1"
                     /locus_tag="KLMA_20613"
                     /db_xref="GeneID:34715074"
     mRNA            <1264411..>1265652
                     /gene="LEO1"
                     /locus_tag="KLMA_20613"
                     /product="RNA polymerase-associated protein LEO1"
                     /transcript_id="XM_022818242.1"
                     /db_xref="GeneID:34715074"
     CDS             1264411..1265652
                     /gene="LEO1"
                     /locus_tag="KLMA_20613"
                     /codon_start=1
                     /product="RNA polymerase-associated protein LEO1"
                     /protein_id="XP_022674929.1"
                     /db_xref="GeneID:34715074"
                     /translation="MSTSVVDPSSPKEEPAEKHVVDELDDLFGDDSEEENQINDSEEN
                     DEQSDASGSGKKLRRVIDEEEDEEQAMYNRKFLGEDYEGQSEEEFEKKYKEVDVEIVN
                     HVVPYKTANAADDKTIYYAKVPQFLTIDPIPFDPLTFQKKVEERMAKYSSKEDQLGDR
                     LIEENTIRWRYSRDKDQRVFKESNAQIIQWSDGSFSLKIGDEYTDILVNNTENTYLTV
                     SHEDQELIQCVEGGEITKSLMFVPTSTNSKVHQALSKAVARRDEREQHGPSTYIVRMD
                     PELEKRELEKKHDQILRERRKKQLKQKLEQENAGESPEPQFNLQKSLPRRRNLDEYEY
                     DDGFVAEDDEEELEEEEDEEFSDERNASGSDSEDSDSEQESKNAEKLKKVKQAGTEEY
                     QTEDSHTKKRRIAVLDDEDDE"
     gene            <1266242..>1266858
                     /gene="PFY1"
                     /locus_tag="KLMA_20614"
                     /db_xref="GeneID:34715075"
     mRNA            join(<1266242..1266254,1266491..>1266858)
                     /gene="PFY1"
                     /locus_tag="KLMA_20614"
                     /product="profilin"
                     /transcript_id="XM_022818243.1"
                     /db_xref="GeneID:34715075"
     CDS             join(1266242..1266254,1266491..1266858)
                     /gene="PFY1"
                     /locus_tag="KLMA_20614"
                     /codon_start=1
                     /product="profilin"
                     /protein_id="XP_022674930.1"
                     /db_xref="GeneID:34715075"
                     /translation="MSWQAYTDNLLATGKIDKSVIYSRAGDSVWASSGGLQLQPAEIS
                     EIARGFDNPSGLQSNGLHVQGQKFMLIKADDRSIYGRHEAEGVVIVRTKQTILIGHYP
                     AGVQAGEATKIVEQLGDYLISVQY"
     gene            complement(<1267112..>1267423)
                     /locus_tag="KLMA_20615"
                     /db_xref="GeneID:34715076"
     mRNA            complement(<1267112..>1267423)
                     /locus_tag="KLMA_20615"
                     /product="YCII super family"
                     /transcript_id="XM_022818244.1"
                     /db_xref="GeneID:34715076"
     CDS             complement(1267112..1267423)
                     /locus_tag="KLMA_20615"
                     /codon_start=1
                     /product="YCII super family"
                     /protein_id="XP_022674931.1"
                     /db_xref="GeneID:34715076"
                     /translation="MVEWVVIVYDKPGSDRSQFRPQHLAALPPLVESGKLVQAGAIYK
                     DVIDGKPTNFAGSHLTVVADTKEEVIQIIKNDVFAKEGIWDVENAIIYPFGCAYRVAK
                     K"
     gene            <1268571..>1269818
