GenomeNet

Database: RefSeq
Entry: NC_036027
LinkDB: NC_036027
Original site: NC_036027 
LOCUS       NC_036027            1588169 bp    DNA     linear   CON 23-OCT-2017
DEFINITION  Kluyveromyces marxianus DMKU3-1042 DNA, complete genome, chromosome
            3.
ACCESSION   NC_036027
VERSION     NC_036027.1
DBLINK      BioProject: PRJNA264644
            BioSample: SAMD00067077
            Assembly: GCF_001417885.1
KEYWORDS    RefSeq.
SOURCE      Kluyveromyces marxianus DMKU3-1042
  ORGANISM  Kluyveromyces marxianus DMKU3-1042
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1
  AUTHORS   Lertwattanasakul,N., Kosaka,T., Hosoyama,A., Suzuki,Y.,
            Rodrussamee,N., Matsutani,M., Murata,M., Fujimoto,N., Suprayogi,
            Tsuchikane,K., Limtong,S., Fujita,N. and Yamada,M.
  TITLE     Genetic basis of the highly efficient yeast Kluyveromyces
            marxianus: complete genome sequence and transcriptome analyses
  JOURNAL   Biotechnol Biofuels 8, 47 (2015)
   PUBMED   25834639
  REMARK    DOI:10.1186/s13068-015-0227-x
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1588169)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1588169)
  AUTHORS   Yamada,M. and Kosaka,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2011) Contact:Mamoru Yamada Yamaguchi University;
            1677-1 Yoshida, Yamaguchi, Yamaguchi 753-8515, Japan URL
            :http://ds22.cc.yamaguchi-u.ac.jp/~jo-sei08/index.html
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP012215.
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps and the
            genomic and proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: SPS phrap v. 0.990329
            Assembly Name         :: Kmar_1.0
            Genome Coverage       :: 8.4x
            Sequencing Technology :: Sanger ABI3730
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1588169
                     /organism="Kluyveromyces marxianus DMKU3-1042"
                     /mol_type="genomic DNA"
                     /strain="DMKU3-1042"
                     /db_xref="taxon:1003335"
                     /chromosome="3"
     gene            complement(<2176..>3879)
                     /locus_tag="KLMA_30001"
                     /db_xref="GeneID:34715295"
     mRNA            complement(<2176..>3879)
                     /locus_tag="KLMA_30001"
                     /product="aminotriazole resistance protein"
                     /transcript_id="XM_022818488.1"
                     /db_xref="GeneID:34715295"
     CDS             complement(2176..3879)
                     /locus_tag="KLMA_30001"
                     /codon_start=1
                     /product="aminotriazole resistance protein"
                     /protein_id="XP_022675149.1"
                     /db_xref="GeneID:34715295"
                     /translation="MSQAESSSNSLNEVAEKEGEFPIESIFHPNRLKHFKFLCILTAL
                     ALDFMSLGAMIVLVQDVEKRFNISATKASWSLTSYVITFAGFIAFFGRVGDIVGNGMM
                     MSISIGVFGICSLLCAVIPNFVGFAVFRAFQGMAGAGIVPCSYALVNSMFAGENLQRY
                     FSILSSIGSGTIGVGFVIGGAFAETKIGYKALFYMVFGASILTCMLILLLIGYPEYVR
                     VKSDYSARFKKVTKLDVIGSFTFISGSVLLVVALTDGGDSWKKPSAYVPLVISIILMA
                     AFFAWNLGYQKVLSLLKPHISTGAYKYMESVSVLIPKELLYAHNFAPVLLVSFFAFAA
                     FMVVMYTVVNYSISVEGDAVIVAAVKIMPLIVGLMLANTTIALHQTILKPKNGLIVGT
                     FVCTLGCAFLTALKEVNGNLYWKLLLLSAFLAGVGGAVYFSYMLSMAIGDAPMEYKAL
                     AGGVVQTASQFGNEVALSVIVSLLGNGKTNRKELRRRYQNVGYFAIACAAMAFISAIT
                     TLRDQLEPSGDEEQQNASVHSVKGCESDESTTHQQCQVTVVQVGFEEDEKMKSQPGRI
                     A"
     gene            complement(<4810..>5304)
                     /locus_tag="KLMA_30002"
                     /db_xref="GeneID:34715296"
     mRNA            complement(<4810..>5304)
                     /locus_tag="KLMA_30002"
                     /product="choline-sulfatase"
                     /transcript_id="XM_022818489.1"
                     /db_xref="GeneID:34715296"
     CDS             complement(4810..5304)
                     /locus_tag="KLMA_30002"
                     /note="TIGR03417, choline-sulfatase."
                     /codon_start=1
                     /product="choline-sulfatase"
                     /protein_id="XP_022675150.1"
                     /db_xref="GeneID:34715296"
                     /translation="MLDLVPTVFDLGKVKTRYPNNGKSWVPLLHPQSTDDIVHKDYVV
                     SEGGFLKTEEPIIEVAPFPYDIKANLQHDEIDTVGRVVSMRTKEFTFIYRLYEPNELY
                     NRIEDLEERHNLIADPTYTSIVDAFEKKMLKFFIESSDHAPFVTDTRIPEVNLPLPGS
                     KQFK"
     gene            <5828..>7120
                     /locus_tag="KLMA_30003"
                     /db_xref="GeneID:34715297"
     mRNA            <5828..>7120
                     /locus_tag="KLMA_30003"
                     /product="transposon Ty1-NL1 Gag polyprotein"
                     /transcript_id="XM_022818490.1"
                     /db_xref="GeneID:34715297"
     CDS             5828..7120
                     /locus_tag="KLMA_30003"
                     /codon_start=1
                     /product="transposon Ty1-NL1 Gag polyprotein"
                     /protein_id="XP_022675151.1"
                     /db_xref="GeneID:34715297"
                     /translation="MASNDIISTNVPSKVPTTDTEEYPVQHGSAAKTPIVPSDNQASP
                     EESGSIDVEHKANADDEASGSHEGHHENFSKDSTKTGTPQDTLHKEPVDGSPVPNYAQ
                     QSWYYHTQPPPQFYSSPYANYGPGPYTPPWANMNMPIPGANTNPDKTGGHYQTTGPSG
                     DSSQYNPAYYFPYQLEPKPGLQSQTTTECTFGQLHNPRKTFTLSKVNSPHYYDSWVRE
                     MCQAMLEQNLGHLIPTEDNKTPETPEPAEKRYIEEIHIACVPEEKYPKWLKSSYDEGE
                     ALIDCFKEGIRRIKAEEDPEAIVLALAGLTLDYRESIPNFAKRLRKIHQRTVNAKFPM
                     AEKIVISRALKALPERYEKVDINFTKSNDQSFNNFINILLTTEPRMKSSNQYDNQRFY
                     TNSERKQVDRRPNRKTVHHIGSKTVEGDLRPDTEVQEE"
     gene            <7149..>11123
                     /gene="TY2B-GR2"
                     /locus_tag="KLMA_30004"
                     /db_xref="GeneID:34715298"
     mRNA            <7149..>11123
                     /gene="TY2B-GR2"
                     /locus_tag="KLMA_30004"
                     /product="transposon Ty2-F/Ty2-GR2 Gag-Pol polyprotein"
                     /transcript_id="XM_022818491.1"
                     /db_xref="GeneID:34715298"
     CDS             7149..11123
                     /gene="TY2B-GR2"
                     /locus_tag="KLMA_30004"
                     /codon_start=1
                     /product="transposon Ty2-F/Ty2-GR2 Gag-Pol polyprotein"
                     /protein_id="XP_022675152.1"
                     /db_xref="GeneID:34715298"
                     /translation="MLDGGATVSVIYDKRLIHNFTSESNQILVDVQQNEVAVKGEGNL
                     ELKFKGKRISLPAIYAPSTHTNIISVEDLTKSQAYLDLRRNCLLSKNGKTIAPTHKFA
                     GLRWLSRKNAIELPNQTQSVYAITPRSVRSAPDKFSLTSIHNMFGHMNINYIRESFRK
                     GLIQGVKEDDVDWTGVSSFQCQYCMEGKAKRNNHYVNARKDYTKEYLPFEYLHTDVFG
                     PVRVQRTRTTPRYFIAFIDEVTKYIWTFPLLHKTAEEVAPTFKEVVMLIYTQFNTRVK
                     TIQMDKGSEYLNTKVQKFLRERGIVSRETTVADSKANGAIERQHYTLLNDCRTFLRQA
                     NLRPRLWYHAVVYSTVMRNSLLNRSIGTSPRNRAGMSGLSFRDILPFGQPVIVHLPNP
                     KSKLQARGVLGYALHPSTRSYGYIIVVGKKKKIPIDTRNYRVLNYPPGATISEDEVQY
                     MIDRMENNDAESQDDIESNFEPNYTDMEQPIHHTADYFPNTTASNIETDQYNNDSFGL
                     HYGGDSVPPESSSSEDELFPTDESENDSDSSDQSFNDDGDPMSPPYSGGEEQIVPTPA
                     PIRRVPPMEPPSPVEDSPPPLYGTDLDDLFGESNINNYIPEDTDLLALNHESVPEPDT
                     AVPETTNIEQDNVLPSETIENSNPPNDNSDQSGEESGEESCEESGEESVDNRLKSIPI
                     FNGNKHKDSRTAEADLDSLYGGGNNTENNNGPTLEEVFRSIEEDPFMLTQKRPRSRAR
                     YRESNQDSCDSGGDYESDSDSDGSSDESPQKGRKIQRVNYVNAVLKPVNVIPLNMSLN
                     YSQAISRNRNEEEKDAFQKAYQKEIAQLTKMNTWNEELIDASTLPKKKILNSMFIFTT
                     KRDNSKKCRLVARGDQQAADTYDTELKANTVDNLALMTVLALTLDYNLTAFQLDISSA
                     YLYADLKEELYIRAPPHMNAKNKVLRLNKSLYGLKQSGANWYELIRSFLIKKCDLIED
                     RMWKCVFRDKEPLKLIICLFVDDMLVVGNDVKYIKKFISKLSKGFDTKIVNDGSHRPE
                     DGVNEYDILGIELEYKKKEYMKFGMQKSLEDKLPQLGVPLLPNIKIKKVPGEPGEYIL
                     SGKELTLNEKEYKSKVKHLQRIVGLASYVGHKFRFDILYYVNILAQHQLYPSAKVLDR
                     AAQLCQYLWDTRDKKLVWHYSGPKENNVTAVSDAAFAGNQDFKSQSGTLYLRNNKPIA
                     AKSRKIKLTCISSTEAEIYAISESLPILRGLEHLVNKLQDVKATVKVKTDSQPSMAII
                     NGTDDSACLKKHIGSRAMRIRDECDDLGLTLEYIPTKENNADVLTKPLSVKLFKLLTE
                     DWIQ"
     gene            <13005..>14297
                     /locus_tag="KLMA_30005"
                     /db_xref="GeneID:34715299"
     mRNA            <13005..>14297
                     /locus_tag="KLMA_30005"
                     /product="transposon Ty1-NL1 Gag polyprotein"
                     /transcript_id="XM_022818492.1"
                     /db_xref="GeneID:34715299"
     CDS             13005..14297
                     /locus_tag="KLMA_30005"
                     /codon_start=1
                     /product="transposon Ty1-NL1 Gag polyprotein"
                     /protein_id="XP_022675153.1"
                     /db_xref="GeneID:34715299"
                     /translation="MASNDIISTNVPSKVPTTDTEEYPVQHGSAAKTPIVPSDNQASP
                     EESGSIDVEHKANADDEASGSHEGHHENFSKDSTKTGTPQDTLHKEPVDGSPVPNYAQ
                     QSWYYHTQPPPQFYSSPYANYGPGPYTPPWANMNMPIPGANTNPDKTGGHYQTTGPSG
                     DSSQYNPAYYFPYQLEPKPGLQSQTTTECTFGQLHNPRKTFTLSKVNSPHYYDSWVRE
                     MCQAMLEQNLGHLIPTEDNKTPETPEPAEKRYIEEIHIACVPEEKYPKWLKSSYDEGE
                     ALIDCFKEGIRRIKAEEDPEAIVLALAGLTLDYRESIPNFAKRLRKIHQRTVNAKFPM
                     AEKIVISRALKALPERYEKVDINFTKSNDQSFNNFINILLTTEPRMKSSNQYDNQRFY
                     TNSERKQVDRRPNRKTVHHIGSKTVEGDLRPDTEVQEE"
     gene            <14326..>18300
                     /gene="TY2B-GR2"
                     /locus_tag="KLMA_30006"
                     /db_xref="GeneID:34715300"
     mRNA            <14326..>18300
                     /gene="TY2B-GR2"
                     /locus_tag="KLMA_30006"
                     /product="transposon Ty2-F/Ty2-GR2 Gag-Pol polyprotein"
                     /transcript_id="XM_022818493.1"
                     /db_xref="GeneID:34715300"
     CDS             14326..18300
                     /gene="TY2B-GR2"
                     /locus_tag="KLMA_30006"
                     /codon_start=1
                     /product="transposon Ty2-F/Ty2-GR2 Gag-Pol polyprotein"
                     /protein_id="XP_022675154.1"
                     /db_xref="GeneID:34715300"
                     /translation="MLDGGATVSVIYDKRLIHNFTSESNQILVDVQQNEVAVKGEGNL
                     ELKFKGKRISLPAIYAPSTHTNIISVEDLTKSQAYLDLRRNCLLSKNGKTIAPTHKFA
                     GLRWLSRKNAIELPNQTQSVYAITPRSVRSAPDKFSLTSIHNMFGHMNINYIRESFRK
                     GLIQGVKEDDVDWTGVSSFQCQYCMEGKAKRNNHYVNARKDYTKEYLPFEYLHTDVFG
                     PVRVQRTRTTPRYFIAFIDEVTKYIWTFPLLHKTAEEVAPTFKEVVMLIYTQFNTRVK
                     TIQMDKGSEYLNTKVQKFLRERGIVSRETTVADSKANGAIERQHYTLLNDCRTFLRQA
                     NLRPRLWYHAVVYSTVMRNSLLNRSIGTSPRNRAGMSGLSFRDILPFGQPVIVHLPNP
                     KSKLQARGVLGYALHPSTRSYGYIIVVGKKKKIPIDTRNYRVLNYPPGATISEDEVQY
                     MIDRMENNDAESQDDIESNFEPNYTDMEQPIHHTADYFPNTTASNIETDQYNNDSFGL
                     HYGGDSVPPESSSSEDELFPTDESENDSDSSDQSFNDDGDPMSPPYSGGEEQIVPTPA
                     PIRRVPPMEPPSPVEDSPPPLYGTDLDDLFGESNINNYIPEDTDLLALNHESVPEPDT
                     AVPETTNIEQDNVLPSETIENSNPPNDNSDQSGEESGEESCEESGEESVDNRLKSIPI
                     FNGNKHKDSRTAEADLDSLYGGGNNTENNNGPTLEEVFRSIEEDPFMLTQKRPRSRAR
                     YRESNQDSCDSGGDYESDSDSDGSSDESPQKGRKIQRVNYVNAVLKPVNVIPLNMSLN
                     YSQAISRNRNEEEKDAFQKAYQKEIAQLTKMNTWNEELIDASTLPKKKILNSMFIFTT
                     KRDNSKKCRLVARGDQQAADTYDTELKANTVDNLALMTVLALTLDYNLTAFQLDISSA
                     YLYADLKEELYIRAPPHMNAKNKVLRLNKSLYGLKQSGANWYELIRSFLIKKCDLIED
                     RMWKCVFRDKEPLKLIICLFVDDMLVVGNDVKYIKKFISKLSKGFDTKIVNDGSHRPE
                     DGVNEYDILGIELEYKKKEYMKFGMQKSLEDKLPQLGVPLLPNIKIKKVPGEPGEYIL
                     SGKELTLNEKEYKSKVKHLQRIVGLASYVGHKFRFDILYYVNILAQHQLYPSAKVLDR
                     AAQLCQYLWDTRDKKLVWHYSGPKENNVTAVSDAAFAGNQDFKSQSGTLYLRNNKPIA
                     AKSRKIKLTCISSTEAEIYAISESLPILRGLEHLVNKLQDVKATVKVKTDSQPSMAII
                     NGTDDSACLKKHIGSRAMRIRDECDDLGLTLEYIPTKENNADVLTKPLSVKLFKLLTE
                     DWIQ"
     gene            <20182..>21474
                     /locus_tag="KLMA_30007"
                     /db_xref="GeneID:34715301"
     mRNA            <20182..>21474
                     /locus_tag="KLMA_30007"
                     /product="transposon Ty1-NL1 Gag polyprotein"
                     /transcript_id="XM_022818494.1"
                     /db_xref="GeneID:34715301"
     CDS             20182..21474
                     /locus_tag="KLMA_30007"
                     /codon_start=1
                     /product="transposon Ty1-NL1 Gag polyprotein"
                     /protein_id="XP_022675155.1"
                     /db_xref="GeneID:34715301"
                     /translation="MASNDIISTNVPSKVPTTDTEEYPVQHGSAAKTPIVPSDNQASP
                     EESGSIDVEHKANADDEASGSHEGHHENFSKDSTKTGTPQDTLHKEPVDGSPVPNYAQ
                     QSWYYHTQPPPQFYSSPYANYGPGPYTPPWANMNMPIPGANTNPDKTGGHYQTTGPSG
                     DSSQYNPAYYFPYQLEPKPGLQSQTTTECTFGQLHNPRKTFTLSKVNSPHYYDSWVRE
                     MCQAMLEQNLGHLIPTEDNKTPETPEPAEKRYIEEIHIACVPEEKYPKWLKSSYDEGE
                     ALIDCFKEGIRRIKAEEDPEAIVLALAGLTLDYRESIPNFAKRLRKIHQRTVNAKFPM
                     AEKIVISRALKALPERYEKVDINFTKSNDQSFNNFINILLTTEPRMKSSNQYDNQRFY
                     TNSERKQVDRRPNRKTVHHIGSKTVEGDLRPDTEVQEE"
     gene            <21503..>25477
                     /gene="TY2B-GR1"
                     /locus_tag="KLMA_30008"
                     /db_xref="GeneID:34715302"
     mRNA            <21503..>25477
                     /gene="TY2B-GR1"
                     /locus_tag="KLMA_30008"
                     /product="transposon Ty2-F/Ty2-GR2 Gag-Pol polyprotein"
                     /transcript_id="XM_022818495.1"
                     /db_xref="GeneID:34715302"
     CDS             21503..25477
                     /gene="TY2B-GR1"
                     /locus_tag="KLMA_30008"
                     /codon_start=1
                     /product="transposon Ty2-F/Ty2-GR2 Gag-Pol polyprotein"
                     /protein_id="XP_022675156.1"
                     /db_xref="GeneID:34715302"
                     /translation="MLDGGATVSVIYDKRLIHNFTSESNQILVDVQQNEVAVKGEGNL
                     ELKFKGKRISLPAIYAPSTHTNIISVEDLTKSQAYLDLRRNCLLSKNGKTIAPTHKFA
                     GLRWLSRKNAIELPNQTQSVYAITPRSVRSAPDKFSLTSIHNMFGHMNINYIRESFRK
                     GLIQGVKEDDVDWTGVSSFQCQYCMEGKAKRNNHYVNARKDYTKEYLPFEYLHTDVFG
                     PVRVQRTRTTPRYFIAFIDEVTKYIWTFPLLHKTAEEVAPTFKEVVMLIYTQFNTRVK
                     TIQMDKGSEYLNTKVQKFLRERGIVSRETTVADSKANGAIERQHYTLLNDCRTFLRQA
                     NLRPRLWYHAVVYSTVMRNSLLNRSIGTSPRNRAGMSGLSFRDILPFGQPVIVHLPNP
                     KSKLQARGVLGYALHPSTRSYGYIIVVGKKKKIPIDTRNYRVLNYPPGATISEDEVQY
                     MIDRMENNDAESQDDIESNFEPNYTDMEQPIHHTADYFPNTTASNIETDQYNNDSFGL
                     HYGGDSVPPESSSSEDELFPTDESENDSDSSDQSFNDDGDPMSPPYSGGEEQIVPTPA
                     PIRRVPPMEPPSPVEDSPPPLYGTDLDDLFGESNINNYIPEDTDLLALNHESVPEPDT
                     AVPETTNIEQDNVLPSETIENSNPPNDNSDQSGEESGEESCEESGEESVDNRLKSIPI
                     FNGNKHKDSRTAEADLDSLYGGGNNTENNNGPTLEEVFRSIEEDPFMLTQKRPRSRAR
                     YRESNQDSCDSGGDYESDSDSDGSSDESPQKGRKIQRVNYVNAVLKPVNVIPLNMSLN
                     YSQAISRNRNEEEKDAFQKAYQKEIAQLTKMNTWNEELIDASTLPKKKILNSMFIFTT
                     KRDNSKKCRLVARGDQQAADTYDTELKANTVDNLALMTVLALTLDYNLTAFQLDISSA
                     YLYADLKEELYIRAPPHMNAKNKVLRLNKSLYGLKQSGANWYELIRSFLIKKCDLIED
                     RMWKCVFRDKEPLKLIICLFVDDMLVVGNDVKYIKKFISKLSKRFDTKIVNDGSHRPE
                     DGVNEYDILGIELEYKKKEYMKFGMQKSLEDKLPQLGVPLLPNIKIKKVPGEPGEYIL
                     SGKELTLNEKEYKSKVKHLQRIVGLASYVGHKFRFDILYYVNILAQHQLYPSAKVLDR
                     AAQLCQYLWDTRDKKLVWHYSGPKENNVTAVSDAAFAGNQDFKSQSGTLYLRNNKPIA
                     AKSRKIKLTCISSTEAEIYAISESLPILRGLEHLVNKLQDVKATVKVKTDSQPSMAII
                     NGTDDSACLKKHIGSRAMRIRDECDDLGLTLEYIPTKENNADVLTKPLSVKLFKLLTE
                     DWIQ"
     gene            complement(<27449..>30526)
                     /gene="LAC4"
                     /locus_tag="KLMA_30009"
                     /db_xref="GeneID:34715303"
     mRNA            complement(<27449..>30526)
                     /gene="LAC4"
                     /locus_tag="KLMA_30009"
                     /product="beta-galactosidase"
                     /transcript_id="XM_022818497.1"
                     /db_xref="GeneID:34715303"
     CDS             complement(27449..30526)
                     /gene="LAC4"
                     /locus_tag="KLMA_30009"
                     /codon_start=1
                     /product="beta-galactosidase"
                     /protein_id="XP_022675157.1"
                     /db_xref="GeneID:34715303"
                     /translation="MSCLIPENLRNPKKVHENRLPTRAYYYDQDIFESLNGPWAFALF
                     DAPLDAPDAKNLDWETAKKWSTISVPSHWELQEDWKYGKPIYTNVQYPIPIDIPNPPT
                     VNPTGVYARTFELDSKSIESFEHRLRFEGVDNCYELYVNGQYVGFNKGSRNGAEFDIQ
                     KYVSEGENLVVVKVFKWSDSTYIEDQDQWWLSGIYRDVSLLKLPKKAHIEDVRVTTTF
                     VDSQYQDAELSVKVDVQGSSYDHINFTLYEPEDGSKVYDASSLLNEENGNTTFSTKEF
                     ISFSTKKDEETAFKINVKAPEHWTAENPTLYKYQLDLIGSDGSVIQSIKHHVGFRQVE
                     LKDGNITVNGKDILFRGVNRHDHHPRFGRAVPLDFVVRDLILMKKFNINAVRNSHYPN
                     HPKVYDLFDKLGFWVIDEADLETHGVQEPFNRHTNLEAEYPDTKNKLYDVNAHYLSDN
                     PEYEVAYLDRASQLVLRDVNHPSIIIWSLGNEACYGRNHKAMYKLIKQLDPTRLVHYE
                     GDLNALSADIFSFMYPTFEIMERWRKNHTDENGKFEKPLILCEYGHAMGNGPGSLKEY
                     QELFYKEKFYQGGFIWEWANHGIEFEDVSTADGKLHKAYAYGGDFKEEVHDGVFIMDG
                     LCNSEHNPTPGLVEYKKVIEPVHIKIAHGSVTITNKHDFITTDHLLFIDKDTGKTIDV
                     PALKPEESVTIPSDTTYVVAVLKDDAGVLKAGHEIAWGQAELPLKVPDFVTETAEKPT
                     KINDGKRYVSVESSGLQFVLDKLLGKIESLKVKGKEISSKFEGSSITFWRPPTNNDEP
                     RDFKNWKKYNIDLMKQNVHEVSVEKGSNGSLAVVTVNSRISPVVFYYGFETVQKYTIF
                     ANKINLNTSMKLTGEYQPPDFPRVGYEFWLGDSYESFEWFGRGPGESYPDKKESQRFG
                     LYDSKKVEEFVYDYPQENGNHTDTHFLNIKFEGAGKLSIFQKEKPFNFKISDEYGVDE
                     AAHACDVKRYGRHYLRLDHAIHGVGSEACGPGVLDQYRLKAQDFNFEFDLAFE"
     gene            <33718..>35481
                     /gene="LAC12"
                     /locus_tag="KLMA_30010"
                     /db_xref="GeneID:34715304"
     mRNA            <33718..>35481
                     /gene="LAC12"
                     /locus_tag="KLMA_30010"
                     /product="lactose permease"
                     /transcript_id="XM_022818498.1"
                     /db_xref="GeneID:34715304"
     CDS             33718..35481
                     /gene="LAC12"
                     /locus_tag="KLMA_30010"
                     /codon_start=1
                     /product="lactose permease"
                     /protein_id="XP_022675158.1"
                     /db_xref="GeneID:34715304"
                     /translation="MADHSSSSSSLQKKPINTIEHKETLGSDLDHKEALNSDNDNTSG
                     LKINGVPVEDAREEVLLPGYLSKQYYKLYGLCFVTYLCATMQGYDGSLMGSIYTEKAY
                     LKYYHLDINSSTGTGLVFSIFNVGQICGAFFVPLMDWKGRKPAILIGCLGVVIGAIIT
                     SVTTTKSALIGGRWFLAFFATIANSAAPTYCAEVAPAHLRGKVAGLYNTLWYVGSIVA
                     AFTTYGTNKNFPNSSKAFKIPLYLQMMFPGLVCIFGWLIPESPRWLVGVGREEEAREF
                     IIKYHLNGDRTHPLLDMEMAEIIESFHGTDLSNPLEMLDVRILFRTRSDRYRAMLVIL
                     MAWFGQFSGNNVCSYYLPTMLRNVGMKSVSLNVLMNGVYSIVSWISSICGAFFIDKIG
                     RREGFLGSISGAALALTGLSICTARYEKTKKKSASNGALVFIYLFGVIFSFAFTPMQS
                     MYSTEVSTNLMRSKAQLLNGVVSGAAQFVNQFAAPKAMKNIKYWFYVFYVFFDIFEFI
                     VIYFFFVETKGRSLEELEAVFEAPNPRKASVDQAFLAQVRATLVQQNDVRVANAQNLK
                     EQELLKSDADHVEKLSEAESV"
     gene            complement(<36161..>38698)
                     /locus_tag="KLMA_30011"
                     /db_xref="GeneID:34715305"
     mRNA            complement(<36161..>38698)
                     /locus_tag="KLMA_30011"
                     /product="beta-glucosidase"
                     /transcript_id="XM_022818499.1"
                     /db_xref="GeneID:34715305"
     CDS             complement(36161..38698)
                     /locus_tag="KLMA_30011"
                     /codon_start=1
                     /product="beta-glucosidase"
                     /protein_id="XP_022675159.1"
                     /db_xref="GeneID:34715305"
                     /translation="MSKFDVEQLLSELNQDEKISLLSAVDFWHTKKIERLGIPAVRVS
                     DGPNGIRGTKFFDGVPSGCFPNGTGLASTFDRDLLETAGKLMAKESIAKNAAVILGPT
                     TNMQRGPLGGRGFESFSEDPYLAGMATSSVVKGMQGEGIAATVKHFVCNDLEDQRFSS
                     NSIVSERALREIYLEPFRLAVKHANPVCIMTAYNKVNGEHCSQSKKLLIDILRDEWKW
                     DGMLMSDWFGTYTTAAAIKNGLDIEFPGPTRWRTRALVSHSLNSREQITTEDVDDRVR
                     QVLKMIKFVVDNLEKTGIVENGPESTSNNTKETSDLLRKIAADSIVLLKNKNNILPLK
                     KEDNIIVIGPNAKAKTSSGGGSASMNSYYVVSPYEGIVNKLGKEVDYTVGAYSHKSIG
                     GLAESSLIDAAKPADAENSGLIAKFYSNPVEERSDDEEPFHVTKVNRSNVHLFDFKHE
                     KVDPKNPYFFVTLTGQYVPQEDGDYIFSLQVYGSGLFYLNDELIIDQKHNQERGSFCF
                     GAGTKERTKKLTLKKGQVYNVRVEYGSGPTSGLVGEFGAGGFQAGVIKAIDDDEEIRN
                     AAELAAKHDKAVLIIGLNGEWETEGYDRENMDLPKRTNELVRAVLKANPNTVIVNQSG
                     TPVEFPWLEDANALVQAWYGGNELGNAIADVLYGDVVPNGKLSLSWPFKLQDNPAFLN
                     FKTEFGRVIYGEDIFVGYRYYEKLQRKVAFPFGYGLSYTTFELDISDFKVTDDKIAIS
                     VDVKNTGDKFAGSEVVQVYFSALNSKVSRPVKELKGFEKVHLEPGEKKTVNIDLELKD
                     AISYFNEELGKWHVEAGEYLVSVGTSSDDILSVKEFKVEKELYWKGL"
     gene            complement(<39931..>41826)
                     /gene="mirA"
                     /locus_tag="KLMA_30012"
                     /db_xref="GeneID:34715306"
     mRNA            complement(<39931..>41826)
                     /gene="mirA"
                     /locus_tag="KLMA_30012"
                     /product="siderophore iron transporter mirA"
                     /transcript_id="XM_022818500.1"
                     /db_xref="GeneID:34715306"
     CDS             complement(39931..41826)
                     /gene="mirA"
                     /locus_tag="KLMA_30012"
                     /codon_start=1
                     /product="siderophore iron transporter mirA"
                     /protein_id="XP_022675160.1"
                     /db_xref="GeneID:34715306"
                     /translation="MREDITKSTSSEEVGDVTASVEDSLQKKSSDNENVYEIVEPEPV
                     YEKAWSKNMIIVAYAVLFFTAFVETFASDSTKNLDSYATSSFNAHSLLATIAVVYKIT
                     AICAYPVFAKVADILGRGEGFGVSIVFYTLAYLLYAACQNVNTYVCAEIFYALGRNGY
                     RVFQQIFIADTTSLVNRGIWSQLPVAISAIPSLYAGSYIQDAFLKHSTWRWGYGTFCI
                     ILAASAFPLTFIMLYMDKRAKKAGERKQIAIFKDLPEGSWYKKALHVMFVELDLIGGA
                     LLLAGFAVFFVPLTLTGSKSSYKWHEPRLIAMIVVGFVIFCMFLVWNFSFKKRPFPTR
                     KPFVPAQSFANKTVVVILILNALDLCENSSFATYFATTLQVGGYYTAGQASRIDNAKK
                     VTVQIASILTGLAMKYTKLSKIYVLGGVPLVVLGHGLLVYFMNRNGVMESTIRLNVME
                     IFIGFGRGMYQSATQVLIQAIAGVEGIAMSTAFFLAFQSIGSLIGSAIAGGIWNSIIL
                     RKLDKYLPPKEKKNAKKIFKSIKVAMSYKKHTPTRDAISRAYRETLQIIGYTGLGIIA
                     PMLILMFFVREVKLTDKHDAYGNDARSDTDSNIEGIRTDPEQRQDEKPTYSFNQEKRT
                     WTNFWRV"
     gene            complement(<44198..>45889)
                     /gene="CYB2"
                     /locus_tag="KLMA_30013"
                     /db_xref="GeneID:34715307"
     mRNA            complement(<44198..>45889)
                     /gene="CYB2"
                     /locus_tag="KLMA_30013"
                     /product="cytochrome b2"
                     /transcript_id="XM_022818501.1"
                     /db_xref="GeneID:34715307"
     CDS             complement(44198..45889)
                     /gene="CYB2"
                     /locus_tag="KLMA_30013"
                     /codon_start=1
                     /product="cytochrome b2"
                     /protein_id="XP_022675161.1"
                     /db_xref="GeneID:34715307"
                     /translation="MNALKTRAWTITRLTSRKTNNGLFVHTSKRLLRTMKPQPKGQYR
                     LYPKAKLLNYDTTKKASLITGASSLVLFLSHLLFEVEEEKNGSVSVKEVMSHNKINDC
                     WIVIDGNVYDVTLFLSQHPGGVARIMEFAGKDATAKFHQMHSSATLEKMKDHLIYIGK
                     LSGAFENELSEEEIRIMEQKAKIPPLSKIFCLSDFEGVAKKVLPKSTFFYYATGSSDE
                     YTLRENHYAYSRVFFRPKILQDIEEVTTETEFLGTKVNLPIYITAFAGSKLAHPLGEL
                     NLQAAAYKANVMQMVPKQNSYTYEEFFSRVPDDQNQWLQFHFDTQEELDNLDNWVKKA
                     GTLPSVKGLFLNVDLADIGNREKDSRQRAATAGSEYLDEMTDNKFGSHPKITWRTIEN
                     VIKNTNLPVALKGVQRGEDVVLAAQKGVKAVILSNHGGRQLDFSRPPLEVLVEAKQML
                     KEKKLDDKIEIYLDGGVRRGSDIIKALCLGAKGVGLGRPFLYAMAGYGEDGVSHLINI
                     LQAEIENNMRLLGVDKIEDLNETLVDCKSLSFKNPRINDSLYDEAYEPLQFPKFQ"
     gene            <46942..>48579
                     /locus_tag="KLMA_30014"
                     /db_xref="GeneID:34715308"
     mRNA            <46942..>48579
                     /locus_tag="KLMA_30014"
                     /product="conserved hypothetical transmembrane protein"
                     /transcript_id="XM_022818502.1"
                     /db_xref="GeneID:34715308"
     CDS             46942..48579
                     /locus_tag="KLMA_30014"
                     /codon_start=1
                     /product="conserved hypothetical transmembrane protein"
                     /protein_id="XP_022675162.1"
                     /db_xref="GeneID:34715308"
                     /translation="MDNRRIVGRISNSRSRNSKKAPLTLKWGGRPYKNKNKVINIPEN
                     TKLVNGILVAKDEGKTVSASNLNIKNLIVVNEGTQFLCSKKRRSKQTGTKPQCNEENS
                     ASENSLELFNGYSPMNDLWFSPLQVFGSPGLTELFSFYVQETSQIFIVSNSANTVNPF
                     KTTLPQMAIANKIVMKLLAVLGGQHRKKFGYQTDRIEEDKVMKQLYDESLLELERRVV
                     DPQEKFSFVTLACILILASIDIFFDQKQGLWRTHLYGAKDILLEKLKRNSEWTDVVSQ
                     RQKISYSVGEDRESFLTRWFMYLNVISLLSSPKATRQAEIFQQMDLDFCPSADRNNNL
                     LAREDLKDIQPTSGMEPRILAYLSRISQMVFEKDKITSANGMEELMTQAIELDYEISN
                     YLVTSERERDEVLKSVQPTTKNLRIYQFLRCTNLLFGLTALLLLRRRILNLSQRTTLV
                     KELLTRISALLRDKVPLNSPAESCLLLCIFSCGCELIDSSLVSLRDVYIRHLDSLMKG
                     GISGAKIAKTVMEECWETGLPWWEVLKTRKQHISFAI"
     gene            <49603..>51021
                     /gene="bioA"
                     /locus_tag="KLMA_30015"
                     /db_xref="GeneID:34715309"
     mRNA            <49603..>51021
                     /gene="bioA"
                     /locus_tag="KLMA_30015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818503.1"
                     /db_xref="GeneID:34715309"
     CDS             49603..51021
                     /gene="bioA"
                     /locus_tag="KLMA_30015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675163.1"
                     /db_xref="GeneID:34715309"
                     /translation="MTVTLETPNTSYLFQATVDKTGSQVVGGKGVRVDIERDGVVHKN
                     ILDAITGAAVGALGWGDEEVYDIINKAARESTYSYPCLISNKSAEELSKFYIEHSPKG
                     VFESALWTTSGSESNENALRIIRQYYLERGLPKKLKLISREDSYHGFTLGAMAISNNP
                     RITAYKDYFMDQKNICLTMPSAYTYRNKLKGETEEDYSKRLLKTIEEQIITEDPDTIA
                     AIIVETLPGSSLGTTPPPKGYLKGIRDLCNKYDIIFYLDEVMCGTGRSNPNGKLNCWE
                     NFLAPEDGPDIQTVGKTLGSGYVTIAGILIGPKIKEAYVKGSGTIVGGHTYSSHAFNC
                     AVALGIQQKIAKENLTANVFKMGNLMGEKLKQALLSEDNIAGDVRGIGGFWSVELVSN
                     RDTKEAFDPSLGIANRIKEQCFQNGLNVMAMGTTPTKSCSDRILLAPSFIITEADVDE
                     IVEKLVKSVTELSKQLKEEGVF"
     gene            <51781..>52710
                     /gene="YPR1"
                     /locus_tag="KLMA_30016"
                     /db_xref="GeneID:34715310"
     mRNA            <51781..>52710
                     /gene="YPR1"
                     /locus_tag="KLMA_30016"
                     /product="putative reductase 1"
                     /transcript_id="XM_022818504.1"
                     /db_xref="GeneID:34715310"
     CDS             51781..52710
                     /gene="YPR1"
                     /locus_tag="KLMA_30016"
                     /codon_start=1
                     /product="putative reductase 1"
                     /protein_id="XP_022675164.1"
                     /db_xref="GeneID:34715310"
                     /translation="MSSTAEPTLKLNTGASIPQIGLGTWQSPDQEAYNAVVTALKNGY
                     RHIDTAAIYGNEEAVGRGIRDSGVPREEIFVTTKLWGTQQRNPEAALDDSLKRLGLDY
                     VDLYLIHWPVALKTDSIKDGNVFTFPRTADGKIDVDIEDWDFTKTWEKMQHLPKTGKT
                     KAIGVSNFSIKNIEALFKANPNTIVPAANQVETHPQLDQQELLDYCKSKGILLEAYSP
                     LGSSNSLLLTDPTIKKIAEKHNVEPANILINWGLSRGYVVLPKSVNPERVKNNKKIID
                     LPAEDIETINSLATKIGSKRYVSPDFTPFKIFE"
     gene            <53579..>55288
                     /gene="PUT4"
                     /locus_tag="KLMA_30017"
                     /db_xref="GeneID:34715311"
     mRNA            <53579..>55288
                     /gene="PUT4"
                     /locus_tag="KLMA_30017"
                     /product="probable proline-specific permease put4"
                     /transcript_id="XM_022818505.1"
                     /db_xref="GeneID:34715311"
     CDS             53579..55288
                     /gene="PUT4"
                     /locus_tag="KLMA_30017"
                     /codon_start=1
                     /product="probable proline-specific permease put4"
                     /protein_id="XP_022675165.1"
                     /db_xref="GeneID:34715311"
                     /translation="MLVTSDNSERTSVTPYNSGHPKEKGFLNVQHVHEDSDQDYYTDI
                     EKADSPQKVVRGLQSRHIQLIALGSAIGTGLFIGSGGALSTCGPAPLFMAYIIISFFV
                     WTIMNQLTEMVCLIPLPGEASIYSLTKTYMNSSISFMSGWNLFYAMAMIVPTEITACA
                     LLIKYWTDANSAIFITIFIVVSICLTMLPVRAFGESEFYVCTIKIVTIIGLIIIGIVI
                     FFGGGPNQHHVLGFHYWKTPGAFQEHLASGSTGKFLAVWTAIIKSGFSFVLVPETVTS
                     CSAECVMPRRNMPRACQRFVYRLAVFYVLGTLIIGVIVGSDNDRLINAIQSGKSDAAA
                     SPFVIGIQEVGIKVLPHIINACILTSAYSCGCALLYGSSRTIYAMALKGDAPKIFGKV
                     NRFGTPYYSVGAASLFTFLAYLNCSKSSSKVFNWLSNIATISGFVSWIFVAATYLRFR
                     RVMDILNLNDRVPFRVPYQRAFAWATGIFFFILSLTNGYSVFISGNWNVSDFFAAYVT
                     IGFMMVLFIIGTAYHREWRFRDPYEIETEILPKIAISDEEERNEVVPVPKNLWEKIVA
                     FII"
     gene            complement(<55396..>56421)
                     /gene="ARI1"
                     /locus_tag="KLMA_30018"
                     /db_xref="GeneID:34715312"
     mRNA            complement(<55396..>56421)
                     /gene="ARI1"
                     /locus_tag="KLMA_30018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818506.1"
                     /db_xref="GeneID:34715312"
     CDS             complement(55396..56421)
                     /gene="ARI1"
                     /locus_tag="KLMA_30018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675166.1"
                     /db_xref="GeneID:34715312"
                     /translation="MTYVVVTGASGYLAQHVIKQLLERNYKVIGTVRNQQKAEDIAKL
                     FQNDNLTLELVPDLLQADVFDDLFLKYTGQIKHVIHTASPCRFDTTEYENEMLLPAIN
                     GTKRVLESIKKYASETVETVVYTSSVSALANPAGILDSNLTLTEESWNPDSFEDGKKD
                     VFSAYYVSKTFAERTAWDFWKENKDQVKFQLTTICPSYIFGPQAFEENAKGTLNFSTE
                     IVNKILHSKPGDELDKNFAGAFVDVRDVARAHVLALEKPELKSKRLVLLNDVYALQDV
                     ADYINKHFPELRGKIATGVPGEGKEIVKHIAHYDNSKTKKLLGFEFISFGQAITDTVA
                     QILKANN"
     gene            <56899..>58512
                     /gene="fmo1"
                     /locus_tag="KLMA_30019"
                     /db_xref="GeneID:34715313"
     mRNA            <56899..>58512
                     /gene="fmo1"
                     /locus_tag="KLMA_30019"
                     /product="thiol-specific monooxygenase"
                     /transcript_id="XM_022818508.1"
                     /db_xref="GeneID:34715313"
     CDS             56899..58512
                     /gene="fmo1"
                     /locus_tag="KLMA_30019"
                     /codon_start=1
                     /product="thiol-specific monooxygenase"
                     /protein_id="XP_022675167.1"
                     /db_xref="GeneID:34715313"
                     /translation="MTQGEKSGTSVAIIGAGAAGLTGLFELLHTKKGGSTSLKYNSDG
                     SLDEQTSINDDPAFGDIVVFEQSEKVGGVWNPSFDETDVIPQELFDTERYDDPTVLRP
                     KTKIPDGFSNQPYAEPLKIPISESVEAPIKWNRSGIYKSLFSNVARRYLRNSFIPLNP
                     NEEGKSSSKKNRPIDPFITNFEVTDQLLKFVEKYSLLQYVRTNSEVVDVKKSTDGLDQ
                     WIVTVRETDTKTGIDKWYSQRFDKVVVSNGHYSIPHIPRIEGLSKWNKRAPGSISHSK
                     AFRDESIFKNKRVVFIGTGLSGIDILQYAFPLAKEVIVARTPGKKEIFEWLGRAACSE
                     GIVVKPRISSVDYENGKTVKFVDGTEIQDVDLLVFSTGYHWRYPFLNEDDTGISIINE
                     DGSKKIATHTSLVDGLFKSTFSNKDPSLAFIGVLMTQFKWPSFEFEAAIIAAVWSGYA
                     KLPPLEKRLEEHKKRLAETGTNLGYHFFPDHEFVRYVDDAKYLLPANRRSEDIFDPTY
                     IDEQLESVKVAEKLFHELKENTISVHETE"
     gene            <60293..>61498
                     /locus_tag="KLMA_30020"
                     /db_xref="GeneID:34715314"
     mRNA            <60293..>61498
                     /locus_tag="KLMA_30020"
                     /product="AP-1 accessory protein LAA1"
                     /transcript_id="XM_022818509.1"
                     /db_xref="GeneID:34715314"
     CDS             60293..61498
                     /locus_tag="KLMA_30020"
                     /codon_start=1
                     /product="AP-1 accessory protein LAA1"
                     /protein_id="XP_022675168.1"
                     /db_xref="GeneID:34715314"
                     /translation="MRRYYNDKLKIGKVMDILFNMVFSNDYEPGSVSGFGNSYNSEFN
                     MLLGVGNALKALTEVIGPDLRNIRVKFKAVLSSLNMCPCSDVQAVSLKISELVSMFKM
                     ETLFNFKMSMLIVRSLILSFLKRGMPRSGFKVSVEYLLEMGNYEDVVLNRLVFTSFLV
                     FPKYRSLRKYIYGWLKHENRLNVLLKIPDMSPYALQFLLEVYRDLIGKDEDLSSILKI
                     CYTASVSNIPSLQVSGLELVKKILDVYEDVVDPEDESSYLLEQYTALITGVVNPLFSR
                     PSYPEVICCAFDICAVSLSNRVVSYLVDGLLEVAENKPILKIGASEFPLNKKQLQVKL
                     SILRAWANTKGDFVKEYLNVLVPLWIITIREHYSPEIVDSLCAQDPSIINNFDLEGFV
                     FVMFGEILP"
     gene            complement(<61549..>62313)
                     /gene="MATA2"
                     /locus_tag="KLMA_30021"
                     /db_xref="GeneID:34715315"
     mRNA            complement(<61549..>62313)
                     /gene="MATA2"
                     /locus_tag="KLMA_30021"
                     /product="mating-type protein A2"
                     /transcript_id="XM_022818510.1"
                     /db_xref="GeneID:34715315"
     CDS             complement(61549..62313)
                     /gene="MATA2"
                     /locus_tag="KLMA_30021"
                     /codon_start=1
                     /product="mating-type protein A2"
                     /protein_id="XP_022675169.1"
                     /db_xref="GeneID:34715315"
                     /translation="MSNSTLRRTTFFKLSTKEEACSSNKAVQSNNNSIEFPNLKRNGK
                     AFTCSSNEKTSKKFTRPRNQFVLMRTLFNRCVTTHILEHFNQTKIQKNMFSVTSKITS
                     ELWNESPSELKVYFLLLATLEENWHKNKHYCSWDKQSSQTLSMEPIENSHIFSRLAIS
                     LSMGVGSAVSSYSAKDLCLFPKTRTKKKRVASPTLLPNQRFNSKFNSKLSQDTKTKSP
                     KSLVRLKSTKLPTQSGKVFKKRYQNENRVIEDLFLV"
     gene            <63179..>63820
                     /gene="MATA1"
                     /locus_tag="KLMA_30022"
                     /db_xref="GeneID:34715316"
     mRNA            <63179..>63820
                     /gene="MATA1"
                     /locus_tag="KLMA_30022"
                     /product="mating-type protein A1"
                     /transcript_id="XM_022818511.1"
                     /db_xref="GeneID:34715316"
     CDS             63179..63820
                     /gene="MATA1"
                     /locus_tag="KLMA_30022"
                     /codon_start=1
                     /product="mating-type protein A1"
                     /protein_id="XP_022675170.1"
                     /db_xref="GeneID:34715316"
                     /translation="MDGHDKKNPILLLKELCQEAQGLAGVQLKEDGFSSPFKTFSIPF
                     PEEAVKKCSNKALLLQLYHQYSTSLETILNKCPLEDLKVDPQMVADAFNNQFLRTIQL
                     LPVENNLKIKEQNPSDSSGKEDSKNDTVEEDSPSPDNQNSRTAKKFFLEPEAKDLLEK
                     VFKVKKCPNTSERLFIAQKLGLTASQVRIWFTNKRMRTKSKQKKVKPIAGPIK"
     gene            complement(<63843..>64163)
                     /locus_tag="KLMA_30023"
                     /db_xref="GeneID:34715317"
     mRNA            complement(<63843..>64163)
                     /locus_tag="KLMA_30023"
                     /product="protein SLA2"
                     /transcript_id="XM_022818512.1"
                     /db_xref="GeneID:34715317"
     CDS             complement(63843..64163)
                     /locus_tag="KLMA_30023"
                     /codon_start=1
                     /product="protein SLA2"
                     /protein_id="XP_022675171.1"
                     /db_xref="GeneID:34715317"
                     /translation="MILKSLVESSIKSLQDPIASLDVSDLATDLSNAFIDGDINTIVN
                     ILPEFVSLLLRCPQEMQTIAEDFLRCLSSAKQTDSVINANIAFQEKLKIRQYSYRYGD
                     SDEV"
     gene            complement(<64795..>65982)
                     /gene="YHB1"
                     /locus_tag="KLMA_30024"
                     /db_xref="GeneID:34715318"
     mRNA            complement(<64795..>65982)
                     /gene="YHB1"
                     /locus_tag="KLMA_30024"
                     /product="flavohemoprotein"
                     /transcript_id="XM_022818513.1"
                     /db_xref="GeneID:34715318"
     CDS             complement(64795..65982)
                     /gene="YHB1"
                     /locus_tag="KLMA_30024"
                     /codon_start=1
                     /product="flavohemoprotein"
                     /protein_id="XP_022675172.1"
                     /db_xref="GeneID:34715318"
                     /translation="MLSVKTKNIVKATVPALEQNGVTITKTFYKNMLGEHPELLNTFN
                     KVNQQKGKQPAALAMTVLAAAKNIDDLSVLMPAVNQIGHKHRALQVQPAQYDIVGKYL
                     LLAIKEVLGNAATPDIMTAWAEAYKVIADIFISVEKQMYKEAQWDSWKPFTVTKKTPV
                     AKDIVEFCVEPVEGSGIELSKLKIIPGQYLTVKTHPTTHDNKYDALRHYSICSDSTDG
                     GLKFSVKYEHGNIQDGLVSEYLHKYIKVGDTIELSAPAGDFELNQELIKQEEVPLVLV
                     SAGVGATPLVAMLEFQLEHNPKRPVLWIQSSLNEESQAFKDHVNSLLGKFDNAKAELV
                     YTSTMPRIDGAYLEKHIASPSDVYICGSIEFMSSLMDALKQLGHEDKMIHYEPFGPKM
                     SLA"
     gene            <67690..>68613
                     /gene="MIR1"
                     /locus_tag="KLMA_30025"
                     /db_xref="GeneID:34715319"
     mRNA            <67690..>68613
                     /gene="MIR1"
                     /locus_tag="KLMA_30025"
                     /product="mitochondrial phosphate carrier protein"
                     /transcript_id="XM_022818514.1"
                     /db_xref="GeneID:34715319"
     CDS             67690..68613
                     /gene="MIR1"
                     /locus_tag="KLMA_30025"
                     /codon_start=1
                     /product="mitochondrial phosphate carrier protein"
                     /protein_id="XP_022675173.1"
                     /db_xref="GeneID:34715319"
                     /translation="MSSTLPQYTASDYAKFALAGAIGCGTTHSSMVPIDVVKTRIQLE
                     PTVYNKGMISSFRQIISAEGAGALLTGFGPTLLGYSLQGAFKFGGYELFKKLAIDNMG
                     YENAVNYKNTVYIGSAAIAEFFADIALCPLEATRIRLVSQPSFANGLFGGFSRILREE
                     GVGSFYNGFTPILFKQIPYNIAKFVVFEHAAEVYFGLAGSKESLSASATTGINLLAGL
                     TAGLAAAVVSQPADTLLSKVNKTKKAPGQSTVGLLAQLAKQLGFVGSFAGLPTRLVMV
                     GTLTSLQFGIYGSLKKTLGCPPAVEIGKSSH"
     gene            complement(<69510..>70370)
                     /locus_tag="KLMA_30026"
                     /db_xref="GeneID:34715320"
     mRNA            complement(join(<69510..70043,70329..>70370))
                     /locus_tag="KLMA_30026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818515.1"
                     /db_xref="GeneID:34715320"
     CDS             complement(join(69510..70043,70329..70370))
                     /locus_tag="KLMA_30026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675174.1"
                     /db_xref="GeneID:34715320"
                     /translation="MSFEQDLESIAGGKVYRRRDLRNGLADRLGIPDRDREPRGGRYG
                     GVNAGRGRGRGGFRSKREFNDRRVKLTLLRIKNIPLETSDYEIEDMLNEIGEVASFRI
                     NDKKDSRVASVEFKDPQVLAVALETVNNKEVNGSQLECETFEIRVKAGTKGAAPSSVP
                     AQPATHTRPPKPEPKTREELDQEMDEYMSQP"
     gene            complement(<70709..>72886)
                     /gene="DOA1"
                     /locus_tag="KLMA_30027"
                     /db_xref="GeneID:34715321"
     mRNA            complement(<70709..>72886)
                     /gene="DOA1"
                     /locus_tag="KLMA_30027"
                     /product="protein DOA1"
                     /transcript_id="XM_022818516.1"
                     /db_xref="GeneID:34715321"
     CDS             complement(70709..72886)
                     /gene="DOA1"
                     /locus_tag="KLMA_30027"
                     /codon_start=1
                     /product="protein DOA1"
                     /protein_id="XP_022675175.1"
                     /db_xref="GeneID:34715321"
                     /translation="MFELSAQLVGHTQDVRNVVAMNESQLASVSRDGSVRVWERDADG
                     LWNGHIAYISEKFVNSLTWDAQNGFLFFGGQDMIIYGVSGVHSMDQEPVYAFVGHEGN
                     VCSLSGGFDMLVSCSWDKTARIWREGKEDKVLRGHLAAVWDAKVLKDGRVLTASADKS
                     VKLWSADGHVLKSFDKLHSDVVRCLCALEDGNHFVSGSNDGTLKLSNLDGTVLHEFVG
                     HESFVYGVKQLPSGEIVSCGEDRTVRIWNLDGTPKQVITLPAVSIWTVDVFSNGDIAV
                     GSSDKFIRVFTESEERRASEQDIEELHKMVEHSSVNSQTMGFDESKLKPYSDLQNAGQ
                     KEGQIIVVKNPTGVIEAHQWSNGKWAKVGDVVSAAGNDNKVEYEGAKYDYVFDVDVEE
                     GKPPLKLPVNANDNPYDVAEKFILRYELPQSYRDQIVQFIVTNTNSASFDQSQAAPTG
                     VQDTTVGSGAVAGSGPRQDINYRILPVKQYLKLTSFDPDSLFNGIVKLNEKEKTFDDD
                     ALGAIGTALHDIDNNVELLYAHASIIKNQWNASHKTPAFDIVRILAPKLPSSEDLSDF
                     IEEGLSEENPISTMLTTRMLANSFSNEIWGKELMGKPAVYDSIFQLLGSDYQNCKPQH
                     RNNLAVAIATLVFNYSVYITETNNVNVLPIVADALNTKYGTSPMFLNSEEATYRLLVA
                     YGNLSTVEPTLHQYAKSIAWIKRAKDKYGYIKRFEDILEDLYR"
     gene            <73237..>75108
                     /gene="SAC1"
                     /locus_tag="KLMA_30028"
                     /db_xref="GeneID:34715322"
     mRNA            <73237..>75108
                     /gene="SAC1"
                     /locus_tag="KLMA_30028"
                     /product="phosphoinositide phosphatase SAC1"
                     /transcript_id="XM_022818517.1"
                     /db_xref="GeneID:34715322"
     CDS             73237..75108
                     /gene="SAC1"
                     /locus_tag="KLMA_30028"
                     /codon_start=1
                     /product="phosphoinositide phosphatase SAC1"
                     /protein_id="XP_022675176.1"
                     /db_xref="GeneID:34715322"
                     /translation="MRGPVLLCQEKDRVLLKQSSKLGKNDVVLGISAHENEVNVLPAD
                     VFPARGNIRKIAAVIGILQLKIGKYLVIANRVEEAGRLNGHNVYKVAEHNLISIDKKQ
                     RSDADESQYLQLVDRHLDSATLYFSYGYDLTNSVQRNESIEGVSWKTADTRFFWNHYA
                     TETLRKATEVDDRVSDFIIPMIYGYAKVVDTTFNSTPVSVGLITRRSIYRAGTRYFRR
                     GIDEDGNVGNFNETEQVLCVQKPMKDGYHLFSFLQTRGSVPVYWAELNNLKYKPQLLL
                     SEKSSLDATRKHFDEQIRLYNENYLVNLVNQKGHELPVKEAYEQVVNALEEPKLHYVY
                     FDFHHECRNMQWHKVKLLLNQLESMGLSNKDFFHKTMDANGNTIQIISKQQSVVRTNC
                     MDCLDRTNVVQSVLAHWVLQEEFKSVGLTDDTNLWESDKNLLFEFQNFWADNADAVSV
                     AYSGTGALKTDFTRTGKRTYVGALMDGINSLSRYYQNNLSDGPRQDAYDLFLGNFKPY
                     ANVVHSPFPDRRPMIIQAIPTVVYAAITVMMATIVFPKDHFTSPKNLAFFFGSIGVMI
                     ACANFVLKKGVQYVNWPKLVDLGFLIAEHTHNKEKEFKGVSYVPDPNFIRPNSLKRD"
     gene            complement(<75285..>76763)
                     /gene="TRP3"
                     /locus_tag="KLMA_30029"
                     /db_xref="GeneID:34715323"
     mRNA            complement(<75285..>76763)
                     /gene="TRP3"
                     /locus_tag="KLMA_30029"
                     /product="anthranilate synthase component 2"
                     /transcript_id="XM_022818519.1"
                     /db_xref="GeneID:34715323"
     CDS             complement(75285..76763)
                     /gene="TRP3"
                     /locus_tag="KLMA_30029"
                     /codon_start=1
                     /product="anthranilate synthase component 2"
                     /protein_id="XP_022675177.1"
                     /db_xref="GeneID:34715323"
                     /translation="MTISKRVVLIDNYDSFTWNIYEYLCQEGAEVLVYRNDKISVEEV
                     EALKPDIVMISPGPGHPKTDSGISRECIRYFCGKVPVFGVCMGQQCMFDVFGGEISFA
                     GEIVHGKTSPIYHDGKGFFRRVPQGVAVTRYHSLAGTKETLPDVLEVTARTENGIIMG
                     VRHKKYTVEGVQFHPESILTESGHQMIKNILEVTGATWEENEANLRAKAVDANVSGGK
                     SILDTIYEKRRVDVQQQSSTPGFRLVDLETNYKLGLAPQVQDFYQRLQSATQNKKTAV
                     LAEVKRASPSKGDIDLSVVASEQALQYAGAGAAAISVLTEPHWFKGSIEDLRSVRRAL
                     DVKFKGNEANRPCVLRKEFIFSKYQILEARLAGADTVLLIVKMLNDALLKELYDYAKE
                     LHLEPLVEVNSSAELTRALSIGSKVIGVNNRDLHSFNVDLSTTSSLVGQVPEGTLLIA
                     LSGITVASDADQYKKEGVHGVLVGEALMRAESVDTFIQELIN"
     gene            <77524..>78792
                     /gene="CDC11"
                     /locus_tag="KLMA_30030"
                     /db_xref="GeneID:34715324"
     mRNA            <77524..>78792
                     /gene="CDC11"
                     /locus_tag="KLMA_30030"
                     /product="cell division control protein 11"
                     /transcript_id="XM_022818520.1"
                     /db_xref="GeneID:34715324"
     CDS             77524..78792
                     /gene="CDC11"
                     /locus_tag="KLMA_30030"
                     /codon_start=1
                     /product="cell division control protein 11"
                     /protein_id="XP_022675178.1"
                     /db_xref="GeneID:34715324"
                     /translation="MASIIEASAALRKRKNLKRGIQFTLMVVGQSGSGRSTFINTLCG
                     QKVVDTSTTILLPTDTNTQIDVQLREEIVELEDEEGVKIQLNIIDTPGFGDSLDNSPS
                     FEVISDYIRHQYDEILLEESRVRRNPRFKDGRVHCCLYLINPTGHGLKEIDVEFIRRL
                     GSLVNVIPVISKADSLTPEELKLNKKLISRDIDYYSLPIYNFPFDEEDATDEDFQTNT
                     YLRGLLPFSIVGSNDVFESSDGTVIRGRKYPWGTLDVEDATISDFVVLRNTLLISHLS
                     DMKEYTHEILYERYRTEALSGEMPHASVVSSDRVFSGVDGNQEYPGSPVASGRDSIRG
                     AHGVGYNNDVNSMHSNNNANANNKDTYLAREEQIKLEEERLRVFEERVQQELQLKRQE
                     LLQREQELREIEERLEREAKLKQEGIKMEQ"
     gene            complement(<79583..>80794)
                     /gene="HOC1"
                     /locus_tag="KLMA_30031"
                     /db_xref="GeneID:34715325"
     mRNA            complement(<79583..>80794)
                     /gene="HOC1"
                     /locus_tag="KLMA_30031"
                     /product="putative glycosyltransferase HOC1"
                     /transcript_id="XM_022818521.1"
                     /db_xref="GeneID:34715325"
     CDS             complement(79583..80794)
                     /gene="HOC1"
                     /locus_tag="KLMA_30031"
                     /codon_start=1
                     /product="putative glycosyltransferase HOC1"
                     /protein_id="XP_022675179.1"
                     /db_xref="GeneID:34715325"
                     /translation="MAKAKRTNWKRIGTIAVPLIFAVVILFKVFNNSKSAADLQTLLQ
                     NLPKEINMGSSEETERKFMEKFEKFSQDMLRKQDEQARRFDRERKVLEKKIQELKQPA
                     RHATLREKLAVVFEYGTTQRFPAFVWQSWPYLDEDEKLEGDLQKNERNWANKNPGFVH
                     EIVNDDTAAAFVHYFYSTIPEVIEAYDSLPTAILKIDFFKYLILLARGGVFADIDTDL
                     LQPVPNWIPENVSPKEIGLIVGIEHDSKTPDWRSTYLRRLQFGNWIIQAKPGHPVIRE
                     MVAKITETTLDKKYSGQLNTNLRNDLTIMGWTGTGAWTDVIFTYFNDYVQSGVLDKIT
                     WKQFHNLKVPKLVGDVLVFPEVTFSAPRPDSDSDNQGSNPESNTALHFATHSKMKSWK
                     SLPKAAANADK"
     gene            complement(<81224..>81817)
                     /gene="MOG1"
                     /locus_tag="KLMA_30032"
                     /db_xref="GeneID:34715326"
     mRNA            complement(<81224..>81817)
                     /gene="MOG1"
                     /locus_tag="KLMA_30032"
                     /product="nuclear import protein MOG1"
                     /transcript_id="XM_022818522.1"
                     /db_xref="GeneID:34715326"
     CDS             complement(81224..81817)
                     /gene="MOG1"
                     /locus_tag="KLMA_30032"
                     /codon_start=1
                     /product="nuclear import protein MOG1"
                     /protein_id="XP_022675180.1"
                     /db_xref="GeneID:34715326"
                     /translation="MSSWIKQELYGGAITTVIPKTFLDASMLRQVPDTQEVFVNSRRT
                     DEPTSDNLGFNESIIVDLLQRVDETDDRKALEVHLEEVTSLDESSGHTIVTYNQQDNW
                     QSCVAVETAYKWGKESLKETVVLCLGLLRLAEFETDVLISVLVPISSDDEAEHSAMEH
                     AATTKSSEALPPRVVAAYGLLQDMMKAFKVEDPSLFA"
     gene            <82245..>85307
                     /gene="UBA1"
                     /locus_tag="KLMA_30033"
                     /db_xref="GeneID:34715327"
     mRNA            <82245..>85307
                     /gene="UBA1"
                     /locus_tag="KLMA_30033"
                     /product="ubiquitin-activating enzyme E1 1"
                     /transcript_id="XM_022818523.1"
                     /db_xref="GeneID:34715327"
     CDS             82245..85307
                     /gene="UBA1"
                     /locus_tag="KLMA_30033"
                     /codon_start=1
                     /product="ubiquitin-activating enzyme E1 1"
                     /protein_id="XP_022675181.1"
                     /db_xref="GeneID:34715327"
                     /translation="MTDSKNGTGEEIDESLYSRQLYVLGKEAMLKMQHSNVLIIGLKG
                     LGIEIAKNVVLAGVKSLTLYDPGAVTLQDLSTQFFLREEDIGQQRDKVSQGRLAELNS
                     YVPVKVLDGLNDVSQLSEYQVVVATDTISFEEKVQLNEYTHSHGIGFISVETRGLFGG
                     VFVDLGEEFTVIDTTGEEPKTGIVSDIESDGTVTMLDDNRHGLEDGDYVKFSEVEGLE
                     KLNDGTPYKVEVLGPFAFKIGSVKELGTYKKGGLFTQVKMPQKLSFKSLKDTLASPEF
                     MYSDFAKFDSTPQLHLGFQALHQFQVRHQGQLPRPFHQEDANELVKLVSDLAAQQPQV
                     LGPEGTVNEKLITELANQARGDIPGIIAFFGGLVAQEVLKASSGKFSPIKQYLYFDSI
                     ESLPDSEQFPRNAETTKPINSRYDNQIAVFGLEFQKRIANLKVFLVGSGAIGCEMLKN
                     WALMGLGSGPEGKIIVTDNDSIEKSNLNRQFLFRPKDVGRNKSEVAADAVTVMNPDLK
                     GKIEPKIDKVGVETENIFDDQFWNQLDFVTNALDNVDARTYVDRRCVFYKKPLLESGT
                     LGTKGNTQVVVPNLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFSD
                     AAENVNLYLTQPNFVEQTLKQAPDAKGILESISDCLNNRPYNFEDCVKWARLEFEKKF
                     NHDIKQLLYNFPKDATTSNGDPFWSGPKRAPEPLEFDINNPDHFYFIVAGANLRAFNY
                     GLKGDDGEPNLESYKAILSKIDVPEFVPRSDIKIQTNDDEPDPNANNPLGGDVLEQLA
                     ASLPDPSTLAGFHLAPAEFEKDDDTNHHIEFITAASNNRALNYSIEPADRQKTKFIAG
                     RIIPAIATTTALVTGLVNLELYKVADGKTDIEQYKNGFVNLALPFFGFSEPIASQKGK
                     YNDKTFDKIWDRFDIQGDIKLRDLIDHFKEKEGLEITMISYDVSLLYASFFPPKKLKD
                     RMDLPITEVVKLVTKKEVPSHIKKMILEVCCEDNEGEDVEVPYVTVHL"
     gene            complement(<85535..>89425)
                     /gene="STE6"
                     /locus_tag="KLMA_30034"
                     /db_xref="GeneID:34715328"
     mRNA            complement(<85535..>89425)
                     /gene="STE6"
                     /locus_tag="KLMA_30034"
                     /product="alpha-factor-transporting ATPase"
                     /transcript_id="XM_022818524.1"
                     /db_xref="GeneID:34715328"
     CDS             complement(85535..89425)
                     /gene="STE6"
                     /locus_tag="KLMA_30034"
                     /codon_start=1
                     /product="alpha-factor-transporting ATPase"
                     /protein_id="XP_022675182.1"
                     /db_xref="GeneID:34715328"
                     /translation="MLSCCLWKRQTNKQSINQKDMRSLYSNLRLRDDWLLLIVTIFTT
                     IGNGLVPAATSILTGRVFGLLHSLNSNTYASKSDFIHELTLRAFSIAAVAACVIPISW
                     ISLTCWMCVGERQGFRIRKSLVRFYFNRNLQWYDKNETLEGDFIQLNRCVEEVRAGSA
                     ESSAIIFQNVTSIIALIVTSMYYSWSLTLIILCSTPVLAVLATFFSYNVEKFAKLENE
                     ASAQASLVLSWSLNAFQMIRLFNTAHFEETRFERLALKCNKYFIKSCLFSALNASTLR
                     FLTLCMFVQGFWFGNTQVRKGNLNAGDVITCFSSCLQLGSCLSSTLQQLVTLQKGKVA
                     MEKIQGQLSDQDAMKDDSSALGWEKRESIISSTSSLGLAPSLYKGDIKVRNVSFAYPT
                     RPDDYVLKDVSLDIKEGSTTFIVGRSGSGKSTLANLLLKMYSNYSGSIELGGYNLQGL
                     DDSWILEQFTLVEQRCTLFNRTLKENITIVDRNATDEMVKQACQFALLSSLLIDLPDG
                     IDTLLGRHGVTLSGGQQQRVALARSYIRNTPILILDEAMSALDISSRNLMIEAFRYWR
                     KGKTTIILTHEYSQIRDDEFVYLMREGRVIESGLKSSLLEDQDSNFSQLYHLQDNALE
                     ESTMVESVVPYSPDKTKYDMGTVSRFSKFFFDGGVVDTQAQTDSFTKRLGFKNGQVRV
                     KPDSIEKALQSDNIEDLERQERPRPMALTAILKKMNKTIPHRRYLVLGLFFSVIAGVA
                     NPMFSYIFSKLLTGIVPKGTAHSSSSYYLMKWSVIVMSIAAIDGISTFLKDFILGYCS
                     EIWILRLRIMAMHKITRKPLNWFTFSVNNSSELNSLMMNDLRDLRGLASEFLSAITTL
                     ICVAAVGLTWALISGWKLSLVCFSLIPVFILFSGIYGSLLQMYESAYKTEIAELETRI
                     HEVVTSMKTIKTLSLQQQFEDEIVTQRTKVKIVSKKRSVAVGFGIAITNALALVVQAI
                     LYYYGIKLVINGDYSVSKMFQTFTLLLFSIMTCVSLINQVPEISRGQRAATYIFKVLE
                     ESEHDETYNLVQSGRPAYYLNPVYGNTVEVKHLSFAYPNSPSQKVFKSLNFHVQTNET
                     VGIIGESGSGKSTLALLLTRLYPVPNGKINIGIDDINDWDEHSLRRTIVIVEQKTNFF
                     DGTLRENLVYGLKAHVTDSELLSVLQLVDLKMLVENLPEYLDTRIHTGLLSGGQAQRL
                     SIARALLRKPKIIILDECTSALDAANSFAIAEVIKSVMKNITVIIITHSQQMMQICDR
                     LLVLRKGKICEEGSYADLYNRRGEMYRIVASASM"
     gene            <90237..>90890
                     /gene="OPI3"
                     /locus_tag="KLMA_30035"
                     /db_xref="GeneID:34715329"
     mRNA            <90237..>90890
                     /gene="OPI3"
                     /locus_tag="KLMA_30035"
                     /product="methylene-fatty-acyl-phospholipid synthase"
                     /transcript_id="XM_022818525.1"
                     /db_xref="GeneID:34715329"
     CDS             90237..90890
                     /gene="OPI3"
                     /locus_tag="KLMA_30035"
                     /codon_start=1
                     /product="methylene-fatty-acyl-phospholipid synthase"
                     /protein_id="XP_022675183.1"
                     /db_xref="GeneID:34715329"
                     /translation="MSISKYVSDQASLLQDFCDEVVTLTDFDNKKYRIALGLIAFNPI
                     FWNVVARLEHSTHFLTKLAGSAKRGCYLLAATIFSLGIVRDYFYEAALREQGVSAMLS
                     APLFKYIGMAYIGLGQLLVLTSMYQLGITGTYLGDYFGILMDHRVTSFPFNYFNNPMY
                     QGSTSSFLGYALYHGKPAGLVAALLVHVMYSIALKFEEPFTAKIYEARASEEAKKQN"
     gene            complement(91177..91248)
                     /locus_tag="KLMA_R301"
                     /db_xref="GeneID:34718675"
     tRNA            complement(91177..91248)
                     /locus_tag="KLMA_R301"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:34718675"
     gene            <91485..>92207
                     /locus_tag="KLMA_30036"
                     /db_xref="GeneID:34715330"
     mRNA            <91485..>92207
                     /locus_tag="KLMA_30036"
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /transcript_id="XM_022818526.1"
                     /db_xref="GeneID:34715330"
     CDS             91485..92207
                     /locus_tag="KLMA_30036"
                     /codon_start=1
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="XP_022675184.1"
                     /db_xref="GeneID:34715330"
                     /translation="MKSTLLTGVRRYSSFRLQGPRMICMPKNTEGKQTQVNNSDVNEE
                     LEGMLRRRLQVAYTNSLKEKNSFLLLQYNGPEDKRKYDTMKAVRELKKDYRESKFFPP
                     LTFQENEFNSCFQKPVIQGQPDSEHFACLLDIKNANGLDTLLRRVTDVNCFAKVIGVK
                     INNKRGLISLQMLKPFLDELSTKYTSYDYESLLKIAKIEQLPRNVHMYKLLSIFGKYG
                     TVHPTIIEDQSTAESRWLILSK"
     gene            <92395..>94221
                     /gene="mug157"
                     /locus_tag="KLMA_30037"
                     /db_xref="GeneID:34715331"
     mRNA            <92395..>94221
                     /gene="mug157"
                     /locus_tag="KLMA_30037"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818527.1"
                     /db_xref="GeneID:34715331"
     CDS             92395..94221
                     /gene="mug157"
                     /locus_tag="KLMA_30037"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675185.1"
                     /db_xref="GeneID:34715331"
                     /translation="MFNRRLRSVSRLTAVLGFVTVFLSLKYLLFPDNGDNEYIVATQT
                     AQLVQSSDMDGSRKLEKTNSHKYEDHVRSCPEYASYAAVPHFKLDDDLNTALPFQRPP
                     SNCRTFRSKLVDAFIEQMKLKLKDQNLARLFENTFPNTLDTTILYHVTGEQNKRLQNH
                     GLMEYKYRNEHPETFIVTGDIHAEWLRDSAWQLSVYQPFIKYDESLRELIRGAINTQS
                     QLILSNAYCNAFHPPHYTRIRRAQGHIDDVFPRPNWRQVFECKYEIDSLASFFTLSRQ
                     YYENSPKEKRLDFITDDWLFAVTQVLTVLGRESVSTFDESGNINKFYYTFKRNTNVAS
                     ETLPLAGTGNPVNMNTGLVRSAFRPSDDSTIFQFFIPGNAHMAAELEHIISILKEYSE
                     IADEREITVLLPKIIKGCEKFVTSIRKGIQEHAIVDHATFGKVYAYEVDGYGGHVLMD
                     DANIPSLLSLPDLGFVSADDPVYQNTRKMILSPEGNPYFIKGKYFQGIGGPHVGLHNP
                     WPLSLIVKIRSSNDETEIMEALKLLMETSTELGLIHETVNGFVPGGHVYTRSWFAWAN
                     SEFAKTILHIAETKPWLILKDYRQGDKFSLQEFIKSLSSSTL"
     gene            <94552..>95364
                     /gene="AIM27"
                     /locus_tag="KLMA_30038"
                     /db_xref="GeneID:34715332"
     mRNA            <94552..>95364
                     /gene="AIM27"
                     /locus_tag="KLMA_30038"
                     /product="ER membrane protein complex subunit 3"
                     /transcript_id="XM_022818528.1"
                     /db_xref="GeneID:34715332"
     CDS             94552..95364
                     /gene="AIM27"
                     /locus_tag="KLMA_30038"
                     /codon_start=1
                     /product="ER membrane protein complex subunit 3"
                     /protein_id="XP_022675186.1"
                     /db_xref="GeneID:34715332"
                     /translation="MVFESLISMWETVQSGHAGPELLLDPQLKLWALIPISIVMILVD
                     IAKQCVMVLVSPSTTSVPLVRLTEIMHITKANAIMGNGSNLSSESFKVRQEYLANVLS
                     EGKYLAVKPNEGENKIENPFTSAGLSESMTTMAMGNLVNYIPQTVIMWWVNYFFAGFV
                     LMKLPFPLTIRFKQMLQSSVQTNDLDVRWVSSMSWYIISMGGLTPVYNVLFGGDDLSK
                     VDVSPLQAQLSQPQVGMPSPADQMKALANDITVFQHISVLDEVEERVLKLYS"
     gene            <95720..>96901
                     /gene="NPA3"
                     /locus_tag="KLMA_30039"
                     /db_xref="GeneID:34715333"
     mRNA            <95720..>96901
                     /gene="NPA3"
                     /locus_tag="KLMA_30039"
                     /product="GTPase NPA3"
                     /transcript_id="XM_022818530.1"
                     /db_xref="GeneID:34715333"
     CDS             95720..96901
                     /gene="NPA3"
                     /locus_tag="KLMA_30039"
                     /codon_start=1
                     /product="GTPase NPA3"
                     /protein_id="XP_022675187.1"
                     /db_xref="GeneID:34715333"
                     /translation="MPLKTVICIGMAGAGKTTFMQRLNSHLHAAKEPPYVINLDPAVL
                     TVPYGANIDIRDSIKYKKVMENYELGPNGAIVTSLNLFSTKIDQVIQLVEKKQDKYEH
                     CIIDTPGQIECFVWSASGQIITESFASTFPTVIAYIVDTPRNTSPTTFMSNMLYACSI
                     LYKTKLPLIVVFNKSDVKKCDFAKEWMTDFEAFQTALRDDQESNGQTGLGSGYMGSLV
                     NSMSLMLEEFYSQLDVVGVSSFTGEGFDDFLNIVDDKVEEYEKYYKVERERILKEKEE
                     KEKARKEKSLEHLMNDLGFKDKAKKNAAEDDDDSADVISDLEEGENDGLVERDEDEQD
                     DVGKRAEREYTFAGEDRLNGEVNETDTPDLQKRYEDAFAKVAKDASSQTAENIARYIR
                     Q"
     gene            complement(<96983..>97807)
                     /gene="ADD66"
                     /locus_tag="KLMA_30040"
                     /db_xref="GeneID:34715334"
     mRNA            complement(<96983..>97807)
                     /gene="ADD66"
                     /locus_tag="KLMA_30040"
                     /product="proteasome chaperone 2"
                     /transcript_id="XM_022818531.1"
                     /db_xref="GeneID:34715334"
     CDS             complement(96983..97807)
                     /gene="ADD66"
                     /locus_tag="KLMA_30040"
                     /codon_start=1
                     /product="proteasome chaperone 2"
                     /protein_id="XP_022675188.1"
                     /db_xref="GeneID:34715334"
                     /translation="MSTLLIPLVSTGNVSQLCVDLVLHSNSEEFHFVKELDSIWLHSF
                     LGPLDFVDGSSKPLYHECKNSGKQFTTPIELFYNKRLDLYVLQQRSPIISGYENQFFK
                     EVIIPLVDELNIASIVVLDSAGALDPSVPFSGINYQNLFATARCQLESLDSIALQLQT
                     RLSIQDDEQSLVNKIFHFDAASFQHSFSVDQPVFKLFHHLLHNQSGSSRSLKNVTYLS
                     KIVHEGDNSWDAFQTCEKLAELIPNLVNGQLTTPVSWKGVYGARPIALGFEKGLYS"
     gene            <98791..>99759
                     /gene="LIA1"
                     /locus_tag="KLMA_30041"
                     /db_xref="GeneID:34715335"
     mRNA            <98791..>99759
                     /gene="LIA1"
                     /locus_tag="KLMA_30041"
                     /product="deoxyhypusine hydroxylase"
                     /transcript_id="XM_022818532.1"
                     /db_xref="GeneID:34715335"
     CDS             98791..99759
                     /gene="LIA1"
                     /locus_tag="KLMA_30041"
                     /codon_start=1
                     /product="deoxyhypusine hydroxylase"
                     /protein_id="XP_022675189.1"
                     /db_xref="GeneID:34715335"
                     /translation="MSTNFEKHFEVDVDNCSMEQLRDILVNKSGKTPLANRFRALFNL
                     KGVAEEFATKPEEAKKATEYIAEAFGDDSELLKHEVAYVLGQTKNMTGAPLLRDVLAD
                     EQQQCMVRHEAAEALGALNDVESLPILEKYFKEDPLLEIRQTCELAIDRIKWETSEGA
                     KKESLQESLYSSIDPAPPLSLQKDYKIPELKAILNDQSRPLFERYRAMFRLRDIGNDD
                     ACLALASGFDDPSALFKHEIAYVFGQIGNPIVVPHLKEVLEREQEAPMVRHEAAEALG
                     SIATDDVLPVLKEHLKDTDAVVRESAIVALDMYEYENSNDLEYAPV"
     gene            <100021..>100605
                     /gene="HAM1"
                     /locus_tag="KLMA_30042"
                     /db_xref="GeneID:34715336"
     mRNA            <100021..>100605
                     /gene="HAM1"
                     /locus_tag="KLMA_30042"
                     /product="protein HAM1"
                     /transcript_id="XM_022818533.1"
                     /db_xref="GeneID:34715336"
     CDS             100021..100605
                     /gene="HAM1"
                     /locus_tag="KLMA_30042"
                     /codon_start=1
                     /product="protein HAM1"
                     /protein_id="XP_022675190.1"
                     /db_xref="GeneID:34715336"
                     /translation="MPDAKPEIVFVTGNQNKLNEVRLILGGDATPFQLTNEPLDLEEI
                     QGHDLQEIAEAKLKQAVDQLGPGRPVFVEDTALCFDEYNGLPGAYIKWFVKSMGLEKV
                     VKMLDGFENKGAYAVTTIAYADSQGKHHFFQGKTHGTIVPSRGHRNFGWDSIFQPDEA
                     PNGETYAEMEKTDKNKISQRGRAFDQLKKHLYSS"
     gene            <101008..>104295
                     /gene="LOS1"
                     /locus_tag="KLMA_30043"
                     /db_xref="GeneID:34715337"
     mRNA            <101008..>104295
                     /gene="LOS1"
                     /locus_tag="KLMA_30043"
                     /product="exportin-T"
                     /transcript_id="XM_022818534.1"
                     /db_xref="GeneID:34715337"
     CDS             101008..104295
                     /gene="LOS1"
                     /locus_tag="KLMA_30043"
                     /codon_start=1
                     /product="exportin-T"
                     /protein_id="XP_022675191.1"
                     /db_xref="GeneID:34715337"
                     /translation="MSQIQQAVDIANSSSASGELKKQALDFLHQLKSSGEAVNVFSQY
                     LHDSSASDVGRFFALQVLSEQAQAASAGANQETLFALRQTGLEFLRKQLEAGAGDGNS
                     SINSSNNNNNSSNNNSINNNNSINGSENGTNSSNSTAAAGQKAAAPEFIRNKVAELFA
                     HLFYNMYGEVNNNLWSTFFGDLVQLTGIAPLRECKSADGGVSFNALGLDYFLRICASI
                     NTEIGDQAFVRSKEMQAKNNDLKDYMRIQDVECLTNIWFGALLSCQKFPVLASLVLQC
                     VGSYISWIDINLIVQPQYITTIYEYLQFPHTKLACGQCLCEIISKKMKPADKLQLLSM
                     LNLTDRVLATENDDDLELYEQMAKLTNCVALEFSMIIDQCTDSQELQSVSSAADEQII
                     NVMAPLLLKFMAHQYDSVTQQCFPFVTHYLAVMKKLFSVGGKPGSAVAVNSKRIPIDP
                     AHLNFLKSLGTVCIMKMKIDESCDVTDDSEEIDEFVGNVRSKLKVFQDTIAVINPEVY
                     FEIISMNIEQSITEQQDWRVLELAIYQLHNFAESIRNNLFGVNKTDIATSKPAQVMEK
                     YMNTLLNHPTLFQMNNPLIQISFFELIVRHNNFIQIDNKDLTLLNIFCTPFSMFSGNE
                     RVRLRTWYLFTRLIKTSKPKLTTEVLSLLLSKISPLLSIKISPVAEELDTTFDSQLYL
                     FEGVGVLIGANSSAEYDILDAVLTPLFSDLEQCISAQVKSPQVVLQTHHILMAIGTLA
                     RGVHSGLVPDNQVNNAKVSEKVIVKSLIEKFSNIAEVILVTFSYFNKFEAIRDAARFS
                     FARLIPILNNQIIPFASRLISIFLNSDLKTLEMSDFLGFLGQMVHMFKDDDNCYQLFN
                     NLFTPVVSKVFTLETQLEQESSTPPETKPSNGKSVIVTDSFRDKINLKKAYYSFLMAM
                     VSNHCTSLLLTESNKNILPNVLNDLLTYTPEEIHETSTMRLCLNVLVNFVKFFGTGVC
                     KDEQDRNAINISKLDGLNEFFITKCIPLLFEIPFKPEYAFNIQDGGGRVIACDLSQLL
                     KTLYMINYNRDAPNDNPCIRYLTEVYFPQIQFPQALITEFIDVLEDLDYKNFEKYFVQ
                     FISNMKH"
     gene            complement(<106887..>107942)
                     /gene="RFC2"
                     /locus_tag="KLMA_30044"
                     /db_xref="GeneID:34715338"
     mRNA            complement(<106887..>107942)
                     /gene="RFC2"
                     /locus_tag="KLMA_30044"
                     /product="replication factor C subunit 2"
                     /transcript_id="XM_022818535.1"
                     /db_xref="GeneID:34715338"
     CDS             complement(106887..107942)
                     /gene="RFC2"
                     /locus_tag="KLMA_30044"
                     /codon_start=1
                     /product="replication factor C subunit 2"
                     /protein_id="XP_022675192.1"
                     /db_xref="GeneID:34715338"
                     /translation="MSGGTMFKKQKLNPNESKAQAKPWVEKYRPKKLEDVAAQDHAVT
                     VLKRTLQTANLPHMLFYGPPGTGKTSTILALTKELYGPELMKSRVLELNASDERGISI
                     VREKVKNFARLMVSKPSAEDLEKYPCPPYKIIILDEADSMTADAQSALRRTMETYSGV
                     TRFCLICNYVTRIIDPLASRCSKFRFKALDSSNALSRLQYISQEESLKYEEGILERIL
                     DISQGDLRKAITLLQSAAKVVQQNDNADAITLTHVNELSGTIHDKVLQDLISVIESKD
                     LNTIMRTVQDFVNQGWSAASALTQLHDYYIKNDHLDTDFKNKVSWLLFDSDSKLTSGA
                     NEHLQLLNLSMKISQLY"
     gene            <108182..>108598
                     /gene="YAE1"
                     /locus_tag="KLMA_30045"
                     /db_xref="GeneID:34715339"
     mRNA            <108182..>108598
                     /gene="YAE1"
                     /locus_tag="KLMA_30045"
                     /product="uncharacterized protein YAE1"
                     /transcript_id="XM_022818536.1"
                     /db_xref="GeneID:34715339"
     CDS             108182..108598
                     /gene="YAE1"
                     /locus_tag="KLMA_30045"
                     /codon_start=1
                     /product="uncharacterized protein YAE1"
                     /protein_id="XP_022675193.1"
                     /db_xref="GeneID:34715339"
                     /translation="MSSDDGDIWCSDSEDNSKLEESLETRKLREVHKKRGYVDGISSA
                     KEENLQAGFDSTFSIGSKLGLRVGNLVGKFQVLKTLYGDADSDLVEDARLVENELRIN
                     KVLASRHFNEDLDPLASLEELVGKWESRLTVYENKY"
     gene            complement(<108719..>116092)
                     /gene="TOR2"
                     /locus_tag="KLMA_30046"
                     /db_xref="GeneID:34715340"
     mRNA            complement(<108719..>116092)
                     /gene="TOR2"
                     /locus_tag="KLMA_30046"
                     /product="serine/threonine-protein kinase TOR2"
                     /transcript_id="XM_022818537.1"
                     /db_xref="GeneID:34715340"
     CDS             complement(108719..116092)
                     /gene="TOR2"
                     /locus_tag="KLMA_30046"
                     /codon_start=1
                     /product="serine/threonine-protein kinase TOR2"
                     /protein_id="XP_022675194.1"
                     /db_xref="GeneID:34715340"
                     /translation="MRTDIAMLRRKGESVKKRLVSGTAASLQELSLQPSSNGITSAGK
                     SEDGEVPGDGISGEFGAALTDSNVENNVKAFDLIFTKLKSTNQLERVAASYELKSCLI
                     SLAREVSTEYFQRFSNDINNKVFELIHGTESNEKLGGVLAVDTLIDFYSHTDELPNQT
                     SRLANYLRVLIPSNDIEVMRAAATTLGKLAVPGGTLTSEFVEFEVKTCIEWLTTSPES
                     SSSNSKQEYRKHASLLIISSIAHNSPYLLYPFVNSILDNIWRALRDTKLVIRTDAAVT
                     LGKCLTIINDRDSSLTKKWVQRLFNGCIYGLQLNTTVSIHGTLLVYRQLVSLEGGYLK
                     DKYEEIYETTMKHRDNKNIIIRKEIYAIIPVLAAFDPKLFTQKYLDATMIHYLTLLKN
                     MTSHQIALSDKGPILVSIGDIAYHVGSEIGPYLDAIVENLRDGLETKFKTRKEFEKDI
                     FYCVSKLACAVRPLLAKYLNRGLLDALLACPLSDHMQETLLVICEKIPSMEVTVNEKL
                     LNIICLVLSGEKFRPPGSPTPMKSLSSETARAYRDQSLLRKTGENNNDTLDAMILTKA
                     LRMLSDIKPKYSLTEFIRRVIISYMEHDNMQVRKLAALTSCDLFVKDSICKQTSLYAL
                     NVVSEVLSKLLTVAITDPVAEIRLEILKHLDRNFDPQLSQPDNTKLLFMALNDEVFAI
                     QMEAMKICGRLALVNPAYVIPSLRKTLIQLLTELKHSKMTRKKEECASLLCTLISSSS
                     DVTKPYLEPVIEILLPKSQDPSSAVASTALKALGEISVVGGEDMLPFLDELMPLIIDT
                     FQDQSNSFKRGAALKALGQLAASSGYVIDPLLDYPELLGVLINILKSESSQNIRRETV
                     RLIGILGALDPYKHREVERTSITNITSEQNAPPIDVALLMQGMSPSNEEYYPTVVIGV
                     LMKILKDPSLSIHHSTVIQAIMHIFQTMGLRCVIFLKQIIPGFILVMHTCPPSLLELY
                     FQQLSVLISIVKQHIRPHVTEIVDVISEFFPVVKLQLTIISVIESLSRALEGEFNPHL
                     PTILSLFLDVLEKDQSNKKVVSVRILKSLVVFGPHLEEYAHLVLPTIIKLSEFSSGNL
                     KKAAIITIGRLSKNVNALEMSSRIVQALVRVLNTSETEYVKATMNTLSLLLLQLNIDF
                     TVFIPVINKTLVKQNIQHTIYDRLVAKLLNNEPLPTKIIIDKDFDLPNKEMDDVKVAS
                     KKLPVNQMVLKNAWDCSQQRTKEDWQEWIRRLSISLLKESSSHALRACSGLAGIYYPL
                     ARELFNASFASCWGELYTQYQEDLIQSLCAALSSPNNPPEIHQTLLNLVEFMEHDDKP
                     LPISISTLGEYAQRCHAYAKALHYKELEFIEEPSTSTIESLITINNQLHQTDAAIGIL
                     KHAQQHHDLQLKETWYEKLQRWDDALNAYNKREAAGEDSVEVTIGKMRSLHALGEWDQ
                     LSELAADKWASSQLEVKRAIAPLAAGAAWGLAQWDRVEQYIEVMKPQSPDKAFFDAIL
                     CLHRNNFEKAAEHIFSARDLLVTEMSALVNESYNRAYGVVVRTQMVAELEEIIQYKKL
                     PQGSETRAMIRKTWNKRLLGCQKNVDVWQRVLKVRSLVIKPKQDMKVWIKFANLCRKS
                     GRLGLAQKTLNTLLEESGDPKNPNTARAPPPVVYAQLKYMWATGSQKEALNHLISFTS
                     RMAHDLGLDPSNMIAQSVPQNSSVSQHHIEDYTKLLARCFLKQGEWRVSLQPNWRLEN
                     PDAILGSYLLATHFDKTWYKAWHNWALANFEVTSSLTQRIKDDKVPPTLEDASTEFTN
                     GAVAGLNANDNFPPELVQRHVVPAIKGFFHSIALSQSSSLQDTLRLLTLWFKFGGIPE
                     AAQAMHEGFGLIKIDNWLEVIPQLISRIHQPNQTVSRSLLSLLADLGKAHPQALVYPL
                     TVAIKSDSVSRQRAALSIIDKMRMHSPKLVNQAELVSDELIRVAVLWHELWYEGLEDA
                     SRQFFGEHNTEKMFATLEPLHEMLKRGPETLREISFQNSFGRDLNDAYEWVLNYKRTK
                     DINNLNQAWDIYYNVFRRISRKLPQLQTLDLQHVSPKLSAAKDLELAVPGTYHAGKPI
                     VRITHFEPVFTVISSKQRPRRVIIKGSDGKDYQYLLKSHEDIRQDNLVMQLFGLVNTL
                     LQNDPESFQRHLNIQQYPAIPLSPKTGLLGWVPNSDTFHVLIREHREASKIPLNIEHR
                     IMLQMAPDYDNLTLLQKVEVFTYALDNTKGQDLYKVLWLKSRSSESWLDRRTTYTRSL
                     AVMSMVGYILGLGDRHPSNLMLDRITGKVVHIDFGDCFEAAILREKYPEKVPFRLTRM
                     LTYAMEVSGIEGSFRITCENVMMVLRDNKESLMAILEAFAYDPLINWGFDLPTHAVME
                     QTGIDLPLANPSELLRKGVISVEDAAKMELQQKAEVRNARATLVLKRIADKLTGNDFP
                     RCQELSVPDQVDKLIQQATSVENLCQHYIGWCSFW"
     gene            complement(<116613..>118175)
                     /gene="THI20"
                     /locus_tag="KLMA_30047"
                     /db_xref="GeneID:34715341"
     mRNA            complement(<116613..>118175)
                     /gene="THI20"
                     /locus_tag="KLMA_30047"
                     /product="phosphomethylpyrimidine kinase THI20"
                     /transcript_id="XM_022818538.1"
                     /db_xref="GeneID:34715341"
     CDS             complement(116613..118175)
                     /gene="THI20"
                     /locus_tag="KLMA_30047"
                     /codon_start=1
                     /product="phosphomethylpyrimidine kinase THI20"
                     /protein_id="XP_022675195.1"
                     /db_xref="GeneID:34715341"
                     /translation="MTQFEHNIESPLYLGTHWRERRLPTVLTIAGSDNSGGAGIEADI
                     KSISAQGCYAMTCITALTCQTPEQVYSSISVEESHIRSVLQHTFQSMRCDSVKIGMLT
                     YEALKAVTGVLETLELDIPVVLDPVMVATSGAQLSSSKVWDSQEMDQLLQKVSVLTPN
                     IPEAKALLGVSYFKGQSTDDFVQLAKQLKEKCKCNVLLKGGHMPLDGKIVDVLCYNDE
                     VHTYFSEELTSTNLHGTGCTLSSTIASRIARGEDVPVAVQNSIQYVHNAILTGEHIEV
                     TARADSHSATYGPLNHVYELANSGSVATGSGKHQQVGYETMLQIPEVKKAWDSYIDHE
                     FVARVSNGTIDMDKFAKYLRQDYHYLQTFARIHAKLAADATTEIRFQSEVAVLQNIIH
                     EMEKQERILGPGIKTNVKSQEMLDYTNYLKEVAQYGNWEQLYTATMPCCLGYVIAVRK
                     IQDKITVTEDSHPKLYQWLQEYLREDFYQASQEGIKTLDSILKQSQDPATLVKIFKEV
                     CDLETRFWNQGL"
     gene            <118772..>120139
                     /gene="ARP3"
                     /locus_tag="KLMA_30048"
                     /db_xref="GeneID:34715342"
     mRNA            <118772..>120139
                     /gene="ARP3"
                     /locus_tag="KLMA_30048"
                     /product="actin-related protein 3"
                     /transcript_id="XM_022818539.1"
                     /db_xref="GeneID:34715342"
     CDS             118772..120139
                     /gene="ARP3"
                     /locus_tag="KLMA_30048"
                     /codon_start=1
                     /product="actin-related protein 3"
                     /protein_id="XP_022675196.1"
                     /db_xref="GeneID:34715342"
                     /translation="MSYLNNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQSGKA
                     SSSGSKSGFGSNSNAQSSYMSMSGGNSTSATDFNNLASSTLISNNLAGKRGTEDLDFY
                     IGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFFLLTEPP
                     LNPPENRQQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGV
                     THVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEQDASLRTAERIKQEYCYVC
                     PDIVKEFNKFDRDSEKFAQFIVENKEKTTKKVVDVGYERFLAPEIFFNPEIASSDFLT
                     PLPVVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKGLVNDRIAQSEK
                     LSGTKSTGVDVSVISHKRQRNAVWFGGSLLAQTAEFKSYCHTKQDYEEYGPDIVRNFS
                     LFNMI"
     gene            complement(<120657..>122297)
                     /gene="CCT5"
                     /locus_tag="KLMA_30049"
                     /db_xref="GeneID:34715343"
     mRNA            complement(<120657..>122297)
                     /gene="CCT5"
                     /locus_tag="KLMA_30049"
                     /product="T-complex protein 1 subunit epsilon"
                     /transcript_id="XM_022818541.1"
                     /db_xref="GeneID:34715343"
     CDS             complement(120657..122297)
                     /gene="CCT5"
                     /locus_tag="KLMA_30049"
                     /codon_start=1
                     /product="T-complex protein 1 subunit epsilon"
                     /protein_id="XP_022675197.1"
                     /db_xref="GeneID:34715343"
                     /translation="MPDLSNAIVAQDEMGRPFIIVRDQGNKKRQHGIEAKKNHILASR
                     SVASIIKTSLGPRGLDKILISPDGEITITNDGATILSRMELDNEIAKLLVQLSKSQDD
                     EIGDGTTGVVVLACALLDQAMDLIEKGVHPIKIANGFDKASQIAIDHLNSKADDISTL
                     SQEEFNSYLFKAAKTSLGSKIVSKDHDLFAQMAVDAITTVMDSNRKDVDFDLIKLEGR
                     VGGSLKDSKLIKGVVLDKDFSHPQMPKSLEGDLKLAILTCPFEPPKPKTKHKLDISNV
                     KEFELLQKYELDKFKEMIDLVKKSGANVVICQWGFDDEANHLLLQNELPAVRWVGGQE
                     LELIAIATNGRIVPRFQDLSPDKLGSCGKIYEVEFGTTKDRMLVIEECSNSKTVTCFL
                     RGSNKMIVDEAKRALHDSLCVVRNLIRDSRVVYGGGAAEVAMSLAVSEEADKQRGIDQ
                     YAFRAFANALDQIPMTLAENSGLDPIETLSHLKSKQFKEQSANIGVDALGKGSNDMKE
                     LFVVDPLIGKKQQILLATQLCRMILKIDNVIISGKDDY"
     gene            <124606..>127437
                     /locus_tag="KLMA_30050"
                     /db_xref="GeneID:34715344"
     mRNA            <124606..>127437
                     /locus_tag="KLMA_30050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818542.1"
                     /db_xref="GeneID:34715344"
     CDS             124606..127437
                     /locus_tag="KLMA_30050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675198.1"
                     /db_xref="GeneID:34715344"
                     /translation="MRVDEERMRERLREKQKEVQKEELSGFNATRKQIERFLFDSAFN
                     TSLFYLKPYDLESLFSRLPEQKRGGEALESSLAQLKTVEYDPRLSVSVYSEYIAQHLE
                     DVEQGSFEVPFNWYDWADLGVLNDFIELAPEDKVGCEAVFHKYFEPQDLNRFEGQFRH
                     KMFDFDRNKPLGVAGFLQNTKLIDANSKKQPISTQELHEKYCRDSRGSLTPGFLPKKP
                     LSYSRPETYGLQARASLYTNPETQPISITLLNNNKKPLQVMVSQSNGVSGENSPSSSE
                     DDDDDYSNWKPNSLLFNGVLHEYLQKRRTSSSGDNGPTNIEFDHFKAWSQLTEKLDQQ
                     QQQQQKLAAGQPLENGAPAYKIELDPESFEFNALGRYQELKQMNQSQLTRHQKHYLEA
                     LELSLHTHYVDMPKYFTEASKVTDFVHLGHHYDGRFFKGGLPHDEVRARLDAIVRSWL
                     HFTSSNNLTTWLAHGTLYGWLYNGLAFTWDGDHDVQMPIADLNKMAEHFNQTVIVEDP
                     TRSNGRYFLDVGTYLTSRIKGNGNNNIDARFIDVDSGLYVDITGLSVSSEPIHDRFKW
                     LVNKYHDDKRQNAELVPYYKDPNVVEHVSDISVKQLIEYEKSKSKSDSNPHAPPFTKE
                     REDYLKKHENEDTKSGMYHSESMADRYNINKHAQAYNCRNKHFQTLFELSPLRLSFFH
                     GVPAYVPNTVVKILNAEYHVPQEHGFQCFDGRCYLPELRGWYNKDKVDKMRDLISRSP
                     LLSDSKKPFRENGMQQLSKKEFEILLQELAKSNEMDDVFIYAVNSFQVSTFRQREVEL
                     MFDSKMLLRNKDMMLNEFVQNRTFNPVYKDPFQKKLEDKMWYNFLENTDIPYTTLEEI
                     WDELKLKVASQLFRLNEKFVQRKLDWSYEAGLQSPPSPMKFNSRGNRFYIMGKKYHNK
                     VFAKDAVDLDTSITTLYHLKEEKRYSKSN"
     gene            <128015..>129241
                     /gene="NTA1"
                     /locus_tag="KLMA_30051"
                     /db_xref="GeneID:34715345"
     mRNA            <128015..>129241
                     /gene="NTA1"
                     /locus_tag="KLMA_30051"
                     /product="protein N-terminal amidase"
                     /transcript_id="XM_022818543.1"
                     /db_xref="GeneID:34715345"
     CDS             128015..129241
                     /gene="NTA1"
                     /locus_tag="KLMA_30051"
                     /codon_start=1
                     /product="protein N-terminal amidase"
                     /protein_id="XP_022675199.1"
                     /db_xref="GeneID:34715345"
                     /translation="MKFKVPLRIGIVQLNPQIGQTKDTTTRAWKLLDEFQAKNKGRSP
                     DILVFPEFALTGYSFHDRNHILPYTSKVGEGPTYQFAQQVSRKFNCYTVIGYPEKTSD
                     DSKTATLYNSAVMVNSSGDLVFNYRKSFLYYTDDDWGCQENPMGFQQFEIPVNAQDPD
                     GTTRQIALKTGIGICMDLSNYKFEAPFTDYEFATYHLDHGTELLLCPMAWLHSAAITK
                     DTADPQEQWSVVQSVLDKYQLPEIGSQGNFEFNLDKPTNVEPMPFEEALSVKSYDNLD
                     KPDICNITYWILRFTPFVALKKRYEWFHSKVLVPYFAHSSNKTYIGSSLAKPWVHEGK
                     ETVLVLANRCGIEDKKTVYAGSSGIYKFNGRTHGNQDESVDTTNQSVDFLGNLSKGLE
                     GMIVRDVTLEVERESE"
     gene            complement(<129402..>132206)
                     /gene="MNN4"
                     /locus_tag="KLMA_30052"
                     /db_xref="GeneID:34715346"
     mRNA            complement(<129402..>132206)
                     /gene="MNN4"
                     /locus_tag="KLMA_30052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818544.1"
                     /db_xref="GeneID:34715346"
     CDS             complement(129402..132206)
                     /gene="MNN4"
                     /locus_tag="KLMA_30052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675200.1"
                     /db_xref="GeneID:34715346"
                     /translation="MPSIVHLVHIPRKKRFIHIFLAFISVFVVLHLISPLYGQEFELL
                     NYKQVAESIDAFRAHAPAHVVQFYQKFRYNNELRYPKEYDLREDLLKIRYGKNNGSYW
                     GSFEEVKYYDADPRMVWSVYLNELERREYDEVPFAWYDWADFHEYNKLLAMGPEQVPC
                     EFLFQNAFDRDKLREVEREIGEELFHVDREAYEGQRWYETQMQASDKNVIRLLAKHCA
                     VAETVNGSSSSSTSMSYRWGENVRVLDLFDKVRAEVYQFQARSFVLNTLQPPRSLTMV
                     NGPTDVLQFNVRQSRQNASDYETVVSSGMLERFVRETAAGEEEQEQGPRFDHISKFKK
                     FVKSDAAQKHRLVIKELDETRAVMHDDSQGYMMLQESDFEFDAQAKIRELEAREQKDS
                     DNPLSPHDRAYLDSLRFSMSMHFAFTPKYFHEASHVQAFKKYGAHFDKRFFNGPLIVE
                     QPQMELRLDSLIRNFQKFANANGLVSWLAHGTLYGWLYNGRTFPWDNDGDLQMPIRHL
                     NILAQYFNQTLVLEDPSEGNGKFLIDVTSSITHRINGNGLNNIDARFIDIDSGLYIDI
                     TGLSVSTCPETGFNKYYKERSKDIDSRDIKFRDPNLIPGLNDLSLEQLLEEVKQRPDD
                     FPGAQALIEKLIKKFRVQTRRRASPEANLSPEQIYNMNHQLKLYNCRNFHFVSLDTLN
                     PLIKTTFHGVPALVAEKHITYLNNEYRVPTAYQYMKFRTNAFVPELGIWTTTSVLSKL
                     MNKNQINEKVQPVHKPISSLRPEDVYKLLENMANTGMSELLATIYNSMPINQYRVKEM
                     EIAYDNNLSRNDKIKLLNMLRNNVGPHLPRSQKDPWLYRYERRMWEEMVRTREEDCSN
                     ARQFVDNKMAYNLWYAIIKVAERNYPMFKISTSEKPPVEKAIVAEGTVDLNKVGAPVF
                     QTGHLRYSNIFQSDPNILDR"
     gene            <134629..>136947
                     /gene="CTF18"
                     /locus_tag="KLMA_30053"
                     /db_xref="GeneID:34715347"
     mRNA            <134629..>136947
                     /gene="CTF18"
                     /locus_tag="KLMA_30053"
                     /product="chromosome transmission fidelity protein 18"
                     /transcript_id="XM_022818545.1"
                     /db_xref="GeneID:34715347"
     CDS             134629..136947
                     /gene="CTF18"
                     /locus_tag="KLMA_30053"
                     /codon_start=1
                     /product="chromosome transmission fidelity protein 18"
                     /protein_id="XP_022675201.1"
                     /db_xref="GeneID:34715347"
                     /translation="MPAPLPTFTARASDSVLQVHEFDPSAKRFVSASGQTVSLRKRKP
                     AHAALVEGQTTWTSDESYGVNVNTLLDRIEGGTPLERPADTPANESSGLANGKASGKA
                     SASANASANGTLWTEKWRPHKFLDLVGNEHTNRRILAWLRQWAPTVFDEPLPDALPNA
                     SGNGNGNASGADDTTPMDPLGRPTKRILLIHGPPGVGKTSVSHVVARQAGYSVVEINA
                     SDERAGERVRLKVQNALFNHTFNSKPVCLVADEIDGSVENGFIRVLLDIIKSDSNATK
                     EMVLGGGGRARGKARARGKSQGKNKNKNQLLTRPIVAICNNLYAPALEKLRPHCEIIA
                     FRKPSETALLERLELVCKTERVPVSKAYLKDLAVLSQGDVRNCLNNLQFRARATTSTG
                     TTSSGPDDGKDIAISWYRICNSVFRKNPHMEPEVQLSHLLKDVETSGNHERVVEGCWT
                     MYPETRYSDHGVSKPARISDWLFFHDRMFQSLFEHNGELVRYCSFTPLQFFVLFADNA
                     NKEGTNNNNGRSRDGGTTTTSPGGVTSLFELREAERACMNLLDVVRSRLSVHSQVYTT
                     KRSLLGETLPAVEDLISVDLSRIRDVPTRQRCVDTVLPLFHDFRLRIQEQTQGSINSS
                     SSYTHLLVVDPPLDELVLMDEKRRRDVVTKKPAALKFSLAKLEEERIKKRALKAVADE
                     KREQSEQKRRRMEAGTSGGATGTTTGTSTSTSTSTGNFMEQYNSIKKREVTPEAKDTA
                     SESRIWVKYKEGFSNAVRKNVTWSQLWEGPGS"
     gene            137183..137258
                     /locus_tag="KLMA_R302"
                     /db_xref="GeneID:34718676"
     tRNA            137183..137258
                     /locus_tag="KLMA_R302"
                     /product="tRNA-Val"
                     /db_xref="GeneID:34718676"
     gene            <138566..>142447
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_30054"
                     /db_xref="GeneID:34715348"
     mRNA            <138566..>142447
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_30054"
                     /product="transposon Ty1-DR6 Gag-Pol polyprotein"
                     /transcript_id="XM_022818546.1"
                     /db_xref="GeneID:34715348"
     CDS             138566..142447
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_30054"
                     /codon_start=1
                     /product="transposon Ty1-DR6 Gag-Pol polyprotein"
                     /protein_id="XP_022675202.1"
                     /db_xref="GeneID:34715348"
                     /translation="MLDTGAQISVVTDLKLLHNYTSNITRNITAANMGTLNTMGEGIL
                     ILRLSNNVVVQFPAVYSEETPSNILSVMQLTAKQKITVDFYQRKMLVQDHNINIDIIH
                     RNGFYWLSSEYLVLNETNIHSPADDDSPVSISLCHIRENTVPKKKWSLEFIHNLLAHV
                     NIKQIRKSISNGDIRFIKLEDIDWSDMNSFTCQYCNIGKGKFHDHFTDSRDVYMKKFK
                     KFEYLHTDIMGPFREDNTIPPNYLITFSDEVTKYRWIFPMSLASEHQVSAIMRKLISN
                     IRTQQGVRVKEILMDQGSQYTGRMVRDLLDEFGIEGKYTSTGDKRSNGVAERLNRTLL
                     DDARTLLASANLPEFLWYDAAEFAVIVRNSMHMRKLDGSPNMAAGLGGIAINKILPFG
                     QPVVVYYNTGKKTLPRGKIVYALHPAKQSYGYTFYDPSSKQTMETTNYKIINTIQGDY
                     LNSEENLDTLNQVDDIVRQRSNDPSTDSQRHITHRNQREQDYISQERDPTDEPQQPES
                     DSTETHGNYLRTHKNEFQKGIATHTLGKDSRYPVRNSSDVPSQSPQEVQETLPVALSP
                     ASPPNNIFISQERLMEEEARSVKHPTKHVPAENGKRPAQRDELGVSTKRPNTKASPEQ
                     CSPIPEHLSHNDDTTDTSSLNEEERRSLYDKLSAKYRDSSIELQSTDSLYGGGGSDIG
                     DLSNPDKQIMGIISCTKTELKINDSKSDQNHEHQIDAIVNMLIQENPVQTYDNIKHEN
                     RVKIPLVNSLKMVRSLPNTKIDRSLSYSQAITKNSNHQEREAFKEAYDSEIAQLMRRG
                     TWDTTEVDIKSIEPHKLLNTMFIFTTKRDGRKKCRLVVRGDLQHWSTYEKHLESNTIH
                     HYALMTILSVALEENMIVKQLDITAAYLYADLKEELYIRTPPHMKMPNKAFRLRKSLY
                     GLKQSDANWYGTITSFLKERCGLKEDKIWSCVFTKEPPLSIIVCIFVDDIIVTGKDTQ
                     EIERFLEQLRSTYETKLVHDGKMGEDGTARYDILGLDLEYKRNGYMKFGMLDILSHKL
                     PLLNLPLREGSRYNQAPVSSSSEPPKVDKNLYVTEKDYKSNVKKLQQVVGLLSYVAHK
                     FRFEALYHVNVLAQYQLYPTDEVMKWANESVQYFWNTKEKRLVWTKNKTPVDYEFTII
                     SDASDRCEPEGKSRLGWFYEIYGHKISARSTKSSYVCDSSTGAEICAMKEATKFDFAI
                     SALLFTLTGKRPRVRLLSDNKPALGRITNPNSTVSPFKPTFTRTMELREKHNEGLCDF
                     TYIPTEQNVADILTKVLSAKRFNRLTNGWLI"
     gene            <142929..>144107
                     /gene="YAP3"
                     /locus_tag="KLMA_30055"
                     /db_xref="GeneID:34715349"
     mRNA            <142929..>144107
                     /gene="YAP3"
                     /locus_tag="KLMA_30055"
                     /product="basic leucine zipper domain-containing protein"
                     /transcript_id="XM_022818547.1"
                     /db_xref="GeneID:34715349"
     CDS             142929..144107
                     /gene="YAP3"
                     /locus_tag="KLMA_30055"
                     /note="cl02576, the Pfam entry includes the basic region
                     and the leucine zipper region."