                     /locus_tag="KLMA_20616"
                     /db_xref="GeneID:34715077"
     mRNA            <1268571..>1269818
                     /locus_tag="KLMA_20616"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818245.1"
                     /db_xref="GeneID:34715077"
     CDS             1268571..1269818
                     /locus_tag="KLMA_20616"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674932.1"
                     /db_xref="GeneID:34715077"
                     /translation="MTEPVGDISGSLSRLQIDDTEKQHHSRSTYKPKSKSKSKFKRST
                     KQTVVIPCKKFSHAPVNYVLEKSPILLRDSEELYTCSYKVDKSTLWNSLSTKPALRKE
                     ICNFIAQNKWDDDISKNRFIGSNLTEGYEDYVPLPQEVLDSVDLLMQAYDKYNEGLDT
                     MNKTTFISLRHHIIDIIMCPFQNETVSLIMSVLPDRNILISVDKSQCKPNGIHQLTDP
                     NIRKICYTGFALENLLIDSSENENDSQEHELYYSFVRGIINDNVEIFFQAEMDSYNPL
                     TNSYTEIKSSVNFNLNNAYHRKKLLRMWVQTNLLPRSDLLIGFRNPYSNELEQLRPYK
                     IQDIYQKVNNRSILGRPGKFFRYNAVVARDWFHHIFSILKTNLLSLAEPDKLSSFKVQ
                     LDPNLNLSITPTTQSIKDLKIQV"
     gene            <1270072..>1271505
                     /locus_tag="KLMA_20617"
                     /db_xref="GeneID:34715078"
     mRNA            <1270072..>1271505
                     /locus_tag="KLMA_20617"
                     /product="SAM50-like protein SpAC17C9.06"
                     /transcript_id="XM_022818246.1"
                     /db_xref="GeneID:34715078"
     CDS             1270072..1271505
                     /locus_tag="KLMA_20617"
                     /codon_start=1
                     /product="SAM50-like protein SpAC17C9.06"
                     /protein_id="XP_022674933.1"
                     /db_xref="GeneID:34715078"
                     /translation="MPSANDILENSAHKSVYITKVTVDGENQLSPVSDELYKSIFDQV
                     LAEPLQNIETAFQSCQDIQKKLLFTGLFQSAEITLDYDADINASRLLKERVPESLDID
                     LPIPTIAQVKLVPAIFNKGAVTTTTRDSYSSVGGRLFFINKLGNAETISLQGDVNYTP
                     FNGKLDERSIGAKLSLPFPKNPSVKAVFYANHTYLDLFKQPFINESDEHKQSQFGIST
                     GFEKSFLYNNEKSIVETFNGISMVARSIFGFADALAVSDSIKQFQGTFTKTSFISQLH
                     ADSRKFYDRFPVSGKRFELFNEYIINQGFANAKPLPEDSKFDKVSVSFETHKPFFNTK
                     VVTSLNLNAGAIFPWDNKSQPLVHLLDLFYLGGPKSLKGFERNSIGTRGGHYFYKLGL
                     TSSFKLPNTPVDSPLRLQSFIHFGDVLNNWKSAFNERKPALSTGVSLRYAASFANLDL
                     TYAVPLRVRDYDIAKPGLTFGLDLTLY"
     gene            <1271794..>1274283
                     /locus_tag="KLMA_20618"
                     /db_xref="GeneID:34715079"
     mRNA            <1271794..>1274283
                     /locus_tag="KLMA_20618"
                     /product="DNA repair protein XRS2"
                     /transcript_id="XM_022818247.1"
                     /db_xref="GeneID:34715079"
     CDS             1271794..1274283
                     /locus_tag="KLMA_20618"
                     /codon_start=1
                     /product="DNA repair protein XRS2"
                     /protein_id="XP_022674934.1"
                     /db_xref="GeneID:34715079"
                     /translation="MWIISYGYEDASGKHYSQCKALKECTEYSIGRSVNCELRIQQDK