                     /codon_start=1
                     /product="basic leucine zipper domain-containing protein"
                     /protein_id="XP_022675203.1"
                     /db_xref="GeneID:34715349"
                     /translation="MSYISGQQGPFDDQMLRIGASDNYFLSPPPYGGGPDSTGTSTST
                     SHSHGLGHGPGSGSGPGSGPGMASASASAISMDSELNLSFLQHPGLDVHVKEEDQGFP
                     VLMGGPLSNGMARGHSMVESVPDSITDSMSRRNNNGDSSYTSPMSSGQGQGQGNGSAS
                     QTAGQGQGQDKSESSGMKADSEEEQIRRKRAMNRAAQKAFRERKEARVKQLEQQLKDS
                     ERDREQLLSELEDLRKHNIEMHAENRILLQTKSAGMPGVPGVPGRLPLAQGLGQGQGQ
                     GISQSIPQDLGLGAGPGTCPTKFTFPSKRDFVEELIDLQDQTYDAETVSRTQPVNYSH
                     DGQEMMTISATWEYLHKVSERIDFDLSLVMCKLKGKQVCHGKGPSFYKSDVDRYIQEA
                     "
     gene            <144450..>145682
                     /locus_tag="KLMA_30056"
                     /db_xref="GeneID:34715350"
     mRNA            <144450..>145682
                     /locus_tag="KLMA_30056"
                     /product="ubiquitin-binding protein CUE2"
                     /transcript_id="XM_022818548.1"
                     /db_xref="GeneID:34715350"
     CDS             144450..145682
                     /locus_tag="KLMA_30056"
                     /codon_start=1
                     /product="ubiquitin-binding protein CUE2"
                     /protein_id="XP_022675204.1"
                     /db_xref="GeneID:34715350"
                     /translation="MDDSAVHTLAQLFPDATQTKLRNALASAQGDPNLASTILLSEMS
                     MGRQGETVAQLASMFPDKPRAVLQRVLEDSGSLDAAVEVLLGDASGDSFGDAFGDALP
                     KALPNKREATNQASGKARGLATSQDSGPAIVQKYGYVSKRVAEDLCAQYSDPIRALIQ
                     LVYTGTRGTSTSNTGTSTGTSTATNTSDDLSDLLHSPRLSSISPRFLEKALEYFHGDH
                     ERTAALLILIAEHNYGKHTGYYRVEPGPGPGPGPGTSSIRQGTSSARSQIKPRFSPSP
                     STSTIPKAISSPINGTRDGTRDGTRDGPEAGDEPQTLDFHGWLPEDAANTAAQRLARW
                     WATELAQRELNNTRLNQIEAVHVSPVTLVTGRGLHSTGGVPRVRIRVQRMLDELNYVY
                     IEEPSRFTVTGRRRIRQR"
     gene            <145935..>147593
                     /gene="MIF2"
                     /locus_tag="KLMA_30057"
                     /db_xref="GeneID:34715351"
     mRNA            <145935..>147593
                     /gene="MIF2"
                     /locus_tag="KLMA_30057"
                     /product="protein MIF2"
                     /transcript_id="XM_022818549.1"
                     /db_xref="GeneID:34715351"
     CDS             145935..147593
                     /gene="MIF2"
                     /locus_tag="KLMA_30057"
                     /codon_start=1
                     /product="protein MIF2"
                     /protein_id="XP_022675205.1"
                     /db_xref="GeneID:34715351"
                     /translation="MDYMNLGVRSRKTGLTVDKLVPKDEYSMENIDDFFKEGDKTGPG
                     LGPGPASTRTRPGHGPGQALDPRTTSGPGQGPGQSSFDAFKIPSTVPEPGTSPAPGTP
                     ENQTSDQWFPDVNEMPEVPHDSPGTPGSPGTPQKRFIREQDVDSYDSPDSDPSIRLTP
                     EQDYRDVPDLVDDGETTRDTSLSEEHVLLEDELDDDFRPETDIDTEYRDGSTDGSTDD
                     TSDDTSDDDSDHPEDSDSDHPEDSDSDSSLIQAQAKELLQNEKPTASATGGVRRSTRI
                     RVAPLEFWRNEKVVYKRSSNKPVLEIDKIITYDHDQDEEEEQFLKNNKRSKTQAQGQA
                     QAQAKTKSRPYNYIPSGRPRGRPRKNKPPEQEEGEKSGNARILQEIKNGTYPNAQWLQ
                     HGVYQSTVNVSADEKKDQDILAFAPGLAQAEQVTSSNNDKFTLAILFDKHKERFASGI
                     LKIPVDGAKTLANAHNAFINFYVIQGIVEVTVENKKFICTKGSSFQIPAFNNYGFTNK
                     GMDNADLYFVQVTVPETFDGSQEPGSEADDTSDKSSSNMSLTTT"
     gene            complement(<147798..>151160)
                     /gene="STE20"
                     /locus_tag="KLMA_30058"
                     /db_xref="GeneID:34715352"
     mRNA            complement(<147798..>151160)
                     /gene="STE20"
                     /locus_tag="KLMA_30058"
                     /product="serine/threonine-protein kinase STE20"
                     /transcript_id="XM_022818550.1"
                     /db_xref="GeneID:34715352"
     CDS             complement(147798..151160)
                     /gene="STE20"
                     /locus_tag="KLMA_30058"
                     /codon_start=1
                     /product="serine/threonine-protein kinase STE20"
                     /protein_id="XP_022675206.1"
                     /db_xref="GeneID:34715352"
                     /translation="MTMTNASEYSSELLPGTFGSRSVGVGDDGGSKKQEEAEQKIGNV
                     EVGVSNGEDENVLIGKTQGKKQQSASDTLGLPRAPGSLDVKGLQESVGDRFVKDLSDY
                     KSMDPGKPTVPAAAVSDLLGNASHIVSSDQEEDAGESEKKRGYENGNGNPGESESESE
                     RENEHDLDNGNDAQQPTLDEPIQFTRVSSSSVLSGSISDADRNTLSNDDDDDDDISNN
                     YNAGPDGNNITLKETPGTVDSIIGDKTNSTIVGSSSQNIGRMSNGGRVMSDFSSFGAG
                     LDLSNDVLNSKHHSDSPNVTTPITEAIGNRNSNNNSNSNSNSNSNSGLYETRTNDALS
                     TSSESLGRTGNSSAEQFKHVSTHDVIPEEEQPHTYPNLEKKNTSEDQQPLKTPVMMNN
                     FFENQGQSQGQNQSQSQSQFQTPVTGSRSPFRSISSPFTSLRKNVKSQHGTPDHSQRN
                     SNSSTSSSGDTKRKSGAKKKGVFSTFVQNIKRNSHSEKRSSSGGGGVNSTGSGGFKIS
                     TPYDPKHVYHVGVDAKTGEYTGLPNEWEKLLTSSGITMKEQQQHPQAVMDIVKFYQDV
                     TETSGEDKVFKTFKVGGGSGTNIASTPSFRTPSATHVQKFTTPPLQPNASFLDNVNGN
                     HYNNNNSIINEPVYHSNNTSNLQSPLLTNEFGEAANNEKFIPTRPAPKPQGSSSVSRK
                     VEIPSPINSITHGTPKVQRSDTLNSSSGFSFTKRLNSFKSEQPLPPIPKAAEKPVTLQ
                     PTRAAPTPPKQQQQHTPVIPSEQQVPPPPIPGGVSSSSAHSSGGDGGNTQGAQARTAQ
                     EKKREDRRRKNQQIQAKLLEICTAGDPSKLYKNLIKIGQGASGGVYTAYELGTNAAVA
                     IKQMNLEKQPKKDLIVNEILVMKGSKHNNIVNFIDSYLFKGDLWVVMEYMEGGSLTDV
                     VTHCILTEGQIGAVCRETLKGLQFLHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQ
                     INEVNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLR
                     ALYLIATNGTPKLKDPENLSDTMASFLNLCLTVDPEERGTALELLDHPFITEIAEENI
                     SLAPLVKLARMKKLAESMEDEEDEEEARGHGQ"
     gene            complement(<151978..>156432)
                     /gene="UFD4"
                     /locus_tag="KLMA_30059"
                     /db_xref="GeneID:34715353"
     mRNA            complement(<151978..>156432)
                     /gene="UFD4"
                     /locus_tag="KLMA_30059"
                     /product="ubiquitin fusion degradation protein 4"
                     /transcript_id="XM_022818552.1"
                     /db_xref="GeneID:34715353"
     CDS             complement(151978..156432)
                     /gene="UFD4"
                     /locus_tag="KLMA_30059"
                     /codon_start=1
                     /product="ubiquitin fusion degradation protein 4"
                     /protein_id="XP_022675207.1"
                     /db_xref="GeneID:34715353"
                     /translation="MSYYDGDGDYIIYEDDNDGNSDRSDEGESGEYSYPEDEDDLGFV
                     HHADEDDDEEEEEEEIGDDEEEAEEEELDGDGDIRGVRNGRRGDRISFLQDIVSRLAE
                     QRSGDEADSEERAFGRSLPSLLQELGRSEGFFSSGMSSTSSSREGTRYYKLIENVLQA
                     EDDPYIAMESLRELAEQLLMINPLIAERVIPSGKLMDALIHVMSSPLLQGELELQLIA
                     CRCLYNCYEMNPEMIEVSVDRDIIEVLKGKLAEISYIDLAEQVLETLEFISRVHGLEI
                     LRSGSLVCCLQYLDFFTVHAQKKALSIIANSCARAKESDYEMVSEIFPSLKTIFLNNT
                     NPVILKPVLITLYSISGSLNKKSLSTLFDIELVKRFLSLLCSDGELEGESALKTLTIL
                     SLLVSTNAELSKQILLDCELLNVIQSIFQPFKKKATSGFGETLIYVPQELLLCVTTFI
                     LLLLPTEDSQVLTADETKVFTFDDKKTAFVNLITQLIPCLVEIYSNTVDTKIRYTVLA
                     ALARIFTCIPRNSDVDTSSVISLISSGLINGSHASAQELKSETGAILVALLSLASIMM
                     STNPEVYLTKLVKEGIPDALAAFKSHYDTEVVKKHSAGASAGASAGASGDDNDEEQEE
                     EEGTNLDATPIFGSESDGAEDDDNDEKDTFRMEYDEMNIPEFVKPRKIRINIYDHLTP
                     YYLMKHISMFSTSLVEIFSSNVDEIATELSDINAIVAKMKGLNVTADSEQFWTEFWAE
                     LKSTLFNDNYSISGFELISTGLVDAMASIFERDETKQSLSRKTFLKVFEDRLADFVKL
                     LQNALSRTESFAILDAGTGNNEPPSSSLVKQMKIRIVLDSSADAIDEEVEEEEEEGTK
                     TLGNMIPENLRDVVIAVHCVASLKTLDDFLKHKIIQSEFLSTIIPTMSRLSSQINPVS
                     MAKELEKIDFEFSLNGKPLDQSSTIYSAVFKEAMREGQPTSSIWTNVPTFKFRKIAKK
                     TETHKLKSLYPDSAFESADLKPVKSILTVLKCSLHKSVPASAYVNSKISAKLSRQLEE
                     PLIVACGVLPNWVLDITRNYGFLFPFDTRITFLQNTSYGYGRLIQYWREKLLDSNSSS
                     GNSSNSADNPLNQLGRLTRHKLRVSRETLFLSGIKILEKYGSSPNVLEIEYKDEEGTG
                     LGPTLEFYSLMSKEFARKSLNMWRIDSTEAYDLEEKYVTNTLFPGPLVGAEEEENGKV
                     LKLFENLGTFVARSMQDNRILDFRFNEVFFELMHKQCRGEQLDLQDFETCINMIQLVD
                     PQLGKSLRFLYENRKDPSIESLDLYFMLPGYNVELLEGGSKILVSSENVEEYLIRIFD
                     QILAKGIQRQLNAFVTGFSKSFPYSSLLILTPEELSGLFGAVEEDWSAETLFSCIHAD
                     HGYSMDSPTITNLIHTLATFSPQERRLFLQFITGSPKLPLGGFKNLKPKFTVVLKHPD
                     DNTSPDECLPSVMTCANYLKLPKYSDKTMLRNRLVQAMTEGSGAFLLS"
     gene            <157000..>157710
                     /gene="MRT4"
                     /locus_tag="KLMA_30060"
                     /db_xref="GeneID:34715354"
     mRNA            <157000..>157710
                     /gene="MRT4"
                     /locus_tag="KLMA_30060"
                     /product="mRNA turnover protein 4"
                     /transcript_id="XM_022818553.1"
                     /db_xref="GeneID:34715354"
     CDS             157000..157710
                     /gene="MRT4"
                     /locus_tag="KLMA_30060"
                     /codon_start=1
                     /product="mRNA turnover protein 4"
                     /protein_id="XP_022675208.1"
                     /db_xref="GeneID:34715354"
                     /translation="MPRSKRSKLVTLAQTDKKGRENKERIFDEVREALDSYRYVWVLH
                     LDDVRTPVLQEIRSSWAGSKLIMGKRKVLVKALGEKPEEEYKENLAKLCKECSGLTGL
                     LFTNEAVDVVEDYFKAYTRADFSRPKSKAPLTFTIPAGIVYSRGGQIPEEDDVPMVHS
                     LEPTLRNKFKIPTKIKNGKITLESPFLVCEKGKTLDVTQALILKQFGIAAAEFKVKVA
                     AYYDNESSSVEKVGINME"
     gene            complement(<157789..>158304)
                     /locus_tag="KLMA_30061"
                     /db_xref="GeneID:34715355"
     mRNA            complement(<157789..>158304)
                     /locus_tag="KLMA_30061"
                     /product="suppressor of HU sensitivity involved in
                     recombination"
                     /transcript_id="XM_022818554.1"
                     /db_xref="GeneID:34715355"
     CDS             complement(157789..158304)
                     /locus_tag="KLMA_30061"
                     /codon_start=1
                     /product="suppressor of HU sensitivity involved in
                     recombination"
                     /protein_id="XP_022675209.1"
                     /db_xref="GeneID:34715355"
                     /translation="MEDVLRDVLDSDKKTLVIALGNVARKFFEQDLRHKAREHPCFNA
                     IDDIVRGRRNIKVLFLDKLQYLYMYLTYVEIEVEQHSRGDTLSSYEEIVIYGLESLVF
                     PHEKEEEKEEKQEKMSPEQLRNLNLILHGAMRLEKRYAIRVRLVNAVDLGVQVHSWDA
                     LSRYWRRRVLE"
     gene            <158698..>159912
                     /gene="MRP4"
                     /locus_tag="KLMA_30062"
                     /db_xref="GeneID:34715356"
     mRNA            <158698..>159912
                     /gene="MRP4"
                     /locus_tag="KLMA_30062"
                     /product="37S ribosomal protein MRP4"
                     /transcript_id="XM_022818555.1"
                     /db_xref="GeneID:34715356"
     CDS             158698..159912
                     /gene="MRP4"
                     /locus_tag="KLMA_30062"
                     /codon_start=1
                     /product="37S ribosomal protein MRP4"
                     /protein_id="XP_022675210.1"
                     /db_xref="GeneID:34715356"
                     /translation="MSLRYCAKSLSNKGSFALGSGATRLLSSSSKACNKAEGEAEVEV
                     ESSNSSSSSVRQSEFNGSISKLLEQAMRTPVEDMSVLESKFRSPLTEKEQQLDERLTE
                     FLRKYAKQNKVLDLPEDSNKFDFSSKVVSQPLHTREFPYLSQSGKDEPYSEQELYVRQ
                     LKHASHTGKLGADISNVYFPHKDIFNPPSLQQVSIEKLMAAGVHLGQSTALYRASTQP
                     YIYGEYKGIHIIDLNQTLSHLKRAAKVVEGVAENGGLILFLGTREGQKRALVKAAERV
                     KGYYVASKWVPGTLTNPTEISSNWERHEVDYLGNPTGRELTLNESTSIIKPDLMIVLN
                     PTENRNALKEAMKARVPTIGIIDTDSEPSLVTYPIPGNDDSLRSVNLLTGILAKAGER
                     GVQTRLNLASAA"
     gene            complement(<160508..>161737)
                     /gene="LAG1"
                     /locus_tag="KLMA_30063"
                     /db_xref="GeneID:34715357"
     mRNA            complement(<160508..>161737)
                     /gene="LAG1"
                     /locus_tag="KLMA_30063"
                     /product="sphingosine N-acyltransferase LAG1"
                     /transcript_id="XM_022818556.1"
                     /db_xref="GeneID:34715357"
     CDS             complement(160508..161737)
                     /gene="LAG1"
                     /locus_tag="KLMA_30063"
                     /codon_start=1
                     /product="sphingosine N-acyltransferase LAG1"
                     /protein_id="XP_022675211.1"
                     /db_xref="GeneID:34715357"
                     /translation="MSGKKESPQLRRRRTTSIGRIDLGDTSVPGLSTMSVTARSRSAS
                     AARLKVLSSSSQNDLDVLRKLWFSYRELSYRHSWLTSFLILSFTYLLYWCSGNMTPSN
                     PLHMFVAPSYQIGDTRMYAKGPKDLCFVFFYMIFFTFLREFVMQVILRPLAIKLGIKK
                     ENKIKRMMEQMYSIFYYSISGPFGLYIMYHTDLWLFRTDTMYKTYPDFNNEYLYKIFY
                     LGQAAFWAQQSCVLALQLEKPRKDFQELIIHHIVTLALVWLSYVFHFTKMGLAVYITM
                     DVSDFFLALSKTLNYLDSSLTPPFFMIFIVAWIYLRHYINLKILWSLLTEFRTVGNYT
                     LNFATQQYKCWISQPIIFFLLLALQLLNLFWLFLIFRILYRLVVHGIQKDERSDSEST
                     DEEENEPKEENEKEKEK"
     gene            <163365..>164903
                     /gene="HSE1"
                     /locus_tag="KLMA_30064"
                     /db_xref="GeneID:34715358"
     mRNA            <163365..>164903
                     /gene="HSE1"
                     /locus_tag="KLMA_30064"
                     /product="class E vacuolar protein-sorting machinery
                     protein HSE1"
                     /transcript_id="XM_022818557.1"
                     /db_xref="GeneID:34715358"
     CDS             163365..164903
                     /gene="HSE1"
                     /locus_tag="KLMA_30064"
                     /codon_start=1
                     /product="class E vacuolar protein-sorting machinery
                     protein HSE1"
                     /protein_id="XP_022675212.1"
                     /db_xref="GeneID:34715358"
                     /translation="MTSTVKLQKAIDKATDAGLRADNWGYLIEVCDLVKLDAEENGEF
                     AMNLIEDNLLGRNANVILRTLSLVVALAENCGSRLQQAISSKHFTGILFKLVDDSRVH
                     ITVKREVVKTVHQLADSFKNDPSLKYMHDLENKIKITHPQLLSEPRVPKKKEMSRDKE
                     QEEEKELAEALRLSLLEFEKSNGKPNGSGAAPINSGAYQPQQQQQPEQQQPKQTPTTI
                     RKVRAMYDFKATEQDELSFKKGDLICVVEQVYRDWWRGTLGGRVGIFPLNYVTPVTEP
                     TKQELELEARKEGEVFAQKDNVDKLQRKLREAGNADVSQDQEINELYGSVSPLRPQIS
                     KMLGKYSQKKDDLLSLRQVLANAEITYNQLLSRASNAYAAPAPPPTSQYASPGYSMSA
                     SSQQPLQPPVQSPAPIQQQQQQQQQQQPIQQQQQQQYPYAHQQQASVQPMGRPAGQSA
                     VEPQQYSRQSFAFPQMPSQGYPQAQVPPQQSLPYPQATSPVQQNHQQVPQYYNINSTG
                     TLPN"
     gene            <165020..>166091
                     /gene="CAP1"
                     /locus_tag="KLMA_30065"
                     /db_xref="GeneID:34715359"
     mRNA            join(<165020..165048,165287..>166091)
                     /gene="CAP1"
                     /locus_tag="KLMA_30065"
                     /product="F-actin-capping protein subunit alpha"
                     /transcript_id="XM_022818558.1"
                     /db_xref="GeneID:34715359"
     CDS             join(165020..165048,165287..166091)
                     /gene="CAP1"
                     /locus_tag="KLMA_30065"
                     /codon_start=1
                     /product="F-actin-capping protein subunit alpha"
                     /protein_id="XP_022675213.1"
                     /db_xref="GeneID:34715359"
                     /translation="MTRSSACSICIMSKFEEIVREIVFDSPPEEIPLVYNNLQVLSNG
                     DSKQEIISIIQEFNEKVRVPVKYDGENYVLSEYNKSGSKYFDPVKKVLFSVDPVSREV
                     SDVEELQEQELVATDVQDSLYGDLSKYVSKAFPETAAYGVFKTKKSENEYAIVIVSNK
                     KSLGDFWTGNWVSEYIYNAVSDSISGKVSVDAHYFEDGNVRFKSSAPLEEETSTSPVV
                     SIKRFENNFEKNLIEKFQYMNETQFKGLRRRLPVTRAKINWGQGIGNYRLGRDAAQGT
                     N"
     gene            <167978..>168727
                     /gene="RPL14B"
                     /locus_tag="KLMA_30066"
                     /db_xref="GeneID:34715360"
     mRNA            join(<167978..168106,168440..>168727)
                     /gene="RPL14B"
                     /locus_tag="KLMA_30066"
                     /product="60S ribosomal protein L14-B"
                     /transcript_id="XM_022818559.1"
                     /db_xref="GeneID:34715360"
     CDS             join(167978..168106,168440..168727)
                     /gene="RPL14B"
                     /locus_tag="KLMA_30066"
                     /codon_start=1
                     /product="60S ribosomal protein L14-B"
                     /protein_id="XP_022675214.1"
                     /db_xref="GeneID:34715360"
                     /translation="MSTDSVVKASNWRLVEVGRVVLVNKGQYAGKLATIVEIIDQKRA
                     LIDGPTTGVPRQAINLGQVVLTPLTFALPRGAKSATVSKKWASAGVSEKWAASSWAKK
                     IAQRERRSALTDFERFQVLVLKKQKRYAVKKAVAKA"
     gene            <169754..>171004
                     /gene="AUR1"
                     /locus_tag="KLMA_30067"
                     /db_xref="GeneID:34715361"
     mRNA            <169754..>171004
                     /gene="AUR1"
                     /locus_tag="KLMA_30067"
                     /product="inositol phosphorylceramide synthase"
                     /transcript_id="XM_022818560.1"
                     /db_xref="GeneID:34715361"
     CDS             169754..171004
                     /gene="AUR1"
                     /locus_tag="KLMA_30067"
                     /codon_start=1
                     /product="inositol phosphorylceramide synthase"
                     /protein_id="XP_022675215.1"
                     /db_xref="GeneID:34715361"
                     /translation="MSSWFHRTFLADRPAGSRLANLETSFSPQVSIRKLKNYQPTVSE
                     ICHYGFLGSILFFTFIVNPAAWIYKILAYSLLILLCIVPATGQFFFNALPVLTWLALY
                     FTSSSFDATYRPPITVKVLPAIETILYGDNLSDILATSINKPLDIIAWLPYGIFHFGA
                     PFVVAAIIFLCGPPTILRGYAFAFGYMNLFGVITQNVFPAAPPWYKILHGLAPAHYGM
                     HGSPGGLGRIDEYFGINLYTSGFSNSAVIFGAFPSLHSGCATMEALFFSYVFPKLTPL
                     FVFYVCWLWWSTMYLTHHYFVDLMAGSVLSFVIFQYTKYFILPLPEKGVYSRWSYAEI
                     TKFNIWQSDPLYGARADVENVPLSVLETDFELNSMENSNSPSIFDETSTRSASRSSIT
                     SADNFENDLPLRASTAKPNKQRID"
     gene            complement(<171521..>171910)
                     /gene="MRP17"
                     /locus_tag="KLMA_30068"
                     /db_xref="GeneID:34715362"
     mRNA            complement(<171521..>171910)
                     /gene="MRP17"
                     /locus_tag="KLMA_30068"
                     /product="37S ribosomal protein MRP17"
                     /transcript_id="XM_022818561.1"
                     /db_xref="GeneID:34715362"
     CDS             complement(171521..171910)
                     /gene="MRP17"
                     /locus_tag="KLMA_30068"
                     /codon_start=1
                     /product="37S ribosomal protein MRP17"
                     /protein_id="XP_022675216.1"
                     /db_xref="GeneID:34715362"
                     /translation="MLYELVSVVRVSNPLAANAEAKELATTIGRLIIQNRGVVRKIVP
                     MGNKLLPKIIKKDQEQHFQGYHFQMLFDSSAPVQSEILRTLKKDPRVIRSNIIRLNTD
                     KKLDIPISFERAAGNVSSLNKSKSTPF"
     gene            <172398..>173212
                     /gene="DID4"
                     /locus_tag="KLMA_30069"
                     /db_xref="GeneID:34715363"
     mRNA            join(<172398..172457,172562..>173212)
                     /gene="DID4"
                     /locus_tag="KLMA_30069"
                     /product="DOA4-independent degradation protein 4"
                     /transcript_id="XM_022818563.1"
                     /db_xref="GeneID:34715363"
     CDS             join(172398..172457,172562..173212)
                     /gene="DID4"
                     /locus_tag="KLMA_30069"
                     /codon_start=1
                     /product="DOA4-independent degradation protein 4"
                     /protein_id="XP_022675217.1"
                     /db_xref="GeneID:34715363"
                     /translation="MSLLTWIFGENLTPQERMRKNQRALERAQRELDREKRKLEVQEK
                     KLIQEIKKSAKNGQVNAAKIQAKDLVRTRKYIEKFGNMKTQLQAISLRVQAVRSSDQM
                     AISMREATGLLAGMNRSMNLPQLQRISMEFEKQSDLMEQRQEFMDESIDDVMGDELDE
                     DEEADEIVNKVLDEIGVDLNAKLQTAPQNLVQAEQPVSEPAKAVAEAMGSSGGVATSS
                     GPTTDDELQARLNSLKRG"
     gene            complement(<173400..>174002)
                     /gene="MET14"
                     /locus_tag="KLMA_30070"
                     /db_xref="GeneID:34715364"
     mRNA            complement(<173400..>174002)
                     /gene="MET14"
                     /locus_tag="KLMA_30070"
                     /product="adenylyl-sulfate kinase"
                     /transcript_id="XM_022818564.1"
                     /db_xref="GeneID:34715364"
     CDS             complement(173400..174002)
                     /gene="MET14"
                     /locus_tag="KLMA_30070"
                     /codon_start=1
                     /product="adenylyl-sulfate kinase"
                     /protein_id="XP_022675218.1"
                     /db_xref="GeneID:34715364"
                     /translation="MATNITWHPNLTHSERKELRKQSGCTIWLTGLSASGKSTIACAL
                     EQLLLNKGLSAYRLDGDNIRFGLNKDLGFSEQDRNENIRRISEVSKLFADSCTIAITS
                     FISPYRIDRDKARELHKEGELKFIEVYVDVPLEVAEQRDPKGLYKKAREGIIKEFTGI
                     SAPYEAPVSPELHLRTDQQSVEECALQIYEYLVKEGLIVQ"
     gene            complement(<176282..>178336)
                     /gene="VPS1"
                     /locus_tag="KLMA_30071"
                     /db_xref="GeneID:34715365"
     mRNA            complement(<176282..>178336)
                     /gene="VPS1"
                     /locus_tag="KLMA_30071"
                     /product="vacuolar protein sorting-associated protein 1"
                     /transcript_id="XM_022818565.1"
                     /db_xref="GeneID:34715365"
     CDS             complement(176282..178336)
                     /gene="VPS1"
                     /locus_tag="KLMA_30071"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 1"
                     /protein_id="XP_022675219.1"
                     /db_xref="GeneID:34715365"
                     /translation="MDERLISTINKLQDALAPLGGGSQTPIDLPQITVVGSQSSGKSS
                     VLENIVGRDFLPRGTGIVTRRPLILQLINRRVKKETKSATEDLLDLKNSEAHGGQSED
                     NAEEWGEFGHLPGKKFYNFNEIRNEIVSETEKSTGKNAGISAVPITLRVYSPHVLTLT
                     LVDLPGLTKVPVGDQPADIERQIKDMLLTYIKKPNAIILAVNPANADLANSDGLKLAR
                     EVDPDGSRTIGVLTKVDLMDEGTDVIDILAGRVIPLKFGYIPVINRGQRDIEQNKTIR
                     AALEDEKKFFENHPSYSARAMYCGTPYLTKKLNSILLHHIRQTLPDIKHKIEVTLKKY
                     QTELLNLGPESLSSASSIVLSMITDFSKEYTGILDGEAKELTSKELSGGARVSFVFHE
                     IFKNGVYALDPFDQIKDSDIRTIMYNCSGSAPSLFVGTEAFEVLVKKQISRFEQPSLR
                     LVTLVFDELVRILKQIINQPKYSRYPSLRDAISNNFIQFLKEAVIPTNEFVIDVIKSE
                     QTYINTAHPDLLKGSQAMAMVEERLHPRQVDPKTGKPIPTQPTKPEETRPSGFFGGFF
                     SSKSKTRASVLENPPNVLEATGQMTEREKQETEVIKLLIDSYFNIVKKTVADFIPKAV
                     MLKLIVKSKNDIQKILLEKLYSGENLEELTKESDLTTQRRKECQKMVNILSHASEIVS
                     SV"
     gene            <178446..>181739
                     /gene="PAP1"
                     /locus_tag="KLMA_30072"
                     /db_xref="GeneID:34715366"
     mRNA            join(<178446..178455,179320..>181739)
                     /gene="PAP1"
                     /locus_tag="KLMA_30072"
                     /product="poly(A) polymerase"
                     /transcript_id="XM_022818566.1"
                     /db_xref="GeneID:34715366"
     CDS             join(178446..178455,179320..181739)
                     /gene="PAP1"
                     /locus_tag="KLMA_30072"
                     /codon_start=1
                     /product="poly(A) polymerase"
                     /protein_id="XP_022675220.1"
                     /db_xref="GeneID:34715366"
                     /translation="MYKWTVFGEQVNSISSDLAELKVSGCSVTSEPKKKKLESSNENS
                     TGNSDENQTTIIVGKDQEFASSVNENSYTHHHQQQQKQHQQQQQKQQQQHHHHHNQHY
                     QKQSKQHLQQYFVNYNQQGLHYVYFSPTSSPVASPISRRHNSNYNSRRSASTDHIPSL
                     PYGKTTGSLDYLEKARSRSTPDYRSKTFQNTMSQKKIFGVTGPISTEGPTAAENALND
                     SLIQQLKKEGSFETEEETAKRVVVMETFQKLTQEFVYQVSKKKNMSDGMARDAGGKIF
                     TFGSYRLGVHGPGSDIDALVVAPKHVTREDFFTVFDKLLRERPEVEEIASVPDAFVPI
                     IGIKFSGISIDLLFARLDLPQVPITLTLSDKNLLRNVDEKDLRALNGTRVTDEILELV
                     PNKTSFKIALRAIKIWAKRRAVYANVFGFPGGVAWAMLVARICQLYPNACSAVILSKF
                     FQILSRWKWPQPVLLKPIEDGPLQVRVWNPKIYAQDRSHKMPVITPAYPSMCATHNIN
                     ESTKKVILSELKRGVEITQKIFSNELSWGDLFKRHNFFFKYKFYLTVMVSTKGTDEQH
                     LKWSGFVESKLRLLIQKLEVLPGINLAHPYIEPYQSSYIYKNEDEYKDIMNNYGTHKT
                     ERALKKFTKITEENKDTEESKNANQVHISTMFIGLDINTEESNKIDIHIPCQEFFNLC
                     RSLPEYEDPEIFSLIIKYVKVHDLPDEVYQEGETRPVKSSKKRKPEKSGEKSKRPKSD
                     PSSANSTAEKASEKEDASSNGDKSESNNKQPSSEDITQNNLNDGSNSGSNPKAPASNG
                     ISEGAVTSVSQ"
     gene            <183043..>184782
                     /gene="MUP1"
                     /locus_tag="KLMA_30073"
                     /db_xref="GeneID:34715367"
     mRNA            <183043..>184782
                     /gene="MUP1"
                     /locus_tag="KLMA_30073"
                     /product="high-affinity methionine permease"
                     /transcript_id="XM_022818567.1"
                     /db_xref="GeneID:34715367"
     CDS             183043..184782
                     /gene="MUP1"
                     /locus_tag="KLMA_30073"
                     /codon_start=1
                     /product="high-affinity methionine permease"
                     /protein_id="XP_022675221.1"
                     /db_xref="GeneID:34715367"
                     /translation="MSGTRSFLSQLNVFNKENYKFTSEVKNQEGSESGVSNYDDSGSV
                     ENGEHFDVELDKGSKKLGLISCIGLICNRMLGTGIFAVSSTIYSLCGSVGLALIMWAV
                     GAIIALAGLYVYMEFGTAIPRNGGEKNYLERIFPAPKFFITCMYGAYIFFLGWAAGNS
                     VNTAVMFLTAGNAKVTDWNQRGLGVAVVGFAFIVNSVNVKLGLYIQNLLGIFKIAIVL
                     FITVTGWVALGGGLKDGYKTNNFHNAFEGTGGATAYGIVNALYNVIWSFVGYSNVNYA
                     LGEVKNPVRTLKIAGPTSLIFLAIVYIFVNIAYFAVVPKETFKTSKLILVADFFDIAF
                     KNEHAKTAACVFVGLSALGNVMSVIFSQGRIIQQLGREGVLPFSSFFASSKPFDSPAV
                     GLFQHFIVCLVTIIAPPAGDAYNFVLNLISYPMNIINFVISAGLLWIHWERKQGRTVW
                     EPPIKAGIPVIVFFALANLYLIIAPYVPPSDGESVYEHLPYYIHCVVAWGVFGIGAVY
                     WLVWAKILPKIGKYELVNEEVIGEDGFWRQKIIKKPLSDTEVIEENINLEKSSSSSGY
                     DKQLTSQNTISIN"
     gene            <185177..>187915
                     /gene="RSC2"
                     /locus_tag="KLMA_30074"
                     /db_xref="GeneID:34715368"
     mRNA            <185177..>187915
                     /gene="RSC2"
                     /locus_tag="KLMA_30074"
                     /product="chromatin structure-remodeling complex subunit
                     RSC2"
                     /transcript_id="XM_022818568.1"
                     /db_xref="GeneID:34715368"
     CDS             185177..187915
                     /gene="RSC2"
                     /locus_tag="KLMA_30074"
                     /codon_start=1
                     /product="chromatin structure-remodeling complex subunit
                     RSC2"
                     /protein_id="XP_022675222.1"
                     /db_xref="GeneID:34715368"
                     /translation="MSSKVPLKEIIKPLVNIIYELKEENGLEIHPIFHLLPPRRDYPD
                     YYQIIEHPISLSTVRKRMTQYKNPQEFINDLARVTWNARVYNTKDSDVYHYAVILDKC
                     VRETIIPSLKKDFPNVRYPYLGPLPDEAPLEGVEIEEPEKQQKALPKPKPMAESPSPV
                     SNSTSSKTLPLSSLNETPTKDTLRTGRSLTGLENIPLTRSPGGFRTTEEEYRLAANRK
                     EAENRSSSEDTGTGARKANTLTKIRLSQMSPPIINTSKSSTPTPLANKSHVEKKTHMK
                     RGRPPVIDLPYEQRIKNVLKGMKKEVTPDGKDLIASKFERLPDEEREPQYYSVISDPI
                     SLDDIKKKVKQRKYKDFQKFQEDVMLMLNNYRMYHRTQPTELRRAADFETLFNAHCQH
                     ELSRPDIDFMTDGELKYPLETVEVNGKSYKIGDWILLRNPNDETKPTVAQIFRLWYTS
                     DGTRWLNCCWYLRPEQTVHRVDRLFYKNEVVKSGQYRDHLVEEIVGKCYVCHFTRFQR
                     GDPDVPIEGPLFVCEYRYNETEKVFNKIRTWKGCLPEEIREIEDPTIPVVGRKFYKYE
                     SPIKHLLPPNATVNDPLPQPTEGAVNAPPLVGAVYLRPKLRRDDLGEYSTSDDCPRYI
                     IRPGDPPPPGKYDDETGTVITNQHPGTTVPRGPHRLSSLTRNMQQTPITTRQSRPTQY
                     YPPPVTKGQHPSPPLPLPPHQQMMQKHQQQQQQQLQQHLMLQSQQAGNQVQVKSSGSG
                     SGFAEGSKPIPYRSTAIINDLISQMKAPGAPNANVSVDAPAAAILPIPLTKNIELLQR
                     ADYNSQIRRLGKNNVPKRRRAKGEVIWFKGPSVVVSERLINSGTETPLNRWFKKQKVE
                     KSEHEKEGAQATSTEDNEDETEIYPGSFPKGLRPSLEYMAFKLRQQQAQETQVISP"
     gene            <188430..>189878
                     /gene="ADE13"
                     /locus_tag="KLMA_30075"
                     /db_xref="GeneID:34715369"
     mRNA            <188430..>189878
                     /gene="ADE13"
                     /locus_tag="KLMA_30075"
                     /product="adenylosuccinate lyase"
                     /transcript_id="XM_022818569.1"
                     /db_xref="GeneID:34715369"
     CDS             188430..189878
                     /gene="ADE13"
                     /locus_tag="KLMA_30075"
                     /codon_start=1
                     /product="adenylosuccinate lyase"
                     /protein_id="XP_022675223.1"
                     /db_xref="GeneID:34715369"
                     /translation="MSEYDKYTTPLSSRYASEEMSSIFSLRNRFSTWRKLWLNLAIAE
                     KELGLDVISDEAIEQMKAHLTITDEEIAAASKQEAIVRHDVMAHVHTFGETCPDAAGI
                     IHLGATSCFVTDNADLIFLRDAYDILIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPA
                     QLTTLGKRVTLWIQELLWDLRNFERARNDIGLRGVKGTTGTQASFLALFHGNHEKVEA
                     LDKRVTELLGFSTVYPVTGQTYSRKIDIDVLAPLSSFAATAHKMATDIRLLANLKELE
                     EPFEKSQIGSSAMAYKRNPMRCERVCSLARHLGSLFSDAVQTASVQWFERTLDDSAIR
                     RISLPSAFLTADILLSTLLNISSGLVVYPKVIERRIMGELPFMATENIIMAMVEHGAS
                     RQEVHEAIRVLSHQAAAVVKEQGGDNDLIERVKKDKFFEPIWNELDSLLEPSTFVGRA
                     PQQVEKFVANDVQTALAPFQQYITDAEVKLNV"
     gene            complement(<190073..>190828)
                     /gene="LST7"
                     /locus_tag="KLMA_30076"
                     /db_xref="GeneID:34715370"
     mRNA            complement(<190073..>190828)
                     /gene="LST7"
                     /locus_tag="KLMA_30076"
                     /product="protein LST7"
                     /transcript_id="XM_022818570.1"
                     /db_xref="GeneID:34715370"
     CDS             complement(190073..190828)
                     /gene="LST7"
                     /locus_tag="KLMA_30076"
                     /codon_start=1
                     /product="protein LST7"
                     /protein_id="XP_022675224.1"
                     /db_xref="GeneID:34715370"
                     /translation="MSVLDIGFLSLTHFCDKHGPSVLMVTQLASSLENCNELLLPEYP
                     RDSYCSSCLLKFPDTNEHATSIRSTFDDFYSVSTQYSSVRYQLLSLIIKKTFSEENMS
                     YDGSPFMFWDEHRGLNLAMGFKLEDVHARGNERRYCLILSLEKGESSGEKDAFNILAE
                     NWQFVIESFTKLISHIKIQSRGMLDKLQTDFTQIMGGTYLRENKQKIPVSLADIVGDS
                     LIFLKIHKWNTYILKRLASANSNSESSDGVNTL"
     gene            <191472..>192876
                     /locus_tag="KLMA_30077"
                     /db_xref="GeneID:34715371"
     mRNA            join(<191472..191495,191649..192817,192867..>192876)
                     /locus_tag="KLMA_30077"
                     /product="vacuolar protein sorting-associated protein 38"
                     /transcript_id="XM_022818571.1"
                     /db_xref="GeneID:34715371"
     CDS             join(191472..191495,191649..192817,192867..192876)
                     /locus_tag="KLMA_30077"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 38"
                     /protein_id="XP_022675225.1"
                     /db_xref="GeneID:34715371"
                     /translation="MTESEGTHSRVRHLKSISLANLSLIRRHDAQYWFRLFPCFVVLE
                     DIHNNPIYVTNTQDSHCSLLQYEDINEIQCSDTIFGVKVIGKFPEQTVEKELRNEWVV
                     LNHYRVVLKSLVWIGEHIELLFNSNCNFEQFSQYNIPIFEFNDGFYMLPQHAVFFKVE
                     PRKQQQQQKQEMLVKKSFSFNGMLKINKILQYISQVKQETTKFAEYISENYEITGEEQ
                     KYFQECIEKYRERIRRLKDTLETLSGELNAISNNDYDETSSLTSLSMSMLANDDYGSE
                     YSIFAQDKTKLRSLQAKKLSQFFNIISHLKLSEFINLDEAKETENPFFIELKPVFFEK
                     VIASCNSENNSTNSSNVSTESINSQLGYYLLIIKVLSQNILMVPLPYKLLFMGSASMV
                     EDELPLQF"
     gene            complement(<192901..>194646)
                     /gene="DCR2"
                     /locus_tag="KLMA_30078"
                     /db_xref="GeneID:34715372"
     mRNA            complement(<192901..>194646)
                     /gene="DCR2"
                     /locus_tag="KLMA_30078"
                     /product="phosphatase DCR2"
                     /transcript_id="XM_022818572.1"
                     /db_xref="GeneID:34715372"
     CDS             complement(192901..194646)
                     /gene="DCR2"
                     /locus_tag="KLMA_30078"
                     /codon_start=1
                     /product="phosphatase DCR2"
                     /protein_id="XP_022675226.1"
                     /db_xref="GeneID:34715372"
                     /translation="MVALPKKYTRLVQYLGVVTLLVVGLFYFNLHGNITLLLKNGEGG
                     VLSRYSRDPEAPLNGIVVNFGLQRCYHLATWVRICPFKESTLNIGSGDVHISNIKRVV
                     VNKDLLGSEHYNWFGSSEFIWYDVFEIKSVTDVKNVPTGIRLKGLTSIRSNSKGICDH
                     PLRNMCIEAHNLDESSLENVRFISKLTVLFGEDATDPRPNWNLNKDMPLSNVRFPSYI
                     SETYWDNNGPKTLSLSSDSSTTQDLVLNYKQKFKIVQFADLHFSVGVGRCRDEFPKHD
                     VCEADPKTLKFMDSVLDIEDPQMVVFTGDQIMGDECKQDSESALLKVLAPVIARKIPW
                     AMVWGNHDDEGSMSRWQLSKIVSELPYSLFQIGPSDTDDNTFGVGNYVREIKDNKGKT
                     VTALYFLDSHKYSQNSKVFPGYDWIKEEQWKYMEEYANTHDSIKQPLDSKQLLSMAFF
                     HIPIPEYREFPSEYSNRMVGTFKEGITAPKYNSHGIETLHKLGVSVTSCGHDHCNDFC
                     VLNEKENNRVWLCYGGGTGEGGYAGYGGTERRARIFEIDAQKKNIYSWKRLNGSPEKT
                     FGHQKLVNDGSPYIA"
     gene            complement(<194950..>195225)
                     /locus_tag="KLMA_30079"
                     /db_xref="GeneID:34715373"
     mRNA            complement(<194950..>195225)
                     /locus_tag="KLMA_30079"
                     /product="centromere DNA-binding protein complex CBF3
                     subunit"
                     /transcript_id="XM_022818574.1"
                     /db_xref="GeneID:34715373"
     CDS             complement(194950..195225)
                     /locus_tag="KLMA_30079"
                     /codon_start=1
                     /product="centromere DNA-binding protein complex CBF3
                     subunit"
                     /protein_id="XP_022675227.1"
                     /db_xref="GeneID:34715373"
                     /translation="MGVDADNSDIGNLVFNRGGRRVEVDPKTLRKPRLYMPVDHSKPF
                     SEHTTSNGCPLVQNGGHRPTVETPKHHHPQEATESKSDEARKEGEGK"
     gene            <195532..>197739
                     /gene="STE11"
                     /locus_tag="KLMA_30080"
                     /db_xref="GeneID:34715374"
     mRNA            <195532..>197739
                     /gene="STE11"
                     /locus_tag="KLMA_30080"
                     /product="ste11p: Ser/Thr protein kinase"
                     /transcript_id="XM_022818575.1"
                     /db_xref="GeneID:34715374"
     CDS             195532..197739
                     /gene="STE11"
                     /locus_tag="KLMA_30080"
                     /codon_start=1
                     /product="ste11p: Ser/Thr protein kinase"
                     /protein_id="XP_022675228.1"
                     /db_xref="GeneID:34715374"
                     /translation="MSSSVSTSNIEVPFVKRFLEEINCEEHLDAFEKYKLLDEARIYY
                     LDREILEEIGVKEIGDKIKILKRSRQLRREASGFDPKKELIEITGKINALNSNPLSIN
                     EELVSDKHSVIFVLNDGSAKKVNVNGCFNANSIKKKLIKRLPPEFISIDPVTKEPVYS
                     SQDYDVFVVDYTKNVLHLLYDVELVTICHSSDRLEKNRLIFVAKDQTPSEKAIFTSKK
                     VYLKTLSVMQQMGSQHGTGRPLLSAPGNNALRIENRSDDIREIFTQRPPTELISTNLP
                     EYFPHTDINRLKKTLRNSMRQSIRASMIKGKNGSLVSLAGSNKIGDILVNQSQAVDRA
                     LLESIQNAPAVTQSNSHTGNNAVPLRTNSIGGSEGSTASLTSLMKRTSISSSGGRTAS
                     KPANAHRSRSTSGASDNTSRIELYNTDTDSEGDDDDAEDTISLPTKVEAPKSWLKGAR
                     IGSGSFGSVYLGMNAETGELMAVKQVKIQPAAVSAGVVPIAEDSKKAQSPGGTTAIKN
                     TSQIHRKMIDALQHEMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNN
                     YGPFDEPLVKNFTRQILIGLAYLHKRNIIHRDIKGANILIDIKGGVKITDFGISKKLS
                     PLNKQQNKRASLQGSVYWMAPEVVKQVVTTEKADIWSVGCVIVEMFTGKHPFPDFSQM
                     QAIFKIGTNITPEIPSWISEEAKSFLLKTFELDYRKRPSSLELLQDPWLNTVL"
     gene            <197962..>201036
                     /gene="PEP5"
                     /locus_tag="KLMA_30081"
                     /db_xref="GeneID:34715375"
     mRNA            <197962..>201036
                     /gene="PEP5"
                     /locus_tag="KLMA_30081"
                     /product="vacuolar membrane protein PEP5"
                     /transcript_id="XM_022818576.1"
                     /db_xref="GeneID:34715375"
     CDS             197962..201036
                     /gene="PEP5"
                     /locus_tag="KLMA_30081"
                     /codon_start=1
                     /product="vacuolar membrane protein PEP5"
                     /protein_id="XP_022675229.1"
                     /db_xref="GeneID:34715375"
                     /translation="MSLSTWRQFQLFESIPIKDPFIESENALYSDHTLTAIASLNETY
                     IAIAVQSSLIKIVDLHDMRVQFEFEAYTSEYQLTYLERVSDSFVLSVGECIGKPLVIK
                     LWNLEKMPTDERKYHAMAEVRNGSNSYPVSSISCSLHNSCIAVGFTDGHIILVRGDLL
                     RDRGSKYRIIYEDPNKEPITAVSLNNDARTLFATTTSKIMLFNTSGRNNGKPDMILND
                     TEGVDLKCGVMNKSTDEFICAMKNRLDIFMSSGGKRSLIVDIPHAKQIFPISEDSLLI
                     LMSNEPKSTLHLGNTSSETTRALILDTKNKIVSLTLLITSSVIDIFNDGASINLLTSD
                     GFIYKLKEKKLEDQIKTICQKEIYPVALKIAEQHSLPIVRIQEIRKLYADYLFKKGSK
                     REAIEQYMESLDVCDPTEIISKFGVEQKTNSDDSINLRDFLWTLVREGKAKVDHVTLL
                     LTLMIKLHDLKGLEFFISNYRRDGTFANEPETFGKWSMTDDSYFYSDKKLFDLDTVVR
                     LLLESDLLELAHKFVLKFSKDPVNVINIVLLQKKDALESLNYIKSLPVDDALRVLIKF
                     SKKLLDMIPNETNLLLIDLFTGKYQPSDYDAGKTNLKYKEGTAKEKNESEDSTPLVFY
                     NYHSFFEYMLPSSASGASNSDQASIHEPTYHPPKPNLIFSSFVQKPFEFVVFLEACLE
                     TYKRFQGYDQDRQEILTTLYDIYLSLSEDDIDERKPEWKSKAEAVLKESENRNLKPIS
                     GKDTDKSLMLLISHMHDMNPFTLSSVKDEEVPNSLISHVSLSDVFRSMCLTSHPKECL
                     TFLEQYGSKDHELYKVAMSHFISRKQIYDDIGGDDTFKEEVLNKVLEFDLMSPLDIIQ
                     TLSSTNVVKYGVIKEFLVNYLKTENAEIKKNEMLVESYQKELEQKKSKLKELIASESP
                     LQVKVKKRLCDGCTFLIDFPMVYFKCGHLYHQRCLNEESDSDLLYRCPQCVLETESGK
                     KIMESYKTSTQNPNLLRAALSDLEPKDDRFGIVTDFIGKGGLDDPNYFVLQS"
     gene            <201358..>203430
                     /gene="FUS2"
                     /locus_tag="KLMA_30082"
                     /db_xref="GeneID:34715376"
     mRNA            <201358..>203430
                     /gene="FUS2"
                     /locus_tag="KLMA_30082"
                     /product="nuclear fusion protein FUS2"
                     /transcript_id="XM_022818577.1"
                     /db_xref="GeneID:34715376"
     CDS             201358..203430
                     /gene="FUS2"
                     /locus_tag="KLMA_30082"
                     /codon_start=1
                     /product="nuclear fusion protein FUS2"
                     /protein_id="XP_022675230.1"
                     /db_xref="GeneID:34715376"
                     /translation="MIKSRYSVYQINYPSNNVVTPIRTCREDNYELPNFYKSKHNPYS
                     NSLWNTSTENREALNRIREKTANKRIREDRIESKVLSSAISETQSLVWDHETEPQAKK
                     SYSPLDVESFSQKLYLNSDRPDSKTLSFIITLQKLCESELQYFEMLSLCLSTYKTEAC
                     YNKKFKNKLFNTAKNDELLVFGNIDTMAELSKLFSRKLLENIEKCSGYPQNGKMWNEI
                     KSNDRICQDILKIDFASLIKSHLQRLKSTYHSYCLCHAERKMLLDSLKLQNTELFYKW
                     YELCLKKSQFEKLEDLLELPLERLGQWGSLFENLCLFGDNLLPEPQSAQLNLVSKEFI
                     SYLRELNDELNELGKPKDKFIRENSPPTEQPRHQNSESFQQPKPSSLPGSRHDSIPDL
                     SLPSSNCTSQAVSKSSSFYSDARSLKDRQNPMVPQNNIEDTSCNTEEHGVSLKQSMEQ
                     FNNLYTNLQKWDKALCKLELAKVLDRTLNTAIVWKNLIEFEPPNELFKPGNDDRTIYG
                     TYVEKIDKQRQQVMILQLQDLRRKVIKPLQLLIQRCSIVKQKLVDRKTLKKEYIDYIK
                     RQQIDKDTHDAKKEILANSFQKLHSQLTESLPTFNNYATKVVTMLVSQYTLLMMEYMK
                     ILSGGDQFLEKELQEAAASERKLGDNFDILQLFCSSRYYTRQAVRENWTAYGDPRASR
                     PARKLFEL"
     gene            <203655..>204275
                     /gene="RRS1"
                     /locus_tag="KLMA_30083"
                     /db_xref="GeneID:34715377"
     mRNA            <203655..>204275
                     /gene="RRS1"
                     /locus_tag="KLMA_30083"
                     /product="regulator of ribosome biosynthesis"
                     /transcript_id="XM_022818578.1"
                     /db_xref="GeneID:34715377"
     CDS             203655..204275
                     /gene="RRS1"
                     /locus_tag="KLMA_30083"
                     /codon_start=1
                     /product="regulator of ribosome biosynthesis"
                     /protein_id="XP_022675231.1"
                     /db_xref="GeneID:34715377"
                     /translation="MSVSKSKYSERPVTVEKAIPVTYDLGNLAVFDTNVLDKNALDSS
                     NATREETLKELTRDNVQLLVNQILSLPIKTTTESAGGSSGQSASMTLVQLPEPTTELP
                     REKPLPKPKAPTKWEQFAAKKGIKPKERQGKMIYDEARGEWVPKWGYKGSNKELDDQW
                     LVEVDDKVKGTEDELIDPRTLSRAERKRLVKKNELQHKRNLKNQLK"
     gene            <204597..>209860
                     /locus_tag="KLMA_30085"
                     /db_xref="GeneID:34715378"
     mRNA            join(<204597..204632,204769..205363,205707..>209860)
                     /locus_tag="KLMA_30085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818579.1"
                     /db_xref="GeneID:34715378"
     CDS             join(204597..204632,204769..205363,205707..209860)
                     /locus_tag="KLMA_30085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675232.1"
                     /db_xref="GeneID:34715378"
                     /translation="MAELDRYVPMIDAILSVSDPEEVSAKRIRKALQELFAVDLSVHK
                     HDLKDLIVSRFNRLQDLQSKTLKHEELIDLDSKLAAKLQSEEVSSLKRHRSGKKEKKV
                     KGKKEKKKKRKTSNENPNSIHVKNVGLSPALQKFLNAEQMPRTQVVKAVWDYIKANDL
                     QNPEDRREIICNDEMRPIFGDKMTMFSMNKILSKHLYKLQGTSEDPSETPERQSDKDK
                     AVGRVRNFMENLRVVSTSSTYSTSSCGEPFDVNSLDTTYSICDGVDEVYSEVLKVVVF
                     EYINEPRFRRKWKRVNVSTSNSDSQKLRAKSGNREVSNNRLSTWLSHADSDDEENDPS
                     GYNKESMKQMLKGLESKLTRVAMNQDVISDAMLRRSLLKFYNDVFLDSQFKQTLETMS
                     KPEDLIILFVKSANKELVKMETEDPKSNLFSQMGRFINILIEVSRDTKMGPTYAKRLN
                     DYKKSLKNTGVSSNNNVSVPNLPIGTTENVTASKLVDDTLQPTFRLDEITHVKALANI
                     FKVDELRLQRDVIRISPIVKNDLYLQELIEAERGIRNDESSLQPSDFPDSSQYEMWKQ
                     AQLKNIQDVRNKVKQGCAGHNESGARTKLTDDTRLIPADPRRILRSLMYYIFENDFSL
                     QSSEQNKSISLDSKFFLSKCAKYWLLSYQSGIFTNAVSGCLHIVPDLEFAESLKMIQY
                     VFNFMETRLSNENEQELDPMLWNRYDQDQWTCNQVAIFTWLINQMDKSIKGMFNNKAN
                     GDFNLKSIISTYSALVENDSVLISRNFQKSEIYKRQIHSLKKTTFRTIEKRYIELIRN
                     VPTNNEISIRNLYDLADAILNDVAMIEMKYKPLKKLSARYKFVHIVTNTFVTALFRDL
                     KVLMQRIKKYNKPNESDALDTYKLLNELRYKNSIESGSDSNVGNALEVEFYEYLLTFC
                     EHISETMKQGCERIVSQEEWVPMNKEAEQWLSQSAYDIARLISDTLRLVDNLQWNDFA
                     QLARAYNIILGKVSECIVHYTKTMEEIVTEDLSMGSGIDGNGELNSGNMSLFKEMKSM
                     IQSSKLWNKQWKHEVQKEETPTSGRSSSATTGNGSSGTYVISMRSCVCLNNMESLIVM
                     LNDIEKTFHMKQLSNALRADVAAKATNGSSSSVNERRTNKQLLSLIKGQLWSIVPVAA
                     EGVPQVESGQEDPWYSISIVDTAKRREIYRTRAAGSPRWWEDEEFDLELEPQQKMSLC
                     LVLWQDKQDKKNRMRMSGTHSHDHDNGKKKNTETPVGRCYLDLDIPRDMYGTNANSNN
                     NNSEREMYLSLSLDTQGYIHVKVSIEVERAEPDCIIGRTRRIVARTLTRGLKQVSHRF
                     EPCIHRSFSKETLSALMNHVNGRSRRPEDDAIYDSLVPLFDDLNENLTVLAQALPTSL
                     LHEVMLLVWHEIIVAADDLLLPQLQQALQHASMSAASNAHKNNNNNLTVPGSVWDSAI
                     SGFQKVLQTKPLSPNASGGSNTSINMNNRSHNAISQLEVEIVLMWMDILSKDFFHNNG
                     EGPPLAELKNDAYQNLMLIASMFDQPTPDLKATVLQTKDQSASSSSASAYSLRLPLQM
                     AIALRILWSRGEYHFVSKFLESRAREIRAAVAMSKITLNDKK"
     gene            <210289..>211155
                     /gene="mug14"
                     /locus_tag="KLMA_30086"
                     /db_xref="GeneID:34715379"
     mRNA            <210289..>211155
                     /gene="mug14"
                     /locus_tag="KLMA_30086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818580.1"
                     /db_xref="GeneID:34715379"
     CDS             210289..211155
                     /gene="mug14"
                     /locus_tag="KLMA_30086"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675233.1"
                     /db_xref="GeneID:34715379"
                     /translation="MSTTNTEVHTEEVGKLSTRTQGVHNLSTGGFKYRNLRPEFKDKY
                     EERRHTLEHMAGVFRVFGRRGYGEGAAGHVSVRDPVDRNTFWINPLGVHFSQIKVSDL
                     VHVDENCNILPDGNQVAINAAGFKIHSHLHKARPDVNAACHTHSTYGKAWSTFGRPLE
                     MLNQDVCMFYKKHTVYESFGGVVLEDEEGERLSQALGDNKAIILQNHGLLTVGETVDE
                     AGYLFTLMEKCCEVQLLVEAAARSGLEKKIIGDEEAYYTYFNTSDPETLYTEFQLDYN
                     LELELTKGAFLE"
     gene            <211393..>212499
                     /gene="RNH1"
                     /locus_tag="KLMA_30087"
                     /db_xref="GeneID:34715380"
     mRNA            <211393..>212499
                     /gene="RNH1"
                     /locus_tag="KLMA_30087"
                     /product="ribonuclease H"
                     /transcript_id="XM_022818581.1"
                     /db_xref="GeneID:34715380"
     CDS             211393..212499
                     /gene="RNH1"
                     /locus_tag="KLMA_30087"
                     /codon_start=1
                     /product="ribonuclease H"
                     /protein_id="XP_022675234.1"
                     /db_xref="GeneID:34715380"
                     /translation="MAKKAYYAVARGRQTGIFSTWAECEAAVRKYPNAKFKKFESSSE
                     ATQFVRGNSNGNGQSHGPAQGQGTASRPPSSGYNNRPSSGGVKKPSSTYNNRAPTSYK
                     STAGPSFYAVRSNNPDAPSRVFTNWTDCQAYVRGKRHMSFKKFPTKEQATAFSTGQAS
                     LQTTYAHMNTTESEFINQYKIPQQAAPAVKVAPNPSHVYCDGSSLSNGSGRARAGYGV
                     YFENENIRIAKPLTSGPQTNNRAELTAVHEALDHIWNELESNSSSSSSSEVNVKKYTI
                     HTDSEYVVKLLNDYSKHSTPQQLKAAPNGDIVAPLVQTYNKVKQYYDVNKDVLGLGAE
                     DGLQVDWVKGHAGVPGNEVADQLAREGAARGIHS"
     gene            <213476..>215581
                     /gene="FAA1"
                     /locus_tag="KLMA_30088"
                     /db_xref="GeneID:34715381"
     mRNA            <213476..>215581
                     /gene="FAA1"
                     /locus_tag="KLMA_30088"
                     /product="long-chain-fatty-acid--CoA ligase 1"
                     /transcript_id="XM_022818582.1"
                     /db_xref="GeneID:34715381"
     CDS             213476..215581
                     /gene="FAA1"
                     /locus_tag="KLMA_30088"
                     /codon_start=1
                     /product="long-chain-fatty-acid--CoA ligase 1"
                     /protein_id="XP_022675235.1"
                     /db_xref="GeneID:34715381"
                     /translation="MVAQYSVPVGKAANEHETAPRRNAKAKNGPVTKPDGMKCTTVYE
                     FVVECFEKYGGRHGMGWRDTIDVHREKKKIMKKIDGKETEVEKEWLYYELTGYKYSSY
                     SELNEIMHDYGRGLVKMGLKPHSEDKVHLFASTSHRWMKTFLATQSQAIPVVTAYDTL
                     GENGLIHSMVQTDTRAMFVDNALLSKLYNAVQKATNLKYIIHSEPIDPNDKRDEGRLY
                     KEAADAVAKLKEIRPDLEIYSMDEIIEKGKAAKGEIEPNPPTPEDLSCIMYTSGSTGD
                     PKGVVLKHYNIVAGLGGISSIVTNRPEHVSVNDRVIAFLPLAHIFELAFELITFYWGA
                     TLGYANVKTLTDMSVRNCQGDMKEFQPTIMVGVAAVWESVRKGIIAQVNKLPALTQKV
                     FWAGYSAKIKMKKYHIPGGDTLGNVLFKKVREATGGHLRLVLNGGSPLSRDAQEFITN
                     LICPMLIGYGLTETMANTTILAPEHFEYEIAGDLLCSITVKLVDVEELGYFAKNNQGE
                     VWIKGAPVLTEYYKNEAETKASITEDGWFKTGDIAEWTPKGQLKVIDRKKNLVKTMNG
                     EYIALEKLESIYRSSPYVHNICVYADQTKVKPVGIIVPNEAAVAEKAIKLGLLEKGED
                     VTHLYHDDKLRHEILSDLWKTARSQGLNGIELIQGIVIFEEEWTPQNGYVTSAQKLQR
                     KKILAAVQKDVDSLYANSN"
     gene            complement(<216588..>217889)
                     /gene="CLD1"
                     /locus_tag="KLMA_30089"
                     /db_xref="GeneID:34715382"
     mRNA            complement(<216588..>217889)
                     /gene="CLD1"
                     /locus_tag="KLMA_30089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818583.1"
                     /db_xref="GeneID:34715382"
     CDS             complement(216588..217889)
                     /gene="CLD1"
                     /locus_tag="KLMA_30089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675236.1"
                     /db_xref="GeneID:34715382"
                     /translation="MSSRSSSSQLWNTLRRYTEITGVINRFRKDHAIGSSFSNSGSNS
                     NEQINVRTNRKSTAPTALPLMQIITNLHRLFPLSFSRSFEDFHQFTVNKEVFQENLLS
                     VLPYYPVSSSRYTAKVIRTPVGDSGNYINEFQITPVRASHGESMAPDGTPLKHIILVH
                     GYGAGLGFFIKNFNALLSENVVIHAIDLPGYGFSSRPKFPFSYPKDSYLAVENYFHDM
                     LHQWFEQKGLTRSWESNFVVAHSMGAYIFALYANKYKHFRKLVMCSPGGVSRNESMPS
                     PPWWFVKMWDKNISPFSLVRNSGRLGSKLVSGWSSRRFGLDHPHFEKIHRYTYGIFNQ
                     PGSGEYMLSFMLGCGGWPRVPLESRLFTDKNFKCGHLDWLWLYGDGDWMDVNGGRRIN
                     EFLKKNNIKSSLAVVPDAGHHLYWDNDSFFNDIVKREIIKN"
     gene            complement(<218298..>220220)
                     /gene="MUB1"
                     /locus_tag="KLMA_30090"
                     /db_xref="GeneID:34715383"
     mRNA            complement(<218298..>220220)
                     /gene="MUB1"
                     /locus_tag="KLMA_30090"
                     /product="MYND-type zinc finger protein MUB1"
                     /transcript_id="XM_022818586.1"
                     /db_xref="GeneID:34715383"
     CDS             complement(218298..220220)
                     /gene="MUB1"
                     /locus_tag="KLMA_30090"
                     /codon_start=1
                     /product="MYND-type zinc finger protein MUB1"
                     /protein_id="XP_022675237.1"
                     /db_xref="GeneID:34715383"
                     /translation="MREANYRSVTANRATVIISQTVYDRRALDNVADLPLINSLNHLA
                     ALCSNSELIREAISQDGALERLVSILHECYIPLANLPQNTLNQNLNPLQTVKRDRQLA
                     YLSWKWTLAYQCLVLTGTRGTPYMREQVVKSGIIPIIATVLDNYMIYAKNFDFINNTP
                     IPFTFSELVDMDSDLFQLTEEELQTLNEMVDPSDPYYKEYMAMEKLKLLVGQAGNQFG
                     FDLENVAGLHLKPNVVTELDTDWQSMAQEELCVPLPGSALENVLIMPPRRFFLGKMIP
                     ELDDVTWAVQLLAFLTKNTAVKPVLQKTTLVDSLSFRPILENAKRRMSRTMELDMTPL
                     SLHAEASDEGEDGEEEEEEDDDSEEPPEDRMDLSPDVTLIGKYFKEIEHLFVTKQKEH
                     EEEEIYTEKVDDILSVRIKKEEVLRENFKQYCQQQEECSRELTSEDWNRIFNYDTINL
                     FALVERFTVKGSLNGMVNYWSSVIMRNSCRKHEATGVRQCANLNCGKWEDHPKQFPKC
                     RRCKRTKYCSRLCQLESWDYHRFWCQESHSNTTAGTPTSAGNNAPSTSADADNDADAD
                     TNTATPTGSHTPLATSAGSEAETDPAQILNDQVNPRPQEATTIPPTSAASDIATNDAV
                     TAPTTATGLAPGARTP"
     gene            <220566..>221183
                     /gene="VPH2"
                     /locus_tag="KLMA_30091"
                     /db_xref="GeneID:34715384"
     mRNA            <220566..>221183
                     /gene="VPH2"
                     /locus_tag="KLMA_30091"
                     /product="vacuolar ATPase assembly integral membrane
                     protein VPH2"
                     /transcript_id="XM_022818587.1"
                     /db_xref="GeneID:34715384"
     CDS             220566..221183
                     /gene="VPH2"
                     /locus_tag="KLMA_30091"
                     /codon_start=1
                     /product="vacuolar ATPase assembly integral membrane
                     protein VPH2"
                     /protein_id="XP_022675238.1"
                     /db_xref="GeneID:34715384"
                     /translation="MFDIAIGHGLLRQKLEELKEDRRASVSLQQEVVSFEVLAELYEQ
                     YWGDDTNINLEKLLASSDLRFKRKRVPGEEYTEEFKAELEKLRWVQKEQEYQDMIRRD
                     SLVPAGTLNEHDPTISEINKEIKEQVAAVFNVLLTVFGTVYAVWYVTRSGWDIHIRII
                     LCLFSGILVLIADAAMYNVYYRKIEEARALERKKKVVKKVIKRLI"
     gene            complement(<221478..>222641)
                     /gene="SRT1"
                     /locus_tag="KLMA_30092"
                     /db_xref="GeneID:34715385"
     mRNA            complement(<221478..>222641)
                     /gene="SRT1"
                     /locus_tag="KLMA_30092"
                     /product="putative dehydrodolichyl diphosphate synthetase"
                     /transcript_id="XM_022818588.1"
                     /db_xref="GeneID:34715385"
     CDS             complement(221478..222641)
                     /gene="SRT1"
                     /locus_tag="KLMA_30092"
                     /codon_start=1
                     /product="putative dehydrodolichyl diphosphate synthetase"
                     /protein_id="XP_022675239.1"
                     /db_xref="GeneID:34715385"
                     /translation="MTLSHFWPTKEQVEQLEVPAYDEEVAADLYEQNEGYLAKISTSS
                     LHHARQQLSRLRVKTSVLTRFVAWFQTFMLAVLSYGPTPQHLSFIMDGNRRYAKRLGQ
                     PVKEGHKAGGAKLIDILYICKRLNVNSVSAYAFSIENFNRSPAEVDTLMGLLGYYIDQ
                     FTQRATDARDDLYGIKLKIAGDMSYLSGDLVAKIRKAEELTRNGTQFTLYLALPYTSR
                     NDIAHAMKVSVENCVNSNADITEEALTQNMYFEKHSDKCDLLIRTSGHTRLSDYMLWQ
                     VHENGILEFSDCLWPDYGFWRLYFTMLKWSFYNTWQQASLNWDNEQQQKEYSNNNNNN
                     NASGGGKHNNNSSWFPALSDLMPGPVSAFRKTKGISLESLPPAPLAVTVVDRK"
     gene            complement(<223116..>224075)
                     /gene="OAC1"
                     /locus_tag="KLMA_30093"
                     /db_xref="GeneID:34715386"
     mRNA            complement(<223116..>224075)
                     /gene="OAC1"
                     /locus_tag="KLMA_30093"
                     /product="mitochondrial oxaloacetate transport protein"
                     /transcript_id="XM_022818589.1"
                     /db_xref="GeneID:34715386"
     CDS             complement(223116..224075)
                     /gene="OAC1"
                     /locus_tag="KLMA_30093"
                     /codon_start=1
                     /product="mitochondrial oxaloacetate transport protein"
                     /protein_id="XP_022675240.1"
                     /db_xref="GeneID:34715386"
                     /translation="MSEPKEEKHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDTV
                     KTRMQLQGEMHAGAAKVYTNPIQAVGVIFKNEGMRGLQKGLSSAYIYQIALNGSRLGF
                     YEPIRRLLNNTFYPNIESHKVQNIGINVVAGASSGIIGAVVGSPLFLIKTRMQSYSNA
                     IHIGQQTHYTSVFNGLSTIFRNEGFKGLYRGVDAAILRTGVGSSVQLPIYNICKNFFL
                     KNDILNDGTALHLLSSTISGFGVAVVMNPWDVVLTRVYNQKGNLYKGPIDCFVKTVKA
                     EGFSALYKGFGAQILRIGPHTILCLTFLEQTMKLVYAVESRFA"
     gene            complement(<224942..>227530)
                     /locus_tag="KLMA_30094"
                     /db_xref="GeneID:34715387"
     mRNA            complement(<224942..>227530)
                     /locus_tag="KLMA_30094"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818590.1"
                     /db_xref="GeneID:34715387"
     CDS             complement(224942..227530)
                     /locus_tag="KLMA_30094"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675241.1"
                     /db_xref="GeneID:34715387"
                     /translation="MSMGEYPDVWNEAESGSKIDWLELASDEAFKRHVKEGEHIKVYR
                     KKKRGFKQFRRLILAQELCSSGEEGAVWCLRFSKDGKFMASAGKDEVLRVWKVISSPS
                     ERLEMNQRSISFLKSTTNAISELNGRLARYTVGDPGSGDSYSLNSNSSLQAESLGSAS
                     IRGAPSSKQQQQQHQQQHPHLHQRSDGHAPIQNSAGVDGSYFGVFHPKPYASFHEHSD
                     DILDVDWSKNSFIITGSMDKSCKLWHCERETSLHTFVHPDFVTGVRFFPLDDRFFVSA
                     CLDQKCRLWSILDKKVLFEYDCGDLITAMDISHDGRYTILGTFNGHIHVLVTKSLELL
                     FSFNVLDKNSELNSHTDENGNSYDSNANGSHGHGSKFKRKLKNRRKLKQGPKITGLEF
                     IRKEYRNSTIKNHDISSWFLVSSNDSRIRIYTLGKELLSIMKGHSNEHSQITAHSLVT
                     RGGKAFVVSASEDHWIYCWKISDESSDKEELSSKDEKGRRSRSGSLRGFCKRRHNDHT
                     PLDTLESRLAGKGHKNNQPNTNSNYIGFHAHHHPITCATMVPSQTSKVLSLSNDLICE
                     LTMQFWETTDDITAGDDSKRSNGTSSRAKRSGSFYRETIKNDSNGGSSRSTPQMTASS
                     SLQHLNVDAYPGSGANGVNGGGNDNNAKNQPTLSEFVGSILVSADTTGVIRVFRSDIS
                     SNVRQKVLARLAAVEAQMRNSHIPMNATSVPMTKGGSHHGAPHPPGYGLISSNGNTSL
                     NGNEGLGISKIPTNGMNGGGAAGSMGNGNGVASGVHRSNSMLNGIVYIERPTPFPAQG
                     SPNIGREESMVSLSTLQQKSPRARVCNVCGGTNFAADQKAGFSKSPQNMRYFCLDCGA
                     LYTSFR"
     gene            <227934..>228395
                     /locus_tag="KLMA_30095"
                     /db_xref="GeneID:34715388"
     mRNA            <227934..>228395
                     /locus_tag="KLMA_30095"
                     /product="signal recognition particle subunit SRP21"
                     /transcript_id="XM_022818591.1"
                     /db_xref="GeneID:34715388"
     CDS             227934..228395
                     /locus_tag="KLMA_30095"
                     /codon_start=1
                     /product="signal recognition particle subunit SRP21"
                     /protein_id="XP_022675242.1"
                     /db_xref="GeneID:34715388"
                     /translation="MGGFDLDTFITSSLKVLETNGSGTNVVMKYKPGKKRSVVKFRTK
                     NDRLGLSYGFKTRDAKEVSRGLSAMGPTGVSLPLGRVGKRVYKKKVLDLPGMSTLMVN
                     RKVKKAPEQVAAAPAAASKSHEGGKAASKTSTTAPAGGKGGKKKSKKKSKK"
     gene            complement(<228483..>230183)
                     /gene="SSH4"
                     /locus_tag="KLMA_30096"
                     /db_xref="GeneID:34715389"
     mRNA            complement(<228483..>230183)
                     /gene="SSH4"
                     /locus_tag="KLMA_30096"
                     /product="protein SSH4"
                     /transcript_id="XM_022818592.1"
                     /db_xref="GeneID:34715389"
     CDS             complement(228483..230183)
                     /gene="SSH4"
                     /locus_tag="KLMA_30096"
                     /codon_start=1
                     /product="protein SSH4"
                     /protein_id="XP_022675243.1"
                     /db_xref="GeneID:34715389"
                     /translation="MGLMMMMKEGEVNAGNSDDYFRVPDDIPADDAFSLMFLISLSIT
                     FGLLLLVLILISVYLTFCGGSDAADSDEEDEGSGSVSFKFFRKGNSLLLDSSFMTPGK
                     FDDEQALLEQEAEELPRMSRFEVELYERTKEFQKMSPPMVKPFGTFLNSQDKQMIKER
                     GIQSYFFLPSINDNVDRNGSFLPSFFVEDKLNVTFTKFNVSSSAIMNYPLPMNRKDAV
                     YFEVKVYKFKPCSNSIFSIGLMTCPYPYFRIPGTAIYSIAYESTGKLRINNAFRADTL
                     LPKLEEGDVVGFGYRYSSGTIFITHNGKKMMDVTHRVGIDLFVGIGAMNAAYTRTYTK
                     DGLFEDPDNVSFRQKWTDVTSSNVGGGSSSSGSQGASHISDVINPQLLEVHDPKDSPV
                     SSDPIELHVNLGQLGFVFIEANVKKYAFGSVYGDIGIPPAYNGDDIKQDMLLQKGEEL
                     PPEYPDDEVDFFGGVREHTTESRAAAGSAAGSEARIGVGFGNEAEASASTDQGASTDT
                     PGTVSETAPEAAPEAAPETAPSTAPETAPETSPVTTRKTTPAKKKNKKRKRKNKGSRR
                     "
     gene            complement(<230695..>232611)
                     /gene="RRN3"
                     /locus_tag="KLMA_30097"
                     /db_xref="GeneID:34715390"
     mRNA            complement(<230695..>232611)
                     /gene="RRN3"
                     /locus_tag="KLMA_30097"
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN3"
                     /transcript_id="XM_022818593.1"
                     /db_xref="GeneID:34715390"
     CDS             complement(230695..232611)
                     /gene="RRN3"
                     /locus_tag="KLMA_30097"
                     /codon_start=1
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN3"
                     /protein_id="XP_022675244.1"
                     /db_xref="GeneID:34715390"
                     /translation="MVVDNKQKRQCTAETAGDASKKKRKVEFDIAPQAQDLQGGSEGD
                     SKFAMEMFESFVIRALKDLDNGECSGMESLAMQVSLPATDADRISVEKLTVLLRLLGN
                     NISKIDNSKSGASMIRSIINFEKWWELPGPALSSYISFIRILCSSLPKWWQDVSMALI
                     SNFALSPGKTVQHHEMLKYFLKTIPSSIHFIDTYIGKFFPNKNDSKKVLLNFISNVLA
                     LTEYCHELRFQAWSLVIEKVISIDVELQNELDELDEDIDDDTGDDDDDDDDDDDDDDD
                     DDDEDEDEQEEATERVNDDADDDMDEDMDDDEDLGDSDDDEAEVEVDGDEVYYVDLSH
                     NIKELSSKLDEILSVITSKLSCALTPESLEEGDGVNIFNTLTSLFKSHILPTYYTRSV
                     QYLMFHVSQQQPELMDAFLVTLIDISFSPTETMEKKIKSLQYIGSFIARAKKMTRTQI
                     VFVTSYLTSWLNRYVLEREEEVDQPGGMERFKHFYAVFQAICYIFCFRHSLLRDGDDA
                     WECELDKFFQRLVISKFNPLKYCNENVMMMFAKIAQHEGVVYCFSIIENNNNERLRGI
                     TGKATESGGGSSVNGSWSLATRQQFIDLQSYFPYDPLFLTNYKTMMKDYYIEWTEVSK
                     GYDSDVSEELDESP"
     gene            complement(<233218..>235521)
                     /gene="YPK1"
                     /locus_tag="KLMA_30098"
                     /db_xref="GeneID:34715391"
     mRNA            complement(<233218..>235521)
                     /gene="YPK1"
                     /locus_tag="KLMA_30098"
                     /product="serine/threonine-protein kinase YPK1"
                     /transcript_id="XM_022818594.1"
                     /db_xref="GeneID:34715391"
     CDS             complement(233218..235521)
                     /gene="YPK1"
                     /locus_tag="KLMA_30098"
                     /codon_start=1
                     /product="serine/threonine-protein kinase YPK1"
                     /protein_id="XP_022675245.1"
                     /db_xref="GeneID:34715391"
                     /translation="MYSWKLSSKFRFGRSKEKDEKHHQKHLEELEQDANDTRSSVDRK
                     ATIVPGSATVVQSRASTDTRATSDDNSTMSQGYPQGYPQGQGYGPGSGSGHASGHGTG
                     TFTEGSSSTDVSRESVTVSGAQDLESGDSHFSENAAPNGATGTSTNGHTNGMSSFQQQ
                     QQNLLQQQRQQEALAQQQQENTAAAAASAMADSATSPPLTTHSSNGILTVKIYCGDAF
                     KLPLPIAYNEQVLSKLLSSGVDVTSTTQQESLEELIQSMHGLSLLKQDESKLLSGDDA
                     SQFIPASVILPGSKNRNSLLYFTIEFDNTIATIEPESGTLNRPIFNKISTFDVTRRLP
                     YLKIDVFARIPSILLPSQNWQETQAAQDPVLSDYVQKIKSNNDIHLDSFQLPLNLKID
                     SASNIRLYNHQWIDLDAKMGKLNISVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQV
                     RKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYL
                     VLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALETLHDFDIIYRDLKPENILLDY
                     QGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEM
                     LTGLPPYYDEDVPKMYKKILQDPLRFPDNFDKDAKDLLIGLLCRDPKRRLGYHGSDEI
                     KSHPFFHQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREKPVDSVVNEFLSESV
                     QQQFGGWTYVGSEQLGQSMLPDKSFQT"
     gene            complement(<235965..>237665)
                     /gene="PGM2"
                     /locus_tag="KLMA_30099"
                     /db_xref="GeneID:34715392"
     mRNA            complement(<235965..>237665)
                     /gene="PGM2"
                     /locus_tag="KLMA_30099"
                     /product="phosphoglucomutase-2"
                     /transcript_id="XM_022818595.1"
                     /db_xref="GeneID:34715392"
     CDS             complement(235965..237665)
                     /gene="PGM2"
                     /locus_tag="KLMA_30099"
                     /codon_start=1
                     /product="phosphoglucomutase-2"
                     /protein_id="XP_022675246.1"
                     /db_xref="GeneID:34715392"
                     /translation="MNTVNIPTKPYQDQKPGTSGLRKKTKVFMEQPHYTENFIQAIME
                     AIPEGSQGATLVIGGDGRYYNDKVVQLIAAIGSANGVRKLIIGHNGILSTPAASNVIR
                     TYHEKCTGGIILTASHNPGGPTNDFGIKYNLANGGPAPESVTNKIWEQSKQLTSYKIV
                     ENFPQLDLSKLGENQKYGDLLVDVIDSTAAYTQLMKRIFDFPLIKQFLDSQTEKGFKV
                     LFDALNGVTGPYGKALFVDELGLPESVLQNCTPKPDFGGLHPDPNLTYAHTLVERVDR
                     EGVQFGAASDGDGDRNMIYGAGPAFVSPGDSVAIIAEYASEIPYFKEQGIYGLARSFP
                     TSAAIDRVAKAHGLSCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWA
                     IVAWLNILAIYNKHHPEKEASIKAIQTEFWHKYGRTFFTRYDYEHLTSEDAGKVIELL
                     REYVAEPEKLKGTKFPGNESLTVVEGGDFSYTDLDGSVSSHQGLYVKLSNGVRFVVRL
                     SGTGSAGATIRLYVERYTDDESKYEQTAEQFLGADIKAVIKFLKLKEYIGTEEPTVRT
                     "
     gene            complement(<238030..>239910)
                     /gene="YKU80"
                     /locus_tag="KLMA_30100"
                     /db_xref="GeneID:34715393"
     mRNA            complement(<238030..>239910)
                     /gene="YKU80"
                     /locus_tag="KLMA_30100"
                     /product="ATP-dependent DNA helicase II subunit 2"
                     /transcript_id="XM_022818597.1"
                     /db_xref="GeneID:34715393"
     CDS             complement(238030..239910)
                     /gene="YKU80"
                     /locus_tag="KLMA_30100"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase II subunit 2"
                     /protein_id="XP_022675247.1"
                     /db_xref="GeneID:34715393"
                     /translation="MSQLTAFLIDVAAGNSPLATRETTTQCLSYLEYTLLNKAHAQRK
                     TDYVQVALANLSSNDPDRDPALPVNMAMLAGPQPRPLISVKDVGEWVGRVSRHLERPR
                     NPRNPKDEQDEETDVSSSLFNALLVLVLQLKEFVGKRKMRVRIVVFTGDTFQDVSSDE
                     LETFDQQCPFEVVLVSPSALPSALPKAETNDSGAKALSKAVSLSHGLLFSTQQMISAI
                     ADPRPKLVRPVRIFEGQLRLGDPQLPESLCINVEAYPGTKQVSLESRRVLHRVGEQGL
                     YEYKPVKSVVEYYTGPNSDDTGATISSQYVSKAHRYGSDYVSLPQMLEEKRQFHASPG
                     IDIRGFLDMDKLERRYLCSESVYVVAGSTSRADYVGFCSLVDALAKQRRTVLARWVPK
                     SGSEAQMCVLAPARGSNGERVLVMSRLAMAEEERGFSGAAASSEAAASDEAAGSDLLM
                     ERFVEGMTMQGGSSSSPGSSPGPGIIQRYADMAVDTGVPLPMDQTSGKSGQKSGGQNP
                     GQGFDLPPAIPLHLQRWAILHKVHTNYISQYLGLAPGIEPGLEPGSDSTLLSHRTPPM
                     SPAVTRTFTPHHGPLELSHQLKSHLGVEKQPERRPTESPDTPSTPQDPELLDLEALLG
                     GA"
     gene            <240279..>240584
                     /gene="SPG4"
                     /locus_tag="KLMA_30101"
                     /db_xref="GeneID:34715394"
     mRNA            <240279..>240584
                     /gene="SPG4"
                     /locus_tag="KLMA_30101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818598.1"
                     /db_xref="GeneID:34715394"
     CDS             240279..240584
                     /gene="SPG4"
                     /locus_tag="KLMA_30101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675248.1"
                     /db_xref="GeneID:34715394"
                     /translation="MSKFFEAFEVYNRNKHAPGDAKSRGGNHSNIGTGNTTYMFAREY
                     RGPNKVQAVPRSQEDGQAQAQPQMVDVSKLSREEFEAMYYKMHPETPRGEPNNKVNF"
     gene            <240784..>241791
                     /gene="PMU1"
                     /locus_tag="KLMA_30102"
                     /db_xref="GeneID:34715395"
     mRNA            <240784..>241791
                     /gene="PMU1"
                     /locus_tag="KLMA_30102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818599.1"
                     /db_xref="GeneID:34715395"
     CDS             240784..241791
                     /gene="PMU1"
                     /locus_tag="KLMA_30102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675249.1"
                     /db_xref="GeneID:34715395"
                     /translation="MPTFKAVPEYFDIPGQGLGVSQGESMSNCPAPGQGLVQTLEQAL
                     ANPSHKLLVLCRHGQGHHNVCESTFGTEKWESQVALQPTFGSIVLEDAHLTDLGMQQV
                     RDAGTNLLAPLVQTLGWPERMYCSPMRRCIETFMESWGAVVECSSSASSSASSSASPE
                     VEDEQSTGELPHDIVKTWIMGQGSGPSPDPDQLASQCVVTAHVSETFRETLGRHYCDK
                     RVSHSETIGQYGTRTLVLPAPKSSPTLHVSWQYPNNPPMDEEDTMWSPTHRETDDEID
                     ARIGPGLNEILSGPERYISLTCHSGVIHSALRVLGHPPLRQLLTGGVVFVVVTPEPCA
                     V"
     gene            <242458..>244434
                     /gene="dur3-1"
                     /locus_tag="KLMA_30103"
                     /db_xref="GeneID:34715396"
     mRNA            join(<242458..243806,243954..>244434)
                     /gene="dur3-1"
                     /locus_tag="KLMA_30103"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818600.1"
                     /db_xref="GeneID:34715396"
     CDS             join(242458..243806,243954..244434)
                     /gene="dur3-1"
                     /locus_tag="KLMA_30103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675250.1"
                     /db_xref="GeneID:34715396"
                     /translation="MSKYLHEDSQSTENFMVANRNIGVGLTGSVVFSSWYWATEILWV
                     VTMVYSYGIMSSFWYFAGLSVQICVMSLLGIQAKKKIPNGHTCLEIIELRYGKPSHLL
                     YMFMCLVNNLLSASEMILGAAAAISIVSGNLNIVASTMLIPFGVMCYTVVGGLKATFL
                     TDYLHSLVALIILVYFNTAVISSDKIGGISGLYNKVIKHELEQPDSYIQGNYKGSFLT
                     GKSQGAIYFGIINCVGNFGLTVMDSSFWQKAFSANIRASVPGYLIAAALIPAVVWPLG
                     TIVGLANVVLEKESFFPTYPRQMNDNEINNGFGLPYTLMAVLGKKSLGALLLTIYLAV
                     TSTVSAQMIAVSSIISFDIYRQYFNSSATNSQLIKVSHIGVIFFGLFSAGFTVMLHYV
                     GVDMTWMGYFTSMINCPGVVPLTLAILWDRQTKLAAIVSPIVGCIAGLAVWLGTAYKL
                     ANLIVGGPTLETSLEGSLEEPSKEKSKEASKEASKDDGIVQITEWPSDDDNNSSTTPS
                     QVKTQRIADFYTKVAAGSVVFVTLVTWVLWPLPLYRDYVFSMAFFTGWTVVAIFWVYL
                     ALIMIGLFPLWDGRESLMKVVRGVIGSIADSIARPIARPRPGN"
     gene            <245344..>247446
                     /gene="ILV2"
                     /locus_tag="KLMA_30105"
                     /db_xref="GeneID:34715397"
     mRNA            <245344..>247446
                     /gene="ILV2"
                     /locus_tag="KLMA_30105"
                     /product="acetolactate synthase"
                     /transcript_id="XM_022818601.1"
                     /db_xref="GeneID:34715397"
     CDS             245344..247446
                     /gene="ILV2"
                     /locus_tag="KLMA_30105"
                     /codon_start=1
                     /product="acetolactate synthase"
                     /protein_id="XP_022675251.1"
                     /db_xref="GeneID:34715397"
                     /translation="MLAGRIASQRSARIHSIHKLYKHSRCIAMIGGARAPPIHMVPTG
                     TRSAASAAAVSSAETSNEQPARPQPAPSFNIPSLKNRTTTNSNSKDKHGLAQMDDSFI
                     GMTGGEIFHEMMQRHNVDTVFGYPGGAILPVYDAIYNSDKFKFVLPRHEQGAGHMAEG
                     YARASGKPGVVLVTSGPGATNVVTPMADALADGVPLVVFTGQVATSAIGTDAFQEADV
                     VGISRSCTKWNVMVRSIEELPRRINEAFEIATSGRPGPVLVDLPKDVTAAVLRNPIPM
                     KSILPSDTLNQLTQRVVDEYTLQNIGRAAELINKAKKPLLYVGAGILGHSKGPQFLKQ
                     LSDRAQIPVTTTLQGLGAFDQEDPKSLDMVGMHGNAAANLAIQNADLIIALGARFDDR
                     VTLNISKFAPEARKAALEKRGGIVHFEISPKNINKVVEAEVAVEGDVTHNLEKLLPLI
                     ETVPERPEWSAQVQEWKQKYPYSYQRETPGSKIKPQTVISKLSKLVNSTGKPAIVTTG
                     VGQHQMWAAQQWTWKSPRTFITSGGLGTMGYGLPAAIGAQVARPDAIVIDIDGDASFN
                     MTLMELSSAVQARTPIKILLLNNEEQGMVTQWQSLFYEHRYSHTHQLNPDFVKLAEAM
                     GLKALRLSDQKDTDAVLKQFIDYNDGPILLEVQVEKKVPVLPMVPTGKGLHEFINFDP
                     EEEKKQNELRHKRTNGKH"
     gene            <247951..>251739
                     /gene="MYO1"
                     /locus_tag="KLMA_30106"
                     /db_xref="GeneID:34715398"
     mRNA            <247951..>251739
                     /gene="MYO1"
                     /locus_tag="KLMA_30106"
                     /product="myosin-1"
                     /transcript_id="XM_022818602.1"
                     /db_xref="GeneID:34715398"
     CDS             247951..251739
                     /gene="MYO1"
                     /locus_tag="KLMA_30106"
                     /codon_start=1
                     /product="myosin-1"
                     /protein_id="XP_022675252.1"
                     /db_xref="GeneID:34715398"
                     /translation="MAIIRRAKNKQAPQKRADATIKKATFDATKKKEVGVSDLTLLSS
                     ISDDAINQNLKKRFENGTIYTYIGHVLISVNPFRDLGIYTDAVLQSYKGKNRLEVPPH
                     VFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASDTHEASIGKIKD
                     MVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNEQFEPCAGQITNYLLEKQRVVGQ
                     IKNERNFHIFYQFTKGASDTYRQNFGVLQPDQYVYTSASGCTSVDTIDDLDDFKETLK
                     AMDVIGLSQDEQDQIFRMLSAILWIGNISFIENDEGNAQVRDTSVTDFVAYLLQVDAS
                     LLIKCLVERVMETGHGARRGSVYHVPLNVVQANAVRDALAKAVYSNLFDWIVDRVNVS
                     LKAFPGAVKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQEEYNRE
                     QIQWTPIKYFDNKVVCDLIEAKRPPGIFATLDDSVATAHADSSAADQAFAQRLNMFST
                     NPHFDLRSSKFVIKHYAGDVTYDITGMTDKNKDQLQKDLAELIQTTTNPFLMNIFPDA
                     VDKSSKKRPPTAGTKIIKSANELVDTLSKAQPSYIRTIKPNQTKSPRDYDDQQVLHQV
                     KYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPQCSYAGDYTWQGDTLGAVKQILKD
                     ASIPTTEYQLGVTKVFIKTPETLFALEHMRDKYWYNMAARIQRAWRRFIQRRIDSAIK
                     IQRAIKEKKGGNQYEQLRDYGNRLLGNRKERRAMSLLGYRAFMGDYLSCNEMKSKGAY
                     IKRQAGIKEVVVFSIHGEALHSKFGRSAVRLPKTIILTPTTLYIIGQAVAQNQVSYTV
                     DRKVNVAHIKYVSLTSLADDWVGIYVQGENLPDPFINTVFKTELITHLKQLNRALEIK
                     VGPTITYQKKPGKIHTVKCQVSQAAPKYGDIYKSSTISVRQGLPANSKQHPKPKKKSS
                     LLDGSDGYAPVSTSQRQSRPQPPQAAQQSQPQPQPQQRQNRPVVPQATQKKRAPPPPG
                     ANNVSSSNTSSGAGMDPRNLAATAAQAVYHPQTSQRPNKAAAPSRPQQPQQPQQQQQQ
                     QQQQQQQQQPGKKSVPPPPPPPPPSNQNIPKFQAAYDFTGTGSPSELPLTKGTVITVS
                     KQDPSGWSLGKLLDGSKEGWVPTNYIVEYKESQAPPAPPAPPAAAATTNNNYNAASAA
                     AVGTAAAVGVAAGAAAGAAMAQNSFSAGLADALAARANTMRLESDDESAGNAEEDDDW
                     "
     gene            complement(<251999..>253564)
                     /gene="HFD1"
                     /locus_tag="KLMA_30107"
                     /db_xref="GeneID:34715399"
     mRNA            complement(<251999..>253564)
                     /gene="HFD1"
                     /locus_tag="KLMA_30107"
                     /product="putative fatty aldehyde dehydrogenase HFD1"
                     /transcript_id="XM_022818603.1"
                     /db_xref="GeneID:34715399"
     CDS             complement(251999..253564)
                     /gene="HFD1"
                     /locus_tag="KLMA_30107"
                     /codon_start=1
                     /product="putative fatty aldehyde dehydrogenase HFD1"
                     /protein_id="XP_022675253.1"
                     /db_xref="GeneID:34715399"
                     /translation="MTKLEYTPLEDIPAKIDSAVEFYKARQLRLSKAKNPLKQDIAER
                     KRCLQRLYWAIKDREEQLVEAMEQDFHRARSESMTVELIPLYNNILYIIDNLEKNIKP
                     KKIKSSGIAYRFGSIVIEKIALGTVLVISPFNFPILLALDPLAGAIAGGNSVVFKPSE
                     LTGNCARLMEEICREAFEPGHVETVQGGVEETTVLLDSGKFDKIFYTGSPAVGAIIAE
                     KAGKSLTPCVLELGGKSPAFVTENLPKSKWDTAIRRIFFSSFGNSGQICVAADYILCH
                     ESIYEEFTALCKKILHEFFPKITPETEYTYMVHKRASDRIKKILDSSKGEKFAAQSDG
                     NLPETCIPPTLIINATWDDSSMESENFGPILPIVKYSDLDRAIDQVLQRHDMPLVQYV
                     FSDSKSEAAHITTRIRSGDCIIGDTMIHVGIEEAPFGGIRSSGYGNYHGTYTFKTFTH
                     ERTVFKQSYWVDILINIRYPPFDKFKTRVAQISTESKPNFDRNGNKTFNYKLFGFVLV
                     SGIVLAFLLRKWT"
     gene            <253859..>254608
                     /gene="SHE2"
                     /locus_tag="KLMA_30108"
                     /db_xref="GeneID:34715400"
     mRNA            <253859..>254608
                     /gene="SHE2"
                     /locus_tag="KLMA_30108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818604.1"
                     /db_xref="GeneID:34715400"
     CDS             253859..254608
                     /gene="SHE2"
                     /locus_tag="KLMA_30108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675254.1"
                     /db_xref="GeneID:34715400"
                     /translation="MSIGDKGSHLVLTDEIKESLEQLVAVYSNYISRYVEFMNNLIGM
                     QRRVSTLRFERMTLIKYVKKLRFMNDILHSWKVELSGSSSNDGMTLREAIDPLGSYLI
                     KVFEVLDLLNFYITQPLRGETISKTLNEDLVLSEETIECINETYRVYVKGIQWLVESI
                     GGPGEGEDKKYPHLVMELVEFARKCAIEDGVDMTNSEDILLQDVAVVDSGEEFHELLC
                     DWTSILGEKGTELKELFNQDSTKWASVTKKK"
     gene            complement(<254641..>255891)
                     /locus_tag="KLMA_30109"
                     /db_xref="GeneID:34715401"
     mRNA            complement(<254641..>255891)
                     /locus_tag="KLMA_30109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818605.1"
                     /db_xref="GeneID:34715401"
     CDS             complement(254641..255891)
                     /locus_tag="KLMA_30109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675255.1"
                     /db_xref="GeneID:34715401"
                     /translation="MDEVVRREDESVGSPRAGDGSNMVSDNEIGELQHRCSNNINQRS
                     VLGQENGGNGGSTGSTATSSTPELTELVVEMLRNQTVMLEEVNSMRMQQLRLKEQVES
                     LQREQERFHVSGYKRMDQGFKKVDKCLTQMEGMNEVFKEVIGIISGERVRFLDHSQEN
                     LHEEDAHMAANSELLEDNGRRNNQGMVWNSSMSYNHDRRLLEASVKREEEPWPASASA
                     SESASVPAAGSAGLAQEHSETELRNDIAGEGGSSRGDSQPLSQTDAQARRDFVLRYRM
                     NRAVKTVKDLAREYYEGLPGQPSVLSLERRFGSTWRSSASERTFFHKRFVIIQRIESI
                     LRDPAKFKLPLDISRRNAVRVVENIRIGNNTFNNGSPCCMTLAQLYIYFSKKMDSHHD
                     YSLTLINKDVPSIREIKNRLKKSI"
     gene            complement(<256116..>256469)
                     /gene="MED11"
                     /locus_tag="KLMA_30110"
                     /db_xref="GeneID:34715402"
     mRNA            complement(<256116..>256469)
                     /gene="MED11"
                     /locus_tag="KLMA_30110"
                     /product="mediator of RNA polymerase II transcription
                     subunit 11"
                     /transcript_id="XM_022818606.1"
                     /db_xref="GeneID:34715402"
     CDS             complement(256116..256469)
                     /gene="MED11"
                     /locus_tag="KLMA_30110"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 11"
                     /protein_id="XP_022675256.1"
                     /db_xref="GeneID:34715402"
                     /translation="MSQPQYVQERLESLAKIDEQLVDVLHRASLTVSTLIDLKKGQEE
                     LKPQFEQNAQEFYTDLESATCQLRREIKLLDENVGTRLLPIQTHKRATGQDNVKLQEQ
                     FKLLEQLLTEPKDVV"
     gene            <256671..>257981
                     /gene="FOL3"
                     /locus_tag="KLMA_30111"
                     /db_xref="GeneID:34715403"
     mRNA            <256671..>257981
                     /gene="FOL3"
                     /locus_tag="KLMA_30111"
                     /product="folylpolyglutamate synthase"
                     /transcript_id="XM_022818608.1"
                     /db_xref="GeneID:34715403"
     CDS             256671..257981
                     /gene="FOL3"
                     /locus_tag="KLMA_30111"
                     /codon_start=1
                     /product="folylpolyglutamate synthase"
                     /protein_id="XP_022675257.1"
                     /db_xref="GeneID:34715403"
                     /translation="MSIELGLGRITQLLVHLGNPHHSLKVLHVAGTNGKGSVCSYLSS
                     ILQQLNHQKDVTRTSEAAFRIGKFTSPHLCHVRDSITVNSKPISAQDYASIRQHLKKV
                     DEQHALQCTEFEIMTATALQYFHQVQCSWCILEVGLGGRQDATNVVPGSNKVCGITKI
                     GLDHEGFLGSNLESIAWQKAGILVSETPFVAVDGTNDPKVLKVVREVAQSVNAQLETT
                     NHDVSVKKVSTKSWGTLDLNNRLPLNGEYQISNVQVALLMLDYLQQRNQIDLSTEQVL
                     AGIGKAEWPGRLQFLNYKYSQGNKSVPVLFDGAHNGSAAQELAKYLDSTFRFSPDEPL
                     TFVIAITKGKTLDPLLAPLIKPQDRVICTRFGAVEGMPWISAMDTHELASEIKKYTDN
                     VSIDEDLHGILGKLAQSGPETKICVCGSLYLVGQLLEVHYANSV"
     gene            complement(<258005..>258916)
                     /locus_tag="KLMA_30112"
                     /db_xref="GeneID:34715404"
     mRNA            complement(<258005..>258916)
                     /locus_tag="KLMA_30112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818609.1"
                     /db_xref="GeneID:34715404"
     CDS             complement(258005..258916)
                     /locus_tag="KLMA_30112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675258.1"
                     /db_xref="GeneID:34715404"
                     /translation="MCGRYALNLNSETIVDEFRARNVDLEAKQMPSFKERYNVGPTQE
                     VPVFHDSHLQLMKWGMIPFWTKDLSKATPWKTFNARAESVFKSRLWKPSLNHKRCVVP
                     ISGYYEWQGKKGEKTPYFIRRKDKKVMFLAGLFDMVELKADQKTKEDPDGETQQLWSF
                     TIITGPAPKELEWLHERMPVVLEPNSKQWESWLDPKRDSWSEDEIMDELKPVWRESEY
                     EWYPVPKEVGNVQNNEKRLMEKAIPKSAPAGAAAAKKPRGGIDSFFKQKKEEEEQDDE
                     TKPKRHLKREEESSNDLEAPQKKVKKE"
     gene            <259217..>260725
                     /gene="MGR3"
                     /locus_tag="KLMA_30113"
                     /db_xref="GeneID:34715405"
     mRNA            <259217..>260725
                     /gene="MGR3"
                     /locus_tag="KLMA_30113"
                     /product="mitochondrial inner membrane i-AAA protease
                     supercomplex subunit MGR3"
                     /transcript_id="XM_022818610.1"
                     /db_xref="GeneID:34715405"
     CDS             259217..260725
                     /gene="MGR3"
                     /locus_tag="KLMA_30113"
                     /codon_start=1
                     /product="mitochondrial inner membrane i-AAA protease
                     supercomplex subunit MGR3"
                     /protein_id="XP_022675259.1"
                     /db_xref="GeneID:34715405"
                     /translation="MKVGGCLQNIMLQKCGARTLLRAAEVRAIRHNMIITNGPITMTP
                     IGRSLGSHMMARSYYIPPKYEAKNKRYNWLFGLGVFGALSFGLWWFYYPHHNYPRSVS
                     KLLRKALWEESDKKEFNYQGALKYYIEALEQCQKLGMDPLGDEYTGIELKIAEMYEHL
                     NFEKEANLIYWELVHRYYKALNTPGKIPEEKRQHMVQKDLRVLIKALEQNQDLMYGKK
                     VLLSHLLLAQEEILSRSQELKQYFDTRKQDVIKSNEKEGRDIIVIKQKFDPDEFLKSI
                     KVDENGYMILDLHKDSSAWEPLKEEFFTARDLYTAYCLSTKDLLSALGCKMTTVQWMV
                     LADMAPGQILLSQANLGSLLYLQTEQVEGQLFALNQTPKEDRDDDFKEKVAQLTKQRE
                     VCLDLANRCYQSVVSFGKKNKKLRFQVNDLLDPSASQAIALSTYGMGVISLHRGDFSK
                     AERLLNDSLSLAKETDFQELISPSEVELEKVAKARADPKVLEPFHSSPTTEN"
     gene            <261106..>263454
                     /gene="OCT1"
                     /locus_tag="KLMA_30114"
                     /db_xref="GeneID:34715406"
     mRNA            <261106..>263454
                     /gene="OCT1"
                     /locus_tag="KLMA_30114"
                     /product="mitochondrial intermediate peptidase"
                     /transcript_id="XM_022818611.1"
                     /db_xref="GeneID:34715406"
     CDS             261106..263454
                     /gene="OCT1"
                     /locus_tag="KLMA_30114"
                     /codon_start=1
                     /product="mitochondrial intermediate peptidase"
                     /protein_id="XP_022675260.1"
                     /db_xref="GeneID:34715406"
                     /translation="MHQTVSVSRRYVPQCLGRLSRTGLCINGQGYAHRWYTSTTLERL
                     KQPLRRVFDDEGYWKDINKPNYKSDKRFGLSFGSQLETGLFQNPYLKSANGLLEFTEH
                     SFNRARELVHKIHSIETEEQLKHYIKDLDQLSDVLCRVIDLCEFIRATHPDRKFVQTA
                     QQCHEKMFEIMNILNTDVKLCDLLTQCLDKSEALGLSSEEIRVGKILLEDFEKSGIYM
                     EPEIREKFINLSQEISVIGQEFISNTEFVRDNHVKISCDVLEANVNAIVYSQLKKDIS
                     GEHYKVPTYGYIPYTILRSCSDETIRKKIWTAMHSCSDEQIERLRKLVDLRIQLAKLL
                     GSKNFAEYQLQGKMAKNPENVKGFLESLVHTTRVKAANELKPMARLKAELTGMQTPET
                     LEEVLEVIKPWDRDYYGSIQALSQRRSSALETGESISASFSLGVVMQGLSDLLEKIYG
                     IKLVPRTPKTGETWSPDVRRIDVIDENEGLIGVMYCDLFERDGKTPNPAHFTVCCSRN
                     MYPNETDTSTIQVGVNSKGQKFQLPVISLVCDFRPSEVQMEDGSSVQICLLQLNEIET
                     LFHEMGHAMHSMLGRTQLQNVSGTRCATDFVELPSILMEHFARDTRVLSSISSHYKTG
                     ESLDIQILKNHQLENQFLQNCETFSQIKMSLLDQELHNLDQNGASIDVVRLYHRLERR
                     LRVMPDNESNWCGKFGHLFGYGASYYSYLFDRAIASRIWEHLFEQNPFDRTNGTKLKE
                     GLLQWGGSRDPWFLLSKVLDEPRLAKGDEWGMRYIGDVKSGM"
     gene            complement(<263741..>265111)
                     /gene="ASC1"
                     /locus_tag="KLMA_30115"
                     /old_locus_tag="KLMA_30116"
                     /db_xref="GeneID:34715407"
     mRNA            complement(join(<263741..264169,264560..>265111))
                     /gene="ASC1"
                     /locus_tag="KLMA_30115"
                     /old_locus_tag="KLMA_30116"
                     /product="guanine nucleotide-binding protein subunit
                     beta-like protein"
                     /transcript_id="XM_022818612.1"
                     /db_xref="GeneID:34715407"
     CDS             complement(join(263741..264169,264560..265111))
                     /gene="ASC1"
                     /locus_tag="KLMA_30115"
                     /old_locus_tag="KLMA_30116"
                     /codon_start=1
                     /product="guanine nucleotide-binding protein subunit
                     beta-like protein"
                     /protein_id="XP_022675261.1"
                     /db_xref="GeneID:34715407"
                     /translation="MSSSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLI
                     SWKLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEA
                     RFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPK
                     NLEEGEADDGRITFVSAGMDKIVRSWSLNEDSYRIEADFIGHNNYINVVQPSPDGSLA
                     ASAGKDGQVYVWNLKHKNAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEV
                     LIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN"
     mRNA            complement(<264515..>265111)
                     /gene="ASC1"
                     /locus_tag="KLMA_30115"
                     /old_locus_tag="KLMA_30116"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818613.1"
                     /db_xref="GeneID:34715407"
     CDS             complement(264515..265111)
                     /gene="ASC1"
                     /locus_tag="KLMA_30115"
                     /old_locus_tag="KLMA_30116"
                     /note="containing WD40 domain"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675262.1"
                     /db_xref="GeneID:34715407"
                     /translation="MSSSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLI
                     SWKLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEA
                     RFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPK
                     NLEEGEADDGRITFVSAGMDKIVRVCATFFCFPFLLLI"
     gene            <265889..>268012
                     /gene="APL2"
                     /locus_tag="KLMA_30117"
                     /db_xref="GeneID:34715408"
     mRNA            <265889..>268012
                     /gene="APL2"
                     /locus_tag="KLMA_30117"
                     /product="AP-1 complex subunit beta-1"
                     /transcript_id="XM_022818614.1"
                     /db_xref="GeneID:34715408"
     CDS             265889..268012
                     /gene="APL2"
                     /locus_tag="KLMA_30117"
                     /codon_start=1
                     /product="AP-1 complex subunit beta-1"
                     /protein_id="XP_022675263.1"
                     /db_xref="GeneID:34715408"
                     /translation="MGVDKKIKKFLRDAIRVAPKISNKGELFELRNGLVSPYPQTRKD
                     AIRKIIQQMTSGKDVSSLFPDVLKNIATQDIEQKKLVYLYVANYAETHPELCILVVNT
                     FVSDAADPNPLIRSMAIRTMSMIRVDKILEYIEIPLRKTLQDDNPYVRRTAVLCVAKL
                     FQLNKTLCRELGVLDDLQNALLDENPIVVANALAALHEIDEMDPGCINLKKLISQNVK
                     RFLNVLNECTEWARITILESLAEHKSIDPMESQEIVDRVVPHLQHVNPSVVLISVKCI
                     LMHIPNLNTVSESLYNKLSTALVSLMSTPVEIQYVALRNIRIILEAFPNLLRKELRIF
                     YVKFNDPLYLKVEKLDILVRLVPENNSKLYTMLFNELTEYSKDFDHEFVTKAIQAISQ
                     LAIKVSNGGHDTNNKFLNSVVDELVSMLQQDGREEYRDAIMISIGDLFRHDSEGNLIA
                     ETSKNELSAIVSSWQDVETIFSSDLGKCNYFWFLANFTQCDVESKLRSTVEVFDEQGP
                     LTQMSILMCVVKCHNSASSSFLQEVLDLCTSEVHDLDIRDMAMMYWRCLSIDNGDQVI
                     NQLFDRFEIPKLHSTLSSFSKETLQILLQELSMLSSVYFKPLSQMRRRANDLDIIKDK
                     DIDELKGMATNEILKNMNEDVLLDMDDSPTATNSTVLDELNDLFDITGDMNKVSISGG
                     NNSSKPAANSNSNSKSHVTDLLDLM"
     gene            complement(<268130..>268459)
                     /gene="CMC1"
                     /locus_tag="KLMA_30119"
                     /db_xref="GeneID:34715409"
     mRNA            complement(<268130..>268459)
                     /gene="CMC1"
                     /locus_tag="KLMA_30119"
                     /product="COX assembly mitochondrial protein"
                     /transcript_id="XM_022818615.1"
                     /db_xref="GeneID:34715409"
     CDS             complement(268130..268459)
                     /gene="CMC1"
                     /locus_tag="KLMA_30119"
                     /codon_start=1
                     /product="COX assembly mitochondrial protein"
                     /protein_id="XP_022675264.1"
                     /db_xref="GeneID:34715409"
                     /translation="MSENIEKHNQRLPLWMLNPAEEKEARQNLKKFAYAQCVDYVEAM
                     VECSKIHGLKVFPACNEPRDAMRKCILSYQGDSYLDVQRDLMVQQKLERLEQQLAEQK
                     KQQQQQK"
     gene            <268810..>269199
                     /gene="MRPL31"
                     /locus_tag="KLMA_30120"
                     /db_xref="GeneID:34715410"
     mRNA            <268810..>269199
                     /gene="MRPL31"
                     /locus_tag="KLMA_30120"
                     /product="54S ribosomal protein L31"
                     /transcript_id="XM_022818616.1"
                     /db_xref="GeneID:34715410"
     CDS             268810..269199
                     /gene="MRPL31"
                     /locus_tag="KLMA_30120"
                     /codon_start=1
                     /product="54S ribosomal protein L31"
                     /protein_id="XP_022675265.1"
                     /db_xref="GeneID:34715410"
                     /translation="MFGPFRASQPALGGLLWKVPWRMSGPQKARQRDRLRKVDDVLAT
                     LKLGLHLNRNSMPVSEASQLNVRKIKPGVKSLRILDKAKYFPKEHEMSATDKYSVFSR
                     YSSGYRKGIHKVPKWTKLSIRRNPRHF"
     gene            complement(<269307..>269846)
                     /gene="SPC24"
                     /locus_tag="KLMA_30121"
                     /db_xref="GeneID:34715411"
     mRNA            complement(<269307..>269846)
                     /gene="SPC24"
                     /locus_tag="KLMA_30121"
                     /product="probable kinetochore protein SPC24"
                     /transcript_id="XM_022818617.1"
                     /db_xref="GeneID:34715411"
     CDS             complement(269307..269846)
                     /gene="SPC24"
                     /locus_tag="KLMA_30121"
                     /codon_start=1
                     /product="probable kinetochore protein SPC24"
                     /protein_id="XP_022675266.1"
                     /db_xref="GeneID:34715411"
                     /translation="MNNPVELLQQVRSNFIIESDVASVKQIKRDMRLLTKQMSEKQTH
                     HDELIKQLQAEVERQQNMVQSLIKSFQEQKNQVRRVESELNIPQLEQEIDEVMREIEH
                     LRSSIQNGISSVMEIQRKLLEEEPETADNKPEGEESKVRVLKLKMFHSLDLALYNGQL
                     LDLRHDAAPLDSSNVWKSL"
     gene            <270055..>270249
                     /locus_tag="KLMA_30122"
                     /db_xref="GeneID:34715412"
     mRNA            <270055..>270249
                     /locus_tag="KLMA_30122"
                     /product="DASH complex subunit HSK3"
                     /transcript_id="XM_022818619.1"
                     /db_xref="GeneID:34715412"
     CDS             270055..270249
                     /locus_tag="KLMA_30122"
                     /codon_start=1
                     /product="DASH complex subunit HSK3"
                     /protein_id="XP_022675267.1"
                     /db_xref="GeneID:34715412"
                     /translation="MDTKQRQYARLAMHLKQLRENLDETCAQVETMAQQSKMITKLGA
                     NQAASFIGSSRVFENEMLKK"
     gene            complement(<270334..>271698)
                     /gene="CTK1"
                     /locus_tag="KLMA_30123"
                     /db_xref="GeneID:34715413"
     mRNA            complement(<270334..>271698)
                     /gene="CTK1"
                     /locus_tag="KLMA_30123"
                     /product="CTD kinase subunit alpha"
                     /transcript_id="XM_022818620.1"
                     /db_xref="GeneID:34715413"
     CDS             complement(270334..271698)
                     /gene="CTK1"
                     /locus_tag="KLMA_30123"
                     /codon_start=1
                     /product="CTD kinase subunit alpha"
                     /protein_id="XP_022675268.1"
                     /db_xref="GeneID:34715413"
                     /translation="MSQPKVFKKRRPGSRYHGAVQSRYQPNSGQNANQNPNQSANGGD
                     GRSNGMPHGPRRASPGPHVGKRGGKMKYSGRPGPRGSRFEGHDAIPRGPRSMGPKSTD
                     AAVPAKQPETLQQSLISFTNIKSSFQPLAQVGEGTYGKVYKAENVHTGKLIALKRLRL
                     EQERDGFPITSIREIKLLQQLDHANISLINEIIVCDKNSISMGFQYMENDLAGMLMDK
                     SIEFSHANIKHLMKQLFVGLQYLHQQQIVHRDIKGSNLLIDNRGNLKITDFGLAKKLV
                     GNTTNSNTNRVITLWYRPPELLLGCTDYKYEVDCWGCGCLLVELFTGCALFPGANEID
                     QFNKIIQVMGTPSLDQWPKMVDMPWWFMLVPQLTQNYENVFLDKFSSDGVPHDALELA
                     SKLLRYDQDTRFTAHEALSHPYFSNDPKPQPLLLGEDFKGSHEYEVKKLRRKERQKES
                     SVTN"
     gene            complement(<272075..>272620)
                     /locus_tag="KLMA_30124"
                     /db_xref="GeneID:34715414"
     mRNA            complement(<272075..>272620)
                     /locus_tag="KLMA_30124"
                     /product="succinate dehydrogenase [ubiquinone] cytochrome
                     b subunit"
                     /transcript_id="XM_022818621.1"
                     /db_xref="GeneID:34715414"
     CDS             complement(272075..272620)
                     /locus_tag="KLMA_30124"
                     /codon_start=1
                     /product="succinate dehydrogenase [ubiquinone] cytochrome
                     b subunit"
                     /protein_id="XP_022675269.1"
                     /db_xref="GeneID:34715414"
                     /translation="MFKSVLKPGIISGVRPSVLNVNTRLMMTNFVRGQSNIMAKKTTT
                     AEEYELLVAQRKARPVSPHLTIYQPQLTWYLSSVHRVSGVLLGFAFYAITIGFGVSSL
                     FGLGLNTENLVQFYNEKIPSWLDITAKVGCAYLFAFHFGNGIRHLIWDAGKELTLKGV
                     YRTGYSVLALTAVLGSYLLTL"
     gene            complement(<273009..>275606)
                     /gene="VTC2"
                     /locus_tag="KLMA_30125"
                     /db_xref="GeneID:34715415"
     mRNA            complement(<273009..>275606)
                     /gene="VTC2"
                     /locus_tag="KLMA_30125"
                     /product="vacuolar transporter chaperone 2"
                     /transcript_id="XM_022818622.1"
                     /db_xref="GeneID:34715415"
     CDS             complement(273009..275606)
                     /gene="VTC2"
                     /locus_tag="KLMA_30125"
                     /codon_start=1
                     /product="vacuolar transporter chaperone 2"
                     /protein_id="XP_022675270.1"
                     /db_xref="GeneID:34715415"
                     /translation="MLFGVKLANDTYPPWRDQYIDYEKLKKLLKESVIRDSEINNSGS
                     KKGKKQGKADEYWTEKDESKFVTALDEELEKVYSFQTSTYNKIMNTLNKLEEETDNDE
                     SLQSIDFQAFQQHLEECLSQAQELDNFQRLNFTGFTKIVKKHDKLHPGYPSVKSLLQV
                     RLKSLPFHSEEYSPLLYKISYLYNIVRNNFSTVSKSLANSSKFSSIPNHEETTTQSFK
                     FWVHQDNLMEVKTNILRRLPVLVYAQAPSESDDLINRLESSLLNDDGGPAISNSSNET
                     DVGHLNKSFEPVISTLYFDNDAFELYNNKLLKTNSAPTLRLRWIGKLSDKPDIFLEKR
                     MFVIDDESNRTDFEETRIKLKPKFINGFIFNGDTEYKELMLKKLKESGSSSDTAKKLE
                     NEFDSIQKFILENELQPVLRTLYQRTAFQIPGDDRVRITIDSDIMYIREDSFDKDRPI
                     RDPKHWHRSDIDADVVNPLKMVRPGEYAKFPYSVMEIKVKTSSSLAASSENALSALSH
                     GGHQVKWIADLANSHLVKEVPKFSKYVQGVASLFGEDEKLDMLPFWLPDLEFDIRKDP
                     KQAYEEEKRKLERQQEHAAKMDKMKRLSVVASGNGTSGDLSHDAAVAAATAAANAANA
                     AAGNGGAIDDGSSDNESSDDEDGSGTSHKKKSKKSRRRHKNLEPTIMSLFTGASNAES
                     SKLTGVDSEDEEIELPPGVKKPTSYLKNAGPVKVEAKVWLANERTFNKWLSVTTLLSV
                     LTFSISNSVKKANLAKLADWLTYIYFGLTVFTGLWAYHTYVTRLNVIKARSGKHLDAP
                     VGPLLVSFVVSAALIINFVVAFVDLGKKRANPAAGDYISVASARTESPIISAIIDSIT
                     GWLGVAPAH"
     gene            complement(<276370..>277014)
                     /gene="SEC4"
                     /locus_tag="KLMA_30127"
                     /db_xref="GeneID:34715416"
     mRNA            complement(<276370..>277014)
                     /gene="SEC4"
                     /locus_tag="KLMA_30127"
                     /product="ras-related protein SEC4"
                     /transcript_id="XM_022818623.1"
                     /db_xref="GeneID:34715416"
     CDS             complement(276370..277014)
                     /gene="SEC4"
                     /locus_tag="KLMA_30127"
                     /codon_start=1
                     /product="ras-related protein SEC4"
                     /protein_id="XP_022675271.1"
                     /db_xref="GeneID:34715416"
                     /translation="MSGLRTVSANGSMNKNYDSVMKILLLGDSGVGKSCLLVRFVEDK
                     FTPTFITTIGIDFKIKTVDINGKRVKLQLWDTAGQERFRTITTAYYRGAMGIVLIYDV
                     TDERTFENIRQWFSTVNQHASEDVVMLLVGNKKDMDTRTVSYEQGEALAKELGIPFIE
                     ASAKDDTNVSEIFFTLAKLIQDKIDDGKMEGKADKEGSVSIRGSGASGSKANCC"
     gene            complement(<277440..>283892)
                     /gene="BLM10"
                     /locus_tag="KLMA_30128"
                     /db_xref="GeneID:34715417"
     mRNA            complement(<277440..>283892)
                     /gene="BLM10"
                     /locus_tag="KLMA_30128"
                     /product="proteasome activator BLM10"
                     /transcript_id="XM_022818624.1"
                     /db_xref="GeneID:34715417"
     CDS             complement(277440..283892)
                     /gene="BLM10"
                     /locus_tag="KLMA_30128"
                     /codon_start=1
                     /product="proteasome activator BLM10"
                     /protein_id="XP_022675272.1"
                     /db_xref="GeneID:34715417"
                     /translation="MSEKQANSNIKSPLPSKALKNPLLQSVRMASDKRSASNAELSVK
                     KTKLSNGLNGIGSNEDGLSNRARSTTPTLMYKVLEGSYMKERLAHYGLDFDEDVEKHR
                     ANIHDPTSRFFGRRVKPAVELEDLLPYDIESHLDQAKYLYHILTNLYVAIKSMDVQGL
                     ISITSKDLLALKNEVYDLALNSDMFRLIQDVADDPHDVANFDEDDENDSMELLEENEF
                     LDAADPDFGVSGKITARSAAVINVNHWTNELKNCMHFEFPLTLRKALAVVYYNLCLVR
                     GQKVYRQLHLEMFEKLVSTGDEGTDFTQELIKIGMVLDYKPMKDLLNEFLPTTEPDYK
                     MYDIENKSDLSLFRLLVMLSSMARPFFDPNDPNILTDTMDYFLASISPQTMSVALPSL
                     SCLVPFHYHKDRKVLDYFPVLFSLWSNTSADNSFDTHLYAFVGHVAMDAYYQYIQQAN
                     PRILALSNVDFGDYGILTEFQMDFILNRIKNHIKEDYQLCSVTRVVRPLVYSINGKNP
                     HAFFDKLTKLLTSVETYVHPSNTGYWTDIIAKFIHGFIRMYHERYMHEKKADAPYRNE
                     LKFTDECHEILVNSFIDLLLVGSQSKQSEVANYYISSFGYLLDMKPKNAHKICDKIIV
                     DLYDALSDQYVNSEHRLLTSLKQFTRIVRFLIEDKLYRVHITNLLSILIEKIDLNNIS
                     LTSNLMNSIVSISCFIPIEVFVKDDEYLTFESNTIPFIEQHLYFIKEGGSSTDFQYDE
                     SVLEQAFKASTTVFENCMKVYVDKLYQLVDVDLDPGLISKINQTSMIMLQSMDNKMFY
                     YVFGLLEKSFWDNDSFKVKNPLIELVSIPLSASIKRDHSLSVKIFRDLNFNIREQIKN
                     GAGSVRSTTEIQPRDVKLATLLSTLNDVLRYAQESLLTFADDLVDLLEYIYTNVTNPP
                     LDVITAMLLHHTLESLTTTEVVDYRLFQEDCEIEDSEKWGGLQFDKRKYDPKLQQFKW
                     HQPSSQEIDFAMKLIERFYTFAAKSMESLMSDPQNNFNYVDNMKKNILIITNVISGSS
                     ILYDADFNQSNKSISLMDPYKKKLLLLQKIRDETCDNNELLVDIEKVRGETGDTDIEM
                     TEAQGSDADENFDISDESTGTENNKLVDYDTEPSEAPSGIATPVPGNDRDSNSSMMNS
                     YMAFRDIDVFSYNYFFGKTPSERALDPRYSKIHHLREEIGLFLHKVFKFMNENFENST
                     SVFQTLLHGLKVWFTDVGQETIFIDDPKGAISIEFLENIQDIAHWEEPFLPFTRTYLA
                     ADCQELHTSRLTLHSTNRKPSKLESKLLNDVISLSLSVYPNIHRPAQQCMIHVMKQLI
                     GSYSIIVKKVFNAFEAALESTDDEAPKRLEVLIQVLSMKKIQRKMMSDYNNLERMIIL
                     LLRASKINSDTVVSLSDQVLDSVSDLIKIPSKVCLFDESAIDCLKPNDDTIGKQVSVV
                     KTAKDRKRQEYLQKLETLNANLIAFQKKDPQLRWISVCQIVRIGQVIQQNLEIKPNPD
                     VLVQSFELTKTKHPLVIAHCIVTMLNVCNKMISLGNYNYDVAATYRSDYVREYVKYLD
                     SSQPNFEQEFFKEMDNVEHPNYFVDSKAYVGWLSWGRPVGVVKTQNQINFNLREEDMQ
                     IMKEFGKLITKEWLMELCQIFIRSNEAQSSFSTNRLGLFGILVHLISNECCSMKYEDI
                     LDICEEIYDKDDKSSLIACSEIVSGLLLSCKYTTDADLVKFESFLKRFLGKWLDNNYN
                     ATTTDIWSVVAWWVPGFIDLRRSPEIYRRFLTVEGLFDVTSESSLELSGKLTVITQAL
                     SDVTFKMGSVQRIIDNLVFDHPSDVVRREVGKLFSVIFYVKASAHKPNVKSLLESAQN
                     QPLEVREVPEWLKEKAIKIFEEIETERELVKNLSAQDILKTRYIYLATTMFYWTSHLI
                     HTGAKACLAPFAYKYLAPFLMKLDRMRDVCKMVNIKAYNVYLELAYIPIPKHLLPEMI
                     SILDLTDLTSSHELRVNLTYAEKIFSTQSLVMKEPEREKILDFVVDKLYYESSVEVRQ
                     KAAFVLAGIVHNISYDTATLHMLLDHFNKKLGSYTSKQKAALSKSNTEIHGAVLGLGA
                     IIEAFPYVSPLPDWVPANIAILASWARTSGMCGAAAKNIISRYKKVRADTWHLDRFQF
                     TSEQLEDMEGVLWRSYYA"
     gene            complement(<284309..>285928)
                     /locus_tag="KLMA_30129"
                     /db_xref="GeneID:34715418"
     mRNA            complement(<284309..>285928)
                     /locus_tag="KLMA_30129"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818625.1"
                     /db_xref="GeneID:34715418"
     CDS             complement(284309..285928)
                     /locus_tag="KLMA_30129"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675273.1"
                     /db_xref="GeneID:34715418"
                     /translation="MNLPIEVLDRVVTSGLDSFESLMAWSQIGVHFRSVVRKKLGILA
                     IIDSDKHASRASPAPLNYDLVSDESNTMCVFSDTFDFGNVSEFLGRFDNILVVVMSDR
                     FYSDPLATTLGELSKGLSGMGQEKNICLIYKTYVNFLSKFYFRELCHCSALLRLCELH
                     ILANSSGAFDREEVDMFDVDTIFENTYLHNVEIVYTLNLRRGRKMMAPKLRTLKHLQV
                     EDNSGIVESLKYCPLLSSIDQYQLPPGRTVILPPCDHLVIANYNTNVVRDLVDGSHVR
                     ESLTIKPSLLSSEPKFMNIKCPSIISLYLEFNTNILGNVKFIDCFFGNLKSYKAPIST
                     DWEDLVYSKSVYIDTIGFTVSSILSLQNLCEIPFSLNKLILYSSDVELQVTELQPVQL
                     ETVSSYKQIIQDLKRIEFHLHSIWDCVVFQHNILPFLVEDTELFVEIDRYSIANEILK
                     ARMKDSTLSQLAILQLNWNQSKLVFRIPKLKAFQIYSNAQQQQFHESRGRSSSMNGDT
                     LSLLHPLVHTTENAFANRSQIDIIDFIDMNT"
     gene            <286481..>288940
                     /gene="CFT2"
                     /locus_tag="KLMA_30130"
                     /db_xref="GeneID:34715419"
     mRNA            <286481..>288940
                     /gene="CFT2"
                     /locus_tag="KLMA_30130"
                     /product="cleavage factor two protein 2"
                     /transcript_id="XM_022818626.1"
                     /db_xref="GeneID:34715419"
     CDS             286481..288940
                     /gene="CFT2"
                     /locus_tag="KLMA_30130"
                     /codon_start=1
                     /product="cleavage factor two protein 2"
                     /protein_id="XP_022675274.1"
                     /db_xref="GeneID:34715419"
                     /translation="MTYTIETCQDEKKRFKGTIVRFENVIMLLDPGWNGEGSYEECEA
                     FWERYIGEVDILLISQPTIECLGSYSMMYKQFLTHFSSRIRVYGTLPVSNLGRVNTVD
                     LLTSVGILGPFSNAVMDLGDVEHSFDCIESVKYSQTVDLKSKFDGLSLEAHNSGYAPG
                     GTIWTIVTSSERILYAPRWNHTRDTILNSADLLDNKGNPTSSMMHPTSVITNIDIVGS
                     TEPQRKRSEHFVDTVKRGLQMNNSLLIPVEIGGKLLELFVIINNFLYESMKEGKKHDI
                     PIFLISHSKGRSLTYAKSMLEWLSSQVIKTWESRDNRSPFDIVSRLRIVQPEELGGFS
                     GQKICLVSEVDDILSQTLNKLCTKDKVTIILTERHANMPALHPLRKLNDKWQQALKSG
                     SRSALDGNPISISDTMSLRIMKKSIMPKKEADKVRETIKARNEVREKLIQEYTAKAND
                     LNQTAAILFDPGDESSSDEEGIEMMESVGKKNGASSAKIEIPVDIVRHGSNDDDKHLF
                     FPFHPAKIKSDDYGDVVDVKKFLPQEEPYETAQSLKRSLNNSNDYDGDEDDDTYEVLD
                     SRINKSKKRKANSGNDSHSRRNNENNDDISYLDPLKSDIYKRAVVETKVNIRCSLVFI
                     DLTSIVNARSISIIWPVIKPRKVVVLPSVTNVDTQVVGNLERRKVDVLVTAFNEPKAM
                     DTSVRAIDISIDPSLDQLLNWQRISRSYTVAHVVGRLLKEKDPKHPNRDKITLQPLKN
                     PLALHSGSSLRIGDVRLPELKRRLTAENHRAEFQGEGTLVIDGKVLVRKINDAETIVD
                     GSPSDVFYKVKSAVSDMLANV"
     gene            complement(289119..289190)
                     /locus_tag="KLMA_R303"
                     /db_xref="GeneID:34718677"
     tRNA            complement(289119..289190)
                     /locus_tag="KLMA_R303"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:34718677"
     gene            complement(289522..289597)
                     /locus_tag="KLMA_R304"
                     /db_xref="GeneID:34718678"
     tRNA            complement(289522..289597)
                     /locus_tag="KLMA_R304"
                     /product="tRNA-Val"
                     /db_xref="GeneID:34718678"
     gene            <289835..>291043
                     /gene="RRG1"
                     /locus_tag="KLMA_30133"
                     /db_xref="GeneID:34715420"
     mRNA            <289835..>291043
                     /gene="RRG1"
                     /locus_tag="KLMA_30133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818627.1"
                     /db_xref="GeneID:34715420"
     CDS             289835..291043
                     /gene="RRG1"
                     /locus_tag="KLMA_30133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675275.1"
                     /db_xref="GeneID:34715420"
                     /translation="MVRPFGQLGNHRKHVLDWYRYSLRNIKANIEIEHLKTQVYSTLK
                     RTVRENKNHKSAWYVRGLLQDLNDINTYILNDDLHQLLKLRDKYSNEDVITSTTTNTP
                     PSGNALLGEAITGIKVPKDSFVLIEREEKDERKKKKKAMSLSSSPTPSSARSDRLSRR
                     VLYSYIRKHYRPPFSLPQEHIESLIKPLAYHEYYCKKLYLIELRLAQGPPKVSLGYTG
                     AGRARIWFVRSPLNRKKRQSKRLTTLIRLSKLQAQKNLDGARECEKMLWHGYHEAQWE
                     YMLEKNNQRFPKTAEEVISLVKHGGNLRRLPVNFVNWLQPIIEALQQFEQFDIEVQEK
                     FRKQRDMLVEGGQYHYYHNLNQQLYAKRMARFKNLKKELPVTNPFTKENNLGALLVKW
                     KFLSPHQLLK"
     gene            complement(<291105..>291737)
                     /gene="RTR1"
                     /locus_tag="KLMA_30134"
                     /db_xref="GeneID:34715421"
     mRNA            complement(<291105..>291737)
                     /gene="RTR1"
                     /locus_tag="KLMA_30134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818628.1"
                     /db_xref="GeneID:34715421"
     CDS             complement(291105..291737)
                     /gene="RTR1"
                     /locus_tag="KLMA_30134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675276.1"
                     /db_xref="GeneID:34715421"
                     /translation="MATVEEIKSVILKPYTNHRQLTIREVENISVSLIELLITKDASD
                     AKTMKYIARFLTKQDYDDLVQERNLVKRCGYPLCHRSQARVRDPFADRQMTNFMKKNN
                     PYAYLTEFCTKAHYRCSQYYQFQLSDEALFSRVGVHLDDYEPSTEVQLLEEALQKESD
                     IKEMIRGMTELKLADEENKDEIEKDISEMLADIKIVEVNEPNIIGDLARD"
     gene            <292009..>293634
                     /locus_tag="KLMA_30135"
                     /db_xref="GeneID:34715422"
     mRNA            <292009..>293634
                     /locus_tag="KLMA_30135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818630.1"
                     /db_xref="GeneID:34715422"
     CDS             292009..293634
                     /locus_tag="KLMA_30135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675277.1"
                     /db_xref="GeneID:34715422"
                     /translation="MASEKEPSSKSKRAESRRKSSSPPNPSFDEYNVSSIKDFIYREL
                     RPTTGRQVDEDSFDENVKAIEYDLEQIVNILRVPFQIEQFFTYALLTCLNCFLHFFTT
                     MPMRIAHALFVRRDRLSLHKVRQELLALAMVAFPCVILNYLDTSRIYHRIKGQNAIKL
                     YMIFQVLEMAEKLLSSIGIDLFSILMLRDSVQRSKKEMVILYTTCCLCLTLHALIYIY
                     EMLALNVAVNSYSNSLWTLLLSMQFSELKSAVFKRIDKEGLFQMTIADVVERFQLIIF
                     LMVIAVRNFVVAGKNWSDVLPHSWTVNSTQSLLLGVFIGPIITVIGSELVVDWIKHAY
                     IIKFNRIRAHVYERYLQIISKDMKYNGGIRFQRRLGLPFPPLVASFIVLVWPAVKQTL
                     RNNNKWWLTALMTIIGFIWLLFIKLTLQIILVKWSRHMQKKPFNIQPDHLYINGNLSA
                     GRGSMDEDTRRMIHKSQNNNNTNINSSSGARQPPTVVTPPGSPELVSVDKLDKRQSNI
                     PPSMEEQRNKRDLKHPKSLETVERYKMSSKRIW"
     gene            <294052..>295518
                     /gene="gabD"
                     /locus_tag="KLMA_30136"
                     /db_xref="GeneID:34715423"
     mRNA            <294052..>295518
                     /gene="gabD"
                     /locus_tag="KLMA_30136"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818631.1"
                     /db_xref="GeneID:34715423"
     CDS             294052..295518
                     /gene="gabD"
                     /locus_tag="KLMA_30136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675278.1"
                     /db_xref="GeneID:34715423"
                     /translation="MSHLIESDFLLQTKAFINGKWVDTGDSFDVSNPATGDVIQKVSN
                     CGVGHYNEAVKGAHEAFAKFKQTNVRERAQILENIYDLMQEHKQDLAKIITIENGKPL
                     KDALGEVEYSSMYFKWFAEEAPRVYGDVISSGVPGKQKIFTIRQPLGVVGILTPWNFP
                     SAMIARKLAPAIATGNTSVIKPAHETPFSALALGALAERAGLPAGVCSVLPTNHTHEV
                     GEYLCEHELVKKITFTGSTKVGQLLMGQSSKGKNIKKFSMELGGNAPFIVFEDADIDR
                     ALEGIIGCKFRQSGQTCICANRIFIHESIYDEFSKKLVERIESTFKLGDGLQDDVTHG
                     PLIHQGSIDKVSALVQDAKTKGADVLTGGSRASTLGPLFYQPTVLGNVTESMNIFHEE
                     IFGPVASLIKFKDIDEVISRANNTDVGLAGYFYSKDIATIFDVAEKLNVGMVGVNTGA
                     ISEPSLPFGGVKNSGLGKEGSKYGIEDYTELKAIVVAP"
     gene            complement(<295597..>296676)
                     /gene="mlo2"
                     /locus_tag="KLMA_30137"
                     /db_xref="GeneID:34715424"
     mRNA            complement(<295597..>296676)
                     /gene="mlo2"
                     /locus_tag="KLMA_30137"
                     /product="protein mlo2"
                     /transcript_id="XM_022818632.1"
                     /db_xref="GeneID:34715424"
     CDS             complement(295597..296676)
                     /gene="mlo2"
                     /locus_tag="KLMA_30137"
                     /codon_start=1
                     /product="protein mlo2"
                     /protein_id="XP_022675279.1"
                     /db_xref="GeneID:34715424"
                     /translation="MAEISVKEYVKKQEQLEDEANELMPFDPSYCTYSMGPIRQPVYA
                     CRTCRNIGVCYSCSIQCHTSCDLVELFDKRDFSCDCGTDRQFKGGEEFRPCNIRKNSE
                     PDVGDMSNRYGQNFQGLFCSCHKEYDPNTTATMLQCVLGLECNEDWYHDHCILGIETN
                     PDPVTEDRVLPGFPELASFDGFISWKCIDKYRSVFERLLSHEDADKIVAHKVFRKDAK
                     CLETGENEKTDKKRSLRDMENSGTSDSYSLFLKEGFREEFKKLRDSLEKDDVLKAFLT
                     NTAPFLCEEEKVYEPPKEEEQGSLVELGESALAKNLSHQQTLASLLAFQQIKTKLTDF
                     LRPFAESNTVVSETDIKNFFDSHKK"
     gene            <297388..>300048
                     /gene="MCM2"
                     /locus_tag="KLMA_30138"
                     /db_xref="GeneID:34715425"
     mRNA            <297388..>300048
                     /gene="MCM2"
                     /locus_tag="KLMA_30138"
                     /product="DNA replication licensing factor MCM2"
                     /transcript_id="XM_022818633.1"
                     /db_xref="GeneID:34715425"
     CDS             297388..300048
                     /gene="MCM2"
                     /locus_tag="KLMA_30138"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM2"
                     /protein_id="XP_022675280.1"
                     /db_xref="GeneID:34715425"
                     /translation="MSDNEEISGGRRRRRRVDDEDEDEEELGTDSLSTQPREGANIPS
                     SPQFEAPLGSPDEIDFENPDNDGDEAINADEDLEEVEERMNEVDLMGDDMYRDYAANR
                     EQDEYEERGVDDEEQEELSLAERRRIDAQLNERDRLVQRNKAYLDDDDEGTGAGGVDL
                     DAMGLPVQRRRRRRQYEEADDDLLSDMDIDPLADELSLESLGDVKASSYSEWITQPNV
                     SRTIARELKSFLLEYTDESGKSVYGARIRTLGEMNSESLEVNYRHLVESKAILALFLA
                     KCPEEMLKIFDTVAMEATQLHYPDYTRIHSEIHVRISDFPSVLNLRALRETHLNSLVR
                     VSGVVTRRTGVFPQLKYVKFNCLKCGAVLGPYYQDSNEEIRISFCTNCRSKGPFRINM
                     EKTLYRNYQRITIQESPGSVPAGRLPRHREVILLWDLVDIAKPGEEVEVTGIYKNTYD
                     GNLNAKNGFPVFATVLEANSVKRREGGLQDGDGNEGLDAFSWTEDEEREFRKMSRDRG
                     IIDKIISSMAPSIYGHRDIKTAIACSLFGGVPKNVNGKHSIRGDINILLLGDPGTAKS
                     QILKYVEKTANRAVFATGQGASAVGLTASVRKDQITKEWTLEGGALVLADKGVCLIDE
                     FDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPIGGRYNSTLPLSQN
                     VNLTEPILSRFDILCVVRDLVDEESDQRLASFVVDSHIRSHPDKDLEDPNDNGNEGGD
                     EEANDNEDRDDGAPLSSKQRRLQSHRRREDEISPIPQHILMKYIHYARTKVYPKLHQM
                     DMDKVSRVYADLRRESVTTGSFPITVRHLESILRIAEAFAKMRLSEFVSSWDLDRAIK
                     VTVDSFVGAQKISVRRQLQRSFAVYTMGTM"
     gene            complement(<300282..>302399)
                     /gene="NCL1"
                     /locus_tag="KLMA_30139"
                     /db_xref="GeneID:34715426"
     mRNA            complement(<300282..>302399)
                     /gene="NCL1"
                     /locus_tag="KLMA_30139"
                     /product="tRNA (cytosine-5-)-methyltransferase NCL1"
                     /transcript_id="XM_022818634.1"
                     /db_xref="GeneID:34715426"
     CDS             complement(300282..302399)
                     /gene="NCL1"
                     /locus_tag="KLMA_30139"
                     /codon_start=1
                     /product="tRNA (cytosine-5-)-methyltransferase NCL1"
                     /protein_id="XP_022675281.1"
                     /db_xref="GeneID:34715426"
                     /translation="MARRKNQKKGQKKTFGTRDDSNNQKNWTELVKENAKWESYYKDL
                     GVIPEEEWDTFKKTCQTQLPLTFRITGSRKHAKEVLQLFQENHLPNLTNVVWEGETVK
                     PPMALPWYPQNLGWQLDVSKSVIRKNEQFSRMQRFLVVENAVGNISRQEAVSMIPPIV
                     LDVKPEHYVLDMCAAPGSKTAQLIEALHAESDEPSGFVIANDADYKRSHMLVHQLKRL
                     NSANLMVVNHDAQFFPRIKTANASGPVGPQFLKFDRILCDVPCSGDGTMRKNVNVWKD
                     WNTGSGLGLHIVQFNILDRGLNLLKEGGKLVYSTCSMNPIENEAVVAAALRKWGDKIR
                     LVNCDDQLPGLVRSKGITQWKVYDKQFEIREKGHENCLDSWFPPSAEEVEKFNLDRCM
                     RVYPHQQNTGGFFITVFEKIDTTSTPPPAATATATATANEEEQAQEPELKKAKVDTSS
                     TASHIQKKEKLPRDANEEPFVFVDPNHPQLAKCWSFYGIDDKFDKSSCLVRNATGEPT
                     RTIYHVATPLKQLIVNNEDRLKIVYSGVKLFVSQRSDIDCSWRIQSESLPIMKQHMHS
                     DRIVPGNMEMLKKLLTEAFPRYDDLIAENVDPEFVSKTQKLSAGCTFIKVDRNDPSKE
                     DLFLPIWNGSKCINLMVCKEDAHELLYRIFGIETTSKQNPKAEHMAKKAQEESANTEG
                     ESEKEPTVGTEAETEAEADVKTE"
     gene            complement(<302685..>303062)
                     /gene="RRN10"
                     /locus_tag="KLMA_30140"
                     /db_xref="GeneID:34715427"
     mRNA            complement(<302685..>303062)
                     /gene="RRN10"
                     /locus_tag="KLMA_30140"
                     /product="factor RRN10"
                     /transcript_id="XM_022818635.1"
                     /db_xref="GeneID:34715427"
     CDS             complement(302685..303062)
                     /gene="RRN10"
                     /locus_tag="KLMA_30140"
                     /codon_start=1
                     /product="factor RRN10"
                     /protein_id="XP_022675282.1"
                     /db_xref="GeneID:34715427"
                     /translation="MNANVYEACHNLVKGPNGTILSPDECLGLRINHICPIPLMTRDE
                     LHPRLPSIDTKVVHYFLTQLILQRYPHLVGRFDETSLITISWLLEKWIAEYLVLSGSE
                     KLSDGVSKQITKPINYRYSPADI"
     gene            complement(<303952..>304551)
                     /gene="EMP24"
                     /locus_tag="KLMA_30141"
                     /db_xref="GeneID:34715428"
     mRNA            complement(<303952..>304551)
                     /gene="EMP24"
                     /locus_tag="KLMA_30141"
                     /product="endosomal protein P24B"
                     /transcript_id="XM_022818636.1"
                     /db_xref="GeneID:34715428"
     CDS             complement(303952..304551)
                     /gene="EMP24"
                     /locus_tag="KLMA_30141"
                     /codon_start=1
                     /product="endosomal protein P24B"
                     /protein_id="XP_022675283.1"
                     /db_xref="GeneID:34715428"
                     /translation="MLLQFLVLLFAGLCNAHTVHLPAYGRRCFFETLNKDDELSVSFQ
                     FGDRDPHGTDQLTGDFILYGSQRNEVLKTLRDVSHGEVFVNAPYAGKFQYCFLNENSG
                     IETKDVTFNVYGVVYVDLDDPNTRTLDGSVRQLSKLVREVKNEQSYIVIRERTHRNTA
                     ESTNDRVKWWSVFQLVVVIANSLFQIYYLKRFFEVTSYV"
     gene            complement(<305796..>306731)
                     /gene="GLC7"
                     /locus_tag="KLMA_30142"
                     /db_xref="GeneID:34715429"
     mRNA            complement(<305796..>306731)
                     /gene="GLC7"
                     /locus_tag="KLMA_30142"
                     /product="serine/threonine-protein phosphatase PP1-2"
                     /transcript_id="XM_022818637.1"
                     /db_xref="GeneID:34715429"
     CDS             complement(305796..306731)
                     /gene="GLC7"
                     /locus_tag="KLMA_30142"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase PP1-2"
                     /protein_id="XP_022675284.1"
                     /db_xref="GeneID:34715429"
                     /translation="MDQQSVDVDDIIDRLLEVRGLKPGHQVDLEEHEIRYLCSKARSI
                     FIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLET
                     ICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPI
                     AAIVDEKIFCMHGGLSPDLNTMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSEN
                     DRGVSFTFGPDVVSRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFD
                     NAGAMMSVDESLLCSFQILKPASKLLERNVVRRKK"
     gene            <308467..>309135
                     /gene="YIP4"
                     /locus_tag="KLMA_30143"
                     /db_xref="GeneID:34715430"
     mRNA            <308467..>309135
                     /gene="YIP4"
                     /locus_tag="KLMA_30143"
                     /product="protein YIP4"
                     /transcript_id="XM_022818638.1"
                     /db_xref="GeneID:34715430"
     CDS             308467..309135
                     /gene="YIP4"
                     /locus_tag="KLMA_30143"
                     /codon_start=1
                     /product="protein YIP4"
                     /protein_id="XP_022675285.1"
                     /db_xref="GeneID:34715430"
                     /translation="MDTVESDTIQPDFIEADDAPLRDNNNYGSTFSTSQRGTLDESIA
                     ATFKRDVHEINDKLKKVVYPHFPLGGPTAQDQHVFQGTDLWAPLCFIILYSLFLSKGR
                     GKFSTFFITCWLLISTMATHLKLLNPHEPMSWMSYLSLAGYCVFPQVINSLACSIIFP
                     LINEIPKVSLVRLVVLARIASFALCSSWAIVSMCKVSNSQTFVKKYPLALCLIILGWL
                     PVIQ"
     gene            <309543..>314015
                     /gene="MDS3"
                     /locus_tag="KLMA_30144"
                     /db_xref="GeneID:34715431"
     mRNA            <309543..>314015
                     /gene="MDS3"
                     /locus_tag="KLMA_30144"
                     /product="negative regulator of sporulation MDS3"
                     /transcript_id="XM_022818639.1"
                     /db_xref="GeneID:34715431"
     CDS             309543..314015
                     /gene="MDS3"
                     /locus_tag="KLMA_30144"
                     /codon_start=1
                     /product="negative regulator of sporulation MDS3"
                     /protein_id="XP_022675286.1"
                     /db_xref="GeneID:34715431"
                     /translation="MPFLLPSNCSCYNLHLPHLDAAKAATLDECSIKRLSLDVRTGAA
                     TVLARSGIFVHGGLTIPLNLNQITSTNLQQELIMHFARELNDSSTFQNLSQWISREVF
                     FLDLISRRWERVTTFYADNDEDNDEDDEDDEDDDAGDDQYEGAAETETELQVEAEVET
                     EVNDDEYSFSSLKLSPRLTERLFHAICYCNESLYVFGGLTVSPNSDYEFVATNELWKL
                     DLHTKVWSLVSAEPAVTRRFNCQMHVLYESDAEKDTKLIVVGGLNNMDQPVEDVDVFN
                     LKTHRWESVEVWNNEDDLHDITLNVEGKRTPLVAEKNFSFLVEENEAQLPSLAVYSPS
                     IEESKPQTPTSPSHPNEQPTCNFQSEENPLFALPLMPETEGVRMHVYDVNDMRRKRLH
                     IAYNLQWPTGDKFGYNIIIAGFHPNLQPHNFHCFLYNITSGKWTRLNINCDDLHTSNH
                     RFWKLFLWESHHKALLLGSRSGNGALPSVQKFDKLLSFGLHITNLFHSAQTELKGTRS
                     LSGRKLQNSSTQTETDQFENYSRYVAPPSEITSIRSVFPSYSMVLGKDSLEVYNKLLA
                     DFEFITEDNESVAVPGFLLRKRWGRYFDTLLANAYVQITNDSKISEAYKHMSKNPSEK
                     PIPFSGSPHTSASVSSIQKDDKKPNSQGSLDTFFNRHRPSAQSVLSNPPSLHRKSACL
                     FFNTSPIASKSSDNNISSNQSSKYGPDDLTSTAISENLAVGTATSIPDPITSLEEVSE
                     QSSLRRQSTATSGVTSSSGGMVFRVPFRASGESSKKSTPPPVSLDPNEVSDPSKISGS
                     SSNRKNSESSYSAAYSDDYRRSNQSQSRKLSQSTVNDNLLHSSYGFNSPLSSRKASIA
                     STSSSFSHVSSTSDRMGESIYRSASADEVLSLNIALPSPQPAPCEPLPALPSHPPHDF
                     NVAKKSLDHLGIESRYRTSTSPLSSRRSSLHHDISQHISPDSIYHNRIDEVFNGDPLQ
                     KTDSKNDGITTPQNERYSFASNADSFNSQHPNNAEVDFEPLFMPRSLYMPWPTETVKA
                     FAEFFYTGQVDGKWPLTPVAVGLLNMAKLYEVPLLFDLMLEVFYSIIGKKEESLFIIC
                     KSVKESFLSRVSAAFDEDNEGMEEYLDNLKNYQDFLTVENSLNSIDDGYFDIDHLRKA
                     STAFSVSTVSSNNTQDPNDKLSGVDSPGYVPTVMSGSPRDSINSISSLQYPSTIFGGT
                     SSKKSSISHVQQRINNNPKHKSSLSKEVSTAGSQEEISRPSSSLQIKRESLEMHRIDD
                     ELDQVKNLLEEEASGKRKNPDQDDSGYSSDSDDLGVGLGLPSKSKIEKSFRERALELE
                     ESVDPLSRTSTEFSFSHSRGNNNLLSGKIRNDPAYNNQRIATLDSLASPNSLPPVDYV
                     MELIYESAVLVSDVKLMMRCMDCLHISKELKKIKRKLIQDITELEETAPKSRKAASNF
                     EIRTDSHENSPAPRYHSHPPSSAPSSSKSFEKITRTISNLTIGSSRSKTNASSK"
     gene            <314771..>322777
                     /gene="GCN1"
                     /locus_tag="KLMA_30145"
                     /db_xref="GeneID:34715432"
     mRNA            <314771..>322777
                     /gene="GCN1"
                     /locus_tag="KLMA_30145"
                     /product="translational activator GCN1"
                     /transcript_id="XM_022818641.1"
                     /db_xref="GeneID:34715432"
     CDS             314771..322777
                     /gene="GCN1"
                     /locus_tag="KLMA_30145"
                     /codon_start=1
                     /product="translational activator GCN1"
                     /protein_id="XP_022675287.1"
                     /db_xref="GeneID:34715432"
                     /translation="MSKWEEIEPTLYRDCHNSLLKVRLPALTNVLQWLKLEDSKTNEA
                     ALGQIFECVLGTYDFYQDKESKNAAISILVQLFEIDDSFLKKITDFVIVTGSSHSGGS
                     KAIMDYLNLMEWILVFMDLVFKKHDASFEAHWTDIIQAYIALVGAIETMLDTHETVKH
                     DENKQNQHRKRLRLCVFQQSTKSFARCLTLERDSNSNIVEDIIPFVLDNYVKLKLSNT
                     GIIVLLGSLVHSVLQCQSKKPIPYNSLEELTEKLVEYIGKEVILAKQPPSAFCLSVFL
                     SEFLHTFVTEEQVSKILIPSFEKANLRAPETSFAASSEFYSAFNSSKINFLGLFVSSK
                     CITQTISSLKSSKEIVRESSLKSLIALLRSLKTDSYDEKALEKLMDELFKSLKSNMNT
                     DYKITISSILVNTPTYSPQVSNIILNGLKNYISKESNEVALEKMLSAFFTHFFSSESA
                     DPATISTIKAGFNEKKLPLKKIWFNSFLIHSNSIKLDIADSFEEELIQHLKDIVSNPL
                     RNGEVSTLGCFVYIQRLFELEAEKTLSSIQSIIDENSESYGLMWAYTLLSNGVSFEQR
                     QIAFELFDKSFKRQPSFVGEVVLTALESAVRNSSELLSRISFRRSAPLFTVLSQPLSD
                     KEVSADILKKMLVLSQLSTVNLKNGWAGLVLNSRLDPAEVVRSSGEKMLKDMLADLSD
                     SKVVKSELRDAVVKAIAHISFINPEVISPLLAVAIKTNLNTSKLSAFATEDIQIWKGE
                     EGELVIDVLSAKSSAALTDKNSKDYEILKWQESIKKDQAKKGIKKLTKEEQKLVSDQL
                     KKESEIRARVDNFVVMIKSTIAIISQLTKDATLLDNGLANWFPASVNALLSILQQDNF
                     YSLFENIGFDLFLQLSFLLEDRLGMFSKTVGYATLLVYKVPHLLSELTADAKLQLIST
                     ALFKIKHGCRQVPFQSMALTYILPLLVKVMEIGKKVAIKNANKPANRSEFVEEEPEEE
                     QLLLALDIISSHGEAFQDTSIPRSSIISVLLSLLALPSKAKLAKEYFMTLCQNISMTP
                     TEEDLNLLLSSLLTPNQFVQATILEALDDEYDLQPYMSYSPEIYITCFSEDVNNRDVA
                     NFIWDSNQFKVTDELAQSLLKFFEQTDSGLRLFTAKAYASAVAQLEKENPGSFTRYFH
                     TLLDFYVQKAEPPKDILDEYGLVKVSAMDQKDPWEARSTTAIALKELCSSFEAYDGSV
                     VEFIHFLIDSGALGDKEELVRQEMKEAGIEVVDYYGSKYLKELMPIFESFLSTSNDVV
                     MKENVVILYGSLARHLEPNDPRIRTIAERLLTSLQTPSEDLQKSISKCLAALVPLFKD
                     SIQEYIDSSFQVLYDSKAPVQIRRGAAWGIAGLVKGYGIAALSEFDVIRYLIEGSEDK
                     KDPRRRESVAYGFECLSISLGKFFEPYVIEVLPNILKNLGDSVPEVREATAQAAKAIM
                     SSTTSFGVKKLIPVAVSNLDDISWRTKRGSVELLGNMAYLDPTQLSASLSTIVPEIVG
                     VLNDSHKEVRKAADESLNRFGEVIRNPEIQKLVPILINAIGDPTKHTEEALDALIQTQ
                     FVHYIDGPSLALIIHVIHRGMRDRSANTKRKACKIVGNMAILVDTKDLVPYLQQLIDE
                     VEIAMVDPVPNTRATAARALGALVERLGEEQFPDLIPRLLATLSDNTKSGDRMGSAQA
                     LAEVISGLGLSKLDELLPTILSGVTNYRAYVREGFMPLMLFLPVCFGQQFAPYINQII
                     QPILSGLADTDENIRDTALKAGKLIVKNYANKAIDLLLPELEHGMFDENERIRLSSVQ
                     LAGELLFQVTGISSKNEFDEEDGDFNSEIGKQMVEVLGEERRARILSALFVCRSDVSG
                     IVRATTVDIWKALVPNTPRTIKEILPELTSTIVVHLASSSRTLRLIAAQTLGDLVRRV
                     GGNALSQLLPTLKHSLETSSDPNSKQGVCIALHELIQSSNSDSLDEFQDFIVNIICST
                     VIDEDESVREAAASCFDVYQEVVGKVAIDEIIPFLLNKLKEPESSEYALSALQEIMAT
                     KSEVIFPILIPTLLKPPIDSFKANALGSLAEVAGPALYKRISTIINSVVNTLIETDDE
                     DTKHSLEGTLDKILLSVTDNEGLHPLLQQIMALLKHEDSSKRIVMLERLPNFFDNTVL
                     DYSIYTTDIVTNAILSLNESDSRIVEANFHALTSLVKNQDKPMLEKLIKPAKQALLMT
                     GKQGEDLAAFKLTKGPSCVLPIFLHGLMYGSGDEREASALAIADIVSKTPAAGLKSYV
                     TVITGPLIRVVGERFNSDIKAAILFALNILFAKIPQFLRPFIPQLQRTFVKSLSDPTN
                     EVLRLRAAKALGTLIEYQPRVDPLIVELVTGAKQSTSDGVKTAMLKALLETVSKAGSK
                     LNQSSKSNILNLIEEEMLSANDKLAVAYAKLIGSLASILTTEEAEKILRSKVLESSLT
                     EDSGKFGILTLNSFLRDAPEHIFGTGLIDECVAYMINAAESTNAHFSDNGLIAIGKAL
                     LLEGETKSPYSSGDVKEPFHLGEENIQKMVSELAKSMLKPNSNSLDSRRLALVVVRTL
                     ARFKFEEAIHSNYDILGPSVFSCLRDPIIPIKLAAEKAYLAMFHLVEEEGMETFNSWF
                     SKLEGSTVSNSIGDTLQLRSIGDYTKRVGKRLASVEREKISAGGDAEAMFSDRFEDEN
                     EIWAVGGIELNPDA"
     gene            complement(<323373..>324164)
                     /gene="SGF29"
                     /locus_tag="KLMA_30146"
                     /db_xref="GeneID:34715433"
     mRNA            complement(<323373..>324164)
                     /gene="SGF29"
                     /locus_tag="KLMA_30146"
                     /product="SAGA-associated factor 29"
                     /transcript_id="XM_022818642.1"
                     /db_xref="GeneID:34715433"
     CDS             complement(323373..324164)
                     /gene="SGF29"
                     /locus_tag="KLMA_30146"
                     /codon_start=1
                     /product="SAGA-associated factor 29"
                     /protein_id="XP_022675288.1"
                     /db_xref="GeneID:34715433"
                     /translation="MEDRWGIVVTQLQDLYKLNDVADFESLDPKNMNFHSMSVNQLSE
                     LQLSLENRHSVNEKMQNYCRELVENIAYIVEHYPVQQEIKSELEYGGVSGGGESSGGL
                     TGGGVGAGGVAGESSSVGRSFWTSQFNPSEPIEVGSDVAYKSKKTGEWIQCICTKVSG
                     DGLRFEVKDPEPDEFGKPGGIFKCNSKEILLIPPVTSKKSQLPNYPINTKVLARYPET
                     TTFYPAIVCGSKRDGTCKLRFDGEEEIDKETEVERRLVLPFPSRK"
     gene            <324807..>325898
                     /gene="MRPL2"
                     /locus_tag="KLMA_30147"
                     /db_xref="GeneID:34715434"
     mRNA            <324807..>325898
                     /gene="MRPL2"
                     /locus_tag="KLMA_30147"
                     /product="60S ribosomal protein L2"
                     /transcript_id="XM_022818643.1"
                     /db_xref="GeneID:34715434"
     CDS             324807..325898
                     /gene="MRPL2"
                     /locus_tag="KLMA_30147"
                     /codon_start=1
                     /product="60S ribosomal protein L2"
                     /protein_id="XP_022675289.1"
                     /db_xref="GeneID:34715434"
                     /translation="MFSSTWQQVPKFVVQQVRTATKRAAGSRTSMKDSAGRRLGPKKY
                     EGQKTQVGEIIMRQRGTKFYPGENVGIGKDHTLFALEPGYVRYYLDPFHPGKKFIGVS
                     LFEDVKLPLPHFEPRLRRFGKSVIEDEEKAAAEAAALPRKIYLIKDELIAKQKEREAK
                     REALMKEYRKILVEELKLDVNEQELALALPYLVRWKTCLKNGFSEEDSQFNAFYYLEQ
                     DLKLRMRDEESASKLQDQLAVLKQVSSKLNESVSFNNKLELIKYISRDEKSKLKEQLI
                     ADLKAIDIKDKNSKKLVLSKFENAKNFLSLSEEVKLRRKFLKPVKPETKLEEPLKPSK
                     KTITLRRYNYEAKTIDVVVRPKTDFLGKL"
     gene            complement(<326095..>326982)
                     /gene="ILV6"
                     /locus_tag="KLMA_30148"
                     /db_xref="GeneID:34715435"
     mRNA            complement(<326095..>326982)
                     /gene="ILV6"
                     /locus_tag="KLMA_30148"
                     /product="acetolactate synthase small subunit"
                     /transcript_id="XM_022818644.1"
                     /db_xref="GeneID:34715435"
     CDS             complement(326095..326982)
                     /gene="ILV6"
                     /locus_tag="KLMA_30148"
                     /codon_start=1
                     /product="acetolactate synthase small subunit"
                     /protein_id="XP_022675290.1"
                     /db_xref="GeneID:34715435"
                     /translation="MLRSRVVPQLAFRSLARAKSSSTSALAYKQLHKNRTRPPLPTIE
                     TPSWSTNSAISSILYETPAPSKEPKKQHVLNCLVQNEPGVLSLVSGTLAARGFNIDSL
                     VVCNTEVKDLSRMTIVLQGQDGVIEQARRQIEDLVPVFVVLDYSHSTIIQRELLLARV
                     SLLGAEYFEDLIHHHEQDSNKDTIERIRQKPYHPSNLPLSQVLRLKHEHLNDITNLTA
                     NFGGKVVDIAEQSCIVELCAKPSRVSAFLKLVEPFGILEVARSGMMALPRTHLNVSDE
                     EDTQGKINDIVDISQLPPG"
     gene            complement(<327846..>329093)
                     /gene="IDP2"
                     /locus_tag="KLMA_30149"
                     /db_xref="GeneID:34715436"
     mRNA            complement(<327846..>329093)
                     /gene="IDP2"
                     /locus_tag="KLMA_30149"
                     /product="isocitrate dehydrogenase [NADP] cytoplasmic"
                     /transcript_id="XM_022818645.1"
                     /db_xref="GeneID:34715436"
     CDS             complement(327846..329093)
                     /gene="IDP2"
                     /locus_tag="KLMA_30149"
                     /codon_start=1
                     /product="isocitrate dehydrogenase [NADP] cytoplasmic"
                     /protein_id="XP_022675291.1"
                     /db_xref="GeneID:34715436"
                     /translation="MAKISVKTPIVEMDGDEQTRIIWKLIKDHLIYPYLDVDLKYYDL
                     SIENRDLTDDSVTVQSAEATLKYGVAVKCATITPDEARVKEFNLKKMWKSPNGTIRNI
                     LGGTVFREPIVIPRIPKLVTNWEKPIIIGRHAFGDQYKATDVVVPGAGKLKLVFESDD
                     KSVENIDLDVFHFDEQSKGGVAMAMYNTTESITGFAHSSFKMALERNLPLYSTTKNTI
                     LKKYDGKFKDIFEGLYETEYKTQFEEKGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYD
                     GDVQSDIVAQGFGSLGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKETSTNSIA
                     SIFAWTRGLIQRGKLDNTPDVVKFAQLVEDATVNTVQEDEIMTKDLALILGKTERSAY
                     VTTEEFIEAVHKRLDSHFKTAFN"
     gene            complement(<329916..>330593)
                     /locus_tag="KLMA_30150"
                     /db_xref="GeneID:34715437"
     mRNA            complement(<329916..>330593)
                     /locus_tag="KLMA_30150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818646.1"
                     /db_xref="GeneID:34715437"
     CDS             complement(329916..330593)
                     /locus_tag="KLMA_30150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675292.1"
                     /db_xref="GeneID:34715437"
                     /translation="MKAAVFSDFDGTITLQDSNDYLTDHLGFGKEERRKVFAGVLDGT
                     KPFREGFRAMLDSVHEPLDKCIERLLAHIELDPGFVGTAEWCHEKGVPLVVISSGMKP
                     IIEALIGKLVGAERAKELQIEVIANDVKVDEATGEWHIVYRDDSPHGHDKARTIAECK
                     KKFAADKYFYCGDGVSDLTAARECDVLFAREGCDLVPYCDRHGIPYVKFNNFTEIREK
                     IEAEMSG"
     gene            complement(<332523..>333107)
                     /gene="SSP120"
                     /locus_tag="KLMA_30151"
                     /db_xref="GeneID:34715438"
     mRNA            complement(<332523..>333107)
                     /gene="SSP120"
                     /locus_tag="KLMA_30151"
                     /product="protein SSP120"
                     /transcript_id="XM_022818647.1"
                     /db_xref="GeneID:34715438"
     CDS             complement(332523..333107)
                     /gene="SSP120"
                     /locus_tag="KLMA_30151"
                     /codon_start=1
                     /product="protein SSP120"
                     /protein_id="XP_022675293.1"
                     /db_xref="GeneID:34715438"
                     /translation="MSWEEWHMREEHEMSKYTPEQFFDMHDMGNKGYFDAKDIINMYG
                     LQKEVVVGKGDGMGQNDESQEIDDGLRERVVKFVMALLDVDDDTRITRKEYLDYAAKG
                     NKFVDLGVGVGHHGDFETEYEMHHWNQYHKDQDPDIKNVHKEDVEHELLHHEHEVEES
                     EQGPAGATKGSVITDDEMESRIEKDRIPKKYRAN"
     gene            complement(<333554..>335771)
                     /gene="SPO1"
                     /locus_tag="KLMA_30152"
                     /db_xref="GeneID:34715439"
     mRNA            complement(join(<333554..335536,335667..>335771))
                     /gene="SPO1"
                     /locus_tag="KLMA_30152"
                     /product="putative meiotic phospholipase SPO1"
                     /transcript_id="XM_022818648.1"
                     /db_xref="GeneID:34715439"
     CDS             complement(join(333554..335536,335667..335771))
                     /gene="SPO1"
                     /locus_tag="KLMA_30152"
                     /codon_start=1
                     /product="putative meiotic phospholipase SPO1"
                     /protein_id="XP_022675294.1"
                     /db_xref="GeneID:34715439"
                     /translation="MRLLYFVLLLNCGFILVQGFSKVDCPKDASLRTAKNEQVSEGEA
                     RYLENRHKVIAKSFNRFYEDLSIPGIDIENINYPTISVAISGGGFRSMLISSGFILGM
                     HQHGLWECTSYVAGISGGSWTLLKLILADFDVSSLTKFDIERVMLEGIPNFDLKNHDM
                     IRQGDSGNDDQNNAKLLAMDAEFVRELRQQSIPLNKRDYNDEHTEQGEGYVPDYYQFL
                     DELKKIFDTTDQYPENLLKFDKRSMDALYKIKGLVEDFFHQDETDQDSELDMLNDLME
                     SFGKFRKTIGFYINLHREVRQKKEAGFPISFTDYLGQALIDRVPVGKLSSAKQFSNFL
                     QSKKVAGYEVPIPIIVANAKTSKRPDIRNVVFEFSPFEFGSWHQNVSKFINMEYLGSS
                     VEKGKLENCVKGFDSLGFITATSSSLFNNALLYIWKMVTTNIESNDKLKAIKTLFGVF
                     GIGLSQLRSDYAIYQPNPYYGDTDVLSSISGSSRLLLVDGGEDGENIPIRPLLVSGRE
                     NDVIFIVDSSSDKENLPQMRKLQDTYDNIVMVEKNRRLVAVDEEIYEMDPMPYIPTQK
                     ELLLSNYSLSAPIAFGCHLQSYSPIRNNKKAVASQEKSLNSDRQVFHMPPILIYHGNY
                     PITFQSNTSTFKLNYTKEEYNGMLNNGHHLFNNGDPQDEYLQCLGCVMLLRNNANQTS
                     SFCDECVAKICYN"
     gene            complement(<336256..>339390)
                     /gene="TEF3"
                     /locus_tag="KLMA_30153"
                     /db_xref="GeneID:34715440"
     mRNA            complement(<336256..>339390)
                     /gene="TEF3"
                     /locus_tag="KLMA_30153"
                     /product="elongation factor 3"
                     /transcript_id="XM_022818649.1"
                     /db_xref="GeneID:34715440"
     CDS             complement(336256..339390)
                     /gene="TEF3"
                     /locus_tag="KLMA_30153"
                     /codon_start=1
                     /product="elongation factor 3"
                     /protein_id="XP_022675295.1"
                     /db_xref="GeneID:34715440"
                     /translation="MSDSAQSVKVLNELFEKLSVATPDNRSAAAVEVASFLNGNIIEH
                     DVPEEFFANLKKALKDKKAAANALEAINHIASETGLSPSVEPYMVSLVPEICAKAGDK
                     DKDTQALAAAALLALSKAINPVAIKAFLPLLTNALESTSKWQEKVAILAAISSLVDAA
                     KDQIALRMPELIPVLSEAMWDTKKEVKQAATATMTKATETVDNKDIERFIPKLIECIA
                     DPSEVPETVHLLGATTFVAEVTPATLSIMVPLLNRGLAERETSIKRKAAVIIDNMCKL
                     VEDPQVVAPFLEKLLPGLKNNFATIADPEAREVTLRGLKTLRRVGNVGPDDALPEISH
                     AGDVATTRGVMDELLKDQKVAPRFEPVLTYIAAISADLIDERIIDQQAWFTHITPYFT
                     VFAHERTAKEIIDEFRKRAVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAKILLNKTQ
                     LRLKRARRYGLCGPNGAGKSTLMRAIANGQVDGFPTQDECRTVYVEHDIDGTHEDTSV
                     LDFVFMGDVGTKEAITEKLREFGFSDEMIAMPIASLSGGWKMKLALARAVLKNADILL
                     LDEPTNHLDTVNVAWLVDYLNTCGITSIIVSHDSGFLDKVCQYIIHYEGLKLRKYKGN
                     LSEFVKKCPTAKSYYELGASELEFRFPEPGYLEGVKTKQKAIVKVSNMTFQYPGTAKP
                     QISDVSFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTEGEVYTHENCRIAYIKQHA
                     FAHIESHLDKTPSEYIQWRFQTGEDRETMDRANRVINENDAEAMNKIFKIDGTPRRIA
                     GIHARRKFKNTYEYECSFLLGENIGMKSERWVPMMSVDNAWLPRGELVESHSKMVAEV
                     DMKEALASGQFRPLTRKEIEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAACTWQR
                     PHLIVLDEPTNYLDRDSLGALSKALKAFAGGVIIITHSAEFTKDLTEEVWAVKDGKMT
                     PSGHNWVTGQGSGPRIEKKEDEEDKFDAMGNKISAVKKKKKLSSAELRKKKKERMKKK
                     KELGDAYVSSDDEF"
     gene            340459..340548
                     /locus_tag="KLMA_R305"
                     /db_xref="GeneID:34718679"
     tRNA            join(340459..340493,340511..340548)
                     /locus_tag="KLMA_R305"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718679"
     gene            complement(<340765..>342771)
                     /gene="GSH1"
                     /locus_tag="KLMA_30154"
                     /db_xref="GeneID:34715441"
     mRNA            complement(<340765..>342771)
                     /gene="GSH1"
                     /locus_tag="KLMA_30154"
                     /product="glutamate--cysteine ligase"
                     /transcript_id="XM_022818650.1"
                     /db_xref="GeneID:34715441"
     CDS             complement(340765..342771)
                     /gene="GSH1"
                     /locus_tag="KLMA_30154"
                     /codon_start=1
                     /product="glutamate--cysteine ligase"
                     /protein_id="XP_022675296.1"
                     /db_xref="GeneID:34715441"
                     /translation="MGLLSLGTPLPWLESRQYNEHVRDNGIEQLIQSFRKAGGRDNDE
                     LYWGDEVEYMICEFDEAGENVVLSVEHDEILEQLNREYHEECERLNVHFHPEYGRFML
                     EATPARPYHLYEGVEVEKNMRTRRVVAEEKLQKLNRKSGNEVVPLSLTVFPRMGRDGF
                     TNLKDPWDHKNSASRSLFLPDEVINRHARFPTLTANIRTRRGEKVCINVPMYQDSRTA
                     PRDESIYERDWFVPEDLESAKASKPGHIYMDSMGFGMGCSCLQLTFQAPNIDKARYLY
                     DTLANFAPVFLAATAASPVFKGFLADQDVRWNVISGAVDDRTPYERSEEPLLPKYNNG
                     YGSIAPEEVPSVRRINKSRYSVVDLFLGGNGFFDAKFNDTEVPINEKVFKRLTTNDIH
                     PMDKDLARHFAHLFIRDPLVIFEERIEQDNMTETDHFENIQSTNWQSLRFKVPAQDAT
                     PNNKKAPGWRVEFRPMEVQLTDFENAAYSNFIYLVIESILTFSDKINAYMYMSEIWEN
                     METAHRRDATLKEKFYWKSDFADTQGKTELLTINEIFHNAHNGIFSVFINPILVHKGL
                     VSKSWTELLHNSGDNADLIRLYYYLKLISDRASGVLPSEASFIRSYVLNHPEYDHTSN
                     VTKKINYDLLHLSYRISHYDNSKGELTALLGQEIATYLINNSIL"
     gene            <343549..>345225
                     /gene="LSB6"
                     /locus_tag="KLMA_30155"
                     /db_xref="GeneID:34715442"
     mRNA            <343549..>345225
                     /gene="LSB6"
                     /locus_tag="KLMA_30155"
                     /product="phosphatidylinositol 4-kinase LSB6"
                     /transcript_id="XM_022818652.1"
                     /db_xref="GeneID:34715442"
     CDS             343549..345225
                     /gene="LSB6"
                     /locus_tag="KLMA_30155"
                     /codon_start=1
                     /product="phosphatidylinositol 4-kinase LSB6"
                     /protein_id="XP_022675297.1"
                     /db_xref="GeneID:34715442"
                     /translation="MTGGESSSLLRPVASRNTYEWLKYQDEPHYEYGTEHSMNTIDSI
                     GRWTSSLWSDAASHVSHGSSHGGVSQGYGTIDGNSGHLTASADDSGAHNRQQRLKIEY
                     SVFQPSIKSGPIPKPLDTKPHFDTVVEDCMVAIEVQHIELQRINAGSSGSYFVFGTEN
                     SKEPNGVFKPKDEEPYGPFSPKWTKWLHRTFFPCFFGRSCLIPNLGYVCEAAASLLDS
                     RLRIGLVPHTEVLSLSSTRFYDYRNHWFCGFKPRLQNKIGSFQLFVHEYMSADEFLSK
                     YPLPTMFRDHFSTHGNQNPEGFHWNNYTLKQFRLQLEKLIILDYIMRNTDRGLDNWMV
                     KVYQNESNGKWEVKLAAIDNGLAFPWKHPDEWRSFPYGWLFLPLSILNVPFSNQTREH
                     FLPILLHTKWWEETYREFTSLFAMDSEFKASLWKKQWSVLKGQAFNVVETLKDPRCGP
                     LELVKRTPCLVVDGLMEYTFYPTQETTLSHSLAESLPKQSSPMIVGSIPNLIDEHKPS
                     QPNNQDNDNSNSNSNLNPIEERTPTHPQKKTVIIERLQICNSKQPLFTWW"
     gene            <345623..>347776
                     /gene="CHS6"
                     /locus_tag="KLMA_30156"
                     /db_xref="GeneID:34715443"
     mRNA            <345623..>347776
                     /gene="CHS6"
                     /locus_tag="KLMA_30156"
                     /product="chitin biosynthesis protein CHS6"
                     /transcript_id="XM_022818653.1"
                     /db_xref="GeneID:34715443"
     CDS             345623..347776
                     /gene="CHS6"
                     /locus_tag="KLMA_30156"
                     /codon_start=1
                     /product="chitin biosynthesis protein CHS6"
                     /protein_id="XP_022675298.1"
                     /db_xref="GeneID:34715443"
                     /translation="MNMLWKSKKKKSTSRPGSVVLTDQNGGAIFDDLPGEKKRMDDNP
                     RIMESQFGESLGLRMSSLRKLLANDTVSLGFPDLVHVAHYDKSRKDEIGEYHYITGID
                     CSSEAMPIGYLSTLRLSQNWANETISTFCCYNLFSKLDLRIKFENEKAFQVSAIECSS
                     GTQHVPMSEVLWKETFISGVIRAMIFNKDREWKLPGMVEVPVGIDNGIGSAQSIVKSF
                     CEFIPRYKETGTDLSHSPHVSPLNNYLVDALLSFLAMTPRLHHYCISILEEFTESDPK
                     HAVLYQLVKCKVAFKSENSDLLTASSINALVNGYFKDVSKLKKSQLIMLTDLLNLQTE
                     FLIKKSDYNLALPVALYATQLVPDTFNSWYNLADCYIHLKDYESALLAINSVPKLLIM
                     DPCKDAYWSVGFDKLYYRKPQGQGATSSLSSHEYNYALTKLRPVKEKDMNDIVFGKII
                     MPANSYGCVKSIFENACAQIGPVYGPKSNNLIDFVSNEEIGAVAYTALLERNSLKNKL
                     PWYMQQMYRLLMKIVNLLGWNGLLELRSSIFVMESEHLDYQKRTNPSLRKKRMCEKWL
                     DTLFMEVYQDLKVSLNSPALKDSKSSGLEWELLGLLLVKTANWNEAVACLRTSIMARF
                     DVVAADTLLGLFLSETGKFPLTIDEILSILLGNCSYHSRFYDACQWQNLQVLYKLNEE
                     FGTETLRNRIYAHPMAEKGIVTLIDKCLDWIQQFA"
     gene            <348464..>351793
                     /gene="SAP190"
                     /locus_tag="KLMA_30157"
                     /db_xref="GeneID:34715444"
     mRNA            <348464..>351793
                     /gene="SAP190"
                     /locus_tag="KLMA_30157"
                     /product="SIT4-associating protein SAP190"
                     /transcript_id="XM_022818654.1"
                     /db_xref="GeneID:34715444"
     CDS             348464..351793
                     /gene="SAP190"
                     /locus_tag="KLMA_30157"
                     /codon_start=1
                     /product="SIT4-associating protein SAP190"
                     /protein_id="XP_022675299.1"
                     /db_xref="GeneID:34715444"
                     /translation="MSGSFWKFGQNYANEAPLTKLLNKAFFRIHDGDDGKSSGKAGVK
                     HRSELASESDSDCISGEDDYLSTGDEAKHGKSDSDEDNDDDEDNDEGNERLRGNSSKN
                     DGEQGDEDNGDEDDDDDQVSISENNFEYKDYRPNLDILDDLLDDEELYTELMCSNFKL
                     LVFFRYPEVLAKLVDYVTNEHVLEQVDEGQQEEDEDEEHKHAQIGLGDRASGVAQTFT
                     NVDESEQAFDSETKEGDDYDDHYTTIAKNGDSDDEETNAASSQNQTQLDAGADNASES
                     SAETSITLPPESEEQVESRRARIAAEILSADVWTISSAFMDNEDLLIKLWSTLEHPAP
                     LSIIASTYFMKINERLLDMDINGMINFILKQDNIVDRFIAHIDNPPLMDFLLKVISTD
                     KPDAPTDIIALLNKQNLISKLLDYLSMDYDSSIQSAAGDFLKALITISANSNNEIASA
                     IGPNELTRELVSPEMVAKLVKIMLQGGTSLSNGVGIVIELIRKNNSDYDFVQVMYTTL
                     ETHPPTDRDPVYLGHLVREFATHMDKFNKILVETKLDPLETPFGTIEPLGFERFKICE
                     LVAELLHCSNMGLLSEPSGESIVRERDLKRKEILRRMELDQNDMLQTRDSDENDSPLE
                     KTESPADELQKDMQNLHIKNANNAEGTEDVEDVEDVGNVEDVDASSADRDDLHSESSS
                     GSEVTEKTLRENPVVGDLLKISLQDNNIITTILGMFFKFPWNNFLHNVVFDIVQQVFN
                     GPLKTGYNRFLLADLFSSAHITEVIMNGDRDCVNYEKETGIRLGYMGHLTLIAEEVAK
                     FAAYIDEANVSFDCPVVMEGLNEPKWKEYCDTILTETREKYSSLLGEDGIEEGENEEA
                     EDEIYDEDLGNDDEKRFLNVSESMHFDNDQGDGDENAVLGGDNCFVYEDSMGNKTKIQ
                     VHMDENEKDASYTADLNKFSNYMSNQIKSGLNMADSDEEEEAEEEDEIWNGQSSNTFQ
                     PQVPNKAFFNNSMFHSHQFDLSPDDEEDYLDPNDDGQSYAKPNHPLYSSMLSPGGIPY
                     NAGEDDLNDLDVNDEDDDDEDDDEIDEDMDANRRMRRLHDEYTLHRTSSNDKIVYNES
                     EKDSAVLGLPSLQRSNSYDTE"
     gene            <352335..>352988
                     /gene="PHS1"
                     /locus_tag="KLMA_30158"
                     /db_xref="GeneID:34715445"
     mRNA            <352335..>352988
                     /gene="PHS1"
                     /locus_tag="KLMA_30158"
                     /product="protein PHS1"
                     /transcript_id="XM_022818655.1"
                     /db_xref="GeneID:34715445"
     CDS             352335..352988
                     /gene="PHS1"
                     /locus_tag="KLMA_30158"
                     /codon_start=1
                     /product="protein PHS1"
                     /protein_id="XP_022675300.1"
                     /db_xref="GeneID:34715445"
                     /translation="MASKKASVFSFLPLYNLVSALAWGYVLYQVIDVYPKIGQPAFFI
                     ATKDLVTAVQCGAIVEVLNSLFGIVRAPIVTTAAQIASRLLVVIGIFKYLPEAENAHK
                     IYYVTLLSAWSIAEIVRYMFYFFNLVSEAPKLLVILRYNMFYVLYPLGVGSELLIVYS
                     ALNIAEAKYNTYYKWFLIAGMLAYIPGFPVLFTHMVAQRKKVMRSLREGKTKTTKKA"
     gene            <353352..>353840
                     /gene="MRPL49"
                     /locus_tag="KLMA_30159"
                     /db_xref="GeneID:34715446"
     mRNA            <353352..>353840
                     /gene="MRPL49"
                     /locus_tag="KLMA_30159"
                     /product="54S ribosomal protein L49"
                     /transcript_id="XM_022818656.1"
                     /db_xref="GeneID:34715446"
     CDS             353352..353840
                     /gene="MRPL49"
                     /locus_tag="KLMA_30159"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="54S ribosomal protein L49"
                     /protein_id="XP_022675301.1"
                     /db_xref="GeneID:34715446"
                     /translation="MLRNFSQLLGRPLRPLAGISTSIKPLNLGFVRKTHSEVEKKSSK
                     VDLTPLKLANELYAIFRIHNRPYLVTKGDKVILPFKLKQAEVGDVLNLNDVTTIGSRN
                     FKLVDEPIDTELYTLKATVVEKTKRPLRVREVTKRRNRKVRHATNKADLTVLRISELK
                     VN"
     gene            <354184..>358218
                     /gene="BCK1"
                     /locus_tag="KLMA_30160"
                     /db_xref="GeneID:34715447"
     mRNA            <354184..>358218
                     /gene="BCK1"
                     /locus_tag="KLMA_30160"
                     /product="serine/threonine-protein kinase BCK1/SLK1/SSP31"
                     /transcript_id="XM_022818657.1"
                     /db_xref="GeneID:34715447"
     CDS             354184..358218
                     /gene="BCK1"
                     /locus_tag="KLMA_30160"
                     /codon_start=1
                     /product="serine/threonine-protein kinase BCK1/SLK1/SSP31"
                     /protein_id="XP_022675302.1"
                     /db_xref="GeneID:34715447"
                     /translation="MAFLKKKSTSGGHSRSGSASSILNKHVDPANISEFYPSVSEHKT
                     ATGLKNDYTLDSSSKSSRKSSGGSTNSLTSEKLLFNWDVTDPSQWTMPRIIQWFRSND
                     FNEQWINFFKRNSISGNKFLKLLAYDNFAPYEKNLTHSKTSCYERFQYLLKKTLEENV
                     VKGNNRNGNRIINNSRSSSESAKINQRLPKSFSTHIRSTSESALLGNKAADSVAEQQQ
                     NGGDANGHKKHNSNEHNVPLRHTKTNSASALYRRSLISLRNSSTTKEPTVKNDIKITI
                     PPRPFSSIENNSSKSPPVPAPVSPSHSAYSGIFKRQLKSSSSESSLFNAIFGHAPPEE
                     SVENTETTTPKVQENKRTSIPPMAYSSPLKLNPYTADEKATLWDKIKRKGPPTEESPT
                     YTSSNPIIEEGRESSTPSPNTVQISEDMYPKKASNSTALFILITKDNSTFSPFNIRPF
                     LQKDVHEFKRALALALGITHLNFTVHLTDFGAEYGSKIPDNLLEMLQKVSFHNVPKKL
                     YIKDMEKIVPTRARTETLNSQHSVAASSISKSSVKSGASNTSTGEGSSSDLTSIDDQS
                     SSHRRTYPHTPSHYYDNNASSEADYWSFKDATPELAPDPVPAILPKSRPSIKLNSAAV
                     NTSSSQKSTFRIIRKASDTDIDFNKRRESPYARVPELAPKRKAPKPPISSSTSTVNIP
                     TTTNEQSPQTEIPSTTKLELNSDSLKLKKKQRPPPPITTYLNTRLSVSSSSSKDQEDL
                     KVSPVQPFTPASTQVMIPQPYKGALETLKTRKSSSDLAVRPRMSMKRFSRSNSSVNRN
                     VLSSSRQSINRTNSKTLINSSTAADVFDENEISFADAPGLSDSDDHSMSSDEIIWSKN
                     EKSSPKNDVPEFSFNGEESVDMVGSDTTQVSTGENTNTLTPKKMALRPSPDVVYQNLE
                     KFFPDADLDNPILEGLTPPSSPNVEKSPSNSKEFGVAKAKQEQNPPFLSTREDSSQFL
                     TPVSTLKPPRRTKTIRIIAQEASEARKNDVSMKLKRKNTKMWGTKVVEITDKRTISIN
                     KARNSKGEYKEFAWIKGEIIGKGSFGAVYLALNVTTGEMMAVKQVTVPQFSSQDESVI
                     SMVEALKSEVSTLKDLNHLNIVQYLGFEEKEGIYSLFLEYVAGGSVGSLIRMYGRFDD
                     QLIRHLTVQVLRGLAYLHSTGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNS
                     DMTMRGTVFWMAPEMVDTAHGYSAKVDIWSLGCVVLEMYAGKRPWSNFEVVAAMFQIG
                     KSKTAPPIPDDTKDLISASGKNFLDMCFEINPEKRPTADFLVSHPFCKTDPSFDFSKT
                     KLAQFIRSNDKLNNSKLRISSQEL"
     gene            complement(<358398..>360317)
                     /gene="TOK1"
                     /locus_tag="KLMA_30161"
                     /db_xref="GeneID:34715448"
     mRNA            complement(<358398..>360317)
                     /gene="TOK1"
                     /locus_tag="KLMA_30161"
                     /product="outward-rectifier potassium channel TOK1"
                     /transcript_id="XM_022818658.1"
                     /db_xref="GeneID:34715448"
     CDS             complement(358398..360317)
                     /gene="TOK1"
                     /locus_tag="KLMA_30161"
                     /codon_start=1
                     /product="outward-rectifier potassium channel TOK1"
                     /protein_id="XP_022675303.1"
                     /db_xref="GeneID:34715448"
                     /translation="MNRTRTNGSGRRSVSAPNINSNSNSNFGLPSRALQESVKFKQER
                     IAVLNTDPSSKSFIIWFGVSCYFPVISACLSPLSNMISMAGAVDHWRINPETGHQVDD
                     PSSVRTLNIISLLSGVIANFVLLLNFSGRLGYVKAQLICITAWIVALVVLTIALIMCT
                     TRDYDQGYQRSIGYWFAVITACLYFICVSLLSIHFIGYLKKKYAATFNLLENERLLMS
                     FTFVFSIWFLWGSALFSRLLHLTYGNSLYFCVVSVLTIGLGDIYPDTTASEIMILIYS
                     LIGVIILGLVIAMISGIVSSSSGPIFFFYHVETQRTRLYKKYTENPDPNFTDFKAFES
                     IRNIRERSKSRQHIHAIILSLFLFLLFIFLGALVFYLAESWNYFESFYFCILSLITIG
                     YGNLCPITGCGRAFYVLWCIGAVPLMTVLISTVGDSLYRCSRTIDRRIRRYIYFEKPS
                     EAQTLSFKNIILQFLSPRNYPPKADESVLPVSSATEASASDPVDLERNSGNDISTLSE
                     TSTKSNSYSARRRSNKARLLSLEDTMKEESPFAKITEMRKLLDDLKEIDVISIENEDY
                     EFTYEQWVKYLRLEKRLNQSQSKLFWISEESPLRYPFKQSLYLTYRLSDMLNEILDDL
                     LEDVEIGEMKSHDHT"
     gene            <360769..>363984
                     /gene="SRS2"
                     /locus_tag="KLMA_30162"
                     /db_xref="GeneID:34715449"
     mRNA            <360769..>363984
                     /gene="SRS2"
                     /locus_tag="KLMA_30162"
                     /product="ATP-dependent DNA helicase SRS2"
                     /transcript_id="XM_022818659.1"
                     /db_xref="GeneID:34715449"
     CDS             360769..363984
                     /gene="SRS2"
                     /locus_tag="KLMA_30162"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase SRS2"
                     /protein_id="XP_022675304.1"
                     /db_xref="GeneID:34715449"
                     /translation="MAVGVAASDSYLENLNEAQQRAVMFDHKKALQIIAGPGTGKTKV
                     LTARFAYLVLQKGIQAEDIVMTTFTRKAAEEMKERLLPVLVSHGISPHGLKIGTFHSI
                     CWKLLKEKGFLIGREKIERATTEKIKSVLEEIIVEMPDQIRDYATTKSYRNSVSLCRI
                     KNNQWQVHPDMILKRISELKADAMTPEKYGQQAVFDEALLHFYQQYQAKLSKENLIDF
                     DDVMLYSFELLSKHRVWKNIKHVLVDEFQDTNLLQINLIFQLARGSHHSCEGVTVVGD
                     PDQGIYGFRSALSHNFQTMIELCPIQYDQIVLTENYRSAQSILDISETVIKQQKNGRD
                     NREPLRAQFVTDSKPVFMSFPSNEIEAYTIAKEILYLKAIPELFQYKDFAILVRLKKS
                     LRAFENALIAHKIPYVIQKGYTFWELKECKAIIRYMSMICNDDDWESLKRTINYPSRG
                     VGDTTIGKIAAALEKVRAEEKTQTAFGFLQNIARGNVQLNLNSSSLIGIKEYVKTIEQ
                     LRKIFSVINSDASKETLADSFEKIYTLSGLKSQYAPNNESEMDLEGKESGKEIHRHRN
                     IINVKNYFSTFKIPAAEDGKSRDVVPLIEFCREFVSFTDLYTFKEDNDSNDHNDSKED
                     HLSKDAVVLSTIHASKGLEWPVVFVPQCVEGLLPSYYKDVNEMQSIDEESDEEIQSLA
                     VGNDGNESQDEGAENAITSSPSKKKTRTTFSEERRMFFVALTRAKYFLYITTVEKEAT
                     IFKSRFLKNEVIELCDETLTCFESIEQLFKLYYTMKVKIPNQDRISYEQLIQDYNNYG
                     SNNRQLIFWKDKKYSHVDLPNTTENTVGIATKKNEVKSSLPYSALPRVNRKRQTKEQT
                     EPLRRPADIIVNQNNTTDRFVADNPNSAGIVPSLSPTKTRLTREETRELDVLLSDNEF
                     LPEAPIKSEVDYTAAEILHNKEETVVDNRPILTSARILASAIKQELSQSLPSVDLSST
                     ESQASNIKEEDSVSHFKGKVPKNPREQSKNSKTSSASSSQNKAKKTPRTGSVKKKSKK
                     SNTTKVKLEHKPTNDILFRLERAKQRKEEWDGEIIDLRSSQ"
     gene            <364339..>367251
                     /gene="SRS2"
                     /locus_tag="KLMA_30163"
                     /db_xref="GeneID:34715450"
     mRNA            <364339..>367251
                     /gene="SRS2"
                     /locus_tag="KLMA_30163"
                     /product="ATP-dependent DNA helicase SRS2"
                     /transcript_id="XM_022818660.1"
                     /db_xref="GeneID:34715450"
     CDS             364339..367251
                     /gene="SRS2"
                     /locus_tag="KLMA_30163"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase SRS2"
                     /protein_id="XP_022675305.1"
                     /db_xref="GeneID:34715450"
                     /translation="MEELIKGLNERQRLAVTHRETDVLQVLAGPGTGKTKVLTARFAY
                     LVTEKKIHPLRIIMTTFTKKAANEIKERLQPILKEVGISADGLLIGTFHSICSRILRQ
                     AGHLINIPKNWSIAKSEDFSTVIKTILEDMPEYIIQSSRFTTELLDKRQNVNVIRNKI
                     ADLKSKGITPQIYLSDSTSDPAISYIYEHLQKMLLSEALLDFDDILLYTKILLENHTV
                     WPFIKHVLVDEFQDTNDLQLELVYLLSRGSHGSCSGITAVGDPDQSIYGFRFASSDNF
                     LKLKNRSPVEFNQVSLIENYRSAQSLLNFSDNIISQQLTERIKREPLKGQYDHRLKPF
                     FSHFERTDSMENNETNGIAHEIIYLLSLPNLYKYSDISILVRTRRQVYDIEKSLLKRH
                     IPYKVINSKAIWERKESGMFLDYLRVISQKHTTLATLRCLQFSTNGIGPATVKIIKQF
                     MDSHNGECSFDALKTLCNSKTLKGEKIMQALCSFVTNIEKLQKACQTYNSYDDMKELF
                     VQIYVLGKLYLVLDGTTEELDKKIYENKSRMVEFLESEHPTMFKIYEIFTEYQISNTD
                     ELISIKNDSDNLDDLELVYENHDNININILEVLNLFVKSVALYASEEEDFKNKSQRSS
                     EPNEKVTVSTIHAAKGLEWPVVFIPSINEGLIPFTDKSARQRLEDLAELRQEDRSEGD
                     ESDELVNNSTKQHLKEKEEEIMDDMAKILNEERRIFFVAITRAKHLLYLSSSGKKSVF
                     LEKCEPFYSQNTLLNDKETIEKFYNSIQKTLKEEPLKISLNKLCEDYRKYKKRRSKDL
                     IWNGEVINSFSSIDFSCNTKPINSIGVKHAFKPASSLLSINSPTLIKNNNSTRPNTTS
                     DVKRGETSSSNKNSDTLQANNKKRRVCIDMIFAKKTNNELKLVGKLSPKNVLSASNTT
                     VIKPNAPKNYKVPKTLSTPTPGKQKSYAPAYTPVRNNAAYISKRKGNTGGTKIVPK"
     gene            complement(<367339..>368667)
                     /gene="GWT1"
                     /locus_tag="KLMA_30164"
                     /db_xref="GeneID:34715451"
     mRNA            complement(<367339..>368667)
                     /gene="GWT1"
                     /locus_tag="KLMA_30164"
                     /product="GPI-anchored wall transfer protein 1"
                     /transcript_id="XM_022818661.1"
                     /db_xref="GeneID:34715451"
     CDS             complement(367339..368667)
                     /gene="GWT1"
                     /locus_tag="KLMA_30164"
                     /codon_start=1
                     /product="GPI-anchored wall transfer protein 1"
                     /protein_id="XP_022675306.1"
                     /db_xref="GeneID:34715451"
                     /translation="MSSIQDAADLKRRKEEFVTGHSGSSIADLRDVTLAGILCNAAWI
                     FIVSRNPWLKHSFWLDFSLNWLSLLFSVTIFGEQPLLTCMIALSALGVLTNAPKGMPK
                     QKEEKRNDGQSATLTVYRSTMLILTSFAILAVDFPIFPRKYAKVETWGISLMDLGVGS
                     FVFSNGIISYRRFKKSSQLSRLARIRESLRSTLILLVLGLIRLFSVKATNYQEHVTEY
                     GVHWNFFFTLSLLPLVSIAFDFFSMKLRFALGLIGALVYEYYLMSSPTFLDYLLNADR
                     TDFISANREGIFSFVGYCIIYLCGQQVGSIIFSNSDTMQTLWRLLRYTILSFLISYFL
                     INNHPLQISRRFASLGYSSVVTTFNLLILTCYHIIVECFAGGAFVSDTYVAVNKNGMA
                     MFLVSNVSTGMINFTFNTIDSSPSKSMTILIVYALFLAIFALKVPFKLKL"
     gene            complement(<368981..>371065)
                     /gene="DPB11"
                     /locus_tag="KLMA_30165"
                     /db_xref="GeneID:34715452"
     mRNA            complement(<368981..>371065)
                     /gene="DPB11"
                     /locus_tag="KLMA_30165"
                     /product="DNA replication regulator DPB11"
                     /transcript_id="XM_022818663.1"
                     /db_xref="GeneID:34715452"
     CDS             complement(368981..371065)
                     /gene="DPB11"
                     /locus_tag="KLMA_30165"
                     /codon_start=1
                     /product="DNA replication regulator DPB11"
                     /protein_id="XP_022675307.1"
                     /db_xref="GeneID:34715452"
                     /translation="MSGKGFRGLVFCPTSVPASVSDSICQKVTKLGGTFTKDLTRLVN
                     VLVVGELFTAKYNFAIKNRTDIVFVRAECIDELYEMWLSGQDLLQLAKFDMLKYMAEQ
                     YTVPPFDRFNIFIGRVGTCGGYTLEKLVELCKLGKVKRLDTDHFIRNSSSSKSAAGLM
                     TIFVTDDLSGHRVQAAMEEDVPVVHPKWIVDCMDRMGTLDFNGYYLLKNCQSLDYEEI
                     GAGSYIKVHKKQQKQDLPQQDQQNPLPGDSVAPLKIAIDKFKPQATQIWGKLLAREDR
                     SASRQGSVNPPAAAAAATVAAESVNQDSESIPVREKMLASTPGGSNIFADCHFVLYRF
                     EPRQVTILSSVIHGNKGTCSLFSTDSSPTKPGVFYICSSQYAATLLPDLPPGAQWLTE
                     FFIERCLYYEQLLAPDLWSQPFYNKFEFTPPQSLLHGSNLSFHITGFHGVELLHINKI
                     IEVLKSIGFEHHEKLTKKTDFLLVNISQLTSIPKEHTLRQNKYASMFRTDLDMKISLN
                     QAQMFKNSMKRKFEFVKTRHQIPILTPSFIIEMFHRSMKQNKPSVNIYFNDVNWCISC
                     PKGSKTDFMLQIIPKPVQQQQKQQQEKLESVSEMGTPAITRPSSAASSSAASEHINVP
                     HRESRWGKLLSNTLEKENEEPSFIQEDQESDPNNHDHITHTQITYGTAPKNVKRRKIS
                     TRSQVNDVISRV"
     gene            <372633..>374882
                     /gene="SIP4"
                     /locus_tag="KLMA_30166"
                     /db_xref="GeneID:34715453"
     mRNA            <372633..>374882
                     /gene="SIP4"
                     /locus_tag="KLMA_30166"
                     /product="protein SIP4"
                     /transcript_id="XM_022818664.1"
                     /db_xref="GeneID:34715453"
     CDS             372633..374882
                     /gene="SIP4"
                     /locus_tag="KLMA_30166"
                     /codon_start=1
                     /product="protein SIP4"
                     /protein_id="XP_022675308.1"
                     /db_xref="GeneID:34715453"
                     /translation="MPSVTDDPQGMKREQLVGPAGAGPDSDSAASSSSNYNNNSSSTN
                     TNHGNGHGNGNGTKKRKYGKVDRHNEKELLPTPLVKKKRFSQACDRCRLKKVKCDGLK
                     PSCTNCRKIGYHCSTSDKLTRRGFPRGYTEMLESEIIKLQRMCGLIDENGETVAEGSE
                     EQLRRLQNNMAMASDGTCNPSAAGNVNVNINVSQQNPNATDDIAKDQQPPASASTGSF
                     LPFINDTFHKFPNYIHDQVYLGNFTWNCIINANKPYLKSWQYNRSLVHDPVLSFLSLH
                     FPLSSSGVPTNIPLSTEDLMRLIDKYLHSNQIFPYLLGDSWHQRIMSVLTGSSTACDP
                     AVSIVLILIVQFELNCFPKETVFQAIKLFGALSQDRLCAIQLINFGIRYFMSQENSYA
                     VIWTNDLISFNQYMITNSALFLNYNNLVGHEHSTSKTIRLLTFYQFQIFQIWWSFING
                     LPKTNFLTDEFHPPLIQDFPPNLKMFQLVYDFIIQLDGCHLQLLVNKTNNKYQYLIES
                     FGYKLIYQWKVYHHLQDHDFKQIQLENNDLLEIGITLVYLVCRYLQQPKSIELSYEII
                     SLYWLILSDNSNVKPINSRILKTVQFMPLNNKQLIENCLVNLLNEPKQSFNWFKYKKL
                     LKRWVTIWMDDNDIFSKLISHYQLPIGMTDISPTVSNFKPLEIVMDPVADPSSLFKIY
                     NDVDNFIDDEGYEEDNESDYQELVILPKRRTIGHHHPSAKASSIHKNTTRTDFSLFNN
                     KIDHIIIKE"
     gene            <375491..>376411
                     /locus_tag="KLMA_30167"
                     /db_xref="GeneID:34715454"
     mRNA            <375491..>376411
                     /locus_tag="KLMA_30167"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818665.1"
                     /db_xref="GeneID:34715454"
     CDS             375491..376411
                     /locus_tag="KLMA_30167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675309.1"
                     /db_xref="GeneID:34715454"
                     /translation="MVKFSLPDPDSEDEIDLINTTAKKPTFKALSDEEDENDNSGKKF
                     KFKLKRNQKTNLIQEDTFEDDYSDLFVQKNENQKRNAQSAVQSMGNTVKVLNLEDLEG
                     SEEDPDDGQENDTKMSIQKKTVTFDPNPDSKVTEKSYVKLLSKQDKEDLKELGITAQA
                     DINTEVDDVLMMEDSLQDERLALGDKDNRLMQQRKRQEIEQLIALHDDRTLNETDLLS
                     DELQQLQKMSGKTTVLLPKLQPEQTTQELSTELTALAHQDTKEVLINKRIEALENKLQ
                     NLSVTKEKLLEEFFNTCKPKDQQNLATLNS"
     gene            <377030..>378052
                     /gene="ARG3"
                     /locus_tag="KLMA_30168"
                     /db_xref="GeneID:34715455"
     mRNA            <377030..>378052
                     /gene="ARG3"
                     /locus_tag="KLMA_30168"
                     /product="ornithine carbamoyltransferase"
                     /transcript_id="XM_022818666.1"
                     /db_xref="GeneID:34715455"
     CDS             377030..378052
                     /gene="ARG3"
                     /locus_tag="KLMA_30168"
                     /codon_start=1
                     /product="ornithine carbamoyltransferase"
                     /protein_id="XP_022675310.1"
                     /db_xref="GeneID:34715455"
                     /translation="MTTTEKSVGNFSIQSSSGSSIRHLVSIKDLTDDEFKALVDRAEY
                     YKKVFKSNDTAEFQKQHLKLLGKTIALIFTKRSTRTRISTEGAAAFFGGQPMFLGKDD
                     IQLGVNESFYDTTKVVSSMVSCIFARVNKHADIQNLAKDSSVPIINALCDRFHPLQAI
                     CDMLTIKEKLDYENNKLKMTWVGDANNVINDMAIAALKLGIDVSVATPPGIELEDEIV
                     EEAKKLATKNNCEFVATHDSLAACKDANILVTDTFVSMGEEFAKEAKLKQFAGFQINS
                     ELCSVAAPNYKFMHCLPRHHEEVTDEVFYSENSIVFEEAENRLYAAMAAIDIFVNHKG
                     DFFSEP"
     gene            complement(<378185..>380626)
                     /gene="TRL1"
                     /locus_tag="KLMA_30170"
                     /db_xref="GeneID:34715456"
     mRNA            complement(<378185..>380626)
                     /gene="TRL1"
                     /locus_tag="KLMA_30170"
                     /product="tRNA ligase"
                     /transcript_id="XM_022818667.1"
                     /db_xref="GeneID:34715456"
     CDS             complement(378185..380626)
                     /gene="TRL1"
                     /locus_tag="KLMA_30170"
                     /codon_start=1
                     /product="tRNA ligase"
                     /protein_id="XP_022675311.1"
                     /db_xref="GeneID:34715456"
                     /translation="MVEESVVELVEKLEAAASLKKHGRATKISCTVFNRPDIRLNSWK
                     FNEWDYGKSKIQLPINARGLFIVDDEANPRIVARGYDKFFNVDEMQQTSWSSIETNTE
                     GPYEITVKENGCIILIGGLEDGTVVVCSKHSTGPRDDVNRNHSLAGQQFLEKQLADKN
                     INIKDFGRFLYDNNCTAVAEYCDDTFEEHILEYTKDKAGLYLHGVNYNTPEFKTWPMA
                     KVVEFANTWGFKSIDYFTLEDEKSLRSFLTECEEKGHYNNQEIEGFVIRCSNKETKGT
                     FFFKFKFHEPYLMYRQWREVTREYISTKSRPIKFRTHNYITNKYMDFVIPLLEKDPQL
                     AEDFMNGKGIIKLRKMFLESYDMSGLEILNLDRIKELEELDKQTVDTINEKTKFLLIP
                     IATIGCGKTTVSLILNELFPETWGHIQNDNITKNKTDYIKCALELFKDGKQFVIADKN
                     NHQFRERAAVFEWVRQFKDTYVPYDSNVQIIALTFVEEVTKEMEELTIQRVLKRGDNH
                     QSIKSDSEGQQKTLKIMHGFMNRFQPFNPDKAPDSQFDFHIKLEVGKDSSMKNAVKVL
                     QDLKSHYGDVIPEVPEDSKIQEAFNRALEYKPVVRKIVKNGNKASKNQLKPIYFSASV
                     ESTTNLIQHVVETLKKNKSTLAPFLSDVSTIPFKNEYHVTLCHKSQIKSQGIKAKQLW
                     AKYTDRYRHLLIKDGGASEQPSKVIPTEDSVTFKLRDLIWDKYVIVATIVLPDEPIVD
                     NSNNHVSGLYCLNEVPHVTLALLSEEKKAVYAGQLAKEVYDFGINADAENDAGIIHFD
                     EGSEETFTAKVCINV"
     gene            <381079..>382938
                     /gene="EXO70"
                     /locus_tag="KLMA_30171"
                     /db_xref="GeneID:34715457"
     mRNA            <381079..>382938
                     /gene="EXO70"
                     /locus_tag="KLMA_30171"
                     /product="exocyst complex protein EXO70"
                     /transcript_id="XM_022818668.1"
                     /db_xref="GeneID:34715457"
     CDS             381079..382938
                     /gene="EXO70"
                     /locus_tag="KLMA_30171"
                     /codon_start=1
                     /product="exocyst complex protein EXO70"
                     /protein_id="XP_022675312.1"
                     /db_xref="GeneID:34715457"
                     /translation="MASIDVNEADVIIFSDGLKKLDALYHDMSESLSKISTSTSNASQ
                     LFKPIIKKNQQLKVLQYNIETSLNSVASVKDLANDASKHELILEQPISNVGLKPYINA
                     IHKIDDILEDLNERTQSNETSEFAGMVTHLRDLIVEGERNLQIYFSKLLNSIQPFDPQ
                     INMNKKIPFPYYDDEYLAQMSVILDYFENSTQKESMVDIFIKQRIRLVSQSLAFLEPF
                     TKQITTGPNVPYQKGSSGVNPYTEAMLGFIANENSLVQDLYSKEAARQPIIFGKLCSP
                     IVQNYLKIIKHNRQLLQKDKDNVGLFSFELSDKVNDVLRLLRGKNIPETESLNTELIE
                     IQRISHSLFQELFSYINTKTRSMSQVPSDNGVTEPTVDIMSRIRKFSEYKSGCLSTIQ
                     AMSRVQWLPKDPKIPWTISKSQESDYSSTALLSSFFGDSIDYLIFGLERRAQETLNPQ
                     HEIHILSNKRFPNIQRIGFFLLNNLSLIDQVVQRSEINSILGELGLQRLEKLRKKYIN
                     YYVSDWRDLTAILLDQTFVDSSGKISSKEKDQIKEKFKKFHDGFEDLVSRSKSYRISD
                     PALKKLLKQEIVSLLLPMYERFYNRYKDSFKHPRKHIKYTPSELMNVLNTIIK"
     gene            complement(<382947..>385709)
                     /gene="ALY2"
                     /locus_tag="KLMA_30172"
                     /db_xref="GeneID:34715458"
     mRNA            complement(<382947..>385709)
                     /gene="ALY2"
                     /locus_tag="KLMA_30172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818669.1"
                     /db_xref="GeneID:34715458"
     CDS             complement(382947..385709)
                     /gene="ALY2"
                     /locus_tag="KLMA_30172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675313.1"
                     /db_xref="GeneID:34715458"
                     /translation="MSDLERVRSPVFPSEMPIGIPRDATPLTKTSTLQVFIQLAEPTI
                     FLQGFGSTQWEGKPPAILRGSLILRVTKSTKLKSVNLTFKGTSKTEWPEGIPPKKQEF
                     VEINDIVKHTWPFFQADMQQVPNNQSTDPSDLLKGSNASLYRSFEEELGGNSTASFRR
                     PSLVKSVNSNSSNNGGRSLSPIGQFLRSTSKDIPNVKSVSETFSDILSISDVTSVKSN
                     GTGNGPSGSASPGTFIFHPGDYIFSFEHAIPLSYPETISATFGQVEYALLVNIERQGA
                     FKSDVNAKLPVTLVRTPSDSSVEETEPIAISRDWNSHLHYDIVIASKDIVLDAFLPIA
                     FRVTPMDKVSLHRIRVFLTETLEYYCKGKKVHRLEPTKKFLLTEHRAPPLKDIPPDAN
                     PTKAKYLGNLLEDEHGDLVSKEFEYQVFFPERLNYQQKIHPDTSYSTIKANHWIKISL
                     RLSKNVDGVKKHFEISIDSPIHVLNKLSSHANTLLPSYDTHALIPNHNSSSFGGFEFN
                     MYHHHDSNFYFPKQVVNSPVMSPDVQPLDEKIGLSPRSLSPVSHNKSNLGLFQHKNST
                     HSELSIADISLRNKVLQSPELSSNIYQPEHIHAELASPQAIPLSPITSPTWAPLPHNI
                     QGNGFGLSLEDDILPPFQEHMANSNCLPVHPPSYAESISTNTTNTTNTNDTSESKHSK
                     ENSESSSLRIPTIILPNNSNNNNNSNLNNQHDMNSEDIAEEFHFSGGENGSMNFPVAI
                     MRSRSPLDKASQSRRSSFSHRRRSSIATQDVLPSTIKNSSSSFNDLENVLSAAGNAEN
                     KNSEISPHSSADTIQKLEPTDSHPNSLSSQPLLLRQSTSQDDQESKGSLDLTTMLGVE
                     RTSWHPLQSDYSIAPVFSQSYSMNVLQTNHALEDFKHNLESYKQTESPSTPNTSDPID