                     SISRVHLVVKYEKNELSITNKGKLTKVNNKPVRIDECIVIQNHDIVFDIGGSPINVEI
                     HFSYQEWKIPHKLSLEEEKSTILQYGVKLCESFSKKSTLQVFSEGSSHTGCLFALIKG
                     VPVVSTEFLNCICQLLKEDNYLNFESSFQAIIRRFNLFPSYNHVPNVLSNICIMVFEQ
                     KLFDTLRYTIESGGGMIKLLTSTSEIDGSVIDNEKKIIVLSTNTVTDTQASKMNTSFS
                     NKFSEFGIVTHSLNDFVNALINNDLNALSEQKKPTTEEPTREISQPVVVKSKARIKPK
                     VQRLDSLTCFGGGNQLKIENSEYNTPSKTSDDSWNKGSEHESKSTNSFEAVEPTPIVP
                     KSSEIVTPPTDTKENISSITTAFAKENEPSIALDSKKRKRRPKVQQLGNLMMRDIPKV
                     ATESFQEQRDGDSKRIKLETDTSTEKPILAKSLPRNDKEDSNLIKYKYDSTKLGKEND
                     ATNNRYKQNDDLDDVRKGVISDESTPQDQPSSFETSEKSSPRVTDRPRSIAKLETNLP
                     ERRKTNDIVSAIAETKQKEVRRFQEGIFEVDQSELTESSLEEFKNVAKVEKIKVKPRI
                     LHPTVVSDKSAIWAGRKNFKRFTKKWPLYMKSYSIEANTGHIPYPKDNNNNRYIAMKR
                     FDYRKDGKSEENNGINIEIDFRLPNRMEGSNELSLQQSGETESAQESRVASGFGFKSK
                     PKSVPERNTLFITEDDDDSYDYDAPAAHNQLVVHGNKIEMEDDISLQSNRSVSFGTNS
                     LERSNSADADTDDDDDENNTRRFNFRSRRRK"
     gene            complement(<1274461..>1275387)
                     /gene="YPR1"
                     /locus_tag="KLMA_20619"
                     /db_xref="GeneID:34715080"
     mRNA            complement(<1274461..>1275387)
                     /gene="YPR1"
                     /locus_tag="KLMA_20619"
                     /product="putative reductase 1"
                     /transcript_id="XM_022818248.1"
                     /db_xref="GeneID:34715080"
     CDS             complement(1274461..1275387)
                     /gene="YPR1"
                     /locus_tag="KLMA_20619"
                     /codon_start=1
                     /product="putative reductase 1"
                     /protein_id="XP_022674935.1"
                     /db_xref="GeneID:34715080"
                     /translation="MSHLKPSTTKFKLNTGAEIPGIGLGTWRSTDDEVYNAVITALKN
                     GYRHIDTAAIYRNEEAVGRGIRDSGVPREEIFVTTKLWGTQHRNPLKGLEESLQRMGL
                     EYVDLYLMHWPVPLKDNPKYPGIPPASVGIERNTDLENWDFVKTWELMQELPATGKTK
                     AIGVSNFSVNNIKQLLASPGNKIVPATNQVELHPLLPQDELVSFCQEKGIVVEAYSPL
                     GSGTSDIITDPIIVGLAKKYNVEPAQYLINWGLKRGYVVLPKSITPSRIISNFQEFDL
                     TADDVKNAYTLPFYRGEKRLISPDWGTFKTFE"
     gene            complement(<1276389..>1277708)
                     /gene="LEM3"
                     /locus_tag="KLMA_20620"
                     /db_xref="GeneID:34715081"
     mRNA            complement(<1276389..>1277708)
                     /gene="LEM3"
                     /locus_tag="KLMA_20620"
                     /product="alkylphosphocholine resistance protein LEM3"
                     /transcript_id="XM_022818249.1"
                     /db_xref="GeneID:34715081"
     CDS             complement(1276389..1277708)
                     /gene="LEM3"
                     /locus_tag="KLMA_20620"
                     /codon_start=1
                     /product="alkylphosphocholine resistance protein LEM3"
                     /protein_id="XP_022674936.1"
                     /db_xref="GeneID:34715081"
                     /translation="MTALKSIGETVTGVFHRRKTGKGQKDEVPEIEDDIDASEFEDDD
                     DKVVKKPKSRRPKETRFTQQRIAAYNPVLTPKRVLPIYLFLGVIFLVFGGVMLNDARR
                     VDQLFVYYQDCDKNAPTSRFSDVPDDHYKYVFHKKYDKGNLPVPQWRYVADSNPDPTE
                     QQTGTCQLRFSTPYALPGPTYIYYYIEKFYGNHRRYVLSFSEDQIVGTKASLSQVKDT
                     VGINCKPLVRDDAGKIIYPCGLIANAMFNDTFPNQMQRINPSTGAQTSTIPLTNKNIN
                     WSSDKTRFKKTKYAPTDVVPPPYWHKQFPNGYNETNMPNIHEWEEFQNWMRTPAFDKF
                     ARLIRRTDQGLQQGTYQIDVDLHWPVTQYHGKKAVYVTHGSNLGSRNPAPAIIYLVGG
                     GICMLLALITLVSHLAWGRAMADTRLLSWNKIQESTETESPAEPEAE"
     gene            <1279224..>1280843
                     /gene="SNG1"
                     /locus_tag="KLMA_20621"
                     /db_xref="GeneID:34715082"
     mRNA            <1279224..>1280843
                     /gene="SNG1"
                     /locus_tag="KLMA_20621"
                     /product="nitrosoguanidine resistance protein SNG1"
                     /transcript_id="XM_022818250.1"
                     /db_xref="GeneID:34715082"
     CDS             1279224..1280843
                     /gene="SNG1"
                     /locus_tag="KLMA_20621"
                     /codon_start=1
                     /product="nitrosoguanidine resistance protein SNG1"
                     /protein_id="XP_022674937.1"
                     /db_xref="GeneID:34715082"
                     /translation="MTLEGLSDMSSDDVRAVNETQHERFLEGVGQNTMSDGPYMDVNT
                     PKEGAAVEKVFDGENSEDNDLGTSNDLGTSNDQAESVKEYNCDNAAFNNTDDTAVDGG
                     GAPPDGGSESSVPLERIRTRLFSSRLHSQRQIYQRKFIFNLLMLGALSIAMFSLYWGA
                     LYNHQSHFHQVKFIAFLGDDGELTQGIEPILRNAVPHFEIYNDTTIKQKYGQDVNVTE
                     KIHHLVHTLHYWGSLIVYPNATNAFVDSLTNPESPSFNSTNYFEFFYESARDLANYRT
                     TILPLLTQQETTYKETYFYKTYLPKIISNLTNISGSKLAAASDMQWREIDNRAFTDST
                     LMGPMQVGLIYCVLLTFFQLSLFGPVHGMITPLLKPVHIIIYRLVSSWATYFFLSLFF
                     CTVSAIFKVDFTLAYGRAGFIVYWMTTWLLMGAVGGANENVLSLLLAFYPQFLGFWLI
                     TWIILNISPSFVSMVLCNRLYRYGYMTPIYNGLECYRVIFMNTYKGNLGRNYGVLVAW
                     CVLNTLLFPLVMKVVGKKFKNDAKKKAAGSK"
     gene            <1281214..>1283817
                     /gene="FIG4"
                     /locus_tag="KLMA_20622"
                     /db_xref="GeneID:34715083"
     mRNA            <1281214..>1283817
                     /gene="FIG4"
                     /locus_tag="KLMA_20622"
                     /product="polyphosphoinositide phosphatase"
                     /transcript_id="XM_022818253.1"
                     /db_xref="GeneID:34715083"
     CDS             1281214..1283817
                     /gene="FIG4"
                     /locus_tag="KLMA_20622"
                     /codon_start=1
                     /product="polyphosphoinositide phosphatase"
                     /protein_id="XP_022674938.1"
                     /db_xref="GeneID:34715083"
                     /translation="MNILDSGPLEPLSKQKTSKQRKTMKFTLGKYTIYETNKSMYIVA
                     SNKRETMFRILEIDLSNEDQSLNIAEDNVFFMRNEVMEVLRKIEDADNDALTKKLTGY
                     GLLGVIRFTACYYLVVITKMSQVAVLGGHSIYHIDDTELVPITKSTKKPDATELRFIQ