                     HELVNT"
     gene            <385997..>388348
                     /gene="RAD4"
                     /locus_tag="KLMA_30173"
                     /db_xref="GeneID:34715459"
     mRNA            <385997..>388348
                     /gene="RAD4"
                     /locus_tag="KLMA_30173"
                     /product="DNA repair protein RAD4"
                     /transcript_id="XM_022818670.1"
                     /db_xref="GeneID:34715459"
     CDS             385997..388348
                     /gene="RAD4"
                     /locus_tag="KLMA_30173"
                     /codon_start=1
                     /product="DNA repair protein RAD4"
                     /protein_id="XP_022675314.1"
                     /db_xref="GeneID:34715459"
                     /translation="MNSNSHGGATEGGNGRLSREYFDLVRDALKEERKSKRPDRPLKR
                     RKTQKPEVITIDSSSEEEPNANANVDDDGGDDFEFDEDEDYDSEEFEDVTTTTTAAEK
                     DGDISITIDARTAEKPQKKGGKRKSGNGVDAKLKEYRKTFHMFVLMTYMCHSFIRNKW
                     CNDEKLQKKLSKLVPDEIFNNLHPPKDEQMPARSTRKLLDALRMAMQLWNKKFSVQLT
                     SPYEYTHLYMVRWDSVVKHECKPVSFKQFKKFFSKMRGPCNISVQGFVTMMRGCGLNA
                     RLLHNIQPPDFTDAKKYEKRVSWRLENECLKYPIYWCEVWDKFAKQWITIDVVGQEII
                     EQVRTKSKLEAIGRKNLEFNMMRYVISYDRKLGCKDVSRRYISHLQNKVRKKRITRDP
                     GLRDWYSQVINTLNKRSRNRTDDYEDEYFALRDEQEGIPDNLQDMKNHPFYVLEKDLR
                     ANQVLKPNAQHCGFLRLRNKENSLLKVYSRKDVISCYSARHWYMQGRVLKTGAKHMLT
                     HRVKAAMPDEDEEEERLYPIDQTEYFIPKQVGEDSKIPTNAYGNIDVYKPWMIPIGCC
                     LVENPNSIKAASFLRVPFAKAVTGFKFESGRRVKPKITGVVVENEYVDALIAVIDHIE
                     EYNADVARHELEIEALNGWSLLLTKLRIKSRLVDQHGVVQDEEEEQIAHQNSNTSSTS
                     ASDEEETQFEAGGFLLDSTAEPGGFLPEPEDAPEPEPEPEPETNYRPEPDAGHTTSEH
                     ESTQHPNESVNNIEDYEQFLQEVGSDYESEDAGDDSSFEYESE"
     gene            <388562..>389527
                     /locus_tag="KLMA_30174"
                     /db_xref="GeneID:34715460"
     mRNA            <388562..>389527
                     /locus_tag="KLMA_30174"
                     /product="protein SPT2"
                     /transcript_id="XM_022818671.1"
                     /db_xref="GeneID:34715460"
     CDS             388562..389527
                     /locus_tag="KLMA_30174"
                     /codon_start=1
                     /product="protein SPT2"
                     /protein_id="XP_022675315.1"
                     /db_xref="GeneID:34715460"
                     /translation="MSFLAKLQQLKQSAKVPEPGKSGNDQKKPEVKSLDSSRLLPKNY
                     VREVDPAIKRLKEARRLKQGVLETKTTKSTSKTRHKDSSPKSELPVYKKKPGSNTATA
                     KPVYVPKKEPIKKLSFEELMKRAEQKPKTVQNESSRPKPVDIKKAGFKSRTNSRSPSS
                     SSRSVQRVEKPTPKSHHEHNVHKRKVVVESFSRIAQPNEKLAKKLKLKERRNEDLRRR
                     NQRYDSEDEDLSDFIEDDEVDRSEDTSNGVPYDRDEIWSIFNKGGRRRYYDYDDEDDD
                     MEANEMEILEEEEMAAKMARLEDKKEEAWLKKHEAEKKRLKKNHS"
     gene            complement(<389685..>393188)
                     /locus_tag="KLMA_30175"
                     /db_xref="GeneID:34715461"
     mRNA            complement(join(<389685..392295,393154..>393188))
                     /locus_tag="KLMA_30175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818672.1"
                     /db_xref="GeneID:34715461"
     CDS             complement(join(389685..392295,393154..393188))
                     /locus_tag="KLMA_30175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675316.1"
                     /db_xref="GeneID:34715461"
                     /translation="MPRTAQNAQNSPKHPTKSVTTQYHITTLAGLSGVEAAMKFGSQI
                     LVKSVPEWKLNNIDYQQLKTGIKKCTTVRENFHPANAAEDPELRSLEKLFRSQFEMIN
                     VFVSMKLKECSTRIVSIENYLTQVGNIKDENKQLRRIKLINHHLDRCNFELQKLSRYL
                     ILQKIAIRKLFKKFLKHYPYGKDVAQEFIDSLKNCPELKEGHDGVSLLTVDLDPYLLE
                     ISLIVDILHELEVNSGHEPQQSLRHPLPVSSNNTTLVTRPSTADSVHTESIPSSSRKT
                     SIASPLNNIDSTLSFDHLFVGRFHHVKSFLISQESEDEIKFMLVKLGFCLFDNTVMAT
                     SKKILSGNDSLIKRKNSIKSLHMLRDASIGDEPAASTAGQPQQQQQQQPEAVNNVNQE
                     TITHNIQFEPLAKAGVSTANLYASTEENLFPNMLVSYPNSEECVLLCHVGGLRNHIST
                     DTINYKDIKDILNGVDPANPDHSNRLDEFCREWCYSHNIRLTDFVIKSKRSRFIVSTS
                     SIQTDNDYLICIDENIEVDNHKIPFAVLEIKMLERNNSVLGPQQSKSKKTADPVVAQI
                     IDKLIEDDLSVYPVTKRFTLWNLASKVVNGSDPLTCIDDGNFLSSEEMFESGKNLLKE
                     LKTNYDLQLNPPIIDLSKPPSPSSNKSIPINRTTEPDKPRIRYWNEFDDDEEAMDQGF
                     YTYSSDEDDKIHDYGLITFSPAFIVAVYRFISKFQFSFGFVGDVQERRHLLPSPNKSY
                     SSLNTESTVLTSHSSERNEVNKIWDLEQQESESIYEFEHDEVISFFYVSSLLISCLTT
                     GITIGIMTSLFKSLDEDSELDNGTPILIMIFVSLAISLILSSWSLLLLFSRFTLAPTW
                     HYVSGVVIFITIILAVCYGFIELIL"
     gene            <393515..>394636
                     /gene="SLU7"
                     /locus_tag="KLMA_30176"
                     /db_xref="GeneID:34715462"
     mRNA            <393515..>394636
                     /gene="SLU7"
                     /locus_tag="KLMA_30176"
                     /product="pre-mRNA-splicing factor SLU7"
                     /transcript_id="XM_022818674.1"
                     /db_xref="GeneID:34715462"
     CDS             393515..394636
                     /gene="SLU7"
                     /locus_tag="KLMA_30176"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor SLU7"
                     /protein_id="XP_022675317.1"
                     /db_xref="GeneID:34715462"
                     /translation="MRRNGRGNGRGGRNGNGNGGQNEHIPSFIRNRPWYVGQQQQGNA
                     EAGGSGSGEEDYLAHHRLGSTKQQQPGKSTGIQDAFSYVRRSGGGPRCENCGGHGHLK
                     RDCLERPKKRGASGTSGTSGQGEGEGEASVVRVRDESVIEADYDAKRDRWYGYVPDID
                     ELERKHAAARNSKQQQQQQRTMDEIQRHEMERLKLVPEDLGFDAILPLDAEKYNPVRS
                     RDDRAAYLQDMNAEETLYDPKSRIYKSKEDGTIDPKSNMFRRHLTGDALQVGVINERV
                     RQEALKSGVKDFEVNKEKLNHVFAANPTKYELLMRSETGSESSSKGSAGSESKNSTDQ
                     AQDEQDQQQQQQQLPKRRRVEHASLPSNSQMKDLYDKYM"
     gene            <394891..>396012
                     /gene="PUS6"
                     /locus_tag="KLMA_30177"
                     /db_xref="GeneID:34715463"
     mRNA            <394891..>396012
                     /gene="PUS6"
                     /locus_tag="KLMA_30177"
                     /product="pseudouridylate synthase 6"
                     /transcript_id="XM_022818675.1"
                     /db_xref="GeneID:34715463"
     CDS             394891..396012
                     /gene="PUS6"
                     /locus_tag="KLMA_30177"
                     /codon_start=1
                     /product="pseudouridylate synthase 6"
                     /protein_id="XP_022675318.1"
                     /db_xref="GeneID:34715463"
                     /translation="MVICEEEMSVYIQNGLRKIAPYYNARSSFVKGRWFGKSLTQVFI
                     DEFSQSQEEAEAKIAEGSIKLLREGKPLNGNPVIKNKDILVTYQHNHEPPVKYWGPPI
                     TDEKHVVGIPVVHQNEELLVINKPSGIPVHPTAYFYKNTLTELLRDHLGYPVHPCYRL
                     DKITSGLLILAKNPLEANRVQSKIRDRDMKKYYLARVNGRFPDTAVDKSPIYTCDLRI
                     RSEPFSQLKDAHTEFELMKYDAKKDESIVLCKPFTGRTHQIRIHLARLGHPIVNDPFY
                     NLKNSTYPLRSRFIIETPDWTQLTTERIEKLRKRFEMELDDVWDDLNEDQPRCEKCNE
                     EMPKDPTPESLELYLHAWKYHGLDIEFETELPSWAAVDE"
     gene            complement(<396192..>399113)
                     /gene="BBC1"
                     /locus_tag="KLMA_30178"
                     /db_xref="GeneID:34715464"
     mRNA            complement(<396192..>399113)
                     /gene="BBC1"
                     /locus_tag="KLMA_30178"
                     /product="myosin tail region-interacting protein MTI1"
                     /transcript_id="XM_022818676.1"
                     /db_xref="GeneID:34715464"
     CDS             complement(396192..399113)
                     /gene="BBC1"
                     /locus_tag="KLMA_30178"
                     /codon_start=1
                     /product="myosin tail region-interacting protein MTI1"
                     /protein_id="XP_022675319.1"
                     /db_xref="GeneID:34715464"
                     /translation="MSVPFKVEALFPYTSDFEDDLPFPKGQIITVLEIEDEEWYFGEF
                     QDENGTTKQGIFPKGFVSAPLSDEKDEKISKPSSEVEESPLVEKEENKENEAEEQTGT
                     ESKSAVQDDTEAMAKVETESDSIPKSDFEPVTKSESPVKVPVPHIDTSSDHSTPVPSH
                     KSPVTHDNVRKLAGNLSSLDDSSAPHLRERHTFANSEDLVKEAKSESKMSLQQRILLL
                     QEQQKLQQEHAETMHKNKKHAAAAAAAAATSTSSEENGPADDAVSVKTGATGAEDKEV
                     KSPDGETGSLVSKSDSLINVGNDDDKSTHQPAHDDSHGDNDEDEADEGQGQDDNEDET
                     SNSEDEEEQRRAALRERMARLASASRYGMPNTYFNPFGMPMPSNDSSKTKKKSKKVEE
                     EQGTPKNEEPVPAPIPVIPFADPSKLPMFKNKTEEPTDTSNAELTAGNEADIESESNF
                     VDAEEETQPIRAPAKHEEEQVYVHESKIDESATSLGYESEGDETTVKAEKIEEEEQLP
                     AVPERGPGRSVKRTSVHENVEAPGSPNQKLPPPGPPIPSVPILPSAASAPHVPHVPHV
                     PSAPTVPTTRSGPPDSKVPPLPTAPPVPPVPSNEPAAPPIPSRSSISAPSEKPHAPAP
                     PIPPAAAPVPPLPPKAAEHVPNVAKAQDIPLAASKPHAPVPPIPHHFAPPPPPPSSSQ
                     APRPNILATSMTGESNKSSSTVSSPAIPSSAVPPLPNMGQPIRRSTTQKFESGTVPEL
                     EFSKHSSWWLTKTVQPDTVTPSKAKYIWESQDHIVKRRNNKTLIVRDFQFLFEDYSQV
                     QAYVVYDPKRPLETATFHQEYVPSPSHISGSDLLINTIYESSIKLIGKTCHSFIPQVL
                     GPIEELVPPIAHRTYGITVFEQSHGSPVDQASLEKLVPGLIIVARNAEFSFQDGLTYS
                     LGIEAPFVGILKSVDPQAQSVEVIEELGGECRTSVYPLNNLVKGKLKVATPVHRKDIG
                     W"
     gene            <399388..>400434
                     /locus_tag="KLMA_30179"
                     /db_xref="GeneID:34715465"
     mRNA            <399388..>400434
                     /locus_tag="KLMA_30179"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818677.1"
                     /db_xref="GeneID:34715465"
     CDS             399388..400434
                     /locus_tag="KLMA_30179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675320.1"
                     /db_xref="GeneID:34715465"
                     /translation="MVLCKKQRLSKIEQFLGYEYGNSTAEFDATAACRRLVGVLGVNG
                     VLALIKRVKVLDTKSLVDGLPLVVAIPLLRKITKRDDFVSWILGLGIGLTQLKRQVPH
                     WFVASLSIESLSKLFRCYVDMDCISERRWIILRQIAVSILLPIFYHRNLTKGRLYRIL
                     FEKRSPWKDFALLFAVWNLVKVYQNIKKVIFKKKTEKNHNRNSSPLSLDSDAPETRTH
                     YNLMTRMLIQRLEDLNELSGKQSRATLKELVCGFFFSDNFIKYVKWTLWRQIIMLIFN
                     GKHSKCLKPFHKSTIIMLSFMLLSDPQPLDINWPLVKQLVRSTLSEELRRIPQYQKPI
                     LFAALNVSYLTKYI"
     gene            complement(<400584..>401309)
                     /gene="CLC1"
                     /locus_tag="KLMA_30180"
                     /db_xref="GeneID:34715466"
     mRNA            complement(<400584..>401309)
                     /gene="CLC1"
                     /locus_tag="KLMA_30180"
                     /product="clathrin light chain"
                     /transcript_id="XM_022818678.1"
                     /db_xref="GeneID:34715466"
     CDS             complement(400584..401309)
                     /gene="CLC1"
                     /locus_tag="KLMA_30180"
                     /codon_start=1
                     /product="clathrin light chain"
                     /protein_id="XP_022675321.1"
                     /db_xref="GeneID:34715466"
                     /translation="MADKFPELEDESVQDNFVANDGDDTDFLRREAEILGDEFKTEQD
                     SELLTQEDDSDSKTLGTSVNEADAIAAASYKEQDNSNNSTGEVEEPSVPAGVDDEEEE
                     EFGELESSHVPAPISRGDSEALKNWKERRELEIAERDQAEEKAKAELQEEAAKHMDDF
                     YENYNIKKHQGIEETRKEAEEFLASIHGFASQDLSVWDKALQLINLEDADIVDGRDRS
                     KFKEILQRLKGNNSAPGAAGKAE"
     gene            complement(<401591..>402877)
                     /locus_tag="KLMA_30181"
                     /db_xref="GeneID:34715467"
     mRNA            complement(<401591..>402877)
                     /locus_tag="KLMA_30181"
                     /product="beta-glucan synthesis-associated protein KRE11"
                     /transcript_id="XM_022818679.1"
                     /db_xref="GeneID:34715467"
     CDS             complement(401591..402877)
                     /locus_tag="KLMA_30181"
                     /codon_start=1
                     /product="beta-glucan synthesis-associated protein KRE11"
                     /protein_id="XP_022675322.1"
                     /db_xref="GeneID:34715467"
                     /translation="MPELVLPLGPYSIEKDSIKLSNDVNRSFIIFGEELPLFITSSTP
                     LVDRLQSLRVDLKEASLVIDETTNEFIKHNDNVWEVNPSFIKNSVFNSDYLLSNNGQQ
                     GRIKFTLKYKKNHTNSNSSIKSYEEDTDGFLPSFKPLNDHDITSSAYLEKQEQPDYNT
                     IVVEYPMFSLMNMRLRNVSIRSNRNSNTPQVISSLDLQLVRKFGDLFPGETHVVVEDL
                     SYKLCDGNFEFEIKPLEEMIQFPLQVKRQDAYTINYNLQDSSRQVKVTIVYTVGSHYR
                     IHTSWKTEVCLGRSASSKSVVSSNASTPTFIQPPKVQLPRVLTQAHFTFLQPKIKAKK
                     GHPFTLSLQIENTTARTLNLVVYHKPKTPLAQTVVLISNDLKLPLLFPGTTFKCDLEL
                     IAISTGYHHHMKGLKILDLDALETIDLGVSLSLLIE"
     gene            complement(<403348..>405342)
                     /gene="SIR2"
                     /locus_tag="KLMA_30182"
                     /db_xref="GeneID:34715468"
     mRNA            complement(<403348..>405342)
                     /gene="SIR2"
                     /locus_tag="KLMA_30182"
                     /product="NAD-dependent histone deacetylase SIR2"
                     /transcript_id="XM_022818680.1"
                     /db_xref="GeneID:34715468"
     CDS             complement(403348..405342)
                     /gene="SIR2"
                     /locus_tag="KLMA_30182"
                     /codon_start=1
                     /product="NAD-dependent histone deacetylase SIR2"
                     /protein_id="XP_022675323.1"
                     /db_xref="GeneID:34715468"
                     /translation="MVFSPMTGFYETLQKRPLEEDVVEEGTRVESSVGKKLKGEDGVD
                     GGVSDSVSSKGSVESADDENSLSQKDILEQTKADELDEVVDDYAEEAVASSSGSAMDQ
                     GAGKGSGTGSDRADTVGDVTASETGRTTTSAGTEFKVNDAKSPSNENGNGNNTADDVE
                     QSSNAEKEYLPVKPENPIHLEKDPVSGKYIFPAITKEDSLNARSYLKHFGSTSFLNDY
                     LPEDLNSLYVYHMIKLLGFQIKDKDLMSAIQEVAQTPDSFANGDANGNSANSYPSPGF
                     EDPLEKKHAVRLIKDLQKAMNKVLSTRIRLTNFHTIDDFVAKLKTAKKIIVLTGAGIS
                     TSLGIPDFRSSEGFYSKLGDLGLSDPQDVFSLEVFSEDPSVFYNIAHMVLPPENMYSP
                     LHSFIRMIQDKHKLLRNYTQNIDNLESYAGVEPEKMVQCHGSFATASCVTCHWKVPGE
                     RIFPNIRNLQLPICPYCYSKRVEFFKTKPDDDVAGGAEEESDYQARSVPKSFGVLKPD
                     ITFFGEALPSKFHRLIREDVLQCDLLICIGTSLKVAPVSEIVNMIPASVPQVLINKDP
                     VKHAEFDLSLLGLCDDVAALVAQKCGWDIPHHKWNDLKSKEFVADEVERGIYNVYPKQ
                     TATEEAASAKNLPLQQSTAALTPPASTFDKSPTLSVSNNK"
     gene            complement(<405890..>406471)
                     /gene="RTG1"
                     /locus_tag="KLMA_30183"
                     /db_xref="GeneID:34715469"
     mRNA            complement(<405890..>406471)
                     /gene="RTG1"
                     /locus_tag="KLMA_30183"
                     /product="retrograde regulation protein 1"
                     /transcript_id="XM_022818681.1"
                     /db_xref="GeneID:34715469"
     CDS             complement(405890..406471)
                     /gene="RTG1"
                     /locus_tag="KLMA_30183"
                     /codon_start=1
                     /product="retrograde regulation protein 1"
                     /protein_id="XP_022675324.1"
                     /db_xref="GeneID:34715469"
                     /translation="MADDDGSKRGNINELIQELLTIIPEPFFQEYYRKNSDPKVKEEH
                     LSRSKGASANANKPTKGQILTQAVEYVNSLQEQVDLKNREEVELILKIKELSKETGSI
                     VNDLNLDNTSAEIALARIGVGPLAGMYEKETISNHARPSSNEDAAAAAAAAAAAAHPG
                     SSNEPSELAQPVRKEPPIYKFDYGGYREYNNEP"
     gene            <406841..>408145
                     /gene="RPT2"
                     /locus_tag="KLMA_30184"
                     /db_xref="GeneID:34715470"
     mRNA            <406841..>408145
                     /gene="RPT2"
                     /locus_tag="KLMA_30184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818682.1"
                     /db_xref="GeneID:34715470"
     CDS             406841..408145
                     /gene="RPT2"
                     /locus_tag="KLMA_30184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675325.1"
                     /db_xref="GeneID:34715470"
                     /translation="MGQGASSHGQKKKDKKQKPKYEPPVESKFGRKRRKGPSTVEKLP
                     SVYPSTRCKLKLLRMERIKDHLLLEEEFVTNSEILKPFEKKQEEEKKQLDDIRGTPLS
                     IGTLEEIVDDDHAIVTSPTTPDYYVSILSFVDKELLEPGCSVLLHHKTMSVVGVLQDD
                     ADPMVSVMKMDKSPTESYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVIL
                     YGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAADNAPSIV
                     FIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPA
                     LIRPGRIDRKILFENPDISTKRKILGIHTSKMNLASDVNLDSLVTSKDDLSGADIKAM
                     CTEAGLLALRERRMQVTAQDFKEAKERVLKNKVEENLEGLYL"
     gene            <408748..>409653
                     /gene="PTC1"
                     /locus_tag="KLMA_30185"
                     /db_xref="GeneID:34715471"
     mRNA            <408748..>409653
                     /gene="PTC1"
                     /locus_tag="KLMA_30185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818683.1"
                     /db_xref="GeneID:34715471"
     CDS             408748..409653
                     /gene="PTC1"
                     /locus_tag="KLMA_30185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675326.1"
                     /db_xref="GeneID:34715471"
                     /translation="MSNSNENANANANSNANSSSEDYELTYKVGVAENNNSKFRKTME
                     DVHTYVENFASRLDWGYFAIFDGHAGSQASKWCGANLHRYLEQKILEDETRDLRDALN
                     ASFVHADNEINNSLEGNSGCTAAVCVLRWEIPETTVPSEDETMNLQQHKRMLYTANVG
                     DTRIVLFRNGNSIRLTYDHKASDILELQRVEKAGGLIMKSRVNGMLAVTRSLGDKFFD
                     SLVVANPFTTSVEITTSDQFLIIACDGLWDVIDDHEACEMIKDMTDPNEAAKMLVRYA
                     LENGTTDNITVMVILLDSSQEPLEE"
     gene            complement(<409891..>410733)
                     /gene="MED2"
                     /locus_tag="KLMA_30186"
                     /db_xref="GeneID:34715472"
     mRNA            complement(<409891..>410733)
                     /gene="MED2"
                     /locus_tag="KLMA_30186"
                     /product="mediator of RNA polymerase II transcription
                     subunit 2"
                     /transcript_id="XM_022818685.1"
                     /db_xref="GeneID:34715472"
     CDS             complement(409891..410733)
                     /gene="MED2"
                     /locus_tag="KLMA_30186"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 2"
                     /protein_id="XP_022675327.1"
                     /db_xref="GeneID:34715472"
                     /translation="MAAKGVVAEKQDNKLTQCFDDILRLAADLLSQQQLKTIKLDPQV
                     TTGFSQAQQKVLKDRLTHFYSLIDTLDVSLQTTAEYVDAVKANAIQIKKQREEEELRK
                     QEQQKLEQQKLEQQKLEQQKLEQQKLEQQKLEQQKLEQQKLEQQKLEQQKLEQQKYSA
                     KNTPMDMLTTFDSDLPSAGVAQPQGFNSDFGDLNGMDLSMFDSMDNQGSFGGLQSSSG
                     MNEKKNDPQMNFNDTNAPPSAVAVPESENPNSYLTLNDFNDLGIDWNAANDNNELNLE
                     DFNL"
     gene            <411489..>411962
                     /gene="ATP16"
                     /locus_tag="KLMA_30187"
                     /db_xref="GeneID:34715473"
     mRNA            <411489..>411962
                     /gene="ATP16"
                     /locus_tag="KLMA_30187"
                     /product="ATP synthase subunit delta"
                     /transcript_id="XM_022818686.1"
                     /db_xref="GeneID:34715473"
     CDS             411489..411962
                     /gene="ATP16"
                     /locus_tag="KLMA_30187"
                     /codon_start=1
                     /product="ATP synthase subunit delta"
                     /protein_id="XP_022675328.1"
                     /db_xref="GeneID:34715473"
                     /translation="MFRLSARTFAKSVNTIAKRGYAEAADGALKLQFALPHQTLYSGS
                     PVTQVNLPAKSGQIGILANHVPTVEQLVPGVVEVLEGSGSKKFFVSGGFATVQPDSTL
                     SITSVEAFPLESFSAENVKSLLAEAQKNTSSSDEAVAAEAAIQIEVLEALQAALK"
     gene            <412952..>414757
                     /gene="MCD1"
                     /locus_tag="KLMA_30188"
                     /db_xref="GeneID:34715474"
     mRNA            <412952..>414757
                     /gene="MCD1"
                     /locus_tag="KLMA_30188"
                     /product="sister chromatid cohesion protein 1"
                     /transcript_id="XM_022818687.1"
                     /db_xref="GeneID:34715474"
     CDS             412952..414757
                     /gene="MCD1"
                     /locus_tag="KLMA_30188"
                     /codon_start=1
                     /product="sister chromatid cohesion protein 1"
                     /protein_id="XP_022675329.1"
                     /db_xref="GeneID:34715474"
                     /translation="MSTSTNNHTHVTLSTKNGPLAQIWLAANLNSINRNIAKTNIVES
                     VEEIAKAAGVSLDDESVEPITLRASGELLHGVVKVYSQKASYLLTDISDLLSKVKSIF
                     KGTLNKTVTIQLDTVAKLDQLLLQDVVTELDVLETPSLDFLNDVQIPEAFLSAERSME
                     RQVQGAAPVSSLTAQQQAWDMSIEVGRRFLGDDDDINEISRHQDSSHLKLDFDLGESN
                     QTSNAKSWGEGTRTTANDMEGEGDLTLKNMGNDDDDEDELLPLNDEWDLGLNDTVNDI
                     SGNVSQHESDRSIEQGRRADDNYSLHDDSHLDFDLGLPKEPEDQEERDAEQEPLSPVK
                     PVKKRQPRNAAFMNIKKIVVDEDLELKDSEVKEGPSETILSLRNEDVSSGAKRRRNIE
                     ELYTDLDFLPDRIVSNLFNYNGFKKLRTLSQSRPDEESDVDIDISLGMDESLIQNSDP
                     FDHQDIDFGNESAGPLFENVPRPKTAGRETSMDIQDNSLIQSDDFDTNESVEEDKTPK
                     VELNTGEVVSKSTVEMASLLREEMTSGETTFERVMESKYKDNGALVTKGMASKAFFEL
                     LSLATADCISLRQEDTFGEIKVLGKSNLYEKFVAA"
     gene            complement(<414870..>417083)
                     /locus_tag="KLMA_30189"
                     /db_xref="GeneID:34715475"
     mRNA            complement(<414870..>417083)
                     /locus_tag="KLMA_30189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818688.1"
                     /db_xref="GeneID:34715475"
     CDS             complement(414870..417083)
                     /locus_tag="KLMA_30189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675330.1"
                     /db_xref="GeneID:34715475"
                     /translation="MSSRQLRRLGKDDLETTLLKLTSKSSSPDAIAEEETVVSVHDKP
                     STTQSNMFMLMGDDETSEVDSEEAEKEEEEKEEETVAQPKKVIQVETKSQKKNRKKNS
                     KKNKGKKSKGKQSNTQSSLNDEEEDEEFDRLLAQFQKKTVASYKSLDSQGGYDEYDDE
                     EGFMTADEGKIGDGDESRTSSAYGRHYDLRTDPGFSKFKHFKQLYSLFESFDFNRLIP
                     DNEFKLLFDDLSPETLQDIDSVTSTSVSPEVMKQIEKLKRLVKNWSGKDKRSVPNGGS
                     VRKLQFTKIRDDWLPTVRGEFLLKKLGKQELVPWLKWQRPLDWETVINEDAEYKWLRH
                     FTYYKFDALNQTNSKKALTEFYLSTILHPDHEALISIISSHFPYHVPGLLQVALICVR
                     QGDKSNSNGLVERALFVFDRCLKTGIQFNAKDFQLPYIYFYNRQFYLAIMRYIQIVSQ
                     RGAISTAAEWAKTLLSLSPLEDPLGARYFMDHYLAANEEYQYIIQLVRNPLFNLYKQW
                     FTLGIGLTAVYSYWKLECLQESRELLQRVWKKYPSALHTIFTEFLLGDPSSVKINLES
                     PSVSDSIETKAYMTRMGAIWKDHDSKTFLHDELLHIFKTVPVESTDSEEENYDDASPN
                     PFFIEDIPVNLLRFAILSQESSVMAMIPEEVWSNYSVFEFDVLPPQPHDRESEEVVET
                     IETLIDSKQLELAQMERFADEQLLQQINQLSLQEFMEQQQRLQQQPDQNPLNEEL"
     gene            <417512..>418657
                     /gene="IPI1"
                     /locus_tag="KLMA_30190"
                     /db_xref="GeneID:34715476"
     mRNA            <417512..>418657
                     /gene="IPI1"
                     /locus_tag="KLMA_30190"
                     /product="pre-rRNA-processing protein IPI1"
                     /transcript_id="XM_022818689.1"
                     /db_xref="GeneID:34715476"
     CDS             417512..418657
                     /gene="IPI1"
                     /locus_tag="KLMA_30190"
                     /codon_start=1
                     /product="pre-rRNA-processing protein IPI1"
                     /protein_id="XP_022675331.1"
                     /db_xref="GeneID:34715476"
                     /translation="MAKKTVRQQDFMKKKLKVGKPKQKPSNVTDTSFQMKRISLPSQT
                     RISGPGSSKGDGSGIDLNAEMVKRVTLLRHHSDVTRKETVIYYESMIPRIIHLPCMSN
                     LMQAAIPLICDSSKQVRDELVKLFDTIGKNDPNVLKLQIRALTLYLNNAMTHIITPIQ
                     RDAGMFMQVLMRYCGDDLVRQAWIKMLKGFFQVLGWTLTAPNSSKKAQTTSMGITSSS
                     VVSMNKNKKHKNENLKAMLEFIRIGTGALSTQEQNDQTATQSDADAAAAAATAAPAPY
                     LPYMIPEFPQPYAYLKLFIKQFAQDSVSRATNSSTNLNSTGAVSDDASLQELETLSFE
                     DPVTRTKIFQQYFYPSIKRQLPALIKDGGECGRTAHSFSNVLQQIIE"
     gene            <420525..>422282
                     /gene="NAM8"
                     /locus_tag="KLMA_30191"
                     /db_xref="GeneID:34715477"
     mRNA            <420525..>422282
                     /gene="NAM8"
                     /locus_tag="KLMA_30191"
                     /product="protein NAM8"
                     /transcript_id="XM_022818690.1"
                     /db_xref="GeneID:34715477"
     CDS             420525..422282
                     /gene="NAM8"
                     /locus_tag="KLMA_30191"
                     /codon_start=1
                     /product="protein NAM8"
                     /protein_id="XP_022675332.1"
                     /db_xref="GeneID:34715477"
                     /translation="MSSYSSLSPDSFAGGSAGISSSASASASTYSNVSFRSNSVPDSS
                     SGNIPVVQNSCQLYMGDLNPEWSENDIKSIWSMLGEPNVQVKLIKSSNPNKSHSAQNS
                     GYCFVEFANQVAARNALMKSGLQVPLDPNYVLKLNWASFATAPGTEFTIFVGDLAPNV
                     TEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEAEQQRALVDMQGVFLNG
                     RAIRVGTTSKNKYQQQQQQQQHPHHQNQHQHQHQHPHSHQQHHQQQHRFGSNGSASVA
                     PPTSASAQQVASSVSSANSGMAQSKFSYPVLQQPSINQFSDPNNTTVFIGGLSTLITE
                     DELRTYFQPFGQIVYVKIPVGKGCGFVQYVDRVSAETAISKMQGFPIGNSRIRLSWGR
                     SAKQAAAMQQAISLALKQQTQQNQQVQQQQQQQQQQQQIPQYSYQPQPSMPSNYSYNM
                     DSLPGNHYVPVSHNNASYTSQPQQSLSQQPLLPSYTSMEYQNAGSLNGSMSGSSSFQF
                     PMGSSASSLGSALATQQNGFNLNSNMNMQPNVSQSSLFASSLRPQLSPQSTDIYTQKK
                     VEMIDFLEQGGNNNGYIFA"
     gene            <424524..>425339
                     /locus_tag="KLMA_30192"
                     /db_xref="GeneID:34715478"
     mRNA            <424524..>425339
                     /locus_tag="KLMA_30192"
                     /product="protein PET130"
                     /transcript_id="XM_022818691.1"
                     /db_xref="GeneID:34715478"
     CDS             424524..425339
                     /locus_tag="KLMA_30192"
                     /codon_start=1
                     /product="protein PET130"
                     /protein_id="XP_022675333.1"
                     /db_xref="GeneID:34715478"
                     /translation="MSKLIAVPTFGKTFIKVVEESKKPVKVNHAKLMSELAYGEYGTT
                     MIKPNPFKVNKARADYDLKGVIGGVRNYQLMNRLDNLNSVVYRCPYFSLAFYPPEHFM
                     GLAKKSTPAIHIHYKKPSFFLNANLRNGKSLEENIKFLQSNAFQDQRAKLDKKLGTSF
                     LSLFPKDWAYIRVRVRKLLRPCFHDAWTEFRAPDGLYIYNINIFSDKNNEKEYQKHIR
                     QSVEAVAKMDMKAFVRNKKGQNWVHFDNSRVNVSVLNRVLSLELAPFRYKRVP"
     gene            complement(<425743..>426015)
                     /locus_tag="KLMA_30193"
                     /db_xref="GeneID:34715479"
     mRNA            complement(<425743..>426015)
                     /locus_tag="KLMA_30193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818692.1"
                     /db_xref="GeneID:34715479"
     CDS             complement(425743..426015)
                     /locus_tag="KLMA_30193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675334.1"
                     /db_xref="GeneID:34715479"
                     /translation="MGKRFSESAAKKAEGLARKREQAKAKEREERLRQEAEEAKKWED
                     GAKKANAKKLLEEQKREEKLRAKKEREELLAAEEAALGKGGKGKRR"
     gene            <427357..>430119
                     /gene="PSD2"
                     /locus_tag="KLMA_30194"
                     /db_xref="GeneID:34715480"
     mRNA            <427357..>430119
                     /gene="PSD2"
                     /locus_tag="KLMA_30194"
                     /product="phosphatidylserine decarboxylase proenzyme 2"
                     /transcript_id="XM_022818693.1"
                     /db_xref="GeneID:34715480"
     CDS             427357..430119
                     /gene="PSD2"
                     /locus_tag="KLMA_30194"
                     /codon_start=1
                     /product="phosphatidylserine decarboxylase proenzyme 2"
                     /protein_id="XP_022675335.1"
                     /db_xref="GeneID:34715480"
                     /translation="MFNRSVLREKNLSWMEPKALAYSIGELQLSFKLVSNNNDDSDTL
                     TSFHLWTMRLMNNLEYESLKSGMYRETVEDSLEFEDVLDEGDLLDVLKIDDDAVEDMD
                     LDVGLPGETVSDDEEEDSDDYDDDDDDDEREEEDDDEEDEDDLILDNELLDPIGALYA
                     LDTMSISSGDSVKSTAASVCISETPSLYSLYSEDRGISGNLSALSEFHLYNRMETSPT
                     GHHDSSPTYDSSPSLSQDMDALRDEDDKKLLSRRRKRIPQRKRSIHTFEVSKREHSMG
                     IVLLTLNKIKDLPVYRKAVSKASYDMDPFVIITFGRRVFKSSYRKRTLNPEYDEVCAF
                     EIYPDERHFEFRFEVVDKDSFSFHDKVASASISWADVIKKYSIGETLDLEMPLELRKP
                     ADNNKPVMSISFQFLPYADLKRRFWTQSLHSLTTQKSFDVVELGVLLEKVGQFTCNEI
                     NEFFYYFNKVPWSFETLSLNELVAYLENWTNNNRYSSPFNNIQTCPLCGNRVMKSRNS
                     VKSKLNRENDLISHFAICQLKRNQSQRTFLTPSYVSVKSASRRWFSKILIKMTYGKYA
                     LGSNNANILVQDRDSGVIIEEKISAHVKLGIRIIYNGKGVKSRKFKNLLRKQTIKQGR
                     KFDAPSSVRYIPSFIRFHSLDMSECLKTEYKTFNEFFYRKLKPGSREPESQNPGILLS
                     PADCRATVFPTVHKAQEIWIKGRQFTLRKLLSGCPQQSQFTENLSSIAIFRLAPQDYH
                     RFHSPCEGVIGKIHYISGEYYTVNPMAVRTKLDVFGENVRCVVPITSPVFGTILYIAV
                     GAMMVGSIIFTCKEGDTISRGQEMGYFKFGGSTIILLIPHQKIIFDSDLIKNSDEMVE
                     TLLKVGMSVGHLPTEPEHPRIKRSVKNKEEFEKIKRTITVTDENVSALGSVPWEYNQL
                     KNLSSD"
     gene            <430369..>431832
                     /gene="POL31"
                     /locus_tag="KLMA_30195"
                     /db_xref="GeneID:34715481"
     mRNA            <430369..>431832
                     /gene="POL31"
                     /locus_tag="KLMA_30195"
                     /product="DNA polymerase delta small subunit"
                     /transcript_id="XM_022818694.1"
                     /db_xref="GeneID:34715481"
     CDS             430369..431832
                     /gene="POL31"
                     /locus_tag="KLMA_30195"
                     /codon_start=1
                     /product="DNA polymerase delta small subunit"
                     /protein_id="XP_022675336.1"
                     /db_xref="GeneID:34715481"
                     /translation="MDSLLKSFSYVEISIENPSLASFYHTNHISHFTSQQRNEEGAQT
                     VRSSLRVNHDRPNEYALDMKNRNYDMQFFKMYQYRLNVLRKRVQSCCEAKWDHDFKIQ
                     GKNVVKKSKVLDIRAGEPCWCIGTVYCEMKYKPNILQEVVEDTYGAPDLTKSYTDPNG
                     TDEIMLDDESGRVILVGDLVKNTPFVSGTVIGILGMEADAGTFQVLDICYPKALPQKS
                     LPSLKNTKVALISGINATPNSPVGSLRLQLLQDTLTGELDSNSDLAQCARCMIVGNSL
                     SPGENRNDLPGSLKELTPFLSNILKSIPVDILPGENDPSDKSLPQQPLHKALFDDALN
                     PFFEKENSDIFNTVTNPYWFDIAGLQLLATSGQQIDDIVKYIIPYYEETRTLKGDTIE
                     HRLDLAEATLKWQNIAPTAPDTLWCYPYSESDPFILNEWPHVYIIGNQPQFGYRRVEL
                     EGGIEVMIISIPEFSSTGQFLTLDLETLTPQVHSIVV"
     gene            complement(<431877..>433616)
                     /gene="MSM1"
                     /locus_tag="KLMA_30196"
                     /db_xref="GeneID:34715482"
     mRNA            complement(<431877..>433616)
                     /gene="MSM1"
                     /locus_tag="KLMA_30196"
                     /product="methionyl-tRNA synthetase"
                     /transcript_id="XM_022818697.1"
                     /db_xref="GeneID:34715482"
     CDS             complement(431877..433616)
                     /gene="MSM1"
                     /locus_tag="KLMA_30196"
                     /codon_start=1
                     /product="methionyl-tRNA synthetase"
                     /protein_id="XP_022675337.1"
                     /db_xref="GeneID:34715482"
                     /translation="MRNQAVRAAESIIPALPKFHITTPIFYPNAKPHLGHLYSSLLCD
                     VQYRWNKLLGKDCCFTTGTDEHGLKIQTAAQLNGYKDPKMFVDKLYTHFIDMDQKANI
                     QYSRFIRTTDPDHIENVKTLWNICYEKGYIYKGNHEGWYSVSDETFYPDSKVLRVMKN
                     GETIPFDGKIDPNAEYINTESRNQVTYQSELNYYFKLSAFQKPLIKLLRSNPGFIHPP
                     SRHSQILKELESYDLKDLSISRPETRLKWGISVPNDETQKIYVWFDALCNYISSIGGI
                     KAVLQNGESSPCMHKDRNSIQYAGLFWRNTEHLIGKDIAKFHTIYWPAFLMAAELPLP
                     KRIVIHGHWLSGGVKMSKSLGNVVDPLEIIEHYEADTMRWYLLENSSIDNDGNFNEKN
                     LWETREQLCSKFGNLINRCGGKKFNLRSGVISFANKPVNSMLEQLSSETRSAASALLE
                     TMENAPERIEECYKQYDISGAQKIIWNIVNAANSFVQNTEPWTKKDNDVERSAIIYTA
                     LDAARVATILSQPIIPTISANLLDRLDVSNDKKTLQYAQFGADDSYGNLTNKRFKEIP
                     IQRIPYRLVTPNE"
     gene            complement(<433879..>434988)
                     /gene="RBG2"
                     /locus_tag="KLMA_30197"
                     /db_xref="GeneID:34715483"
     mRNA            complement(<433879..>434988)
                     /gene="RBG2"
                     /locus_tag="KLMA_30197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818698.1"
                     /db_xref="GeneID:34715483"
     CDS             complement(433879..434988)
                     /gene="RBG2"
                     /locus_tag="KLMA_30197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675338.1"
                     /db_xref="GeneID:34715483"
                     /translation="MGVIDKIKAIEEEMARTQKNKATEHHLGLLKGKLARYRQQLLAD
                     EAGSGGSGGGSGFEVAKSGDARVVLIGYPSVGKSSLLGKITSTKSEIAHYAFTTLTSV
                     PGVLKYQGAEIQIVDLPGIIYGASQGKGRGRQVVATARTADLILMVLDATKGAHQRES
                     LEKELEAVGIRLNKEKPNIYFKKKETGGIKITFTAPSKSNLTEDAIKLILRDYRIHNA
                     DVLVRDDQCTIDDFIDTLNEQHRNYIKCLYVYNKIDAVSLEEVDRLAREPNTVVMSCE
                     MDLGLTDVVDEIWYQLNLNRVYTKKRGIKPDFSDPLVVRNNSTVGDLCHSIHRDFKDK
                     FKYALVWGSSAKHSPQKCGLNHKIHDEDVVSLFTK"
     gene            <435616..>436440
                     /gene="YIP1"
                     /locus_tag="KLMA_30198"
                     /db_xref="GeneID:34715484"
     mRNA            <435616..>436440
                     /gene="YIP1"
                     /locus_tag="KLMA_30198"
                     /product="protein transport protein YIP1"
                     /transcript_id="XM_022818699.1"
                     /db_xref="GeneID:34715484"
     CDS             435616..436440
                     /gene="YIP1"
                     /locus_tag="KLMA_30198"
                     /codon_start=1
                     /product="protein transport protein YIP1"
                     /protein_id="XP_022675339.1"
                     /db_xref="GeneID:34715484"
                     /translation="MAYYQPSVPAVNPNNNANGNNGFFQPSQQYSFPQGSMAFGNDAQ
                     GSGMDFSGGKSNGTPANFSNEQLKPGLFNALSTSGYSYEPTLLEELGINFDHIIAKTK
                     FVLVPFSYQGLSREIQDDSDLAGPIIFWLLFGILLLTAGKVHFGYIYGVALFGSISLH
                     TLLKYMSDGAHQNQQQLQSQPGSSPNVTSSISYLRSASILGYAFLPLCFLALIGIFVG
                     LNNTFGYIMGILTVMWSTWSSSGLFTVSLDLHNVRILIAYPLLIFYSVFALMAIFV"
     gene            436686..436799
                     /locus_tag="KLMA_R306"
                     /db_xref="GeneID:34718680"
     tRNA            join(436686..436722,436755..436799)
                     /locus_tag="KLMA_R306"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34718680"
     gene            <437834..>439051
                     /gene="RNR2"
                     /locus_tag="KLMA_30199"
                     /db_xref="GeneID:34715485"
     mRNA            <437834..>439051
                     /gene="RNR2"
                     /locus_tag="KLMA_30199"
                     /product="ribonucleoside-diphosphate reductase small chain
                     1"
                     /transcript_id="XM_022818700.1"
                     /db_xref="GeneID:34715485"
     CDS             437834..439051
                     /gene="RNR2"
                     /locus_tag="KLMA_30199"
                     /codon_start=1
                     /product="ribonucleoside-diphosphate reductase small chain
                     1"
                     /protein_id="XP_022675340.1"
                     /db_xref="GeneID:34715485"
                     /translation="MTGTVKETPSKAAANELSKMELDAKKKDLASELAAVKEEAPTGE
                     EIDLKISKAAEEHRKFMKSHQVHRHKLKEMEKDEPLLVENKRRFVLFPIKYHEIWEAY
                     KRAEASFWTAEEIDLSKDLHDWNNRMNENERFFISRVLAFFAASDGIVNENLVENFSA
                     EVQIPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKEHEFLLNAIETIPQIKEKAQW
                     AIRWIRDDEALYAERLVAFAAVEGVFFSGSFAAIFWLKKKGLMPGLTFSNELICRDEG
                     LHTDFACLLFHHLKNKPDPKIVERIITEAVEIEKRYFIDALPVSLLGMNADLMNQYVE
                     FVADRLLVALGNKKYYNVTNPFDFMENISLAGKTNFFEKRVSDYQKAGVMAKSSNTET
                     QTGSGAFAFDEDF"
     gene            <439245..>440567
                     /gene="OKP1"
                     /locus_tag="KLMA_30200"
                     /db_xref="GeneID:34715486"
     mRNA            <439245..>440567
                     /gene="OKP1"
                     /locus_tag="KLMA_30200"
                     /product="central kinetochore subunit OKP1"
                     /transcript_id="XM_022818701.1"
                     /db_xref="GeneID:34715486"
     CDS             439245..440567
                     /gene="OKP1"
                     /locus_tag="KLMA_30200"
                     /codon_start=1
                     /product="central kinetochore subunit OKP1"
                     /protein_id="XP_022675341.1"
                     /db_xref="GeneID:34715486"
                     /translation="MSKWHQLLAYSTLFDDLGKIKTNCLFMRFRCPLAIIAAKKNTIR
                     KWKLACKGLRGSLSTAVIIMSKRYVDDILSSDAGSSDSDLSFENINGDDYRIDVDERD
                     IGKRNTTSRAHDDLRAGPPYNLESVFEMPEEPVTPRTENANNNELSDDYQDENDNTMV
                     KDIVTPPRERKRVRFGVNEKDDSEDYSNVNPWDFKRLIRKLYKEQLPDTYQIRNWKRP
                     QRELVTSFIEMIENNVELASAEVFDQYGDELDRFYKSNGERDDLKEKLEVNVYDIIYN
                     IKKRLKRTKFPSKIWVDNLDLEYVYAKGEFIKKRYESELDHAEEIERQLLREEEHVKS
                     LKLEGEAKIKKHKETLTAELSELSKNLHPSLSTALTNSFGLIKDSQMSNTIYQRDKLD
                     FNLRLKTDFSQPLKLDSDDTADNDVMQTLKSAQNLADEILGKLSNITG"
     gene            <441105..>443345
                     /gene="PBP1"
                     /locus_tag="KLMA_30201"
                     /db_xref="GeneID:34715487"
     mRNA            <441105..>443345
                     /gene="PBP1"
                     /locus_tag="KLMA_30201"
                     /product="PAB1-binding protein 1"
                     /transcript_id="XM_022818702.1"
                     /db_xref="GeneID:34715487"
     CDS             441105..443345
                     /gene="PBP1"
                     /locus_tag="KLMA_30201"
                     /codon_start=1
                     /product="PAB1-binding protein 1"
                     /protein_id="XP_022675342.1"
                     /db_xref="GeneID:34715487"
                     /translation="MRGSSKKSSASGNPGNSGNSRGNAGSNGATSAFYENESVKQNFE
                     ERMDYLLVNSIGSQAVVTVPSGVKYEGILAACNPHSSSNGIDVVLKYPKVFDKGLSSS
                     GISALSAELSDTLTIKADDVSEIELRDITFNSDEKAEHETKSKPEANINKAKEADSTA
                     TATAVPKETDKQPKKEFKTDTAISGASKELKERELQKWSPDDETAFPLNNTSLEDDDG
                     TWDQFAVNEKKFGIKPTFDEHFYTTRINKDDPEYQKKLKEAEKIAKEIESQGASGNIH
                     IDEDRNVVTYDDSGLDEEDKYSGVDRRGDELLAQLKLNSKPEAKPVKYVPPSLRSQPH
                     HADPAILSTTGKTNTGKSTKSSRTEIADLKSFSEKFKIPYDMPEEVKNILKKKEPVSK
                     EKDASQKPQPESQKPAANKSQSSSPPPSTNSNISTVTSSPSPVQSQKGTSSLKANPSL
                     PPKPSSQPPSTPTLSSASGNKSSNRSSKSGTPALAKIEMRRGSHNKFSNGGKTPLSSP
                     SISRAETFSRRRQRNFFEDGKPKCLKKDFSRNFNMFLKSKETYDAKVKASEKKNIEQF
                     FIEKPYFTSPTWISTVDQSYKTLFPDERTAIQRTQMRLQQRSINMMAQGMGGGPGVIP
                     MVMPVGVPPGAPPFMGGHPSAAGGSHGMFMSFQPQPMFYPPMGGQMMPMMNARNDTRG
                     GSGSNSQSSSPPATPAFMNGVPMNVPYGYPMRYQAMGAPPPQQHQQKQFHQNHGRNYR
                     QHNDSR"
     gene            <443794..>445380
                     /gene="RRN7"
                     /locus_tag="KLMA_30202"
                     /db_xref="GeneID:34715488"
     mRNA            <443794..>445380
                     /gene="RRN7"
                     /locus_tag="KLMA_30202"
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN7"
                     /transcript_id="XM_022818703.1"
                     /db_xref="GeneID:34715488"
     CDS             443794..445380
                     /gene="RRN7"
                     /locus_tag="KLMA_30202"
                     /codon_start=1
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN7"
                     /protein_id="XP_022675343.1"
                     /db_xref="GeneID:34715488"
                     /translation="MSTYIKGPICGVDNCRSRLWRIINGRRTCQYGHVMEGDVEFNDD
                     EDDINAMGVVTRRLNLTTNATGNFQSSFSISQSQRSALEANKTEKTYGREGQVLFIKS
                     FQYILKRQTDWLISHESFPDSYSDLVKLIWAMHLEHADSILYPHDSGADSSRNPNAGL
                     NHTDSQYSSGGRRENGVNKLKLSMVSTISIHYLACLHLGLPVFSNDILRWICVDGLPY
                     FRSHHLLPKEWQERLPNYYLQILDGGKPPHEMQLQHKIAQCAELIEFKTHFRYTLTAP
                     VLLLKLTLLERIPGEFYFFARELLRLVNDTEELPILTYEDNHYRKPHQYPEIGICAAF
                     IACIKIKLLQDEQLPNAKYNSKFAETWLRMSKLVEDDPREKFSKANLILKMTYKPATA
                     LLEEPQEQLSSIATEAYLDWIEKNLLPTEQSHLESTQTLDDKIAKRKLHNIVPLKKPS
                     SSENISPTFSSTLIDDIQSRFLEFSSLYDQNTGDNTTSVHRMVDTLIEHISLSFGLSS
                     DQLREAIEHVINTACSSLDA"
     gene            <445837..>447384
                     /gene="ATF1"
                     /locus_tag="KLMA_30203"
                     /db_xref="GeneID:34715489"
     mRNA            <445837..>447384
                     /gene="ATF1"
                     /locus_tag="KLMA_30203"
                     /product="alcohol O-acetyltransferase 1"
                     /transcript_id="XM_022818704.1"
                     /db_xref="GeneID:34715489"
     CDS             445837..447384
                     /gene="ATF1"
                     /locus_tag="KLMA_30203"
                     /codon_start=1
                     /product="alcohol O-acetyltransferase 1"
                     /protein_id="XP_022675344.1"
                     /db_xref="GeneID:34715489"
                     /translation="MMKLQKMSALKLERGHARRAGLVEEVMLIQYRQKVYANFAMYGE
                     LRQGFTKVQISHALRNMFLKYPILATTVIPDRLKVPDDAYYRTDEYYNKPGVAEDYIS
                     VLDKIKYEDVIMNLQSEHSSYVNKILSQWALDGCRFSGKLCTLIDRYRFPYWDPTKPQ
                     FRLILLPTSETNHEKKHVLFVSNHVVSDGTSGANFLQDLSTELGQLKDPLESIDTLFN
                     YEDDYESLPKLPDPIEKRVSYAVTMKFIPPTVLRQLAKRFLAKKWDEPITVPIDESPS
                     AHLAHVIRLDAATMQKLRMRVKEKLHGKATLTPFLQTCWFVSCYQAGLFENLKWNEYF
                     TNIVLPLNSRQFLPDDPEVRNQFKYGTNVGGSDYYHLISSFNVKDSKQFWDLTNYYQE
                     CYAYDRKEKAGLQSFGLLISDFVTKSKNIEKLYVDDMQGQKRGFTLFSNIGYFPQKSQ
                     ETNPYQLQDIGFTQTGTEMPYVFCLNCVSTDINGMSFTVTCAEKAIPETQWHKLLEIF
                     ENNLTTL"
     gene            <448132..>449634
                     /gene="ERG1"
                     /locus_tag="KLMA_30204"
                     /db_xref="GeneID:34715490"
     mRNA            <448132..>449634
                     /gene="ERG1"
                     /locus_tag="KLMA_30204"
                     /product="squalene monooxygenase"
                     /transcript_id="XM_022818705.1"
                     /db_xref="GeneID:34715490"
     CDS             448132..449634
                     /gene="ERG1"
                     /locus_tag="KLMA_30204"
                     /codon_start=1
                     /product="squalene monooxygenase"
                     /protein_id="XP_022675345.1"
                     /db_xref="GeneID:34715490"
                     /translation="MSSATDKKVVPQELLNADASVVYDAIIVGCGVVGPCIATGLARK
                     GKKVLIVERDWTMPDRIVGELMQPGGLRALRSLGMIQAINNIDAIPVTGYSVFYNGKE
                     VSIPYPFKADVAPVEKIPDLVFDGNDKVLEDNTIHIKEFEDGERERGVAFTHGRFLQN
                     LRDMVSKEKNVTRLQGNVIEILKNKENEVVGAKVDIPGRGKEEFKAYLTFVCDGIFSH
                     FRKELAADHIPTVGSSFVGMSLFNADVPAKNHGHVILGTNHMPVLVYQISPEETRILC
                     AYNSPKLPKDIKPWLKSDVRPNLPKSLLPSFDKAVEDGKYRSMPNSYLPAKQNTITGL
                     CVIGDALNMRHPLTGGGMAVGLNDVALLIKTIGNLDFSDRETVLDELLEYHYERKSYD
                     SVINVLSIALFSLFAAENKNLQVLQRGCFKYFERGGDCVNIPVSFLAGVMPKPFLLTK
                     VFFAVALYSIYVNFQDRGIVGFPLAVIEAISILITAARVFTPYLFRELTG"
     gene            <450149..>450583
                     /gene="CBP4"
                     /locus_tag="KLMA_30205"
                     /db_xref="GeneID:34715491"
     mRNA            <450149..>450583
                     /gene="CBP4"
                     /locus_tag="KLMA_30205"
                     /product="assembly factor CBP4"
                     /transcript_id="XM_022818706.1"
                     /db_xref="GeneID:34715491"
     CDS             450149..450583
                     /gene="CBP4"
                     /locus_tag="KLMA_30205"
                     /codon_start=1
                     /product="assembly factor CBP4"
                     /protein_id="XP_022675346.1"
                     /db_xref="GeneID:34715491"
                     /translation="MSSSGFLRWGKVFAAGGSIVLAGVLLFKYTTPTDEQLIQALSPE
                     LRLQYERERNLRQAEQQELMKIVQQTMKSNDPIWKSGSVENPWEKDNGSRATKDQFQR
                     MKADQVQKEELERIRQELGKIRTESLNETDKIVSKKSWWSLW"
     gene            complement(<450688..>451331)
                     /gene="APS3"
                     /locus_tag="KLMA_30206"
                     /db_xref="GeneID:34715492"
     mRNA            complement(join(<450688..451229,451310..>451331))
                     /gene="APS3"
                     /locus_tag="KLMA_30206"
                     /product="AP-3 complex subunit sigma"
                     /transcript_id="XM_022818708.1"
                     /db_xref="GeneID:34715492"
     CDS             complement(join(450688..451229,451310..451331))
                     /gene="APS3"
                     /locus_tag="KLMA_30206"
                     /codon_start=1
                     /product="AP-3 complex subunit sigma"
                     /protein_id="XP_022675347.1"
                     /db_xref="GeneID:34715492"
                     /translation="MIHAVLIFNKKCQPRLIKFYTPVDVEKQTLLVRQVYELISQRNS
                     QVQSSFLVTPPSLLMDSGDNEDIQIIYKNYATLYFTFIVDEQESELAILDLIQTFVEA
                     LDRCFEEVNELDLIFNWQTLESVLEEIIQGGLVIETNVRKIVMAVDELNNTNDSDNSL
                     TKLAGNRISEALQAFSYSNFGTWGSFQ"
     gene            complement(451692..451762)
                     /locus_tag="KLMA_R307"
                     /db_xref="GeneID:34718681"
     tRNA            complement(451692..451762)
                     /locus_tag="KLMA_R307"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718681"
     gene            <452176..>452481
                     /gene="TIM13"
                     /locus_tag="KLMA_30207"
                     /db_xref="GeneID:34715493"
     mRNA            <452176..>452481
                     /gene="TIM13"
                     /locus_tag="KLMA_30207"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM13"
                     /transcript_id="XM_022818709.1"
                     /db_xref="GeneID:34715493"
     CDS             452176..452481
                     /gene="TIM13"
                     /locus_tag="KLMA_30207"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM13"
                     /protein_id="XP_022675348.1"
                     /db_xref="GeneID:34715493"
                     /translation="MALTSIFGGSSSSAQPKANTSTNDVKTQLKSQISQELAVANATE
                     LVNKVTENCFEKCLNAPYTTTQDNCVDQCLAKYMRSWNAISKAYIARIQQASVNGEI"
     gene            complement(<453148..>453477)
                     /gene="QCR9"
                     /locus_tag="KLMA_30208"
                     /db_xref="GeneID:34715494"
     mRNA            complement(<453148..>453477)
                     /gene="QCR9"
                     /locus_tag="KLMA_30208"
                     /product="c reductase complex"
                     /transcript_id="XM_022818710.1"
                     /db_xref="GeneID:34715494"
     CDS             complement(453148..453477)
                     /gene="QCR9"
                     /locus_tag="KLMA_30208"
                     /codon_start=1
                     /product="c reductase complex"
                     /protein_id="XP_022675349.1"
                     /db_xref="GeneID:34715494"
                     /translation="MSGIHKTSVLGTFQMDKSPLSLDCLRSRALKLNEFTNNKIFLQS
                     FSSTLYNTIFKRNSVFVGTVFASTFLFQVAFDSGITAWYENHNKGKLWKDIKGRIMNG
                     DEEDDDE"
     gene            complement(<454161..>460049)
                     /gene="UBR1"
                     /locus_tag="KLMA_30209"
                     /db_xref="GeneID:34715495"
     mRNA            complement(<454161..>460049)
                     /gene="UBR1"
                     /locus_tag="KLMA_30209"
                     /product="E3 ubiquitin-protein ligase UBR1"
                     /transcript_id="XM_022818711.1"
                     /db_xref="GeneID:34715495"
     CDS             complement(454161..460049)
                     /gene="UBR1"
                     /locus_tag="KLMA_30209"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase UBR1"
                     /protein_id="XP_022675350.1"
                     /db_xref="GeneID:34715495"
                     /translation="MINDSIGVEPYLRQHVGDTLASVHCRPAFSDLKGSAERAVMDKE
                     LKSFIYGYLYYMISDQGRLLEHMFTATQKEDFPRSVEEAMEVKLNSKPWYRIDENGGH
                     SKFSHAGRICGAKFKVGEPIYRCKECSFDDTCVLCVNCFNPKDHTGHHVYTTICTEFN
                     NGICDCGDKEAWNHTLFCKAEEGRESDTDGFEDRDGRISKILESVLIELFDHFIDVFN
                     QNIEPLPTIQKPLLSKLRYFVQNGKYNEQADLLSRLAYRNRYVDKEHPSHRESSPSLN
                     PLSICKDYAILIYNDEFHNYSQASAAIRQGGADNKHIDLLTAKIDSEGRSLLRCSVDI
                     SSLIGGFFSIQSNGISCTLTQWNDYVHQEASKYCIMWINDCLNIPNSTFQSLFRDAIG
                     RVLCSQYDPLYRSVDMTPVIRDYFSDSYMADDTYLYADHSVLGEGVKIPLGRHKSLDP
                     SDMNTISPVLNKVIAEDNHEYANSRLQYILFLENRYWKKLRKIVQDLIIPTLASSSVF
                     KPMFSDQLVEIFPHMTRSVTYMDREPQLTSLRESVVQLFTCPTTANNIFESGHFKYVI
                     WSVIDVFVDFSTMDEGTLVWQRVQRSNPSKSYSISFKQGLYAVETLLSKITNPNLLLK
                     PEEFIMIVTLCKLFNGAWKIKRKEGDHVLREDQHFIPYLEYTTSIYSIIQTFDKVLQQ
                     SKDLIDEQLLIGAINLLDSFLGHRNLPYKIYKDFEIIKFQISKERVSFMNPVHTLFSF
                     LVQHVPLEVSIRVLSQSKDYLVISDFALRSVVLCSQIDIGFWVRNGMSVLHQSAYYKN
                     NPEMSSYSRDIQLNQLAFLVENDDIQRVIYNMLDRWELLEWFDGSVSSTNTVYEDKFP
                     SIIQQFIAFLYQVLVERDFYKKFDSLEERQLYNIKNAIIYKLYAEPLSYTDLLNDIPD
                     YLTESVSQFDMALEEVATYIEPKGLEDNGVFKLKKELYKSIDTLRLLNMGNDFEHSAT
                     IVESHLTDNKEKRAKMVVKPQLLGLDELDDRIRDLGNFTRTNVFAKLIYKLLKLAVSD
                     PGLSFTYELLHLIHAIFKDDEMVNGKNSLPETYINKPICDLLLSIVDSEGGSFSENVV
                     ATADYLLENMIMKRPTAILESLAECFGTKYIADYKTRKANQGINFEETEQERRRRLAK
                     ERQQQIMNRFSRQQQKFMDKHVEYADNDEDVDMDSETNLATCTHEFQCSLCHGDVSDD
                     FFVIPVYQSYSPIFLNSEPNPLEMYKPWNGFDNSEHLGTYNTELFYKKKEHDSKQIMS
                     ENTRKLMVSCNHTVHYRCFKHYIDKKRYSTDLFICPLCQTYCNSVIPVDTMNIEAGGS
                     LLKRKFLEGIEEPLLQIFADAVPELDKSVESIVIALKDSTQNSRSNRNAPFWIQDRFL
                     TLSLQFCNNICMLEMLSRLSKDPFGTLVVGEEQKFKTLYNILKSLSVYARFTEDTEEI
                     VEKFHKEVENSNLPTLSFFYIVERALRSKQPLRGCLMNVMKARVKGSTISFVDFFKKH
                     EQELQAQTCFDSSPFLEPLKEMILGSGLLSGSDIDKHTLDLYYTFLVSDLVPTLRRSL
                     ILLRVLNIFLSGEDDINIDGVNIVRDSVAGNKEEHFLKLIKSLLGVGFDDLLRDSLEP
                     PEDGRFLVNIPHEYCNITKLADLATHLNTYVTNNMNVLLREENDQKLRNTVNRLDYKI
                     CLICGVKIHARTDGLEMQKHMERCSHGPSGLFLIPNISQVCLYLSKPNCTVNISAPYL
                     NAHGESGRNAIERGDLTVLNLARYEHLTRLWISNGIPGYISRVMGDEFRVAMANNRAF
                     TRNMFWRPGAAFNAGGDSSDEELFNDEDLIDEEAPELRFREPEIELRINGGPFGGEMP
                     LRLPTERGDIHDFFEFVANLRGGAGDGVDGEIPTTEDIIQQLQGNVMNGLFRRRNRNR
                     DDPDNEGHTDGGEDTHHSEEDDDDDDDDDEQDDGLEEQETEYSSADEDTNFHDAADDI
                     NQVE"
     gene            <461212..>466350
                     /gene="UBR2"
                     /locus_tag="KLMA_30210"
                     /db_xref="GeneID:34715496"
     mRNA            <461212..>466350
                     /gene="UBR2"
                     /locus_tag="KLMA_30210"
                     /product="E3 ubiquitin-protein ligase UBR2"
                     /transcript_id="XM_022818712.1"
                     /db_xref="GeneID:34715496"
     CDS             461212..466350
                     /gene="UBR2"
                     /locus_tag="KLMA_30210"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase UBR2"
                     /protein_id="XP_022675351.1"
                     /db_xref="GeneID:34715496"
                     /translation="MSQSVECLRDFLVHYAHFCGYKYNDMCSFYLWKVLSRCMERDSE
                     EIKWEELMDVFGSNEWESGGFRKIKLRSDWRESFIPRRRVNEHRGSQCSKQCHGTETV
                     YYCFDCTKNPLYEICEECFDETQHMGHRYTSRVVTRPEGKVCHCGDISGYNNPEKAFQ
                     CKISSNNVRVDLSPDDMYEENWISTFSQVLDYVIDCCYASLDADEKIKHENVESIPIQ
                     DSHGNIETFSDRYALILYQHECHIHIQDVARKISQTLKKDIGFGTYVLSQFDPDEHFT
                     IVAESTDKHSMLKLKDLLAAQDIPTHLLNSSNVFKKYLVSELCRWLHHFAINNSSVIS
                     GKMSLRLAFMEQYHSNLMATKPFKINILGNFTVPQQQHNTFPWIKPWNFQHNRDETHD
                     SRVLATMIRYDQKIKETDTPNSTCRYLPLSGSRFQYFITQCVTAFSHFTRLRLLEVLG
                     TIFSVTDDSKKCLAAQYLDVYCNVLYGTIVFDSSGCKLTLMSTLAQYIFPSPAIANMI
                     INSGFIERCLAFSYSIMPSDSEIVHNSSPIPLSTDFKLPQTVIKNKKTVICFKDIYQT
                     MCTNNNPESVFANKSLVKAISECFFSFNTILPLKREAVKHVQYENFDFSSFYFFFSSI
                     LIMVDGFLRNISLVMDPIKRKEIVSSLLKSSIDRQLASLDKFRSPVSNINTNFFNASV
                     CNVRSQIFNFQVGSDIQNFFNPISYYIKFILQWSQCGRYEPLPESLNNAIKFSELLPS
                     ASECLWIAEPSLCTLVMISQIEVGFWVRNGSPIQHQLKMYTRYSMREFTYFSDFFHVQ
                     LSMCYANPQDFMVNFLTRWGLKNWAEGIPIDNYPEEPLTVAMTEQCILTLIRLLTETR
                     ALCVSSSVEGFESTMKSEIIHSLCFRNCTYSSLVEAIPEHVTKHPAFDLYLKEFSDYH
                     KPTGIFETGTYSLKKQYRKNVDPYFIGFSSSKRYEATILVRERMKKTHGISFNDTFVP
                     AVTVIDQLKDTQYRNLYQITSTDIFGIFIKNTLVHTMKLKQESLLGKVLHLIHLCIIN
                     NLTEFSKIFWREYHLDESENGFYHSIGSLLYYFLSSEDFNYENGKIREIFRFLKDRAP
                     HINVNDYLFEQTQGYDPRVLFTDISESENDEHTKKKILAKKRREKMMQKLAKQQQEFM
                     DNHNVSTNDFGSQAINLETSDIDISWSYPEDDCVFCTMPKDYDVLSYFVFIERGLTSI
                     DVSLEDNSKNLKFGPVLTACGHCAHFGCLLSHMKSIRKNLGQITKNTRDNYGLSTITC
                     ALCKSMVNSFIPLLKGMQHCADYNSKSLLTRHSLALITELSGMKFSLQNGFIASCTLL
                     ANTIANLELSLRESKHKFIINKLSNRQVTSLRLLDDLISVGLEKRLISASGRRIKDPF
                     LSFCISIHLFSGIKVVTDLLRRKVIEELTLRVNDLVSLSYQQIVPESSSKIDFDIPCS
                     DVISQIIVTRIHSIQDIEQNSISEAESFFRRNQKALINLFMSHFLIFLRKACVALHCK
                     FINEQKMLFNYKNSNELETMLDHCNLPSFLNLLQEMFSIFSQSTSTSIKITNIMSFKP
                     QLPISSPFINLPEVLSNLSKLTDSELHLRFRAFKEDISICMFCGTSCGLQRSSLLHFS
                     RLGQCTNHYYNECKFKSPYACFFILKSNVIYLGYGNQGSFYQTPYVNKHGETDEDYKL
                     GTPVFFNEARYKHFIQDIVIPGKIPHFINRANDKTVDLGGWESM"
     gene            complement(<466662..>467855)
                     /gene="TYS1"
                     /locus_tag="KLMA_30211"
                     /db_xref="GeneID:34715497"
     mRNA            complement(<466662..>467855)
                     /gene="TYS1"
                     /locus_tag="KLMA_30211"
                     /product="tyrosyl-tRNA synthetase"
                     /transcript_id="XM_022818713.1"
                     /db_xref="GeneID:34715497"
     CDS             complement(466662..467855)
                     /gene="TYS1"
                     /locus_tag="KLMA_30211"
                     /codon_start=1
                     /product="tyrosyl-tRNA synthetase"
                     /protein_id="XP_022675352.1"
                     /db_xref="GeneID:34715497"
                     /translation="MSSVTDPKEQYELITKNLQEVLNGQIIKNVLEVEKRPLKLYWGT
                     APTGRPHCGYFVPMTKLAHFLKAGCEVTVLLADLHAFLDNMKASLEVVSYRAKYYELV
                     IKAILKSINVPIEKLKFVVGSSYQTSTDYVMDIFKLSNIVSQNDAKRAGADVVKQVDN
                     PLLSGLIYPLMQALDEEHLGVDAQFGGVDQRKIFVLAEENLGKLGYKKRAHLMNPMVP
                     GLGQGGKMSASDPNSKIDILEEPKQVKKKINSAFCAPGVVEDNGLLSFIEFVVAPIQE
                     LKHGANYFKFDIDRPEKFGGPVSYSSIDDIKKDFAEQKLAPPDLKAGVTEAINELLAP
                     IREEFQNNPEFQEAEAKGYPAPVPEKTKKAKKPKNKGDRYPGAKPATEEVTQQLKDTT
                     LEGSQ"
     gene            <468561..>470597
                     /gene="TFG1"
                     /locus_tag="KLMA_30212"
                     /db_xref="GeneID:34715498"
     mRNA            <468561..>470597
                     /gene="TFG1"
                     /locus_tag="KLMA_30212"
                     /product="transcription initiation factor IIF subunit
                     alpha"
                     /transcript_id="XM_022818714.1"
                     /db_xref="GeneID:34715498"
     CDS             468561..470597
                     /gene="TFG1"
                     /locus_tag="KLMA_30212"
                     /codon_start=1
                     /product="transcription initiation factor IIF subunit
                     alpha"
                     /protein_id="XP_022675353.1"
                     /db_xref="GeneID:34715498"
                     /translation="MSAPLKSDDASPFIKRDQMRREFLKARQRSNNPRPMVKKEDPEQ
                     AEEEARKLLQPEALSRRVKKEPGKSGYSEFPLRAIDMRENENVKTNLVKFQSKKPIDP
                     QDFHLPIRLHRKDTRNLQFQLTRAEIVQRQKEIAEFKKRQLEEAGGSTGSAGATNNST
                     PTPFNANNRSGNSKQSTPVAHQGNSTASVTPMNTNTNTNNTTTTTTNNNNNGNTNGAT
                     DPNNPGAKEGSPSNILTPLEVAGPAEDPTKVGMVKYDGKPEPEVHEEGTIDPMADIAP
                     HGGGRFKRGNSKKKTRQLKRLDEEAKRLRFEEFYPWVMEDFDGFNTWVGSYEAGNSDS
                     YVLLSVEDDGSFTMIPADKVYRFTARNKYNTLTIEEAEKRMEKHKEGAPRWFMKHLDE
                     SSKTTTRYDRTLRRLRAVDGNTRKADEDEDRDDNSEVELDYDEEFADDEEAPIIDGNE
                     EENKESEQRIKKEMLQANAMGLRDDDGEESDDELFGEKKIDEEGEKVKKALLKTDLGA
                     LYESDEDENPYLSHSEEDEEQNEEKKDSDKENEKQSRKSSPKKKSSDTPSGPPKLVVK
                     SVNQHIVVLHGEKSVLSNFPAGDWNPNAKKRAAEPTSSAQPDSKKLKTDYSDADLLTE
                     DDIINAIQGKKLTLKQLIQQLKEKVSKHPDNKERMKVFVKNLVKLNGKFLELSK"
     gene            complement(<470756..>471910)
                     /gene="HGH1"
                     /locus_tag="KLMA_30214"
                     /db_xref="GeneID:34715499"
     mRNA            complement(<470756..>471910)
                     /gene="HGH1"
                     /locus_tag="KLMA_30214"
                     /product="protein HGH1"
                     /transcript_id="XM_022818715.1"
                     /db_xref="GeneID:34715499"
     CDS             complement(470756..471910)
                     /gene="HGH1"
                     /locus_tag="KLMA_30214"
                     /codon_start=1
                     /product="protein HGH1"
                     /protein_id="XP_022675354.1"
                     /db_xref="GeneID:34715499"
                     /translation="MPTQLEELVSFLHSDQPAVRQIALDNLVGFSTGSNAAIFRYDNY
                     RSIKDLKILAKDKSKVIVQQSTTILANLCDDVTARKLIVDDEEFLEYLSWKICDLSNA
                     SADIMCILLSNLAKEDKVTKVFSFVKREDDGIPLDKEVFKSNKVMDCLMDCFVKGYDR
                     KLNKYANFDYLAYFFADISRFKMGREYFIQEQEYDNVIPIKKLLVFTEKYDCKTRREG
                     VAYTIKNSLFDSEKHEVLLKNEDINLLPYILLPIASAKDSEIDEEDLFNLPDELQFLP
                     EDKQRDPIPEIICVHLESILLLCTTRAGREYLRSKSVYPLIRELHKNVDHEDIGEVCH
                     RVVNMLMRGEPENEVIEEIVSKSAEDGDELEAEEVDEESEDDDEAIVEVL"
     gene            <472353..>472670
                     /locus_tag="KLMA_30216"
                     /db_xref="GeneID:34715500"
     mRNA            <472353..>472670
                     /locus_tag="KLMA_30216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818716.1"
                     /db_xref="GeneID:34715500"
     CDS             472353..472670
                     /locus_tag="KLMA_30216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675355.1"
                     /db_xref="GeneID:34715500"
                     /translation="MSSPLIGLSSSESESFNCNKLSKIHDGTMLMAGLSAGILQLESF
                     AGFGMFLGVYTLVNLLFIGWMCKFKPSYYFGTPIQTIWLQPLFRELAGFVMTWTFAFT
                     LVR"
     gene            complement(<472919..>475783)
                     /gene="PUF3"
                     /locus_tag="KLMA_30217"
                     /db_xref="GeneID:34715501"
     mRNA            complement(<472919..>475783)
                     /gene="PUF3"
                     /locus_tag="KLMA_30217"
                     /product="mRNA-binding protein PUF3"
                     /transcript_id="XM_022818717.1"
                     /db_xref="GeneID:34715501"
     CDS             complement(472919..475783)
                     /gene="PUF3"
                     /locus_tag="KLMA_30217"
                     /codon_start=1
                     /product="mRNA-binding protein PUF3"
                     /protein_id="XP_022675356.1"
                     /db_xref="GeneID:34715501"
                     /translation="MSISEQMDGWGLTVSDVMGSGSKDAGNPIDSELASIVSSLSALS
                     NPALQRQQSQQQLSQQQQSQQQQQQQAQQQSQQQIGGFRRASFNSNAGSDVDSEILFA
                     SQNSPMLRRTTLSVGGVSLPANTSSHAQNRLNPMNHYSASIAGGLTAQFQAYSSNNNN
                     NNNNGSTVGSNSAANVASSGGTGFFERFGRALAEGTREVELNMAPVSQTVSGQQVSVG
                     SGAAGAGSRRTSASPGMEHLSRVGSTTTMQATAAARRMSDTSDVLESVSESLSMQHNE
                     PNPTTIWNVAAAPVFRPQDAQQAGVPQSHQMHQPNRQFYGGAGGNGKDDQDPGITNNI
                     EQPQYNYGYPPFNQFGVPMFIPPVLSPHPHFPGMPSDQNPEDANAAADGNASLHGDKV
                     NNGGASSFTGGDHVDGSATRDAAEQQGLKNGGAGASNGATDMAAGASPMMPHPPNGHY
                     PFPTPYPFMFPPVKENAIDDSDGNSAAKPPMSPPFIPQLPYMFIPPGVPVHNHPNAQD
                     STSTAETTRSGKRGTDSKFSTKSKGNPYLHNGKPNYGQFSPPPSRMNGTPQQNSQHGG
                     SSTPSSSKPARQGKGARQSNKPPIIRSPLLEEFRNNPTNKVYKLSDIYGSALEFCKDQ
                     HGSRFIQQELATASDAEKEVIFNEIRDESIPLSHDVFGNYVIQKFFEHGTKTQKEVLV
                     DQFRGKMEVLSLEMYACRVIQKALEFLDEDQKVSLVSELSNRVLVMIKDQNGNHVIQK
                     AIECIAIEKLPFILQSLKGQIYHLSTHSYGCRVVQRLLEFGSLEDQDNILNDLDEFIP
                     FLIQDQYGNYVIQHILQHGTDDTSVHIGRSKQNIIDTICKNVVEFSKHKFASNVVEKS
                     VVYGSKSQIRQILDEILPKDEEHAADLEDSAPLILMMRDQYANYVVQKLVGVATDNDE
                     RLIVIAIRSYLDRSNKNNTLGNRHLASVEKLATLVENIKI"
     gene            <477436..>479445
                     /gene="IZH3"
                     /locus_tag="KLMA_30218"
                     /db_xref="GeneID:34715502"
     mRNA            <477436..>479445
                     /gene="IZH3"
                     /locus_tag="KLMA_30218"
                     /product="ADIPOR-like receptor IZH3"
                     /transcript_id="XM_022818719.1"
                     /db_xref="GeneID:34715502"
     CDS             477436..479445
                     /gene="IZH3"
                     /locus_tag="KLMA_30218"
                     /codon_start=1
                     /product="ADIPOR-like receptor IZH3"
                     /protein_id="XP_022675357.1"
                     /db_xref="GeneID:34715502"
                     /translation="MKVVMPVVEDVAVIGSGLEEDHHYGDEMRGKTNSEQEYVALTRL
                     ARFIQAANQKLDRLESVLPSNPVSNTTNLPRKGFNMLRQRGRRFFRWNNSRAIEAEEG
                     GVGEQTLVDLINSPDAPAFYKFLKRTTEELGAVLPDSDVETLFAEEFEKNLGKNRASI
                     TLPLAKFSQIYEDHFTSNSTSCTSSSTTLHSSAKGSTRSSSRNSTKHSSRSGSDEGTA
                     SGSVSPTWSHANLASQQSQQQQLLSTGLSTISTTTSTTITSSSTTAFALDAIRADAQE
                     AQNTESQCAELPDSFYAGNVEEVDPLQVIQTLDFLDKHLDLFIEDPSSIKTTIQFYNW
                     ENARDTGRKRHLHFYELPFPWRENRYIINGYRFYDSHFKSLLSVVNWYGWHNETLNIW
                     SHLFGAFYIVYLLLVQFPSTKVYQSHEVPMFGKIMVQVFLVAGLKCLISSSIWHTLNG
                     TCCLSLRSKFACIDYTGITVLITASILSTEFVSVYNVATDSLSNSMIVYMSLSLCLGV
                     FGSVMNWSPNFDRPESRPFRIAFYVVLAGLGMLSFIHLTIAHGIEQSSQFFHPLWNKS
                     LIWYLIGVAFYGSFIPERWRTDVELDCDIPTNAELCSNLDILTKHKHLHFRDVPSKKS
                     RTGFFSLWWVDYVLSSHTIWHLFVLLGVIGHYNSLLDMFELKWHL"
     gene            <480015..>480758
                     /gene="SDO1"
                     /locus_tag="KLMA_30219"
                     /db_xref="GeneID:34715503"
     mRNA            <480015..>480758
                     /gene="SDO1"
                     /locus_tag="KLMA_30219"
                     /product="ribosome maturation protein SDO1"
                     /transcript_id="XM_022818720.1"
                     /db_xref="GeneID:34715503"
     CDS             480015..480758
                     /gene="SDO1"
                     /locus_tag="KLMA_30219"
                     /codon_start=1
                     /product="ribosome maturation protein SDO1"
                     /protein_id="XP_022675358.1"
                     /db_xref="GeneID:34715503"
                     /translation="MAVINQPSGQIKLTNVSMVRLKKAKKRFEVACYQNKVQDYRNGV
                     EKDLDEVLQINQVFLNVSKGQVASKEDLQKAFQTTDVDAVIKEIISKGEIQLSEKERQ
                     LQLNKINNEMLTIISAKCINPNSKKRYPPTMIHKALLELKFNVVVNKPAKLQALEAIK
                     LLVSKQIIPIVRSKMKIKVDVSLETQGSTELIEQLNNIIKSADVNKSETSYSIVGLID
                     PVAYRELVNMCNGKATLQVLDMAVIEDTK"
     gene            complement(<480810..>481295)
                     /gene="IRC25"
                     /locus_tag="KLMA_30220"
                     /db_xref="GeneID:34715504"
     mRNA            complement(<480810..>481295)
                     /gene="IRC25"
                     /locus_tag="KLMA_30220"
                     /product="proteasome chaperone 3"
                     /transcript_id="XM_022818721.1"
                     /db_xref="GeneID:34715504"
     CDS             complement(480810..481295)
                     /gene="IRC25"
                     /locus_tag="KLMA_30220"
                     /codon_start=1
                     /product="proteasome chaperone 3"
                     /protein_id="XP_022675359.1"
                     /db_xref="GeneID:34715504"
                     /translation="MKFVEHVKELDSEVFSDFPGELGIFASHYENKVVVQIRYNGEMD
                     STYELKSKGLGNQEQELALDFGNEGGDFADDYAPVRDPLSHYDVITKLGDSNDMKIPI
                     ICTQIAQLYDRVIIPRLGGQQGLPSDYVITLSTKLWRKSEVKSFEKLIFLLAAIKEAY
                     E"
     gene            <481570..>483189
                     /gene="YEH2"
                     /locus_tag="KLMA_30221"
                     /db_xref="GeneID:34715505"
     mRNA            <481570..>483189
                     /gene="YEH2"
                     /locus_tag="KLMA_30221"
                     /product="sterol esterase 2"
                     /transcript_id="XM_022818722.1"
                     /db_xref="GeneID:34715505"
     CDS             481570..483189
                     /gene="YEH2"
                     /locus_tag="KLMA_30221"
                     /codon_start=1
                     /product="sterol esterase 2"
                     /protein_id="XP_022675360.1"
                     /db_xref="GeneID:34715505"
                     /translation="MELRPPYFSRFIRVSSESVQRTGRFSMVQKWYHTITSRLITTMF
                     LTVLMICAIWHNFLTSHIFKRKQRVVLDPRDTRPANVITPQTTSHSHMMHRHTQSFSS
                     SAPIEVDVEVDDVNNIEYDRTITRRIKARDTDFNPFADVLSGEDLKLVPNLQYYYSQY
                     NIVVDEYEVTTKDGFVLELWHLRKKDESEFNDRYPILMLHGLLQSSGSFASAGRKSLA
                     YYVHDSGYDVWLGNNRCGFKSKWDREKLAPNGEWDWDLNTMTRYDLETLVDAVLEKKQ
                     HKFEKLSLIAHSQGTTQAFMGLVNEDDIYKDTDFRLSSKLDNFVALAPAVYPGPLLDE
                     KLFVKFMAKHIDNKWVFGDKSFVPLMMEMRDIMAGHKIFSFLSYVMFNFLFNWNDILW
                     DRPLRDRHFLFSPVHISVKLMQWWLSLDPLKSSFKTFAEDMFPDVKTWFPVHSESTSM
                     DEHLHKNEHKPVTQDWPKILLFIPRQDRLVDGERLINHFINHEPHSIFKIWYIDEYSH
                     LDVLWAGDVIERIGKPMLENMYFPEQHSATN"
     gene            <483633..>485066
                     /gene="DCAF13"
                     /locus_tag="KLMA_30222"
                     /db_xref="GeneID:34715506"
     mRNA            <483633..>485066
                     /gene="DCAF13"
                     /locus_tag="KLMA_30222"
                     /product="protein SOF1"
                     /transcript_id="XM_022818723.1"
                     /db_xref="GeneID:34715506"
     CDS             483633..485066
                     /gene="DCAF13"
                     /locus_tag="KLMA_30222"
                     /codon_start=1
                     /product="protein SOF1"
                     /protein_id="XP_022675361.1"
                     /db_xref="GeneID:34715506"
                     /translation="MKIKTISRSADDYVPVKSTQESQLPRNLDPALHPFERAREYTKA
                     LNATKLERMFAKPFIGQLGYGHRDGVYTIAKNYNVLNKLATASGDGIIKYWNMSTREE
                     LSSFKAHYGMVTGLCVTPLHLSPQRENFMLSCGDDKTVKLWSVNSDDFANVKDDTRLN
                     NEHGIIKTFHGEHAFQSLDHHRQKSNFVTGGAQIELWDTNRSKPISNLSWGADNINHV
                     RFNQNEVDILASTGSDNSVVLYDLRTNSPTQKIVQTMRTNSICWNPVEAFNFVIANED
                     HNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGHSRE
                     IYHTKRMQHVFQVKYTMDSKYIVSGSDDGNVRLWRAKAWERSNAKSTREKNKLEYDEK
                     LKERFKHMPEVKRISRHRHVPKVVKKAQEIKKIEIDSLKRRERNERRTRKDMPFVPER
                     KKQIVGTVFQYEDKQKDNSKSTNSDDE"
     gene            complement(<485498..>486784)
                     /gene="PSR1"
                     /locus_tag="KLMA_30223"
                     /db_xref="GeneID:34715507"
     mRNA            complement(<485498..>486784)
                     /gene="PSR1"
                     /locus_tag="KLMA_30223"
                     /product="phosphatase PSR1"
                     /transcript_id="XM_022818724.1"
                     /db_xref="GeneID:34715507"
     CDS             complement(485498..486784)
                     /gene="PSR1"
                     /locus_tag="KLMA_30223"
                     /codon_start=1
                     /product="phosphatase PSR1"
                     /protein_id="XP_022675362.1"
                     /db_xref="GeneID:34715507"
                     /translation="MGFITSLLCGSSDSESSKKQKSKNSVTSNNHNSKSGTGLNLEKS
                     KSNKSGSPSRTNKKRSSAHTGLHSTNTRQSAVHTTLSNSTAEMHLAKKGTTKIKRAYG
                     SVPVEKSKAPAVAEQVVHSSEITNDSSSDDAAMDVDVDMDADDDDDDDDIKADEKQTL
                     LVYNAESDNSTGTTADTAVSAGQAAPPEITTTVHETEHTSSAEDSEGIQSQGVSDIDM
                     VNADYDEGDLLDLSLLQPDQAHAPGVNTLLLPKTEQFKGKKCLVLDLDETLVHSSFKY
                     LRTADFVIPVEIDNQVHNVYVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLDIL
                     DKEKTIHHRLFRDSCYNYDGNYIKNLSQIGRPLSDMIILDKYPASYIFHPQHAIPISS
                     WFSDAHDNELLDIIPLLEDLAQERVPDVGKILDVTI"
     gene            <487558..>488871
                     /gene="POM34"
                     /locus_tag="KLMA_30224"
                     /db_xref="GeneID:34715508"
     mRNA            <487558..>488871
                     /gene="POM34"
                     /locus_tag="KLMA_30224"
                     /product="nucleoporin POM34"
                     /transcript_id="XM_022818725.1"
                     /db_xref="GeneID:34715508"
     CDS             487558..488871
                     /gene="POM34"
                     /locus_tag="KLMA_30224"
                     /codon_start=1
                     /product="nucleoporin POM34"
                     /protein_id="XP_022675363.1"
                     /db_xref="GeneID:34715508"
                     /translation="MNDGISAPGTPVKNFQTPSRPLSQQQFRSLKEKAAKQSPSLYKF
                     KVLSDPTKKSGLGSSEIAKQSAQKTVPESDSSLFERSVFSGRREKSSDGGLIGHLSKD
                     RSRLENNIKQHIPPKAKVLLSKVSLKSHEQPRTSLQAESSSSSDLLPDEAPPTGNETT
                     KWDGSEGQLTDFENPALAVFTSRMVNKELEMRRLLTNIVLALIWNLISKFVMLFFQYT
                     KKGAQLRDEIHRLVLKYVVYKIYPQAHVQSIWFQLLSWQCITSVFHLIVLYNIGVCLW
                     NLLVKAQNLDMSDLNLTEHQKRLLGIIDDHATTANSTAPATGERLSNNKPTGKNVHNT
                     FVNDADSKAGHKPFIFKSLQTPTKMREEQYSSRNEIGGQNHVSFSVQPKKVNAFGVQS
                     VDATSMTPMRSLPSIRSQRQEIRPGYIPSNRYTYMMDSPSSTRKL"
     gene            complement(<489112..>490134)
                     /gene="MEU1"
                     /locus_tag="KLMA_30225"
                     /db_xref="GeneID:34715509"
     mRNA            complement(<489112..>490134)
                     /gene="MEU1"
                     /locus_tag="KLMA_30225"
                     /product="multicopy enhancer of UAS2"
                     /transcript_id="XM_022818726.1"
                     /db_xref="GeneID:34715509"
     CDS             complement(489112..490134)
                     /gene="MEU1"
                     /locus_tag="KLMA_30225"
                     /codon_start=1
                     /product="multicopy enhancer of UAS2"
                     /protein_id="XP_022675364.1"
                     /db_xref="GeneID:34715509"
                     /translation="MRIFIRGFKAIPKFYKFTMTNTKSAELPQTFEGTIDLGIIGGTG
                     LYKLDCLEPIAILPRMETPWGQTSSPITVSRVKSDETEHFHVAFIARHGVNHEFPPTR
                     VPFRANIAALKHLGTKAILSFSAVGSLQQEIKPRDFVLPQQIIDRTKGIRESSYFNDE
                     GLVGHVMFGEPFSKSFADYIYQFQDVLENPDSAEPCLLHYNKELTVVCMEGPQFSTRA
                     ESKMYRLLGGDVINMSVIPEAKLARECEIPYQMVCMSTDYDAWRDEEEQVSVQTVIGN
                     LQNNAKNANHLASKVIVEMAKELPVFMKNGDGLRDMMKFSISTKPEAMSKETLAKLKF
                     LFPNHW"
     gene            complement(<490671..>490967)
                     /locus_tag="KLMA_30226"
                     /db_xref="GeneID:34715510"
     mRNA            complement(<490671..>490967)
                     /locus_tag="KLMA_30226"
                     /product="cytochrome c oxidase copper chaperone"
                     /transcript_id="XM_022818727.1"
                     /db_xref="GeneID:34715510"
     CDS             complement(490671..490967)
                     /locus_tag="KLMA_30226"
                     /codon_start=1
                     /product="cytochrome c oxidase copper chaperone"
                     /protein_id="XP_022675365.1"
                     /db_xref="GeneID:34715510"
                     /translation="MLTHLVMNNVQQRPESLSLDKKSSNTYIPRHNTMPETTNTNAQT
                     QTETAASKPKPCCVCKPEKEARDECLLFNGQDNGKCDELIAKYKTCMKGYGFDI"
     gene            <492074..>497851
                     /gene="CYR1"
                     /locus_tag="KLMA_30227"
                     /db_xref="GeneID:34715511"
     mRNA            <492074..>497851
                     /gene="CYR1"
                     /locus_tag="KLMA_30227"
                     /product="adenylate cyclase"
                     /transcript_id="XM_022818728.1"
                     /db_xref="GeneID:34715511"
     CDS             492074..497851
                     /gene="CYR1"
                     /locus_tag="KLMA_30227"
                     /codon_start=1
                     /product="adenylate cyclase"
                     /protein_id="XP_022675366.1"
                     /db_xref="GeneID:34715511"
                     /translation="MDSSNSKEQDPIQDQQHVDSSSTAGQNVRGSDGGGNATDRSSHS
                     QTTDDNVHDSNVWHSYSNDVPTFKLDYTIDAAGNSRVPEKKGFHSAIGRNAGSFAHNP
                     RPPLSRPVKPSFERSKTANLSPASPRAGGQNLPHLSNLSRTTSALSMSSMASHHQSKG
                     NLKPSRASTFFKKLTSRKSSLAGQTAPSDLDTVSINDDKVYTTDGDIPLPQQQHFHAP
                     PTSALRRKMSTFIHGSGNMTSVSPFTALHGPTSKAGTSKSNLLLVSNSESRRGSTSSA
                     TTTVSNTSNLNANSNPQHSGSQLTKNTADTDLIRTRSRSSHEATSKKSSANDIFGVDL
                     NLQNLSDMTDVVVNMAPSVPVTASKIETPAPLTPNEKNEANAAARKQWTAPESWDVDE
                     TVGLDVNKIREKHKNSKTHNQKTKNRHRKHHKLDGSQKNMSKKLVDHRKSEAVIPHVH
                     HHDFEEDALSPHTSSTAKGSDDLSLSLSRTLSSECECCNTISPNGEDDSDITLDTQSG
                     SFDEVDSDKKSSRPGSPLPQTKIEQYSQIDGETEFEEHMLEKYYSDLSDIDQTKKYAI
                     RIFNVDDTFTTLSCHPNTTVAELIPQIKKKFNIHQGNFQLSLKVGKLSKILSPTAHPI
                     LIQIKLLLLNGYKKSDPLHILGLDDVSFVFSFKFHPVTTSQLTAEQQQRLSKGDFIHV
                     DLRNMDLTTPPIIFYQHTSEIESLDVSNNANIFLPIDFIESAVKLSSLRMVNVRASRF
                     PANITEACDLVSLDLERNFIKRIPESISNLSNLTILNLQCNQLDRLPSGFKNLKNLQL
                     LDISSNVFTTYPEVVNKCTNLLQVDISYNKISSIPSSINQLTNLAKMNLSNNRIQAVP
                     DLSGMTNLRTLNLKNNRIASIKSNAPNLQNLFLTSNRISVWEDSLPKLRSCDLTENPV
                     TSFDYRGNVLSNLTSLSLNKAKLSSLPIEFLKTLQKLEKLELNENNLTSLPPQIKYLK
                     KLVHLSAANNKLDSVPNEIEFLTNLKSLDLHCNNISNLPAQISKLELTTLNISSNLLG
                     YDAGFNNYAESPLSKSLLFLNVADNNLSAEMLPLFNYNNRLKIINLSYNDISDISSLN
                     LPTLTELYLSGNNITSLPGEIFQRMKSLKVIMLNGNKLMSLPSELSQLTNLTVLDVGS
                     NQLKYNISNYHYDWNWMHNHNLKYLNFSGNKRFEIKSMIGADTKTDLSDLTILRQLKI
                     LGLMDVTMKTSKVPDDGVNFRLRTTGSMINGMKYGVADTLGKKSSVSTRDIKYERFRG
                     KDDQCLFCLYDSVNENSTSGHKISQIVRDIYDKILSRSLDKYGDDTDENIRTALRFSF
                     LQLNKEINSMVVSMENGSNHAELTSVDLLSGASATVVFFKGDSVYTANIGNIRAILAK
                     NNGDYEILTRLHVPIKRDEYERIRIAGGYVNSNKLDGVSDVSRAVGFFDLLPHIHASP
                     DISDFKLTFSDQMIIIASHNLWDYINYETASDIARENGSEPMLAAEKLKDYAISYGCT
                     DKVTVVCISLEKGATQTNRFNISKKDLLSRKNAFEDTSLRRLQPEIPPPTGNVAIVFT
                     DIKNSTFIWELFPDAMRTAIKTHNDIMRRQLRIFGGYEVKTEGDAFMVAFPTPISALV
                     WCLSVQLKLLEAEWPGEITSIRDGCLITDTNGNKIYQGLSVRMGIHWGCPVPEVDVVT
                     KRMDYLGPVVNKAARVSGIADGGQVMLSNDFMVEFNKILKYHQQVAEQNTPLDKAYGE
                     DIVGEVLEREMHMLDSIGWVFIELGEQTLKGLETKEHVTIAYPKSLESRHTLATQDQK
                     NSVISDEFLFQIRSVSNRLETILSSVQGGIIGLDGTMNGQYTTFDTHTKQAVMKKSSE
                     ADLLSFLDHLVTRIESSVVLMNMRQQIQGGLLIYKPNEQKKQKSIFELLDDVLAKVKS
                     LPQEDVSSENTEGNNISEVDTNSQT"
     gene            complement(<498129..>498722)
                     /gene="SYS1"
                     /locus_tag="KLMA_30228"
                     /db_xref="GeneID:34715512"
     mRNA            complement(<498129..>498722)
                     /gene="SYS1"
                     /locus_tag="KLMA_30228"
                     /product="protein SYS1"
                     /transcript_id="XM_022818730.1"
                     /db_xref="GeneID:34715512"
     CDS             complement(498129..498722)
                     /gene="SYS1"
                     /locus_tag="KLMA_30228"
                     /codon_start=1
                     /product="protein SYS1"
                     /protein_id="XP_022675367.1"
                     /db_xref="GeneID:34715512"
                     /translation="MASVRRYLRVPRELMPSEIFKQESQSPGKIVIQIILLQMFYYLT
                     AAVLFYGWATLCGYDINLKQWLFTWQDIDFSNSFGISLSALWLIDSLICVFFLTVIVG
                     RSKLAWDFAITIHAINLVVVWTHTGLFPSLAWFVLQFLSTLILVFLGTWFTRWRELKD
                     TFFEGMVDTESVSAPSSQPASQPLTGNIELRDLEAQK"
     gene            <499190..>501469
                     /gene="DRS1"
                     /locus_tag="KLMA_30229"
                     /db_xref="GeneID:34715513"
     mRNA            <499190..>501469
                     /gene="DRS1"
                     /locus_tag="KLMA_30229"
                     /product="ATP-dependent RNA helicase DRS1"
                     /transcript_id="XM_022818731.1"
                     /db_xref="GeneID:34715513"
     CDS             499190..501469
                     /gene="DRS1"
                     /locus_tag="KLMA_30229"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DRS1"
                     /protein_id="XP_022675368.1"
                     /db_xref="GeneID:34715513"
                     /translation="MVGKKFKAFGDFVPTISDSEEDIPDLDASDDELQKKPVKASKNS
                     KNKGKKGKKNTGQDLDEDVHEDLNPEFQFSVDGAEVTTNFEGWEFLGDDKTDAPEKKD
                     VDLDGIIRRKGGLIKMAAAGSEEEEGESAEEEEEEEEEESDKEEVNNDSDDDELALDG
                     FGMGAIKKTKESTEDDEENEEENQEDSDEENDAEGSDEDVEMTQNDLGRGKFNEEEEV
                     EDSPEEMAKFYAPDDEGDDAKKTVHKTFNSLSLSRPVLKGLSSLGYTKPSPIQSAAIP
                     IALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAQIASTRVIVLTPTRELAIQVSDV
                     GKNIAKFVNGITFGLAVGGLNLRQQEQSLKTRPDIVVATPGRFIDHIRNSPSFSVDAV
                     EILVIDEADRMLEDGFQEELQEIMSLIPSKRQTLLFSATMNSKIKQLISLSLKRPVRI
                     MIDPPKQAAAKLTQEFVRIRKRDHLKPALLYQLIRKLDSASQKRIVVFVARKETAHKL
                     RIILGLLGMQVGELHGSLTQEQRLQSVNNFKSLQVPVLICTDLASRGLDIPKIEVVIN
                     YDMPKTYEIYLHRVGRTARAGREGRSVTFVGESSQDRSIVRSALRSVEENADSGKALS
                     RSVDWVQVEQINSLVESKNEVIEEVLDEEKQEKEILRAEMELRKGENMLKHKEEISAR
                     PRRTWFQSESEKKNSKLLQILSKNKKPMNSKKRKQQEALAERPRLYKKTKKDRMEYQE
                     LQFKKQSKAPAKKGKKGKK"
     gene            complement(<501581..>503560)
                     /locus_tag="KLMA_30230"
                     /db_xref="GeneID:34715514"
     mRNA            complement(<501581..>503560)
                     /locus_tag="KLMA_30230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818732.1"
                     /db_xref="GeneID:34715514"
     CDS             complement(501581..503560)
                     /locus_tag="KLMA_30230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675369.1"
                     /db_xref="GeneID:34715514"
                     /translation="MDAIIQELENCKAHANNAGTLSQESSERYLDLLITSLFSQDAVE
                     RDDKLLLIGLGHLSDMASVETWKQRLSPDLINKIYDLIISQQSDDLATTQASTSILTK
                     LSQICLSNSPEVEALLEHLCISLQTNNNILTLLHFLLQKYNKNMMICFKIVNYLSLHI
                     ECLVKWCSRGEKTAIQIATATNIALKDIGILDEIDVILKSQKRESSIINAVDAFIKSF
                     KRLKTCLVELDPLEYEIETVQQVKALIHQLFDVYDVTKERFSKSNKECENLAGLTIIE
                     ILNLRFALIQNDLTFKKQFTEQLMFQENPLPLLKSISGISDIIWKYLDMSNDQIETKP
                     YKKHFILHFKEIIISLLNMLAKMWEISKSGTLGDLESLLGLVRILILKVDKICQTEED
                     SFLELFSEICETSSYEDLRQLQVAQWRTKQYQDWADDISSFDEILRNQVQEFVRYQRL
                     LLMQKGTWVYSENPIEAKDKLPKVSFIALSDNQMNFLIREFKHKVETSPSVNDNEIEC
                     IDRSALLNNKTLVIPLKNIANIQSRQIELDRKIPEGARLINILQTTIYTEVTIFERNG
                     KILSVFYLESAKSFYTWLDGLQLLSQNKNAKLSSETVEQIDILIELRRNIQLAALNDK
                     FKDEQSVESFSEEEDDELYYNQDTLKLLTENLYYE"
     gene            <504252..>505565
                     /gene="MMM1"
                     /locus_tag="KLMA_30231"
                     /db_xref="GeneID:34715515"
     mRNA            <504252..>505565
                     /gene="MMM1"
                     /locus_tag="KLMA_30231"
                     /product="maintenance of mitochondrial morphology protein
                     1"
                     /transcript_id="XM_022818733.1"
                     /db_xref="GeneID:34715515"
     CDS             504252..505565
                     /gene="MMM1"
                     /locus_tag="KLMA_30231"
                     /codon_start=1
                     /product="maintenance of mitochondrial morphology protein
                     1"
                     /protein_id="XP_022675370.1"
                     /db_xref="GeneID:34715515"
                     /translation="MIDNGTNNTIVSEFNSSELCIDDGNTSYSNFTNEHSGTNDTFMT
                     LDEYLNKTLPLHLDQLVLDTNQRELFDTAAKSILSSALLERQQQSLQTISSKPHSSFS
                     SQSFAQGLIVGQLSVLIVLIFAIKFFVFSEGGAKTATAKSVATTSSFMDSTKNSILST
                     IIKRGGKDGLEVAEQENDKSKQINSILEKTYYNVETHSPESLDWFNVLIAQTIQQFRE
                     EALQKNNIINSLNDFIERRSDELPQYLDQIKITEVDIGDDFPIFSNCIIQYSPNSNKK
                     RLEAKIDIDLSDRLALGIETRLLLNYPKPLSAALPIQLTVSIVRFQACLTVSLTTDEQ
                     FVPTSKDVGDEMGNEKGYYLMFSFNPEYRMELEVKSLIGARSKLENIPKIASLIEYQI
                     SKWFVERCVEPRFQFVKLPSMWPRSKNTRKEKTDTDDTGSVKSND"
     gene            complement(<505562..>508351)
                     /gene="SPO75"
                     /locus_tag="KLMA_30232"
                     /db_xref="GeneID:34715516"
     mRNA            complement(<505562..>508351)
                     /gene="SPO75"
                     /locus_tag="KLMA_30232"
                     /product="sporulation-specific protein 75"
                     /transcript_id="XM_022818734.1"
                     /db_xref="GeneID:34715516"
     CDS             complement(505562..508351)
                     /gene="SPO75"
                     /locus_tag="KLMA_30232"
                     /codon_start=1
                     /product="sporulation-specific protein 75"
                     /protein_id="XP_022675371.1"
                     /db_xref="GeneID:34715516"
                     /translation="MNVENKTNILDYLRNIIYNYVEVDDSTAILVLNYKDELSPLQSK
                     YKNYTSGLIRTLLSNTRSGSAQRQFGITFSSFLSGVLVSVIFCVVQVLIFSILRNRFD
                     FIYQPNVNLYERHNKVNTEEADNYQGNGPLSEKLGNQLWSWIKPTWSASIEEYREYGL
                     DAYFFLRLLKTLSMFFLLLSIVIIPILIPIHYISGYKSADIENYISKMDLHDKITNEQ
                     MLSHLPYGLTGLDKISMSNISPAHNNRLAFHLILAVLLICFFHHLLLHELKYYVAERN
                     KLLTSQYKTKSFQNVLFIGNISKDFDRDKIEYFCESLIPGSVDQIVSLPEDYKMRKMF
                     RREICQLISLIENTQLDIIFSKAYYGKDKISSNDNIHYRSKQELSKIFPLYEFRYIYS
                     KRIDLKQKRNPIIYSARRLSFLIKETFSGNIFTGFQFKLIQNNNNIWRRFFSLKWNPN