                     SFQNLNLSKTFYFSYTFDITNTLQTNLLRQKLMSVGRTDLEVPPGIPDYNEMFMWNSY
                     LLDPIFSCIDTVYDWFQPIIHGFIDQVNVSLFGKSIYITLIGRRSHYFAGARFLKRGV
                     NNKGYVANEVETEQIVADMSLTSFHSPGRGFFDSDKYTSFVQHRGSIPLFWSQEVSNL
                     TAKPPISINIKDPFYSAAAKHFDKLFQRYGGGPIQILNLIKTKEKNPRETKLGEEFER
                     CIKYLNIFLPEAKKIEYTAWDMSRASKSHGQMVIEFLEKYAKETVESTGIFHNGKNFE
                     STSIQEGVCRTNCIDCLDRTNAAQFVIGKRALGEQLHALGIIEDTFLEYDSDIVNILT
                     ELFHDHGDTIALQYGGSHLVNTMETYRKVNQWSSHSRDMIESIKRFYSNSFVDAQRQE
                     AINLFLGHYIWAKDQPMLWDLSTDFYLHNLYEIGAPRRSYTHWWLNSHIKGLHKTIQE
                     EIIDKNNDVTYDKIIKNVRGYPNSYDNYWNEHYTPRMFVSFRDLFTFNMNSTRRYHNG
                     KDPISPFDSRKQTSINQKLRLLTTKKQKRFTSDSKESKKIVLSTSKDELDLYSVQLKL
                     SMDQNNNLLDQLNNFPIRFPIFSNDQLLSYNEFAIVEDNSPIIEQAEGEFHFSENDVP
                     TVRADIGKVFVEPSEESFYDKVLQFDNYQPLDDYSEYSDYQSLTVSNSSISEYEEAIN
                     KAHRYENPTFI"
     gene            complement(<1283847..>1284563)
                     /gene="RRP40"
                     /locus_tag="KLMA_20623"
                     /db_xref="GeneID:34715084"
     mRNA            complement(<1283847..>1284563)
                     /gene="RRP40"
                     /locus_tag="KLMA_20623"
                     /product="exosome complex component RRP40"
                     /transcript_id="XM_022818254.1"
                     /db_xref="GeneID:34715084"
     CDS             complement(1283847..1284563)
                     /gene="RRP40"
                     /locus_tag="KLMA_20623"
                     /codon_start=1
                     /product="exosome complex component RRP40"
                     /protein_id="XP_022674939.1"
                     /db_xref="GeneID:34715084"
                     /translation="MSQLLLPGDLIKGNETSDEEISAGPGVYCDPVTQELVATHAGIE
                     VVTETKKGHAVYVNYNSRRYIPAVGDLVVGVITGSFGDSYRVSLSNFSNPVSLSFMAF
                     PNASKKNRPTLKVGDLCYARVCSAYKELEAEIECMDSTKGQDAGFGLLDGGMIVETTL
                     AYARELLFNESYPLLNILGKLVEFEVAIGVNGIVWIKTDEVKTTLACYRAILACQDIP
                     PNQFDKTIKQIFNDTLKSSD"
     gene            <1284876..>1285853
                     /gene="PFA3"
                     /locus_tag="KLMA_20624"
                     /db_xref="GeneID:34715085"
     mRNA            <1284876..>1285853
                     /gene="PFA3"
                     /locus_tag="KLMA_20624"
                     /product="palmitoyltransferase PFA3"
                     /transcript_id="XM_022818255.1"
                     /db_xref="GeneID:34715085"
     CDS             1284876..1285853
                     /gene="PFA3"
                     /locus_tag="KLMA_20624"
                     /codon_start=1
                     /product="palmitoyltransferase PFA3"
                     /protein_id="XP_022674940.1"
                     /db_xref="GeneID:34715085"
                     /translation="MIFNKIGYYFPKLLTHTLILYTAVICFLKVDIIPRGLNGFLLTI
                     LVFIQLFTYWRVINLGAGCPSEFPLLSINRVEDVMNGVEQPPDIIKNNCICVKRDGSY
                     RFCRQCKLWKPDRSHHCSKCNKCYLKMDHHCPWFATCVGFRNQKLFVQFLCYVTIYSA
                     YVLLLTSLEMYFWFSDAKYETELLNMHLLITWLLALLSSISTFAFSCYTIWLVTKNET