                     LIIDSKQKKLERYLKKFEKNLIVQQDLEDHTGEKSSKQAFLVFKKVSFAHIFDQMLLS
                     SKSSEMSDDKALGINPEDIVWCNIEAVGRVMKLFRVAVSNFLNVTIIIGWVVPVAIVG
                     FVSQIPIITKIVPILTSLEDLPEYISKPLASIVPAVTLIFLTEGVPIFFRWFSVVKCL
                     RTGAQIEIDVQKWFFSFLFVHIFLVVTISSGISVVVETVVNSPINIPHLLGTNLPKCS
                     NFFCSFVLIRGIAYFGGNLLQLKNLLFYLGYYRWVKRTPREKLEYILDIPVYQWGSLY
                     PIFSVLASISIIYSVIAPFILPLASFSFIFVMFSFKYSLKYQYDHKNKSETLGKFYPQ
                     ALMQLYSGVYFLEACLIGLFALANCFRLSLFMFIFMIFTVSAHFQISNFTKPIIDHLP
                     ASLSSDEITQPKKDFRLNELESISHKIWIPYDKSGISTTEGEKWQSKYDMEFVHDNAF
                     INENGKIVVNSNPYV"
     gene            complement(<508827..>511064)
                     /gene="PMT2"
                     /locus_tag="KLMA_30233"
                     /db_xref="GeneID:34715517"
     mRNA            complement(<508827..>511064)
                     /gene="PMT2"
                     /locus_tag="KLMA_30233"
                     /product="dolichyl-phosphate-mannose--protein
                     mannosyltransferase 2"
                     /transcript_id="XM_022818735.1"
                     /db_xref="GeneID:34715517"
     CDS             complement(508827..511064)
                     /gene="PMT2"
                     /locus_tag="KLMA_30233"
                     /codon_start=1
                     /product="dolichyl-phosphate-mannose--protein
                     mannosyltransferase 2"
                     /protein_id="XP_022675372.1"
                     /db_xref="GeneID:34715517"
                     /translation="MSSSVSNDELQSNLRRRGKDVPEEVEVEGVSEQEIDDLSKYKNV
                     NQDPLLKLESIVMPIVFTGLALFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDV
                     HPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPDYIDYVKMRLFNALFSALCVPVAYFTA
                     KAIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVRFHNTRSKPF
                     SRKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLGDKSVSNKTYVCHW
                     IARILCLIVVPFSVFLACFKMHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDIAL
                     GSSTVSIKNQALGGALLHSHVQTYPEGSKQQQITTYGHKDSNNNWRFDRKRFDTPWSE
                     NETDIEFVVDGGRYRLVHQNTGKNLHTHPIMAPLLASAWEVSAYGDNYIGDPKDDWII
                     EVVDQKGDEDVTKLHPLTTSFRIRNAEMGCYLSQTGNSLPAWGFRQGEVACVKNPFKR
                     DKRTWWNIETNENEKLPPRPEDFKFPKTNFFKDFIHLNLAMMATNNALVPNAEKLDRL
                     ASSAWQWPTLNVGIRLCGWNDESVKYFLMGSPASTWPSTIGVLVLILIVGIYLIRWQR
                     QYNDFTDPESRNLFLMGGLYPLMAWGLHFFPFVIMSRVTYVHHYLPALYFALLVLAYL
                     FEISMQKWKKSKCGRVMRLCIYASYMAIVIYGFYYFAPISFGMTGPSTDYKYLNWLST
                     WTISD"
     gene            complement(<511496..>512785)
                     /gene="FUN26"
                     /locus_tag="KLMA_30234"
                     /db_xref="GeneID:34715518"
     mRNA            complement(<511496..>512785)
                     /gene="FUN26"
                     /locus_tag="KLMA_30234"
                     /product="nucleoside transporter FUN26"
                     /transcript_id="XM_022818736.1"
                     /db_xref="GeneID:34715518"
     CDS             complement(511496..512785)
                     /gene="FUN26"
                     /locus_tag="KLMA_30234"
                     /codon_start=1
                     /product="nucleoside transporter FUN26"
                     /protein_id="XP_022675373.1"
                     /db_xref="GeneID:34715518"
                     /translation="MDIEDSGTTLIASPGPDATSSRIRNKDLSDESWKEKLLDVNYLA
                     FFLIGIALLWPWNSFLSASLYFQHDVFEDTTIYAKIYTSTMMTVSTISSVLSNIILSE
                     IQHHYTDRIVSGLVLEIIVFTSLCGIVLFHTWISHFLSFVFIMILVLISSVATACSQT
                     GVMAMANVFGAEYNHAVMVGQAVAGVLPSLVLFIVSLFNQQQEQTATGINTYFLTTSV
                     MSLISIIVYRRSDIPLAGDEMVQVNELDEKVYIPFHVLFYKLKFLVISIFVIFCVTLI
                     FPVFASNTYVVSLPLKNSQFIPLIFLLWNLGDLVGRLVAERTFNSAWFTPRRIFALSQ
                     LRIAMVVVFFFFNINDTHKHSHLKALLDLSYGAWQFLFGLTNGLLGSLCFMNVGRSLD
                     TEDERKAAGGITNVFLSFGLASGSIISYLFAYIISNI"
     gene            complement(<513387..>515837)
                     /gene="CCR4"
                     /locus_tag="KLMA_30235"
                     /db_xref="GeneID:34715519"
     mRNA            complement(<513387..>515837)
                     /gene="CCR4"
                     /locus_tag="KLMA_30235"
                     /product="glucose-repressible alcohol dehydrogenase
                     transcriptional effector"
                     /transcript_id="XM_022818737.1"
                     /db_xref="GeneID:34715519"
     CDS             complement(513387..515837)
                     /gene="CCR4"
                     /locus_tag="KLMA_30235"
                     /codon_start=1
                     /product="glucose-repressible alcohol dehydrogenase
                     transcriptional effector"
                     /protein_id="XP_022675374.1"
                     /db_xref="GeneID:34715519"
                     /translation="MNYPPPLSGFQKPGGQAVPQMVATPQSVAQQLHQHPPGLLGAQG
                     NQHQIPHQHQHQHQHQHQHQHQAGQLNNVVPMMMNQVQGVMPGGASGPQQAVGPPNVG
                     TPNASQAALVAQQLSNANNPLCHPHLTDHSLLNSPIWKLQLQLAAISRQSLGQSNVYA
                     RQNAMKKFLNNQNQMGLSNTGPDGNQLQGNQTQQGLQNQQQQQQQQQQPQQAQQQVNG
                     NDASMSLVEHTKQHLMEMASSGNEASAGVVNSSSEVNSTGFSTPNTPKAELHPNTPSM
                     LLQHKKLSQYNIDEDDEVEHRMVAPSSSKHDDQLWHALDLSNLALFNLSEKLFDYEFL
                     TRLYLNGNNLTSLPSSIRKLRNLRVLDLSHNRLTELPKELGMCYQLKYLYFFDNMITT
                     IPWEFGNLFNLQFMGCEGNPLDKMLVKILAEKSVTGLIFYLRDNAPEIPYEHDRKFIE
                     ISSDGEPINEYESLQENAEHLNNNLLNNSFTLLSYNTLCHHYATPKMYRFTPSWALSW
                     DYRREKLKEQLLDFDTDVICLQEVETQTYEEYWVPLMEKHNYRCLFHAKTRAKTMPSK
                     DSKKVDGCAIFFKKDQFQLVFQDSIDFSSTWRSHKKFHRTEDYLNRAMNKDNVALIAE
                     LKHLETNENIWVVTTHLHWDPQFNDVKTFQVGVMLDYLETLIKQQNHINNNNDIKKVP
                     MVICGDFNSQLDSAVVELFNSGHVSSNHKDIEKRDFGYMSQKNFSHNLTLRSSYSVIG
                     ELPFTNMTPSFTDVIDYIWYSSQSLRVRGLLGKVDEDYASKFIGFPNDKFPSDHIPLV
                     TRFEISKGSNTQTSSRRV"
     gene            complement(<517172..>518287)
                     /gene="ATS1"
                     /locus_tag="KLMA_30236"
                     /db_xref="GeneID:34715520"
     mRNA            complement(<517172..>518287)
                     /gene="ATS1"
                     /locus_tag="KLMA_30236"
                     /product="protein ATS1"
                     /transcript_id="XM_022818738.1"
                     /db_xref="GeneID:34715520"
     CDS             complement(517172..518287)
                     /gene="ATS1"
                     /locus_tag="KLMA_30236"
                     /codon_start=1
                     /product="protein ATS1"
                     /protein_id="XP_022675375.1"
                     /db_xref="GeneID:34715520"
                     /translation="MTAVYELQCFGSNGSGQLGVGHEEDLMLPITSFVSKGIGIKKVA
                     CGGNHSLLLLEDGSLFWCGDNSVGQCAPIGKENGDTPNKSCSWVSVPGKYIDVACGWE
                     FSVVIDSEGMVMTRGKGCKGELGVPEVTESDAWNALFRVQDRRNATCHAAFQHCAVVD
                     RNVVFAWGNNRKQQICGESSLKVVDSPREIYHGRGSSEYVRVAVGKDFTFILVDKEGK
                     QDLILQGPLQQELPRIISKLDADQTTVKQFASMWSSLHLLTESGHLISIGRGSHGQFL
                     QNPIPSNTIGFAAGSEHGILVTSGMEVYCWGWGEHGNCGPLRPQGSSLESENHVTAHH
                     VNDKSNVISPLNLIGKYENVEAVYGGCATTWIMTRSD"
     gene            <520782..>522215
                     /gene="MTH1"
                     /locus_tag="KLMA_30237"
                     /db_xref="GeneID:34715521"
     mRNA            <520782..>522215
                     /gene="MTH1"
                     /locus_tag="KLMA_30237"
                     /product="protein MTH1"
                     /transcript_id="XM_022818739.1"
                     /db_xref="GeneID:34715521"
     CDS             520782..522215
                     /gene="MTH1"
                     /locus_tag="KLMA_30237"
                     /codon_start=1
                     /product="protein MTH1"
                     /protein_id="XP_022675376.1"
                     /db_xref="GeneID:34715521"
                     /translation="MFVSPPPTVSQQQLLPNVLTRRKSNDLATIPENPSGGSQDSLLS
                     NVGSGNTKKEFVNAPPEFANRARDEIKKRLLQKRGGAGSSGNSGNHGSGVRSMHSFRN
                     HGSSAVSSSQSSVYSGNTYNSDAASVVTGMTASSAAQSSIFSVPSFNTVSTQLTESSS
                     VIDAYDAKQQQQPLTITLEQALPTIFYDMYSPEILMNPQNLMSNGRPKFTKRELLDWD
                     VNDIRSLLIIESLRPEWHGQLPTIAFQPLQADGSMEQEPYFPQFRFQLLPLNSPDEVI
                     ISTLVSSDLYIEANLDYEFKLTSAQYTVNSARRRHEEHIGYHEPVMHLSKPEWRNIIE
                     NYLLNIAVEAQCRFDFKKACSEYKKWKLEQLRQQAIQQKQSFVKKPNMPPPSTIPKKS
                     KNSLLRRALLRNSQLKIEEQHELELQQQQQQMQQQQANAVEIPTKVSLTKEEKSMVWS
                     HCQLHVYQRLGLDWTPDNVSANKVATD"
     gene            <523071..>524495
                     /gene="DBP5"
                     /locus_tag="KLMA_30238"
                     /db_xref="GeneID:34715522"
     mRNA            <523071..>524495
                     /gene="DBP5"
                     /locus_tag="KLMA_30238"
                     /product="ATP-dependent RNA helicase DBP5"
                     /transcript_id="XM_022818741.1"
                     /db_xref="GeneID:34715522"
     CDS             523071..524495
                     /gene="DBP5"
                     /locus_tag="KLMA_30238"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DBP5"
                     /protein_id="XP_022675377.1"
                     /db_xref="GeneID:34715522"
                     /translation="MAELSKQASDLMARLNIKEPGKSAAVEEQPEKKPTDVSEKDASK
                     ETESKTNKEPETNVINSEYEVKVNLADLQADANSPLYSVKSFEELGLSEELLKGLYAM
                     KFQKPSKIQEKALPILIRDPPHNMIAQSQSGTGKTAAFSLTMLTRVDPNVNATQAICL
                     SPARELARQTLEVIQEMGKFTKVTTQLVVPDSFERNKPITANIVVGTPGTVLDLIRRK
                     MLSLGSIKVFVLDEADNMLDKQGLGDQCIRVKKFLPKTCQLVLFSATFDDGVRQYAKK
                     IIPTAVSLELQKNEVNVDAIKQLFMDCDSEEHKYTILSELYGLLTIGSSIIFVKTKQT
                     ANLLYAKLKKEGHQVSILHGDLQSQERDRLIDDFREGRSKVLITTNVLARGIDIPTVS
                     MVVNYDLPTLQNGQADPSTYVHRIGRTGRFGRTGVAISFIHDKKSFEVLSAIQKYFGD
                     IEITKVPTDDPDEMEKIVKKALKA"
     gene            <525203..>525403
                     /locus_tag="KLMA_30239"
                     /db_xref="GeneID:34715523"
     mRNA            <525203..>525403
                     /locus_tag="KLMA_30239"
                     /product="plasma membrane proteolipid 3"
                     /transcript_id="XM_022818742.1"
                     /db_xref="GeneID:34715523"
     CDS             525203..525403
                     /locus_tag="KLMA_30239"
                     /codon_start=1
                     /product="plasma membrane proteolipid 3"
                     /protein_id="XP_022675378.1"
                     /db_xref="GeneID:34715523"
                     /translation="MTLIRFSDRCFIVYCTTLVCVLAIFLPPIAVFMARGWGSECILD
                     IVLTILFFFPGMLYALWTVLQD"
     gene            complement(<526146..>526319)
                     /locus_tag="KLMA_30240"
                     /db_xref="GeneID:34715524"
     mRNA            complement(<526146..>526319)
                     /locus_tag="KLMA_30240"
                     /product="mitochondrial import receptor subunit TOM6"
                     /transcript_id="XM_022818743.1"
                     /db_xref="GeneID:34715524"
     CDS             complement(526146..526319)
                     /locus_tag="KLMA_30240"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit TOM6"
                     /protein_id="XP_022675379.1"
                     /db_xref="GeneID:34715524"
                     /translation="MFAAPGAAPSASAPGKESRFEQFKQSPAFPVLVHTALFAAGVAF
                     IQSSVIEMLSPQL"
     gene            complement(<528118..>529554)
                     /gene="WHI2"
                     /locus_tag="KLMA_30241"
                     /db_xref="GeneID:34715525"
     mRNA            complement(<528118..>529554)
                     /gene="WHI2"
                     /locus_tag="KLMA_30241"
                     /product="growth regulation protein"
                     /transcript_id="XM_022818744.1"
                     /db_xref="GeneID:34715525"
     CDS             complement(528118..529554)
                     /gene="WHI2"
                     /locus_tag="KLMA_30241"
                     /codon_start=1
                     /product="growth regulation protein"
                     /protein_id="XP_022675380.1"
                     /db_xref="GeneID:34715525"
                     /translation="MSQGQPQSIITQVSQDDQGGAGALLGQDGSYIDYEQYNEEDTLI
                     HLNIQEKPYYITRTQLMSLPESLLLCLFPSGVFMSRDGQIITNLTPEDEVYIPSFSTE
                     CFEYIMDVYNEAHNDYLNFPVNEIFNRKPPGGSAGGGSKFFGFGSSSSSSSSQESEIL
                     HEKPGIIVLREDLDYYCVPQCAIEYEEGTTDSEKESLLHGIMMQIKMAAGSHLLGQTS
                     VFLGLKSSNRVKKSSAKSSTTTPASPSNSSNNSAASSSAATTTTPKLGAAEQHLMDML
                     CSSGFEPDSVWGNRYQEVDKTVISSLSLCRIANETTSEFREMVAQAKAKYEDDQRSIA
                     SSNNGAEFSPLSKTPSATQLTPTASRTETKRRSRLSVLTDNVRSRSRSRNRSASRQRA
                     NEPPTLYELVPKPEINTKLLLFWKKPARKCWWSQELINLAIDLPATFENGVLKVSKDT
                     SQVHKFEIPVKIHIRRVWTLELSIIGMQ"
     gene            complement(<530823..>532034)
                     /gene="CUE5"
                     /locus_tag="KLMA_30242"
                     /db_xref="GeneID:34715526"
     mRNA            complement(<530823..>532034)
                     /gene="CUE5"
                     /locus_tag="KLMA_30242"
                     /product="ubiquitin-binding protein CUE5"
                     /transcript_id="XM_022818745.1"
                     /db_xref="GeneID:34715526"
     CDS             complement(530823..532034)
                     /gene="CUE5"
                     /locus_tag="KLMA_30242"
                     /codon_start=1
                     /product="ubiquitin-binding protein CUE5"
                     /protein_id="XP_022675381.1"
                     /db_xref="GeneID:34715526"
                     /translation="MSDKVEDVPIDVEPVDATTPVPEERVEETVEKKVEDKPEEKTEE
                     KTEKSESGKDAEQKEKEEKEEEEEEAAPPPLPSRKSTSSEIEKPKENPMLKELKEAFP
                     GVEEKYVKAVLIASQGQLDPAFNALLFLSDPGFEKEASLPTRPVHAPVQAHPETPRQL
                     SQLEQDELLARQLDEKYNKHGRSSGERAARERRIRRRQRDYERRYGQGAQAPEGTEDY
                     DEDSDDMFSTFVEKDLPQIRENLNRNIQETGKKISTWFSGIKKNLTEEGSDEQSVGGR
                     SSRSKFNSFGDRYGDDSVDDQTKLQNAGITLENEDLDFGSDDDVPPQLPSRAKSKHVV
                     AETTYIDTPEQARTKHNRSPLKTFAPQAISPTKTKAKATTETTPETASKDPGPITLED
                     NDIVVDSDLDI"
     gene            complement(<532874..>533743)
                     /gene="GLO4"
                     /locus_tag="KLMA_30243"
                     /db_xref="GeneID:34715527"
     mRNA            complement(<532874..>533743)
                     /gene="GLO4"
                     /locus_tag="KLMA_30243"
                     /product="hydroxyacylglutathione hydrolase"
                     /transcript_id="XM_022818746.1"
                     /db_xref="GeneID:34715527"
     CDS             complement(532874..533743)
                     /gene="GLO4"
                     /locus_tag="KLMA_30243"
                     /codon_start=1
                     /product="hydroxyacylglutathione hydrolase"
                     /protein_id="XP_022675382.1"
                     /db_xref="GeneID:34715527"
                     /translation="MLRGLVATRISTRRMHVKAIKMRWLTGGVNYSYLLSTNDKKKSW
                     LIDPAETLEVMEDLTTDEIKTIEAIVNTHHHYDHAGGNVTTLAALKEKGCNVSHVIAG
                     SQRSPIANEIPDNLHETSLGKLKILCIRTPCHTQDSICYYVQDTETGEQAIFTGDTLF
                     TGGCGRFFEGTAEEMDKALNVNLLEYTGGRTNWDKIKVYPGHEYTAGNVHFIRNNVYL
                     NKSDNKSFNELESFANANEVTTGHFTLADELSYNPFMRLDDKIVRKRVGDSQLSWTRA
                     QVMDKLRELKNRA"
     gene            complement(<534083..>536674)
                     /locus_tag="KLMA_30244"
                     /db_xref="GeneID:34715528"
     mRNA            complement(<534083..>536674)
                     /locus_tag="KLMA_30244"
                     /product="WD40 super family protein"
                     /transcript_id="XM_022818747.1"
                     /db_xref="GeneID:34715528"
     CDS             complement(534083..536674)
                     /locus_tag="KLMA_30244"
                     /codon_start=1
                     /product="WD40 super family protein"
                     /protein_id="XP_022675383.1"
                     /db_xref="GeneID:34715528"
                     /translation="MREPLDNLKISGIFGSSSKSRTCYSTTKNLVAYAASGGVVVARL
                     DLGAQRVSEQRFFCASSKSHRQEVFSTASLSKDQYGLIKPEQSIVIKGDTWNDADENS
                     DKTITIGSDLSPARCSPSKIKDRIKDISCLCLSNDGKFLIVGETGHQPRILLYSMAPD
                     SNDYPVFVIHQHSYGISQLQFHPEDSTIFTSLGLINDGFLHIWKLSSHGVRLIASNKN
                     STIVLGLNWYKDSALVTYGVRQIKVWKFENPNNAANSKLAISRTRTAIKGKNIVLGSL
                     IESTFIDCERLRGDQLLFLTDSYQIVLYQNGSLISFFQLDSNKQYDNILVDWDNDKLW
                     LSYDESVDSIPLTHILNHQERLRPTTGSLNSRSSSPIKSKLFDTKLTEPETSPRDKQR
                     ILMMSLLDDNVLLYCTSKGEISVITEGGINQISNPSLNDINVFKKIDQNLAVISSKKG
                     DIKLFNGLELSKYDIELPDLPLSEEITALDLSLTDNRLVVGDSTGKLLIYKENECEYQ
                     ENIHSSAINDVHIFEKDQIKVVITVSRDRTMNFIQLVDGEWCICETIKDNKGNIIQLE
                     ISDNQIYTISSDRTVSCYRLDIVDHMINVSKENILSVKNSPLKLQLTNSDIVVSRSDK
                     SIQIFERDNTSSPRVLRLLDDQGDGILVNQFYVNNEKDQIICSSSLDKAIRCYSFVTG
                     KCLNQYYAHADPVIGMTTVANKFVTVTGNGCLFSWEMKTKEDIAETATTAENLDLVSS
                     AFTEMTVSVPSTPVKSPKGISPVKLTHPTPSYSPIRKESPVSSSPRRGIIPANQLITS
                     KVDSQNILNTLRQLRRLLANNENVENIGEIRKEVSVIHALLEPQETLLQDFGDKLLQL
                     VEAKLQN"
     gene            <537275..>538435
                     /locus_tag="KLMA_30245"
                     /db_xref="GeneID:34715529"
     mRNA            <537275..>538435
                     /locus_tag="KLMA_30245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818748.1"
                     /db_xref="GeneID:34715529"
     CDS             537275..538435
                     /locus_tag="KLMA_30245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675384.1"
                     /db_xref="GeneID:34715529"
                     /translation="MSQFSRAASLPLLETAELLRSGLPKTRFGVSLRDFIEWNNMMNA
                     RSYNFFAKRPTRQRNEVGRLQPLLSHCMARWLHVEYKLNYYPYYDLNVVSIYTDLHEA
                     IENAEQTVNYFKNCSNDDVYGRLNYYLVPLYDTTTDAKSLARPPSNPKIRIMKEGILS
                     NYGRYKIEDPVFVTMVNDVIKYLPCDLVQYNDDLKKWQQAYIEYDPVDGFIKQEFREM
                     DYWCHMTAKLLQLDQGYQGSELYITTRLVNLFMQLHQTLPEHKLFIIDDPQRWLPSVS
                     TIIKMMMGWKTYPITQANISTDLYKPWNKENFPRRESSTFITDFSQVKSLYTEITEGS
                     KTLEAQDLRDFANEWMDVKESIELMDKSGMSAEYVKTSFQPLNETTLGVIRG"
     gene            complement(<538933..>540216)
                     /gene="RSB1"
                     /locus_tag="KLMA_30246"
                     /db_xref="GeneID:34715530"
     mRNA            complement(<538933..>540216)
                     /gene="RSB1"
                     /locus_tag="KLMA_30246"
                     /product="sphingoid long-chain base transporter RSB1"
                     /transcript_id="XM_022818749.1"
                     /db_xref="GeneID:34715530"
     CDS             complement(538933..540216)
                     /gene="RSB1"
                     /locus_tag="KLMA_30246"
                     /codon_start=1
                     /product="sphingoid long-chain base transporter RSB1"
                     /protein_id="XP_022675385.1"
                     /db_xref="GeneID:34715530"
                     /translation="MSQTIRDIASPVIAAAAAATTTDSYYSGPLPKLGFNSAMAGIFF
                     AFLLYHTWACVYTKQWWFGGSFMCACILEVLGYIGRALSHQHGGDQSDYYVLQMVCLT
                     IAPVFSMAGIYFQLAKLIEIYGHQFALLPNPLMYSYIFVACDIVSLAIQAAGGAMDAS
                     TINDSTASETGSHIFVAGLAVQTASMSAFLYLFFDFLFKIFVKTRAEYLGVSVWKWGA
                     LWKVKQSEIDHLYRPKYAMIRDGKRWTFRYFILAITAATVFIYIRCIYRLCELAEGWT
                     GYLISHEWFFIALDALMVSFATLILSIWHPGFAIMGRHLFIPVTAQGRNHIDDADPES
                     IHSTSESNDLNNTEEKTEPKRGGGVLSSVFRRKKQKDSEDVTTIPIEQDDGLFTRNLN
                     EDSNENNEDDDDRESHELQQQPRNSSNLNFNNATL"
     gene            <542891..>545176
                     /gene="GPT2"
                     /locus_tag="KLMA_30247"
                     /db_xref="GeneID:34715531"
     mRNA            <542891..>545176
                     /gene="GPT2"
                     /locus_tag="KLMA_30247"
                     /product="glycerol-3-phosphate O-acyltransferase 2"
                     /transcript_id="XM_022818750.1"
                     /db_xref="GeneID:34715531"
     CDS             542891..545176
                     /gene="GPT2"
                     /locus_tag="KLMA_30247"
                     /codon_start=1
                     /product="glycerol-3-phosphate O-acyltransferase 2"
                     /protein_id="XP_022675386.1"
                     /db_xref="GeneID:34715531"
                     /translation="MAIAAKDLYADPKFHNDYSGLTYNFRTWLYDVAVFVFDVVFTIF
                     FREINVRGTYHLPKKGTPTILVCAPHANQFIDPCLVMSQTRKVPGSRSRQTCFVTAEG
                     PMKKNKYVKLFGSWTGAIPVARAQDNLKPVDPAIRLWVPDYENDPTLVKLVSVEPERV
                     PVEASRRFTAKSLLGLQNYLSNAQIEAVIDDETIRLRKPFADKESVRKCISEPRPFMY
                     AEKINNSTVFENVFNHLHTKGCVGIFPEGGSHDRPSLLPIKAGVAIMALGAVAADPTM
                     EVHIVPCGLHYFHRHKFRSRATLEYGEPIVVTKEMGAEYSKDPRGAVSTLLKTVEQAL
                     YSVTVNAEDYETLVAVQTARRLYDPSKWLDPNIARYSSNGGSGHERIPLSVVVEMNRR
                     LLLGYSKYKDEPRIQQLKRDIQKYNSMLFSMGLKDHQVAKLQPGDKKWTVLMTLLFRA
                     IQVYFMVLLALPGTILFSPIFLTCKYFSRKKALEGLRKSAVKIKGQDLLATWKIVVAL
                     TMAPTLYLVYSLIMVYLTRKYPSIYDWLTVPHFVFNSKVLYFCHCYFVLMLTTYISFK
                     TGEKGMDIVKSLPPLLVSLFYPQRTCKKIKETRTKLSQDVTSICNDLGPTVFPDLMPK
                     SAPSENKEQEGERETKVEMEPRQDAEAKHKEEKEDEDNDNDNDNDSDNDNDNDNDNIS
                     SFRSRALSIGSVDSRASNALSQVNSRGSLTDVPIFSEGSHANLITEVEFSENPISVEP
                     RSIHSTISSLIMKRRWKNKEE"
     gene            complement(<545449..>546075)
                     /gene="BET3"
                     /locus_tag="KLMA_30248"
                     /db_xref="GeneID:34715532"
     mRNA            complement(<545449..>546075)
                     /gene="BET3"
                     /locus_tag="KLMA_30248"
                     /product="transport protein particle 22 kDa subunit"
                     /transcript_id="XM_022818752.1"
                     /db_xref="GeneID:34715532"
     CDS             complement(545449..546075)
                     /gene="BET3"
                     /locus_tag="KLMA_30248"
                     /codon_start=1
                     /product="transport protein particle 22 kDa subunit"
                     /protein_id="XP_022675387.1"
                     /db_xref="GeneID:34715532"
                     /translation="MSTNTGTSNTSTSGAAPSLSSYKTIKQIGESVWKNRTVKINAEL
                     FTLTYGSIVSQLCQDYQRDFTKVNDRLFSMGYNIGIRLIEDFLARSALPRCDNFVTTS
                     EVISKCAFKIFLNITPHVTNWSTSKNSFSLIFDENPLSDFVELPMDASKELWYSNILC
                     GVLKGALEMVQLDCEVYFVSDVLRGNPQTELKVKLNKILKDEMPAGED"
     gene            complement(<546451..>547716)
                     /gene="ETT1"
                     /locus_tag="KLMA_30249"
                     /db_xref="GeneID:34715533"
     mRNA            complement(<546451..>547716)
                     /gene="ETT1"
                     /locus_tag="KLMA_30249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818753.1"
                     /db_xref="GeneID:34715533"
     CDS             complement(546451..547716)
                     /gene="ETT1"
                     /locus_tag="KLMA_30249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675388.1"
                     /db_xref="GeneID:34715533"
                     /translation="MAKRPLGLGKSSKQKKQKKEGEDGKKKSVEPSPEAGQNQIEITL
                     DENENADDELVQLQGLWKTFLEDKENQLLLNGVVHECDRLLREQANDEKIKLNDVFHS
                     IYAQALAELTVFLAEEDDEEKRYKQMHEFFEAALDRQRLGAEKYPESKVLSLIKSKII
                     LQRIPLQYISQLTVEDENEEKYRLHELLEEAKEAFLHVPGHEQLAYDVMLSFYDLLDI
                     IETFEDKEELEEGLDSDDEEEVVEIELPKKHPLKKIKNQLGDNYKWLESRLVHLFNSL
                     SETKPKQEKKDDSGDELSKQVASTLGQLYLKLAEEPSKTFAELMYDSDDEEQTDKKSL
                     KKAKKLQSEAIPLVQNAIKYLEEARVDDDPQTWVDVAEAIIDLGNLYDYESKEQEESY
                     KKAEDILRKANKAAHGKYQVILDNLVENQ"
     gene            <548299..>550146
                     /gene="MET1"
                     /locus_tag="KLMA_30250"
                     /db_xref="GeneID:34715534"
     mRNA            <548299..>550146
                     /gene="MET1"
                     /locus_tag="KLMA_30250"
                     /product="uroporphyrinogen-III C-methyltransferase"
                     /transcript_id="XM_022818754.1"
                     /db_xref="GeneID:34715534"
     CDS             548299..550146
                     /gene="MET1"
                     /locus_tag="KLMA_30250"
                     /codon_start=1
                     /product="uroporphyrinogen-III C-methyltransferase"
                     /protein_id="XP_022675389.1"
                     /db_xref="GeneID:34715534"
                     /translation="MMFKSSPQVKDILELMSVQLETFSEQQYTPLITGLKSVGEVFLL
                     IGTQSYNVSQSRIKSVLGAGASCVVVNSNDEHLKQLSVKFQNQDVVLLDREFQLSDLT
                     SLGRSKVGRIVDRVFVNLGAEDSLLIRDIFEQCEKLRIPINTHQRPEFSTFSMCSTYN
                     DPGNSGLQIAITTNGQGCLLANRIKREIVSKLPINISKVVKNMGHLRERIIYEDHSQI
                     IHSHFLSNDLQELGFGIDEDTWESHKLNKLVYEFKVTKKQMQMKRSRWLSQIMEYYPL
                     QSLAELSVDQLADQYQQLSQNSADNGTKTAGTSVQSSTSGPVDDSNTGDSTRSPLTVT
                     ESEDLKPKKNGKGTISLVGSGPGSVSMLTIGALHEIKTADLILADKLVPEKVLQLIPQ
                     GTETFIARKFPGNAERAQEELLEKGLNGLQKGLKVVRLKQGDPYIFGRGGEEFLFFKS
                     HGYTPLVLPGLSSALAATVVSNIPATQRDVADQVLICTGTGRKGALPAIPEYVETRTT
                     VFLMALHRAQVLVSALIEKGWDENAPAAIVERASCPDQRITRTLLKDVPQTIEEIGSR
                     PPGLLIVGRAINVLTDPEVLNFSGSNTYHIEEGYEHLGFEDNVEALVST"
     gene            <550516..>551574
                     /locus_tag="KLMA_30251"
                     /db_xref="GeneID:34715535"
     mRNA            <550516..>551574
                     /locus_tag="KLMA_30251"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818755.1"
                     /db_xref="GeneID:34715535"
     CDS             550516..551574
                     /locus_tag="KLMA_30251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675390.1"
                     /db_xref="GeneID:34715535"
                     /translation="MLFKRVITRGFHKDIAFAFDIDGVLLRSKNPIPGSSEALKLLTK
                     EKIPYILVTNGGGVLENKRTEFISSVLDVDISPLQIVQSHTPFKALTNKHKKVLCCGL
                     DSVREVAKAYGFQHVVHPMDILAANRDISPFSSVTDSYLKKVAQTHESLTETPFDAIM
                     IFSDPKDWATDIQVISDLLNSDGGRLGTLRKYKSETPSIPIYFSNDDLLWANRYHLNR
                     FGQGAFRIIINSLYSALNDGKALKETVIGKPTALTYNYASHVLIDWKQKLENGTTDST
                     EQILPPLGVPPSTKPFDKIYMVGDNPASDIIGAHNYGWESCLVRTGVYADGDKLPCKP
                     TMIVDNVWEAVTKALERQ"
     gene            complement(<551947..>552282)
                     /locus_tag="KLMA_30252"
                     /db_xref="GeneID:34715536"
     mRNA            complement(<551947..>552282)
                     /locus_tag="KLMA_30252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818756.1"
                     /db_xref="GeneID:34715536"
     CDS             complement(551947..552282)
                     /locus_tag="KLMA_30252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675391.1"
                     /db_xref="GeneID:34715536"
                     /translation="MSEIVEKECKMEVDESCVANNGNGKVATQSRVGKKDIKKKKKKD
                     RCCFEKCNSAAVKFIGDCNFCEGHFCSKHRLLENHQCQGLKSCKDQMHQRNADKLHKE
                     QPIIPKIHI"
     gene            complement(<552861..>553886)
                     /gene="DRE2"
                     /locus_tag="KLMA_30253"
                     /db_xref="GeneID:34715537"
     mRNA            complement(<552861..>553886)
                     /gene="DRE2"
                     /locus_tag="KLMA_30253"
                     /product="protein DRE2"
                     /transcript_id="XM_022818757.1"
                     /db_xref="GeneID:34715537"
     CDS             complement(552861..553886)
                     /gene="DRE2"
                     /locus_tag="KLMA_30253"
                     /codon_start=1
                     /product="protein DRE2"
                     /protein_id="XP_022675392.1"
                     /db_xref="GeneID:34715537"
                     /translation="MTVDEIALVLIHPAVTQEPELLESVKRGTVLLNTNIDGQYLINK
                     LNDGSVSLESEKYDVIYYVTVEKPEEIQFPSRLIPVLGKALKFGGRLYGLSDKLKVDA
                     LLNGFEVVNASEASGSEYHWLRKQNAVQQSAPVSISLKNGASAKTAGLPSFKRLSSKP
                     EGSKKKLPTFSKLSEKVSSVKLTSSDLEYDPDVSDDDNDGDSVADDKSKFFDEFEDPE
                     TGADSIDEDALITEISLENDEITMIQCGKTKQRRKKACKDCTCGLKEMEEQEIESRRL
                     KQQQVIKFSEEELTEIDFTIEGKKVGGCGSCALGDAFRCSGCPYLGLPAFKPGQPINL
                     NSISDDL"
     gene            complement(<554345..>556450)
                     /gene="VHS3"
                     /locus_tag="KLMA_30254"
                     /db_xref="GeneID:34715538"
     mRNA            complement(<554345..>556450)
                     /gene="VHS3"
                     /locus_tag="KLMA_30254"
                     /product="protein VHS3"
                     /transcript_id="XM_022818758.1"
                     /db_xref="GeneID:34715538"
     CDS             complement(554345..556450)
                     /gene="VHS3"
                     /locus_tag="KLMA_30254"
                     /codon_start=1
                     /product="protein VHS3"
                     /protein_id="XP_022675393.1"
                     /db_xref="GeneID:34715538"
                     /translation="MSPVTPHPTEEQQPSLVSPRFTNLGERRNTEMLNTGGSPQSVAI
                     GSQATSPVNKPASPPVSITKSIMNASGTSGAVISNTPASGLKRVPTVTFTDAKHAILK
                     QQATAEQTSALLNSLNNQGSKKAAHSPPGSDKASSPPPMELYANSNKHSQQHMAAAAF
                     AAATAAADAARQKGQSGVSTGGLGDARLPEDARARKNIVSNGERGPAAEGETVVTPVE
                     ASDVREGVEKMNIGTPKHDSEQHPHFVVNDELHSPKFKARSRSNSVSPMPTVAAQGNQ
                     APQFKLNETSIPENEQLDSGGEPPIEIAQIVAPNIPKREAAKNVDPRLPQDDGKLHIL
                     FGATGSLSVLKIKSMIKKLEEIYGRDRVSIQVILTHAAAQFFANRTLSKKKGSLSGHP
                     HSYAAAAAGVASTPSPAAGAAGTSGAGTGAGDGVGPTSGQLLSQPLGQTSSNPATSSP
                     LSHDAHLTSNDTLAGQDAKAATDGNAISTAAKIELPSHIQVWTDQDEWDAWKQRTDPV
                     LHIELRRWADILVVAPLTANTLSKIALGLCDNLLTSVIRAWNPLFPIFLAPSMVSNSF
                     NSSITKRHLNMIKEEMPWITVFKPSEKVVGIYGDIGLGGMMDGNEIVDKVVMKLGGYP
                     EDENQEEEGEDEDEDEDEEDDEDPSDKKNNEEDDDDDDDDDDDDDDDDDDDDDDDDDD
                     LIDIDDVKSLHETGPSASA"
     gene            complement(<557211..>558581)
                     /gene="NOB1"
                     /locus_tag="KLMA_30255"
                     /db_xref="GeneID:34715539"
     mRNA            complement(<557211..>558581)
                     /gene="NOB1"
                     /locus_tag="KLMA_30255"
                     /product="20S-pre-rRNA D-site endonuclease NOB1"
                     /transcript_id="XM_022818759.1"
                     /db_xref="GeneID:34715539"
     CDS             complement(557211..558581)
                     /gene="NOB1"
                     /locus_tag="KLMA_30255"
                     /codon_start=1
                     /product="20S-pre-rRNA D-site endonuclease NOB1"
                     /protein_id="XP_022675394.1"
                     /db_xref="GeneID:34715539"
                     /translation="MSEQHPHVRALVLDATPLITQSYTHYQNYAESFYTAPTVLHEIK
                     DEKSRKNLEIWQGLGTLKVRHPSAASIKRVSDFAKLTGDYSVLSANDIHIIALTYELE
                     TELNKGDWRLRKKPGEPLKKEAVEVEEKEKEKKETAEDAGFTTVEKKKKKTRRGGKKQ
                     REKREAAMKEEEEKKKAELAAKEEEAKEEEAKEEEAKEEESKEKEEKEEEGGFFSDDD
                     GDWITPDNLTETIIKDSGEDTTGGEGVVATKDTSASLELPQNQVALATGDFAVQNVSL
                     QLNLNLMNFMSGLRIKRLRNYMLRCHACFQLLPMPKDGKPKHFCPSCGGSGTLLRCAV
                     SVDSTTGKVTPHLKANFQWNNRGNRYSLPSPLSKNATKRFGKKGFVHTKHDQGVELLR
                     EDQKEYEKAVKQEEWTRKHNEKILNNWIGGGSAENYISPFAIDGLKHHSVRVGRGRFA
                     NSVRKR"
     gene            <559243..>560394
                     /gene="SGT1"
                     /locus_tag="KLMA_30257"
                     /db_xref="GeneID:34715540"
     mRNA            <559243..>560394
                     /gene="SGT1"
                     /locus_tag="KLMA_30257"
                     /product="protein SGT1"
                     /transcript_id="XM_022818760.1"
                     /db_xref="GeneID:34715540"
     CDS             559243..560394
                     /gene="SGT1"
                     /locus_tag="KLMA_30257"
                     /codon_start=1
                     /product="protein SGT1"
                     /protein_id="XP_022675395.1"
                     /db_xref="GeneID:34715540"
                     /translation="MPIEKDLKEAYTLLYDKREIEKALELYDKILGQDGNNLYANAYK
                     SACLEKLYFRSSSWHNEETLESATDFLKKALDIAQKRGDRAKIGFVYFRFCIHYYNCK
                     KYDLSKEYLSKCEQYGFSDDTLPLWKHNIETAYEKHKSKFKKEQPQEKLQEKPQEKPQ
                     EKPQEINVEVLAPKDTFKTDWYQSSNTVSISLFTKNLPQSKDDVNVSIKDSLLSISYQ
                     IPSTGSEFQYSVKLSHNVEPEPVQVSVFTKKIEVTLKKAEKIQWKTLEKTGNEITPPP
                     TVPVVADVKAEPLATNNRAAELSYPSSSKKAIDWSKIDVDSDEDDPKTQSADSFFQQL
                     YKGADEDTRRAMMKSFIESNGTSLSTNWEEVSKGKVEPALPEGVEMKKL"
     gene            complement(<560554..>562977)
                     /gene="ASE1"
                     /locus_tag="KLMA_30258"
                     /db_xref="GeneID:34715541"
     mRNA            complement(<560554..>562977)
                     /gene="ASE1"
                     /locus_tag="KLMA_30258"
                     /product="anaphase spindle elongation protein"
                     /transcript_id="XM_022818761.1"
                     /db_xref="GeneID:34715541"
     CDS             complement(560554..562977)
                     /gene="ASE1"
                     /locus_tag="KLMA_30258"
                     /codon_start=1
                     /product="anaphase spindle elongation protein"
                     /protein_id="XP_022675396.1"
                     /db_xref="GeneID:34715541"
                     /translation="MQTTPVSEVPDPVDCFRLTPVNLKTLRSPLKQRPMSTEGNESLY
                     KENFNLISKQLQNLLSELDVIYREVGYSKIEISRKEKQIFHNLSNSISKFFDEANAER
                     DTLTKEFQTGQYTLQCMLNTINDPKGVNTIPDLFMRNNILVTSSQTMIDDNCSSPHKS
                     SSLLNKLKILNNVKDYVMNAYLPNFMRYLSTVLKLRHLMEKVPDMQDQILPTNFALPQ
                     KELCSQFNSQIRSCGGDTKLLFKFFQEENETIFQRSFFSKITNDQIKFLESFIKSYSE
                     EYTRRLERYKTLQNELQEISQSLGIDYRSIISSEQQNEIPTESEPVISWNAIVSLEKS
                     IKKYEILRQTRLKEKDELLTKCQTLWGKLKVPDGQQQKFIENNSNLSAESLENIRAEL
                     DRLEEMKKKLIKKLIQDSCDKINEYFTAMSFTESEKAEFQNSFDEMSRQSQSLKDDER
                     LLEFCESQIDDLKRKMEIFQPIWKLIQDFESLQNDKIKLDESTKDSSRLLARNSHKIL
                     LEEERARKRITRYFPSVVRELKEKLTLFEEEFGKPFLLNGEQFLDIVLQEQAELANRY
                     PKSRINMKAPSVRLRDNTKTIPKTPSKNHVAGSMCSSTSSSVKNRVAKPMTTPIPRNS
                     TLKKVTTNRELLPPPHISVRKEFSRIPSIATTTTGSLNNSKRLAMSPEPRLLAPVSNN
                     KLNIRNSNENEKKQPAKPLELNSLRVTREKNMINSSKTNRYMAAKLPSSPIKEPFGSV
                     YSISRSPEGKIKLNVSCNSGNNTTNAHDNNPDSSFLNDSNFIEWKQNQVAKLNNFNDE
                     NSSWNNNIQ"
     gene            563569..563658
                     /locus_tag="KLMA_R308"
                     /db_xref="GeneID:34718682"
     tRNA            join(563569..563604,563622..563658)
                     /locus_tag="KLMA_R308"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34718682"
     gene            <564081..>564524
                     /gene="AIM29"
                     /locus_tag="KLMA_30259"
                     /db_xref="GeneID:34715542"
     mRNA            <564081..>564524
                     /gene="AIM29"
                     /locus_tag="KLMA_30259"
                     /product="altered inheritance rate of mitochondria protein
                     29"
                     /transcript_id="XM_022818763.1"
                     /db_xref="GeneID:34715542"
     CDS             564081..564524
                     /gene="AIM29"
                     /locus_tag="KLMA_30259"
                     /codon_start=1
                     /product="altered inheritance rate of mitochondria protein
                     29"
                     /protein_id="XP_022675397.1"
                     /db_xref="GeneID:34715542"
                     /translation="MSTEIDFDTEEPLITTVRPLTNSTITVRVIKSFPYRNVKNIVFT
                     DYDIKNKTAKDLYEDVINHIKTTGAFRPFRNVNYDALKVYTHAHGSKTVNLVINFDHD
                     DDWTLDINDSTKKLVDYGISNETELSLFNHDDYIAFKANPEEKWL"
     gene            complement(<564633..>566051)
                     /locus_tag="KLMA_30260"
                     /db_xref="GeneID:34715543"
     mRNA            complement(<564633..>566051)
                     /locus_tag="KLMA_30260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818764.1"
                     /db_xref="GeneID:34715543"
     CDS             complement(564633..566051)
                     /locus_tag="KLMA_30260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675398.1"
                     /db_xref="GeneID:34715543"
                     /translation="MQPKKAGSSDSMTNGPNDRKKHLFILVHGLWGNHKHMDSIKEMM
                     EKKLDGIDDIVIFKPENSGYIKTLHGIRVVSYNVLDEICQFVKDYGVERFDRVSMIGY
                     SMGGLVSRFIIGKMVTECKDIFGNMTPVIFMTFATPHLGVNFFLPADVKRRTVYRRVL
                     NTVLTGLGKTILGRSGSEIFISNKNDRILVDISQGEYLYGLSRFKHRVCFANVKNDRT
                     VAFYTAIIGNCDPFIETANTLDYRFNHDLPIDVNNYPVQPRILVLDELDPTVYRAKEE
                     KPPVSLKHRVNRILFLMLLLMVFLPLAILINTFGTCYSYITTSRHHALLKKGRHKVQS
                     HEDMFTSLMSSLRSMIGDTINDEQDKGQDNDSDWSLDKNTLSRTITNDSALMNDAWEK
                     FIHSYSKVWSHDKFPSLPFDESRTTIYQNLSKLSWIRIPVYVKAMNAHDGIVARKGLD
                     KASPYGVANVMFACELINHLLE"
     gene            complement(<566395..>567201)
                     /gene="SLD7"
                     /locus_tag="KLMA_30261"
                     /db_xref="GeneID:34715544"
     mRNA            complement(<566395..>567201)
                     /gene="SLD7"
                     /locus_tag="KLMA_30261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818765.1"
                     /db_xref="GeneID:34715544"
     CDS             complement(566395..567201)
                     /gene="SLD7"
                     /locus_tag="KLMA_30261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675399.1"
                     /db_xref="GeneID:34715544"
                     /translation="MPLFKELVLRLDVGHNTVIRDVQLWREMDAEKGHEGGPSAKNCL
                     AEVIGMVSVAKLPLWLDLDRRYRCFTTSETSFRYFNAKLMRQRHRNRGILCRIHSNND
                     SIEYMLFHKCLKTDVDASFEIESIVIDLSTKRRLDAVLDKIHSASDESNATTESISRN
                     AAGPSNATKSIEKILEKNRQQRLQKSNSLNKRVLLNDQHQHFVTLLSQCILSGLRLRG
                     VPQSQYEKLYKMTYKASEFAFRNELRQTTPISFEAIQDCVETLLKLFTKT"
     gene            <567601..>568623
                     /gene="CKA2"
                     /locus_tag="KLMA_30262"
                     /db_xref="GeneID:34715545"
     mRNA            <567601..>568623
                     /gene="CKA2"
                     /locus_tag="KLMA_30262"
                     /product="casein kinase II subunit alpha'"
                     /transcript_id="XM_022818766.1"
                     /db_xref="GeneID:34715545"
     CDS             567601..568623
                     /gene="CKA2"
                     /locus_tag="KLMA_30262"
                     /codon_start=1
                     /product="casein kinase II subunit alpha'"
                     /protein_id="XP_022675400.1"
                     /db_xref="GeneID:34715545"
                     /translation="MTTLQPSSLNLKSKRVYSVARVYQDACEKRPQEYWDYEQCVTID
                     WGKISNYEVINKIGRGKYSEVFKGKSVLNDIPCVIKVLKPVKMKKIYRELKVLTNLTG
                     GPNIIGLLDIVQDPGSKIPALIFEEVKNVDFRTLYPTFTLPDLQYYLTQLLTALDYCH
                     SMGIMHRDVKPQNVMIDPTERKLRLIDWGLAEFYHPGVDYNIRVASRYHKGPELLVSL
                     NQYDYSLDLWAVGCMIAAIIFKKEPFFKGSTNADQLVKIAKVLGTQELFQYLKHYGLE
                     LPSEYNDIMKNYERKPWSYFISDNTPLAVDEIVDLIDHLLRYDHQQRLTAKEAMDHKF
                     FKKDFS"
     gene            complement(<569164..>569946)
                     /locus_tag="KLMA_30263"
                     /db_xref="GeneID:34715546"
     mRNA            complement(<569164..>569946)
                     /locus_tag="KLMA_30263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818767.1"
                     /db_xref="GeneID:34715546"
     CDS             complement(569164..569946)
                     /locus_tag="KLMA_30263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675401.1"
                     /db_xref="GeneID:34715546"
                     /translation="MISNSLDDTVIIRKNLLLLDNVTNLNKPAIDYFHHNFKETYSIC
                     ETWKVLLKVGKHKVLRLPSCSQEDESDYNYYLKRLHHCLWRRWSMENFHLNDSAHKYD
                     PLRINWNKENDMTVLYGPQLSDDCVAATQLLPKRKALSADDGALPSAGVDSDSESYSS
                     FSYNNYSSSPTNSDTSSIFENTKPLLVKRNSSSSSSHHHSSAHRNIRFNESVRTREID
                     YSGVIYDGTSAINDKWANEMIMRQDCFILSVDDSDEDYQMEL"
     gene            complement(569495..570288)
                     /locus_tag="KLMA_R309"
                     /db_xref="GeneID:34718683"
     tRNA            complement(join(569495..569548,570257..570288))
                     /locus_tag="KLMA_R309"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34718683"
     gene            <572151..>573314
                     /gene="RPL3"
                     /locus_tag="KLMA_30264"
                     /db_xref="GeneID:34715547"
     mRNA            <572151..>573314
                     /gene="RPL3"
                     /locus_tag="KLMA_30264"
                     /product="60S ribosomal protein L3"
                     /transcript_id="XM_022818768.1"
                     /db_xref="GeneID:34715547"
     CDS             572151..573314
                     /gene="RPL3"
                     /locus_tag="KLMA_30264"
                     /codon_start=1
                     /product="60S ribosomal protein L3"
                     /protein_id="XP_022675402.1"
                     /db_xref="GeneID:34715547"
                     /translation="MSHRKYEAPRHGHLGFLPRKRAASVRGRVKSFPKDDKSKPVALT
                     SFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRSL
                     TTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYAAKYAGDGAQVDRELARIKKYASVVRV
                     LVHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAKEHFEKTVSVDSVFEQNEMIDVV
                     AVTKGYGFEGVTHRWGTKKLPRKTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHHRT
                     SINHKIYRVGKGDDEANAATEFDRTKKTITPMGGFVHYGSIKNDFVVLKGSIPGTRKR
                     VVTLRKSLYTNTSRKALEQVTLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL"
     gene            complement(<573553..>574239)
                     /gene="YNG1"
                     /locus_tag="KLMA_30266"
                     /db_xref="GeneID:34715548"
     mRNA            complement(<573553..>574239)
                     /gene="YNG1"
                     /locus_tag="KLMA_30266"
                     /product="protein YNG1"
                     /transcript_id="XM_022818769.1"
                     /db_xref="GeneID:34715548"
     CDS             complement(573553..574239)
                     /gene="YNG1"
                     /locus_tag="KLMA_30266"
                     /codon_start=1
                     /product="protein YNG1"
                     /protein_id="XP_022675403.1"
                     /db_xref="GeneID:34715548"
                     /translation="MDDVRYGFLSTLDHLPCDVVRILWTIQSLDISDDGKGKHCEEML
                     RQAQHLLELVRQESARVKFEKQELERFAVIKERYDGHVRKRPKLKPLPPHKPIKIRIT
                     MKSRYPEAEREQKLLEQKKIQQQSSTSDNQHNQSTDAEVYCFCRDVSYGPMIACDNKS
                     CAIEWFHYQCVGLTEAPADNEKWFCSDKCRKEYEDAMKKKKKKVTIGKSEQTAPPIAN
                     KKKKKKRKNW"
     gene            <575211..>576089
                     /gene="CYT1"
                     /locus_tag="KLMA_30267"
                     /db_xref="GeneID:34715549"
     mRNA            <575211..>576089
                     /gene="CYT1"
                     /locus_tag="KLMA_30267"
                     /product="cytochrome c1"
                     /transcript_id="XM_022818770.1"
                     /db_xref="GeneID:34715549"
     CDS             575211..576089
                     /gene="CYT1"
                     /locus_tag="KLMA_30267"
                     /codon_start=1
                     /product="cytochrome c1"
                     /protein_id="XP_022675404.1"
                     /db_xref="GeneID:34715549"
                     /translation="MFKSFSTAARQAVKGAYVQKAIVGGTAVAGIAASTMLYADSLTA
                     DAMTAAEHGLHAPAYGWSHNGPLETFDHASIRRGYQVYREVCAACHSLDRVAWRTMVG
                     VSHTNAEVRAMAEEFEYDDEPDDQGNPRKRSGKLADYIPGPYPNEQAARAANQGALPP
                     DLSLIVKARHGGPDYIFSLLTGYPEEPPAGVVLPPGANYNPYFPGGSIAMGRVLFDDL
                     VEYEDGTPATTSQMAKDVTTFLQWCAEPEHDERKRLGLKAIVVLSSLYLLSVWVKKFK
                     WAAIKNRKIIFNPPKK"
     gene            <577722..>579317
                     /locus_tag="KLMA_30268"
                     /db_xref="GeneID:34715550"
     mRNA            <577722..>579317
                     /locus_tag="KLMA_30268"
                     /product="g1-specific transcription factors activator
                     MSA1"
                     /transcript_id="XM_022818771.1"
                     /db_xref="GeneID:34715550"
     CDS             577722..579317
                     /locus_tag="KLMA_30268"
                     /codon_start=1
                     /product="g1-specific transcription factors activator
                     MSA1"
                     /protein_id="XP_022675405.1"
                     /db_xref="GeneID:34715550"
                     /translation="MSDKEGSSFTNGSGVNTPKKRGRPAILKEYSDPMKSPMAQSSLQ
                     MQKSHQSFNKPLMRVGSSGSPTKFKTPQKKRRSSSTEVSPPHSATGSTKKGRYRGVVM
                     NSSTSPRGKSSGLMKSKGDDLDSNATTPSKNNDQKARMQVTTSFDHDHEHEHDSSSPG
                     TPLDQVFSSISRAHNVKSSPPVMFDTDSPIPTKRKLSVEMRETSCMEDNSSITKRWKF
                     MLNVGRDGKACIETNSLTITENANSETSNNKNLLPPKHLLQNTAKAADVDTNGVAKFD
                     KKRVMGFLRQMKSKNKTLDAKPLPEQTKKFNIPSSPSAPPNSMGNLAEPLTPKCSQLM
                     QFKTGLTPSFNIDELLVSPRLHDSLSRNLFKSPSQYVFKVSSGDPLLINDHQEMDMMN
                     SHSQEVSDILSFLNSPKRGTNLNTPPSYLVNFSSPRSNGKPQNAVPSTSNMKLNLPPL
                     GTPKTEPNHQTTLLPSTPLLKLGNLGPPSQFTPIIQKQMTDESKFSLTQSIHPINLRK
                     EPARKLESSDDARMALKRLINGN"
     gene            complement(<579601..>581286)
                     /gene="ALG8"
                     /locus_tag="KLMA_30269"
                     /db_xref="GeneID:34715551"
     mRNA            complement(<579601..>581286)
                     /gene="ALG8"
                     /locus_tag="KLMA_30269"
                     /product="dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1"
                     /transcript_id="XM_022818772.1"
                     /db_xref="GeneID:34715551"
     CDS             complement(579601..581286)
                     /gene="ALG8"
                     /locus_tag="KLMA_30269"
                     /codon_start=1
                     /product="dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1"
                     /protein_id="XP_022675406.1"
                     /db_xref="GeneID:34715551"
                     /translation="MAKADVGQRSGKHASSSSVVKNVKTRRYSLWNFWICATTLKVLL
                     FPGYYSTDFDVHRNWLAITNKLPMNQWYVEATSQWTLDYPPFFAYFEWFLSQFVPKFV
                     ADDGCLDIVPVGQFGFPTIVFQRTTVILSELVLFFVLQLFINTSDISEKSANFVVASS
                     IVLSPGLLIVDHIHFQYNGFLFGILIFSIVAAKNKRYLLCGAFFAIALCFKHIFLYLA
                     PAYFVFLLRAYVLDFTDFKFRSYRDLISVVQWSNLIKLGSVVLATFAIAFLPFYTTWP
                     QLFARLFPFSRGLTHAYWAPNFWAVYSFIDKVLTLLVLKMPYLQKPLSIVLTSMPTTT
                     DDILKRIATNNSGTKGLVQDVFFVILPQITPKLTFLLTLFYQTLAVIPVLFDPSFKRF
                     VGSLTLCGFVSFLFGWHVHEKAIMLVIIPFSFLVPFDRRLLTPFTLLASAGYVSLFPL
                     LYESQDFLIKFLYTFIWCILYFYAMSQTSKVKRNNFRRIFFFDRLAICYYLLLIPMVL
                     FVQGLNVLKYRYVTLQKYEFLGLMVYSIYCSIGVLSSWIGLSWLFNFDEPMWS"
     gene            <581469..>583472
                     /gene="VPS5"
                     /locus_tag="KLMA_30270"
                     /db_xref="GeneID:34715552"
     mRNA            <581469..>583472
                     /gene="VPS5"
                     /locus_tag="KLMA_30270"
                     /product="vacuolar protein sorting-associated protein 5"
                     /transcript_id="XM_022818774.1"
                     /db_xref="GeneID:34715552"
     CDS             581469..583472
                     /gene="VPS5"
                     /locus_tag="KLMA_30270"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 5"
                     /protein_id="XP_022675407.1"
                     /db_xref="GeneID:34715552"
                     /translation="MDFDNDLGGSVWGDGTEDNPFNELSRTFAKIGEVSDENNQEQTG
                     DTDKHGDEALFSRQWDSSEAQENVSNDHKNDLPLDITPLSFHESSNAPRTDTSELLGS
                     LAPEQDPLHELTQTHLLVSPQKNDPLFGGLDNSPLRIDDDVQRNETTASGPHSPTVSR
                     TGKLNKLFSSARVRRNPSKTQEKSKETSIHDPLVESLAEKEKNEQFVEESLNDDETRD
                     VKLSLEQQLESPLFMIPDRKSASLLESNNRGRSDNANSNNASSVATRNEPEEKFEIAV
                     INPVKVGELTSAYVEYTVVSKGTPLENAEYRVQRRYRDFRWLYRQLQHNNWGHIIPPP
                     PEKQAVGRFKQDFIENRRAQMERMLQHIANSPVLQKDSDFILFLTSEQWSQESKLREQ
                     ISGSKASHDSNDISDIHISEIKLLGPEDAERVLKSGGLDTDTGSGFMGLSFASAPKYK
                     EPDQFFIETAQKTDILEEQLKQLYKALELVDSQRSDLCSVINEFSDTLNILADLELSK
                     KTSEILRNFAEVHLRIKESTSRSSMQDSLTLGVTIDDHLRTIGSVKAILNQRSKIGYY
                     LILVENELNKKKAQLNKISDRSANVEKAKIIENELGICNARYNKIKKEWQSIGEVIRK
                     EINQNNLETVEDFRNNMEIYLESAIESQKECIEIWETFYQNNL"
     gene            complement(<583528..>585978)
                     /gene="TRZ1"
                     /locus_tag="KLMA_30271"
                     /db_xref="GeneID:34715553"
     mRNA            complement(<583528..>585978)
                     /gene="TRZ1"
                     /locus_tag="KLMA_30271"
                     /product="ribonuclease Z"
                     /transcript_id="XM_022818775.1"
                     /db_xref="GeneID:34715553"
     CDS             complement(583528..585978)
                     /gene="TRZ1"
                     /locus_tag="KLMA_30271"
                     /codon_start=1
                     /product="ribonuclease Z"
                     /protein_id="XP_022675408.1"
                     /db_xref="GeneID:34715553"
                     /translation="MYQLIPVTHPCLDTKQPLLLLQSDHGEKYFFGRIGEGTQRACNE
                     SKIKFGKLNGIFLTGEMDYSCIGGLPGLILTASDQGKKNVSIFYGSSILDYVVSTWRY
                     FVFRFGLDLKVFTLKDSECFADKTVSVKSIVINKPGDGCADSGSYEKFTKGLKSIIAR
                     MFPEVSPTDEQDPSSNPTLNVDIPPQAMGPRDLTSSYEISFPSIRGKFNANEAQRLQI
                     PKGKLYAELARGNNITLEDGTVINPEQVLSATRTYGKVLVLDIPSNAYISQFCDRFKD
                     YPLEQLSAVYYFLGDDVTITNDLFNFMDIFHGDHIQHFVSHSKISPNSLAYENAATAT
                     LKLKALQNDNYNVPITDRVYSKEFFECFSKDLPEGTSVVQQQEDSPVSKLNNDNVHIF
                     EKMKGIALEPFVFGKEVMPISESQLATSKPSSTIDELYNNHVVPLEIDGASLESIVHE
                     QLHINNFDNDSKDSEIEIISLGTGSALPSKYRNVISTLIKIPFVESNGNITKRTIILD
                     AGENTLGTIHRTIPDTDIPKLFRNLRMIYLSHLHADHHLGIASLIKEWYKFNENTNER
                     LYVITPWQYNIFLQEWFALEDPKILSRIEYISCEHLKYGDDLRLQTKPLSIKEEITSV
                     DEKPTVVELDNASGNRDQSTIKKMMNDLRIMSFRTCPAIHCNWAYSNSITFFLGAKSK
                     QVFKVSYSGDTRPNFNLFAKGIGKNSDLLIHEATLENELKAEAIKKKHSTINEAIKIS
                     NVMNARKLLLTHFSQRYPKVPNTKNSIVSKAKEVCFAFDGMIVTYNDLGKQQDKVDLL
                     SRIFIEEEKDAENEEVKD"
     gene            586322..586392
                     /locus_tag="KLMA_R310"
                     /db_xref="GeneID:34718684"
     tRNA            586322..586392
                     /locus_tag="KLMA_R310"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718684"
     gene            <587502..>589139
                     /locus_tag="KLMA_30272"
                     /db_xref="GeneID:34715554"
     mRNA            <587502..>589139
                     /locus_tag="KLMA_30272"
                     /product="DUF676 domain-containing protein"
                     /transcript_id="XM_022818776.1"
                     /db_xref="GeneID:34715554"
     CDS             587502..589139
                     /locus_tag="KLMA_30272"
                     /codon_start=1
                     /product="DUF676 domain-containing protein"
                     /protein_id="XP_022675409.1"
                     /db_xref="GeneID:34715554"
                     /translation="MTSFEEEKDVHLVVLVHGLWGNRSHMNEIRNYILSQQGSCKQKL
                     VVHQTHLNEGYKTYDGIDVCGIRVAKEIEDEIAALGDSVVKFSLIGYSLGGLICRYAL
                     GVLYQTQIFAKRDIELVNFITFCTPHVGVLAPGNNMAVKLFNTIVPLVLGNSGKQMFL
                     KDKYNGFPLLYVMSLPNSVFYKALKEFKYRSLYANIINDKRTAWWTSGISRNDPFIEI
                     NEKNGMGRFRFVEGYDPVVLDHKSPLLIAPLEEKEDSSYSELDANKNDDTEIDPQNYY
                     FLNYWFGKVLRWITFLVNLIVIAPLWFIWFILSGIMETVKSTIRAAAFARKYSTYFIT
                     EVLDISTDQSGESTDAIVDDDDEDVVEESDSDIDNDGSESSSTLFEPTSSNYELHLEQ
                     SLTDQRDNLIESLLDAIERKETRTAVVENIKKIDEKDDNPSESKIDVTIRELELYSVE
                     ELISKKKVHIISDDKTATTDEDEVLKLLSNFNLNVDKLQLDIIDSLNKLKWSKFPIYI
                     RKTPSTHAAAIIRHSDPNFTEGHVVLQHFVDKVFQFA"
     gene            complement(<589304..>589723)
                     /locus_tag="KLMA_30273"
                     /db_xref="GeneID:34715555"
     mRNA            complement(<589304..>589723)
                     /locus_tag="KLMA_30273"
                     /product="TRAPP-associated protein TCA17"
                     /transcript_id="XM_022818777.1"
                     /db_xref="GeneID:34715555"
     CDS             complement(589304..589723)
                     /locus_tag="KLMA_30273"
                     /codon_start=1
                     /product="TRAPP-associated protein TCA17"
                     /protein_id="XP_022675410.1"
                     /db_xref="GeneID:34715555"
                     /translation="MSEGSNSLDKLQTLFVALIDREDRPLVIHAVGDKSAKHEIKYNV
                     LSNIALDYFGDTTKSTTSSAPKYLFEIDGNVIYGEYLHQKGLKIVIGTNIRDDEAVLP
                     FFQKVKVFYLKSVINPFNDDFTEQIRRNIDSLGLEPN"
     gene            complement(<590038..>591501)
                     /locus_tag="KLMA_30274"
                     /db_xref="GeneID:34715556"
     mRNA            complement(<590038..>591501)
                     /locus_tag="KLMA_30274"
                     /product="fumarate reductase"
                     /transcript_id="XM_022818778.1"
                     /db_xref="GeneID:34715556"
     CDS             complement(590038..591501)
                     /locus_tag="KLMA_30274"
                     /codon_start=1
                     /product="fumarate reductase"
                     /protein_id="XP_022675411.1"
                     /db_xref="GeneID:34715556"
                     /translation="MLHRYIRLFSFCVILYLVYLLLTKESNVMSKPVVVIGSGLAGLT
                     TSSQLAKFNIPIVLLEKTSSIGGNSIKASSGINGAGTETQSRLHVEDHPELFADDTIK
                     SAKGKGVVALMEKLSKDSSDAISWLQNDFKIPLDKLAQLGGHSVPRTHRSSGKLPPGF
                     QIVDTLKKALESYDSKAVKIQLNSKVVDVKLDSNNRVSSVVFEDQDGTHTIETNNVVF
                     CTGGFGFNKKLLEKYAPHLVDLPTTNGEQTLGEGQVLLEKLGAKLIDMDQIQVHPTGF
                     VDPANPDSNWKFLAAEALRGLGGVLINPHTGQRFVNELTTRDMVTEAIQSKSESKTAY
                     LVMSESLYENYKPNMDFYMFKKLVSKKTIAEFAEDLPVSVDQLIAELSTYSDLSKDDH
                     LGRKFRENTFGSSLSSDSTIFVGKITPVVHFTMGGAKIDEQARVLNAEGKPLATGIYA
                     AGEVSGGVHGANRLGGSSLLECVVFGRQAAKSIRANL"
     gene            complement(<592829..>594004)
                     /gene="GLY1"
                     /locus_tag="KLMA_30275"
                     /db_xref="GeneID:34715557"
     mRNA            complement(<592829..>594004)
                     /gene="GLY1"
                     /locus_tag="KLMA_30275"
                     /product="low specificity L-threonine aldolase"
                     /transcript_id="XM_022818779.1"
                     /db_xref="GeneID:34715557"
     CDS             complement(592829..594004)
                     /gene="GLY1"
                     /locus_tag="KLMA_30275"
                     /codon_start=1
                     /product="low specificity L-threonine aldolase"
                     /protein_id="XP_022675412.1"
                     /db_xref="GeneID:34715557"
                     /translation="MTANTKKPAAEPAYTSAHNDLRSDTFTTPTKEMLDSVFAASIGD
                     AVYNEDVDTIELETTVAHLAGKEAGLFCVSGTLSNQIGLRTHLLQPPYSILCDYRAHV
                     YTHEAAGLAILSQAMVTPVIPSNGNYMTLEDIKAHYIPDDGDIHGAPTRVLSLENTLH
                     GIVYPLEELIRIKGWCLDNDIKLHCDGARIWNAVVETGVSLKQYGEIFDSISICLSKS
                     MGAPMGSILVGDSKFIKKCNHFRKQQGGGIRQSGMMARMALCSVNGDWKTKLRHSHEL
                     AHELAAFCDKHQIPLESPADTNFVFLDLQKAKMNPDVLVKKGLKYGVKLMGGRVSFHY
                     QITRETLENVKLAVLEAFEYAKEHPFDTNGPTKIYRSESTDFDINGNPIGDIKTYKY"
     gene            complement(<595209..>596960)
                     /gene="SIT1"
                     /locus_tag="KLMA_30276"
                     /db_xref="GeneID:34715558"
     mRNA            complement(<595209..>596960)
                     /gene="SIT1"
                     /locus_tag="KLMA_30276"
                     /product="siderophore iron transporter 1"
                     /transcript_id="XM_022818780.1"
                     /db_xref="GeneID:34715558"
     CDS             complement(595209..596960)
                     /gene="SIT1"
                     /locus_tag="KLMA_30276"
                     /codon_start=1
                     /product="siderophore iron transporter 1"
                     /protein_id="XP_022675413.1"
                     /db_xref="GeneID:34715558"
                     /translation="MLSVELEKGKQNDGPDPHHEHAKKSYGVQKVEILNKQYSSLANK
                     AMIFVSIFLMAYVYRLDAMVRKTFTAHAINSYRTHSLISTVGVVRSVSAAASMPIYSR
                     LSDAVGRIELIVCAVVLYVIGTIVCSQATDVTRYAAGMILYQFGLSGLAILFKIISAD
                     FSSLNWRLFCTLVSASPYIINTWISGNVASTIGVKHWSWGIGMWAIWLPIATLPLVCC
                     FLHMTYRAKRNGDWKELKALEGRSFKALLKFIWEDLDIIGVLSFTLILGLILTPFTLA
                     GGEHRKWKTARVIVPLVLGFVMIPVFIVWERKFAAKPICPEKLFKKKSVIVGLCIGVL
                     IDFVWQIQGEYLYTILVVAVNESVRSATRINSLYSFSTTISGLIVGLIVVYVRRLKFF
                     IIGGTCIWMIALGIMVKYRGGLSSHGGVIAGQVLLGVGSGLFTHSTQALLQALVSHEV
                     MSTVTMLYSASYYVGSAIGSSISGAVWTQALPHQINKRIANATIAKMAYKAPLSFIVK
                     NKWGTPGREALVEAYRHVQKILIVISLCFCVPIVCLAVLLDDPVLENVQAKEDTESEY
                     ESDTATTTTTTAGVSKL"
     gene            <597817..>598245
                     /gene="IES6"
                     /locus_tag="KLMA_30278"
                     /db_xref="GeneID:34715559"
     mRNA            <597817..>598245
                     /gene="IES6"
                     /locus_tag="KLMA_30278"
                     /product="chromatin-remodeling complex subunit IES6"
                     /transcript_id="XM_022818781.1"
                     /db_xref="GeneID:34715559"
     CDS             597817..598245
                     /gene="IES6"
                     /locus_tag="KLMA_30278"
                     /codon_start=1
                     /product="chromatin-remodeling complex subunit IES6"
                     /protein_id="XP_022675414.1"
                     /db_xref="GeneID:34715559"
                     /translation="MDRIEFLKQVAAENDTTGLRFKQPTWHKHLKRNKNAKALISDEW
                     KRLTREKEKEKEKEMEGDAAEDPNYNKTRLSYFNVQAYPSTRPAKKYCDVTGLKSHYK
                     APNTGLRFHNSEIYSLIIKPMAPGAEQAYLKLRGDHFVLK"
     gene            <598637..>601000
                     /locus_tag="KLMA_30279"
                     /db_xref="GeneID:34715560"
     mRNA            <598637..>601000
                     /locus_tag="KLMA_30279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818782.1"
                     /db_xref="GeneID:34715560"
     CDS             598637..601000
                     /locus_tag="KLMA_30279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675415.1"
                     /db_xref="GeneID:34715560"
                     /translation="MITYTACTLLAVIWLWYRLFQFLRIPVFKIVGLLNIELPQSTKV
                     SVDKITQDSITLHWENEPDCIYTVSGVEENHHRFKVVSYKLYLDGKLVGNFPNTKRAY
                     TFVHLRGLASGQTYQLDLVTVNQLGFTNKLPNVFVMTLPGDTKLESSVPPVPEQEEAQ
                     IMEDLTHLLPADVKWRKPLMITQSTKTATPSYSSLTTLNDLEGFSIQDLKNILVCSQE
                     ELHDVLQQHSMILQDFNDTKLQLQMELDNLKVQWNHEIELKKSMKSTINSLESSKVLY
                     DLKREKLERSIKQIETKISKMNKDMDSWTKNDDIEKKKETLQEKYRKMSDKLNDAISA
                     TSEQVKKLQEEIAQQEDENKKLNQIKKLMDNESNGSASHQNQNSSSDSSTINWAQVMK
                     KINESTVQRSGLLSSSGEDLLNSLPQQTSLVQAIKSELEIDQKLDNQWKASKSRFNKR
                     IDHLERVWKELQTKNIQLKNELTLQTYSMSQQPSQSGINNDMTNHNPTHQLHLHDPSS
                     YANYNTSGSLLAQTVASAPFTSWLQQGQQQHQQQQQTPLAAAADPTQSLPTSSHEPFY
                     HNAEYEDSSHLISGLENMVADVADKPRTALLFTNDQLDEYWNSSSQISRPFSPSSLPP
                     QNQPQPPTQPSHQQSLSQHQIAPIVSSDSSLSPAPQFKPHTDRSFLGVLNDAPNDDVI
                     SFHSALNNGATTSPMMVPSKTIHSVPDSAFSPSFHSIWNDSGISSPHSSNHAGTDNQN
                     KPWIFNQPLDMPSAPAQERPKESSTRRMSKLFARGTQLFKLPSHDSQ"
     gene            complement(<601121..>601837)
                     /gene="ISY1"
                     /locus_tag="KLMA_30280"
                     /db_xref="GeneID:34715561"
     mRNA            complement(<601121..>601837)
                     /gene="ISY1"
                     /locus_tag="KLMA_30280"
                     /product="pre-mRNA-splicing factor ISY1"
                     /transcript_id="XM_022818783.1"
                     /db_xref="GeneID:34715561"
     CDS             complement(601121..601837)
                     /gene="ISY1"
                     /locus_tag="KLMA_30280"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor ISY1"
                     /protein_id="XP_022675416.1"
                     /db_xref="GeneID:34715561"
                     /translation="MSRNVNKANSVLVRYQEAEAAASGGYQDFSRLKRPTRINKVDKL
                     DEAIRWRSELVKEIGQRITQIHDPSLNEQQIRELNEELNKLFEEKGRWDFHIKNRLKG
                     PDLKKRKQLNTTGGTLLKGTRYFGRALELPEVRELLKEEKERREKHKSAKEKDLELQK
                     KIQRWKNTLRDDNYYMSYGAEVRVYDEERQIEMLRSKLPNNDNKPLVEIPTLPVPSLK
                     DIEKWLVQRRRKELQKQLDL"
     gene            <602209..>603789
                     /gene="GDA1"
                     /locus_tag="KLMA_30281"
                     /db_xref="GeneID:34715562"
     mRNA            <602209..>603789
                     /gene="GDA1"
                     /locus_tag="KLMA_30281"
                     /product="guanosine-diphosphatase"
                     /transcript_id="XM_022818785.1"
                     /db_xref="GeneID:34715562"
     CDS             602209..603789
                     /gene="GDA1"
                     /locus_tag="KLMA_30281"
                     /codon_start=1
                     /product="guanosine-diphosphatase"
                     /protein_id="XP_022675417.1"
                     /db_xref="GeneID:34715562"
                     /translation="MHVNSIVRNYRFLIGALTALMLILLLRSSVSSSTGSLANSSRLE
                     TPDGVHVPNPSTPMEHQQQEYVPKAVSSQKAEDSTTTGKTKADSASKSGKCSEDHKYV
                     VMIDAGSTGSRVHVYEFDVCTQPPTLINETFEMLKPGLSSFDTNAIGAAESLDPLLEV
                     AMEAVPKSKRSCTPVAVKATAGLRLLGEEKSSNILKQVRKRLEEKYPFPVVEGNGVSI
                     MNGEEEGVFAWVTANYLLGNIGAGSKLPTAAVFDLGGGSTQIVFEPNFPPNEKMVDGE
                     HKYELQFGGHTYTLYQFSHLGYGLMQGRNRINSVLVETAIKDGKIEKGQTAKTHELIS
                     PCLPPGQVAKNEKVKLSSNEIYTVTFKGPSVPAGPQCRFLADKILNKDAECKTPPCSF
                     NGVHQPSLVHTFKETNDLYVFSYFYDRTQPLGLPLSFTLQELQDLARTVCNGEDVWKS
                     VFSGIEDSIDQLSKEPQWCLDLSFQVSLLHTGYDIPLHRELRTAKTIANNELGWCLGA
                     SLPLLESDNWTCRVSEVQ"
     gene            <604213..>605757
                     /locus_tag="KLMA_30282"
                     /db_xref="GeneID:34715563"
     mRNA            <604213..>605757
                     /locus_tag="KLMA_30282"
                     /product="NAD(+) kinase"
                     /transcript_id="XM_022818786.1"
                     /db_xref="GeneID:34715563"
     CDS             604213..605757
                     /locus_tag="KLMA_30282"
                     /codon_start=1
                     /product="NAD(+) kinase"
                     /protein_id="XP_022675418.1"
                     /db_xref="GeneID:34715563"
                     /translation="MVNHPLEEKALPTGMECSSSNSSSRTSVPLSFEVKRQNRHNGCE
                     RFQNVMCSDGMEPNDPDHLLHKELQQVDDFQGEENDNVDEMLTTERMFRKLSTGSEDM
                     KKAYSHAQLSSTAHGVRILSKNLSNTKVALEVKNLMIVTKKQDDSLIYLTREMVEWIL
                     VNYPSIDIYVDAKFEKNEPFNAKELCKDSKCGSHKIRYWTPTFVKENEYFFDLIITLG
                     GDGTVLYVSSIFQKNVPPVMSFALGSLGFLTNFQFENFKHDLSKVLQNKIKSKMRMRL
                     CCQLYKRRIKRKDEESGKTHIKYDLKGEYHVLNELTIDRGPSPFIAMLELYGDGSLLT
                     VAQADGLIIASPTGSTAYSLSAGGPLVYPSVNAIAVTPICPHTLSFRPIILPDSMTLK
                     VKVPRTSRSTAWAAFDGKNRVEMQKGDYIVITASPYSFPTLEARSTEFIDGISRTLNW
                     NVREPQKSFTHMLSRKNQQKYEIHTEKAKLGSEEEEELEESTNTAASDSERDSNSESD
                     SDSDVE"
     gene            <606664..>608076
                     /gene="UTR2"
                     /locus_tag="KLMA_30283"
                     /db_xref="GeneID:34715564"
     mRNA            <606664..>608076
                     /gene="UTR2"
                     /locus_tag="KLMA_30283"
                     /product="probable glycosidase CRH2"
                     /transcript_id="XM_022818787.1"
                     /db_xref="GeneID:34715564"
     CDS             606664..608076
                     /gene="UTR2"
                     /locus_tag="KLMA_30283"
                     /codon_start=1
                     /product="probable glycosidase CRH2"
                     /protein_id="XP_022675419.1"
                     /db_xref="GeneID:34715564"
                     /translation="MKCFIKGLAILSIALKAVSADSEVTCSEDSHCPEDKPCCNQYGT
                     CGSGSFCLGGCNPKFSYKKEACMPLPACQNSETVFSNYKSKLASAYTYLGDYTKANWT
                     YEGYPMDYDDENALILAMPKNSGGTVLSSTRYVWYGNVKARFKASHGGGVVSAFIMFS
                     SVQDEIDYEWVGVDTQKVQTNWYWQGALNYTNSKNLTATSYDDDYHVYEIDWKEDAVT
                     WLVDGQPGRTLFKNETYNETSKQYNYPQTPARIQLSIWPGGNATNAPGTIAWAGGLID
                     WDSQDIQENGYYYSIVESVNITCYDPPAGVKKNGTQVYQYTGDDDYMEGGVFLSNANT
                     VLKDYDNSGLDDNTPDKKSSSSSSSSATKTSSSSSSASTSSSKSDSKSQTQTQAKSSS
                     TTESNEGHQADNSSAVSETAESTSSSSSAAVTGFVQNMATASASGSTTASGSPSKAAG
                     SNNTPFSFGMSLVSLLFFFI"
     gene            complement(<608725..>609057)
                     /gene="CYCK"
                     /locus_tag="KLMA_30284"
                     /db_xref="GeneID:34715565"
     mRNA            complement(<608725..>609057)
                     /gene="CYCK"
                     /locus_tag="KLMA_30284"
                     /product="cytochrome c"
                     /transcript_id="XM_022818788.1"
                     /db_xref="GeneID:34715565"
     CDS             complement(608725..609057)
                     /gene="CYCK"
                     /locus_tag="KLMA_30284"
                     /codon_start=1
                     /product="cytochrome c"
                     /protein_id="XP_022675420.1"
                     /db_xref="GeneID:34715565"
                     /translation="MPAPFKKGSEKKGATLFKTRCLQCHTVEEGGPHKVGPNLHGVFG
                     RHSGQAAGYSYTDANIKKNVLWDEQTMSDYLENPKKYIPGTKMAFGGLKKEKDRNDLV
                     TYMLKACK"
     gene            609910..609981
                     /locus_tag="KLMA_R311"
                     /db_xref="GeneID:34718685"
     tRNA            609910..609981
                     /locus_tag="KLMA_R311"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:34718685"
     gene            <610314..>611171
                     /gene="TMT1"
                     /locus_tag="KLMA_30285"
                     /db_xref="GeneID:34715566"
     mRNA            <610314..>611171
                     /gene="TMT1"
                     /locus_tag="KLMA_30285"
                     /product="trans-aconitate 3-methyltransferase"
                     /transcript_id="XM_022818789.1"
                     /db_xref="GeneID:34715566"
     CDS             610314..611171
                     /gene="TMT1"
                     /locus_tag="KLMA_30285"
                     /codon_start=1
                     /product="trans-aconitate 3-methyltransferase"
                     /protein_id="XP_022675421.1"
                     /db_xref="GeneID:34715566"
                     /translation="MSAFTAKDFNAAVYSDFRPSYPDDWYKTLSAYHKGNHHLVLDIG
                     CGPGTATFALRKHMPFEKVVGADISQTMVEKARKVASDSNQQEVQFVAYNGDIKEIGL
                     KPDMVTMAECAHWLDWENAMEQVAAVLPSDGTLAIWCYVDPVFVDFPELDSDIENLQY
                     SEPPAGLGPYWEQPGRQNLRELLPKLPPPEKWFKDIQLWRHDGRSTATRAATPLVMEK
                     TMTLEAFHNYTTTWSSYHNWSSSTNAGESHPDPTIPFMEKVKRVTKLESRDTIRVAWK
                     TVALLARRK"
     gene            <612210..>612956
                     /gene="GRX3"
                     /locus_tag="KLMA_30286"
                     /db_xref="GeneID:34715567"
     mRNA            <612210..>612956
                     /gene="GRX3"
                     /locus_tag="KLMA_30286"
                     /product="monothiol glutaredoxin-3"
                     /transcript_id="XM_022818790.1"
                     /db_xref="GeneID:34715567"
     CDS             612210..612956
                     /gene="GRX3"
                     /locus_tag="KLMA_30286"
                     /codon_start=1
                     /product="monothiol glutaredoxin-3"
                     /protein_id="XP_022675422.1"
                     /db_xref="GeneID:34715567"
                     /translation="MAVISISSQDQFTELTTTKAGDKLLVLYFYTSWAEPCVAVGKVV
                     EALSEERCNKDVVFLSISAEEHVEISELFEVSSVPYFIFIRSGTILKELSGADPKEFV
                     KILNQLNAGDSGANTNTEKADGDAPGSPLTGNDDEPEEAEETEEQLNERLKKLTQAAP
                     VMLFMKGTPSEPKCGFSRQMVGILREHQIRFGFFDILKDENVRQGLKKFSEWPTFPQL
                     YINGEFQGGLDIIKESLEEDPEFFQHTLSS"
     gene            complement(<613354..>615348)
                     /gene="RAD24"
                     /locus_tag="KLMA_30288"
                     /db_xref="GeneID:34715568"
     mRNA            complement(<613354..>615348)
                     /gene="RAD24"
                     /locus_tag="KLMA_30288"
                     /product="checkpoint protein RAD24"
                     /transcript_id="XM_022818791.1"
                     /db_xref="GeneID:34715568"
     CDS             complement(613354..615348)
                     /gene="RAD24"
                     /locus_tag="KLMA_30288"
                     /codon_start=1
                     /product="checkpoint protein RAD24"
                     /protein_id="XP_022675423.1"
                     /db_xref="GeneID:34715568"
                     /translation="MSTPNLKRSLSELCDTISRVSPKKDKSYGKNQRTRTKGSSTAVR
                     ILPRNERTLRSGFSVAQSKDEDTKHLQWYDRFAPTRVEDLALHKKKLEEVRDQLESMI
                     SGKSPERVLLLSGPAGCSKSTCIKLLCDDLVPRYRTDSGMTVSGRKVANFIEYSSTSA
                     EISPMESFNDFLLQSKYLVGNNLSVLIVEDLPNLFHEPTLRRFRESILSWLLADEQLP
                     ILVICLTECQLPESNSNGFSYGIDTTFVAETVLGKDILSHPLFHRIKFNPTNATLMKR
                     HLKLILQKVRREIPEQKYVKGLEYINILASTTGDIRSGISALQFWCTSSFDGENTLFT
                     RHRSTSYFHAIGKIIYGSKESENDVEMTNDLIDDGMVSNETLKLGVLENYSKFNKSNF
                     PLSSALDIVEVLSLSDTLKQLDDEPLHYSIGSVRQTFRNIKVSEHGVHGQANYPREYK
                     MVQEQKKFNLQIQDFKEVEFFKYLSLWSTKDSILLGSYYGPSIRKLISFKAKSLNYYI
                     KSLQPGTNAYQNALRRYQQLPMIDEVDIVERIGGEMKSMSATSDLSAGINDAMDDNAF
                     ISKHNRRRQKLQHLKDELFLQKNTSSVSNTEEFEQDPIVDSDNDNTMDMGIEDGDSEL
                     FEILSQKKPKQLKLPVTGTGGTQGSSIEDVILSDSDIENL"
     gene            <615678..>622109
                     /gene="BRR2"
                     /locus_tag="KLMA_30289"
                     /db_xref="GeneID:34715569"
     mRNA            <615678..>622109
                     /gene="BRR2"
                     /locus_tag="KLMA_30289"
                     /product="pre-mRNA-splicing helicase BRR2"
                     /transcript_id="XM_022818792.1"
                     /db_xref="GeneID:34715569"
     CDS             615678..622109
                     /gene="BRR2"
                     /locus_tag="KLMA_30289"
                     /codon_start=1
                     /product="pre-mRNA-splicing helicase BRR2"
                     /protein_id="XP_022675424.1"
                     /db_xref="GeneID:34715569"
                     /translation="MDEAEKERQRKIKEIYRYDGMSNQVLRVDRDLIENKTDIQHDAA
                     ISQPKSMSGKIDLKEMGSAVRNAELDEEERSAAEKEFQKRLNSSSQDNSLRSRPVIQK
                     KSLLDDISQLNYLPTDDYNSDIYDQIVLICSQLLGDDIPHSILADAADLIIVTLKTDE
                     NVELENKRSKIEDALGVKIDDSTFNPLLKLTGSISDYGTDINGSAVNGDDVDEEGEEE
                     DEKEKNTLLEEVEEEEEEEVESGEHNDSNDIISGNLQNDIMNNTETIDLEVVQADQEV
                     VTINNVDEFFLQRKLRAHFKNLEETKVQEMTNSIYSALSMQKDNSDLEQNLLDILGSK
                     EKGFAHFIISNKDTLYWGHILNTSDGNGINKALEDMENNNLSELVEAYNRGSKTKKRS
                     LDEGEELSSKRTKIIMEDKKNFIDLENFELSQDIQNLSKIKIKLPENSFKRVKNGYEE
                     IHVAPPEKVDDDFPLVKIESLPKWARTAFPSSETSSLNRIQSEVYPTAFQTDANILLC
                     APTGAGKTNVAMLTILRAMSHYYKEEKNTFDLKSFKVVYIAPLKALVQEQVREFQRRL
                     HHFGINVAELTGDSNLSKQQIAETQVLVATPEKWDIITRKSTDTSFHKLVRLIIIDEV
                     HLLHDERGPVIESIVARVLRDRSVDSPARLVALSATLPNYMDVAKFLKVPAEGMFYFD
                     SSFRPCPLAQQFCGITEKSILKKKNAMNQACYDKVLEATKEGHQVIVFVHSRKDTART
                     ARWLLQKLTEDDKLSEFCNQDKGSVEILKTESNNVSDTALAELLCSGLGIHHAGLSKD
                     DRSLSEDLFADGLLKVLVSTATLAWGVNLPAHTVIIKGTEIYSPEKGDWTMLPPQDIL
                     QMLGRAGRPRYDVNGEGIIITNQSDVKYYLAVLNQQLPIESQMIKRVIDCLNAEVVLG
                     NISTIEEATDWLKYSYLSTRMSQSPDVYNINGNSDSLKSDIVKFQHNIVYSALKLLQK
                     HNLLRHNEINGNIEATELGKIASHFYISYSSIAMYNRELGKNSTLIDVLRIFAMSEEF
                     KHMSVRSEEKPELEKLLDRCPIPIKEKATDPLAKSNILLQVYISKLKLEGFALNADMI
                     YISQSAGRLFRALYEICLRKGWPRLTKMLLTICKCIENRMWPTNSPFRQFKKCPTDII
                     KRAEASGLPWIDILNIKTPHEAGEVLRAPQFGKVAFDLIQRFPKIEISCNMQPITNSL
                     IQFELEIIPSWLWDFSVSGSLEPFLVLVEDTDGEEILYQDNIRVTKDNINSSIYLEFV
                     IFLKKSMLPPNYFVSVISEKWLNCEYKIPIIFDTMKLPKQFPAPLLSNGTPLREVKDL
                     QVDEFSNLYKFRFFNRIQSMVFDTLYHDTESTLICAPKDSGKTTMIELALLNHWRKGR
                     GRALYICPSKDKVEELTKNWKKRFSHIAGGKIINCLSENLQQNVKTLAQSHLVLATPE
                     EFNYISRRWPQRKNIKSIELAIFDDIHEIGNGIKGAIYEIVITRMVFISTQLEQQLRV
                     VALGASLANAKDLGEWIGVKKANVFNFAARDRQIPLKVEIETSNSNENPSSNRKVLVD
                     SIKTISSSPVSDITTTIFVADRNQCLSVSTELIKISTSAAIDLLRTDMDSISAYLNRL
                     QGSHIAAFLQKGVGVLYEGMSSSDRRIIQKLHDYNVLSLLVCSRQCCAEAPVSNNIVI
                     ATTNYFEGKENRYIDYSINSILDMVGALKEPSDGSPSHVKLVTTSQRKDFYKKFLLEG
                     LPIESFVPFQIVELLSSEIANETLETKQDCIDLLTYTYLYRRIHANPSFYGVKEVNSE
                     GISLYLTELVEEAVNLMSESDLLTINEVNEKADDVEEKIYPTNACIISGYHNVYYESM
                     CQFSKSASGSLRLRDLLELLASSFEFQSLPIRANDIPTLKKLYELAPLKLSSELDTRS
                     TKTKVFILLQAYFSGLRLPPDLSYDTTNILKVAPALASAMVDVLSANGLLNATVAMDL
                     SQMIVQGVWDTDSPLKQIPFFNEEILQKCKEFGVQTVYDVMSLEDEERENILTLPEPE
                     LNKVAEFVNNYPNIEINCDFDNTNPLKPSESRILAVTVTRDEDPETLDVVSKSLPYKK
                     PESWWLFVGDKKTSHIYSIKKVTLGKISQKFELEIELEEVGSYELTLWCVCDSYLDVD
                     KELSFNVTVST"
     gene            complement(<622196..>624532)
                     /gene="RAD3"
                     /locus_tag="KLMA_30290"
                     /db_xref="GeneID:34715570"
     mRNA            complement(<622196..>624532)
                     /gene="RAD3"
                     /locus_tag="KLMA_30290"
                     /product="DNA repair helicase RAD3"
                     /transcript_id="XM_022818793.1"
                     /db_xref="GeneID:34715570"
     CDS             complement(622196..624532)
                     /gene="RAD3"
                     /locus_tag="KLMA_30290"
                     /codon_start=1
                     /product="DNA repair helicase RAD3"
                     /protein_id="XP_022675425.1"
                     /db_xref="GeneID:34715570"
                     /translation="MKFFIDDMPVLFPYPKIYPEQYQYMCDIKKTLDAGGNSILEMPS
                     GTGKTVSLLSLTVAYQMHYPEHRKIIYCSRTMSEIEKALVELESLMEYRAKELGYVED
                     FRGLGLTSRKNLCLHPRVSKERKGNVVDEKCRRMTNGQARKKKEEHPELDIELCDYHE
                     NMYNYDVADYLPLGVYSFEKLIRICEEKRMCPYFTVRRMISMCNIIIYSYHYLLDPKI
                     AERVSKEVSKDAIVIFDEAHNIDNVCIESLSLDLTKDLLKKATKGANSLDRKVEEMKK
                     VDSKKLQDEYDKLVQGLRASDILEPEEEPLVETPVLSNDILKEAIPGNIRRATHFISF
                     LKRFIEYLKTRMKVLHVISETPNSFLLHLKQLTFIEKKPLRFCSERLSLLVRTLEVDE
                     VEEFNALKDIATFATLISTYEDGFLLIIEPYEIENAAVPNPIVRFTCLDASIAIKPIF
                     ERFSSVIITSGTISPLDMYPKMLNFDTVLQQSYSMTLAKKSFLPMILTKGSDQVAISS
                     RFEIRNDPSIVRNYGSMLLEFAKITPDGMVVFFPSYLYMESIITMWQTMGILDEVWKY
                     KLLLVETPDAQETALALETYRKACSNGRGAILLSVARGKVSEGIDFDHHYGRTVLMIG
                     IPFQYTESRILKARLEFLRENYQIRENDFLSFDAMRHAAQCLGRVLRGKDDYGVMVLA
                     DRRFARKKNQLPKWISQGLSDADMNLSTDMAIANTKQFLRTMAQPTDPKDQEGVSVWS
                     YAQLLEHQENQKKKQHNGFTEPDEEEQKDNDGDIEMKD"
     gene            complement(<624854..>625537)
                     /gene="ADK2"
                     /locus_tag="KLMA_30292"
                     /db_xref="GeneID:34715571"
     mRNA            complement(<624854..>625537)
                     /gene="ADK2"
                     /locus_tag="KLMA_30292"
                     /product="adenylate kinase 2"
                     /transcript_id="XM_022818794.1"
                     /db_xref="GeneID:34715571"
     CDS             complement(624854..625537)
                     /gene="ADK2"
                     /locus_tag="KLMA_30292"
                     /codon_start=1
                     /product="adenylate kinase 2"
                     /protein_id="XP_022675426.1"
                     /db_xref="GeneID:34715571"
                     /translation="MSVLRPLRLLILGAPGSGKGTQTSKLLKEFGSIKAISSGDLLRK
                     QIDQHTPLGSKASEYISKGQLLPDSLISGVICDELKTRDWLSPEASWLLDGFPRTVGQ
                     ASILDKALSEYDAGLNLVVELDVPHEVILERIENRYVHIPSGRVYNLQYNPPKVPGLD
                     DITKEPLTKRPDDTAEVFKKRLEQYTETVGPLKEHYMKQGILSTVSGKSSDIIYPKLV
                     SLILQKFAN"
     gene            <626107..>629688
                     /gene="MSH6"
                     /locus_tag="KLMA_30293"
                     /db_xref="GeneID:34715572"
     mRNA            <626107..>629688
                     /gene="MSH6"
                     /locus_tag="KLMA_30293"
                     /product="DNA mismatch repair protein MSH6"
                     /transcript_id="XM_022818796.1"
                     /db_xref="GeneID:34715572"
     CDS             626107..629688
                     /gene="MSH6"
                     /locus_tag="KLMA_30293"
                     /codon_start=1
                     /product="DNA mismatch repair protein MSH6"
                     /protein_id="XP_022675427.1"
                     /db_xref="GeneID:34715572"
                     /translation="MTTETPKAASKGRKMPSSSGKKYKQATISSFFKKREKPQEQQDV
                     EKTPEMKTPTSSQAPKSKEVQSHATEASPLKNKSTKTIEQLPEIKPVEKQVETVVSSR
                     GRKRQNVSLKESDDEDDSDNDITVSKRSRNRSYIEDSEDEYKLDEASADDDDEYVEAD
                     VVEDDSLNADSGKAVDEEDDDDDDDLIALASRKPVKKAVVNTTVRKTPQSFKRTSLPN
                     TPVSQGKHNKFNKTNEERYQWLVHEKDAEGREPSDPNYDPRTLYIPKDAWGKFTPFEK
                     QYWEIKSKMWDCILFFKKGKFFELYEKDAHLAHHLFDLKLAGGGRANMQLAGVPEMSF
                     DYWASQFIQYGFKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLTDSDMLKSD
                     LATYCVAVREEPMSYYDQEISSTPRPGKIFGFTAIDTATGHIDILEFEDDEECSQLDT
                     IMSQFKPTEIVFEKSNISSLAQKIIKYNAQPSAIINQRNSREFYDFEKTFDELITHEY
                     FPSMEKWPSVLRSYYETGKKVGFHAFGGLLSYLQWLKLDKSLISMGQVEEYNPTKSQT
                     CLALDGVTLQNLEIFSNTYDGSDKGTLFRLLNRAITPMGKRKLRKWVMHPLLKIDEIN
                     ARLDSVDLLLNDMEVRDLLETELLKLPDLERMLSRVHSCTLKIQQFNKVITGFEDINT
                     LVEQLSSSFTLKGAIEHYIREIPESLASVIETWKNAFDRKLAVSEGVVVPNRGVEPEF
                     DESLDIIRGIEDELNEYLQSYKKMLKSSNIQFKDSGKEIYTIEVPMSATKFVPPEWTQ
                     MAANKSFKRYYSPEVQKLARRMAEARETHKVLEDDLKNRLFRKFTAHYNTVWFPTIQA
                     ISNIDCIVSLARTSESLGFPACRPQLVEEIDPKTNEKLNGFLRFKELRHPCFNMGASA
                     AKEFIPNDIALGKDAAQIGLLTGANAAGKSTVLRMTCVAVILSQLGCYVPCEEALLTP
                     VDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAI
                     AEAVLHHVATHIQSLGFFATHYAALGSHFVNHPNVEPLKMDILVDEESRNVTFLYKLV
                     HGKSDGSFGMHVASMCGIPKAVVDGASEAAEAMEHTSKLIKERKNLHQSDEDIPLGIE
                     SDLVRLVFGDGLKNTKNGSGEGVKIYDNNIKKNVLKYMLSVVEGLDV"
     gene            complement(<630032..>632539)
                     /gene="RPH1"
                     /locus_tag="KLMA_30294"
                     /db_xref="GeneID:34715573"
     mRNA            complement(<630032..>632539)
                     /gene="RPH1"
                     /locus_tag="KLMA_30294"
                     /product="DNA damage-responsive transcriptional repressor
                     RPH1"
                     /transcript_id="XM_022818797.1"
                     /db_xref="GeneID:34715573"
     CDS             complement(630032..632539)
                     /gene="RPH1"
                     /locus_tag="KLMA_30294"
                     /codon_start=1
                     /product="DNA damage-responsive transcriptional repressor
                     RPH1"
                     /protein_id="XP_022675428.1"
                     /db_xref="GeneID:34715573"
                     /translation="MAYVPDHYEGSVPVFKPDHATFQDFYKFMTEVDKYGLKSGIIKI
                     IPPKEWLDEVQYPPSAETLQKIRIKTPIQQHISGSKGVFMVQNVEKPKSYNIIQWKHL
                     SQDYKLPEGRHSAKTSGSTEGPTTAGGATAGDATAAEKSQQPSEEHTSNKMRSKSLDS
                     FTLQDFESFREHFNCDNLEQFDDEQRIEFLENYYWKTLNFTEPMYGADSLGSLFEDSV
                     KDWNVSSLPSILNYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGAPKQ
                     WYSIPQEDSEKFYNFMKELFPEESKNCSEFLRHKMFLVSPKLLQSNGIRCNHIVHRQQ
                     EFIVTYPYGYHAGFNYGYNMAESVNFALQSWLDIGAKAKKCMCIDDAVGINVEKLKAN
                     YLNAKEKKLENGKVKEEEDSEKTQEEAKEENPPLKKIKIGSETNKLLDSAKSTPDFLA
                     KSQTDALEDKPTLDGLNGNNSIRSGTPNSQKTWMYGTGSKRDGAFNNGSSISRVSSPL
                     LSRMMDLSHIVEPTLEDPTLKFKKKQSQFMPLSMAQQQAIYPPTQNPMPAPPVQMSPS
                     DTSFFSPAHDHEDNLIALSLASMANSSPSFNQLPPLNISNPRPYSPILQDSILSPRPS
                     YNSNVLSYGQAGNTKSPLGSFGSNSQLPFIKRIQSPNRVTLNISRESSRSPVSLSGLY
                     GTSNPMMAPVPHPYQSSQTSTLNQVSTAERSPAVTPPSSPSKLKASKKRSAKQAKAKQ
                     EPDSPTSSLSQTKINDEEIMFLDDGSKVYVCQECSRQFSSGHHLTRHKKSVHSGEKPH
                     SCPKCGKKFKRRDHVLQHLNKKIPCVPDNDDAAKAGG"
     gene            <633657..>635132
                     /gene="CCA1"
                     /locus_tag="KLMA_30295"
                     /db_xref="GeneID:34715574"
     mRNA            <633657..>635132
                     /gene="CCA1"
                     /locus_tag="KLMA_30295"
                     /product="tRNA nucleotidyltransferase"
                     /transcript_id="XM_022818798.1"
                     /db_xref="GeneID:34715574"
     CDS             633657..635132
                     /gene="CCA1"
                     /locus_tag="KLMA_30295"
                     /codon_start=1
                     /product="tRNA nucleotidyltransferase"
                     /protein_id="XP_022675429.1"
                     /db_xref="GeneID:34715574"
                     /translation="MLKMASIGTKIQLNKVESEICSLVKEFCSQYNALHASEEPLTAR
                     ITGGWVRDKLLGNESNDLDIAVNSMTGEQFAEKLCEFLNERGLQTHSLNTINKNPSKS
                     KHLETCTTKLLGVPVDFVNLRSEEYTMESRIPKVEFGTPYEDAMRRDATLNAMFYNIT
                     EDKIEDFTEKGIRDLNDGILRTPLPPKKTFIDDPLRVLRLIRFASRFNFKIEEQTYQA
                     MKDKDIHVSFNQKISKSRIYTELHKTFTSENPFYALDLIQGANMSSVIFSSSTTSPKI
                     ETVYASLDSHLKQLVDHIPNLLSNHELFARLFPEFQEPLILSLVLCGFKGLTGPDPAK
                     PKNQIPLAGVIVKEGINYPNAQVNNVITCVESEDIYHQLIANAETMQRSELGFALIKF
                     GEPWKMVHFYNMCLEYLRNGIESTSRFDHFYKLVHDRDLADVYSLKHIVNGKELAKLL
                     NKKPGVWMSKTMDDVLKWQLNNPDKSKQYFIENINSIIELP"
     gene            complement(<635719..>638100)
                     /locus_tag="KLMA_30296"
                     /db_xref="GeneID:34715575"
     mRNA            complement(<635719..>638100)
                     /locus_tag="KLMA_30296"
                     /product="protein BCK2"
                     /transcript_id="XM_022818799.1"
                     /db_xref="GeneID:34715575"