                     TIEQYEWNSIRNDLQIYSDSLNCQTSAVNNVFDLGSRKSNFNSVMGNSWKEWLLPIQK
                     YVVDSTDCYTDKGLFFPVKSDIYDEYRESANLQQRLLSRLSPRSSMENI"
     gene            complement(<1286095..>1287822)
                     /gene="EGT2"
                     /locus_tag="KLMA_20625"
                     /db_xref="GeneID:34715086"
     mRNA            complement(<1286095..>1287822)
                     /gene="EGT2"
                     /locus_tag="KLMA_20625"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818256.1"
                     /db_xref="GeneID:34715086"
     CDS             complement(1286095..1287822)
                     /gene="EGT2"
                     /locus_tag="KLMA_20625"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022674941.1"
                     /db_xref="GeneID:34715086"
                     /translation="MVALRLLISGALLSVASAAYNNDTTASDISSSLNSNNSALNPLP
                     AASNSSSTVLITSEPSSIPSLTANNSLTATGYLNSTATSTSTTTPTAAFENIKVYDTL
                     SDSQTSTDPNHWFVIIAELSVSQGFSGDLYLTVPEQFGNFPEGTFDVLADKTPIGTVS
                     YNDSKIFTVSFDNVDADYDGSFNFLAQLEDKPSSPTTVAYTFDVSSGPSFVSSVTYAP
                     KSTTLSTVSTGVDSTGRPYFALDIPYTEYPGDLEFLSYAEDNYLFDDHYFQIVLETDS
                     FNNPIRVSNITAGTDNSDDSTISYSFNSNVSGGQAFRIIYYLSVDNSTTAVKNSAQLR
                     YPTLSFYKRDISIIFDTIDYLKPVANIDISSGNTISVLTNSQSSSINSTNTTTSSVAP
                     VTSSITSLYPNVTSTAAPYNNGSLTFTVITRTDDGVVSELTELVPVSTQATTNSSSTA
                     FDITATDDLTAATEALTSAPPSSTIQTSVRTGLKTRTLSGEETEIGSLVPVGTLDISQ
                     EDIAKKTEAYESTATSPEEVSTFLGLLGASTSTGKPRSIATQYSGYANRIQQQGLGSL
                     AVALLALLL"
     gene            1288822..1288985
                     /locus_tag="KLMA_R219"
                     /db_xref="GeneID:34718665"
     tRNA            join(1288822..1288855,1288927..1288985)
                     /locus_tag="KLMA_R219"
                     /note="tRNA-Stop (AAU)"
                     /db_xref="GeneID:34718665"
     gene            <1289281..>1289727
                     /gene="MDJ2"
                     /locus_tag="KLMA_20626"
                     /db_xref="GeneID:34715087"
     mRNA            <1289281..>1289727
                     /gene="MDJ2"
                     /locus_tag="KLMA_20626"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818257.1"
                     /db_xref="GeneID:34715087"
     CDS             1289281..1289727
                     /gene="MDJ2"
                     /locus_tag="KLMA_20626"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022674942.1"
                     /db_xref="GeneID:34715087"
                     /translation="MVLPVIVGVGITAVAVVARSGIRAWERYRLLTPLMIAQLNKVHI
                     PYKDLDQFGAKYRSHLPSQMLTKMDRYPGGFYDKMSETEALLILGISAQEIEELDEQL
                     LKQKHRRAMIMNHPDKGGSPYLASKINEARDLLASSIIIQRPRNNR"
     gene            <1290054..>1293053
                     /gene="PEX6"
                     /locus_tag="KLMA_20627"
                     /db_xref="GeneID:34715088"
     mRNA            <1290054..>1293053
                     /gene="PEX6"
                     /locus_tag="KLMA_20627"
                     /product="peroxisomal biogenesis factor 6"