     CDS             complement(635719..638100)
                     /locus_tag="KLMA_30296"
                     /codon_start=1
                     /product="protein BCK2"
                     /protein_id="XP_022675430.1"
                     /db_xref="GeneID:34715575"
                     /translation="MTQMSGSSSVSYNNGSFRSTTNANLYLEDAAQLVPDMGLGFGSA
                     YNEDGKGKKMVMQGSHAGTHNTIQPTLNDLNPPTTSSQLQYSPTMSLKGGKGTNKVNI
                     MASPVQIKLSEPPSARENKNSRASKSKKNGANGKNEMVFVNYSVQDTVENQKKKKQSK
                     RDRMLRIFTGSNNSNAAMSKGISTPQSSGSSSSTMTLPAQPQLPHSAPASATKRSYAS
                     FLKYHRSSSNSTPTQAESFAEVVPKSEPIPNGQKPALTRSASSSVALIRNNGRCSLSQ
                     SAMKLGKSHEHFEKMDLLKFNMAKNSGSGSASSQTPPNYLHRSKSNSNSELRRVPTGS
                     MDASTTSSIPSASSLSNIPTPTMARVYNPKQQFNPDEEEFDHHYLEPYQEYDNFSSSA
                     SLQPSGDTPDSLSTFFTDENDASVAFSKLFTRKRTNTGGSISSTLSLQATQPAFPHLD
                     RNPSNNSVPSFRHSPIRSSSQSRTRSNTRNSSQRLSRDLTTLQLSLKNSSGDSSDGPG
                     MESFLDTNSKSGRLSHRKKQESISDMAKYHNSQGTMLNYASANSTTSMSSSSSTPGTT
                     ESTLMQFSKPSQQQQQFSVQRENSLENDLADEEEQFYFKPVIREDEEYESAINTSASS
                     SHMGVSSTTTISTRQTAPEIAEFKQPFSTSNVTKEEGQNIYAPKKNSAGETMAENKQT
                     GWDQPNELFNNYIDFNYEEIPSSQFLNENGNLLHQVFNSNNDTSTITSGMNISPITIT
                     GANTSQDEVASFAPKTHQVYNSNLSFQSRVMNDIDRLAHGFNISDFPNEKVND"
     gene            complement(<639185..>643942)
                     /gene="DNF1"
                     /locus_tag="KLMA_30297"
                     /db_xref="GeneID:34715576"
     mRNA            complement(<639185..>643942)
                     /gene="DNF1"
                     /locus_tag="KLMA_30297"
                     /product="probable phospholipid-transporting ATPase DNF1"
                     /transcript_id="XM_022818800.1"
                     /db_xref="GeneID:34715576"
     CDS             complement(639185..643942)
                     /gene="DNF1"
                     /locus_tag="KLMA_30297"
                     /codon_start=1
                     /product="probable phospholipid-transporting ATPase DNF1"
                     /protein_id="XP_022675431.1"
                     /db_xref="GeneID:34715576"
                     /translation="MSKKGKGSEKFPDRLHDDSSPDSPFNDKFMFEEGQRFQGNQDGS
                     GGSSSPEGKLQGRHTSILKNGHGDHHLRLPSKKKNNHRISFGDGIRGDDGEGPEGFDG
                     LKNDEFEEVSFEGDQWSFDNTPNIKQGEFGDNIKEEEEEEEEDIGTGTSDSSNSKRVK
                     RMRWGTKRDKSGKPSMGRAKTLRWTKKNFHNPFSDDASPNSEQDSSEDERDENYDSSH
                     RQHERRTIYYNLPLPQELLDEDGHSIINYPRNKIRTTKYTPLTFFPKNIAFQFKNVAN
                     VYFLILIILGFFQIFGVSNPGLATVPLIVIVVITAIKDAIEDSRRTILDMEVNNTPTH
                     ILKGVENPNVSNDKVSAWRKFKKANTRLLFRFIDFCKENFTAEGKKKRAQRKRHEMHQ
                     KMRQSKTPRNSLDSVGSYRNSMESDFAGDLTTQDKDELCILDPSLPPLPDCKFAKDYW
                     KSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKCAHMI
                     RNSRDITRTKFTVESEGPHANLYSYQGNLKWTDRETGIEKNEPININNLLLRGCTLRN
                     TKWAMGIVIFTGPDTKIMLNSGVTPTKKSRISRDLNVSVFYNFTLLFILCIAAAVVNG
                     VYYRESNTSRNSFEMGSIGGSPAVNGIVSFFVAVILYQSVVPISLYISIEIIKTIQAL
                     FIYGDVSLYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEVKKCTINGVS
                     YGRAYTEALAGLRKRQGIDVEEESAREKQGIIEDKEQMITELKELAPNPQLRPENVTF
                     VSKEFVQDLKGASGPEQKKCNENFMLALALCHSVLVEPSKDDPEILDIKAQSPDEAAL
                     VGTARDLGFSFIGKTKTGLVVDVQGVKKEYRLLNVLEFNSTRKRMSCIIKIPSENPNE
                     EPKALLICKGADSIIYSRLSKNNDVKLLERTALQLEQYATEGLRTLCIAQRELTWKEY
                     EEWNKKHAIASADLGNREDEMEKMADQIERELTLLGGTAIEDRLQDGVPDSIAILAEA
                     GIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIKASGDDVENYGDSRAEIVRNLILK
                     YLHEKFNMKGSVEELAEAKKIHEPPKGNYGVVIDGDALKLALNTEDVRREFLLLCKRC
                     KAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGIGIAGEEGRQA
                     VMSSDYAIGQFRYLSRLVLVHGRWSYKRMAEMVPLFFYKNVIFTLSLFWYGIYNNYDG
                     SYLFEFTYLTLFNLAFTSLPVIFLGVLDQDVNDVVSLVVPQLYRSGILRSEWNRKKFF
                     LYLFDGIYQSVICFFFPYLCYYKTGMVAKNGLALDHRYWVGIFVAHIAVLSGNLYVLL
                     HQYRWDWLSTLFIALSCLCIFAWTGIWSSSTNSAEFFKSGAHVYGQPIFWAALFVGVL
                     FCLLPRFAIDIFLRTYRPKDVDIIRECWKRGDFDHYPEGYDPTDPNRPKIKKVDPLYN
                     KDLEFVQVSTESIRTEEIQLEEFYNRSSENPGSFPHNRHNRGESVRSSLDVTRDEMRN
                     SHQLDNRYSVERARLSLDLPGVTRASTLLNGHD"
     gene            complement(<644825..>645307)
                     /gene="UBC13"
                     /locus_tag="KLMA_30298"
                     /db_xref="GeneID:34715577"
     mRNA            complement(<644825..>645307)
                     /gene="UBC13"
                     /locus_tag="KLMA_30298"
                     /product="ubiquitin-conjugating enzyme E2 13"
                     /transcript_id="XM_022818801.1"
                     /db_xref="GeneID:34715577"
     CDS             complement(644825..645307)
                     /gene="UBC13"
                     /locus_tag="KLMA_30298"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 13"
                     /protein_id="XP_022675432.1"
                     /db_xref="GeneID:34715577"
                     /translation="MAALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQ
                     SPYENGIFKLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIR
                     TVLLSVQALLASPNPNDPLANDVAEEWIKHEDSAIAKAKEWTKLYATPTETAGEASSD
                     "
     gene            complement(<646099..>647871)
                     /gene="PAB1"
                     /locus_tag="KLMA_30299"
                     /db_xref="GeneID:34715578"
     mRNA            complement(<646099..>647871)
                     /gene="PAB1"
                     /locus_tag="KLMA_30299"
                     /product="polyadenylate-binding protein"
                     /transcript_id="XM_022818802.1"
                     /db_xref="GeneID:34715578"
     CDS             complement(646099..647871)
                     /gene="PAB1"
                     /locus_tag="KLMA_30299"
                     /codon_start=1
                     /product="polyadenylate-binding protein"
                     /protein_id="XP_022675433.1"
                     /db_xref="GeneID:34715578"
                     /translation="MSDITDKTAEQLEQLKISGDQPAQSGSAPSTSASESEVSSVSKV
                     ENNNASLYVGELDPNITEALLYDVFSPMGPISSIRVCRDAVTKASLGYAYVNYTDYES
                     GKKAIEELNYAEINGRPCRIMWSERDPSVRKKGSGNIFIKNLHPAIDNKALHETFSTF
                     GEVLSCKVALDENGNSRGFGFVHFKNESDAKDAIEAVNGMLMNGLEVYVAMHVPKKDR
                     ISKLEEAKANYTNVYVKNIDQETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVN
                     FASHDSAVKAVEELNGKEFKSQTLYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVN
                     LFIKNLDDSIDDEKLREEFAPYGTITSAKVMRDQEGNSKGFGFVCFSSPEEATQAMTE
                     KNQQIVAGKPLYVAIAQRRDVRRSQLAQQIQARNQIRFQQQQQQAAAAAAGMPGQYMP
                     QMFYGVMAPRGFPGPNPNMNGPMGAAIPKNGMVPPPQQFAGRMNAPMYQGMPPQNQFP
                     RHQQQHYIQQQKQRQALGEQLYKKVSAKIEDENAAGKITGMILDLPPQQVIQLLDNDE
                     QFEQQFQEALAAYENFKKEQEAQA"
     gene            complement(<648858..>653555)
                     /gene="CHD1"
                     /locus_tag="KLMA_30300"
                     /db_xref="GeneID:34715579"
     mRNA            complement(<648858..>653555)
                     /gene="CHD1"
                     /locus_tag="KLMA_30300"
                     /product="chromo domain-containing protein 1"
                     /transcript_id="XM_022818803.1"
                     /db_xref="GeneID:34715579"
     CDS             complement(648858..653555)
                     /gene="CHD1"
                     /locus_tag="KLMA_30300"
                     /codon_start=1
                     /product="chromo domain-containing protein 1"
                     /protein_id="XP_022675434.1"
                     /db_xref="GeneID:34715579"
                     /translation="MVQDLPDEILANPELYGLRRSHRAVVSHTSYSGLDSDSEEEVVR
                     PRRGKGKRKSTKTEEEYNEMGEEEFEEEGDDDDDEEFEESGSNSSNVRSRSRSSRKNG
                     PRSRGSSGRGTAKRGGKGRRGRRGEKSAEESEEEPIALPTRFSSRNNNRVVNYTLNDD
                     SNDEDLMESSVEEDDMDEDEDEDMDLQGRYSASPFPQEEVHSIDIVVDHRLKEGVDQE
                     LVKHRRWDADSIKENFEFLIKWADQSHLHNSWENYEDLKEKGTKGIKRVENYYKQFII
                     LDQEIRTDPYTTREDIEVMDLEHERRIEEFEEFKIPERIIDSERFENEDGSGTSHLKY
                     LVKWRRLNYDECTWEVASEIVKMAPEQVKDFQNRSNSKIMPQHSSNYPGNQRPKFQKL
                     DKQPAFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYAR
                     RQNGPHLVVVPLSTMPAWQETFEKWAPGLNCVYYMGNQASRDLIRDYEFYTNPQAKGK
                     KHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRL
                     LITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEQQEEYIRDLHKRLQPFILR
                     RLKKDVEKSLPSKSERILRVELSDVQTEYYKNILTKNYSALTAGVKGGHVSLLNVMNE
                     LKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGKMVLLDKLLTRLKKDGH
                     RVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNADDSNDFVFLLS
                     TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEE
                     VLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKANDNQQ
                     KLEDLNLDDVLNHAEDHVTTPELGESNLGGEEFLKQFEVTDYKADVEWDDIIPEDELK
                     KLKDEEQRRMDEEYVREQLDIMNRKTAAIDKIKRSVNGETFGSDSDDEGSSKARKRSK
                     TNNLDHFGEREIRALYKVILRYGDVEDKFEELIADGSLPVRSIDKFKELYREITGKAE
                     TLMKEEEAKRQALFSRLEKDAAEYKLKLKNMEIKPEEENGKENPITILSAKRREKRAI
                     LFEFHGTKALNAETLVNRCDDLKFLTAYINKNFKNDPLQFKFVHRTPKPVIAWNCSWS
                     KEDDEKLLVGIYKYGYGAWTQIRDDPFLGLTEKLFLNNELVKKTPSSQSGSAANTKPE
                     TQPGTDTNASQPTSASASSMGNVKDETPETSLSAQNTPATAASETATSVPAREPSGKK
                     MIKKAPGAVHLGRRVDYLFGVLRDEAKGPLPEPSHSSSGQSSASTVTQTSKRKQKKSG
                     NHVNNNDNTNGSGTAGSNSLSGSNGNGSAAAGKDGTPDLGPESKRQKGSHQAHGSRSG
                     TPVPAAHRKQQRKMKDIPLAPKADLKATDKEYESMDEDECKKTMSNVRGSLKRLRNGG
                     EGLDRKEWASLLKKELKTVGDFIESHKKDSSRTAPEKFKRHLWSFTSYYWPREVPSSK
                     LLAMYDKIKASEH"
     gene            <654947..>656770
                     /gene="RLI1"
                     /locus_tag="KLMA_30301"
                     /db_xref="GeneID:34715580"
     mRNA            <654947..>656770
                     /gene="RLI1"
                     /locus_tag="KLMA_30301"
                     /product="translation initiation factor RLI1"
                     /transcript_id="XM_022818804.1"
                     /db_xref="GeneID:34715580"
     CDS             654947..656770
                     /gene="RLI1"
                     /locus_tag="KLMA_30301"
                     /codon_start=1
                     /product="translation initiation factor RLI1"
                     /protein_id="XP_022675435.1"
                     /db_xref="GeneID:34715580"
                     /translation="MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPT
                     NKIAFISENLCIGCGICVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRP
                     GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYEDPPEWQEIIKYFRGSELQNYFTKML
                     EDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSAEDVKRYINILQLKNVLNRE
                     VQALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLHAALIIRDLLNPTTYVIC
                     VEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFRTEAL
                     QFRMADAGDELEADASRAFSYPAMKRTQGDFSLTVEPGEFSDSQILVMMGENGTGKTT
                     LIKLLAGAIPADDGKDVPKLNVSMKPQKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDV
                     VKPLKIDDIIDQEVQHLSGGELQRVAIVLSLGVNADIYLIDEPSAYLDSEQRIICSKV
                     IRRFILHNKKTAFVVEHDFIMATYLADKVIVFEGTPSKEAFARTPESLLTGCNKFLKN
                     LNVTFRRDPNSFRPRINKLDSQMDKEQKLSGNYFFLDNTGV"
     gene            complement(<657196..>660210)
                     /gene="GPI13"
                     /locus_tag="KLMA_30302"
                     /db_xref="GeneID:34715581"
     mRNA            complement(<657196..>660210)
                     /gene="GPI13"
                     /locus_tag="KLMA_30302"
                     /product="GPI ethanolamine phosphate transferase 3"
                     /transcript_id="XM_022818805.1"
                     /db_xref="GeneID:34715581"
     CDS             complement(657196..660210)
                     /gene="GPI13"
                     /locus_tag="KLMA_30302"
                     /codon_start=1
                     /product="GPI ethanolamine phosphate transferase 3"
                     /protein_id="XP_022675436.1"
                     /db_xref="GeneID:34715581"
                     /translation="MNAAVNDERHREEKIRQSIMGSQSPTTRTNYRISRFKSAHTLYI
                     LLFSSFAILQFISIAFFAKGFLLRRTVLDNVAEIDPTMSYGPKYDKMVVLLVDALRFD
                     FVIPVDETDPKYNPNYHNNLQVLYEMSSKSDDALLLKFMADPPTTTLQRLKGLTTGSL
                     PTFIDAGSNFNGDVIDEDNWIKQLYLHNKKIFFAGDDTWDALFRPFLANESVPYESLN
                     VWDLDTVDNGVISFFDEYYFNKQQRSKYDVLVGHMLGVDHVGHKYGPNHFTMKEKQLQ
                     VDRFIRKILETADDNTLYVVMGDHGMDHTGNHGGDSQEELESTFWLYAKNAHWNKNGN
                     YDTSSFGASFKQMNQIDLVPTVSLLLGLPIPFNSLGWPISEIAKDPEELKLYHDICHK
                     QLKNYLEVSNIMGSSAKRNKLLSIEDPSEFQSIFLETCKDLWARFDFASILVGIGIMA
                     FSLILLVMIIKLIPSIVVGQMVGDFVGCIVVISVISNVSFQAVYQVLHQPQFLGNSLW
                     CSAFATAVGIILGVLIPVFDRYSVQWLFLRSIEELSDFWSRIATLFMVLHALLFTSNS
                     FTIWEDRIVAFLLTSFGMLALYEFTFLPQRHSTAALLSGAAEKQGTLAGKSVGESNSD
                     SLPLGRFARILGGYHAIVLVICTRIASIITICREEQGEQCTPTFTISNNYSYYTMFGC
                     LLLIPAVPACIKGYYNVCSSYQAAAPIWIGLILKGSLIATFIYWSLIAAENRLQDLDW
                     DVTIWKFTISRIIVGISLIGCNIGWMKGPLCVKLNIHNTDMKSQQATILGYSNVYGSQ
                     FFLLVINFLMAIMLFNKPLGQLSIFLMCNQLLSIIEICDLLKLKENLIGPITLGLLAY
                     QQFFSTGHQATIPSVQWDMGFILTEKITFPWTHLGIVINTFGPFILVSLSVALLTLWK
                     QPPSVLQPQTILSRIVSNCGTLLIYNSALCLSSFIWVTHFRRHLMVWKIFCPRFLFAS
                     LCLIVCQLIVTFVTIGFASSRLIRQISQLFSK"
     gene            <660904..>663567
                     /gene="MCM4"
                     /locus_tag="KLMA_30303"
                     /db_xref="GeneID:34715582"
     mRNA            <660904..>663567
                     /gene="MCM4"
                     /locus_tag="KLMA_30303"
                     /product="cell division control protein 54"
                     /transcript_id="XM_022818808.1"
                     /db_xref="GeneID:34715582"
     CDS             660904..663567
                     /gene="MCM4"
                     /locus_tag="KLMA_30303"
                     /codon_start=1
                     /product="cell division control protein 54"
                     /protein_id="XP_022675437.1"
                     /db_xref="GeneID:34715582"
                     /translation="MSSPPAHQASSPNLFYDPSSSPAPQGSQGQDAGVGSSPFHYPSS
                     SSNATQETAHAPTSGGLRSNTLRSDLLSYSSSLSSGAREGRHSRSRRGEINASDLSSP
                     RRIVTFDNLSSSDNAFSSSSRPNSEVNDQPLKIIWGTNVSIQECGNSFRDFLMSFKYK
                     YRKQLDDQEIFINETTDQELYYVNQLTQMRQLGTSNLNLDIRNLLAYKNTEKLYHQIM
                     YYPQEIIAIMDQTVKDCMVSLALDNGLESYLNEIESKLFKVRPYNVETKKGMRELNPN
                     DIDKLVNIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPMRCPRVVCNS
                     PNSMVLVHNRCTFQDRQVIKLQETPDMVPDGQTPHSVSLCVYDELVDSCRAGDRIEVS
                     GIFRSIPIRSNPKQRALKSLYKTYIDVVHIQKVAKDRLGIDTSTVEQQLLQNQIDNVE
                     EVKTLSSEDILKIKQTATRPDLYDLLSRSIAPSIYELDDVKKGILLQLFGGANKTFKK
                     GGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTK
                     QLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTS
                     ILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNESSDRELAKHLTSLY
                     LEDRPDSVSQGDILPIEFLTSYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRS
                     DEKRITATTRQLESMIRLSEAHAKMRLSEVVEVEDVEEAVRLIKSAIKDYATDPKTGK
                     IDMNLVQTGNSVVQRKLLEDLAREILKILTERTADTISFNELSRLINEQSQDKVDSIE
                     ISNALTRLQQEDKVVILGEGLRRSIRLNGRV"
     gene            <664422..>666599
                     /gene="DUR3"
                     /locus_tag="KLMA_30305"
                     /db_xref="GeneID:34715583"
     mRNA            <664422..>666599
                     /gene="DUR3"
                     /locus_tag="KLMA_30305"
                     /product="urea active transporter"
                     /transcript_id="XM_022818809.1"
                     /db_xref="GeneID:34715583"
     CDS             664422..666599
                     /gene="DUR3"
                     /locus_tag="KLMA_30305"
                     /codon_start=1
                     /product="urea active transporter"
                     /protein_id="XP_022675438.1"
                     /db_xref="GeneID:34715583"
                     /translation="MAVIEAPLPQGAGYAVVVGLGFVFAFAMILTTYVLRRYQKEIIT
                     AEEFATAGRSVKSGLIAAAVVSSWTWAATLLQSTAMVYKVGISGGYYYAAGAGYQVIL
                     FSALAIKCKQRAPNAHTYLEIIKARYGTLGHAVYMFYALATNILVTAMLLTGGSAVVS
                     DLTGMHTVAACFLLPVGVVLYTICGGIKATFLTDYVHTVVIIVIIMTFAFTVYATSSQ
                     LGSPSAVYDLVREAAKKHPISGNADGEYLTMKSRSGGIFFVINIVGNFGTVFLDAGYW
                     NKAISSSPAAALPGYVIGGLSWIAIPNLISVSMGLACLALESSPKFPTYPDRLTKDQV
                     SAGLVLPSAAVTLLGKGGAVATLLLVFMAVTSAMSAELIAISSIFTYDIYRTYLNPKA
                     TGRQLIFSSHISCVVFALIMSGFATGLYYAGISMGYLYELMGIIISSAVIPCALSLFW
                     DAQNLVAVVASPIIGTALAIMSWLVCTNAKSSEITVNSTFGDDPMLTGNVVALLSPLV
                     TIPILTYVFKPQNFDWEILKTITRADEIPELVEAEARQGVSDSDSSDNAREPEKLTAV
                     RSIVTVIEEIPEDDIKKMADEETALLNRSSKMAGYLALFFAIIFMVLWPMPMYGSGYV
                     FSKRFFTGWVCVLIIWIFFTAFCVCIYPLWEGRHGLYTTFRGIYWDLSGQTYKLREWQ
                     DSNPEEMKAVQSQIIAKVESVRSANDRNIDVKMNDVDAIMDSS"
     gene            <667085..>667447
                     /gene="ATP20"
                     /locus_tag="KLMA_30306"
                     /db_xref="GeneID:34715584"
     mRNA            <667085..>667447
                     /gene="ATP20"
                     /locus_tag="KLMA_30306"
                     /product="ATP synthase subunit g"
                     /transcript_id="XM_022818810.1"
                     /db_xref="GeneID:34715584"
     CDS             667085..667447
                     /gene="ATP20"
                     /locus_tag="KLMA_30306"
                     /codon_start=1
                     /product="ATP synthase subunit g"
                     /protein_id="XP_022675439.1"
                     /db_xref="GeneID:34715584"
                     /translation="MLSRLQTYATSLTQKTQLLLSKTVYYGKVTAELSKQVYTKEGLQ
                     PPNFSDFEMVYTRLYRQAVHYAERPQQAIEALKNIEKDKAIQIGAVGVQMLGLYSLGE
                     IIGRRKVVGYRNYSTASH"
     gene            complement(<667679..>669442)
                     /gene="ROK1"
                     /locus_tag="KLMA_30307"
                     /db_xref="GeneID:34715585"
     mRNA            complement(<667679..>669442)
                     /gene="ROK1"
                     /locus_tag="KLMA_30307"
                     /product="ATP-dependent RNA helicase ROK1"
                     /transcript_id="XM_022818811.1"
                     /db_xref="GeneID:34715585"
     CDS             complement(667679..669442)
                     /gene="ROK1"
                     /locus_tag="KLMA_30307"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase ROK1"
                     /protein_id="XP_022675440.1"
                     /db_xref="GeneID:34715585"
                     /translation="MDIFRVLTRGANIKKKGNGVTSNAADFSMAKEKQSKQQEPSVSS
                     AQNVKEEQELTKELNFFRNKKIVKKVEDQKAQSEAEKSKDGQEDNDEEDDSESNSNDD
                     EDISGRILTKEQAIRLRKSYQGKVTGQDVPLPIGSFEDLISRFHFDKRLLNNLIENSF
                     TEPTPIQSESIPISLLERDMVACAPTGSGKTLAFLIPLLQQIINDKKPGLKGLIISPT
                     KELANQIFQECSKLANKIYLDKKRPLQVAMLSKSLSSKLRNKVISQDKYDIIISTPLR
                     LITVVRDESLSLGKVKHLIFDEADKLFDKTFVEQTDDILSSCTDPHLRKSMFSATIPS
                     NVEEIAQSIMNDPIRVIIGHKEAANSNIDQKLVFCGNEEGKLIAIRQLVQEGEFRPPV
                     IIFLESITRAKALFHELLYDKLNVDVIHAERTQVQRDKIIERFKTGDLWCLICTDVLA
                     RGVDFKGVNLVINYDVPRSAQAYVHRIGRTGRGGRSGKAITFYTKQDALAIKPIINVM
                     KQSGCEVSEWMQKISSMSKREKESLKKGKAFSQRKQISTVPSVVKQKKRQKREMIEAS
                     KKRKLITDDSTDHTKDAEHDI"
     gene            <670085..>670837
                     /gene="MRPL15"
                     /locus_tag="KLMA_30308"
                     /db_xref="GeneID:34715586"
     mRNA            <670085..>670837
                     /gene="MRPL15"
                     /locus_tag="KLMA_30308"
                     /product="54S ribosomal protein L15"
                     /transcript_id="XM_022818812.1"
                     /db_xref="GeneID:34715586"
     CDS             670085..670837
                     /gene="MRPL15"
                     /locus_tag="KLMA_30308"
                     /codon_start=1
                     /product="54S ribosomal protein L15"
                     /protein_id="XP_022675441.1"
                     /db_xref="GeneID:34715586"
                     /translation="MSCIRLGINYGTKFGVRSVTYLHTGARVRGLKRDPSESLKNPYG
                     LHFNSLLKDGHVATVRKALNLEKYGADLPDELLAQCLTHKSFAQGVKPYNQKLSIIGG
                     HFIKFQACLYSVNQPVSDSQLQKVGAESITSPEAAGIMVNGLNFGMLGKGESKMLISK
                     QTMAEFIQRRGVDKLVFWNKRDLEKNHIYNGEFTVLQTVLNAVVGGIYLLKGQEKAAE
                     YVTHELFNGNDNSLTKISEQLLSKSESTEKNL"
     gene            complement(<671426..>675178)
                     /gene="SPA2"
                     /locus_tag="KLMA_30309"
                     /db_xref="GeneID:34715587"
     mRNA            complement(<671426..>675178)
                     /gene="SPA2"
                     /locus_tag="KLMA_30309"
                     /product="protein SPA2"
                     /transcript_id="XM_022818813.1"
                     /db_xref="GeneID:34715587"
     CDS             complement(671426..675178)
                     /gene="SPA2"
                     /locus_tag="KLMA_30309"
                     /codon_start=1
                     /product="protein SPA2"
                     /protein_id="XP_022675442.1"
                     /db_xref="GeneID:34715587"
                     /translation="MKDDSKELKYAQRVQIHNYYQSLKQFFEITGGSRDRSMTSRAQK
                     ARSKLLKLSAPQFFELSTDVNDELQRRIDESQLQHEFLAPNESFHAKRNQARQKLANL
                     SNVRFNDLVDDILFEIRRRGFSTLPAPEEVDNEKSPNLDNGSLPVDKAEQPTPALDVL
                     DIKNSPMLPSNDEHKEKKEKPTDEDTSPLNTTLQTSTVIPKTASIDWSSDEEEPKEEN
                     ETESLEPIEPLEPFKQKEAKETDVSEELNEKKEYPAQEDVSPSNNVITLDDVSSLNQS
                     PNLEKGYTRNPTEQSNISAPSPVGNKSINSLDNPLTFSDRPLSQSSATMTPIIQTAAT
                     TAAATGFGLSPVENKSKRMGSLSQSVERNKDRDIELLLSEGNKLDNVITNLEKEKLQL
                     LERIKELESNNEELKAKNDSLCEEVDELKQRSNEPSATKALDNNFQKGMSELTSHLNQ
                     LSVENEELKQQKVELQLLLKNVSSPSKHNGSLIDKESTWNSKRDDSSQSRSSRVATNK
                     LAPIANKELFPENSIIPSNLIDDLDSQIANILNLVLSPQASVLPLFQGIASISDYCSK
                     ILTLVNSSDTKSVCLVLENTISHAITSVRYYCSYKTPLLKVILENSIAEISYAIYDLI
                     KTVNLNSNKQEVYETPKLSDELEDSVVYSNQNTPMQKNLPQAEDLDYGLDKPTFSSAA
                     EGVEMSPVKPLKITQKRSSQEAPTRPVTSRKPSGPGLFTAMLNGGLKKDITPKSSRNP
                     LHLELQLDGSPKEKPQVPVIETRGIKRIDINQPSPTPERSSNQSNLNDSKLKVTSEKT
                     ATPLPVDHKESISVVQQPVTSEKKDKITKPVPSVERSANKSSPNDTQSKPVKQNSSTV
                     SSHETKSTTSSDEKGSPVTPIIANSDNVVPVTRNLNVTKSSNTERSPRLQNINSDMYN
                     SNDEETGGESIDDDDTNATYEALRKTMKLKHSQPEEQGKDSKKDIFSPVIHPQPIEVT
                     MSDDDLNEKPFNFETDSIEKPDSASIPSSTSNEKADNHIPKPVSTPVQKSPVASLSPA
                     QLVVSPLKPVARDSIIFENAKANDVKRGIDMEKASAPPSSIAETIENSESEEEIEFDV
                     DAFDIENPDNSLADLLLYLEYQTMDVINTIQSLLSSIKQPNSTAGELRTESNAINQVI
                     RQMVEATSVSMNQSRNSHLKEHGSWVVQSLDDCRRRMTVLCHLKPDGEIKSYEGDEEF
                     ADKHFKQRLAGIAFDVAKCTKELVKTVEEASLKTNIDYLNAKLSKE"
     gene            complement(675657..675729)
                     /locus_tag="KLMA_R312"
                     /db_xref="GeneID:34718686"
     tRNA            complement(675657..675729)
                     /locus_tag="KLMA_R312"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:34718686"
     gene            complement(<675904..>677385)
                     /gene="MCH2"
                     /locus_tag="KLMA_30310"
                     /db_xref="GeneID:34715588"
     mRNA            complement(<675904..>677385)
                     /gene="MCH2"
                     /locus_tag="KLMA_30310"
                     /product="probable transporter MCH2"
                     /transcript_id="XM_022818814.1"
                     /db_xref="GeneID:34715588"
     CDS             complement(675904..677385)
                     /gene="MCH2"
                     /locus_tag="KLMA_30310"
                     /codon_start=1
                     /product="probable transporter MCH2"
                     /protein_id="XP_022675443.1"
                     /db_xref="GeneID:34715588"
                     /translation="MLNKPRDDDAKDNEVISSKNANIDQEITMGVDENSSLSPYEEKA
                     PATHDYNKIQIPDGGYGWVVVGCYFFLNFCTWGSNAGFAIYLTYYLDSNKFPGGTKED
                     FAAVGGLAFGAGLMFAPLINYFVFRTSVKISIGVGIVLQGAALLLCAFSTKLWQVFLT
                     QGLLISFGLAFISIPATNILTPWFRKKRTLALGLGAAGSGLGGVVFNLGMQRILEIKS
                     LRWALISQCIIDTVLSTIALMLIRTRETAVQETTKEKPKFFDPSLLRHYVVWFLILYV
                     GTTMLGYVVLLYSLSAFTVSLGYTQKQGSVVSCMISAGGCAFRPLVGYCADRFGPVTV
                     GIVVHAIVGILCVAMWIPCRNLATAIAFSLLSGALMGSIWPLLTSISSRIGGLNKLAS
                     IYSFTWPCVGMCAIVSPIIGLKLRSNDPTVSNAYVNTAIFSGMGYYGAALFLWLIRGY
                     LIARDKLAIAAKTGHDDGELHLRVSVPDFLKELFNIGRLPRKV"
     gene            complement(<678532..>680874)
                     /gene="ACO2b"
                     /locus_tag="KLMA_30312"
                     /db_xref="GeneID:34715589"
     mRNA            complement(<678532..>680874)
                     /gene="ACO2b"
                     /locus_tag="KLMA_30312"
                     /product="aconitate hydratase"
                     /transcript_id="XM_022818815.1"
                     /db_xref="GeneID:34715589"
     CDS             complement(678532..680874)
                     /gene="ACO2b"
                     /locus_tag="KLMA_30312"
                     /codon_start=1
                     /product="aconitate hydratase"
                     /protein_id="XP_022675444.1"
                     /db_xref="GeneID:34715589"
                     /translation="MLSARVAFKKQGAVRHLATAVSGTLTRDSKVNQNLLESHSFINY
                     KQNVEYVNIVRERLGRPLTYAEKILYGHLDDPHGQEIERGVSYLKLRPDRVACQDATA
                     QMAILQFMSAGLPEVARPVTVHCDHLIQAQLGGEKDLKRAIDINKEVYDFLATATAKY
                     NMGFWKPGSGIIHQIVLENYAFPGALIIGTDSHTPNAGGLGQLAIGVGGADAVDVMSD
                     LPWELKAPKIMGVKLTGRMNGWTSPKDIILKLAGITTVKGGTGKIVEYFGEGVDTFSA
                     TGMGTICNMGAEIGATTSVFPFNKSMIDYLDATGRSKIAEFGQLYHKDLLVADEGAEY
                     DEVIEIDLNTLEPYVNGPFTPDLATPISKLKDVAVKNNWPLEVKVGLIGSCTNSSYED
                     MSRAASVVKDAAAHGLKSKSIFTVTPGSEQIRATIKRDGQLDTFTEFGGTVLANACGP
                     CIGQWDRKDIKKGDKNTIVSSFNRNFTARNDGNPDTHSFVASPEIVTAFAIAGDLRFN
                     PLTDTLKDKDGNEFKLKPPTGEGLPSRGYDAGENTYQAPPKDRSSVTVQVSPTSDRLQ
                     LLKPFKPWDGKDALNMPILIKSLGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINA
                     ENKKANCVKNFFTGEYDGVPNTARAYRDAGVKWVVIGGENFGEGSSREHAALEPRFLG
                     GFAIITKSFARIHETNLKKQGLLPLNFAEPEAYDKINPDDTIDIVGLNEFAPGKNLTM
                     RVHPKNGEAWETPLTHTFNAEQIEWFKAGSALNKLAQSKK"
     gene            complement(<682039..>687762)
                     /gene="STT4"
                     /locus_tag="KLMA_30314"
                     /db_xref="GeneID:34715590"
     mRNA            complement(<682039..>687762)
                     /gene="STT4"
                     /locus_tag="KLMA_30314"
                     /product="phosphatidylinositol 4-kinase STT4"
                     /transcript_id="XM_022818816.1"
                     /db_xref="GeneID:34715590"
     CDS             complement(682039..687762)
                     /gene="STT4"
                     /locus_tag="KLMA_30314"
                     /codon_start=1
                     /product="phosphatidylinositol 4-kinase STT4"
                     /protein_id="XP_022675445.1"
                     /db_xref="GeneID:34715590"
                     /translation="MQGLKRCSVSLRARALQKLCEVNGPEDSPLSKLINSLPISYSSN
                     VSKLYSIPLTLKEFEIIIAICDASPNDVKTVQSIIDTLIRPYFVNCSKQKFTDVVLSK
                     FKVNGFKNPLEVLSHKMTLFLLRASSSFSTLSVTVNKIFEEYLSTVKSSIEVNSLVSL
                     LGYMQAISDELKKSKEVYDIHWTIVFGLSKLLDSEFLLNSETLLAKSVSNDILVDYYD
                     NHREICALRFAQMLSQINVNLLRTLFRVEDPMELSEYLLKIQDLEYQEKTDTMKYANF
                     KTINRTYSKEISRLTSTAARFIIAIDDGAPYMNLQTYNTVALAYSCKIRNMEILTFSL
                     VSEEPESAILSRRLIFITSHEVETLQATVRMENPTFLKTIVNIASLLNFYTDKLSHQL
                     LNVFPLLVSSQHITTNSVVEISANFAIGLKALSEDAIVGTIYSLNNLLAVTKDGSPIP
                     LLKERKMTISSANDLDKMFPRQRKNNTLSLNDMKLYLGSENNSSSSLVFNKALETEEK
                     TLFDTSNTHYHDQLFKNAVMACVTVARHYGDQSISALAITILTQKYRALSEKSDKLIL
                     EGLAHILPFVGDNEFKMLCKFYNSVSLQSLKEENTIILDAVQSARAIISKELKNSNKG
                     SYYLYYLRSILDIIVSRGDVEKLEHHRSHHEISKVAEQIAFFLTPLALLLPVPGEEPS
                     IRNILSKDAVTTTAFRNIWFNMVIHGFYAKSDLALKHRKELEIIAYNSPPLVSDFPAN
                     NRETTLEMNTILRRGSSNHNVKAQKNSIQHVLSSNVIATRTISTTKIMFLAATYFLEC
                     IRCDIGDCSTILEYFSDSSIVNSNLDKFIGSIAISLTHRYLQTVPTGDLKLFSSKQIS
                     FQLKRMILMLSHRDLYLQDCSFQCCDVFIKKLPSSLCHHESLYALLDSLSMLFDSVTE
                     FETRKYDPRFEFTLRTSGIKVLLTDSEEWRTTSFQRLVSKAREWIKMLLRTSNQDGKI
                     LLQSYITDVTDLHNTNMVEYGVSFALEMAGTILSVDHEPSQIGIARVKIQPNTLSGFL
                     SQHAWRSKILTERSTMSSAEDINAERISLKNMIISTLLAKKKVNDVSITNFLSLCGVL
                     LILRTGDSASFVYDLVSIPFQTFYGNTMKAATNVWLSFIKERKDLSHLLVSEIATFWC
                     KSIDNKFGLFNRSIDKKDVEFSKMEYKPYDMEAIKRENIKVSNILKPHQEVVRFFASH
                     FEATVYESDHLLKLFTHVAYHGVSNLEHASLHPFARMVRNELISFAFLVLLVNEKKNT
                     GDVKRLAQALIKGALSWFKVRPTWPLGGNESKIKADLDVLIDLFHQFKSHSKLLLKHT
                     GNSYVLLEYFMLNEIFLLKTWLYPFDKHENGTPKLPGELISHAFELDALLAVNLCERY
                     SNESKNSDKLSKLIRKSPLNACHIHTALKYLLNESGSSSSGKGIPHEVIYWVPVSPSS
                     SINLFLPPWNRNKFLLQYNLRALESHDVENTFFYVPQIVQCLRHDDHRYVERFILDTA
                     KISLQFSHQIIWNMLANEYQDDEAMIEDSMKPTLERIRGKMIDTYDEEARLYYEREFS
                     FFNDVTGISGKLKPYIKKTKAEKKQKIDEEMAKIEVPLDVYLPSNPDGIVVDIDRKSG
                     KPLQSHAKAPFMATFKVRREKESGSDDDSEKVVTEDVWQSAIFKVGDDCRQDVLALQL
                     ISLFRSIWSFIGLDVYVFPYRVTATAPGCGVIDVLPDSISRDMLGREAVNGLYEYFIS
                     KFGNENTIEYQRARNNFVKSLAAYSVISYLLQFKDRHNGNIMYDAQGHCLHIDFGFIF
                     DIVPGGVKFEAVPFKLTKEMVKVMGGNQNTQAFRQFEDLCVATFLGIRPYMDLIVDFI
                     VPMLESSLPCFKAQKTIKNLKNRFVPGKTPHEASQHMRQLIRKSYESMFTKGYDEFQR
                     LTNGIPY"
     gene            complement(<688025..>689314)
                     /locus_tag="KLMA_30315"
                     /db_xref="GeneID:34715591"
     mRNA            complement(<688025..>689314)
                     /locus_tag="KLMA_30315"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818817.1"
                     /db_xref="GeneID:34715591"
     CDS             complement(688025..689314)
                     /locus_tag="KLMA_30315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675446.1"
                     /db_xref="GeneID:34715591"
                     /translation="MNVPELPGFTYDPVKKRYFKTQSHQRSSQAKPELPAGLNKSVAR
                     QEYLKCIDDLIRNRTPENIEWFEFQNKQPQLTTSYFLPTFISQQGTGDIQIGKVDRSI
                     ILNDSNFRLFELCIDASDDSFKVKFDRDSSSHESVVFFKITAEVTISINRFNDFNFNT
                     RSIIAGGKLKLPEIIDISSYQSKQKTYLTFLSSQGFQWIYYDGNHQQSSTEWRIQKKY
                     GDAICCLMINTQTILVGFRNGTILRVETDPKSKSSKVEKFLKLDGPIISINNIEGIDR
                     KTDLLVSVGKHPFQQILRINHERLIISEFQSRFSNLSKNKELLKTVKIEDLHCVIYGK
                     RLESEFDVFLLNSTNFKFPANLNWDWPLKKDGILDILVTNNDEYVLFPLESDTIRKRS
                     IANVKFHPYHNYRLNSIKIFILSRDENYSLTLSEYIL"
     gene            <689816..>690388
                     /gene="UBC12"
                     /locus_tag="KLMA_30316"
                     /db_xref="GeneID:34715592"
     mRNA            <689816..>690388
                     /gene="UBC12"
                     /locus_tag="KLMA_30316"
                     /product="NEDD8-conjugating enzyme UBC12"
                     /transcript_id="XM_022818819.1"
                     /db_xref="GeneID:34715592"
     CDS             689816..690388
                     /gene="UBC12"
                     /locus_tag="KLMA_30316"
                     /codon_start=1
                     /product="NEDD8-conjugating enzyme UBC12"
                     /protein_id="XP_022675447.1"
                     /db_xref="GeneID:34715592"
                     /translation="MLKLRALAEAKAKAKAQEEAGVKGNSEHPSHAAKPALLRLQKDL
                     DNIDLPKEILEYTTHLNETPMRVNLSLKPDIGYYAGGTYYFNLFVKDTYPMEPPVVKC
                     MQRIYHPNIDIDGNVCLNLLREDWTPALDLQSIVIGLLFLFHEPNGKDPLNQDAAKTL
                     MEDPSRFEAKLNYTLRGSNIDGVWYDKVMN"
     gene            complement(<690926..>691174)
                     /locus_tag="KLMA_30317"
                     /db_xref="GeneID:34715593"
     mRNA            complement(<690926..>691174)
                     /locus_tag="KLMA_30317"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818820.1"
                     /db_xref="GeneID:34715593"
     CDS             complement(690926..691174)
                     /locus_tag="KLMA_30317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675448.1"
                     /db_xref="GeneID:34715593"
                     /translation="MFTNSIKMLNTTAKCYIPKKPIKSTTFPKQLHTMEQTQYRAQNH
                     ATAYSYALYLKSDVKDQRPTVISSDSDEVSTVADHVRV"
     gene            <692760..>693740
                     /gene="CDA2"
                     /locus_tag="KLMA_30318"
                     /db_xref="GeneID:34715594"
     mRNA            <692760..>693740
                     /gene="CDA2"
                     /locus_tag="KLMA_30318"
                     /product="chitin deacetylase 2"
                     /transcript_id="XM_022818821.1"
                     /db_xref="GeneID:34715594"
     CDS             692760..693740
                     /gene="CDA2"
                     /locus_tag="KLMA_30318"
                     /codon_start=1
                     /product="chitin deacetylase 2"
                     /protein_id="XP_022675449.1"
                     /db_xref="GeneID:34715594"
                     /translation="MILTCWIVNIWISIVLVSAAAIDMLDVESNSLSISAEDASKEAT
                     LSEQSIFPIGRSPRSQAKTPFPAWLTQFTGLTEWPGADPPYIPLDFIDFNKIEKYEPY
                     KEGRCNKNPRESCSFDCHKCVAHDDVHSCAKLSQTFDDGPSVHTLTLLDKLQHKTTFF
                     TLGMNVVERPEIYHTVMERGHLIGTHTWSHPFLPSLTNEQIIAQLEWSIWAMNATGNH
                     LPKWWRPPYGGIDNRVRSIARQFGMQAVLWDHDTLDWLAASNPFQRTESAILKDVTEW
                     KRTSNGLILEHDGSKKTVDIAMKVNDIIGSDQMTAAQCVGGIDYIKEFKV"
     gene            complement(<693866..>696205)
                     /gene="IMH1"
                     /locus_tag="KLMA_30319"
                     /db_xref="GeneID:34715595"
     mRNA            complement(<693866..>696205)
                     /gene="IMH1"
                     /locus_tag="KLMA_30319"
                     /product="Golgin IMH1"
                     /transcript_id="XM_022818822.1"
                     /db_xref="GeneID:34715595"
     CDS             complement(693866..696205)
                     /gene="IMH1"
                     /locus_tag="KLMA_30319"
                     /codon_start=1
                     /product="Golgin IMH1"
                     /protein_id="XP_022675450.1"
                     /db_xref="GeneID:34715595"
                     /translation="MFKQLTQIGKNITDELTKGLNEELNGINSEQLDKNGPYAELPSE
                     IQIKLRKFEKYEQKYPLLLQAYKNEKLKTEKVEQIQKVLSECTPVSDISDVESLKSYF
                     ETVTQKISMLNTEVKRLTLENGDLLKQSESSKQQLAESQAAVEGFEKDIAKKDELIES
                     LNTDISAKDKSIDSYKEELATKNQLVDLFKKKIEELASPPASATDDGADSNSNDNQNQ
                     SPDQQQKPGAGAGKKKNKKKKGKNAAANANNGSEAAPAPASAPDSSNATQTANDITQA
                     ITLQVKLDSLQADYDKLKGEYESLSKSNEELLELKQLIKSKDEEIESVRDMLRDVGND
                     LVEAQNQLKERNDSSAEANDLKLQLESLRSSNANNLKSYELKQKELVAEVATMKKTEA
                     SLRQTVSQKEKIIDYLENQVKEYSANETKLKSEIDARKTENATLVKKIENLQKETEKW
                     RVESKKNDGNLENYIKENGKLSERLEVLQEKLQTLQNLKSNSNDQVETIKKQCEELSF
                     KLKDANKKIISLEEELNENANILQERNRELSTMRKILKELQTDKSSRVEELEAKLQLT
                     IEEKSKIENDTQMELARKSQELKQLKQSIDQLQSTYHDEVSKNERYSAEIEELKSTYE
                     RIKRSNSVSQEDSSGLDSMVKSLKDALSKSEKKQRELLNANMELKELNNDLNKKFDRL
                     SKNYKNLSSQVSKPGNIEPKSARTTPHASRSNSIIQENIPTQISTSQSEINEKIAYIK
                     NVLLGFLEHKEQREQLLPVVATLLQLDSNDEKRLVLSLK"
     gene            <696902..>699016
                     /locus_tag="KLMA_30320"
                     /db_xref="GeneID:34715596"
     mRNA            <696902..>699016
                     /locus_tag="KLMA_30320"
                     /product="glycolipid 2-alpha-mannosyltransferase
                     domain-containing protein"
                     /transcript_id="XM_022818823.1"
                     /db_xref="GeneID:34715596"
     CDS             696902..699016
                     /locus_tag="KLMA_30320"
                     /codon_start=1
                     /product="glycolipid 2-alpha-mannosyltransferase
                     domain-containing protein"
                     /protein_id="XP_022675451.1"
                     /db_xref="GeneID:34715596"
                     /translation="MLRDNVRHLSQMHRKIVLFGMLAFGMMVVLYGLSSYQPEVRKVW
                     KLWPEQNSVASNIGPITFQGDVLRESKVSDVYRWRFERFQLRSLNGGLNIAYDKRAFL
                     KKVSDWGKRSSAKTFGSLKNSRVSFKSLASSHAYFRLGTDSVKTGNGTMESPFSIRRK
                     NRKSENNNNNIGKKKRRVSGRHKACILVYLGDMQQLPILKRTMESVERNYNWKYKYPW
                     VLVQHGKLELSQAAKDSLLEAASGVVKFVHITTPPTDNQLFMNSQQDGKAHFSKEKYQ
                     LHRDEKCDYLKNLHRLRLKYLDGTLPDMKGSDISLCSKLYDPSSISTSRLLSSDIFRL
                     DEVLEYDYFLRVAPGTMFDCQVRYDIFDRFASNPYANVGIAFMEKTLDSRIFSALNFT
                     IDLVKKAQKVKLSKYFQDENSNYNGITLDTESFFVGKTSFFNRKQYISFIRFMDKQRT
                     EQNAPWSASEIISAFFSIVYNEASFVDYHSGKTLISREDILVYEDLGVSDISMMNSNY
                     DVDDIDDIKVEKYVTAKQSCPMSSNEENELLLRNVLDCNCDMDTRYFYRDTKVPMSQL
                     KWDSKEGISIIPIKDTIFREFHDMTFAQMVRSLSETADSNEVKEFVHYFQSFPENEMD
                     NLENIKESKVINDEYERNLQDERSAKIREKRLKEYERMIADKKKQLQEVEKKNEKQLE
                     ELKEKLKPTVNEQKIDQNNNTK"
     gene            complement(<699387..>701897)
                     /gene="ATG1"
                     /locus_tag="KLMA_30321"
                     /db_xref="GeneID:34715597"
     mRNA            complement(<699387..>701897)
                     /gene="ATG1"
                     /locus_tag="KLMA_30321"
                     /product="serine/threonine-protein kinase ATG1"
                     /transcript_id="XM_022818824.1"
                     /db_xref="GeneID:34715597"
     CDS             complement(699387..701897)
                     /gene="ATG1"
                     /locus_tag="KLMA_30321"
                     /codon_start=1
                     /product="serine/threonine-protein kinase ATG1"
                     /protein_id="XP_022675452.1"
                     /db_xref="GeneID:34715597"
                     /translation="MSSESHGKAVAKAIRLPTENYTVEKEIGKGSFAIVYKGVSLRDG
                     RNIAIKAVSRSKLKNKKLLENLEVEIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCA
                     LGDLTFFIKKRRSLVMKHPLIKTVFDLYPPPSAEHNGLNRVLVVNYLQQLSSALKFLR
                     SKNLVHRDIKPQNLLLCTPLQDYSDPKTFHEMGFIGIYNLPVLKIADFGFARFLPNTS
                     LAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLYEMCCGRPPFKASNHLELFQKIK
                     KANDEVTVPSNCYIEPKIFKLIKGLLTFDPEARMGFNEFFNNEVVTEDLSRYEASYEP
                     DLESKSKDVAESNMFVSEYLVRPAAQEKANGGLRTDEGSAMPGAEHTYNKEREHYRER
                     QDLQGQQQQQQQHPDSPPRGSTQGYQSSAGQTRMKSSYNDLILEKEYVVVEKKTVEVN
                     SLADDFANNGPTTNNQGAQIIKPLRYRTSSSSDGHGGRRASLVERRLSISSLSPSNAL
                     SKALGLASVRLFGYQQPNTQTTSTSTHPTLLNPQIFHELTENAVLRADHHLNLFNEQI
                     SDSNITPFVESLSAKAFVMYSFAEMKFSQILPSPPSSTDYYSQSDKRLSNGSCAIDDD
                     DDLDSGNPSSNQTLTPGANKVSAANVDNLIPAPELKKLCMESLLLYLKSLTILASSMK
                     LTSKWWYENESKNCTLKLNILVQWIRDRFNECLDKAEFLRLKLHTLNQSEDPQVLDDE
                     PTIFVEKLIYDRALDISRNAARLEMEGGNYNTCELAYATSLWMLEILLDEHLSSNEVY
                     DDGYSSNITSLDESDKEMIRKYVSSIANRLKALKSKMS"
     gene            <704286..>704963
                     /gene="MND1"
                     /locus_tag="KLMA_30322"
                     /db_xref="GeneID:34715598"
     mRNA            <704286..>704963
                     /gene="MND1"
                     /locus_tag="KLMA_30322"
                     /product="meiotic nuclear division protein 1"
                     /transcript_id="XM_022818825.1"
                     /db_xref="GeneID:34715598"
     CDS             704286..704963
                     /gene="MND1"
                     /locus_tag="KLMA_30322"
                     /codon_start=1
                     /product="meiotic nuclear division protein 1"
                     /protein_id="XP_022675453.1"
                     /db_xref="GeneID:34715598"
                     /translation="MAPGRNTVSLAEKKARILSFFQEEHTVYNMKELEKLIPKKCGIS
                     SMLVKELVQKMIDEDGIISVEKCGNINVYWSFKNQTQNKFNNDAIKAEKRIQEEKEKI
                     ESCIETYTKETESSRSNTMKNRKGWKRSEQLLKLKELQRMVRELNTKNEELSKNNWTP
                     QRLKEQKNELFKKLGCALVTVDNIECVVGYIKSTYQIQITDLQAELELPPEFNQFEDL
                     IEKLGKA"
     gene            complement(<705415..>706788)
                     /locus_tag="KLMA_30323"
                     /db_xref="GeneID:34715599"
     mRNA            complement(<705415..>706788)
                     /locus_tag="KLMA_30323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818826.1"
                     /db_xref="GeneID:34715599"
     CDS             complement(705415..706788)
                     /locus_tag="KLMA_30323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675454.1"
                     /db_xref="GeneID:34715599"
                     /translation="MNYSMYQNDTVAVSQETLREGAMYNLQLKRSAIDDSESQAQNVG
                     GRSSMRLSTFEYDESELSNDLTGKTLEDEILSFQQGTSIRAMGDNIRRLSISENHRDH
                     PMFYEFEYFNRGFKQDIPSSVFSDEEDDMDLGLDSNLDLEMDRESIFVNIGSKSTNSS
                     NHTPSASTSSMALLLSGLDEDVSMNLDLDDQQDVTGNGNGNGVKKLFKLNKMFRMNNR
                     DLASEDEPEQIFKKKYFWSRKPTVPILRDSKNEQTGYSSSQNSSFHNDQLIVSGVEDS
                     TMNTANVNPIKLVTVEKNMADNYSPTLSSGSSKINSLEPEMALSSNSSIVSQIKPNTT
                     GSTSISSSSSSYVQTPVSVHSSKAQSLSLSKLNIQNNLGSTIIKKQHGVPKTRGRKPS
                     PILDASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCDICGKKFSRSDNLSQHLK
                     THTHDQK"
     gene            complement(<707547..>710336)
                     /locus_tag="KLMA_30324"
                     /db_xref="GeneID:34715600"
     mRNA            complement(<707547..>710336)
                     /locus_tag="KLMA_30324"
                     /product="GAL4-like Zn2Cys6 binuclear cluster DNA-binding
                     domain; found in transcription regulators like GAL4"
                     /transcript_id="XM_022818827.1"
                     /db_xref="GeneID:34715600"
     CDS             complement(707547..710336)
                     /locus_tag="KLMA_30324"
                     /codon_start=1
                     /product="GAL4-like Zn2Cys6 binuclear cluster DNA-binding
                     domain; found in transcription regulators like GAL4"
                     /protein_id="XP_022675455.1"
                     /db_xref="GeneID:34715600"
                     /translation="MDSEGVSSSNDDGGVRHLNNGEKLIPMKDKSALVLDDGKIYKIQ
                     HKRQRQILSCVACHKRKIKCDRIRPTCGSCHKNEWQCTYFVNARVSRGGSSSKLDDET
                     QVVPNKASKEELLKVIEKAKQLEMQQGEKLISDQKVQQQRSRVKRVRKASKDIGVRET
                     GGKKDGLINETEGNNNGKNKCTNANANASSHAGSDISDSARSIEDSVYYKNKSMLDFN
                     KKLESSASDVLKLVWDLLPSIERANELYVIYTQNIHMILPLIDLQHFENDHHQFWESV
                     TSGESLKQPDFLLLLFPILYASVKSLYHLLDKEQSQGLLQEMSQYKTACLRLYSAFDF
                     PNKYSIKILTGFVLLNSVIENPSVTTIAQLTRLCQRARLTKDPLLLGLSDSSVVQSKR
                     ILFWQIFQLDTMTSLHNNLSPLIKLDEFDTSLPVEVINGTLNPSICYINANYRFVLLL
                     NELCQKRGSFSGIKERIVDLHVCCMGSALSLNNHLSTHRLSLHEAKFIQWAMYMLNTL
                     ADRSLLLLHLNIISTSIPTLHNRKLLKKDIRMCDDPIVESGYGKDYNVIQTILNNSGN
                     LDLTSHNQTKKPMVYNFENLTNNLVPASLHFLDEFVKYHSTNRYACFNWELLVGNMPI
                     NAITFALKMLALDANRAEKLGRRLVLNTDLRYILLSKAIPIVEDRLDIETAISKNCFR
                     LAKLLFQLLVVKFGNSNAEPIPNKYDITYSTSKDVPQPTLNQDLEEEKSSMPNGFPLK
                     SDGRSNVTYIMNNSIPSPRNTVLDILSKDVNGQGNNGHEELFDDTFFFSGNLIYNSEL
                     LDGDNNITASCAQIAPRTMKAISSHEFDMKATPHTTTPWDEIPYFISEQTQDQIRNNT
                     DIVQQPNSFSLPPASVTSKKEEEIKAIYKKVQDYIILFNSSNNELEYVASGDEYYREF
                     ENALLEVLCGILTQS"
     gene            <711510..>712895
                     /gene="STR3"
                     /locus_tag="KLMA_30325"
                     /db_xref="GeneID:34715601"
     mRNA            <711510..>712895
                     /gene="STR3"
                     /locus_tag="KLMA_30325"
                     /product="cystathionine beta-lyase"
                     /transcript_id="XM_022818828.1"
                     /db_xref="GeneID:34715601"
     CDS             711510..712895
                     /gene="STR3"
                     /locus_tag="KLMA_30325"
                     /codon_start=1
                     /product="cystathionine beta-lyase"
                     /protein_id="XP_022675456.1"
                     /db_xref="GeneID:34715601"
                     /translation="MSKPSLNTSLVSVLHNDKYGSSVPPLYQSTTFKATSFDELQEYD
                     YTRSGNPTRTVLQQQIANLYEVNQEQVFAVSSGMTALDIILRTLIDNSDQIPTIIAGD
                     DLYGGTQRLLTFLQTRNHAKVVHTDTTNTASFIELFKSLPRVDIVLLESPTNPLLKVA
                     DLPALCHFVKQATNDSCKIVVDNTMMSGLNSNPLQFGADLVYESGTKYLNGHHDIMAG
                     VIIAKKDVAPSVYFVINSTGAGLSPMDSWLLIRGLKTLSVRLYKQQINAMVLSHWLQD
                     VCGFKPNAAEKEKPQLRTRFVGLKSHPQFQLHQSFNRGPGAVLSIETGDVKLSERIVT
                     SKRLKIWAVTVSFGCVNSLISMPCKMSHASIDPEVRKQREFPEDLIRLCCGIEDVKDL
                     QYDLLAAFEEAGLVELQQRGQDTYILNKQNGHLARNNIGETYQENYNVYDQFFGQNIV
                     SKTRHLHRPKL"
     gene            <713678..>715690
                     /gene="PIB2"
                     /locus_tag="KLMA_30326"
                     /db_xref="GeneID:34715602"
     mRNA            <713678..>715690
                     /gene="PIB2"
                     /locus_tag="KLMA_30326"
                     /product="phosphatidylinositol-3-phosphate-binding protein
                     2"
                     /transcript_id="XM_022818830.1"
                     /db_xref="GeneID:34715602"
     CDS             713678..715690
                     /gene="PIB2"
                     /locus_tag="KLMA_30326"
                     /codon_start=1
                     /product="phosphatidylinositol-3-phosphate-binding protein
                     2"
                     /protein_id="XP_022675457.1"
                     /db_xref="GeneID:34715602"
                     /translation="MSSVHSQTSEVDVPPISATKLKGGTQNGSDTSIVSVKSTITFEK
                     QKVVPRTRTMSVQSVLSSFSLRSMINNRDNCGSQQQNCDEEECTNTSHNHNGNNNNNT
                     GSGSLAATYINPIQQIQSPAMASTMMKKRNGNGGKHKQTLFSDLPQSETRSRIGQQLP
                     FTDDKRKSAKDLRQRRSSSNISQHSSSNSNPNSQTEIEHEQNGSDKQPKVKSKTPSSS
                     SASSTSNNNNNNNDNNNNSSSSSNSDDASKNSNNQSVDNDSSSESSPIDSSHDSESEE
                     DDISRQNKLTTDALRKLSMIQHNREAASKSIQTTPLTSSENLVDPKEPLTQLTFGGKN
                     VILDTSTTIRKNSVAIEPAKDHADGRKQSLEIITQPTSSTTGASPHNFSETKCSRSGS
                     STSLNSKRLLQQINEPKKPMYMPAVLRDISETNITIDTLKSHSPAPSDATQSTLQAAL
                     SRHSNNSSPNYARSVHSTTSSIMSSYRNKIQSWLSNDKDPQFQLAQPTREHWVPDSKR
                     LSCKYCHKMFSFWERKHHCRHCGDIYCQQHVMHWLYLNPKAKFIIGSGGVGVLSKICN
                     SCLEEYENLVKNGPAKDQIGNNQEQQQMIPPFSATSPNSSYPSNDSRQDENNAGHSGP
                     LSNLAKADNERNIDETLNGSRNSVNNRQHLETVVGSVPADWSWSSF"
     gene            complement(<717070..>719223)
                     /gene="SCT1"
                     /locus_tag="KLMA_30327"
                     /db_xref="GeneID:34715603"
     mRNA            complement(<717070..>719223)
                     /gene="SCT1"
                     /locus_tag="KLMA_30327"
                     /product="glycerol-3-phosphate O-acyltransferase 1"
                     /transcript_id="XM_022818831.1"
                     /db_xref="GeneID:34715603"
     CDS             complement(717070..719223)
                     /gene="SCT1"
                     /locus_tag="KLMA_30327"
                     /codon_start=1
                     /product="glycerol-3-phosphate O-acyltransferase 1"
                     /protein_id="XP_022675458.1"
                     /db_xref="GeneID:34715603"
                     /translation="METPLIKKEPVVVRHSTPHVEDDPNDPPFMYEEPALWRKMVYDV
                     FLWLFTKIFDCFFREIRTRGGYKVPTQGPIIFVAAPHANQFVDPVILMGQVKKTVNKR
                     VSFIVAEKSLRRPAVGTFARCAMSIGVVRAQDNLKLAKGKIRVDPDNYQRIIGTNTEF
                     TKFHQKGLIGLPKSLGNVEIDSIVSDTELILRKEFKMQKPEVKATLLNGTAFKYAPKV
                     NQSRVYHNVFEHLAHDQCIGIFPEGGSHDRTDLLPLKAGVAIMALGCMDLHPDVNVKI
                     VPCGMNYFHPHKFRSRAVVEFGHPIEISKELVAKYRNPATNREAVKELLDTITEGLKA
                     VTVTCPDYETLMVVQAIRRLYAGHLVSKLPLPLVVEMNRRIVNGFQTLKDNEDISKLK
                     EDILRYNSHLRDYNIPDHQVETATVNMPRSLGLLIWRSVKLVILLTLALPGIILFSPV
                     FIAAKRISAKKAAEALAASTVKVKANDVIATWKILIGIGVAPLLYSLWSILFVWYFRD
                     SLTKNKFLSFIIAYTCCATVTYSALISGDHGMDIFKSIRPLYLAIISPKGLQSLKDER
                     TVLSEKINGIVNEYGPRLFPDFNVESLASYASGHSLSDEQIEEQEDRKTSELKRRRRL
                     AKLKKRLQSQQENPEHVKSSSTATTDDESDALSMINSDNSLSNIPIFSNRDRSTSSTS
                     IGSMGSSIEVSLNTSDEKSHSISGIADQVRKNRAD"
     gene            <720676..>722205
                     /gene="PPQ1"
                     /locus_tag="KLMA_30328"
                     /db_xref="GeneID:34715604"
     mRNA            <720676..>722205
                     /gene="PPQ1"
                     /locus_tag="KLMA_30328"
                     /product="serine/threonine-protein phosphatase PPQ"
                     /transcript_id="XM_022818832.1"
                     /db_xref="GeneID:34715604"
     CDS             720676..722205
                     /gene="PPQ1"
                     /locus_tag="KLMA_30328"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase PPQ"
                     /protein_id="XP_022675459.1"
                     /db_xref="GeneID:34715604"
                     /translation="MGNSPSKNQYGIQGTIKHSSGSQQQQGSSLSDETGNEPNDPDDS
                     RPLPTITTNPTLIASAKSRAQQQQQQQHMNMNMNSQLSSSTPRTFDLDIDLSLACELN
                     STKYPFSTSNTSSISSTSDSSFSMKSGSTQAIAPGGGSLPMTSSSSLSDSHFDHSPMS
                     LPPIKEENCTAPSSVSSSFRKGVKIQNQRSARPIILKRAAHDPNCTDQVNIDDMIEKL
                     LYLGESRIYHSKDFPFRSWEIQLVCTMAREVFLNQPSLLKLQAPIKVVGDVHGQFTDL
                     LRILRLSGVPPDTNYLFLGDYVDRGKQSLETILLLLCYKIKYPDNFFMLRGNHESANV
                     TKMYGFYDECKRRLSTKAWKMFVDVFNSLPFAAIIQDKIFCVHGGISPQLSDLRQVAN
                     IHRPTDVPDDGLLTDLLWSDPDSSVKDWSLNDRGVSYTFSKKNIADFCSKFKFDLIIR
                     GHMVVEDGYEFFARKKLVTIFSAPNYCGEFENWGAVMSVTTGLMCSFELLKPHGIRRK
                     R"
     gene            complement(722880..722951)
                     /locus_tag="KLMA_R313"
                     /db_xref="GeneID:34718687"
     tRNA            complement(722880..722951)
                     /locus_tag="KLMA_R313"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:34718687"
     gene            <723464..>724060
                     /gene="CBC2"
                     /locus_tag="KLMA_30329"
                     /db_xref="GeneID:34715605"
     mRNA            <723464..>724060
                     /gene="CBC2"
                     /locus_tag="KLMA_30329"
                     /product="nuclear cap-binding protein subunit 2"
                     /transcript_id="XM_022818833.1"
                     /db_xref="GeneID:34715605"
     CDS             723464..724060
                     /gene="CBC2"
                     /locus_tag="KLMA_30329"
                     /codon_start=1
                     /product="nuclear cap-binding protein subunit 2"
                     /protein_id="XP_022675460.1"
                     /db_xref="GeneID:34715605"
                     /translation="MSLAEFDEIKYDHSCDRLDKPSRYLIRKAKRDPESGLQQLRKSM
                     KSCTVYVGNLSFYTSEEQIYELFSKCGTIKKIIMGLDRFKFTPCGFCFIIFEKMEDAL
                     NSIKYLSDTKLDDREITIDLDPGFEEGRQFGRGKSGGQVSDEMRFEFDASRGGFYTPL
                     ENRIGTNANFGARRVKNIPEQQEDDIVDEDEDAYIPGQ"
     gene            complement(<724916..>726193)
                     /gene="CUP9"
                     /locus_tag="KLMA_30330"
                     /db_xref="GeneID:34715606"
     mRNA            complement(<724916..>726193)
                     /gene="CUP9"
                     /locus_tag="KLMA_30330"
                     /product="homeodomain super family"
                     /transcript_id="XM_022818834.1"
                     /db_xref="GeneID:34715606"
     CDS             complement(724916..726193)
                     /gene="CUP9"
                     /locus_tag="KLMA_30330"
                     /note="cl00084, Homeodomain"
                     /codon_start=1
                     /product="homeodomain super family"
                     /protein_id="XP_022675461.1"
                     /db_xref="GeneID:34715606"
                     /translation="MSTSSSSNGTGPGSGSGSGSGNGNAVTLPSIKSLLYSNSNSGNN
                     SDVVQVPSHALPHEIQYTMTDIALNRHIGANCTSSSSKQMLPPLRARSHSEPMDPLVT
                     LSNTASQMLHTRDKPEGITQGVSVGRSNSLLLTQSSHSMARPQHSVYSMISTHGTPAG
                     TFVPATAPASTPNVVLSTLSPISTPAITNNNTTRVMNTHTNNSSSNSNGISNGHMNSI
                     HSNSNSHSSEGNSNNNITGGNNSNINAGMNMNINTGNNGLTGYAMVSGVNAGGKKHSR
                     KKSKSSKSLMNSSKRSNLPKEVINVLNDWLLKNLHNPYPTPQVKRELLEKTGLNHVQL
                     SNWFINVRRRKIFNEYYKLNQSVNTDKSMKNSDMLPSNYNDDQNDDGSDPQLEMRFRT
                     IPLTRRKKLIDRLEELKRLSSSNMPPPSHRRQP"
     gene            <729140..>730810
                     /locus_tag="KLMA_30331"
                     /db_xref="GeneID:34715607"
     mRNA            <729140..>730810
                     /locus_tag="KLMA_30331"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818835.1"
                     /db_xref="GeneID:34715607"
     CDS             729140..730810
                     /locus_tag="KLMA_30331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675462.1"
                     /db_xref="GeneID:34715607"
                     /translation="MIFQNPKVTLTPTCSPLESDVPPTYSVSDSCDNSPTALSHRSSA
                     SGPHIVPLVSADGPVPSRPMLIRLNKAKRFSATPFTYNVFDKTANPLKTVHDCLTLRL
                     ETKLDSNTVYLPGLNSSLDDELESQKASLSGHLVLTVKSTSLVIQNLAVRLNGYSTEF
                     LCVLDNDQIEKVNEDGTTVNKSNLESQVRLFREGPEKRPSYYDPFITDEIVCFDKFPI
                     VLTKGTYSIPFTFVLDSRKHHASYRSMRGSTTYRVETSLTLLPEGGRRGSASFGMFFP
                     KPEPELIFLTQECKMVKTIPYSTMLQNQSVEDQGFLKKENTDYSFYLSSKVLEIGKPF
                     QCTLNLIAPPETKLLKVDVKLLQKMTIPIVTTDMCTPVGKIYAKSQFFQLDSFEQPAN
                     AVSNTINVKFDNIVISDERDNGILTKKILPTYCEASRLKIPTKDSKIAKLETSHHVII
                     TATAAVPVGTDHADASPSKQKYKKTNINFKIPVIVLDQYMGSTLHLPAYEPETTNSKI
                     LSNCLEFSGTINCLDDCVPLVYTAAYSSTENSPDSSPTSPPRYAALYN"
     gene            <732216..>733925
                     /locus_tag="KLMA_30332"
                     /db_xref="GeneID:34715608"
     mRNA            <732216..>733925
                     /locus_tag="KLMA_30332"
                     /product="sporulation protein 23"
                     /transcript_id="XM_022818836.1"
                     /db_xref="GeneID:34715608"
     CDS             732216..733925
                     /locus_tag="KLMA_30332"
                     /codon_start=1
                     /product="sporulation protein 23"
                     /protein_id="XP_022675463.1"
                     /db_xref="GeneID:34715608"
                     /translation="MFFRKLSISGSGDSKRPPEYNENDDLNHLPTVFDECISTKGPTL
                     MPINSLISDQSSEARNVPPSVVSLKSFKKHNPDNGSFLYNPFDESQNPVKTIHESNNL
                     RVELILENDTVFLPGLKEDLKSHTSLMDHSRSQVDEEELANYRTSLSGKLVLTVKSTS
                     VVINDLKVRLNGYSNEYVCVLEKKTDAGCLGDNDEDDEIPRRKQYEKTVKVLTDSTDG
                     KFTFLKPFVTDEVTGFKKTPTLLSKGTYIVPFSFILDPYNYHSSFESAVGSTSYRVEA
                     FMSTLSTSNISNTSTINHMTLDTSGKYENVFLTHKCSIIKTLSPSSLLKYESITSQGS
                     YKEGFLDYDFFISSKLIELNCPFHCQFSFKTKPQATINRVTLSLVQMALMPCIKEDGV
                     TPVKKSYIQSNTFVLGHYSPPRDKKSDLVLAKFEDLQIHSRLNDDSRTGSKILPYYCE
                     ESRLLLPRNDRIEKRFKLKVTHFLKISLNTTLNYYPGSFVDNSRRININFKIPVMIID
                     KNMGSSLHLPPYEPPMVSKSMSTSLDSEYNWSPNSSLQCQSLNSFTASPPSYDSLSPL
                     KGM"
     gene            <734524..>735819
                     /gene="HFI1"
                     /locus_tag="KLMA_30333"
                     /db_xref="GeneID:34715609"
     mRNA            <734524..>735819
                     /gene="HFI1"
                     /locus_tag="KLMA_30333"
                     /product="transcriptional coactivator HFI1/ADA1"
                     /transcript_id="XM_022818837.1"
                     /db_xref="GeneID:34715609"
     CDS             734524..735819
                     /gene="HFI1"
                     /locus_tag="KLMA_30333"
                     /codon_start=1
                     /product="transcriptional coactivator HFI1/ADA1"
                     /protein_id="XP_022675464.1"
                     /db_xref="GeneID:34715609"
                     /translation="MSLSTPIASSAMGAGNEGTPMGSDIDMTEHNHHSSITKSQKTEK
                     DEDNMGFPQDKRLDIESMINEFNEYLSKEHWAKYARLISLFILGKLSRKELVNELDVI
                     FRPTQEQPNIKPRDLIRLHNQLLLSLFTNSLRETTDDDPQSSKWGFRNGSQQQNKRRS
                     KPNSQIELYKKIVVSLPLSDRQRLKMITKEAGKRGFVLCSVLQARLRQIPKLPCVFNQ
                     ETAKRIQQQELKGPQEWSQEIMSGFKTQLSTESYVLPDNESLYLRMVGIARENGIVGQ
                     IDSRCVDIVSLALEYYLKTIIESTIDTVRYREKKYSDYYDLNDDGFQQASGTSFSDKK
                     ETDKAKDITANRIISLTNEDALDSFTIFPNVVDPTGAYLGLTTNGLVNDDEIIQFKSP
                     IDDLLYFKQEKPSFTPLDEKNMGTREELNWLIKDILTKK"
     gene            complement(<735942..>737810)
                     /gene="CIK1"
                     /locus_tag="KLMA_30334"
                     /db_xref="GeneID:34715610"
     mRNA            complement(<735942..>737810)
                     /gene="CIK1"
                     /locus_tag="KLMA_30334"
                     /product="spindle pole body-associated protein CIK1"
                     /transcript_id="XM_022818838.1"
                     /db_xref="GeneID:34715610"
     CDS             complement(735942..737810)
                     /gene="CIK1"
                     /locus_tag="KLMA_30334"
                     /codon_start=1
                     /product="spindle pole body-associated protein CIK1"
                     /protein_id="XP_022675465.1"
                     /db_xref="GeneID:34715610"
                     /translation="MHESRIPSINSGKRQRPFSSASLPDEDRLPEIHVTKKRHSALAN
                     ITNVVMSSGVTSMASKSSMKAEPFSSPYQSQRQSTNMRLLNKYFYGDPTVIEEVKKRE
                     RKVLKDIHISSNQIKEVDAELENLNNNIIPQLKYDLNKKSNIFRHMKQDTLSMQEQLY
                     QLNNDCDLKKKNHELMLNNLSLKHSVNMQDMMNYWHQKISEKRHDWELKIQKLKQTEP
                     DPAVLNDIKMLKAEKQEREKTLQELKNANESELQDHENKLKTEFEQFKQEKKKPLAKS
                     ISENKKLNSELNELIEKKKSLLRKIDDKINEENSLREAIKERNLALKALNDSIEPIEH
                     ELSHLQLKFRSEKEITDAIKSQAKQAETEYTKQYDRMEQEQLQRRILENTIDDLDGHI
                     RCFAYINCNDHDEYEVDYMNKCIIGDHDTFYFNRVLPRDLVSPLALFSSECFTFIDSS
                     LKGGKSCNIISINDDLRKQFLETIQQKYPNLKILVQMVVLNDDDSSKDLLNLEDSDLS
                     AVIEEKCIDFHARRLPITEVDGYMVSDFNGIHVTKFEIFRDEHNFESIFFIQAPKQEV
                     DKLNVIRTSKLKGTPVSTFLQSLLSRLQSLIVFNFDTLDSSLLQLSQTLHKLPNPK"
     gene            complement(<738338..>738841)
                     /gene="YAH1"
                     /locus_tag="KLMA_30335"
                     /db_xref="GeneID:34715611"
     mRNA            complement(<738338..>738841)
                     /gene="YAH1"
                     /locus_tag="KLMA_30335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818839.1"
                     /db_xref="GeneID:34715611"
     CDS             complement(738338..738841)
                     /gene="YAH1"
                     /locus_tag="KLMA_30335"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675466.1"
                     /db_xref="GeneID:34715611"
                     /translation="MLRTILPRQAVLLNQFRTGAMHSRMQMKPHTRLWTSNLIGKRFH
                     GHLHKPKPGEELHVTFILKDGTQKTFEVAEGDSLLDIAQGHNLDMEGACGGSCACSTC
                     HVIVDPEYYDALEEPDDDENDMLDLAYGLTETSRLGCCIKMSKDIDGIRVALPAMTRN
                     VSSTDFE"
     gene            <739430..>740095
                     /gene="VTI1"
                     /locus_tag="KLMA_30336"
                     /db_xref="GeneID:34715612"
     mRNA            <739430..>740095
                     /gene="VTI1"
                     /locus_tag="KLMA_30336"
                     /product="t-SNARE VTI1"
                     /transcript_id="XM_022818841.1"
                     /db_xref="GeneID:34715612"
     CDS             739430..740095
                     /gene="VTI1"
                     /locus_tag="KLMA_30336"
                     /codon_start=1
                     /product="t-SNARE VTI1"
                     /protein_id="XP_022675467.1"
                     /db_xref="GeneID:34715612"
                     /translation="MSSLLQNYESECQVAINQAKVLLSNASSDAGVLQSGGSSEILAQ
                     IEQYYEESLDLIDQMEIELNNTGSSLDSKARASYKAKIRDYRKQCQNDIKTPLKKLIA
                     DNDRAQLLQGHTFENDEQRQQLLSNHAILQRSGDKLTDATRLASETENVGAQIMMDLR
                     SQRETLENARQTLFHADSYVDKSISTLKTMSRRLIANKFISYAIIAVLILLILLVIFS
                     KFK"
     gene            complement(<740313..>743534)
                     /locus_tag="KLMA_30337"
                     /db_xref="GeneID:34715613"
     mRNA            complement(<740313..>743534)
                     /locus_tag="KLMA_30337"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818842.1"
                     /db_xref="GeneID:34715613"
     CDS             complement(740313..743534)
                     /locus_tag="KLMA_30337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675468.1"
                     /db_xref="GeneID:34715613"
                     /translation="MSVITTEEKRLQQNKNREKYWLKWGPYLSERSWATVKEDYSHDG
                     DAWSFFPFEHANSRVFRWGEDGLFGVSDNRQIICSNVAVWNGKDPILKERMYGLTSHQ
                     GNHGEDGKELYYYVDNLPSHAYMKAIYKYPFNKPYPYEELVAKNAERGYDDQEFEIYE
                     IDGLFKEKDTGDTPYFDIVYEMAKDDDNPMDLNFRITAYNRSSTKYGELYIIPQVFFR
                     NTWSWETTDRVKPHLSKTGNNFVTLNTEKYGTHYAIFAPSPGEFDSSEQGSDEENSDD
                     EAADIEPILLFTENESNLKKLFNSKENPAPYTKDAFNEFIINEDPSAVNPEEEGTKSC
                     AVYHFPKIPPNEYVTVRYKLTDQALPKLDDEMIIDEDDFDALFDRREQEADNFYWRVT
                     PNPISDSLRMVQRQAFAGLLWSKQFYYFVQDEWFNGDPMQKPPPPKNRANGRNKDWKH
                     MYAQDILSLPDKWEYPFFASWDTAFHCIPLAMIDPEFAKKQLDLFTREWYMHPNGQIP
                     AYEWNFSDVNPPVHAWAVYRVFKIERNMYGREDRVFLERVFQKLLLNFTWWVNRKDHD
                     GNNVFEGGFLGLDNIGIFNRSEPLPTGGTLEQADSTGWMAFFSLQMLNIALELAKNNP
                     VYEDIATKFFEHFLYISDSMSFKYEIDSADNFKEEVKESLWNEDDKFYYDAISWGEPF
                     KQQLPIRSLVGLIPLYACMTLEPRILDKFPGFKKRIDWFLENRSAMFGRNIASMEKRG
                     VGERLLLSLVNKERLEAILSRMLDETEFLSDYGIRSLSKYHEKHPFTMSVNGEKYEVS
                     YLPGESNSGMFGGNSNWRGPVWFPTNFLLVESLQRFFLYYGPEFKVECPKGSGEFLNL
                     AQIAEELQHRLIHLFIPDAEGHRAVYHGEYSDLLSKDPNFENLIPFYEYFDGDTGRGL
                     GASHQCGWTALVAKWIHDTGLSCIRLPRTPRSSVNVANLDNAHINSLLSDVKPNMPRK
                     MARRKSSKSLINLTATQLELTEEEKYLHYIGNARRESLKAEPRSGSIISSEEDDEDLA
                     LSLERLRKSRSVEEESRLVNELRRKLSHTTINSTDDDELECVP"
     gene            complement(<744249..>744662)
                     /locus_tag="KLMA_30338"
                     /db_xref="GeneID:34715614"
     mRNA            complement(<744249..>744662)
                     /locus_tag="KLMA_30338"
                     /product="protein ICY2"
                     /transcript_id="XM_022818843.1"
                     /db_xref="GeneID:34715614"
     CDS             complement(744249..744662)
                     /locus_tag="KLMA_30338"
                     /codon_start=1
                     /product="protein ICY2"
                     /protein_id="XP_022675469.1"
                     /db_xref="GeneID:34715614"
                     /translation="MDTEEVFACSLRDSSFCDTIDYTIVKPPLLSHTPDFSFDEEEHY
                     GLPQLDQTQTPLLYAVEPVPAFLDEDMFSLDQDQDQDRIDQQNQDLFTFPVWTKSRNG
                     GNDAHSSVLIQNSSKTDSSFSTVPQDNYRIWLQSF"
     gene            <746314..>746892
                     /locus_tag="KLMA_30339"
                     /db_xref="GeneID:34715615"
     mRNA            <746314..>746892
                     /locus_tag="KLMA_30339"
                     /product="ATP synthase subunit b"
                     /transcript_id="XM_022818844.1"
                     /db_xref="GeneID:34715615"
     CDS             746314..746892
                     /locus_tag="KLMA_30339"
                     /codon_start=1
                     /product="ATP synthase subunit b"
                     /protein_id="XP_022675470.1"
                     /db_xref="GeneID:34715615"
                     /translation="MPRLPKENTIRKHILDMSAVKELSVPLESNPRDFFKWFQNSDNI
                     GGFFFLCFALSLALLAFVTLLFGLYYFIFAPIPKTEPKRKSIWISIADYQDKLTPKQQ
                     ELYIEYACKQYEEEMMELRQRQREAMSGTMFPDPKPKPFLTRIKHLFNKPKVYPIKQL
                     HEESPNCYFATAETIDEVEKEANRAASPDQMV"
     gene            <747193..>749121
                     /gene="SWA2"
                     /locus_tag="KLMA_30340"
                     /db_xref="GeneID:34715616"
     mRNA            <747193..>749121
                     /gene="SWA2"
                     /locus_tag="KLMA_30340"
                     /product="auxilin-like clathrin uncoating factor SWA2"
                     /transcript_id="XM_022818845.1"
                     /db_xref="GeneID:34715616"
     CDS             747193..749121
                     /gene="SWA2"
                     /locus_tag="KLMA_30340"
                     /codon_start=1
                     /product="auxilin-like clathrin uncoating factor SWA2"
                     /protein_id="XP_022675471.1"
                     /db_xref="GeneID:34715616"
                     /translation="MTDPFADLLSSFKSGQTPSDSKPSSLKNASLNDLLSSRSAVNSP
                     APVPVTTTTTTTPPLQKMNDLSGDLFDDLLSKPITQNKKVESPLASASTKDDFDLVFE
                     SLNSPPPAVFVQNENEVEISERTPKQEEPVVDEVKDMEISKIMSLGISFEKSVRYYEK
                     GILYEQLLDRKLNHKTRSGSENLDSSYAFSSTSSHTSYGQTEETPAFLAMASKFFNKG
                     KDFIEDKIIAPLQHDDLEQRSPPQSHLRQSRHPNGNSLPKKTPLARSEFFGDNDATGI
                     HSIDQLSIQENKSTSAIRRSEPSPKPQNSPLPAGSGSEPQSKLENDTPVLLDFDAGPE
                     TQSSSQYHISEFELTSFNEFKNNGVKLFGSGDFHGAFSQFEKSLNTLPTEHPLRIISL
                     SNMISCQLKMGENSKALKTIDVAIEMIKKCPDLSTVIEQSSPPRTYKQMSEKIESKHA
                     EIYEHMENYDKALSIYTQLISEGVTDRKIMEGKRRCEKIVNPEKFKPKPPKTVTKPSI
                     NPSQVKSTSPSLNSDALHKIKEDGKKKAQEEEKRLELYDKVNEKIKKWSYQHEKDLRY
                     LLVHVDPLLKWTSWKPVSPEDVVLEKKVKLYYLKAIAKTHPDKIPSDTSLENIMVAEN
                     VYMTLNKAWEDFKSTNNV"
     gene            complement(<749185..>751380)
                     /gene="ERG7"
                     /locus_tag="KLMA_30341"
                     /db_xref="GeneID:34715617"
     mRNA            complement(<749185..>751380)
                     /gene="ERG7"
                     /locus_tag="KLMA_30341"
                     /product="lanosterol synthase"
                     /transcript_id="XM_022818846.1"
                     /db_xref="GeneID:34715617"
     CDS             complement(749185..751380)
                     /gene="ERG7"
                     /locus_tag="KLMA_30341"
                     /codon_start=1
                     /product="lanosterol synthase"
                     /protein_id="XP_022675472.1"
                     /db_xref="GeneID:34715617"
                     /translation="MLELYSEKIKLPRTDPTRWRLHTDELGRETWEYLSVEESKKIPQ
                     STFAQWLLQCEEFPEPQPQVNSKTSNFTAWNAAHNGAKFFELLQDPNSGIFPCQYKGP
                     MFMTIGYVVTMYLAKLEIPEHERIELIRYIANYAHPVDGGWGLHTTDKSTVLGTVLNY
                     VSLRLLGLPKDHEVCTRARDTLHRLGGAIGSPHWAKIWLSILNLYKWEGVNPAPPELW
                     MFPYSLPIHPARWWVHTRGIYLPVSYLSSTRYTCDLDPLLKEIRSEIYTKPFETINFA
                     EHRNTVCGVDLYYPHTKVLNTVNAMMTCYEKYIRPNWMLKKATKRVHELVKKEIANTD
                     YLCIAPVNMAFCAIVTLIEEGKDSTEFNSFLYRFKDVLFHGPQGLTVMGTNGVQVWDC
                     AFFVQYMFTAGLAELPEFHDSVSRSFKFLCRSQFTENCADGSFRDKRLGAWPFSTKTQ
                     GYTVSDCTAEAIKAIIMVLNSASFKDVHDYYDPKKLNNGIDVLLSLQNVSSFEYGSFS
                     TYEKIKATTLLEKLNPAEVFGNIMVEYPYVECTDSSVLGLTYFRKHFDYRKKDIDFAI
                     KEAIAYIKNVQNEDGSWYGCWGICYTYAGMFALEALYTVGENYENSEVVRKGCDFLVS
                     KQLPDGGWSETMKSSELHSYVSDKTSYVVQTAWAIIGLILAKYPNKHVIDRGIKLLKE
                     RQQPSGEWKFEAVEGVFNHSCAIEYPSYRFLFPIKALGLYVKEYKDNAI"
     gene            <751636..>752439
                     /gene="YFT2"
                     /locus_tag="KLMA_30342"
                     /db_xref="GeneID:34715618"
     mRNA            <751636..>752439
                     /gene="YFT2"
                     /locus_tag="KLMA_30342"
                     /product="FIT family protein YFT2"
                     /transcript_id="XM_022818847.1"
                     /db_xref="GeneID:34715618"
     CDS             751636..752439
                     /gene="YFT2"
                     /locus_tag="KLMA_30342"
                     /codon_start=1
                     /product="FIT family protein YFT2"
                     /protein_id="XP_022675473.1"
                     /db_xref="GeneID:34715618"
                     /translation="MQIMVPEDITLFRIRSYGNWWLYIYPFLVVFGYVSSAIIPNQEL
                     DRERKEWYWISGRNIINHTFAYEGRYFFDGCFLALFILQFYVKASYDESLLPTNNNNN
                     SQKNWREWSKKTIRVYLLKFLIVYVTLFACFLFIDHVFIWTGGSCDISDTKSAQKCKS
                     LGGVWSGGFDISGHFCFLTNISLILWQELKLLFNSSNQYYVYWTTFPRVVHWLILSIL
                     LIWINILSITAIYYHTFLEKVLGCLLGYSCLVLIYYTIPKVKTLNKILM"
     gene            complement(<752432..>753420)
                     /locus_tag="KLMA_30343"
                     /db_xref="GeneID:34715619"
     mRNA            complement(join(<752432..753288,753369..>753420))
                     /locus_tag="KLMA_30343"
                     /product="central kinetochore subunit MCM21"
                     /transcript_id="XM_022818848.1"
                     /db_xref="GeneID:34715619"
     CDS             complement(join(752432..753288,753369..753420))
                     /locus_tag="KLMA_30343"
                     /codon_start=1
                     /product="central kinetochore subunit MCM21"
                     /protein_id="XP_022675474.1"
                     /db_xref="GeneID:34715619"
                     /translation="MDAIESVQQDILALEREIQSIRSQLSDARNNKSNADEIKVPDLY
                     KEFLSEGINFSRLLIREDEHFTDKVVISPNKRIPNSKHYRNPDQSHSINSAVRSNFTG
                     VAAKENVAGFESINEFVRWENSVRLSGVSLFPVNYCDIEYMGIRLEVFSELDLRYKLP
                     LYIILKPSAKIVGAWELFKHSLPKYVQIYHYWEQCTDSTDTSNSNIMKFANLCYKDIL
                     NVHSRVEFFHKLDKASDDKTENQFSLLKIDEMGYHVSFRLGAAIVNIINNDRNEIVNC
                     AINDQLNMSFLGSIFDLPGKFDLVTT"
     gene            complement(<753620..>754750)
                     /locus_tag="KLMA_30344"
                     /db_xref="GeneID:34715620"
     mRNA            complement(<753620..>754750)
                     /locus_tag="KLMA_30344"
                     /product="protein HIM1"
                     /transcript_id="XM_022818849.1"
                     /db_xref="GeneID:34715620"
     CDS             complement(753620..754750)
                     /locus_tag="KLMA_30344"
                     /codon_start=1
                     /product="protein HIM1"
                     /protein_id="XP_022675475.1"
                     /db_xref="GeneID:34715620"
                     /translation="MSVFHTLLLGATGLTGSLVFQHFASLHSYLSWVDLANLKDDLEL
                     NHYVLVISRSSFDLRDTVKLAFDELQNSDLVEWHYSFFHDDDENDNQSVITYSTRLND
                     AVSVNINVLVSTIQEPDSTKWAEIIPKRLSTYDGLTNLSVISCLGSTSLGSKKSGVPR
                     EWVDKTLNFEILKAVTDNVSISKKVTQYIAVTSFNNPALSKLFPYFKAKQEFESDVKL
                     LLEKSETCNSAIILRPGPLIGKHGSTPVFVTPELDDHLLRSVLKYKKAILSHYATRIK
                     LWQDVGIATRASELVAQISYKVPGARLVGYPVKANDCAIVIASERIANALGKHSSHVK
                     FRIINSQEIDSYKAEFSNSGADSVQALPLSPAPVLVFNNLLS"
     gene            <759425..>760762
                     /locus_tag="KLMA_30345"
                     /db_xref="GeneID:34715621"
     mRNA            <759425..>760762
                     /locus_tag="KLMA_30345"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818850.1"
                     /db_xref="GeneID:34715621"
     CDS             759425..760762
                     /locus_tag="KLMA_30345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675476.1"
                     /db_xref="GeneID:34715621"
                     /translation="MTNKRIKIQDLLNNETVVEDAQPRLLHSAQTPLKPVPTSVASTY
                     NTSTATVYANEPSVTTTNDTPVNSLPGRYSFSSSTTLPPSTRLLSNTLPGSGPLLPLH
                     MHAASTSQSPQLPPFQLKTEGLTPGIGGFSPLMHVNHTNSPNMLPMASSPHPQNVRTP
                     LGGSPGVAKPPHHTERPLRQQQLMAVAMHEQDHQMIQSGSAPSVGSDNSSHRKLSPEL
                     VAAVSLSASNVSNFQYKINKPQGRPIIQSIIGKFTLYANIQDLILDITRFDRIRLRDV
                     FNESLGTFELIRYSKEDLQLHHHNQNSDSDSAAQEPSTPHSNASIQKNLVINEAHVYD
                     KLTQEFQCQYLKFIKIIRDKKGKLIRLESVIIPNTNEITIDFIKKKICYPRYKSNMKI
                     YLIKCDAPEEFQNKFIYIHDSQSLEDGKNLVNIDNLDKDLEQFKNLTIWCRNE"
     gene            complement(<761174..>761482)
                     /gene="CWC21"
                     /locus_tag="KLMA_30346"
                     /db_xref="GeneID:34715622"
     mRNA            complement(<761174..>761482)
                     /gene="CWC21"
                     /locus_tag="KLMA_30346"
                     /product="pre-mRNA-splicing factor CWC21"
                     /transcript_id="XM_022818852.1"
                     /db_xref="GeneID:34715622"
     CDS             complement(761174..761482)
                     /gene="CWC21"
                     /locus_tag="KLMA_30346"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CWC21"
                     /protein_id="XP_022675477.1"
                     /db_xref="GeneID:34715622"
                     /translation="MSYNGIGLSSAKGSSTSGYVQQSLAFNAKRQNTKTEPKKADTHE
                     QRTFVQDESIISHKARREIEVLVSEYRDTLEDDPAELSDDTIEKKCEEYRNSLLTRKG
                     "
     gene            complement(<761825..>762457)
                     /locus_tag="KLMA_30347"
                     /db_xref="GeneID:34715623"
     mRNA            complement(<761825..>762457)
                     /locus_tag="KLMA_30347"
                     /product="ornithine decarboxylase antizyme"
                     /transcript_id="XM_022818853.1"
                     /db_xref="GeneID:34715623"
     CDS             complement(761825..762457)
                     /locus_tag="KLMA_30347"
                     /codon_start=1
                     /product="ornithine decarboxylase antizyme"
                     /protein_id="XP_022675478.1"
                     /db_xref="GeneID:34715623"
                     /translation="MKKYYLQSFTTSKIENGLTLPIGWRSTGLSTFNLEQYWDILILF
                     ESKFYQYKPQDYKLWTAFLIKRVGSTLKQLVHGSSVESKLYDIGSVYFTILDPTFQLF
                     GKILHTSDMGKIASILFHNVSTTAFSQDLRNLMLKIWEFLDQDHFQCDIMIFYIPNKI
                     EDHDFVSSLLRNLSWLNGSLRKPLGTRTPDPSFNSIHWSDDQYVVLEFQV"
     gene            <765154..>766083
                     /gene="AQY1"
                     /locus_tag="KLMA_30348"
                     /db_xref="GeneID:34715624"
     mRNA            <765154..>766083
                     /gene="AQY1"
                     /locus_tag="KLMA_30348"
                     /product="aquaporin-2"
                     /transcript_id="XM_022818854.1"
                     /db_xref="GeneID:34715624"
     CDS             765154..766083
                     /gene="AQY1"
                     /locus_tag="KLMA_30348"
                     /codon_start=1
                     /product="aquaporin-2"
                     /protein_id="XP_022675479.1"
                     /db_xref="GeneID:34715624"
                     /translation="MSSEEIQQPVVNRDLEEQRPVADDVSRQPETEYIPPYEPKYNQL
                     GFKNETYRNHLVAAIGEFCGTFIFLWSAFVIAQIANSDLDVKRTGGSHPGQLIMIAFG
                     FGFSVMFAVFIFFRVSGGNLNPAVTLTLMLTNVIPWPRALVMWLAQMVAGMAAAGAAS
                     AMTPGPILFANGLGGGCSKSRGLFLEAFGTAILCSTVMFMAVEKHRATPMAPFAIGIA
                     LFVGHLICVYYTGAGLNPARSFGPCIAKRSFPVYHWIYWVGPIIGAFMSALLWKLLKV
                     LRYETCNPGQDDIAEAKAREYVEAHSHTHYVEN"
     gene            <767228..>768601
                     /gene="MNT2"
                     /locus_tag="KLMA_30349"
                     /db_xref="GeneID:34715625"
     mRNA            <767228..>768601
                     /gene="MNT2"
                     /locus_tag="KLMA_30349"
                     /product="probable mannosyltransferase MNT2"
                     /transcript_id="XM_022818855.1"
                     /db_xref="GeneID:34715625"
     CDS             767228..768601
                     /gene="MNT2"
                     /locus_tag="KLMA_30349"
                     /codon_start=1
                     /product="probable mannosyltransferase MNT2"
                     /protein_id="XP_022675480.1"
                     /db_xref="GeneID:34715625"
                     /translation="MSVLNGDILRRRWIINGLLVVAVWFIIRNSLQYGTNVDTNVPTS
                     ELLSDSAAKPTPVPGFDSTVQPKPEDPKQEEPKKEEYGQKEDTHDTFSWPGVSKPPAL
                     NLDRPNDKPKNKNVYPFNITGAGAAFETVVQGKKDKPKACFVSLVRNSEIWELTKSIA
                     SVQDKFNGKFDYPWVFLNDEPFTEEFKKHILAVVPNSKFGLIPKEHWSYPDYISQERA
                     AKARVDMKDIIYGDSESYRHMCRFQSGFFFQHPLLAEYDWYWRVEPSTELYCTIDYDV
                     FQFMQDNDITLGFTITIHEYRATIETLWETTKKFLEENPGYVHKDNLLGFISDDGGNE
                     YNLCHFWSNFEVANLNFYRSKAYLDYFNYLDKSGGFFYERWGDAPIHSIAASIMLSRD
                     RIHYFNDIGYHHPPYSNCPFVDDIRSKGKCTCDPEIDFTFRGYACGKEYFNSQGFRRP
                     ENWEKYT"
     gene            <769070..>770182
                     /gene="CNS1"
                     /locus_tag="KLMA_30350"
                     /db_xref="GeneID:34715626"
     mRNA            <769070..>770182
                     /gene="CNS1"
                     /locus_tag="KLMA_30350"
                     /product="hsp70/Hsp90 co-chaperone CNS1"
                     /transcript_id="XM_022818856.1"
                     /db_xref="GeneID:34715626"
     CDS             769070..770182
                     /gene="CNS1"
                     /locus_tag="KLMA_30350"
                     /codon_start=1
                     /product="hsp70/Hsp90 co-chaperone CNS1"
                     /protein_id="XP_022675481.1"
                     /db_xref="GeneID:34715626"
                     /translation="MENPKKYVPGPNDPLLPPQLSEFRNKTTDEVLEELNKMPFFMNK
                     LDPDENNVELEALKAMAYEGEPDEIATNFKNQGNDLFKAKRYKDARAMYLKGLEIKCD
                     VPSINESLYLNLAACELEIKNYRSCVNYCREALKLDAKNIKAFFRIGRAYLEIGKLKE
                     SLEAVEVGLAIDPENVALNSIRKRINEKLQRQREAEERTLAQKQKEKELQEFLDLAIK
                     IRNISLIDTKQPAELLQDAKLQLENPVDFESQLVFPAMVLYPTTDEFDFIASVSELST
                     PNDLLDLVLDRPAEWFAQPGHKDFSSNKLQAYMETLSGGLIKVGKKVTFHDVLKMEKP
                     VVPLFDKALRIYFVPKSEAQDWLSKWDKNAAVMKRL"
     gene            complement(<770303..>772558)
                     /locus_tag="KLMA_30351"
                     /db_xref="GeneID:34715627"
     mRNA            complement(<770303..>772558)
                     /locus_tag="KLMA_30351"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818857.1"
                     /db_xref="GeneID:34715627"
     CDS             complement(770303..772558)
                     /locus_tag="KLMA_30351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675482.1"
                     /db_xref="GeneID:34715627"
                     /translation="MDWALEAAKKKFKNQAGGSRSIVESLNDFNGVILKGHKEAEDIF
                     YRSNDWINMEMEALGFPRGDGTKVAPVSPEKSLMNDDEAREESDAIDQDETAKKMDIS
                     YNRSEYSLSTKSKTQGEQHGKERQHKQEQERKQEQERKEERKEEQEQEQAQKEDLQRD
                     RETQNQKREGPVLNHSQEEKQLETHEYDAVVSGEPNIRYVTDEHTGDSKGPQQTDLQD
                     NNNTNFNQRLYVQPAITPKSLLGDDTGRLQVNSSSIKKSTESSLAKSSPWQVQRDNKD
                     STSTGEIKLAVTKDTWILDQDIDQNNLASDLALDEKIHRDSITKSIRDRSQRRSNMFV
                     PLPSKDPLIVQPTPNHNRKRTYVSGTLQHNQFKKQETAAAAHIPPSSAQLKSKSPRYE
                     GNVFERLSNNLTESFERKAAERRAISPIRNKRNTTSPNRSQRPGASIHGSPTSRKNAS
                     STSHTDKIHHTLKNIFDSRIPQLPKKNTTVQPLKRRVSNLIDRSKVQERKSLIPRIQK
                     VTPVKRINGTTVTETSENNHIKIGGSIDAMQSVSRAKASVPAQKSTLISPNSLEQKIN
                     AHDRLTKFQLIPNSTNSKQEKDVLKQKLNKRLSEVMRNQQEQQMKKKFEMQQRRISQA
                     DEESKRRTKILLDHNNSTLPTLSKTTNTNSVLYDINTVDYREMIGLPPKGEESNGDVT
                     LPEIASDDEGDNAETGRTLMSWAEATKLKQQLLSQQDWDIEKVLGPIPVLHIDEVFQT
                     NTSRLQKLKKR"
     gene            <773096..>775579
                     /gene="SSY1"
                     /locus_tag="KLMA_30352"
                     /db_xref="GeneID:34715628"
     mRNA            <773096..>775579
                     /gene="SSY1"
                     /locus_tag="KLMA_30352"
                     /product="SPS-sensor component SSY1"
                     /transcript_id="XM_022818858.1"
                     /db_xref="GeneID:34715628"
     CDS             773096..775579
                     /gene="SSY1"
                     /locus_tag="KLMA_30352"
                     /codon_start=1
                     /product="SPS-sensor component SSY1"
                     /protein_id="XP_022675483.1"
                     /db_xref="GeneID:34715628"
                     /translation="MINKAAPGFFPEIRYELSDYNDVRHDDDPNCSIDTKLFDQMCQK
                     IPSDIESSLQSDRFCLSRIYLAGNTSALSALNSTDFGQFKKNSDREYVLRNKLKEYLA
                     NSSESGIPLPQFNHLDTVLTRGYDVVRTQNRRWRNTITDLFNRKKRAGSRSSRYEFGV
                     PQLDSLISTEIIDNVGPEVDFIDFKYEKNGITQIQEVATSSYNDDFTDDGYNNSNDKN
                     NNNSDNSNGNNININKGKNRNATRRRTQRNVTLQRKLKIRHLQMISLGATIGVGLFLN
                     SGRAFSIAGPMGAFLGFLYGAFVILATLFSFAEILAFIPMISGISGLCSRFVSDSFGF
                     TVGWCHWLSYAVAFPSELIASAMMISYYKPFEKVATDNSHMAATITILIVVLTGINLL
                     DVRIYGELEYIMSAFKLLVVVSLIILVIILNCGGFKNTSYIGFKFWTKNESPSPDITF
                     GPFRPTYDLEDYGSGSRRGIGGFGGVILSCITCSVSSIFSYIGSEIGFIAAPEAQNPR
                     KTVPSVTKRIFVRVVLFYLLSIFIVGTVIYAGDPRLLRILSDDRKSSDNSIESYMDVI
                     NKLGGMNCNSHFSNDNFFNESSNQSPWVIAFKSVKQCELANIINGVFVCIGISAASSQ
                     LYASSRTLYSMASQNKAPIVFTYCFKNGVPYTAVLFCGALGFLSLLCLDLRSTEALLL
                     FVSIGSTGSVIMWLGMNLSFLRFYLALKRRPDIIDRNSKEYPYKSPFQPYLCIFGIVS
                     TTLLLLMSGIQNFFVWKTSNFISSYMIIVIFVVLYVGYSIVRNSSIHHLEQIDLDSGR
                     REMDRVLWIEDANYTLNVREVFHEIFSYV"
     gene            complement(<775792..>777231)
                     /locus_tag="KLMA_30353"
                     /db_xref="GeneID:34715629"
     mRNA            complement(<775792..>777231)
                     /locus_tag="KLMA_30353"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818859.1"
                     /db_xref="GeneID:34715629"
     CDS             complement(775792..777231)
                     /locus_tag="KLMA_30353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675484.1"
                     /db_xref="GeneID:34715629"
                     /translation="MHSNMAQVANNSRASYYLSSTDYDFDFTNRYENSTGDSSMGDSN
                     TSPLSAKNYTRKSHTRSSSSQSSSSHGSGDYILRSPIQLENNPVAIRMRNFSFPNFDV
                     NSEIDPLADSESKRQCAPPGKDLLSKYHHRAMNSGQSSLGPGNSYPSSEESSPRRSAN
                     SRTCSSLSSFSVDAPILKGCAELSANPLQEHVHFENESENLFNQLRSYRIGSQVDSHS
                     NSDKESHYDEADLQGLRSAFLRSSRKSSLENPGRQLQEFKKRQSLSRMSTSSIVTPQM
                     SPQMSPRGTFHKRASAISDSQHTLLFDNSTFRLRKNSTSESEFSACSGELPKLFKIET
                     TGYCNTYKKHSTVPSPKLTIENTKEQIRRNSNGHFENFHQFAKLNGIERRGSVFACLP
                     ETGDSVTDPKINLDFVTTFKMERPPRYRKYKTYFEKRLASTISEEGSSSQPSSDSSSS
                     SSCYLYKEKNSNKDKDDEMLTLIDFLKTD"
     gene            complement(<779948..>781408)
                     /gene="LEE1"
                     /locus_tag="KLMA_30354"
                     /db_xref="GeneID:34715630"
     mRNA            complement(<779948..>781408)
                     /gene="LEE1"
                     /locus_tag="KLMA_30354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818860.1"
                     /db_xref="GeneID:34715630"
     CDS             complement(779948..781408)
                     /gene="LEE1"
                     /locus_tag="KLMA_30354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675485.1"
                     /db_xref="GeneID:34715630"
                     /translation="MKKHSRPGSRTRHDFNRSRHSHSHSSSAGNNSSNINNSGMNSNG
                     ENDKYDGSSSVVEHGSPEQGFSSQQQKAIIEHLLITKNSAPKKDYSHVPCKFFVQGNC
                     QAGDSCPFSHDLNSAVSEQTCKYFQKGNCKFGMKCANAHVLPNGTRLNPRRSSLPNAA
                     NSNSSSNPNSNPNSNSNGISNSISNKHHNSGNIVAGSARAEHMSGPGLAPALPAYRTT
                     FTTISKQQQQQQQQQQQQQQQQQQQFSTPITNSSSSFMWTSEQTSPINYSNLVSNEVM
                     QNSEFIGNNTYAMEGPNTPQMFTYSYEAPSSAQSNTYAYPTRYSEYTSPNSHYGPTEL
                     QLEETLLPNELSDLLTPNENRRRESFNKASTMTTKPLSAPNSFSSSSASEPRLSYSSS
                     SSSSDFAWRNLTSSNQNIEYWQNLEQLENNLNRFKIEEQDEDKLNANTYHLSHESASP
                     HQANMVPNSQGFPAHARSNASGDTQFMFDDLHGGIY"
     gene            <783516..>784805
                     /gene="AMN1"
                     /locus_tag="KLMA_30355"
                     /db_xref="GeneID:34715631"
     mRNA            <783516..>784805
                     /gene="AMN1"
                     /locus_tag="KLMA_30355"
                     /product="antagonist of mitotic exit network protein 1"
                     /transcript_id="XM_022818861.1"
                     /db_xref="GeneID:34715631"
     CDS             783516..784805
                     /gene="AMN1"
                     /locus_tag="KLMA_30355"
                     /codon_start=1
                     /product="antagonist of mitotic exit network protein 1"
                     /protein_id="XP_022675486.1"
                     /db_xref="GeneID:34715631"
                     /translation="MSCGTSVNTKRTRYEDFNPIEDGDNCESPLKKCSKRFQKWSLSI
                     ATPQSSPVKTFALKRKSKSLDEELIIGSPVKFGCDTNVLNAEFQGLTLENSLSVSEAS
                     SNHANLTSPVFCIPELLHRIFKLLNPESLYNCSKVNPLWAAVASRIINQDLVIQPHSI
                     SGDLRIVEQDNMVHPQSLTFYKLKQQKLFIDTQFPHINFSRLNSLNFYISPVIPMVFD
                     KLVVPNNVTKLTIAGDKRISDIELITLIKGLPNLIELDLRACSQISDVSIVSIVTHCP
                     KLQSINLGRHDNPHLITDLTVMALCELENLTTVGLSGCTNISDVSIWQLYNKHSTTLV
                     RLSINGCKQITDNSIVDIVTKNGFPNLSVLDIRNCSLIRFKRLIEYRLWRYEVAEKPI
                     HIHISDSMQQEFELQERQLYKEFRARIRNDLNKWVNE"
     gene            <785116..>785832
                     /gene="LGE1"
                     /locus_tag="KLMA_30356"
                     /db_xref="GeneID:34715632"
     mRNA            <785116..>785832
                     /gene="LGE1"
                     /locus_tag="KLMA_30356"
                     /product="transcriptional regulatory protein LGE1"
                     /transcript_id="XM_022818863.1"
                     /db_xref="GeneID:34715632"
     CDS             785116..785832
                     /gene="LGE1"
                     /locus_tag="KLMA_30356"
                     /codon_start=1
                     /product="transcriptional regulatory protein LGE1"
                     /protein_id="XP_022675487.1"
                     /db_xref="GeneID:34715632"
                     /translation="MSEHSDRGSSYRSGGSYGGGYGGYNHSGYRYQQNGSSGNHRGGP
                     RYRSNYRQDGYYNNQDYNQQEGYGYTQPQSQPQSQPHNHNHNHNHHPPSHNAHGAHRQ
                     SYWRGSYHPYRHNDNRYNANHNYRRSPPSQQDMRTPTPTSATHQNSPYTGAEEFNKKF
                     VIPKDESPFLYMIHSAGSRTTKLKEIYKENDEIDNKIEELKIKLFRDELELGLMSTQC
                     EKDALNVQLTQEKLDSLLMN"
     gene            <786120..>787160
                     /locus_tag="KLMA_30357"
                     /db_xref="GeneID:34715633"
     mRNA            <786120..>787160
                     /locus_tag="KLMA_30357"
                     /product="3-ketoacyl-CoA reductase"
                     /transcript_id="XM_022818864.1"
                     /db_xref="GeneID:34715633"
     CDS             786120..787160
                     /locus_tag="KLMA_30357"
                     /codon_start=1
                     /product="3-ketoacyl-CoA reductase"
                     /protein_id="XP_022675488.1"
                     /db_xref="GeneID:34715633"
                     /translation="MTTLVEQLYNIDKLRECKYLNAAAWVVFTFGVSKVLFLSLNFAK
                     MLLDLFVIPGPNFKKYGKGKGAYAVVTGASDGIGKEYAKQLGKRGFNLILISRTESKL
                     VALKQEIENECKIDVKTLAIDVSADTKENYALIREVCSGLPVTVLINNVGKSHSIPVP
                     FDETEESELRDIITINNTATLMITQTLLPQLKASVKTLKCRGLILTMGSFGGLLPTPF
                     LATYSGSKAFLQSWSNALAGELSRDSIDVELVLSYLVTSAMSKIRRSSALIPNPKNFV
                     KSALNSIGKRGGAQERYATTTPYWSHAFYHFIIVNTVGVYSKIANSINYSFHLSIRKR
                     ALKKAARQAKKE"
     gene            <787824..>788711
                     /gene="CDC28"
                     /locus_tag="KLMA_30358"
                     /db_xref="GeneID:34715634"
     mRNA            <787824..>788711
                     /gene="CDC28"
                     /locus_tag="KLMA_30358"
                     /product="cell division control protein 28"
                     /transcript_id="XM_022818865.1"
                     /db_xref="GeneID:34715634"
     CDS             787824..788711
                     /gene="CDC28"
                     /locus_tag="KLMA_30358"
                     /codon_start=1
                     /product="cell division control protein 28"
                     /protein_id="XP_022675489.1"
                     /db_xref="GeneID:34715634"
                     /translation="MSELTNYKRLEKVGEGTYGVVYKAVDLRHQNRIVAMKKIRLESE
                     DEGVPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESVPKD
                     QPLGSNIIKKFMMQLCKGIAYCHAHRIIHRDLKPQNLLINRDGNLKLGDFGLARAFGV
                     PLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDVWSIGCIFAEMCNRKPLFSGDSEIDQI
                     FKIFRVLGTPNERTWPDIVYLPDFKTTFPKWNRRDLSEVIPSLDANGIDLLDKLITYD
                     PIHRISAKRAVQHPYFKDE"
     gene            <792182..>793255
                     /gene="SUR1"
                     /locus_tag="KLMA_30359"
                     /db_xref="GeneID:34715635"
     mRNA            <792182..>793255
                     /gene="SUR1"
                     /locus_tag="KLMA_30359"
                     /product="mannosyl phosphorylinositol ceramide synthase
                     SUR1"
                     /transcript_id="XM_022818866.1"
                     /db_xref="GeneID:34715635"
     CDS             792182..793255
                     /gene="SUR1"
                     /locus_tag="KLMA_30359"
                     /codon_start=1
                     /product="mannosyl phosphorylinositol ceramide synthase
                     SUR1"
                     /protein_id="XP_022675490.1"
                     /db_xref="GeneID:34715635"
                     /translation="MRKELWYMVYSHLVILVFLLYMTFDLLTLVVDNTFSDALTSTDL
                     NPPETAEPRAQLIPKIIHQTYKTEDIPAHWKDGQRKCIDLHPDYNYILWTDQKSRQFI
                     QEEYPWFLETFDGYKYPIQRADAIRYFVLSHFGGIYIDLDDGCERRLDPLLTVPAFVR
                     KTTPTGVSNDVMGSVPRHPFFLKVLESLQRYDNNWLIPYLTIMLSTGPLFVSLIWKQY
                     KRWGVPENGVVRIMLPSDYKMHETSFFAISEGSSWHLNDAHFIKALANYIPLCVVLGF
                     ALAFFIMYLEYRVLCWLVTGGAWSRFCNNVLYTLGLSRSRTGNDSMELAQFRRLRKDS
                     NLPINICIPDLEKQDPKFTDLSQ"
     gene            complement(<794190..>795578)
                     /gene="TOS1"
                     /locus_tag="KLMA_30360"
                     /db_xref="GeneID:34715636"
     mRNA            complement(<794190..>795578)
                     /gene="TOS1"
                     /locus_tag="KLMA_30360"
                     /product="protein TOS1"
                     /transcript_id="XM_022818867.1"
                     /db_xref="GeneID:34715636"
     CDS             complement(794190..795578)
                     /gene="TOS1"
                     /locus_tag="KLMA_30360"
                     /codon_start=1
                     /product="protein TOS1"
                     /protein_id="XP_022675491.1"
                     /db_xref="GeneID:34715636"
                     /translation="MKFSTVANTALLATFAHAGCENVGGNYYCSSTDAVVYSNVGYSG
                     SYQDVTSMDESSCACAQSSVSFEGNMAPLDEELSVHFRGPIKLLQFGVYYPGSSVSLN
                     KRDAVEADNEESASCTTTARKHHEHKREAAVQWVEVTSTVVVGGNGEPISESLTPIAE
                     PTNNYEGTTTLAPSSAAGSPAGSSSSSSSSSSAAAASSSSSSSGSGSSSGSGSSSNSA
                     SAWNRVSYFTPGSAQNLTFMNHQGGTKGSGTWSACFGNSISYCDSDGVTGAASPVALG
                     EVTVPSDKEFMIFSGSKCGDSSANGDCGYYREGIPAYHGFGGNTKMFVFEFSMPSDNS
                     GGYNADMPAVWLLNAKIPRTLQYGDATCSCWKTGCGEFDLFEILSTGSDKLITHIHDG
                     QGNDGTSTGGGGTQDYFQRPTSGTLKAAVIFNGSDKTIHIVEVDDSFDSTISADTVNS
                     WFSKGGSSAPLS"
     gene            <797337..>797531
                     /locus_tag="KLMA_30361"
                     /db_xref="GeneID:34715637"
     mRNA            <797337..>797531
                     /locus_tag="KLMA_30361"
                     /product="protein YSY6"
                     /transcript_id="XM_022818868.1"
                     /db_xref="GeneID:34715637"
     CDS             797337..797531
                     /locus_tag="KLMA_30361"
                     /codon_start=1
                     /product="protein YSY6"
                     /protein_id="XP_022675492.1"
                     /db_xref="GeneID:34715637"
                     /translation="MAIQTPRQRLANEKWAKKNEKKLGKPKVKAKDQASKLPISKPWV
                     IGLLFLLIGGGVLQLISLLL"
     gene            <799069..>803625
                     /gene="PDR12"
                     /locus_tag="KLMA_30362"
                     /db_xref="GeneID:34715638"
     mRNA            <799069..>803625
                     /gene="PDR12"
                     /locus_tag="KLMA_30362"
                     /product="ATP-dependent permease PDR12"
                     /transcript_id="XM_022818869.1"
                     /db_xref="GeneID:34715638"
     CDS             799069..803625
                     /gene="PDR12"
                     /locus_tag="KLMA_30362"
                     /codon_start=1
                     /product="ATP-dependent permease PDR12"
                     /protein_id="XP_022675493.1"
                     /db_xref="GeneID:34715638"
                     /translation="MSHSSISEGKTNEDGRNSIHSSDSYAHSVASFHLRDDESQNITV
                     QLSNQISHVLSNEVGQEKIESLARVISTKTKKQMESFEVNQLDFDLKALLNYLRSSQL
                     EQGIEPGDSGIAFHDLTAVGIDASAAFGPSVEEMLRSWMHFPNKLWRKMTRQKSETPL
                     RNIIQHCTGVVESGEMLFVVGRPGAGCSTLLKCLSGETSELVEVTGDISYDGLTQEEM
                     MQKFKGYVIYCPELDFHFPKITVKETIDFALKCKTPRSRIDHLSRAQYVDNMRDLWCT
                     VFGLTHTYATKVGNDVVRGVSGGERKRVSLVEALAMNASIYSWDNATRGLDASTALEF
                     AQAIRTATNMMNNSAIVAIYQAGENIYQLFDKTTVLYNGKQVYFGPADEAVGYFERMG
                     YIKPNRMTSAEFLTSATVDFENRTLEVREGYEEKIPKSSTEMEAYWHNSPEYAKITQY
                     FNEYCQSHPEEETRQRLETAKKQRLQKGQREKSQFVVTFWAQVWYCMIRGFQRVKGDS
                     TYTKVYLSSFLIKGLIVGSMFHKIDPKEQSTTEGAYSRGGLLFYVLLFAAVTSLAEIS
                     NSFHNRAIVVKHKTYSMYHTSAESLQEIFTEIPTKFVAILILALVSYWIPVLKYDAGS
                     FFQYFLYLFTTQQCTSFTFKLVATLTKDGGTAHAIGGLWVLMLSVYAGFVLPIGNMHH
                     WIRWFHYLNPLTYAYESLMSTEFHGRKMLCSRLLPSGPGYENVSIAHKICDAAGAVAG
                     QLYVSGDAYVLKKYHFRYKHAWRDWGINIVWTFGYIVMNVVMSEYLKPLEGGGDLLLY
                     KRGHMPELGSESVDSKVASREEMMESLNGPGVDLEKVIASKDVFTWNHLNYTIPYDGA
                     TRQLLSDVFGYVKPGKMTALMGESGAGKTTLLNVLAQRINVGVITGDMLVNAKPLPPS
                     FNRSCGYVAQADNHMGELSVRESLRFAAELRQPKSVPLQEKYDYVEKIISLLGMEKYA
                     EAIIGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRALA
                     DSGQSILCTIHQPSATLFEQFDRLLLLKKGGKMVYFGDIGENSSTLLNYFERQSGVKC
                     GKSENPAEYMLNCIGAGATASADADWHDLWLQSPECAAAREEVEELHRTLASRPVTDD
                     KELAGRYAASYLTQMKCVFRRTNIQFWRSPVYIRAKFLECVLCALFVGLSYVGVDHSI
                     AGASQSFASIFMMLLIALAMINQLHVFALDSRELYEVRESASNTFHWSALLICHCVVE
                     IMWSTLCEFLCWICYYWPAQYTGRASHAGYFFLIYVIMFPAYFVSYGCWVFYMSPDVP
                     SASMINSNLFAGMLLFCGILQPRDKMPGFWKKFMYNVSPLTYIVQSLVTPLVQGKKVR
                     CTKNEFAVVNPPEGQTCGQYFTTFIKDNTGYLKNPDDTESCHYCPYSYQQEVVEQYNV
                     RWTYRWRNFGFLWAYIGFNFFAMLACYWVLRVKNYSLTSIFGVFKIGHWKNVTSKPKP
                     RHEKDHTIFEEKAGDAANVKKNGA"
     gene            <805193..>809746
                     /gene="PDR12"
                     /locus_tag="KLMA_30363"
                     /db_xref="GeneID:34715639"
     mRNA            <805193..>809746
                     /gene="PDR12"
                     /locus_tag="KLMA_30363"
                     /product="ATP-dependent permease PDR12"
                     /transcript_id="XM_022818870.1"
                     /db_xref="GeneID:34715639"
     CDS             805193..809746
                     /gene="PDR12"
                     /locus_tag="KLMA_30363"
                     /codon_start=1
                     /product="ATP-dependent permease PDR12"
                     /protein_id="XP_022675494.1"
                     /db_xref="GeneID:34715639"
                     /translation="MSNSSSSEGKTNEDGRNSVHSSDSFAQSVASFHLDDNESQNVTA
                     QLSQQITNVLSNSNGAERIESLARVISTKTKKQMESFEVNQLDFDLKALLNYLRSSQL
                     EQGIEPGDSGIAFHDLTAVGIDASAAFGPSVEEMVRSWIHFPVRLWKKICRQKSETPL
                     RNIIQHCTGVVESGEMLFVVGRPGAGCSTLLKCLSGETGELVEVTGDISYDGLSQEEM
                     MQKFKGYVIYCPELDFHFPKITVKETIDFALKCKTPRSRIDHLTRAQYVDNMRDLWCT
                     VFGLTHTYATNVGNDVVRGVSGGERKRVSLVEALAMNASIYSWDNATRGLDASTALEF
                     AQAIRTATNMMNNSAIVAIYQAGENIYQLFDKTTVLYNGKQVYFGPADEAVGYFERMG
                     YIKPNRMTSAEFLTSATVDFENRTLEVREGYEEKIPKSSTEMEAYWHNSPEYAKATEL
                     FNEYCQSHPEEETRQRLETAKKQRLQKGQREKSQFVVTFWAQVWYCMIRGFQRVKGDS
                     TYTKVYLSSFLTKGLIVGSMFHKIDPKSQSTTEGAYSRGGLLFYVLLFAALTSLAEIS
                     NSFQNRAIIVKQKTYSMYHTSAESLQEIFTEIPTKFVAILTLSLVSYWIPVLKYDAGS
                     FFQYLLYLFTTQQCTSFIFKLVATLTKDGGTAHAIGGLWVLMLTVYAGFVLPIGNMHH
                     WIRWFHYLNPLTYAYESLMSTEFHGRKMLCSRLLPSGPGYENVSIAHKICDAAGAVAG
                     QLYVSGDAYVLKKYHFRYKHAWRDWGINIVWTFGYIVMNVVMSEYLKPLEGGGDLLLY
                     KRGHMPELGSESVDSKVASREEMMESLNGPGVDLEKVIASKDVFTWNHLNYTIPYDGA
                     TRQLLSDVFGYVKPGKMTALMGESGAGKTTLLNVLAQRINVGVITGDMLVNAKPLPPS
                     FNRSCGYVAQADNHMGELSVRESLRFAAELRQPKSVPLQEKYDYVEKIISLLGMEKYA
                     EAIIGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRALA
                     DSGQSILCTIHQPSATLFEQFDRLLLLKKGGKMVYFGDIGENSSTLLNYFERQSGVKC
                     GKSENPAEYMLNCIGAGATASADADWHDLWLQSPECAAAREEVEELHRTLASRPVTDD
                     KELAGRYAASYLTQMKCVFRRTNIQFWRSPVYIRAKFLECVLCALFVGLSYVGVDHSI
                     AGASQSFSSIFMMLLIALAMVNQLHVFALDSRELYEVREAASNTFHWSVLLLNHTFVE
                     IIWSTLCEFICWICYYWPAQYSGRASHAGYFFLIYVIMFPAYFVSYGCWVFYMSPDVP
                     SASMINSNLFAGMLLFCGILQPKDKMPGFWKRFMYNVSPFTYVVQSLVTPLVQGKKVR
                     CTKNEFAVVNPPEGQTCSQYFARFIKDNTGYLKNPNDTESCHYCPYSYQQEVVEQYNV
                     RWVYRWRNFGFLWAYIGFNFFAMLACYWVLRVKNYSITSIFGVFKIGNWKKAIHHDSR
                     HEKDHTIFQEKPGDAANVQKTKA"
     gene            <810074..>811705
                     /gene="EXO5"
                     /locus_tag="KLMA_30364"
                     /db_xref="GeneID:34715640"
     mRNA            <810074..>811705
                     /gene="EXO5"
                     /locus_tag="KLMA_30364"
                     /product="defects in morphology protein 1"
                     /transcript_id="XM_022818871.1"
                     /db_xref="GeneID:34715640"
     CDS             810074..811705
                     /gene="EXO5"
                     /locus_tag="KLMA_30364"
                     /codon_start=1
                     /product="defects in morphology protein 1"
                     /protein_id="XP_022675495.1"
                     /db_xref="GeneID:34715640"
                     /translation="MTILRLFRLYSVKRNTHLIATNLEPIKFNQDDKDAIQSILKLVP
                     LNRETVKNNVVRSKSNREYIDRKISTVKSLFPSEPGSELLSMKPPDHLKNPFFDVYSK
                     STYDADGKVLVEGTDRLSVTKLLTKRWCELNQMYDIYSRKPIFEHIQLKIGKQEHEKL
                     ETAIHGIAPDVKVFMDTYEWELANDELHELADAWFQCINRLLTLFSNGEAREILCHGY
                     LDSRTCKLIDGCAKDDKDILVSGVIDHIILFHVDSGKPKSLDPNLRESNNNDMYEILE
                     SLTKTVQRTTDLQIAVSDVKTRPTATVPRYASVVNASKLQVMYYRNFLETLGKDSKVT
                     FDRLLINAERRGISVDEPINISNLIYFMEIDPSIRPDLEKIMNGEAIGFEPYDDSYLY
                     TTENASNETSIYDLSQYSDLTIDETTLQRYGVFYQKWARPPTLRYLAARLAQLYQLVA
                     QLLSDRLMIEYYKGSYNFHTERFKYDPEFLNQQCYNSARFWFGKRPVEPIPPTNHNLA
                     THCKYCDYHDVCSWRANGINSFKQLGNDLQEISKV"
     gene            <812245..>813276
                     /locus_tag="KLMA_30365"
                     /db_xref="GeneID:34715641"
     mRNA            <812245..>813276
                     /locus_tag="KLMA_30365"
                     /product="putative pyridoxal reductase"
                     /transcript_id="XM_022818872.1"
                     /db_xref="GeneID:34715641"
     CDS             812245..813276
                     /locus_tag="KLMA_30365"
                     /codon_start=1
                     /product="putative pyridoxal reductase"
                     /protein_id="XP_022675496.1"
                     /db_xref="GeneID:34715641"
                     /translation="MPSPSDYRKELLDVEVGYGLMSLTWRKDPLPAEKVFPTMKKVVE
                     KAGNKKALFNVGEFYGPHLANYKLLQSFFDKYPEDRKKVIISAKGGVNVETLQPTGDA
                     DSISASIENALKVFGGYLDIYEPARIDLALAEKNGEKLFPRETFDTIVKYIKDGKVGG
                     FSLSEVTNEQIRAIYKEYGEYLACVEVELSIASPEIISNGILDTCNEFGIPVVAYAPL
                     GRGLLTGSLKSTADIPEGDFRGQLKRFQDDAIAHNLTLVKFLQDEIAAKRSDNPSLPQ
                     VAIGWVRGLRREYPKTNIIPIPSGSSVEKVSVNFDHIDLSDDEMSKIKDFLKSFKIAG
                     DRYEFAQAH"
     gene            complement(<814459..>814899)
                     /gene="GRX5"
                     /locus_tag="KLMA_30366"
                     /db_xref="GeneID:34715642"
     mRNA            complement(<814459..>814899)
                     /gene="GRX5"
                     /locus_tag="KLMA_30366"
                     /product="monothiol glutaredoxin-5"
                     /transcript_id="XM_022818874.1"
                     /db_xref="GeneID:34715642"
     CDS             complement(814459..814899)
                     /gene="GRX5"
                     /locus_tag="KLMA_30366"
                     /codon_start=1
                     /product="monothiol glutaredoxin-5"
                     /protein_id="XP_022675497.1"
                     /db_xref="GeneID:34715642"
                     /translation="MFARSFITKSSLLRPAFKTQFNFQRFLSQETKKAIEDAISSAPV
                     VLFMKGTPEFPQCGFSRATINMLGQQGVDPVKFAAYNVLEDPELREGIKEFSEWPTIP
                     QLYVNKEFIGGCDIIMNMAQTGDLTKLLEDADALVPEEEEEQEK"
     gene            815246..815317
                     /locus_tag="KLMA_R314"
                     /db_xref="GeneID:34718688"
     tRNA            815246..815317
                     /locus_tag="KLMA_R314"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:34718688"
     gene            815437..815507
                     /locus_tag="KLMA_R315"
                     /db_xref="GeneID:34718689"
     tRNA            815437..815507
                     /locus_tag="KLMA_R315"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718689"
     gene            <816429..>817304
                     /locus_tag="KLMA_30367"
                     /db_xref="GeneID:34715643"
     mRNA            <816429..>817304
                     /locus_tag="KLMA_30367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818875.1"
                     /db_xref="GeneID:34715643"
     CDS             816429..817304
                     /locus_tag="KLMA_30367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675498.1"
                     /db_xref="GeneID:34715643"
                     /translation="MVSEQPSLVGHSVRDIDDSENPDFVPEKMPDFSQLNESVRKLHL
                     KNPSSDNVDHYTSVAELNKEGALLTDDHDVDLDAMIAKGLDDISELKSSLEKKKKKGK
                     GTTRSSLSASSYSHDHSNDISPVHSGTVDSLVTSTDPIDDSIMISPEDEKDYLRTRSA
                     NRSERKPSDPHSHSHSVIRNSYGEIIDDKSERPHLARGDSYQQSSEDLDTVSSPGRSG
                     RSKKRLQSDYLRSLSRSLQRDHVDHKKVSDDTGMIYSTTSYSISQRDVENAPHVIRET
                     SEEDSARHLAAPNRY"
     gene            <817384..>819003
                     /locus_tag="KLMA_30368"
                     /db_xref="GeneID:34715644"
     mRNA            <817384..>819003
                     /locus_tag="KLMA_30368"
                     /product="dentin matrix acidic phosphoprotein 1"
                     /transcript_id="XM_022818876.1"
                     /db_xref="GeneID:34715644"
     CDS             817384..819003
                     /locus_tag="KLMA_30368"
                     /codon_start=1
                     /product="dentin matrix acidic phosphoprotein 1"
                     /protein_id="XP_022675499.1"
                     /db_xref="GeneID:34715644"
                     /translation="MQEVSTSDKNEASTSDSAKKHTEVTEHDLSQPSDTSEQKLKNSE
                     EEEAVEKGNESESATEPEKEEHLEEEEEEEEEEGEEEEEVEKKDDEMEKENFDTQQED
                     IEVMDSKESSPVNTPVNTLPENSEVPEVKHIKEEHIEEVPVSELDVTNDHIEEAPITD
                     RTDQEALSSETEVETKQDSSKSMSPDSDSNSKTLGSSTPQDEKHNYDEDDVSLTSIQP
                     KEQDAIPLDLGKESKLPIELENEEHSDVEEHIPVSINNSGATEVTEIGESDVEDTTME
                     ERAEDTKLNSSAVQDVLKEDPSSLPNNSDGNKHTEKLAEDEEKDDDTKEASTDNIDGQ
                     EEAQTEIDSVASNTLDKSDNIESADVDPNLVRSDDASIHYNEESATKGSVEHSEDVEV
                     LEEKISQKDLPTDEIEGGKRKSAQDVAEDIDSFLNELKSELENEDLEAHIENAAKNEP
                     VYIFTSLAGGGIHMPRRTNRLATILTANEIEFSYRDCGTDAEARSIWKAHSAGRLLPG
                     VVRGTTLIGNWKEIDDANEEYRLYEMIYNSL"
     gene            <823358..>825541
                     /locus_tag="KLMA_30369"
                     /db_xref="GeneID:34715645"
     mRNA            <823358..>825541
                     /locus_tag="KLMA_30369"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818877.1"
                     /db_xref="GeneID:34715645"
     CDS             823358..825541
                     /locus_tag="KLMA_30369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675500.1"
                     /db_xref="GeneID:34715645"
                     /translation="MVNFTVSNVNDAISFKPHLCKEVPPEQYNSLKNWYIEFTGTSIR
                     KNKCRLFFLPINVSDELQQLNPVIPDEVKITNPDNCELTYYKNRLITELDFENVKRVQ
                     RACIYIAYAAINQLLNIETDPSMILESSQSNAGQAGTNSSGGYPSSSHSNNNNSTNNE
                     SVDATESCYLSLKRGEVLGFRELGHLINITPWHFHRVFKVITGLTIREYGQLCVEFLK
                     KNSTLVNPVVARVEQLKEAGDTYSCLDDDDFMIDDTLRYECDDKCIILPDYFIDLTKS
                     KESKRKGNDSPPSTASSNANGNGHSMENDHSKNQHPTSGLSRSEQRKRRSSVMIQKIR
                     NASVCSFSTNPSIQSAMNNHGNGNGNGNGASSPPLPLPLQQPVEYCESLTPSPSNQGL
                     DQGQGQGMQLGTYISGEGSATYLRHPSTSTIGLRRKSKVSRNGSVSGMENHGMVSKAK
                     HKRNVSDPLASAGDDLLADKINGDLSLFDGQGQGPGQLQGPGQGQGQGLSEAFNFPSP
                     QVDFKFNMFDEPDLGLNLDVNLNSLNLSEMALNSISMNMGAGAAAAAAEVTHAHAQAL
                     AQSQSQTQSQTQAQAQELGPDQGPGPSHGTVTVSTSEVDSRLPSDDITEMSSFSMNPV
                     DQFQYIHTDKHRQSQALRSNNSVLHLDKLSEPQSLSSTLPTTPQDMNTLLPVQGHESL
                     LLEFSPEEPNSALSALDPLYPLYPSSMLTAVPSDAFASYEDFIAN"
     gene            <826604..>828709
                     /gene="GSY2"
                     /locus_tag="KLMA_30370"
                     /db_xref="GeneID:34715646"
     mRNA            <826604..>828709
                     /gene="GSY2"
                     /locus_tag="KLMA_30370"
                     /product="glycogen [starch] synthase isoform 2"
                     /transcript_id="XM_022818878.1"
                     /db_xref="GeneID:34715646"
     CDS             826604..828709
                     /gene="GSY2"
                     /locus_tag="KLMA_30370"
                     /codon_start=1
                     /product="glycogen [starch] synthase isoform 2"
                     /protein_id="XP_022675501.1"
                     /db_xref="GeneID:34715646"
                     /translation="MTRDIANHLLFEVATEVANKVGGIYSVLKSKAPITCKQYGPKYM
                     LLGPLNPQSMQVEVEPVDWEKEENFYIKEVQWALRSMYNRGVRFTYGRWLIDGAPMVI
                     LFDINSVRGYMNEWKADLWEIAGIPSPDGDFETNDAILLGYTVAWFLGELAHMNQTNA
                     IVAHFHEWLAGVAVPLCRKRRIDVVTIFTTHATLLGRYLCAGNVDFYNNLDKFDVDAE
                     AGKRGIYHRYCIERAAAHSSDVFTTVSQITAYESEHLLKRKPDGILPNGLNVIKFQAV
                     HEFQNLHALKKEKINDFIRGHFHGNFDFDLDKTLYFFIAGRYEYRNKGADMFIEALAR
                     LNHRLKASGSKMTVVAFIIMPAKNKSYTVDELRGQAVVSQLENSVKDVTQLIGKRIFE
                     HAMRFPHNGTKTEIPTSLEELLKPSDKVLLKKRVFALRRPEGTLPPIVTHNMVDDATD
                     PVLNQIRRVQLFNNSYDRVKIIFHPEFLNANNPILSLDYDEFVRGCHLGVFPSYYEPW
                     GYTPAECTVMGIPSITTNLSGFGAYMEDLIEKDQAKDYGIYIVDRRFKNPDESVNQLV
                     DYMEEFVLKTRRQRINQRNRTERLSDLLDWRRMGLEYVKARQLALRRAYPDEFKELTG
                     GNELDDSNMDSMAGKKQKIKVARPLSVPGSPKDSRASSVGAVMMTPGDFGTLQDANNA
                     DDYFHLAMDDDEEDDEEDY"
     gene            <829677..>830954
                     /gene="CMK2"
                     /locus_tag="KLMA_30371"
                     /db_xref="GeneID:34715647"
     mRNA            <829677..>830954
                     /gene="CMK2"
                     /locus_tag="KLMA_30371"
                     /product="calcium/calmodulin-dependent protein kinase II"
                     /transcript_id="XM_022818879.1"
                     /db_xref="GeneID:34715647"
     CDS             829677..830954
                     /gene="CMK2"
                     /locus_tag="KLMA_30371"
                     /codon_start=1
                     /product="calcium/calmodulin-dependent protein kinase II"
                     /protein_id="XP_022675502.1"
                     /db_xref="GeneID:34715647"
                     /translation="MFKKDRVPREEYVQKPEEPEPVEGHKLTKLFNKVTGQPDSYVNK
                     QDYIFGKTLGAGTFGVVRQARCISTGENVAVKILLKKALKGQSVQMQMLYDELNILQQ
                     LDHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEEDAVFIIKQILEAVE
                     YMHKKNIVHRDLKPENILYLDKSENSRLVIGDFGIAKELKGDHDLIHKAAGSMGYVAP
                     EVLTTSGHGKPCDIWSIGVITYTLLCGYSPFLAESADGFIEECTSGEYPVVFHKPYWN
                     SVSKTAKEFILWALTVNPARRPTAKDLLNDIWITSTESSKTDLFPEIRKGFDAHKKFR
                     DAVEIVKLNNRIKKLKLLYENQEDGSDTDIEVNPTDSLESIQSSMKTMSIKDGQGDLH
                     SSLKQNAFAQLVLTASKHKDKVKNFQETEEETS"
     gene            <831578..>833923
                     /gene="PDC2"
                     /locus_tag="KLMA_30372"
                     /db_xref="GeneID:34715648"
     mRNA            <831578..>833923
                     /gene="PDC2"
                     /locus_tag="KLMA_30372"
                     /product="protein PDC2"
                     /transcript_id="XM_022818880.1"
                     /db_xref="GeneID:34715648"
     CDS             831578..833923
                     /gene="PDC2"
                     /locus_tag="KLMA_30372"
                     /codon_start=1
                     /product="protein PDC2"
                     /protein_id="XP_022675503.1"
                     /db_xref="GeneID:34715648"
                     /translation="MGLSIEQKYNICLMAEKHPKWTQAELAQWAYQVYQLPSKPSQGT
                     ISRLLAKKSEFMNSKEHEKDSNRLRRPNNLLVHKILQEWVSQSIWNGIPVSLPVIQDT
                     AQSVWHKIPPEYREGKGSFSHKWVANFLSRMNLSTHIIEHDMPKHPKVWYFDERSSLK
                     QFISNISEDSLFTLDETFLAYNLPLDYAQYETNSIQKRLEVVTVMLCSNLKGTEKMNP
                     LVIGRYENYNSFKNFMKDDGHSVGQDSHLGEKTGKRFGIVYQSNRKSWLTSTIFHDWL
                     VAFDKRLVSDNRKIWIILDDSCSHRIINLNLQNIELIYTSANSRFLPFNWGVLEEFKA
                     RYRIQQYKALIDLQKNISQDSGDSRLLTYEQSCLTMTNAFKFIKIAWDAIPKERINAT
                     WKNSGILPYKLLHHEEMGPNTFQKNKALETSLNELCNTYSCMRKWDYSMLLHLNIENK
                     NKNFLSLEEIIESSIVDQWEPEVRQDTLLLEDMDDLFNTFNTAPPTKRITPMENQILN
                     DQSKLLSDQIPVTDSYGMITTSNDNQDNKISTVSELIDNNTEDIFGNMLDENFFSDEL
                     LTTIGDPFANKLNGNNEQSQPVQPPQRPQSSLSAVRVAEIPSNTSPYSDEGRSAVYGG
                     GAEVPKSHSSHSSPYVEGSGGQQTETMILPSYVNQIFSKGSSVEIENDKLVMMTTLQT
                     NVELAKAMGTILKHSELQEVGLSEASLKEMKMGYQNCLKRITKARHFLNSMDKKRRQQ
                     NIEHQFLTSHSGSPQDSISSMHIADSFFENFAENHSTASSS"
     gene            complement(<834032..>836662)
                     /gene="VPS41"
                     /locus_tag="KLMA_30373"
                     /db_xref="GeneID:34715649"
     mRNA            complement(<834032..>836662)
                     /gene="VPS41"
                     /locus_tag="KLMA_30373"
                     /product="vacuolar protein sorting-associated protein 41"
                     /transcript_id="XM_022818881.1"
                     /db_xref="GeneID:34715649"
     CDS             complement(834032..836662)
                     /gene="VPS41"
                     /locus_tag="KLMA_30373"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 41"
                     /protein_id="XP_022675504.1"
                     /db_xref="GeneID:34715649"
                     /translation="MESEPVDIDQCKESSHNGSDSDISIGSKSNRTQDIDPEVEEDSS
                     SGTESESEIYSDEDEEDEDDSDDSDEDEDEDEPPILTFSRLTHIPKSFFQRDSISSCL
                     FSDRLFAFGTHSGLLHLTRPDFTTIRTFKCHSSSILSIATEGDYFATGSIDGTVVIGS
                     IEDAQDISGFDFKRPIHAVVLDKNYASTKTFVSGGMAGDVVLTQRNWLGNRTDTILEK
                     NNGAIVGIYTVDDVIFWMNDNGITFYSSISRTKLLNIPFPQDEENRPDLYWPKVTFPE
                     TDRAIVCWGKHIWQFKVSVSKVQDSTNHIGSIISSAASSLRGVPDRKVELEHHIELNC
                     LVAGAAAFKDDQYLCLGIDQSNKDKLDAPELKIIDIFNGEELHTYQVISKSFQNMTLN
                     DYHLGVHIGEGKSEYYLISSTDAIVSKELSLEDRFKWYVERQMYLKAWEIGDYVVNPM
                     QRLLVGQQYIDSLLLKQDWSTAAEAIVKVFQEVQEGDEELMNFKISKWGMYIMKFVKN
                     KHADDIIDQVPTDPVLDYNVYTTILQSFITAGKYDKVLSLLKKWDCSYYDVRTLLDSI
                     EEELESREDTTLRRCLIQIYSLTDQYVPLVKQMLILKDVKVLDVLLEHNLLSNFVSSL
                     KEIILLPYNEDPINIDKMPLSVVRKVFSKSILLLVENRHSIPIERVISEFSGPLRVIL
                     FLFMEECMVLEPLMVTPYEDDMISLYIQFNKKDLLDFLKLKSNYDVDRAIELCQADPS
                     LYNELIFLWSKIGENRKALSLIIDRLDDPKLAFQFVKDSNDNELWNYLINYSLDRPKF
                     IKAILDTSDIFEDEIATIVERVPDDIEVEGLKDSLQHITTNNELKLGVMNSIFKIVDD
                     ETKQIVAEFLMVRKKGKAFM"
     gene            complement(<837129..>839249)
                     /gene="COG3"
                     /locus_tag="KLMA_30374"
                     /db_xref="GeneID:34715650"
     mRNA            complement(<837129..>839249)
                     /gene="COG3"
                     /locus_tag="KLMA_30374"
                     /product="conserved oligomeric Golgi complex subunit 3"
                     /transcript_id="XM_022818882.1"
                     /db_xref="GeneID:34715650"
     CDS             complement(837129..839249)
                     /gene="COG3"
                     /locus_tag="KLMA_30374"
                     /codon_start=1
                     /product="conserved oligomeric Golgi complex subunit 3"
                     /protein_id="XP_022675505.1"
                     /db_xref="GeneID:34715650"
                     /translation="MKMVRSRRGSIVQDIASKSSVSHGLPVYTDDLVQLLKDVGLNRE
                     LEPPHSNLELKNEKYKEYTDYLNQLEEKNGYYTTLRSTTRQVTDRLVTIIDKFQAISS
                     ETESFQNSIDSLATSLKESEESYETIQRELQYFQNLEPIARRLNQYSSPNIVLKDSFN
                     QNLAKIDESLNFLKEHPDYLEAESYRIRFKQCLVRACTLIANYLNNQIKGRNDDIISR
                     LNSSKTQLTNNSNEALLYNRFATIGSTYKQLIDSIISRSQYDEVESLLRDCFNTYFKC
                     RSKLLKDGIWNQLTETQLHSGKTVKYVQDNLLFFENLAHREFNLFSQFYPLNDETVAR
                     FNEWCMELFEPLYDSVRSIILRETSIATLCDTITLLNKYYQMEEGSTEYKLQFKNLKF
                     DALFKPIVKECQSRLIFRSQIYVEENINKYKPRVDSFVIRHRKASKETKPKITEVEEI
                     SQPFFELEEFNSAYPPLVYGIALLSKIYQMVNSTVFDDIAHTIVHDCIMSLKKAFYLV
                     SSNATINVLDTQLSLLKNMLLLRDQVQNFDIQYISKETYLDFSGLLQSIKDIGKLSVS
                     VFQTVPKIINNMVDARSELIIELRDTINGFTRQAADQITKDYLSLSTPQDKLLEQNNE
                     LRKSIETNLPSIYEQIGNFIVDPEIKSHLVDAIQQEVVSRYANYYETLADNPSVDAKK
                     LSECMYIDVFQNFINNETSKLLST"
     gene            complement(<839582..>839956)
                     /gene="PET100"
                     /locus_tag="KLMA_30375"
                     /db_xref="GeneID:34715651"
     mRNA            complement(<839582..>839956)
                     /gene="PET100"
                     /locus_tag="KLMA_30375"
                     /product="protein PET100"
                     /transcript_id="XM_022818883.1"
                     /db_xref="GeneID:34715651"
     CDS             complement(839582..839956)
                     /gene="PET100"
                     /locus_tag="KLMA_30375"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="protein PET100"
                     /protein_id="XP_022675506.1"
                     /db_xref="GeneID:34715651"
                     /translation="MRLPFKYTRAQLEVFRFGFCLLAPVAVMYYIGTDTDKKLNVPGF
                     WPDPETLNKIPKERYEIKAELARMKKERLEKRLRLERKIAEEYGIDIEAEKEKIRQEE
                     RALKEAKEAELGLKNSAPSEQT"
     gene            <840496..>841497
                     /locus_tag="KLMA_30376"
                     /db_xref="GeneID:34715652"
     mRNA            <840496..>841497
                     /locus_tag="KLMA_30376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818885.1"
                     /db_xref="GeneID:34715652"
     CDS             840496..841497
                     /locus_tag="KLMA_30376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675507.1"
                     /db_xref="GeneID:34715652"
                     /translation="MSVSQTVKRAKMSMKQICTHSGSFHADEALAVYMLRLLPQWRDS
                     KLVRSRKPEDWEASDIVVDVGGQYDNGVKFFDHHQRGFSETFNDKYKTKLSSAGLVYK
                     HFGKDIIKELGPQLNDDQVELLYDKVYSQFIESLDANDNGIDQYDADVEPKFSAKAIT
                     LPSIISRFNPEWNKDSSDESFYNQFLKASEYIGTVFKDLVNGYINSWLPAKTLVIEAV
                     ENRFNVDKSGKIIELAEFCPWKEHLFQVERELNIENTIEFVIFSDTSGAYRVSTVPVT
                     STSFEFRKGLPEPLRGLRDEELSEKSGFPGCIFIHAAGFIGGAKSRESAIGLARLSL"
     gene            <841732..>842484
                     /locus_tag="KLMA_30377"
                     /db_xref="GeneID:34715653"
     mRNA            <841732..>842484
                     /locus_tag="KLMA_30377"
                     /product="cation transport regulator-like protein"
                     /transcript_id="XM_022818886.1"
                     /db_xref="GeneID:34715653"
     CDS             841732..842484
                     /locus_tag="KLMA_30377"
                     /codon_start=1
                     /product="cation transport regulator-like protein"
                     /protein_id="XP_022675508.1"
                     /db_xref="GeneID:34715653"
                     /translation="MTKDAEGVWVVGYGSLIYKPPPCWKYMVNGILHGFLRRFWQSSI
                     DHRGTPNSPGRVATLIPYSEIIQNEAFKKDLDERKTREVSTGHDLQLLARAYYIPPEH
                     VQSVTEYLDVREQNGYTAHKIHIHLEPPRNEPKELQELLNKLPVDEVTGKHILVSMVY
                     IGTSDNEAFIGPENIQDTASVIAFNEGPSGPNYEYLKLLHDSLIQMANQIGKPLEGIE
                     DSYLDSLVECTESIRSNKNMKPHSDSKSTSVT"
     gene            <842774..>845071
                     /gene="STT3"
                     /locus_tag="KLMA_30378"
                     /db_xref="GeneID:34715654"
     mRNA            <842774..>845071
                     /gene="STT3"
                     /locus_tag="KLMA_30378"
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit STT3"
                     /transcript_id="XM_022818887.1"
                     /db_xref="GeneID:34715654"
     CDS             842774..845071
                     /gene="STT3"
                     /locus_tag="KLMA_30378"
                     /codon_start=1
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit STT3"
                     /protein_id="XP_022675509.1"
                     /db_xref="GeneID:34715654"
                     /translation="MKQSTLLALEGLQTVLKVVIFIAIFGAAISSRLFSVIRFESIIH
                     EFDPWFNFRATKYLVSHSFYEFLNWFDDRTWYPLGRVTGGTLYPGLMTTSGAIWHILR
                     KIGLPIDIRNICVLFAPAFSGFTAWATYEFTKELKDSSAGLLAAAFMAIAPGYISRSV
                     AGSYDNEAIAITLLMVTFMFWIKAQKTGSILFSTFAAVFYFYMVSAWGGYVFITNLIP
                     LHVFILILMGRYQSKLYSAYTTWYAIGTLASMQIPFVGFLPIRSNDHMAALGVFGLIQ
                     IVALGDYIKSQVSSEKFKVVMIISLVLILAIGVSGLFFLTYMGYIAPWTGRFYSLWDT
                     NYAKIHIPIIASVSEHQPPAWPSFFFDNQFLIWLFPAGVFLLFLDLKDEHVFVLAYSV
                     LCSYFAGVMIRLMLTLTPIICVTGAIAISKLFDIYLDFSVLLSGGSKATEIAKSVEKL
                     AEKEPKKQALSKSEDDEADDYEAHLEFEYEESSKSRWFNVAAKALVSASFISYLFIFV
                     YHCTYVTSNFYSSPSVVMPSQNPDGSVALIDDFREAYYWLRMNTAEDAKVAAWWDYGY
                     QIGGMADRTTLVDNNTWNNTHIAIVGKAMSSPQDKAYEILKEHDVDYVLVVFGGVLGY
                     SGDDLNKFLWMVRISEGIWPDEVKERNFFTDRGEYRVDSQATKTMKDSLMYKLSYYRF
                     PSLYPNGEGVDRVRNQKITENDVGDLDYFEEVFTSETWLVRIYKLKSPDTLGRDHGSA
                     AKFSKSSKGGVRKRSVKKPTTDLRV"
     gene            complement(<845236..>846069)
                     /locus_tag="KLMA_30379"
                     /db_xref="GeneID:34715655"
     mRNA            complement(<845236..>846069)
                     /locus_tag="KLMA_30379"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818888.1"
                     /db_xref="GeneID:34715655"
     CDS             complement(845236..846069)
                     /locus_tag="KLMA_30379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675510.1"
                     /db_xref="GeneID:34715655"
                     /translation="MSGRSGEESANCNGNGSDSDSDFGDFGEATVKVEELEVPEESPV
                     TAEPNASGASGGASTSGPVVQENSATAVEAIFDCTRKVLAAKKRGIEIRDKKVLFQDL
                     LKNEKTKKIYDSLFPDGQPLPPSQWRKEPLQRLIRQTLGMEEPHDEEEEEEYVIQDLL
                     YLKLEEDEHNTLESLGYERLKEDKEKVPSVDISELLAMQEFSSVPLEKLTVVHDQLID
                     AIEKVQNEINTLKAEERELLKDKETYEELITNLVGHTQRIRREEIAEYKKKHKSLFKR
                     K"
     gene            <846821..>849049
                     /gene="ALK2"
                     /locus_tag="KLMA_30380"
                     /db_xref="GeneID:34715656"
     mRNA            <846821..>849049
                     /gene="ALK2"
                     /locus_tag="KLMA_30380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818889.1"
                     /db_xref="GeneID:34715656"
     CDS             846821..849049
                     /gene="ALK2"
                     /locus_tag="KLMA_30380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675511.1"
                     /db_xref="GeneID:34715656"
                     /translation="MEEAVGGAVHVNSVIRQEFETSFDEYSAGESAKRFIALEVSDNE
                     DDYNSSVDSLHAVSKVSTNTVLGPLADNGTENRDLDIPESISTVTQSYYGSGNNNGSM
                     TGNSSALGPASVSVGNDSNSNNNNNNNNSNNNNNTNNNSNNNPSLRPVKDEKKRWSFI
                     SANSSNKKRWSTLSFVSDTKSNKRLSIVSSDSSSKRSSVQSLSQQSSSNKLKRSSTGA
                     SLRSMFNKIALKDEDKENTNTILHHKRVQSTTVASTVNVTAQAQMNPPANSNRIPLSQ
                     INQNTRREQRFSTIPASPSMDNMSMFSQQSNASMGSKWKFWKRRAGDFPQDSRYMQDP
                     NTSSSSTTTTSMRTKTSLSDLRKSIFQNSILGTDPNSQDLKSRRSHSSLHHKTSQSSL
                     KQKTSHPSLKKLQSSRRNSSIASNDSSPQISLPIPDQVSRDKIRTKLRHSSSLISINS
                     NVVGGSVIIAETDEYDESVLQQILDLCTVKEIVSFDYSPTLRQLDHYIYIDSSNSTIY
                     KIVPLDNDDRECKMTRQMRLQELQLTMLLNGTPGFTNVLDVKLVRRDNDQTLFLVYHM
                     KNHGKSLNQLIASEHRQFTVAEIKDIITQCIRILYVAETKFQFEHRLLTLDHVLLDSN
                     KNVTLIDYKLSRATYGSQVLFTRLDHPLFFEFRKDYNSILQWLRQSMTVDSWSLFYPK
                     TNLVWLNYIISKLLQHCKDPQTNSPLLNKIQASLESTKSRKLWKRHDGVVESCADIVS
                     YL"
     gene            <849557..>850810
                     /locus_tag="KLMA_30381"
                     /db_xref="GeneID:34715657"
     mRNA            <849557..>850810
                     /locus_tag="KLMA_30381"
                     /product="hypothetical protein"
                     /transcript_id="XM_022818890.1"
                     /db_xref="GeneID:34715657"
     CDS             849557..850810
                     /locus_tag="KLMA_30381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675512.1"
                     /db_xref="GeneID:34715657"
                     /translation="MDASAFEIDAGLSGLRAEHQEQQQQEQQQRHQEQEQHQHQHQHQ
                     QREQEQRAVSLKNGRSNSGHSSGNGGDRRFIARDWFNVSCERDCELMQIFIEQLNGTN
                     HVNYSKAYLLFKERTGFPFSDPKHMRKRMDQIVYTFKTQGDMLPEDVKRKITEYNEAL
                     EAAKQRDSSNRKRLILMEPVEADDTRSRSRSGSGSGSRSRSGSASDGVSDGEADVESQ
                     ARGIARGIPNSNNLLGLGSKKNNGSSMSPTGLTMGVTMGMGVTKSNSNSNSKSRKRKH
                     GNGFSAEESSDRTLKRLAENVETLTRMMQSHDLLLNRIVRLLEGNSTVAALDHHSSNG
                     GAGQEEPDPSESHTTTTTAGTSAVVVPDTASAAAAAAAAAAAAAAASNVLNLNPSLAA
                     ANAVSSNEYDEEDGSGGERDHVTIR"
     gene            <856316..>857695
                     /gene="NSR1"
                     /locus_tag="KLMA_30382"
                     /db_xref="GeneID:34715658"
     mRNA            <856316..>857695
                     /gene="NSR1"
                     /locus_tag="KLMA_30382"
                     /product="nuclear localization sequence-binding protein"
                     /transcript_id="XM_022818891.1"
                     /db_xref="GeneID:34715658"
     CDS             856316..857695
                     /gene="NSR1"
                     /locus_tag="KLMA_30382"
                     /codon_start=1
                     /product="nuclear localization sequence-binding protein"
                     /protein_id="XP_022675513.1"
                     /db_xref="GeneID:34715658"
                     /translation="MGSKSADKKVSKKDLKLKKKQDAKKVKAVEPESSSDSESSSDSS
                     SDSSSDSESESSDSSSDSSSDSSSDEEEEKEEEKPKKKEESESSDSDSDSSSSSSSDS
                     ESESEEEKEEPKKKESSSSSSSDSDSDSSSSDSESEEEKEEPKKKESSSSSDSDSDSD
                     SDSDSDSSSSDSEEEKKEEPKKRKADEEEQEEQEESKKQKTETTGEPATIFVGRLSWS
                     IDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEMHGKEIDG
                     RAINCDMSTSKPAGPPKDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYEIFGKYGE
                     IVSVRIPTHPETEQPKGFGYVQYGSIEDAKKAFEALQGEYINNRPVRLDYSIPKQNFG
                     GDRGGRGGRGGFNRGGDRGGRGGRGGFNRGGDRGGRGGRDFGSGSNTSPLGAARQNAA
                     FQGKKKTFD"
     gene            <859396..>861246
                     /gene="RIM8"
                     /locus_tag="KLMA_30383"
                     /db_xref="GeneID:34715659"
     mRNA            <859396..>861246
                     /gene="RIM8"
                     /locus_tag="KLMA_30383"
                     /product="pH-response regulator protein palF/RIM8"
                     /transcript_id="XM_022818892.1"
                     /db_xref="GeneID:34715659"
     CDS             859396..861246
                     /gene="RIM8"
                     /locus_tag="KLMA_30383"
                     /codon_start=1
                     /product="pH-response regulator protein palF/RIM8"
                     /protein_id="XP_022675514.1"
                     /db_xref="GeneID:34715659"
                     /translation="MALLNKLLRSKEARSTTDVGAESVGASSHGVGLSASSGSSIFKH
                     SGVKSIILEFQVDLDDVHRVRKPNETVEGTVTLRLKRDVSNVWIRLSHVGECQLRSGT
                     PKAMTSGSLRSKCSERLFCRSNDIYGSEQQPLDLTSGQHKFPFSCSIPTKNILSSIDF
                     KKGSVKYWVQAELHTRSAPVVIRKQWYQLVVPFDVSQLPKPEIKTVILQSPNSNYSHM
                     NHSRKHLAAGSADHQDATSSLTRRTADSSTITNASTGSCTSSNSGNSCPAENNSNNNN
                     NSTNNNNNNSSASTSNNNNNNNNNNTNNNNKTVKISVEIPSLGYTVGEDIQVKVKVSH
                     YKHYSHPAGLIATLVRICRVANSANLEQTETFRKDICQSVAPLYTDPDTHDASVMLKL
                     KVPLDTFPTSDVKNKFFTFQYYVEVLANLSKKNQVYTESNRLVGGQRTSDIPTQSEKL
                     SFIPKLIASDHNSAGEDESVTFFQDLINVDRLKRLRNVTGMSIEIVLGTHREIPQQQQ
                     QQQESPVAEGVPVAQDNGHVTTNDNAANTSLEEPSSPIDQVYGYLLQQNMSTLPEVTL
                     SESDIAMSYPTDPVPSYSSNFNNFALPTIADDKQELEQMRLKELESEPPI"
     gene            <861839..>863428
                     /gene="CCT2"
                     /locus_tag="KLMA_30384"
                     /db_xref="GeneID:34715660"
     mRNA            <861839..>863428
                     /gene="CCT2"
                     /locus_tag="KLMA_30384"
                     /product="T-complex protein 1 subunit beta"
                     /transcript_id="XM_022818893.1"
                     /db_xref="GeneID:34715660"
     CDS             861839..863428
                     /gene="CCT2"
                     /locus_tag="KLMA_30384"
                     /codon_start=1
                     /product="T-complex protein 1 subunit beta"
                     /protein_id="XP_022675515.1"
                     /db_xref="GeneID:34715660"
                     /translation="MSIPIFGDQVTEERAENARMSAFVGAIAVGDLVKTTLGPKGMDK
                     LLQSASNSSSLVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAEL
                     LREAEKLVEQGRIHPQTIIEGYRIASAAALSALEKAAVDNSKNKEEFYNDLISIANTT
                     LSSKILSQDKAHFSKLATDAILRLKGSTNLEHIQIIKIIGGKLSDSFLDEGFILPKRF
                     GTNQPKRVENAKILIANTSLDTDKVKIFGTKFKVDSTSKLAELEKAEREKMKRKIEKI
                     AQFNINTFINRQLIYDYPEQMFTDMGINSIEHADFEGVERLALVTGGEVVSTFDNPEK
                     CKLGECKLIEEVIIGEEIFTKFTGCKSGEACTIVLRGATEQVLDEAERSLHDALSVLS
                     QTTKETRTVLGGGCAEMIMSKAVDTAAQNVEGKKALAVESFAKALRQLPTILADNAGF
                     DSSELITKLRSSIYNGMSTSGLNLDNGTIADMRELGIVESYKLKRAVVTSASEAAEVL
                     LRVDNIIRAKPRTADRQQQHM"
     gene            complement(<863661..>864812)
                     /gene="END3"
                     /locus_tag="KLMA_30385"
                     /db_xref="GeneID:34715661"
     mRNA            complement(<863661..>864812)
                     /gene="END3"
                     /locus_tag="KLMA_30385"
                     /product="actin cytoskeleton-regulatory complex protein
                     END3"
                     /transcript_id="XM_022818894.1"
                     /db_xref="GeneID:34715661"
     CDS             complement(863661..864812)
                     /gene="END3"
                     /locus_tag="KLMA_30385"
                     /codon_start=1
                     /product="actin cytoskeleton-regulatory complex protein
                     END3"
                     /protein_id="XP_022675516.1"
                     /db_xref="GeneID:34715661"
                     /translation="MPKLEQFEIKKYWQIFSGLKPIDNKLNHDQVQPILFNSRLDTSI
                     LNKIWFLADIDDDDQLDFEEFVICMRMIFDMVNQNIDSVPDELPDWLIPGSKAELVKQ
                     RKKERMSGSLSDTSSVNTAPDVSTSQQETRKEVDWYISREDKTQYEAIYESAISSRDN
                     TVSYISLSSAVRSKYINLSSQDLEKTWRLVNPKLDMSIDRDPALYFIHILRQVNDYAC
                     PIPSHLPDALKETFTKSRVPTSLSSKQGEIRKQNTSSSNSSSPSYQIPKREGTDFSVT
                     QGTDWEVVRLQRELANIDSELSSVQQQKSMSQNNQENRMRLIKQQLEQFLQYQTKING
                     PNSSSQNIDIRSLRDDINNIEQQVQMLEQYLNTKKSELNNLNVEIQSLQ"
     gene            <866439..>868796
                     /gene="AXL2"
                     /locus_tag="KLMA_30386"
                     /db_xref="GeneID:34715662"
     mRNA            <866439..>868796
                     /gene="AXL2"
                     /locus_tag="KLMA_30386"
                     /product="protein AXL2"
                     /transcript_id="XM_022818896.1"
                     /db_xref="GeneID:34715662"
     CDS             866439..868796
                     /gene="AXL2"
                     /locus_tag="KLMA_30386"
                     /codon_start=1
                     /product="protein AXL2"
                     /protein_id="XP_022675517.1"
                     /db_xref="GeneID:34715662"
                     /translation="MKAGLLVSSTLSLFCAVAYASVYEAYPVNKQIPPIARVDEDFQF
                     KISNDTFKSTSDGSVQVSYNAYEMPNWLSFDSGSLTFSGKPSLDFLEGEETRYFNVVL
                     EGTDSSDSSSSNTTCQLVATKRSGISVASDFNLLNLLKNYGFTNGKDALKLSPRDIFN
                     VTFERSYFEGLDNDTVLTYYGRSTQYNAPLPNWVFFDVNNLKFSGTAPVVNSQIAPEM
                     DYSFSLIATDIDGFAAASIDFQIVVGAHRLTTSIENTLVINITDSGSFSYPIPLDYIY
                     LDDTVISKSDLGNIELVNAPESIKISDNYTLTGKLPSDNETSSFQLSIYDKYEDVVYL
                     NFLVESTQNLFAIASFPSVNVTRGEYFDYSLLPSQFTSFSETKVSASFNSENNWLHFQ
                     PSNLTFFGEVPNDFDSLSVEIVAAVGSKKESRTLKMIGIDGKTHSHTSSSTSSSASSS
                     STSSVTSTVDGKSTATATSTSTVTPDAINKKKKSNNTVAIACGVAIPVAVILILLLLL
                     LLWRRRRNEKKNNDKEKMAISSPDPKNPANEPNDIGAENPFSDENTLDSDDLSTEAKR
                     LGTLNAMKLDDVSNSSSITFSDEKVGESIYEDAQMATSRDMLVRDDESSVFDDKYRTS
                     SVYFQNAPSQRKSWRFSKGKMQDEDKTMRQSYASLNTVSTQELLTSELKNNTTLPHDP
                     RKSSLGLRDSVFWSKDQSSSPLKTVSEDSARSAEEKIKSESAHSSMSSDDLIPMKQED
                     GRYKWVENDRPVRKHSTKRVGSVRQKVGVDIRNANQFAGESPERI"
     gene            complement(<869206..>870795)
                     /gene="Acot10"
                     /locus_tag="KLMA_30387"
                     /db_xref="GeneID:34715663"
     mRNA            complement(<869206..>870795)
                     /gene="Acot10"
                     /locus_tag="KLMA_30387"
                     /product="acyl-coenzyme A thioesterase 10"
                     /transcript_id="XM_022818897.1"
                     /db_xref="GeneID:34715663"
     CDS             complement(869206..870795)
                     /gene="Acot10"
                     /locus_tag="KLMA_30387"
                     /codon_start=1
                     /product="acyl-coenzyme A thioesterase 10"
                     /protein_id="XP_022675518.1"
                     /db_xref="GeneID:34715663"
                     /translation="MLSLRKLAHTKKAATIAVSKALPIYNSKRLMHSKDDGKATDAAN
                     QPDATTTTLTDKYEFQRLFTNNSSVIEGFKATWVNALAERKKQLAQGKVIDSYSYNSV
                     KSTEIGEKTRADSFTYLTLPFKEDPIVADFYVNAGGRVRMGQIFQDLDALAGRIAYRH
                     TAPAEPVIVTASVDRIYMLKPLDHISDFNVVLSGAVVWTGRSSMEISIKASAIKGKLP
                     EKITESSLSDDDTFLTASFTFVARNPETHKSLAINKLLPLNEDEWMDFRRAESHNAAK
                     KLRAKNENLNINPPTEEESNIIHKMWQASRELRVMEDKPKNLMLMKDTNVKSTMFMQP
                     QYRNRHSYMIFGGYLMRQTFELAYCAASSFSHSLPRFVSLDSTTFRAPVPVGSILHMD
                     ATVVYTEHLHEKTSQPKVAASVVDEEIDGNTLFHFEPRPVNTISTNKKDFLSKPGTII
                     QVKVNTVVQELASEKQTKSGSFIYSFFAPRDYDPEMPGQPGYATVIPQTYSEMIEYIE
                     ARRRAIETANYAKAVKRVSKL"
     gene            <872654..>874249
                     /gene="SAL1"
                     /locus_tag="KLMA_30388"
                     /db_xref="GeneID:34715664"
     mRNA            <872654..>874249
                     /gene="SAL1"
                     /locus_tag="KLMA_30388"
                     /product="calcium-binding mitochondrial carrier SAL1"
                     /transcript_id="XM_022818898.1"
                     /db_xref="GeneID:34715664"
     CDS             872654..874249
                     /gene="SAL1"
                     /locus_tag="KLMA_30388"
                     /codon_start=1
                     /product="calcium-binding mitochondrial carrier SAL1"
                     /protein_id="XP_022675519.1"
                     /db_xref="GeneID:34715664"
                     /translation="MPSSNGGYPGDETPEERKLRHQRLFASIDVDGTGRVNRDMLQRA
                     LEKSDHPLKASPEAVDHIFKALDQNKDSVIDFNDFEKYVTTAEAQIKIGFRKIDKDND
                     GKINIEELSKYLSQFRKDHVTKEDELHQDGGSGSAAGNSAKKRSSISNFVDWAFNRKS
                     YITYEQWRDFLLFVPRKEGSRLNTAYAYFYLFNDDVDLSSEGDVTLINDFIKGFGFFI
                     AGGCSGVVSRTCTAPFDRIKVFLIARTDLASTLLNSKDTLLAKNPNADLSKIKSPLIK
                     AATTLYRQGGLRAFYVGNGLNVMKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRL
                     STYIAGGLAGVCAQFSVYPIDTLKYRIQCAPLNNNLKGTSLLVQTAKEMYQQGGIRLF
                     YRGVHIGVMGIFPYAALDLGTFSALKKWYIKREARKTGASEDDIVISNFVVLPMGAFS
                     GTVGATLVYPINLLRTRLQAQGTYAHPYVYTGFSDVLKKTIQREGYQGLFKGLVPNLA
                     KVCPAVSISYLCYENLKRLMKLE"
     gene            complement(<874471..>875169)
                     /gene="REV7"
                     /locus_tag="KLMA_30389"
                     /db_xref="GeneID:34715665"
     mRNA            complement(<874471..>875169)
                     /gene="REV7"
                     /locus_tag="KLMA_30389"
                     /product="DNA polymerase zeta processivity subunit"
                     /transcript_id="XM_022818899.1"
                     /db_xref="GeneID:34715665"
     CDS             complement(874471..875169)
                     /gene="REV7"
                     /locus_tag="KLMA_30389"
                     /codon_start=1
                     /product="DNA polymerase zeta processivity subunit"
                     /protein_id="XP_022675520.1"
                     /db_xref="GeneID:34715665"
                     /translation="MKFVQKWLPVYIKAWIQLIWYHRDIYPRETFQWTKYHAFNLPNH
                     IPVNIHPDLQQYLDDLCDDLLDKIKQVHYLNLYICECDDETNIIERYCLDFGDVNHLD
                     KMEGVINQEDIVFDEFRSSLYSLLAYLEKLPLLRPGKYTFDIVIETVEMSLGHVSNEN
                     MNRTKESIAALERDWNWVKYRDSSKDFSGGTETQQQRVKMYSLNGCDLNSLVFHQFAE
                     RVIENNPDISASIE"
     gene            <875417..>878194
                     /gene="PMS1"
                     /locus_tag="KLMA_30390"
                     /db_xref="GeneID:34715666"
     mRNA            <875417..>878194
                     /gene="PMS1"
                     /locus_tag="KLMA_30390"
                     /product="DNA mismatch repair protein PMS1"
                     /transcript_id="XM_022818900.1"
                     /db_xref="GeneID:34715666"
     CDS             875417..878194
                     /gene="PMS1"
                     /locus_tag="KLMA_30390"
                     /codon_start=1
                     /product="DNA mismatch repair protein PMS1"
                     /protein_id="XP_022675521.1"
                     /db_xref="GeneID:34715666"
                     /translation="MGIQSLDTTDIHKITSGQVIIDLRSAVKELIENSLDAKADKIDI
                     VFKNYGIESIECTDNGTGISESDLDNIGLKHRTSKISSFEDVSKVTSFGFRGEAIASL
                     CQMGNVSITTTTKGPKAYKVVITHGGKRTKTVCSRNTGTTITVSNLFDTLPVRKKDFV
                     KNHKRQFSRSVELIQSYALIQTNVKISVSNILPSGRKTAVLSSTGKSDLKRNLLSIFG
                     SNAIKGLENISLELSVSNIRHNSILPESFQNEDMGDEIKIQVTGMISMISFGCGRATK
                     DRQYIYINGRPVEYPKVAKTVNEMYQSFNNIQYPTFVLNFIIDPKFLDLNITPDKRTV
                     VLHYEEYVLDAFKEELNIFFQKQGFVVPKSDNNSTRITNNKRIKLESLSQDIPNDDEN
                     TNNHSTKVRRIIKEEEYEITPFKENSIPPLIDEEEKTEAQEIKKKKWQPESDALDDDV
                     RVEPDSMDVDVKFEEPKKSSTCSSPILAPSMDVNAEETSLSDTNTHVVKEQTPHFPPE
                     ADTQPTEMDKSSEISITDEVDLSISEVLPSKSVKIGQSKLDSFLHRRSSVVSIEEPVL
                     DIDEVVVNIDNNITTIPASQDGSNALVFHPQHVNDHNCSHTHHSTPDSSLSDNDHFEE
                     DRSSQSMEDRDGSAQSLKFNLPEGIKNEIVSPMAQEIHNLFTTFHISLKTEVQRAKQV
                     VNCIEMDRAIKHERLVNEIASIEDKEKAEDLLSLTVSKSDFKNMNIVGQFNLGFIIVT
                     RCKKDSFDLFIIDQHASDEKYNFESLQKNTVFRSQSLLAPKTLELSVIDELLVMEYEN
                     VFSKNGFKLQIDPEEDPGKRVKLVKFPVSKNTTFTEYDFHELIQLIREHEGHNMSAIR
                     CSKVRSMFAMRACRSSIMIGKPLSHRTMKKVVSNLGELDKPWNCPHGRPTLRHLMELK
                     DWDSFYDDYMI"
     gene            complement(<878272..>878685)
                     /locus_tag="KLMA_30391"
                     /db_xref="GeneID:34715667"
     mRNA            complement(<878272..>878685)
                     /locus_tag="KLMA_30391"
                     /product="37S ribosomal protein SWS2"
                     /transcript_id="XM_022818901.1"
                     /db_xref="GeneID:34715667"
     CDS             complement(878272..878685)
                     /locus_tag="KLMA_30391"
                     /codon_start=1
                     /product="37S ribosomal protein SWS2"
                     /protein_id="XP_022675522.1"
                     /db_xref="GeneID:34715667"
                     /translation="MVVHILGKGFKGKEVIKIALASKFYGIGEKTAERICSKLGFYPW
                     MRMHQLTEPQVMAITSELSNMTIEGDARAVVKENIALKRKIGSYEGMRHALGLPVRGQ
                     RTRNNAKIAKRLNKVDRRGYHTQASPSILDQVQAL"
     gene            complement(<878926..>879936)
                     /locus_tag="KLMA_30392"
                     /db_xref="GeneID:34715668"
     mRNA            complement(<878926..>879936)
                     /locus_tag="KLMA_30392"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818902.1"
                     /db_xref="GeneID:34715668"
     CDS             complement(878926..879936)
                     /locus_tag="KLMA_30392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675523.1"
                     /db_xref="GeneID:34715668"
                     /translation="MLSRRKRTITGKPVIPSVPKIKPVKARRIIRRFHLLIQKRRIIC
                     QKLRCKIVDNDEEANVNYIQKFFEKNISLRESYTSGKESSHPNSELEKLLISVQSVDD
                     RNELCRVFGYICAEIQEHGGLQNYQMASTVGQDANRGGDSSKQLVSWCEELSLDKSVG
                     MTALELGSLSAKNYISTSGIFNPVVRIDLNSNDPVNIKKQDFMDMEIPKNESQRFDLI
                     SCSLVLNFVPTPIQRGQMICRFQEFLKHDKRTYLFIVLPLPCITNSRYMNRNRFCQMM
                     EYLGYSEVRYREAKKLVYWLFDRDPSKKSKGTKEIAQFTKKTKIEDKPGMNNFAITLM
                     AK"
     gene            <880313..>882667
                     /gene="MAK5"
                     /locus_tag="KLMA_30393"
                     /db_xref="GeneID:34715669"
     mRNA            <880313..>882667
                     /gene="MAK5"
                     /locus_tag="KLMA_30393"
                     /product="ATP-dependent RNA helicase MAK5"
                     /transcript_id="XM_022818903.1"
                     /db_xref="GeneID:34715669"
     CDS             880313..882667
                     /gene="MAK5"
                     /locus_tag="KLMA_30393"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase MAK5"
                     /protein_id="XP_022675524.1"
                     /db_xref="GeneID:34715669"
                     /translation="MANKNTKNQKPRVKGDHNGRISKHHPKNITKKNGGKKSVQKKVE
                     EKVVLNANQLQWKTVDIPDTMDDFGGFYGLEEIDGVDVKVVNGKVQFITKDTEKIKEN
                     ATEVEERDDVVFEEEKEDENMGELIEFKNFDDIKEGELSAASGDEDEDDDMNMFEDEQ
                     QEEQKEEKKDQEEDGKSADGEETDELQTNVFTSNIEIDGEEPPVLPEWTDKMNLSNIV
                     LKGLSDLSFTKPTEIQAKSIPVALEGNDVMGKASTGSGKTLAYGIPIIEQLIKDPTND
                     RLIGLIFTPTRELAHQVTDHLQKIWTTMNKQNKYTILSLTGGLSIQKQERILKYDGSA
                     RVIVATPGRFLELLEKNPNLIPRFAKLDTLVLDEADRLLQDGHFDEFEKILKLLSKAQ
                     KAKTNVQGKTKGTGWQTLIFSATFSLELFTKLDKTSWKNLKSSGGEDNELEQVLQHLM
                     KKINFRSKPVIIDTNPEHKVTSQVKESLVECLPMERDLYVYYFITMYPGTTLIFCNAI
                     DSVKKLNAYLNLLHISSFQIHSSMAQKSRLRSLERFKEQSEKNSKINKPTVLIASDVA
                     ARGLDISGIKHVLHYHLPRSADVYIHRSGRTARGDSEGVSVMICSPQEAMGPLRKLRK
                     VLSNKKSTNPKKTKWQNDVPMLPIEPDIVTQLRERSRIAAELADDEIATKSLHKDDNW
                     LKKAAEEFEIDVDSEDEEKDQFLARNKNKKLNKQLDKNEAKALKYQLNEMLKTPIRKD
                     LRKSYLTGGLTNLADSLIKNKGHNSIIGHEKVDALQTLKQKKRK"
     gene            complement(<882917..>884233)
                     /gene="SUP45"
                     /locus_tag="KLMA_30394"
                     /db_xref="GeneID:34715670"
     mRNA            complement(<882917..>884233)
                     /gene="SUP45"
                     /locus_tag="KLMA_30394"
                     /product="eukaryotic peptide chain release factor subunit
                     1"
                     /transcript_id="XM_022818904.1"
                     /db_xref="GeneID:34715670"
     CDS             complement(882917..884233)
                     /gene="SUP45"
                     /locus_tag="KLMA_30394"
                     /codon_start=1
                     /product="eukaryotic peptide chain release factor subunit
                     1"
                     /protein_id="XP_022675525.1"
                     /db_xref="GeneID:34715670"
                     /translation="METDAEKNIEIWKVKKLIKSLEKARGNGTSMISLVIPPKGQISM
                     IQKMLTDEYGTASNIKSRVNRLSVLSAITSTQQKLKLYTKIPPNGLVLYCGDMITEEG
                     KEKKVTFDIEPYKPINTSLYLCDNKFHTEVLSELLEADDKFGFIVMDGQGALFGLLTG
                     NTRTVLHKFTVDLPKKHGRGGQSAVRFARLREEKRHNYVRKVAEVAVQNFITNDKVNV
                     KGLILAGSADFKTDLARSELFDQRLVAKIVKIVDISYGGENGFNQAIELSAEALANVK
                     FIQEKKLITDYFDQISQDTGKYCYGIDDTLKALDLGAVETLIVFENLETIRYVFKDSE
                     DKEVLKFVEPNTEDKSYSLDKTTGAEMDLVSEQPLIEWLAENYKNYGANLEFITDKSS
                     EGAQFVTGFGGIGALLRYKVNFEQLVDESDDEFYDDDEFNEDYDFI"
     gene            complement(<884971..>886713)
                     /locus_tag="KLMA_30395"
                     /db_xref="GeneID:34715671"
     mRNA            complement(<884971..>886713)
                     /locus_tag="KLMA_30395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818905.1"
                     /db_xref="GeneID:34715671"
     CDS             complement(884971..886713)
                     /locus_tag="KLMA_30395"
                     /note="cd02340, Zinc finger, ZZ type"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675526.1"
                     /db_xref="GeneID:34715671"
                     /translation="MPSQSKQFEIVQEDDLGSGDFGVLLQYDNKGQYIKVTPNRNLSK
                     STFIVACKTIFNIDKVFDQCTVVTRLTKKGAPFIIHSGGDMVTFCDALLKARRLTVTL
                     IPAEKIETNVQLENEVKDPFMQDEWKNLKESLRRIEANLEGKIKNFEVPFSEVVHEGV
                     LCDGCQINDANRIINTDTTDCNGFIRGPRFTCLYCHDYDLCYKCESSGFTSDTHKVYH
                     NMIRSNSYDPKLTRFVLAYHRAGEMDINFPLVSKYSVSDTPPKKELSEIKVEGFYGTN
                     DSTSEKPTVSESDPSSESSAPADATTNTDQEFKDVIIEVGQHNKPMFDFFSKIQSEEE
                     LSSLMQDAVSWRIAKQWYGEDIYEKLEKYETMMKEKVQQEQADSDAVIDEDSLGNDQK
                     NRSLRVEMSQKGHLLTFKLFNDGDETIPNGLKLVFQCEQRDRVSTPIKCNLQMGPNEL
                     QPGNYKILNFNYRGTLEEFSFDCPCKIDLIDVRDQIVYTSEECASPGSSVFYLKPPTC
                     EMYRRASYRDVPCNEEYEGRDGQYEEPNAFHSDTDVISTSFTEQEDNGEEAVFVDSLS
                     EDYDLLSDSDIEQV"
     gene            complement(<887343..>890240)
                     /gene="PHM7"
                     /locus_tag="KLMA_30396"
                     /db_xref="GeneID:34715672"
     mRNA            complement(<887343..>890240)
                     /gene="PHM7"
                     /locus_tag="KLMA_30396"
                     /product="phosphate metabolism protein 7"
                     /transcript_id="XM_022818907.1"
                     /db_xref="GeneID:34715672"
     CDS             complement(887343..890240)
                     /gene="PHM7"
                     /locus_tag="KLMA_30396"
                     /codon_start=1
                     /product="phosphate metabolism protein 7"
                     /protein_id="XP_022675527.1"
                     /db_xref="GeneID:34715672"
                     /translation="MAGQTTSSSTSAFVTTLIFNGIVALLFVWLFLRLRPREPRVYQP
                     RTLKDIKTFPESQRSEEVPPGYFNWVPYLLTKPHSYIIQNTSIDGYLFLRYISMFAAV
                     SFIGCITLFPILLPVNATNGHNLKGFEVLSFSNVSNKRRFYAHVFLSWFYFAFIVFVI
                     YRELYYYVTLRHSIQTSPLYDGLLSSRTLILTDLQGDFCTEEGLNKRFLNVSRVTLAR
                     DLKKLHKLVDERDGLAKKYESTLNKVITKAVKKKIKADKKGEQVAEGTTNKNNPQNDL
                     ETYMPQNKRPTHRLGKIPVWKIFTSEKVDTLEYCVKRIGELNDEVAKEQDTWEERDLL
                     STAFIEFKSQYDAQRAYQSVPYLFEKGSYHKALIGYGPDDIRWENTDLSEKEQKAKRS
                     GGNSSLTALIIFWAIPVAFVGCVSNINFLTDKVHFLKFINNMPKVLMGIITGLAPTIL
                     LALLMSLVPVIIKKIAVLSGSLTRQDVELYCHKWYYGFQVVQVFIVVTLTSAASSTVT
                     AIIKKPSSAMTLLAENLPKASNFYIAYFLLQGLSVPSGALLQVVNLILSKVLGRVLDK
                     TPRQKWARYNKLSEPSWGVIYPVLELLVCIMITYSIISPIILVFSTFALGFFLLAYTY
                     NLVYVMKFSYDLRGRNYPRALYQVFVGLYLAEICLLGLFIMAKTWGPVALEAICIAAT
                     VCAHLYCKRRFEPLFDAVPLSALKYARGDSETYYPAKDQGLEEIRSEGKKLANNILSD
                     DRSGVFQDTTRQDLQRVNMLPDDFEESLEDESKSNNGGGTISGHSKNPSNPFVGETEQ
                     FHKTKVPPTLTSEGAESSHDPNVIVNKVDAGEVLADVKGYPVNQPNEQVGLPSDFAKP
                     QSIIQRIKLFFQPQKYYEFAIVRQTLPFAFNDVVKYDLEYLEKAFTDPCVRMKDPVIW
                     IAKDPMGLSQQQKSLAATNGVQVSDDFAEYDEKGREIYLSDPPDFEPVAMK"
     gene            <891558..>892625
                     /locus_tag="KLMA_30397"
                     /db_xref="GeneID:34715673"
     mRNA            <891558..>892625
                     /locus_tag="KLMA_30397"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818908.1"
                     /db_xref="GeneID:34715673"
     CDS             891558..892625
                     /locus_tag="KLMA_30397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675528.1"
                     /db_xref="GeneID:34715673"
                     /translation="MFLRSLANVRLFHTTSSLLRSSPDKIASRVLRRSRQVKRPKTLE
                     SSLLTRLRPVTAITTAESYDLSRTVELLSKKGYQPATLIPNEIISFKYLHDGFRGDIM
                     VLAQNGSVVSWGFNESVLRDEILPLVAEARVNSLQEVQFESEDLDYVELEDKEDISKL
                     KQNYSLGDESSMENEVIIINGVEPESGLLDKAAFSSGISRSTRLAVLEVALDSHIEKT
                     REFTESLSRGKKLNISEKAVLQSTGRLFLMRGKLNLYSELIETPDLYWSEPQLEKLYR
                     QISRNLDIQPRISILNKKLDYATDEARALMAVLNEKKGTRLEWIIIYLITVEVCFELY
                     HFYEKYQEIFKSKKESELERV"
     gene            complement(<892840..>893586)
                     /gene="DOG2"
                     /locus_tag="KLMA_30398"
                     /db_xref="GeneID:34715674"
     mRNA            complement(<892840..>893586)
                     /gene="DOG2"
                     /locus_tag="KLMA_30398"
                     /product="2-deoxyglucose-6-phosphate phosphatase 2"
                     /transcript_id="XM_022818909.1"
                     /db_xref="GeneID:34715674"
     CDS             complement(892840..893586)
                     /gene="DOG2"
                     /locus_tag="KLMA_30398"
                     /codon_start=1
                     /product="2-deoxyglucose-6-phosphate phosphatase 2"
                     /protein_id="XP_022675529.1"
                     /db_xref="GeneID:34715674"
                     /translation="MPLITVNYLLFDLDGTLVSSTDAADQTWKDYCEKHGVSYEELSK
                     TVHGTRTAETLAKYFPNVDNTDNKAVKELECSIANNYKELVSLVPGASDLLISLDRPT
                     GSLPGEVFKHRKWAIVTSGTPWVADAWFDHILKSVGKPEVLITANDVTSGKPAPDGYL
                     LAAQRLKEKWQDDRKDLRTVVFEDAPVGVRAGKASGSIVVALTTTYDKESLFEAGADY
                     VVEDLTQVCVRSNTTASTVLIITDPMERDE"
     gene            <894511..>894885
                     /locus_tag="KLMA_30399"
                     /db_xref="GeneID:34715675"
     mRNA            <894511..>894885
                     /locus_tag="KLMA_30399"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022818910.1"
                     /db_xref="GeneID:34715675"
     CDS             894511..894885
                     /locus_tag="KLMA_30399"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022675530.1"
                     /db_xref="GeneID:34715675"
                     /translation="MSRLWDQRNNPIMYICGYYTLFVVITIVVLFGIYCGVTYWQNCK
                     DILMPEERYQDSPAETQISIDKHMMMLDERDLYPDITSRIGFDLGNRGLTRYPDLVQL
                     LKYNNREQSQTTVGRDSTRLYI"
     gene            complement(<895057..>895974)
                     /gene="RRP45"
                     /locus_tag="KLMA_30400"
                     /db_xref="GeneID:34715676"
     mRNA            complement(<895057..>895974)
                     /gene="RRP45"
                     /locus_tag="KLMA_30400"
                     /product="exosome complex component RRP45"
                     /transcript_id="XM_022818911.1"
                     /db_xref="GeneID:34715676"
     CDS             complement(895057..895974)
                     /gene="RRP45"
                     /locus_tag="KLMA_30400"
                     /codon_start=1
                     /product="exosome complex component RRP45"
                     /protein_id="XP_022675531.1"
                     /db_xref="GeneID:34715676"
                     /translation="MAKGIEISTSESKFILEALKQKQRLDGRTFDQFRDVDIKLGEAF
                     GDVTVTMGKTKVHCRVSCEIAQPYEDRPFEGLFHITTETTPMAGAQFENGNNTGEEEV
                     LISRMIEKSVRRSGALDVEGLCIVAGSKCWSLRADVHFLDCDGGLIDASCIAVMTALL
                     HFRKPDVTVLGEKITVHPVDEREPVPLGVLHVPVCVTFSYFNPDDTEENIKGEQNSEI
                     AIIDATLKEELLRDGVLTVTLNKNREVVQVSKAGGLPMDALSLIDCCHKAYGIVERIT
                     DQIHRTVKEDIASRNQYAHILSSENSRQN"
     gene            complement(<896256..>897275)
                     /gene="RNH202"
                     /locus_tag="KLMA_30401"
                     /db_xref="GeneID:34715677"
     mRNA            complement(<896256..>897275)
                     /gene="RNH202"
                     /locus_tag="KLMA_30401"
                     /product="ribonuclease H2 subunit B"
                     /transcript_id="XM_022818912.1"
                     /db_xref="GeneID:34715677"
     CDS             complement(896256..897275)
                     /gene="RNH202"
                     /locus_tag="KLMA_30401"
                     /codon_start=1
                     /product="ribonuclease H2 subunit B"
                     /protein_id="XP_022675532.1"
                     /db_xref="GeneID:34715677"
                     /translation="MTIDHETLKSYTLAVLPSGLDTSVEIFELPHPSNNESKKNLRLF
                     TLDDQVYQLKTKEFSKGCDYNKQKDLVSDKYHYTSDGQPFKSTFLIDENNRSDGFTME
                     NGSILYSEKYDLTFSLCGYYYRKNVVPNEDAAFTPSINGSINPDKNFYTSSDYQERLI
                     SNHNENWAKTPSHIWEKALENISKIVEEAGEKYYCIDADKITEWLVRKVCRIINNFPA
                     SLKIPSTFPENISSAFKCIMSCNLLVSLIPQLAYQRLINYESEELNIKQHFEEYKKYK
                     EESIKEDIQKEMAIKAAMSTGLPNMTNGIDKSKKKSIPKPKVVKPKVAKGKGRIDGFF
                     KNAKI"
     gene            <897640..>899298
                     /locus_tag="KLMA_30402"
                     /db_xref="GeneID:34715678"
     mRNA            <897640..>899298
                     /locus_tag="KLMA_30402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818913.1"
                     /db_xref="GeneID:34715678"
     CDS             897640..899298
                     /locus_tag="KLMA_30402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675533.1"
                     /db_xref="GeneID:34715678"
                     /translation="MFDLSVGWLLKWFVALSVLIITSVWFLNTVIIESKRDLHTISLN
                     AQSNADPVRKEHETAVYRNYLVPPSFPLTTGLNLSIGYRLRNGNFGDLWSAIIANGSA
                     TSLDFDSESKSLAEINAIAKKLVEKVELIGAKKIGISLSTDSFTGFSVSIGGLMLSLK
                     NVMPLFLHTVPRTEMDIDVLLISNWKSVQFLNGSEKWYKWVVVCEESAEVEKQESSKN
                     IISLKQFLGGNVEPDNEFLYDPKDSSDDAKVLMQISNPAGGLTSFTQMSLVSSVSSYI
                     KSFPIGHTLSTKDQLTICPSSQWNHSICIQAWPKIFAVLLHGGSVSFRNNVKSLIDLP
                     KETTLLMIPHNYPILKHLLNHSKGIRSSLSIALFSEGVYNKIGQISRNIDELRCVYIF
                     NELKNVSIVTDFSAKIPKLTKMQIQRYTSAQVTHLRSLLGSRVIMELYSPFSIFGPLC
                     YTNYYDYRVFPSELDKLVTCYGSFSTSLEGKLVETEENPELEAEKRQGMLVVRGFTIG
                     KPVEEDRLANAMKLSEKFDGGEGWMPLLGVFGLFGNDGCFYEYK"
     gene            complement(<899647..>902238)
                     /gene="APE2"
                     /locus_tag="KLMA_30403"
                     /db_xref="GeneID:34715679"
     mRNA            complement(<899647..>902238)
                     /gene="APE2"
                     /locus_tag="KLMA_30403"
                     /product="aminopeptidase 2"
                     /transcript_id="XM_022818914.1"
                     /db_xref="GeneID:34715679"
     CDS             complement(899647..902238)
                     /gene="APE2"
                     /locus_tag="KLMA_30403"
                     /codon_start=1
                     /product="aminopeptidase 2"
                     /protein_id="XP_022675534.1"
                     /db_xref="GeneID:34715679"
                     /translation="MSSQPDRVILPQNVTPVHYKLQLEPLFDTFKFNGTVSIDLKVND
                     KDTDFVELNTVELEIHEADIAGVKASDITSDEEEQTTRFTFPTGTLQKAGDSGEIATL
                     NIKFTGILNDKMAGFYRAKYTDKKTGETKYMATTQMEPTDARKAFPCFDEPNLKASFE
                     ISLVSEPHLTHLSNMDVKNEEVVEGKKITHFNPTPNMSTYLVAFIVAELEYVECKDFR
                     IPVRVYATPGSEHLGQYAADLTAKTLDFFEKAFDIKYPLPKMDSVAVHEFSAGAMENW
                     GLITYRVVDLLLDEKNASLERIKRVAEVVQHELAHQWFGNLVTMDWWEGLWLNEGFAT
                     WMSWYACNQFQPQWKVWEQYVADDLQSALGLDSLRSSHPIEVPVKRADEINQIFDHIS
                     YAKGSSLLRMISQWLGEETFVKGVSNYLNKFKFGNAKTEDLWDALSDASGKDVRKVMD
                     IWTKKVGFPIVTVTEDGNKITFKQNRYLNTADVKPEEDTTLYPVFLSLKTKSGVDHSL
                     TLDQRELTVTVDDAEFIKTNANQAGIYITSYSDDRWKALANQAKLLSVEDRTGLVADC
                     KNLSTSGYTSTKNFLYLISQWKNEESFVVWEQIVNSLGSLKAAWAFEPKETLDALNEF
                     TRQLVSDKTHALGWTFSEDESYASQRLKVEMFATSAAAKDPVVVKAALEMFDKYTSGD
                     NAAIPPLIKSVVFNTVARDGDAKNYEKLFNIYKNPSSTDEKLSALRCLGRFEDPSLMK
                     RTLGYLMDGTVLNQDIYIPMGGMRGHKEGIETLWAWTKENWDALHKRFPPSLTMLSSI
                     LSVATSGFTSREAIDDIKSFFKDKSTKGFDQGLAQSLDAITSKANWVDRDREVVAKYL
                     KENNYYK"
     gene            <904417..>905142
                     /gene="FSH1"
                     /locus_tag="KLMA_30404"
                     /db_xref="GeneID:34715680"
     mRNA            <904417..>905142
                     /gene="FSH1"
                     /locus_tag="KLMA_30404"
                     /product="family of serine hydrolases 1"
                     /transcript_id="XM_022818915.1"
                     /db_xref="GeneID:34715680"
     CDS             904417..905142
                     /gene="FSH1"
                     /locus_tag="KLMA_30404"
                     /codon_start=1
                     /product="family of serine hydrolases 1"
                     /protein_id="XP_022675535.1"
                     /db_xref="GeneID:34715680"
                     /translation="MSSTAAPKLLFLHGFLQNGKVFSEKSSGLRKLLKKSNVQCDYMD
                     APVILEKKDLPFEMDDEKWQATLDAGVNRAWFYHSDISSELDLTTAIKSVTDYIKEHG
                     PYDGIVGFSQGAALASIITNKITELLPSHPQFKVSLLISSYSFTEPDPEHEGQLRITE
                     KFRDSFTPMENRSTKMLFVYGTSDMAVPCERAKYLYNIYTNGQELDDCKAYEHPGGHM
                     VPNKKDIIRPIVEEINKSLGIDA"
     gene            <905353..>906099
                     /gene="TAD2"
                     /locus_tag="KLMA_30405"
                     /db_xref="GeneID:34715681"
     mRNA            <905353..>906099
                     /gene="TAD2"
                     /locus_tag="KLMA_30405"
                     /product="tRNA-specific adenosine deaminase subunit TAD2"
                     /transcript_id="XM_022818916.1"
                     /db_xref="GeneID:34715681"
     CDS             905353..906099
                     /gene="TAD2"
                     /locus_tag="KLMA_30405"
                     /codon_start=1
                     /product="tRNA-specific adenosine deaminase subunit TAD2"
                     /protein_id="XP_022675536.1"
                     /db_xref="GeneID:34715681"
                     /translation="MDKDIQHMRTAIKLAKYALDHNETPVACIFVHSKLNKVIAYGMN
                     GTNESISGTSHAEFMGIKQIQDKFGLDPKVFSNIILYVTVEPCIMCASALKQLGIKKV
                     VFGCGNDRFGGNGSILSIHNDTSTVKDNIYVSIPGILRKEAIMLLRYFYVRENERAPK
                     PRAKKDRKLDKEVFPAIEWSKYLTREDFIQEFGKENVQLYDSNSDVFKEVDWKLIDSN
                     YDERFLDTMLNEISSIEVADVDWSKKSKDS"
     gene            complement(<906273..>907466)
                     /gene="SNX4"
                     /locus_tag="KLMA_30406"
                     /db_xref="GeneID:34715682"
     mRNA            complement(<906273..>907466)
                     /gene="SNX4"
                     /locus_tag="KLMA_30406"
                     /product="sorting nexin-4"
                     /transcript_id="XM_022818920.1"
                     /db_xref="GeneID:34715682"
     CDS             complement(906273..907466)
                     /gene="SNX4"
                     /locus_tag="KLMA_30406"
                     /codon_start=1
                     /product="sorting nexin-4"
                     /protein_id="XP_022675537.1"
                     /db_xref="GeneID:34715682"
                     /translation="MSETPVNKEPLRKLSVLVSDPQKQKSHSQTYITYQVSTKIEGQD
                     EHSCVVRRYNDFVLLHQILSNDHPTALVPPLPDKKVLNYLSGDRFSHSFTQKRCRSLQ
                     TFMRRLLKHPELAKSRIVDTFLTSSDWDVYRRNLSGQISTSEVSDVLINAFKHVNRQR
                     EEFVEVKEKSEKLDHNLSHLDKLFHKSVKRVDLIGQNLKKLQASLSALQEHCCEEEDL
                     SNGIKAFNDGIMQLSYALSDLNKYIDYEYDVDIKDMINYIEALKQLIRLKDQKQIDYE
                     ELSEYLTRSINEKNNLLSGYGSGNYFKSKLEELAGVNQEMARRDKIAKLESRVQSLTD
                     EVEKSKQVADEFEKEVLNEVELFEKIKTTELKESFSALAQKHIDFYDDMVDKWTKIEE
                     RLGNV"
     gene            complement(<907780..>909018)
                     /gene="BRE2"
                     /locus_tag="KLMA_30407"
                     /db_xref="GeneID:34715683"
     mRNA            complement(<907780..>909018)
                     /gene="BRE2"
                     /locus_tag="KLMA_30407"
                     /product="COMPASS component BRE2"
                     /transcript_id="XM_022818921.1"
                     /db_xref="GeneID:34715683"
     CDS             complement(907780..909018)
                     /gene="BRE2"
                     /locus_tag="KLMA_30407"
                     /codon_start=1
                     /product="COMPASS component BRE2"
                     /protein_id="XP_022675538.1"
                     /db_xref="GeneID:34715683"
                     /translation="MSVPVIPYHESDIVYQGDDAKKPDFPQLCESHRIDEVQYYVTED
                     MPLNKRNFLYQPCTANLMLEKLRFSSSDYFDSGAISLMDRSDKMAFSLDDRSVSVAQN
                     CGWRSMRSDVCMKEGKIYWEIDVRTVSDTAHIRCGISRREASMETPVGCDFYGYGLKD
                     KGLQVIHEGRLQTVVKSYEVKAGDRIGFLLTLPSLEKQNEQAMDYSLKRIMELNSDSE
                     NGQKRNRKLNKEFYKFLLRKCEPLNVVRDQIAIRYKNQLFYESTDYVKTTKPDYYDNK
                     DETQKFYELEESTLEIYVNGEHYGTAFKGITPFLPPFSELQYNEKFYLHHWNKRNIAH
                     GIEIRNKYVNNNRLGYYATVSSFQGGSAAIITDKSQLKFLVDDPDVKTLDDVYNEQIA
                     SDIVWDLIDEVDIEFSSVNV"
     gene            <909322..>911652
                     /gene="PPR1"
                     /locus_tag="KLMA_30408"
                     /db_xref="GeneID:34715684"
     mRNA            <909322..>911652
                     /gene="PPR1"
                     /locus_tag="KLMA_30408"
                     /product="pyrimidine pathway regulatory protein 1"
                     /transcript_id="XM_022818922.1"
                     /db_xref="GeneID:34715684"
     CDS             909322..911652
                     /gene="PPR1"
                     /locus_tag="KLMA_30408"
                     /codon_start=1
                     /product="pyrimidine pathway regulatory protein 1"
                     /protein_id="XP_022675539.1"
                     /db_xref="GeneID:34715684"
                     /translation="MPNKVTKESASHIYRNVAACKRCRIRKIKCDNKFPSCTKCIQAQ
                     QPCVTIDPSTRREIPRSYVVYLEDKVLALKELLEKNGLNPDDVNENIPTSSNDKPCDL
                     ELFKEREKLREKHKLQNGNEMAGFIINKGTSMLNGIVDNTRDLKDASDQFSKVGKVKQ
                     RAKQDSDLEEPSSSYLGDSSGISFAKMMFTAVKFRPDVLPKQKKKKVGGIDEKNRKFV
                     KKDALYLPPKAKAESMIADYFTASNSQLPVLHRELFLVKYFVPVYGPLSPHISWASDH
                     TKINTKFQIPKAFNPPNFKQPLIEYLAENPNVEKIPSVYHQAMFFLNIVFAIGVSTKT
                     LVDDVLDHRLFKFCADQYQDSLYTSKTNRLEALQGLLLIAIYSLMRPTVPGLWYTLGS
                     AIRLCVDLGLHAEKLNKNYEPFIRDIRRRLFWCCYSMDRQVCAYFGRPVSIPDVNITT
                     IFPSSLDDSLITTTEDNIDDYSSSTLSTPSPSYKCVCLSMFQIRRIQSDIVQTMYAPK
                     ASIPEEFLDLEDWRISILNQLDVWFQKVIPKTSLEMNCSFPMDFFALNYHYTKHILYG
                     LSPKCPTLNNAGFIVVYESSMDIANINYKLTLERKLNYTWVGIHNVFMCGMTYLYVIY
                     HTKQFDDALSGTFDTICNRILFVLEALFDKCTAALNCHKIFKVMSSVVLKLKLESMSK
                     SLDTENVSTQMRTENPLNFLDDDSLQQFFDEMNKNLTSTETVKSQSSGVSPALSDTQT
                     SSGQRDGPRVAEMIQRLGGDGIWGEFFSNNTSFESS"
     gene            <911943..>912275
                     /locus_tag="KLMA_30409"
                     /db_xref="GeneID:34715685"
     mRNA            <911943..>912275
                     /locus_tag="KLMA_30409"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818923.1"
                     /db_xref="GeneID:34715685"
     CDS             911943..912275
                     /locus_tag="KLMA_30409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675540.1"
                     /db_xref="GeneID:34715685"
                     /translation="MFVLKRSFHSSKAVLNVANVKVTLFSKQQCGLCDTAKSVMDQVV
                     QQPKYRSCKYEIVDIMDPDNKEWYDKYCFDVPVLHVQNAEKETLNVEKLFHRFDEKKV
                     QDLIEKFT"
     gene            complement(<912298..>914586)
                     /gene="ZIP1"
                     /locus_tag="KLMA_30410"
                     /db_xref="GeneID:34715686"
     mRNA            complement(<912298..>914586)
                     /gene="ZIP1"
                     /locus_tag="KLMA_30410"
                     /product="synaptonemal complex protein ZIP1"
                     /transcript_id="XM_022818924.1"
                     /db_xref="GeneID:34715686"
     CDS             complement(912298..914586)
                     /gene="ZIP1"
                     /locus_tag="KLMA_30410"
                     /codon_start=1
                     /product="synaptonemal complex protein ZIP1"
                     /protein_id="XP_022675541.1"
                     /db_xref="GeneID:34715686"
                     /translation="MSNFFRDNNIVFKPRRNIFSKLRNPKDGESDVSNSSSIMDNPFF
                     NKTDDSMKISTPNDKQPIPKDIMRSTPTSSPIRNLRVENMEPEGEEEGELEITEVREV
                     TLPALDPLLKNTGKEEEYSELAANTTVNASSNDVLLEAFTNTQRICSKLKLELQRQQQ
                     KNGQQKEQIDQYKSEISNMSDKIGSHRNLLTLLEEQMKALKQNKSETDILISELSSNY
                     TTLSNKVKTSTAECESLKSTLHQQKSYQKNLELTIQQKKKELDYLKKELDNCSGQLSE
                     EKIKYNELLQQITTSKTEITATFRELFAKNGTEVITNIEDLQNRISTSTSSIEDRIKE
                     HSVDIKNTLVVDFNTNKEFILTELDKQNNIFTELTLETKEIIGNETKKMFKGFTDVNT
                     ALTEMKSIFNKASDQSEELIKTSFDLNKKSLEEAVSGLASDIQNIPKILSTLDQKIAS
                     AANYESQINSLKEQLQSVMLQKTEVVSLLKSKDHEIEELNTKIFLKTHELDELSSKDE
                     RLQNELITEKRLRESSENDLSQLKKESDETTASLHSKLSAKTEIASLLEKELETSKQE
                     LQTANRTNNQINEELQAFKSKIDTLQQQFQKVNVELVQSKAKELELEEINRSLKEQFD
                     ELETTSNQTSGSVIKLNDKIHQLEKDKSSLNLEKLSLLDKIDELENKLKGTNNQKRTS
                     VVFDHLKQKNNGNNTKSNEDDAFALSSDDLELTNPEFSLIKPIEPCRMPSKLVKSSRR
                     KKLLLSDDMEESSRLKRSKRFK"
     gene            complement(<915007..>916089)
                     /gene="YIM1"
                     /locus_tag="KLMA_30411"
                     /db_xref="GeneID:34715687"
     mRNA            complement(<915007..>916089)
                     /gene="YIM1"
                     /locus_tag="KLMA_30411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818925.1"
                     /db_xref="GeneID:34715687"
     CDS             complement(915007..916089)
                     /gene="YIM1"
                     /locus_tag="KLMA_30411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675542.1"
                     /db_xref="GeneID:34715687"
                     /translation="MVLNRALTYVDNSSPLTIIENEIDLDKCYKDNEIVIRVHAAAFN
                     PVDFILHDLANKWIAGSKPKTIGRDYSGVIVKAGSKVSKDWAVGDKVCGLFDALYNEQ
                     GTVRDYLVLDPEGSRAKLLTKLPEFHDSQYSDFELGAAWPLVFGTALEGFTEYGQKFT
                     DKSNVLVLGASTSVGYHVAKIAKQLYNVHAVVGTCNSKSFERNKEVGYDYLVAYDTED
                     IPSRLKEIVKNELNGEKFDLIYDCTGYQGLIPEINEYLKPKSENSQYITICGKAKHDF
                     NTKTPIRTAIGNMLAGFGALRYSFNYHMLMLKTDRKIPVAFHELVKKGNYKPPIDSVL
                     SLEEFKVAETKMRKYGAKGKIIIKLE"
     gene            <916976..>917863
                     /gene="DPP1"
                     /locus_tag="KLMA_30412"
                     /db_xref="GeneID:34715688"
     mRNA            <916976..>917863
                     /gene="DPP1"
                     /locus_tag="KLMA_30412"
                     /product="diacylglycerol pyrophosphate phosphatase 1"
                     /transcript_id="XM_022818926.1"
                     /db_xref="GeneID:34715688"
     CDS             916976..917863
                     /gene="DPP1"
                     /locus_tag="KLMA_30412"
                     /codon_start=1
                     /product="diacylglycerol pyrophosphate phosphatase 1"
                     /protein_id="XP_022675543.1"
                     /db_xref="GeneID:34715688"
                     /translation="MGIDRLSFGADRFKFYASFKKWKISDVILCGILFLINIPVYYQL
                     PFQRQFFVNDLTISHPHAEIETVSNSALVVYSYFIPFFTIILFSLVLAHEKHRWYLLY
                     ISLLGLTMSWISTSLLTNYLKNWFGRHRPDFLSRCIPRADAPLNTMVFAVDVCTTGNL
                     DRLYDGFRTTPSGHSSESFAGLGFLFLWLSGQLLAEYPETGAWRTIVASLPLLSASVI
                     ALSRTQDYRHHFIDVLIGSLLGFVIALWSYRRYFPSIYSKLPFKPLLDDSDVTLEEYR
                     PVNGATDEEVLPISEGSLN"
     gene            <918354..>923375
                     /gene="GCN2"
                     /locus_tag="KLMA_30413"
                     /db_xref="GeneID:34715689"
     mRNA            <918354..>923375
                     /gene="GCN2"
                     /locus_tag="KLMA_30413"
                     /product="serine/threonine-protein kinase GCN2"
                     /transcript_id="XM_022818927.1"
                     /db_xref="GeneID:34715689"
     CDS             918354..923375
                     /gene="GCN2"
                     /locus_tag="KLMA_30413"
                     /codon_start=1
                     /product="serine/threonine-protein kinase GCN2"
                     /protein_id="XP_022675544.1"
                     /db_xref="GeneID:34715689"