                     /transcript_id="XM_022818258.1"
                     /db_xref="GeneID:34715088"
     CDS             1290054..1293053
                     /gene="PEX6"
                     /locus_tag="KLMA_20627"
                     /codon_start=1
                     /product="peroxisomal biogenesis factor 6"
                     /protein_id="XP_022674943.1"
                     /db_xref="GeneID:34715088"
                     /translation="MVIASLVYLQDITLPVSVSSDLWNEFFDQKSSPHYVKLTLPSYI
                     KYQEVSFVAQCANNSSLEFGSVGLPSNFFKSDSVRPYVNSVIIEPYFEKIPQADTLIL
                     SLKPNLYEELNQLSTEEQWSFLKLKFHIEFNVTVLNVNQIIYPSFCQVFSIAPEAEFS
                     VISENTQVVLIPDSSIDTEHAKSLDDNSKLDRKSFVTVKLQSLTEPVPTEFISPPQQD
                     TADNDIFAFVQPITLLELGIPSGSFVRLTSQNDEILVQLFVLFSPNPFEKDTIYVSPR
                     VRYMFMNENQITIKKTSLTSKKLPVANSVTLSRVGCPVNAQRIYQDIISHQLGEYFNG
                     KQRVVRVGDLIPVTFDSNYASIFSEQIKYSSHDTLVWFKVEEIQGPSTDQYYIIDSSI
                     TRLTTENIVSKDLMPVKICDCNKYYDLSPLFYYDENVFPHALQFRNILSTAAKCFERG
                     ISMGTTILLHSLTPNVGKTMLTKSLCNELGFHLIHIDCLTLTANTAVSDATNKTIGYI
                     RAKIETVISCAKQAVIYISHLEAILENEQAQQDNTGSKLARLMNVEMANLITEYTEKH
                     SGIIFVGSTNDLDGIPPLVRSKIKFELEVPVPTEDQRLAMFEWYFNPAKLNRHNSNYT
                     AVLSKTVKLRNVALQSAGLTPLDIKSIVQASKRKSYQNVKNGVISITESDITAVINIA
                     RDRLSDSIGAPKIPNVTWEDIGGMEMVKGEIMDTIDMPLKHPELFSSGMKKRSGILFY
                     GPPGTGKTLLAKAIASNFSLNFFSVKGPELLNMYIGESEANVRRVFQRARDAKPCVIF
                     FDELDSVAPKRGNQGDSGGVMDRIVSQLLAELDGMSSGGDGVFVVGATNRPDLLDEAL
                     LRPGRFDKMLYLGISDTDEKQANIIKALTRKFTLAPGVEPLDIGKTCPFNYTGADFYA
                     LCSDALLNAMTRIAGEVDKKWEQYKNDIGEHVPLRYWFDKVAKKSDLEVVVTLEDFEL
                     AKQKLIPSVSEDELNHYLKLKHSFESE"
     gene            <1293385..>1294683
                     /gene="RPD3"
                     /locus_tag="KLMA_20628"
                     /db_xref="GeneID:34715089"
     mRNA            <1293385..>1294683
                     /gene="RPD3"
                     /locus_tag="KLMA_20628"
                     /product="histone deacetylase RPD3"
                     /transcript_id="XM_022818259.1"
                     /db_xref="GeneID:34715089"
     CDS             1293385..1294683
                     /gene="RPD3"
                     /locus_tag="KLMA_20628"
                     /codon_start=1
                     /product="histone deacetylase RPD3"
                     /protein_id="XP_022674944.1"
                     /db_xref="GeneID:34715089"
                     /translation="MVYETKPFDPITVKPNEKKRVAYFYDADVGNYAYGAGHPMKPHR
                     IRMTHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESV
                     KFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKSEASGF
                     CYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGT
                     GELRDTGVGKGKYYAVNVPLRDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSL
                     SGDRLGCFNLSMKGHANCVNYMKSFGVPLMIVGGGGYTMRNVARTWAFETGILNNVIL
                     DEELPYNDYYEYYGPDYKLDVRPSNMYNVNTPEYLDKVLMNIFSNLEHTKYAPSVQLN
                     HVPKDPEDKGDEEEDTAAAKDTRGGSQYARDNTIEHENDF"
     gene            <1295114..>1295611
                     /gene="RIB4"
                     /locus_tag="KLMA_20629"
                     /db_xref="GeneID:34715090"
     mRNA            <1295114..>1295611
                     /gene="RIB4"
                     /locus_tag="KLMA_20629"
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /transcript_id="XM_022818260.1"
                     /db_xref="GeneID:34715090"
     CDS             1295114..1295611
                     /gene="RIB4"
                     /locus_tag="KLMA_20629"
                     /codon_start=1
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="XP_022674945.1"
                     /db_xref="GeneID:34715090"
                     /translation="MAVKGLGQPDQKYDGSKLRVGIIHARWNKEVINALVDGAIKRLQ
                     SLGVTDDNIVLESVPGSFELPYGVERFVQKQKEKNEPLDAVIPIGVLIKGSTMHFEYI
                     SDSTTHAIMALSSKLGIPVIFGLLTCLTEEQALARAGIDEGKTMHNHGEDWGAAAVEM
                     AIKFN"
     gene            complement(<1295703..>1297193)
                     /gene="NOP8"
                     /locus_tag="KLMA_20630"
                     /db_xref="GeneID:34715091"
     mRNA            complement(<1295703..>1297193)
                     /gene="NOP8"
                     /locus_tag="KLMA_20630"
                     /product="60S ribosome subunit biogenesis protein NOP8"
                     /transcript_id="XM_022818261.1"
                     /db_xref="GeneID:34715091"
     CDS             complement(1295703..1297193)
                     /gene="NOP8"
                     /locus_tag="KLMA_20630"
                     /codon_start=1
                     /product="60S ribosome subunit biogenesis protein NOP8"
                     /protein_id="XP_022674946.1"
                     /db_xref="GeneID:34715091"
                     /translation="MVVKRVYVGFVNENQDECFSELFKRFNRYGKINGDAKSFERHGS
                     FGYISMEFENDSQFDKLKASFNRVKFKGNTLRVAEAKPDWKVRWELEKKDEERDNKKR
                     KQMLKQEWEHYKKIENINMSWVDRKEVISGRLRTSARPPHKLRNITFRVNVNGKLKTY
                     KCYKTKLWGYEKHKNLRDLVYKFTNNYWRSGTDHIVDKLDYSRTKSVSFRNKAGDTLT
                     VSESTTSNDSEGDNVNENEKENTNMVLASLLTSFDFEKPIAVEEEADNEEFGGAEYED
                     TAIYKESNFKPQVSASALEELKRVKEGEFAKAHNHVKTFDENEDEEENEEENEVTIPH
                     QDNNDNQGDESSEEFIPTFGSTNNNNDAKAESSTNNTEVLRDLFNPSEPTSFKLIEES
                     DEDIDHNKDLKEDEIAEFIPEVSAPQKSNNPLFFVHKDSPFLVGQTRLAKIKPPVTLD
                     ERLLNWEENFWDNRSSWTKEMKQRRRDVIRLNKRRQDKHRGNTLLI"
     gene            <1297584..>1300907
                     /gene="CTR9"
                     /locus_tag="KLMA_20631"
                     /db_xref="GeneID:34715092"
     mRNA            <1297584..>1300907
                     /gene="CTR9"
                     /locus_tag="KLMA_20631"
                     /product="RNA polymerase-associated protein CTR9"
                     /transcript_id="XM_022818262.1"
                     /db_xref="GeneID:34715092"
     CDS             1297584..1300907
                     /gene="CTR9"
                     /locus_tag="KLMA_20631"
                     /codon_start=1