                     /translation="MSMSNLTLEQYYEIQKLEMEAIQSIYMDDFTDLTKRHSSWDKHP
                     QIIFEVRLRSQESKPAESSLDLHVVLPSTYPHASPQITFKHVVNVPDGQLNKVRKDIK
                     EIHQRAKGQEIIYEIIIAVQEILEDSQKRVVTDSLEDQRLQRIKDEEERMKREEEQKL
                     KQREKQKMQEQQYIDELFQKELAKRLDDDVADDNDKEIDLLPPPELTASGQAFIFPRP
                     ITAKLPNNSHYKFRAVIQPQPITLCDDPLSFANQMLVKPYIPAESPLYNVLKSSDKLD
                     SIQYLLSEIILDNPYFNTSNGKKEIALLEKDLESVLQVTHDNVCSLYAFHVERVGKNS
                     ATFQWKIRLLTEYSQFNSLNDVVTSVGFVNLYTARGWILRLLEGLENLHKHGIAHKLI
                     DMHTVQLTKDTDFGTTLPKFIHPSYGYSILSMICRYPNKHGVKLEFPESKWTAPELIK
                     FKGSKPQRKTDIWQLAVLFIVIITGVDTTLNYRSPGDFLESVEMDEALYDFLRKMLNP
                     EPKQRLTPLELLPMKFLRTNIDPSWNKLNLYPDTSHSSRLLSNVASSSGTQVLHSRTT
                     SRASTDGGRRRSFNIGSRFSSLTSTSRSRYATDFEEIAVLGKGAYGQVVKARNALDSR
                     YYAIKKIRHSEEKLSTILSEVMLLASLNHRYVVRYYAAWLEEENSYTDSNAIDSDDDS
                     STGSDLESDLDSDITRSSDGLSSRNRSLAHLNSNNWDFISNSFQGSYPEIVFGNSSDE
                     DIEDGCDVSASVDEKAGADSTMDETEEKDNVTDMKFNKIKRQNGRFGSQKSSLKSTLF
                     IQMEYCENRTLYDLIHTESLNNQREEYWRLFRQILEALSYIHSQGIIHRDLKPMNIFI
                     DESRNIKIGDFGLAKNVQKPQESLGRDSFASAGSSGDLTSAIGTALYVASEIITSHGN
                     YNEKVDMYSLGVIFFEMIYPFDTGMERVDVLKKLRSVDVEFPSDFDEKKLPTEKKIIR
                     LLLDHDPTKRPSASALLRSGWVPVKNQDELIKEALKNISDPSSPWQQQVRESLFSQPY
                     HLSNDILFDLSRTDTTPFLQLLRAQMMDEVTKIFRRHGAIENNEPPMIFPKAPIYSTQ
                     NVYEVLDRGGSVLQLQYDLTYPMARYLSKNPNTTSKQYRMQYVFRPSESNHSSTEPRK
                     FGEVDFDIISNTTTDSAVHDAECLKVVDEIVSAFPVFTKTNVTLVLNHSDILDGVFDF
                     CNIDKAQRSLVSHMLSQLGFGKTFKDLKADLKTQLNISSTALNDLELFDFKSDLDTAK
                     KRLEKHLVDSPYLKRVEEALVYISKVVDYFKPLGVTRNVVIAPLSNYNNGFYKGGLMF
                     QSVFDSGRSRSLISAGGRYDNLISLIARPSGGKLNHIQKAVGFNLAWETMFLIVKNYF
                     KLAGGRSTKKISKGLKLTNSEWKPKRCEVLISSFSNSLLNTIGIEVISKLWKAGISAD
                     IVRDCFSVEDVITAAQKDGVDWIVLIKQQNYSISNNKRRYKPFKVKNLSSNLDSDMDF
                     EEFLLTYEDSFSKDSTNDSMNKEDYFNEYDDRNRWDDNSSQERSQDGETDNLSSNGPQ
                     KVIYIPNPATRAKGKPSKKDKWVYEESARNASKQLIHSLSSVPIFAVDAIRDETLEII
                     SITSLAQKDEWLRKVFGSAANSAPRSFATSIYNNLSKEAAKGGRWAIVHCNKTGKSCV
                     VDLQR"
     gene            <923961..>924431
                     /gene="SRB2"
                     /locus_tag="KLMA_30414"
                     /db_xref="GeneID:34715690"
     mRNA            <923961..>924431
                     /gene="SRB2"
                     /locus_tag="KLMA_30414"
                     /product="mediator of RNA polymerase II transcription
                     subunit"
                     /transcript_id="XM_022818928.1"
                     /db_xref="GeneID:34715690"
     CDS             923961..924431
                     /gene="SRB2"
                     /locus_tag="KLMA_30414"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit"
                     /protein_id="XP_022675545.1"
                     /db_xref="GeneID:34715690"
                     /translation="MHTLQLSHKSNETITIKNQSAIITPTHVHKDLYDNGCVFGTPEP
                     FDYMLSNKLSNIWTQRQSIKGEFGVTYHTADLVIRTNNAFSYSGFQGLILEIESKSLN
                     SFESFKKNFEKVQGMLHEMGLKDVKVSLDKFQKLDTTENFNLFDLAFQYLKVLG"
     gene            complement(<924525..>925652)
                     /gene="RTT103"
                     /locus_tag="KLMA_30415"
                     /db_xref="GeneID:34715691"
     mRNA            complement(<924525..>925652)
                     /gene="RTT103"
                     /locus_tag="KLMA_30415"
                     /product="regulator of Ty1 transposition"
                     /transcript_id="XM_022818929.1"
                     /db_xref="GeneID:34715691"
     CDS             complement(924525..925652)
                     /gene="RTT103"
                     /locus_tag="KLMA_30415"
                     /codon_start=1
                     /product="regulator of Ty1 transposition"
                     /protein_id="XP_022675546.1"
                     /db_xref="GeneID:34715691"
                     /translation="MVFSREQFISKVQSLDETQDSIVSTSKWILTLYKEADKVATTWV
                     EYLSKSSISTKRKLLVIYLANDIVQQAKHRQVPNFDKSFGKVLPSALEKVYVDFPSDI
                     RSKVRRVVGIWRQRRVLSESVLDDIDKRLDAVSSKSSPGPVSGKAEKISTNSGSGKVN
                     KKWSAISSAYDKIEQQEKAYATLRLRFDKSIEALEPNSVVYAENFNVISKIGNSVKES
                     LTKSIGLRTDVITQLEKLITEQKDLLNKEQDSINEIDSMIMDKDPSNLNQTLAADDPD
                     LLPTYENDDDNDDDSSSSDNDDDKSEDNKRLSNNTDDSLVGSNSEKSSSEEPNTKKQK
                     VESSNQNPSNSSNSSTASPSKNNNNVTIASSIQDLLSRLAD"
     gene            <926167..>929436
                     /gene="HRQ1"
                     /locus_tag="KLMA_30416"
                     /db_xref="GeneID:34715692"
     mRNA            <926167..>929436
                     /gene="HRQ1"
                     /locus_tag="KLMA_30416"
                     /product="putative ATP-dependent helicase HRQ1"
                     /transcript_id="XM_022818931.1"
                     /db_xref="GeneID:34715692"
     CDS             926167..929436
                     /gene="HRQ1"
                     /locus_tag="KLMA_30416"
                     /codon_start=1
                     /product="putative ATP-dependent helicase HRQ1"
                     /protein_id="XP_022675547.1"
                     /db_xref="GeneID:34715692"
                     /translation="MNNSDKEPEAKKRKVVNDEFSELKKIFFRLNTFYTFLITRNHII
                     TTFDTLKPPIEKAIRRPLTEQDLAQICVIMPGDTVFKYMDRNQFQVEKKEFDFKHGGF
                     KQKDNDIFELKPQDQDEENDSHDDQVLVFQFKDGNMMNTWKKKLFKTDMNAPDFTTDA
                     MKKMIAKRKMNFEAGLSRFIFNCQLEGKNPKNELQRLSLAYTPQKKDFMDPIELMLKA
                     KGSNSKNDTVTNEAGDTRPTIPILLEKIKNSNIYNDQIKNSYIIPERLAQYGELEFEL
                     SPEVYQALEHSRFYIHQAAAINRIHNKENVIITTSTSSGKSLIYQLSAIDMLLKDPQS
                     TFMYIFPTKALAQDQKRSFQKLLSRIPELSHVVVETYDGDTEQEARAGIRIGARVIFT
                     NPDMIHTSILPNHPNWRMFLENLRYVVVDELHIYKGFFGSHVALVMRRLLRLVKGFYK
                     NEGLQFISCSATLKNPIQHMKDIFGIENVSLIDEDGSPRGNKHLVVWNPPTLSQHERK
                     RENFIAESAKILVQLIIQNVRTIAFCYVRRVCELLMKEVRLLLQEMGKLELINEVMSY
                     RGGYSASDRRKIEQEMFHGNLRAVVSTNALELGIDIGGLDAVLMCGFPLSLANFHQQS
                     GRAGRRNKDSLTLVVASDSPVDQHYVSHSDVLLEIDNPDAYQDLVLDFDNMLMFESHI
                     QCAAFELPIDIERDCKYFDIKKLTTICETRLQHDKNGYHANDRFLPWPSALISLRGSE
                     EDIFAVVDITNGRNVIMEEVEASRTSFTLYDGGIFIHQGYPYLVKEFNPDEKYAKVQR
                     VDVDWTTSQRDFTDVDPEEIEQIRSMQNSDVPVYYGKIKTTIIVFGFFKIDKQGRILD
                     AVETHNPPVVINSKGLWIDIPRRALELIQGKSLNIAGGIHAAQHAILGLLPRFIVTGV
                     DEISTECKAPEKEFAERQSSRKRPARLVFYDSKGGNQGSGLCLKSFEHIEEILIGALQ
                     RVEECPCDDGCPECVAAAFCKENSLVLSKPASLIILHCILGHKKSSFISRIREGPEPN
                     MPDIKVETVVPVSGHIKFSKDLQIIDVRKITDGEEKVVEIKEEEYPEENNGLGHNTGS
                     E"
     gene            complement(<929530..>931359)
                     /gene="SRP101"
                     /locus_tag="KLMA_30417"
                     /db_xref="GeneID:34715693"
     mRNA            complement(<929530..>931359)
                     /gene="SRP101"
                     /locus_tag="KLMA_30417"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818932.1"
                     /db_xref="GeneID:34715693"
     CDS             complement(929530..931359)
                     /gene="SRP101"
                     /locus_tag="KLMA_30417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675548.1"
                     /db_xref="GeneID:34715693"
                     /translation="MIDQFAVFTPLGNLLYGYNSLNKKFSESQINRFVDEFISQPVKN
                     VTSKYPILSTADSSFMYYESKQPHLFFVVSFASAESMQLTSEAESLLSVATKLWESLD
                     LDKIILDNLSGKGKKNVHNFRFVTEDADEKLAKFGTYFEVKYNEMKKVPQQKGKKQKG
                     SQNYNQNQNQSQAVSKSKNANQSKKDSKGSTNSGKNSKSRKWGMDGSLEETGIMDPSL
                     DFSESNEKDISPALASDLETDLQNSAQFGKENDKGEFLISEIDELLASNKQKSKSKDT
                     SSSPFSFLQKHILGNKTISENDLVAVLDKLKQKLISKNVAPEVADYLCNQVSKDLVGS
                     KTENWTSVDQTARMSLQKCLSSILTPSVSVDLLHEIQQKINKKDSNGLNDPYVFSVVG
                     VNGVGKSTNLSKLAFWLLKNNLRVLIVACDTFRSGAVEQLRVHVENLAQLTDENHVRG
                     SKNRRGKTGNEHVELFEGGYGGSNLVTKIAKQAIKYAKTEHFDVVLMDTAGRRHNDAT
                     LMSPLKSFAEQANPDKIIMVGEALVGTDSVQQANNFNQAFGKDRNLDFFIISKCDTVG
                     ELLGTMVNMVYATSIPILFIGVGQTYTDLRTLSVEWAVNSLLS"
     gene            <932002..>933564
                     /gene="OLE1"
                     /locus_tag="KLMA_30418"
                     /db_xref="GeneID:34715694"
     mRNA            <932002..>933564
                     /gene="OLE1"
                     /locus_tag="KLMA_30418"
                     /product="probable acyl-CoA desaturase"
                     /transcript_id="XM_022818933.1"
                     /db_xref="GeneID:34715694"
     CDS             932002..933564
                     /gene="OLE1"
                     /locus_tag="KLMA_30418"
                     /codon_start=1
                     /product="probable acyl-CoA desaturase"
                     /protein_id="XP_022675549.1"
                     /db_xref="GeneID:34715694"
                     /translation="MSDEAQDGGIPEFDYTELLQQTIDVDVPSQVQERVVETAAVKNP
                     TIKHRDHPLVHLLKKVDVGSTIFCIIIPLFSLFKLILSKPAYNKDLLMMLAVYWFLSE
                     ISLVAGYHRFFTHSSYQVHIAIQFCMAVVGASCGLGSILDFTSQHMVHHRHIDTEKDP
                     HSQSVYGYLFSLWGHRFFRGNRKSIRAIAKCRETIVSTSRATYDNHTTQLIRSASYPL
                     LLWQDTNYLQLWVLTNLLLPFVVSKYFIELPVWNCIFYLGFVRMSIVQQQWLIIGALC
                     HWKNFPLSKQPFDDSKTAVDLTLGWIGDILTFGEANHNFHHEFPGDYRNGTDNFTIDP
                     AKWVISALQWLNLAKNLHKVSQEQIEKCLVQQQQKIIDEESAKLRWGIPIDRLPGMTS
                     QQFVKLAKDEYAKNLKAYVAIDGIVHDVTPFIYDHPGGVALVETSIGKDATQAFNGAV
                     YSHSNAARNLLATMRVAVITDQTSTIQTTRWEQNSIADATRRNGMEGQEVGRTRKHVT
                     FTRRNYYAAGAA"
     gene            complement(<933754..>934947)
                     /gene="BCD1"
                     /locus_tag="KLMA_30419"
                     /db_xref="GeneID:34715695"
     mRNA            complement(<933754..>934947)
                     /gene="BCD1"
                     /locus_tag="KLMA_30419"
                     /product="box C/D snoRNA protein 1"
                     /transcript_id="XM_022818934.1"
                     /db_xref="GeneID:34715695"
     CDS             complement(933754..934947)
                     /gene="BCD1"
                     /locus_tag="KLMA_30419"
                     /codon_start=1
                     /product="box C/D snoRNA protein 1"
                     /protein_id="XP_022675550.1"
                     /db_xref="GeneID:34715695"
                     /translation="MELCEVCQQNEWKYKCPRCLKRTCSVVCSKKHKEADSCSGISSV
                     TEYISSESLKGADTEEEMNHLVQRDYNFLIGMNRKLSILKEDGKNKNKRALQKVPAAA
                     AQTQAGNTYQVTKPHKVLRRGVKCLLLPKGMQRSLSNKSKWDKPLDTFVWSLEWILVD
                     TRENVGANNISWKHLSHRNKEESKLVECLGKQVYDKCKEFYCKETTVTDQEAATTKDD
                     RSNHILNMGLRFFTKWFPNNVESIMDTKEVIEIDPRQCVGEIFKDRTVIEFPTIYIAP
                     NLESLTKLELNLHVEGQEKSLPVMSRYNNSTKPASDNRVPALHSKSESSSESDPSSSS
                     SSSSDSSSSSDSDSDSDSSTPEENSTANPAGTAHDSNSDSDSSSEKEDEDGYEVGVSL
                     DFLAS"
     gene            <935467..>935808
                     /gene="VMA10"
                     /locus_tag="KLMA_30420"
                     /db_xref="GeneID:34715696"
     mRNA            <935467..>935808
                     /gene="VMA10"
                     /locus_tag="KLMA_30420"
                     /product="v-type proton ATPase subunit G"
                     /transcript_id="XM_022818935.1"
                     /db_xref="GeneID:34715696"
     CDS             935467..935808
                     /gene="VMA10"
                     /locus_tag="KLMA_30420"
                     /codon_start=1
                     /product="v-type proton ATPase subunit G"
                     /protein_id="XP_022675551.1"
                     /db_xref="GeneID:34715696"
                     /translation="MSQNGIATLLKAEKEAHEIVAKARQHRQELLKQAKTDAAAEIAQ
                     YKAKKEQELKQIEASNEGGVEGLEKEAEQSVQQELKEIKEVASKKEDDVVKLLIKAVT
                     APAAEMHINAS"
     gene            <936278..>938200
                     /gene="ALDH22A1"
                     /locus_tag="KLMA_30421"
                     /db_xref="GeneID:34715697"
     mRNA            <936278..>938200
                     /gene="ALDH22A1"
                     /locus_tag="KLMA_30421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818936.1"
                     /db_xref="GeneID:34715697"
     CDS             936278..938200
                     /gene="ALDH22A1"
                     /locus_tag="KLMA_30421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675552.1"
                     /db_xref="GeneID:34715697"
                     /translation="MNASAEEVYLNSSLLQQLNATVQAYLAELVSTGQTFNSSQIVGE
                     NVRCTSGSIVVGLVTLYLVYYLLFSKNKVPSAVQFKVEIPDAAQKHWKGKRIFPCSVF
                     NPEQPGMIQSYCPATGQFLGSFKSMTESDIDNVINAASAAQVEWAKTSYKERLQVLLS
                     LKYYILENQEAIARVACRDSGKTMLDASMGEILVTLEKIEWIMKHGEKVLKPSKRPGP
                     TNFFMKWYKGAEVRYEPLGVVGAIVSWNYPFHNLLGPIVASIFTGNAVVVKCSEQVVW
                     SSNVFTLMVQEALKVCGHDPNLVQLCYSLPPSENDNAANYFTSHPGFKHLTFIGSKPV
                     AHHVLRAASVSLTPVVVELGGKDAFIVLDSVKDLQSLSSIIMRGTFQSAGQNCIGIER
                     VIVSAKNYDKLVAILNEKVGQLRLGSDIDNLEDVDMGAMISDNRFEQLENLVSDAVSK
                     GARLLHGGSRYNHPNYPQGHFFQPTLLVDVTEEMEIAQNEVFGPVLTVMKANNTDDCI
                     RLANSAPFGLGGSIFGADYEECDRVANSLVTGNVAINDFATFYVCQLPFGGLNGSGYG
                     KFGGEEGLLGLCNAKSVCYDKLPFVSTQIPKPLDYPIRNNTKAWNFVKSFITGAYAIS
                     TWQRIKSLISLAKNAN"
     gene            complement(<938480..>939202)
                     /gene="RRF1"
                     /locus_tag="KLMA_30422"
                     /db_xref="GeneID:34715698"
     mRNA            complement(<938480..>939202)
                     /gene="RRF1"
                     /locus_tag="KLMA_30422"
                     /product="ribosome-recycling factor"
                     /transcript_id="XM_022818937.1"
                     /db_xref="GeneID:34715698"
     CDS             complement(938480..939202)
                     /gene="RRF1"
                     /locus_tag="KLMA_30422"
                     /codon_start=1
                     /product="ribosome-recycling factor"
                     /protein_id="XP_022675553.1"
                     /db_xref="GeneID:34715698"
                     /translation="MSTQAFRVVLAGTKNASFVNVRGFNSSALLFAKKKAKAAKGGKN
                     STEEPLEVIDVKKYVKDATNQFEKTLELHKKKLAEKKIGTASPAIFNDLKVGKDGQKF
                     TNVAATSLKGRNSLIVTVFDPKDTKNVVSAIMGAGMNLNPERIPNNDQQLKVSLPPIT
                     TETRQALCKDLKKVFEDYKHSAMKDSLGHIRSEIMKDLKHLEKKNDDVKKVIQDIEKV
                     HKEYVNKLQEQLKQAEKSIMNQ"
     gene            complement(<939829..>943368)
                     /gene="SSD1"
                     /locus_tag="KLMA_30423"
                     /db_xref="GeneID:34715699"
     mRNA            complement(<939829..>943368)
                     /gene="SSD1"
                     /locus_tag="KLMA_30423"
                     /product="protein SSD1"
                     /transcript_id="XM_022818938.1"
                     /db_xref="GeneID:34715699"
     CDS             complement(939829..943368)
                     /gene="SSD1"
                     /locus_tag="KLMA_30423"
                     /codon_start=1
                     /product="protein SSD1"
                     /protein_id="XP_022675554.1"
                     /db_xref="GeneID:34715699"
                     /translation="MSDQERFVKTTGGKGNPKQIHIAHRKSPSELTNLMIEQFTLQKQ
                     AENDNSGGSSSSQNQGAGSFLPQPPNVPYQLSPNSGGRKGRSHSRSGSAYYNNNDHKQ
                     NTPATGHRRTGSQTSVYGHSRRQSIGLNEAKRAAAEEQAKRESCPHIKVDNPQDIPKL
                     ANENEQTSYKFPGSPPPTDSKNNSHRRTQSNMSPNRAFQFPPAKVNQKENNDDFIPVG
                     TPHRRTNSRNEGIDGNWRVQQQQQMSPFYHSRTHSREFSGHPGLEPPPIFQPGHKSRG
                     SNASTHSFNSANGQQQQNSNGRKSLFAPYLPQANIPQLIEEGKLVAGILRVNKKNRSD
                     AWVSTNGVLDADIFICGSKDRNRALEGDLVAVELLLVDDVWESKKEKEEKKRRKDASA
                     QQDIIPLDSKDDYHNDASTSIVSGTTASTESKDTDNTLGSSSGSIKRRGSLKQRPTQK
                     KNDDVEVEGQSLLLVEEEEINDDYKPLYAGHVVAVLDRIPGQLFSGTLGLLRPSQQAN
                     NDVNKPNKPKIVWFKPTDKKVPLIAIPIEQAPKDFVENADKYQNKVFVASIKRWPITS
                     LHPFGTLVSQLGELNDPKTEIDAILRDNNFLSDEYLDPRDRTKERDSFQPVILSQEET
                     NSRRLYENVIAISETGELSNYSVHLRDTENGNIELGFHVVDVTLHIEESSSLDRRARK
                     RSSAVFMPQTTVHLLPASLNEFLSLQPDKISNTLSVVYELHPENFDVISTWIGETRVK
                     PTTTLTHERLNQELEKPASSRSKFVDKLESVARNFHHYRLNSKTADLYRTLPLLESLD
                     DEKVKPDLNILQRSKALALLSEIERKVNNTVATRLFTSLGDVAFLRRQPEPISTKLKT
                     FQKKVEKLGVPMDVMSSESVLNSILAIDDDITRMAIELFLSKTLTPAKYFISGKVEPD
                     QFAHYSLNLPLYTHFTAPLRRYSDHVVHRQLKSIINGSEYKETVDALKITSEYCNFKK
                     DCAHHAQEQAIHLLLCKTTNDMGNQHGQILTLATVLQVYESSFDVFIPELGIEKRVHG
                     DQLPLVKAEFDMAERVLELYWKKGVDSATFVPTDEQNPKSYRNSIKNKFNSSSKEIAV
                     NQSVLQNKLVSEEFSKELKELNLIPPTLKLPKSNIEDALEKYLEVAVTRQEGDNNIQE
                     IRELQQVPILLRAEIGMALPCLTVRALNPFMRS"
     gene            complement(<944416..>946143)
                     /locus_tag="KLMA_30424"
                     /db_xref="GeneID:34715700"
     mRNA            complement(<944416..>946143)
                     /locus_tag="KLMA_30424"
                     /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
                     /transcript_id="XM_022818939.1"
                     /db_xref="GeneID:34715700"
     CDS             complement(944416..946143)
                     /locus_tag="KLMA_30424"
                     /codon_start=1
                     /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="XP_022675555.1"
                     /db_xref="GeneID:34715700"
                     /translation="MLSRIGLLRSSKRCIAQLSHIQPPKHIGNEPVKAFGSKDLVDWD
                     LLRASLSKFKNSSLDVPLVINGERIYYNEDGGKRGISQQLNPANHSEVLANVTQATNA
                     DVQAAIKASKEAKDKWYKLPFYERASVFLKAADLICTKYRYDMLAATMLGQGKNVYQA
                     EIDCITELADFFRFNVKYANELYAQQPLESSPGVWNRAEYRPLEGFVYAVTPFNFTAI
                     AGNLVGAPALMGNTVVWKPSQNASLSNYLLLTVLEEAGLPKGVVNFVPGNPVEVTKEV
                     LGDPSFAALHFTGSTAVFKKLYGDIQNGVVSGLYKDYPRIVGETGGKNFHLIHPSANI
                     PHSVLSTLRGAFEFQGQKCSATSRLYLPESKSNEFLTDLIGTLSEIQPVNTSASKING
                     GNLHGFVGPVIHEQSFDKLAKVIDDAKNDPEVEIIYGGTYDKSKGYYIQPTVFKTTNP
                     RHPYLSQEFFGPLLTVYEYPDAKFEEVCELIDTTSQYGLTGSIFARDREAIAIADEKL
                     KYSAGNFYINDKSTGAVVAQQWFGGARMSGTNDKAGSGNILSRFVSVRNIKENYYELT
                     DYKYPSNYE"
     gene            complement(<946720..>948123)
                     /gene="BRL1"
                     /locus_tag="KLMA_30425"
                     /db_xref="GeneID:34715701"
     mRNA            complement(<946720..>948123)
                     /gene="BRL1"
                     /locus_tag="KLMA_30425"
                     /product="nucleus export protein BRL1"
                     /transcript_id="XM_022818940.1"
                     /db_xref="GeneID:34715701"
     CDS             complement(946720..948123)
                     /gene="BRL1"
                     /locus_tag="KLMA_30425"
                     /codon_start=1
                     /product="nucleus export protein BRL1"
                     /protein_id="XP_022675556.1"
                     /db_xref="GeneID:34715701"
                     /translation="MDEFNALSLNSTIQDDTLEESDLLAISNLSISEKKPIAEDLISK
                     FLPYSPPCPSPLRSTVSIPESCLSDKMDIDEEYDNSLNVNTIPGNKSNEDIIEEIETE
                     DEDDTNREQKGLIKALLSPTSLGIALATRDLNKNEQDEDHKQLGQQNEQEESKDVPVT
                     ITDKLPTEPTEEKTSAESISSSNEGSQNVSGLQTPERQKRPWQINIQNHHHYYMVTDA
                     NGEPYKYTPPIEEVEQAENENENQLPVPWSSKSRPASKASYAFTTYLQMALNTLTVMI
                     ICSTITAFAKSVRTDIRATWEHQKLELDYESAKCKVQYLANHCADNEVVPALYDQCNE
                     WARCMSRNNKIYFRARTSLGAKLFAEIVNSLIEPLGWKTLLVILLTLAIWCFSSNFVL
                     GFMRAKSYYGGSPTQTHPQIQSKSQPNAGCLLASEVPPASAIVVTNTDSNTKTSASSN
                     SASSSSSPALSKKNMFT"
     gene            complement(<948471..>950207)
                     /gene="DPL1"
                     /locus_tag="KLMA_30426"
                     /db_xref="GeneID:34715702"
     mRNA            complement(<948471..>950207)
                     /gene="DPL1"
                     /locus_tag="KLMA_30426"
                     /product="sphingosine-1-phosphate lyase"
                     /transcript_id="XM_022818942.1"
                     /db_xref="GeneID:34715702"
     CDS             complement(948471..950207)
                     /gene="DPL1"
                     /locus_tag="KLMA_30426"
                     /codon_start=1
                     /product="sphingosine-1-phosphate lyase"
                     /protein_id="XP_022675557.1"
                     /db_xref="GeneID:34715702"
                     /translation="MEYLEGLQKRFYLGYSYKYNTFQFNPVILVDSLKLEIQQYLKNT
                     PWYWILRDCVFIHLVFKFFSKILLYIRGYGLITSLGKLYHYFGKRLFSVILSMPGIRG
                     SVEKQVSKALTSIEADLIKNDPQLEDYTELPSEGLSEEKVLESLDKLNSVLRHSDWKN
                     GKVSGAVYHGGDELIDLQSKAFQKYCIANQLHPDVFPGVRKMEAEVVSMVLKMFNAPE
                     TGCGTTTSGGTESLLLACLSAKMYGLRFKGIREPEMIIPKTAHAGFDKAGYYFGIKIH
                     HVDLDPVTYQCDVKQMKRLINRNTVLLAGSAPNFPHGIIDDIETIGKLGEKYKIPVHV
                     DCCLGSFIVAFMAKAGFDDVPLFDFRVPGVTSISCDTHKYGFAPKGSSVIMYRSPLLR
                     KQQYYVSTDWTGGLYGSPTLAGSRPGALVVGCWATLVHFGEKGYIESCKEIVGKARSL
                     KEFIKKEVPDLQILGDPLCSVISFTSNTINIYELSDTLSKSGWHFSALQKPASVHFAL
                     THLTLQSIDELKQALKTTVEKMKSEPNAKPSSDGTGALYGVAGSVKTAGVADRLIEGF
                     LDSLYKLEPETY"
     gene            complement(<950791..>952980)
                     /gene="HDA2"
                     /locus_tag="KLMA_30427"
                     /db_xref="GeneID:34715703"
     mRNA            complement(<950791..>952980)
                     /gene="HDA2"
                     /locus_tag="KLMA_30427"
                     /product="HDA1 complex subunit 2"
                     /transcript_id="XM_022818943.1"
                     /db_xref="GeneID:34715703"
     CDS             complement(950791..952980)
                     /gene="HDA2"
                     /locus_tag="KLMA_30427"
                     /codon_start=1
                     /product="HDA1 complex subunit 2"
                     /protein_id="XP_022675558.1"
                     /db_xref="GeneID:34715703"
                     /translation="MFLYYILWLDFLHKQRSLVAEFRHNIVFFFFLYAQKNVSLRIAR
                     HFRFQRNAKRSFHKGIYGCHYTVYYVKASEAKVRKDQKNKKTVGPETTANMNLSSSRT
                     QVFCIPVGLTQVQKDLLEILISIHAESFVSCIDKSLVPKLPVKHEADHDDVKRDLSMV
                     ALTDVQLTEWFFENIRAVSNHPCLLVEHYMPRQFLLMEPSERLISTSDKFGKLNLMVD
                     LLLNRKDKSRLLQIAIVSHSVKELDLIEGVMLGKVAKLKRLSGTSLFDEKHEYDDQSF
                     GVNSSNAENGSAMGSVGPESNFKTKDEYNYSKSKRKNDKGAQLDWLFLATTTHLTHSE
                     DLFSRFNLDVIISFDPMLDDSLPSIYKVRKNGKKIPLVKLLVQDSPDHYLLSQRKSLL
                     KDEAVQLDSIVHFLKYRADDKNLVSLRQYEDITSALIKGENPAALIPEMTTGSDKDSD
                     DLTPFLTTPLGLMDLTYGKYELPLQSGPMDIKSYQHILKTLTAERLKQCSIEYEEREK
                     LVLETRIRETKRLNDYDELKVQAGQYFKKLKENEGKLNDSEKRVERTKSDLDILDERL
                     TKLLDRKSELLKLLELSDVSSEIDSRKQISEKLSTDVDELRKRNDEEGTRNEELRSEY
                     QEKSSEAAAKALYTSKLKSEKEELERKLNGPYTKWQLQTLQDKERKLKTTLRKLVQQS
                     QFLIQYMNRVQDQYNIENEPTKKPSPSTNHSSRYTTRTTRATSPTYT"
     gene            complement(<953039..>955030)
                     /locus_tag="KLMA_30428"
                     /db_xref="GeneID:34715704"
     mRNA            complement(<953039..>955030)
                     /locus_tag="KLMA_30428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818944.1"
                     /db_xref="GeneID:34715704"
     CDS             complement(953039..955030)
                     /locus_tag="KLMA_30428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675559.1"
                     /db_xref="GeneID:34715704"
                     /translation="MIELNYGAVPTSRTDTLARVLDCGDDNTGCISAICEPQLTIHEP
                     MDFGSSVGILPCKDCSGYANYLSPKSPDGKAGWFCSFCNAFNETGVTPESGFYVKRLG
                     SVNDLDPSRTVVIVDLNSEFENDISILKSLEFGTPLSLALVTIEDGSVSIHCSDFSRV
                     IIDAESSKANSKLMKLDFNWFIVKYGLASSKFYMDNETFASKLTQLQFVNNPKSKKRC
                     KRNTALAIFLASCLKPSRSIALIFGPCTVGPGKVISMTRKNHIRQHRNIEGGQDLKYW
                     KEARNFYKGMSSSADFVQCSMFICSLDQIGMWEMKPCLAEVIQYESLSDTNFKYDWET
                     FINNKSEYGITELKIKTSKRLLVNGVYGPVVAMNNSDSNVSDTPKGCAGSATYAYKGP
                     KTDSPSILISLSVDTSRTADAALMEMPDKFCLQVEIYYRHKSKYYVAVDTKFIPSVNL
                     PGSNSLTENFHWQVMVGSIMKRIAFEVLFKDKIYDYNMRRWILEIVKLVKSLNTIHIP
                     NLNPLIKMTYFLQRSTLLQKRNTSPDEWIIYHWLILNYPLSHIFKMVKPDAYSKSGPV
                     EFTSDIVKYNEPLLIDGGNFLVVRDTLAGDDRFEDLREAAIAEYHNEKRFPKPWYRET
                     KPGSSQDRFVVARLGLLSDHTLFTDDITLDQYVATFYKK"
     gene            <955509..>956168
                     /gene="MHR1"
                     /locus_tag="KLMA_30429"
                     /db_xref="GeneID:34715705"
     mRNA            <955509..>956168
                     /gene="MHR1"
                     /locus_tag="KLMA_30429"
                     /product="mitochondrial homologous recombination protein
                     1"
                     /transcript_id="XM_022818945.1"
                     /db_xref="GeneID:34715705"
     CDS             955509..956168
                     /gene="MHR1"
                     /locus_tag="KLMA_30429"
                     /codon_start=1
                     /product="mitochondrial homologous recombination protein
                     1"
                     /protein_id="XP_022675560.1"
                     /db_xref="GeneID:34715705"
                     /translation="MSKHIAITKFRPANWLKKAGYAPQVFVFRNLESGQVLYSQFPTF
                     TWAQVEKNFQRPNWENKKPSTRRDIWKCMAVVDLPDYESSVKLYQNLCRLRYLRDVTL
                     SKQAKEMRKKNEFGHTWYSSQFRPTYSQEAVADLRECLLKLKDFQKSIKVHWEDEWRM
                     GDKEKYWTPVLPELTHTTLQRLGNVAREESVILKELGEKAKSEFAKLRKEADEAKNIS
                     L"
     gene            <957292..>958311
                     /gene="SUR2"
                     /locus_tag="KLMA_30430"
                     /db_xref="GeneID:34715706"
     mRNA            <957292..>958311
                     /gene="SUR2"
                     /locus_tag="KLMA_30430"
                     /product="sphingolipid C4-hydroxylase SUR2"
                     /transcript_id="XM_022818946.1"
                     /db_xref="GeneID:34715706"
     CDS             957292..958311
                     /gene="SUR2"
                     /locus_tag="KLMA_30430"
                     /codon_start=1
                     /product="sphingolipid C4-hydroxylase SUR2"
                     /protein_id="XP_022675561.1"
                     /db_xref="GeneID:34715706"
                     /translation="MSSVKSDFGTQLYQRINDALDVSFMASKDAPVAVITKKPDIFDW
                     ISDGKLALALPVVVYWAYSMFFHVIDTFELCEKYRIHPSEEVQKRNQASRTEVLREVL
                     FQHLIQTVVGLTMLHFDPVPTTGFELLEMWKWRQTLPSFVPSLLIKFVYCYGFSILKI
                     FTGFCIVDSWQYWLHRLMHENKELYKRFHSRHHRLYVPYAYGALYNSPVEGFLLDTLG
                     TGIAALVTKLTHTEQVVLYTFATLKTVDDHCGYALRLDPFQWLFPNNAVYHDIHHQSF
                     GIKSNFSQPFFTLWDTVCRTKFHGFEEYEQKQRRVTIDKYKEFLEKRKIENEERLKNL
                     KKKMS"
     gene            complement(<959007..>959627)
                     /gene="atpH"
                     /locus_tag="KLMA_30431"
                     /db_xref="GeneID:34715707"
     mRNA            complement(<959007..>959627)
                     /gene="atpH"
                     /locus_tag="KLMA_30431"
                     /product="ATP synthase subunit 5"
                     /transcript_id="XM_022818947.1"
                     /db_xref="GeneID:34715707"
     CDS             complement(959007..959627)
                     /gene="atpH"
                     /locus_tag="KLMA_30431"
                     /codon_start=1
                     /product="ATP synthase subunit 5"
                     /protein_id="XP_022675562.1"
                     /db_xref="GeneID:34715707"
                     /translation="MFSRVFVRSMAASAKAGVKPPVQLFGLDGTYATALFTAASKTTS
                     IESAASSLNALKETVSKDAKLATILENPALSAEDRAVVADTLSKKINLDQSVQNLLKV
                     LAENNRLSLLPDVSAQFSKLTDAYNGLIQATVTTAQPLDSKLFKRVEKALAASSLVGK
                     GKTLKLENVVKPEIQGGLIVEVSDRTVDLSVANKINKLNQVLREAI"
     gene            <960434..>962035
                     /gene="BFR2"
                     /locus_tag="KLMA_30432"
                     /db_xref="GeneID:34715708"
     mRNA            <960434..>962035
                     /gene="BFR2"
                     /locus_tag="KLMA_30432"
                     /product="protein BFR2"
                     /transcript_id="XM_022818948.1"
                     /db_xref="GeneID:34715708"
     CDS             960434..962035
                     /gene="BFR2"
                     /locus_tag="KLMA_30432"
                     /codon_start=1
                     /product="protein BFR2"
                     /protein_id="XP_022675563.1"
                     /db_xref="GeneID:34715708"
                     /translation="MGKSLAEQIAEIANKPQVEDFDIENEDAVFQHGGSNSGSDVDSD
                     EEKDELKKQHYVPVGKSKLREAADQGLALKDKKYIGSKGSRASVFNDEDLKMPVHEGD
                     SESELEESDSGVDLDAHSESESESESTSEADSDSEELSDAEDEEEDEETATKKKRLAM
                     LVQKQTKSVSRSLAESVQKDASKGYAIIRQNKFFDKVLDSRIKLQKALSASNQLPASE
                     ESWEKLLDEKNTKLLNSTFKILEKVMTQCIAVRHKFQEGDHIDQSETPSSFDTTRKRS
                     FKELHEEKIKLDADLKVYRSAVLNKWSAKVNASSGKSLLQSSKFKSINQSAEVQVENQ
                     LADMPRLLKRTKLNRSNVKPLLFEEDIKKGNLKELKEDANKDEDDDEDENPDIPKNYD
                     PRRKDNNGLDFTENPYIYDDEDFYRVLLNDLVEKKIANSQQQGNGITLAITSRSENKL
                     RKNIDTKASKGRKLNYSIQEPIANYEAPIGSGYKWSDEQIDEFFAGLLGQRINFNEDE
                     QSETETTEHNEESEAIKNDDIKIFG"
     gene            complement(<962144..>963778)
                     /locus_tag="KLMA_30433"
                     /db_xref="GeneID:34715709"
     mRNA            complement(<962144..>963778)
                     /locus_tag="KLMA_30433"
                     /product="uncharacterized transporter C4B3.13"
                     /transcript_id="XM_022818949.1"
                     /db_xref="GeneID:34715709"
     CDS             complement(962144..963778)
                     /locus_tag="KLMA_30433"
                     /codon_start=1
                     /product="uncharacterized transporter C4B3.13"
                     /protein_id="XP_022675564.1"
                     /db_xref="GeneID:34715709"
                     /translation="MDSESSSLIGSRNKPRYDTFENSGGYQSDGESASSGDAVINRFR
                     LMSPDVDPDNILEEDFMDDLTIPTSFSTEMRYVLNNSVLITLTFLLEYSLTIVSLFVV
                     GHVCTASDALAAASLAVMTYNITGLAFVEGMATSLDTFCSQAYGAKKYSKVGLYAFRC
                     AAMIATGIIPVVASWWCSASWLGYIIAEGDILADIQLFLRVLSFGIPGLILFETGKRF
                     LQAQGHFQAGTYALLLTFPINFVLVYSFTKCFGFAGAPLGIAISQWVMSLMLFVYAKF
                     WKPDTLKCWYPIFTSRFHFKRLFSSWMPMFNLAFPGLLMIEAEYLSFEVLTIMSTYLG
                     IQSIAAQSVISNVGSLVYQIPFAMGCVVSTRVANYIGTASVDNARLSIKTSYVIALFI
                     GLLNCSIILIGNTRLAHMFTNDKEVIGLCKNVMPILAFNQLYDAFTTFSAAMLRGQGR
                     QRIGSILNIVAYYIIALPLSAWLTFGRLQLGLPGLWYGCGVGILLLAFALGYCIWSSD
                     WDEIVEECIRREKEDNEIDLESMVSNMSGNMIADYA"
     gene            <964097..>965104
                     /gene="PIH1"
                     /locus_tag="KLMA_30434"
                     /db_xref="GeneID:34715710"
     mRNA            <964097..>965104
                     /gene="PIH1"
                     /locus_tag="KLMA_30434"
                     /product="protein interacting with Hsp90 1"
                     /transcript_id="XM_022818950.1"
                     /db_xref="GeneID:34715710"
     CDS             964097..965104
                     /gene="PIH1"
                     /locus_tag="KLMA_30434"
                     /codon_start=1
                     /product="protein interacting with Hsp90 1"
                     /protein_id="XP_022675565.1"
                     /db_xref="GeneID:34715710"
                     /translation="MTFLLRPVSGHSGANANNVMKIEPSPCFVVKSKILQPNKTSLKK
                     DAKIFINICHNEEIPLPEIDFNPSIVYPLIVNNQWEVPIVTSSIREDSDKKGNLCYVV
                     DCCINTKCVSWIQQDLQLREIVIEWCLESCELREQIEISRDHISFPKLKKKGETIPPL
                     EILKDDLKEDYRETIDEMVKRESKDPISIIEMKRDLIAEEEEGIESDTGLPPLIPVDK
                     VTQHKPLIEEIEDLSLHEVKKPKIISQSEQLKYEVTMGKTNGSSEFFLRVEVTSKIDS
                     SLDYEVKYDPKTNTLLIKNTNTKVYSEKKLEIPLPNVFSDAPKLKCFFVKPERKLVLF
                     L"
     gene            complement(<965207..>966484)
                     /gene="PRO1"
                     /locus_tag="KLMA_30435"
                     /db_xref="GeneID:34715711"
     mRNA            complement(<965207..>966484)
                     /gene="PRO1"
                     /locus_tag="KLMA_30435"
                     /product="glutamate 5-kinase"
                     /transcript_id="XM_022818951.1"
                     /db_xref="GeneID:34715711"
     CDS             complement(965207..966484)
                     /gene="PRO1"
                     /locus_tag="KLMA_30435"
                     /codon_start=1
                     /product="glutamate 5-kinase"
                     /protein_id="XP_022675566.1"
                     /db_xref="GeneID:34715711"
                     /translation="MGKSYVIVIKLGSSSLVDEKTKEPKLSIMSLIVETVVNLRRRGH
                     KVIIVSSGGIAVGLKTLNLESRPKKLSKVQAIAAVGQGRLIGRWDSLFSQFDQRIAQI
                     LITRNDIVDWTQYKNAQNTISELLAMGVVPIVNENDTLSVSEIKFGDNDTLSAITAAI
                     IGADYLFLLTDVDCLYTDDPRSNPDASPILVVPDLSQGLPGVNTDGGSGSDVGTGGMK
                     TKLIAAELATNAGVHTIIMKSDSPENISKIVLYMQKRDEIVLDLTDDLSKLQLSELKS
                     LQENDVPMHTRFIANDNQHHLKNREFWMLHGLVSQGAVIIDAGAYKALTRKNKAGLLP
                     AGVIDVEGSFHEHECIDLKLGARDAKGELDRSVPLQTVGRARCNYTSVELSKIKGLQS
                     SEIEDVLGYADSEYVAHRENLAFPPHCPTAEGD"
     gene            <966849..>970763
                     /gene="CFT1"
                     /locus_tag="KLMA_30436"
                     /db_xref="GeneID:34715712"
     mRNA            <966849..>970763
                     /gene="CFT1"
                     /locus_tag="KLMA_30436"
                     /product="protein CFT1"
                     /transcript_id="XM_022818953.1"
                     /db_xref="GeneID:34715712"
     CDS             966849..970763
                     /gene="CFT1"
                     /locus_tag="KLMA_30436"
                     /codon_start=1
                     /product="protein CFT1"
                     /protein_id="XP_022675567.1"
                     /db_xref="GeneID:34715712"
                     /translation="MNVFDEIVQPTVVNKSLHGHFTSAEREEYIVARTNVLSIFRLSR
                     AHKLVLAYEWKLSGKILDMQLIPQLGSSLKMLAILSSNSKLSLVKFDQTVESLETVSL
                     HYYNEKFANLSLSKLNVESIMAVDPSFRCILVFNNDVLAILPLHVNKEDLDMEEEENA
                     AITEPKVKRPKIDQGVTSDSIIMPVSNLHKTLKHIYDIKWLDNFSKPTLGILYQPILA
                     WCGNEKIMGNTMRFMIISVDIEDEKTTVISQIRDLPNDLHTLVPLTKGYVLIGVNELL
                     YISTSGALQSCIRLNTFATSNINSRIVDKSEMKVFLPPTSIYLHKNLKKHHDLLIVMD
                     ENCKMYNIISESEGNLLTKFDCMEIAIANEIFKNCKLPLTICGDLDLESGRVLIGFKS
                     GNAMFLQLKNLKTAFAGKKQHVETIDDEDDEYSALYGESQNSSHTRIVETQEPFDISL
                     LDSLLNIGPLTSFTVGKVSSVEPTIQRLSNPNKNEFSIVATSGVGNGSHLTAVHSTVQ
                     PKVEQALKFTSATRIWNIKIKGKDKYLVTTDADREKSDVYQIDRNFEPFRAHDFRKNS
                     KTIDMETMYDDKRILQVTSTGLYLFDTDFKRLARLTIDVEIVHACIIDPYILFTDARG
                     NIKIYQLDSKNRKKFIKFKLPEVLNEIIITSGSIFKSNICNRFLHGLENSSQEQLLFT
                     FVTGDNQVIFFTEKHNDRIFQFNGVDQLKDMLFVSTYQIPDEINPDPSIKQIMLNRLG
                     HRKREEFLTILTFGGEIYQYKKSSKHSGKLFKCKTDAFITGAPNNAYPQGVNKIERVA
                     HHFSNYNGYSVIFITGQVPYIIIKEDNSPCRIFRMTNIPIVTMVRWGKSSVMCVDNLK
                     NARVMTLDLNCYYGNSRVLRKIVVEDVVEEFETLGNIAYHERTGMYVVSYTKFIEYKA
                     LSEDGEPLIGYNPEQPNSRGFQSGILLINPLTWNIIDRVDLPENSLVNDIKTMLIQLN
                     SKTRRKREFVVIGSSFAKDEDQPSTGSLLVLDITEVVAEPGKPDTNYKFNEIFQEDIR
                     GSVNTVCEISGRFMIGQSSKAIIRDMQEDNSAVPVAFLDMPVFISDAKSFSNLMIIGD
                     SMQGFTFVGFDAEPYRMIVLGKSTSNFQVMNVEFLVNNGNVNFIVTDRQNNLHVLRYA
                     PDEPNSLSGQRLVHCNTFNLFSTNNFMKLIRKHNEFNAKLLNYIAVGCQSDGSMFRLI
                     PLNESSYRRFYLVEQHILEHEVPLAGFNPKMERLDNEYYHKGHALRPTLDSQVLKKYT
                     QIPIDKRMNIETRVGRHASTELWHDLLDIEYSLRSLTTPQHE"
     gene            <971065..>971718
                     /gene="GPI11"
                     /locus_tag="KLMA_30437"
                     /db_xref="GeneID:34715713"
     mRNA            <971065..>971718
                     /gene="GPI11"
                     /locus_tag="KLMA_30437"
                     /product="glycosylphosphatidylinositol anchor biosynthesis
                     protein 11"
                     /transcript_id="XM_022818954.1"
                     /db_xref="GeneID:34715713"
     CDS             971065..971718
                     /gene="GPI11"
                     /locus_tag="KLMA_30437"
                     /codon_start=1
                     /product="glycosylphosphatidylinositol anchor biosynthesis
                     protein 11"
                     /protein_id="XP_022675568.1"
                     /db_xref="GeneID:34715713"
                     /translation="MPAKKRKSAKKTVSFSDDQNLTNVNAHHHRKGHVDDDSPLVYVR
                     RSWTLIPFHLLAMLYWFLKYSTFDVVKLLYIMIPSQVLYLIFRFNKNTIYGKKRLRIN
                     WLLVCVTLVACLLLTIPCLVIIILFGAPFVELLKESWLLALHCCFLAYPALYDVFNCN
                     FKVGYFKKYFISIVIGCWISCCVIPLDWDRDWQAWPIPLIVGAYIGAFIGFSIGGYI"
     gene            complement(<971800..>972636)
                     /locus_tag="KLMA_30438"
                     /db_xref="GeneID:34715714"
     mRNA            complement(<971800..>972636)
                     /locus_tag="KLMA_30438"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818955.1"
                     /db_xref="GeneID:34715714"
     CDS             complement(971800..972636)
                     /locus_tag="KLMA_30438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675569.1"
                     /db_xref="GeneID:34715714"
                     /translation="MLQSFKRFSTNAGIRSSITDLSVKKLGTGSGPFVEFPDIQPLHD
                     SLLLRLPSFSSVVGRLNNITVIDASNELKNVKLTDLLAVKKQQQLNGFITLSTGDEPV
                     NVICTASSRLNNVSVIEVDDYEKGWTITDPLNTIVCYAGDISVKGNQIKGRGLFAING
                     QSPSWHIQLKDSDQILVPATSILGYSSTVSVIPTKIKQQFQFKKMSWIKTPNALQTWM
                     EENIKSKYEYLRLLINKYFQKDKLMADIRGPGLVIIQHQNSRYNENPLFTDESIIKAL
                     EK"
     gene            complement(<973036..>973638)
                     /gene="CPR5"
                     /locus_tag="KLMA_30439"
                     /db_xref="GeneID:34715715"
     mRNA            complement(<973036..>973638)
                     /gene="CPR5"
                     /locus_tag="KLMA_30439"
                     /product="peptidyl-prolyl cis-trans isomerase D"
                     /transcript_id="XM_022818956.1"
                     /db_xref="GeneID:34715715"
     CDS             complement(973036..973638)
                     /gene="CPR5"
                     /locus_tag="KLMA_30439"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase D"
                     /protein_id="XP_022675570.1"
                     /db_xref="GeneID:34715715"
                     /translation="MKLLLHIFSVLSFLAAIVFADPAVTHKVYFDIEHGDEFVGRIVI
                     GLYGEVAPKTVENFYELSISEDPKMGYVKSTFHRVIPSFMIQGGDFTNGNGTGGKSIY
                     GETFDDESFEVKHDKPGRLSMANRGRNTNGSQFFITTVATPWLDGRHVVFGEVLEGMD
                     IVHYIENVPRDRSDRPKVPVKISASGEVETVPPKELNDEL"
     gene            complement(<973875..>974732)
                     /gene="MED6"
                     /locus_tag="KLMA_30440"
                     /db_xref="GeneID:34715716"
     mRNA            complement(<973875..>974732)
                     /gene="MED6"
                     /locus_tag="KLMA_30440"
                     /product="mediator of RNA polymerase II transcription
                     subunit 6"
                     /transcript_id="XM_022818957.1"
                     /db_xref="GeneID:34715716"
     CDS             complement(973875..974732)
                     /gene="MED6"
                     /locus_tag="KLMA_30440"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 6"
                     /protein_id="XP_022675571.1"
                     /db_xref="GeneID:34715716"
                     /translation="MSLPPLDELQWKSPEWIQTFGLRTDNVLEYFSGSPFFEKTSNNQ
                     VVKMQQQFSQQGPVGGNIPLGGQAGGNGQIGSSGASPGADSNGSSVCGTVTAPPSDRT
                     AIWERYPVHAMLERELMKMKGIEYILVLVREPDLWIIRKQRRNGPNETTTLGDYYVIG
                     SAVYQSPTVYKIVQNRMLSTNYHLSHALSQLNKLVEFHPAQGASFMRSSDTIPTSVAN
                     NTTTGATTGHTIANTVSVPDTGMANTGTSGATAAATSIDPERRQDTINMEVMDKLMTT
                     SIKANPVYI"
     gene            <975033..>975410
                     /gene="FYV4"
                     /locus_tag="KLMA_30441"
                     /db_xref="GeneID:34715717"
     mRNA            <975033..>975410
                     /gene="FYV4"
                     /locus_tag="KLMA_30441"
                     /product="protein FYV4"
                     /transcript_id="XM_022818958.1"
                     /db_xref="GeneID:34715717"
     CDS             975033..975410
                     /gene="FYV4"
                     /locus_tag="KLMA_30441"
                     /codon_start=1
                     /product="protein FYV4"
                     /protein_id="XP_022675572.1"
                     /db_xref="GeneID:34715717"
                     /translation="MFSRRLLSTSVFLQASKTSLRKTVKPTEDIPDVSAFLSKIGRKC
                     DEFAETYENKWENLFAWDGKVLKEKGIPVQQRRYILSQVEKLRKGEAIKEIKKGKKSF
                     FGGERKRKETIAKWRAEQRNAAA"
     gene            complement(<976360..>977640)
                     /locus_tag="KLMA_30442"
                     /db_xref="GeneID:34715718"
     mRNA            complement(<976360..>977640)
                     /locus_tag="KLMA_30442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818959.1"
                     /db_xref="GeneID:34715718"
     CDS             complement(976360..977640)
                     /locus_tag="KLMA_30442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675573.1"
                     /db_xref="GeneID:34715718"
                     /translation="MANKRRPKKTKPPYRKYVGGVGFTHTQGFGDGQINNDTCVDEKF
                     KQLTLEENQLCNKHTLQQFTLQTITIDPKEYSGMKLPLEVFSIIISMMEVQDIKTNVL
                     LVCRAWYLMCIPRLYHTPVLTSRNFSRFVDTVLGDRKRKTCEHVLHLDLSPIIQSGKN
                     SYVSKILRRCSKNLVSFTAPQTSFGIAPLISLKSCHHLKYLDLGLVSETVNLKELFLA
                     IKNFHELTHLSFPRSSIECEGYQEFEWPPNLQYLKLSGGISNEFVQETVFPNTIKILE
                     FSFCPQINEHSIYTVLAKIGDNLTQLYFHYPMPALKDNSLDYVFRYCSNLKVLQLMID
                     YCTKWVFSEHFFTQLPYPRPLKTLILECSGHLGQTFKIHPDDLTIAIYEGRLPCLKTV
                     RISSRLGWDSHNDDVSDLVSCFEDKNSGSIYITY"
     gene            <978087..>979889
                     /gene="BEM4"
                     /locus_tag="KLMA_30443"
                     /db_xref="GeneID:34715719"
     mRNA            <978087..>979889
                     /gene="BEM4"
                     /locus_tag="KLMA_30443"
                     /product="bud emergence protein 4"
                     /transcript_id="XM_022818960.1"
                     /db_xref="GeneID:34715719"
     CDS             978087..979889
                     /gene="BEM4"
                     /locus_tag="KLMA_30443"
                     /codon_start=1
                     /product="bud emergence protein 4"
                     /protein_id="XP_022675574.1"
                     /db_xref="GeneID:34715719"
                     /translation="MEYEEILFGLQPLINAPDASSISIEDVFLQSYLTVLDQLAVHLR
                     APSNRNLIRETGLLTQLLRVLYSLLDHAFHQSHSTQQYLQLSSEFIRCVANALIDNDK
                     NRELFWDGDYNKKNEFIDYYAGRIFGLTDDTENTISLQSRTVVLISNLTMDDKMQYKR
                     IAPKIQPSLMKLMISMRSIFLEEEYNMLVGISFDLLSETIEQYTDFLPLNFLVGLSHM
                     MFNVCQNIINEDNTDKPENNDDEVTEEELFLPNLAQNIAHCIFIGTCSEKYNFSDEKA
                     TSSIQHNLLKSLNTLNQKNFENQLITNREILSSIGNISSNLSYTNEKDILTAIDIVKS
                     QNEDEKSPYAIASALIILSNYISNPEKADEIRGLLDCTLIINSSNVFKDPIQFQGFLT
                     LLRKLLKTDIIMFTPKPELERLAGILVLCYDQSKYYQGLKPLLEKLLEKLLAISTSKT
                     ISDMIKSSRRFYEVISDGGIIASCQTIDKLSKVQKSIEPLQLDETFSKILNYYKEAKA
                     EDMLKDPLSLFHILRSVGIYLTELNIQKQDVIFENFSDQIMKLLEVSLSVKSSEDSAS
                     KAVWNNARYLAGIVIASKSNTIQDTLKDLARRYF"
     gene            <980153..>980959
                     /locus_tag="KLMA_30444"
                     /db_xref="GeneID:34715720"
     mRNA            <980153..>980959
                     /locus_tag="KLMA_30444"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818961.1"
                     /db_xref="GeneID:34715720"
     CDS             980153..980959
                     /locus_tag="KLMA_30444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675575.1"
                     /db_xref="GeneID:34715720"
                     /translation="MKPRKNECKLLGPVSIAIQLLMGVIVVSSLLLKRQSERPRRTWR
                     VWCFDVGKQILGAVSIHFMNLLLSVLKGGGLYEILLGKDNDGSYTGDECDWYFLNLLV
                     DTTVGIPILWCCLTFYESILKRMGVKNIESGNYFSELDIPTPNRRREPSLAAFTKQLA
                     VFIAGLISMKCCLFLILLYFENVAEWFANWVLGWSDPWPNLQVFLVMFVFPLLLNCFQ
                     CFCVDSIIKLPSNRINIRNADNFDQEPLIIGNRPPFFSVSDSNKIYGSTA"
     gene            <981908..>982567
                     /locus_tag="KLMA_30445"
                     /db_xref="GeneID:34715721"
     mRNA            <981908..>982567
                     /locus_tag="KLMA_30445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818962.1"
                     /db_xref="GeneID:34715721"
     CDS             981908..982567
                     /locus_tag="KLMA_30445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675576.1"
                     /db_xref="GeneID:34715721"
                     /translation="MRFNRIAPFMLAPLASAQYFNVSSTTTLQPQTPAAPITTISTIT
                     SEIVKTVYLTLSNGEVSSQVSTATPGEVTTVVTTPTSSDDATLTVSDDTTSTTTVTIY
                     HTISEDDASSSTTSEAAGSATIAGDKLNQVYADDATSTLTTTMLQTITLSNSAGEATA
                     TTVSAVGRELLLGNFSCVPETVTVTEYQATKYITVEATSSPAIRATSAYYGNSTVSSL
                     V"
     gene            <982984..>985110
                     /gene="MLH3"
                     /locus_tag="KLMA_30446"
                     /db_xref="GeneID:34715722"
     mRNA            <982984..>985110
                     /gene="MLH3"
                     /locus_tag="KLMA_30446"
                     /product="DNA mismatch repair protein MLH3"
                     /transcript_id="XM_022818964.1"
                     /db_xref="GeneID:34715722"
     CDS             982984..985110
                     /gene="MLH3"
                     /locus_tag="KLMA_30446"
                     /codon_start=1
                     /product="DNA mismatch repair protein MLH3"
                     /protein_id="XP_022675577.1"
                     /db_xref="GeneID:34715722"
                     /translation="MPLIKLEDNVTKILKSHEYVVSLNTVIKELIQNSVDADATNIVV
                     KVETDKCNIRVQDNGQGLEPNCLNILGSRNVTSKIRSLQELPRISTYGFRGEALYMIL
                     QCSRMNIVTKPIGYSGVWKTEFTGTVRLCTDTERDAFASSQNGTIVNVRDLFYNLPVR
                     REMHKRRALSDILNELRTDALSILIKNPKVFLKVYVNGDLKISSWRTHQSLDAPQRIV
                     GSLRDVFGDIIPEEQLKYVSASFKSYSVKGIISTHPIMSKDYQYIFINGRKYEDSKFF
                     SLINRQFQATKYVEKNWESFSVKSVGTPYNSYPLFLISCDGPLDISDLIQDPGKTIFQ
                     SQTLNILSPLILNVVLSFLRHLGYDISKEFPQPVEKYFIDKPEFYNGVNKPFTLPTIT
                     KSSYNTSKISKSKHKKKLLDVLKSPPKDNSIILKLQDKINVCTKFNVHGNDLKHDSEF
                     DIRTLSLTGTESIYLKDHAVQDFKLLKSDINKFEVIKQIDCKFILVKSQSRLLIIDQH
                     ACHERIMVESILKDTINMFHNRTISCSDTDMNIKVSVEEFDWFNEFLSEFEAWGIFLR
                     LNEGNDEESLITILKIPSFLHDKVRNDHSFLKSVLLQHVYDLKNDKRRRVAKSFYTKG
                     FSSKWWMIIPNMPRVYLEIINSKACRSAIMFGTSLSKEECKIMISELSCCHFPFQCAH
                     GRPSVVPIVEINDNMFNSMHKDYEIL"
     gene            complement(<985149..>986930)
                     /locus_tag="KLMA_30447"
                     /db_xref="GeneID:34715723"
     mRNA            complement(<985149..>986930)
                     /locus_tag="KLMA_30447"
                     /product="anaphase-promoting complex subunit 5"
                     /transcript_id="XM_022818965.1"
                     /db_xref="GeneID:34715723"
     CDS             complement(985149..986930)
                     /locus_tag="KLMA_30447"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit 5"
                     /protein_id="XP_022675578.1"
                     /db_xref="GeneID:34715723"
                     /translation="MTTAYQPILIVRGYDPYDISSVILVLLYCLGSKDLTPNIILGIL
                     QLTPKANSIGVGLPTLENFVKYLLKVSTKRITVNLLHILFSITNYDQIQDLIHLLQEA
                     IVTSLDQQRVSSRFDRLLCVDSAIYDLLPRIIVDSSYEHYFVEDVVQIIQSLESFKLR
                     FTHCDIYKEFESEIFKPNSILDQIFSHPNPNDCEVSPFITVENNGNTIPWLVVSGEKF
                     SILLNYVVQLAISNSTSDDLAGSIIEYTSFNDRTRFPDIILLEMIHYRKIKDYEKTIE
                     RIYQYFDYCRNSNIAVTSSSNFSHICQTFVLSSLHQDHGSPEVALKSLHELIETIREK
                     SGLHGLCNLWDVLIHHIFIQPGDLSSLQRSIHDLLKPFNDNQSTSPEMLQYFFTSQLV
                     LNLHEVGYVPKVLELLSTVIAISSGGLTDDKHRVTAEVLSLAWSFLGFDDIGSCYSEL
                     IPTNRNKQKQLQRIEKLVNNKFYTEAVSAVEKMIEETERNDEGMTWKFSFMRKKIEVM
                     LAAGNPARAHPLIIKYTEKCRETKNDYELSYAILYMARLLNGWKQYKDSYKLLSANIH
                     IIFQYSQSLKDQANILYKEAQNGLSMS"
     gene            complement(<987135..>988448)
                     /gene="CLP1"
                     /locus_tag="KLMA_30448"
                     /db_xref="GeneID:34715724"
     mRNA            complement(<987135..>988448)
                     /gene="CLP1"
                     /locus_tag="KLMA_30448"
                     /product="protein CLP1"
                     /transcript_id="XM_022818966.1"
                     /db_xref="GeneID:34715724"
     CDS             complement(987135..988448)
                     /gene="CLP1"
                     /locus_tag="KLMA_30448"
                     /codon_start=1
                     /product="protein CLP1"
                     /protein_id="XP_022675579.1"
                     /db_xref="GeneID:34715724"
                     /translation="MEFVEFNDVTETTKISQLPKGQEWTVQVPTGAKLTIVVKFGIVE
                     MLGTELANDMPYTFQGVVVNLYAIERAMIEWKCLEELEPKISEDKAYHTYIYNLNFAL
                     ERLRLSSFNGPRVLILGDESTGKSSLAHTLCSYALKIRQYQPLLVNLNPQEGVFSLPG
                     SLTATPISEILDIESSLWGQSITTGATKLHSKQPLVKNFGLENIRDNRQLYKTTISQL
                     AHGVRQRIKNDPVVRRSGVFIDTPKLSHLDTETWSEIEHIIDEFEVKAIIVCAQTDDL
                     AIKLSEVFRAKIGSIVRIPPPNSIIKIDDIMRRSIQRIQIREYFYGTTQTVLSPYTVG
                     VGFEELTVFKPRNQNELLDKTKDIDMTAFDKIDVNASNLQHAIVAITNVSRKESEDEI
                     RTASILGYALITEVNDSKRKLRILLPVPSRIPDRSMILTEYRYLE"
     gene            complement(<988799..>989698)
                     /gene="TUM1"
                     /locus_tag="KLMA_30449"
                     /db_xref="GeneID:34715725"
     mRNA            complement(<988799..>989698)
                     /gene="TUM1"
                     /locus_tag="KLMA_30449"
                     /product="putative thiosulfate sulfurtransferase"
                     /transcript_id="XM_022818967.1"
                     /db_xref="GeneID:34715725"
     CDS             complement(988799..989698)
                     /gene="TUM1"
                     /locus_tag="KLMA_30449"
                     /codon_start=1
                     /product="putative thiosulfate sulfurtransferase"
                     /protein_id="XP_022675580.1"
                     /db_xref="GeneID:34715725"
                     /translation="MPLFKLISPKVFTELVLNETKRRVVPVDSTWYLPNLHRDGKQEF
                     LDEERLKGAVYFDIDSVKDLKSEYPHMLPDSETFNNSMSELGLRKDDILVVYDRIGNF
                     SAPRCAWTLSVMGHDPVYLLNNFQTLKQSGYPVDTSKVSSITPYGKSEYTSNTNLSSE
                     ETVDFEFLQNLLKSGEIKNYQLFDARSLQRFTGEAPEPRAGLSSGHVPGAKPLPFTEV
                     LNDDKTLPTDNDKMLKKIQPFLSDNGIEIDLEKPTIAMCGTGVTGTIIKTALEIAGVK
                     QVRLYDGSWTEWAQRSDAIAKGK"
     gene            <990252..>991373
                     /gene="SET6"
                     /locus_tag="KLMA_30450"
                     /db_xref="GeneID:34715726"
     mRNA            <990252..>991373
                     /gene="SET6"
                     /locus_tag="KLMA_30450"
                     /product="potential protein lysine methyltransferase SET6"
                     /transcript_id="XM_022818968.1"
                     /db_xref="GeneID:34715726"
     CDS             990252..991373
                     /gene="SET6"
                     /locus_tag="KLMA_30450"
                     /codon_start=1
                     /product="potential protein lysine methyltransferase SET6"
                     /protein_id="XP_022675581.1"
                     /db_xref="GeneID:34715726"
                     /translation="MTVEEQEVQVSENFRIKRAIYGGRACYASSDLKKDSCVLEVSDY
                     MGCAILYEFRKEVCHWCLSYNYGTMMKIKINWADVADMFSELHSKISAKQYKGSGLWF
                     CTEECKRSFLHQKNIAELLLLYETVLVHFQSMQRHHNCVAEDTHVEEKYAQIEASKMQ
                     NVIEKRWEEIELNWIPKAAKMKQTKLINELPKIDEDSYSSIRFVLECIFNLKQQEKDS
                     IKLNAWKSLQSNEVEKITTFPVLLDHQMVVFKWVYILAPNFRNILTPAFFRHILGSEY
                     GNSFGIWEIAEESDSREYLGYMVLPEASYFNHSCDPNVQKKRVGRTFKYSLKRDVEQD
                     EELCIDYREILNLDVADRRKILKSNWFFECRCSRCVSEL"
     gene            complement(<991362..>991850)
                     /gene="ATG29"
                     /locus_tag="KLMA_30451"
                     /db_xref="GeneID:34715727"
     mRNA            complement(<991362..>991850)
                     /gene="ATG29"
                     /locus_tag="KLMA_30451"
                     /product="autophagy-related protein 29"
                     /transcript_id="XM_022818969.1"
                     /db_xref="GeneID:34715727"
     CDS             complement(991362..991850)
                     /gene="ATG29"
                     /locus_tag="KLMA_30451"
                     /codon_start=1
                     /product="autophagy-related protein 29"
                     /protein_id="XP_022675582.1"
                     /db_xref="GeneID:34715727"
                     /translation="MNNENTKVYIRVSGKRPEGFIDPKPFEWGFKRDKILWTRISKME
                     SLEDMDWKELCQDLGAPESFLKKRSYMLFQKHLKLLSEQMSDSPRMRSPLDTRNSVDE
                     TILQNLQASKILNNRFDVPNNETLDTTTNKNNEESGSDLSSSLSVSKSALEDALMDRL
                     QL"
     gene            <992316..>996692
                     /gene="REV3"
                     /locus_tag="KLMA_30452"
                     /db_xref="GeneID:34715728"
     mRNA            <992316..>996692
                     /gene="REV3"
                     /locus_tag="KLMA_30452"
                     /product="DNA polymerase zeta catalytic subunit"
                     /transcript_id="XM_022818970.1"
                     /db_xref="GeneID:34715728"
     CDS             992316..996692
                     /gene="REV3"
                     /locus_tag="KLMA_30452"
                     /codon_start=1
                     /product="DNA polymerase zeta catalytic subunit"
                     /protein_id="XP_022675583.1"
                     /db_xref="GeneID:34715728"
                     /translation="MSNIIRSLDSTLEPNLINVQINSTDSYQSFPTALDKISSKSLPG
                     LPFVQVPIVRFYGCLPTGHKILVHCHGVLPYIFIRYDGQMSDTSSEILNRCSNLHNIL
                     EIRMVETYTKNQMTEKFKSLKYVANVSVVKGVPFYGYHVGYEPFYKISLLNGSYVNKL
                     SDLLRDGKILSSKVEVYEAHIPHLLQLMADYNLFGCGWLKLSQCYFRKPILLEDLEIN
                     EILYTESLERFLKTHLKPNENVLDQDPFHRVGRTLLEIDILPQFIVNKQKIQFRDLHH
                     DFIEITKDLQLSDQGYVNSTKDIWDEIQNIRKMKGLSEYQELDNYSRDPMLQYNWKDN
                     TNLLNYFEAAKKRTSSLFPTKSLRFDSFVNVSQNEHLFPSPREALEELWPKIPRYISK
                     KVQTFTEMHQNKDIYNKFGDKSDPFSIQQQHETFSVVNPLSSLNDSDSTTRSKRKASQ
                     SPSKSDNSINPESQIYTVPNKKLHQSISTRDHLKVLKRPKINFANIKESLLLKEIPEV
                     VYPEPFYSNPLDLKRNTTEIADAVFKLSSDHVSFRKGMEYKNYSPVLTASDNVYQRSR
                     WRYVRDKPTFQNVMQNNESCKKEFSAVVGKTPDLPFGYKFKSNNMNLQNFNSFNRMTH
                     FTMELHVNSREDKYPDPKHDAVRMIFWKVQDGTFPFNLDITQEGLLIYSDNGTDRFLW
                     NSADPTIHVTTYEDELSMIYALEDLVRFFDPDILSGYEIHSSSWGYLIDRCRFAHNYD
                     VEEELSRVETNHNNKKKDSWGYTHATAFRITGRHMLNIWRHLRSSLNLLDYTLENIVF
                     HVLHERFPFYSFKTLTGFFDSKDPSSKKCLINYYIKRVRVNYQLLETQNIIGKTIEQA
                     RLIGIEFYSVLYRGSQYKVESFLIRLCKSESFLLISPSRKQVRDQKALECIPLVMEPS
                     SAFYNSPLLVLDFQSLYPSIVMAYNYCYSTMLGRVQTLGLKDNRIGTTTIDIPPDLLT
                     LISDYVTVSPNGIAFVKKELRKSILAKMLKDILATRFLMKDTMNQLKDDHDVVSMLDN
                     RQAALKLLANVTYGYTAASFSGRMPCSDIADSIVQTGRETLERAIEFIESTKKWGAKV
                     VYGDTDSLFVYLPGKSRSDAFKIGKEIAKEITMKNPKPVELKFEKVYHPCFLVTKKRY
                     VGYAYEYENQINPKFDAKGIETVRRDGTPAQQKIVERALRTMFETTDLSKVKEYLLGE
                     FDKIITGRVNIQDFCFAREVKIGHYKSDKTAPPGAQIAMQMMEEDHRKEPQYKQRIPY
                     VVKMGKMGETLSSRCISPEAFLRSKDSRLDYNYYIVKNIIPPLQRFFQLVGVDVMDWF
                     SSMRKTMYVSNESAEHDKIDGRSVTSIVKARSCLRCRKRVHPEYISRICDECRKDKGN
                     TIMALQEAVRLKQSKMHMILRTCQTCSYKFHKDAMAPLDSIALKCQSKDCPVYFSKVK
                     YINGLKNTDMRDLLLGIIDLDY"
     gene            <996926..>997501
                     /gene="TMA16"
                     /locus_tag="KLMA_30453"
                     /db_xref="GeneID:34715729"
     mRNA            <996926..>997501
                     /gene="TMA16"
                     /locus_tag="KLMA_30453"
                     /product="translation machinery-associated protein 16"
                     /transcript_id="XM_022818971.1"
                     /db_xref="GeneID:34715729"
     CDS             996926..997501
                     /gene="TMA16"
                     /locus_tag="KLMA_30453"
                     /codon_start=1
                     /product="translation machinery-associated protein 16"
                     /protein_id="XP_022675584.1"
                     /db_xref="GeneID:34715729"
                     /translation="MPVTKSLGKIQKGLKGKKFTVHPKGRKFQQLNRATLREEKIALK
                     KKAHNEKRSHELSRMTFIQSAINSDSLKEKKVFTYEDTAVLIQEFIARDDDELNELKA
                     KRRSNRPPSGRQLLLQQKRDLEMEEFKAGFLCPDLTDEDNVVFLRAWNQTFGGLSTLK
                     LIRVNVDGEKVLGGTKPVKPTTAEKKDIEMS"
     gene            complement(<997674..>998828)
                     /locus_tag="KLMA_30454"
                     /db_xref="GeneID:34715730"
     mRNA            complement(<997674..>998828)
                     /locus_tag="KLMA_30454"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818972.1"
                     /db_xref="GeneID:34715730"
     CDS             complement(997674..998828)
                     /locus_tag="KLMA_30454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675585.1"
                     /db_xref="GeneID:34715730"
                     /translation="MLLSRCTRFGIRSVHFPTAHLDKGRVSWKVALDPNTPKERSVKA
                     FKSSLHNTIERNAWPSESSPEREVLIELINNLSLPHDTLKKQIRKLYQMIFQHRVSDE
                     DIYKAITKFNSRTIVNVITPKPINLKKELQNLKVTAEKYEKERVLKEQNLNEKSLSIN
                     NGISTKMQHEVVNRHQKPPVNNAKKETTTETITDRDINALKEFLEKAEKQENEIKKFV
                     LEQQRKYQWSHNKGAPTQLTPGSLLFQKRIPSARIRKVSPFIPRLVEYERLIHPFSST
                     ELTKFLSYDVEKSVSKVEPYDSTFLVHIQKKDLFGVINCGRIPPEQLLEIINQYENQG
                     WKLFGDNSKGSYEVVFTKKVVTPPLIGRNGKIALGLASILTGCAFFLPPL"
     gene            <999100..>999591
                     /gene="NAT5"
                     /locus_tag="KLMA_30455"
                     /db_xref="GeneID:34715731"
     mRNA            <999100..>999591
                     /gene="NAT5"
                     /locus_tag="KLMA_30455"
                     /product="N-terminal acetyltransferase A complex subunit
                     NAT5"
                     /transcript_id="XM_022818973.1"
                     /db_xref="GeneID:34715731"
     CDS             999100..999591
                     /gene="NAT5"
                     /locus_tag="KLMA_30455"
                     /codon_start=1
                     /product="N-terminal acetyltransferase A complex subunit
                     NAT5"
                     /protein_id="XP_022675586.1"
                     /db_xref="GeneID:34715731"
                     /translation="MGRALVTIDNVYSNNLGTFKRIIEEVLPVKYSEEYFQEVVDKNA
                     KGVFYSRLAYYGEIAVGAVKARLIANKNGGVLPAGVYIEVIAVLEAYRGKTAGSLLLK
                     YIEDKCKESFQHDLYVHVSVDNESAIQWYEKNGFVKQDDVLKNYYKDTKGSPDAFVYK
                     KVL"
     gene            complement(<999714..>1001735)
                     /locus_tag="KLMA_30456"
                     /db_xref="GeneID:34715732"
     mRNA            complement(<999714..>1001735)
                     /locus_tag="KLMA_30456"
                     /product="protein translocation protein SEC63"
                     /transcript_id="XM_022818975.1"
                     /db_xref="GeneID:34715732"
     CDS             complement(999714..1001735)
                     /locus_tag="KLMA_30456"
                     /codon_start=1
                     /product="protein translocation protein SEC63"
                     /protein_id="XP_022675587.1"
                     /db_xref="GeneID:34715732"
                     /translation="MPQNYDYDETSTTWPFFVLTVLLVCVVPVTCVEIYKLVAGDSSS
                     PDSKSEWARLHEKYTPEEVRKQRLENKKKRSKKGIYFATVGWVLISALVYYIQKNDAI
                     YQIAASTFDPYELLGVSLSSTDKEIKSAYRKLSVKFHPDKLSKDLSESDRSAMEERFV
                     MINKAYKALTDEITKENYKKYGHPDGPQSTSHGIALPKFLVEGSASPFVLFAYFVLLA
                     VVLPVMVAKWWSSSQEYTKHGIHSETASHFVDKLFNFKPSYVVVPDLIIKWISEAKEY
                     QLKYPELTPEDVSNVIHAHINREASKHDYAKNYIITKSSLLFHQLIEIASTFRNTEVA
                     LMALETYRSVIQCTQLSLHSQIFQLPNVNKEHFLDSTTDDIRTLGKLFTYPDEQISKI
                     LGIQDKEALKETLTVASRIPKLQLLKASFKVRGSSLETVEPGSTPHIQVKVLIRSPKH
                     KLFPKSLIPEEKLLGDDPLMLEQDPFEKMLEEPLLPETFAPLHPTRRRTCWYSIVVSQ
                     KDGKIIQTPSITQRLSVENLNVDFDKRIVKDVEKEFKADDWVVGTISVPFAQPAPQDE
                     GSYFFRVVIKSPDYFGSDLDFTVPLVVKRAPVEVDPKKEILHELGSDEEEDDDAQDSA
                     EDEDDSDASDDEYDSDITDIDTDTEDEDEESDASNDAPSPDNEKEVKKD"
     gene            <1002329..>1004101
                     /gene="MEX67"
                     /locus_tag="KLMA_30457"
                     /db_xref="GeneID:34715733"
     mRNA            <1002329..>1004101
                     /gene="MEX67"
                     /locus_tag="KLMA_30457"
                     /product="mRNA export factor MEX67"
                     /transcript_id="XM_022818976.1"
                     /db_xref="GeneID:34715733"
     CDS             1002329..1004101
                     /gene="MEX67"
                     /locus_tag="KLMA_30457"
                     /codon_start=1
                     /product="mRNA export factor MEX67"
                     /protein_id="XP_022675588.1"
                     /db_xref="GeneID:34715733"
                     /translation="MQVNGFSNMNQIGALAQQNHMDNLVGVNIRGWTNATQQDLLNFI
                     SRKTRISVRNSVVQGDTIVGYVTPQEADQLVKFSGYRFAGNTLKIQKAGGAGGNVSTN
                     DTITVLRNVLMRRYNAQTKMLDLGNLFNDPELVQRGMAPKNVNTQSKMFPAMMKVASK
                     EPNMVVESINLSDNNLRDVNGVTTLAQTFPRLKNLCLANNNISRFHSLEAWKNKFKDL
                     RELLMMNNPITSDRLYRTEMLRIFPKLVILDNVVVRDEQKLLSIYSLPTQQTQFFFED
                     SGLASSSTDFVTNFLNLWDTNRMQLMGLYTPQSQFSISVDSSVPAATVPNAQTTPTFG
                     YYLPFSRNISKISSDKTIQERIFMGPEAIYETFRSLPVSKHFLQEQPQAYSVQAWTFP
                     QVNGFVITLHGHFDETAKPEMDKNKTQQNSSSSRGRRYNHGFMSSANTKLSQKSFDRT
                     MVLVPNPNGSVIIASDALTIRPYCDGAWSNPVSPPATVQPPMVQPQQQQQPQQQQQPI
                     NIPLTQTPPNTGALGTTTLQLPPEVQAKLSPIQLELLQKLHVETKLNAEYTYMLAEQS
                     MWNYDSAMQGFRNSVNNLPREAFV"
     gene            <1004450..>1005100
                     /locus_tag="KLMA_30458"
                     /db_xref="GeneID:34715734"
     mRNA            <1004450..>1005100
                     /locus_tag="KLMA_30458"
                     /product="outer spore wall protein 1"
                     /transcript_id="XM_022818977.1"
                     /db_xref="GeneID:34715734"
     CDS             1004450..1005100
                     /locus_tag="KLMA_30458"
                     /codon_start=1
                     /product="outer spore wall protein 1"
                     /protein_id="XP_022675589.1"
                     /db_xref="GeneID:34715734"
                     /translation="MRSIPEPRQTRFNRIRRLLHKAHNCLTMKRFKRRYNVHKIKKGS
                     RVANLRSAVPLDHIANIPTGMTHKSSNIKPLLLVSFNKGRQHSPKVRMLENNGRLRSW
                     VSGRKFTLKKIVNNATIERDPNMADIHTVRRDVANHADLKVNYSQQGIVKSVDIPCCY
                     TEDPKLINIGQEHTLRIRDYPSLNPNQTMRSTVRPMHKQEPLSKIFFQDMLETVSS"
     gene            complement(<1005218..>1005676)
                     /gene="DAP1"
                     /locus_tag="KLMA_30459"
                     /db_xref="GeneID:34715735"
     mRNA            complement(<1005218..>1005676)
                     /gene="DAP1"
                     /locus_tag="KLMA_30459"
                     /product="damage response protein 1"
                     /transcript_id="XM_022818978.1"
                     /db_xref="GeneID:34715735"
     CDS             complement(1005218..1005676)
                     /gene="DAP1"
                     /locus_tag="KLMA_30459"
                     /codon_start=1
                     /product="damage response protein 1"
                     /protein_id="XP_022675590.1"
                     /db_xref="GeneID:34715735"
                     /translation="MSFIKNFLTGGVKTSEDPTGLTQGSNGNNGDNNQDNKPIVEGKF
                     YPRTLYKFNGHDDEKIFIAVKGKVYDCTQGRQFYGPSGPYSNFAGHDASRGLATNSFD
                     LDTLKHWDEPMDTLQDLSEQEQAALDGWVSHFEKKYPCIGTLVPEPGVNN"
     gene            complement(<1006215..>1008587)
                     /gene="TRE2"
                     /locus_tag="KLMA_30460"
                     /db_xref="GeneID:34715736"
     mRNA            complement(<1006215..>1008587)
                     /gene="TRE2"
                     /locus_tag="KLMA_30460"
                     /product="putative zinc metalloprotease TRE2"
                     /transcript_id="XM_022818979.1"
                     /db_xref="GeneID:34715736"
     CDS             complement(1006215..1008587)
                     /gene="TRE2"
                     /locus_tag="KLMA_30460"
                     /codon_start=1
                     /product="putative zinc metalloprotease TRE2"
                     /protein_id="XP_022675591.1"
                     /db_xref="GeneID:34715736"
                     /translation="MARGQGRYHNVGQDEADEVPSNLSLDTPEPQGVDEALLPANPPE
                     YNEADRPDILPMEFGVDNDEQLHSFSRFRQLKTRIEDSFIYPMKNNVVDPLVQLYEMA
                     SAKVDLYLSKLGNPLILRRFVYILFMSIIVYTVILSGLMPNSKSTATIGMFSDKNQLI
                     YYASRSIDYAKLEEDMEYLSSMPHLAGTKGDYAITNYIKESFRNNGLKLMKEIAFQGY
                     MNFPNQSELIVTSSADNKAQSFRLSKENFNPLSSNGNVEDANLIYANYGTKAEMQALK
                     DAGLITENTILAMKYGSLPSEQILLAEKYGIKGIIFISKPFGDDGDVIQKLSAGIPQY
                     GTGDALSPGWSSLLPKKIHLSDSKLIPHIPTIPISYNQGLKLKSLLSQNIGPNNIAFD
                     DLWYSGNANEVKCTLKISNAEKIMHPSWNILGKIEGKEQSDKAIIIAASRDSACKGAL
                     YPNFGTASLMALLQLFQQTKYKYDWKPLRNVYFVSYDGSQYNNFGASELMETETNQLK
                     GEVYTFLDISQLGVDPKAGKTLDIQATALLHSFFQDSKKFDVRVRNVEQYGDWTPYLA
                     NGIPTVVMGVPFVLKKDAPIATCADDFKNWSDMMKETEGSWDLVAETLTYVYEMTLRL
                     IDEPLLPFNVKDYVMNMEHLFQDLQKQGGPQLDYSSMVQGLEDWKKIGNEWNVWVHTW
                     NNIVMMEDEGVEPSLVSVHRWTWNKKLMNIMKRQCHPNGLPDRHFYKNVIFGPTLWTQ
                     EGGHDSWSFPGVRDAITEKNWDEAQKQINNVGNLLVSSAQSFMDETSNTF"
     gene            <1008966..>1010315
                     /gene="SPT14"
                     /locus_tag="KLMA_30461"
                     /db_xref="GeneID:34715737"
     mRNA            <1008966..>1010315
                     /gene="SPT14"
                     /locus_tag="KLMA_30461"
                     /product="phosphatidylinositol
                     N-acetylglucosaminyltransferase GPI3 subunit"
                     /transcript_id="XM_022818980.1"
                     /db_xref="GeneID:34715737"
     CDS             1008966..1010315
                     /gene="SPT14"
                     /locus_tag="KLMA_30461"
                     /codon_start=1
                     /product="phosphatidylinositol
                     N-acetylglucosaminyltransferase GPI3 subunit"
                     /protein_id="XP_022675592.1"
                     /db_xref="GeneID:34715737"
                     /translation="MSKEQEKYNVAMVCDFFYPQLGGVEFHIYHLSQKLLELGHNVVV
                     FTHAYGDRTGIRYLSNGLKVYYIPYLVLYRQTTFPTVLGSFPVFRNLLIREQINVVHS
                     HGSVSTFAHEAILHANTMGIRTVFTDHSLYGFNTLGSILVNKLLHFTLCNTDAVIAVS
                     HTCKENMILRAKLDPQNISVIPNAVVSSDFTPEDGTLKASNTSGRITVVVICRLYTNK
                     GADLLTHLIPRICSDCKTVDFIIAGDGPKFIAFQQMIENNRLQDRVELLGALRHEDVR
                     DVMCRGDIYLHASLTEAFGTVLVEAASCGLLIVTTSVGGIPEVLPEYMTVYAEQTSVS
                     SLIEALNKAISLMRSKKVDTSRFHGDIAQMYDWMNVAERTVNVYHRISKQDPMRKNWA
                     VMVKRFYGQEGSWARMLYVLCAVVEYIIFYIMELIYPAKKIERAVKWKHVITNDSKK"
     gene            complement(<1010364..>1012853)
                     /gene="NIP100"
                     /locus_tag="KLMA_30462"
                     /db_xref="GeneID:34715738"
     mRNA            complement(<1010364..>1012853)
                     /gene="NIP100"
                     /locus_tag="KLMA_30462"
                     /product="protein NIP100"
                     /transcript_id="XM_022818981.1"
                     /db_xref="GeneID:34715738"
     CDS             complement(1010364..1012853)
                     /gene="NIP100"
                     /locus_tag="KLMA_30462"
                     /codon_start=1
                     /product="protein NIP100"
                     /protein_id="XP_022675593.1"
                     /db_xref="GeneID:34715738"
                     /translation="MNEVGIQIGDRVLVRNLSGTVRFIGETEFATGVWIGVELDDPVG
                     KNDGSVQGVRYFELADDKKGAMFGIFSKYEEVRKLYPMSSSTPSPPSSASASTDTARL
                     KKIIGKLEDKLLSMRTQCKTLEEQVSKATAEQSRMYLLENQLEKLTLERDDAEQRNDI
                     LLSELEQLASAHEEALKELNQYKEEVLMRRAADSDLNLEELDSLDSGTLLKQSKLMAV
                     ALSKLQLDLSKMQSQCEDLQKLNDTLGAQTQEYISTIETLEKNLSESKISLEDLQQQF
                     EASGNSSLIIESLTTENHILASEVESLKQELDSIKQKRSEDEELETLYKEIEKELNLQ
                     IHTLQDNLSNDEALISSLKNENETLIQELKSMHKGTESPLPNHSATAVSSDIEKLQAE
                     IAALKFQNRELEFESGVSAHKLSYVKFDEKIDRLSQIKYICEEDFKITQDPIEACKTQ
                     LVLIYYYWLIHFDIDTTLCDKKLDINAFVKCVKENKPLGLNIETIQEPNMNISNPKVI
                     FAAINEFINGFIDSLLSYDLKIDEHDHEKVRLQYSQFQDIHKYCAKKLKEYEEFEGDV
                     LADTNLHPMYLQFVQMVLHLKNEDDNLNKFKQNLESLSINMTAYEKETDNKENTSNSK
                     EFQEQINYLQHTMMEKDQLIEELQLKIKVFDSKFARNEEMELTISDLKNELAVAKAKI
                     LNLQEELSNINEEHQQFLLKVRNEKYDQNNLIVTPSIQKLQEQKESFDRAALLSEIAE
                     LRRVVILREKKSSLEWTMSPLERNLQSSTKVLFQDFNNLANVMSYCIDLSNNQLETKS
                     VTIQRHRLVSLNENLESSFAYIRGMLNSTTY"
     gene            <1013167..>1013670
                     /gene="CDC31"
                     /locus_tag="KLMA_30463"
                     /db_xref="GeneID:34715739"
     mRNA            <1013167..>1013670
                     /gene="CDC31"
                     /locus_tag="KLMA_30463"
                     /product="cell division control protein 31"
                     /transcript_id="XM_022818982.1"
                     /db_xref="GeneID:34715739"
     CDS             1013167..1013670
                     /gene="CDC31"
                     /locus_tag="KLMA_30463"
                     /codon_start=1
                     /product="cell division control protein 31"
                     /protein_id="XP_022675594.1"
                     /db_xref="GeneID:34715739"
                     /translation="MNNRRPSGRVAKTVDKSTLQKELLEEQKQEIYEAFSLFDMNNDG
                     YLDYHEFKVALRALGFELSKGDILELIDRYDADGRRLIQYEDFYLVVGEKILQRDPLD
                     EIKRAFRLFDDDNTGKISLKNLKRVAHELGENLTDEELRAMIDEFDLDDDGEINEDEF
                     IAICTDN"
     gene            <1014127..>1015017
                     /gene="MRPL40"
                     /locus_tag="KLMA_30464"
                     /db_xref="GeneID:34715740"
     mRNA            <1014127..>1015017
                     /gene="MRPL40"
                     /locus_tag="KLMA_30464"
                     /product="54S ribosomal protein L40"
                     /transcript_id="XM_022818983.1"
                     /db_xref="GeneID:34715740"
     CDS             1014127..1015017
                     /gene="MRPL40"
                     /locus_tag="KLMA_30464"
                     /codon_start=1
                     /product="54S ribosomal protein L40"
                     /protein_id="XP_022675595.1"
                     /db_xref="GeneID:34715740"
                     /translation="MSTYKHISKAGARFLEQVKMKDSNIAKMFNKFERSTMPQFLSSP
                     LERVDESEKFTTEREWKFMPGDRVVILNGEFKGNVCAITQHDRHTNGYILDENGPTKT
                     VPVPKQFWQAGQNSHMVSFPVPVSQKDIKLVADIDDPSRPGVSKTVAIRDIEFSGSYY
                     DADYKKMMPYRVVVGDNKMVVPWPKPEFKPDGVLATRSEIARQQTFWVESAIKNPIPE
                     AAFLTIRNPKSKYRRGVLTAKEISRLVAPKMPLTEEKKQYIQQKKELSGLPKRKLTDE
                     DKEAIGSKIYQHFVKSFGAQ"
     gene            <1015395..>1016321
                     /gene="HNT3"
                     /locus_tag="KLMA_30465"
                     /db_xref="GeneID:34715741"
     mRNA            <1015395..>1016321
                     /gene="HNT3"
                     /locus_tag="KLMA_30465"
                     /product="aprataxin-like protein"
                     /transcript_id="XM_022818984.1"
                     /db_xref="GeneID:34715741"
     CDS             1015395..1016321
                     /gene="HNT3"
                     /locus_tag="KLMA_30465"
                     /codon_start=1
                     /product="aprataxin-like protein"
                     /protein_id="XP_022675596.1"
                     /db_xref="GeneID:34715741"
                     /translation="MQGDNSEAIYVIEWEDDGQGPSGVVIDGTQYGTHLFKDPSSKDK
                     KLVSCKHCLKQFENVDTRSIVLHMNRIHPQVRRDMTYEEYMRLFKPSLMKHAHGIEKN
                     MEKSFAIDLRKYVLCPENYQEVLYYDETATIIYDKFPKSEVHLLVLPRNYRVSNSHPT
                     LISSETKAKLEWHIEWVKQFIWKQFTKRYKITQTDLSKERFLQEFIQYGVHSVPSMAN
                     THIHMMTRDFHSERLKNKKHFNSFNSPFFIHWDKLPMTKDLSDKEINDRYIKNYDMIC
                     PYCSSNFKNQFSKLKVHLAEEFSKRFVTNVEK"
     gene            complement(<1016453..>1017766)
                     /gene="RPT4"
                     /locus_tag="KLMA_30466"
                     /db_xref="GeneID:34715742"
     mRNA            complement(<1016453..>1017766)
                     /gene="RPT4"
                     /locus_tag="KLMA_30466"
                     /product="26S protease subunit RPT4"
                     /transcript_id="XM_022818986.1"
                     /db_xref="GeneID:34715742"
     CDS             complement(1016453..1017766)
                     /gene="RPT4"
                     /locus_tag="KLMA_30466"
                     /codon_start=1
                     /product="26S protease subunit RPT4"
                     /protein_id="XP_022675597.1"
                     /db_xref="GeneID:34715742"
                     /translation="MSEEQDPLLAAMEEESGQTNAGENTNGAQATGGESTGAEAPAPE
                     PVDPEQAAKEKAMQHFKKRLMEHRRYDDMLKQRRETIRVLEAEYERTEQDIKALQSIG
                     QLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILP
                     RETDPLVYNMTTFEQGEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGV
                     LLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPC
                     IIFMDEIDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLD
                     PALLRPGRLDRKIEISLPNEAGRLEIFKIHTSKVKKAGEFDFEAAVKMSDGFNGADIR
                     NCITEAGFFAIRDDRDYINQDDLMKAVRKVAEVKKLEGKLEYQKL"
     gene            <1018176..>1019708
                     /gene="GCD1"
                     /locus_tag="KLMA_30467"
                     /db_xref="GeneID:34715743"
     mRNA            <1018176..>1019708
                     /gene="GCD1"
                     /locus_tag="KLMA_30467"
                     /product="translation initiation factor eIF-2B subunit
                     gamma"
                     /transcript_id="XM_022818987.1"
                     /db_xref="GeneID:34715743"
     CDS             1018176..1019708
                     /gene="GCD1"
                     /locus_tag="KLMA_30467"
                     /codon_start=1
                     /product="translation initiation factor eIF-2B subunit
                     gamma"
                     /protein_id="XP_022675598.1"
                     /db_xref="GeneID:34715743"
                     /translation="MGFQAFVFCGRGAKLTPFTNVRGDTGEPKALLPVANRPMIEFVL
                     DWCEQAQFLEVNLVIDIADVEELEAQLKKYREIREHYYGLLAQSVGNNNSHYLRKPAP
                     INLIGSKCENTGDCLKTELLDRITGDFVLLPCDFITDIPPQVFLDQYLNKDPENLAMA
                     VYYNNGFENIDKKHLKQFLTVYSDNLDSISKPVLLDVYSKEDVDKTKYLQIRSQMLWR
                     YPNSTVSTKLLNSFIYFCSYELKTLLKDAPNTTSSDSVAAGKREAETEKDSKKEETES
                     EALNKLTKTFHSTGFLKKKNELIRDPINCNKSLAKVFRDLSRRSWQHVKPRETVGIFV
                     LPDIGLFIRSNSLSAYMEANRFVLKIKQSAIHQRTTDGSSAIGADSVVGNNCSILEKT
                     NIKRSVLGNNCKVGKRCRIVGCVILDGVEIEDETHLENVIIGRNAKIGKKSKLTNCYV
                     EGSYVVNEKSTIKGETLTNIYIGDEYSASSLESESSGSESEYTDEYYDDEDFVDDGLF
                     DH"
     gene            complement(<1019990..>1021342)
                     /gene="COX10"
                     /locus_tag="KLMA_30468"
                     /db_xref="GeneID:34715744"
     mRNA            complement(<1019990..>1021342)
                     /gene="COX10"
                     /locus_tag="KLMA_30468"
                     /product="protoheme IX farnesyltransferase"
                     /transcript_id="XM_022818988.1"
                     /db_xref="GeneID:34715744"
     CDS             complement(1019990..1021342)
                     /gene="COX10"
                     /locus_tag="KLMA_30468"
                     /codon_start=1
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="XP_022675599.1"
                     /db_xref="GeneID:34715744"
                     /translation="MSLILHPVMLKRFSPRLPSVILVTLGPKYGLQRRSFALRSNNEP
                     SEEEHVHINTAPIEFTANLLARKRETDTDKLKDVTLKALRCNDTTPENDSPANSKTAT
                     QNIPFDVKLVDKQERKKVRGSQADSNQLFKKQYIEPYLQLSKPRLTVLVMLSAICSYA
                     LSPYPATVLQLLSLTVGTTLCSASANAINMGREPDFDRQMIRTQARPVVRGVVSPQQA
                     FKFAAAAGSLGVSILGLGVNPTVAFLGASNIALYAWLYTSLKRKHIINTWVGALVGAI
                     PPLMGWAASSPLTHPGAWCLAGLLYAWQFPHFNTLSHNIRNEYKNAGYVMTAWKNPKL
                     NARVALRYSLLMFPLCFGLSYFNITDWYYQLDSAVVNTWMSFWALKFYLQQKRNYSKT
                     VYNNKTEFNKGLALANVYARKTFWVSVLHLPAVLILAILHKKGRWDWLFEEDKKSLKP
                     "
     gene            complement(<1021772..>1022779)
                     /gene="RPN8"
                     /locus_tag="KLMA_30469"
                     /db_xref="GeneID:34715745"
     mRNA            complement(<1021772..>1022779)
                     /gene="RPN8"
                     /locus_tag="KLMA_30469"
                     /product="26S proteasome regulatory subunit RPN8"
                     /transcript_id="XM_022818989.1"
                     /db_xref="GeneID:34715745"
     CDS             complement(1021772..1022779)
                     /gene="RPN8"
                     /locus_tag="KLMA_30469"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN8"
                     /protein_id="XP_022675600.1"
                     /db_xref="GeneID:34715745"
                     /translation="MPGPYEQVIVAPLVLLSVLDHHQRTNTPDNKRCLGVILGDSSTG
                     VVTVTNSFALPFEEDEKNPDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGGKLRAS
                     DLKINEMFKKYCSNNNPVLLIIDVKQEDIGLPTNAYVAVEQIKDDGTSTERTFMHIPS
                     TVEADEAEEIGVEHLLKDVRDQAAAGLSIKLTNQLKSLKGLQGKLRDIVAYLQKVADN
                     ELPVNHTILGKLQDIFNLLPNLGTPEKDEMVGEQQHVLDNVSNNLEKALTVKTNDELM
                     IIYISNLVRAIVAFDNLIENKIQNKKLMEKHSNINFDKKDESNNASTVTEESKSVSTK
                     N"
     gene            <1023044..>1024087
                     /locus_tag="KLMA_30470"
                     /db_xref="GeneID:34715746"
     mRNA            <1023044..>1024087
                     /locus_tag="KLMA_30470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818990.1"
                     /db_xref="GeneID:34715746"
     CDS             1023044..1024087
                     /locus_tag="KLMA_30470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675601.1"
                     /db_xref="GeneID:34715746"
                     /translation="MPFGQIVIGPPGSGKSTYCNGCTQFFNAIGRHVQVVNMDPANDR
                     LPYPCSVDIRDYITLEEIMSEQHLGPNGGLMYAIESLNESIDLFVLQIKSLVQEEKAY
                     LVFDCPGQVELFTHHSALFHIFKRLEKELDLRLCVVNLVDCFYITSPSQYVSILLLAL
                     RSMLMMDLPHINVFSKIDMLKGYGELPFRLDYYTEVQELEYLQPFVEKEGSGFLGKRY
                     SRLTETISEMVSDFNLVSFEVLAVDDKQSMINLQSVIDKANGYIFGASEVGGDTVWAE
                     ASRQGAALVNYDVHDRWIENKDLYDKLEQEARDQLLKEQQMQNKEVDVDENDEWESAL
                     REWEEKQGTNYVR"
     gene            <1024758..>1026080
                     /locus_tag="KLMA_30471"
                     /db_xref="GeneID:34715747"
     mRNA            <1024758..>1026080
                     /locus_tag="KLMA_30471"
                     /product="protein DSE3"
                     /transcript_id="XM_022818991.1"
                     /db_xref="GeneID:34715747"
     CDS             1024758..1026080
                     /locus_tag="KLMA_30471"
                     /codon_start=1
                     /product="protein DSE3"
                     /protein_id="XP_022675602.1"
                     /db_xref="GeneID:34715747"
                     /translation="MGRHFRGQRISSDIDFVRPSSMILTGEDLANIPDAFEQLRLRDE
                     SSGGKSGGKSYGALQGNGLGTRLSRKFGGTIKLKKRLSSVPELLLHEISKDKDVPPLP
                     ASTPTMDPKVLKKRATYSMNRPLPPVEEIAELQQNGILRKPNRYHSNVRNFSSPLSQP
                     PICGFKRQQSSLVMSATTEIAANPKAAQALENLQKNTFAATRDDIGRRPFLRYRENKN
                     KSDVLLEEIVNLYATTGQEDINARPELKQKIDDFIDTIHESLQTHKTSRIEKTKRRDI
                     TPIIVKEEYIKDPITEVTIPQSPELRPASILEANISSPEYNTSGGSDPSSGGEEFSDL
                     DSIPAGIRSPTSCSDESFYSCAEEPTKELGDIPDLGWQPNYSSINVKFSSVVPKVVDV
                     TDLFGFSDGESESSNSPVETNQEEYIDMSESGLVKVIDDTSSSIYSQY"
     gene            <1026478..>1026795
                     /gene="RBL2"
                     /locus_tag="KLMA_30472"
                     /db_xref="GeneID:34715748"
     mRNA            <1026478..>1026795
                     /gene="RBL2"
                     /locus_tag="KLMA_30472"
                     /product="tubulin-specific chaperone A"
                     /transcript_id="XM_022818992.1"
                     /db_xref="GeneID:34715748"
     CDS             1026478..1026795
                     /gene="RBL2"
                     /locus_tag="KLMA_30472"
                     /codon_start=1
                     /product="tubulin-specific chaperone A"
                     /protein_id="XP_022675603.1"
                     /db_xref="GeneID:34715748"
                     /translation="MAPTQLEIKERALKRLCKEEKFYQKELEDQKEHVKKLEADPSVD
                     SYDLKKQIEVQQDTERLLPELYKKIREFRDDLEKFLESYEGTEDLEPAKAAIAEADIL
                     LSK"
     gene            complement(1027141..1027213)
                     /locus_tag="KLMA_R316"
                     /db_xref="GeneID:34718690"
     tRNA            complement(1027141..1027213)
                     /locus_tag="KLMA_R316"
                     /product="tRNA-Val"
                     /db_xref="GeneID:34718690"
     gene            <1027582..>1028793
                     /locus_tag="KLMA_30473"
                     /db_xref="GeneID:34715749"
     mRNA            <1027582..>1028793
                     /locus_tag="KLMA_30473"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818993.1"
                     /db_xref="GeneID:34715749"
     CDS             1027582..1028793
                     /locus_tag="KLMA_30473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675604.1"
                     /db_xref="GeneID:34715749"
                     /translation="MITTNGSLSFLQLSWTTFQSVFVVFVICLCGFLCSCSGLLPKDG
                     QKIISMLNVNLLTPCLIFSKLARSLSLAKLIQLFIIPVFYSVLIGVSYLSGCLVSSLF
                     GLDLDETHFVIGTAVFPNSNSLPVSLMMSLAYSLPQLKWPEIPDDNGDNIASRGILYL
                     LMFQQIDQTLRWSWGVHKLLRWSGEAEESITITEQSSFSTTILDSDTTRTKFAKFSSH
                     LRYHWDNLVSYMNPPLYAIFFSVVAASIQPLKEALFEGSGFLHNTLTMAVDQMADVSI
                     PLILIVLGANFGPSNSTSSMATHNSKNMVFASILSRMILPAIILLPLIALTVKNCKIS
                     ILTDPAFLLVSFLLTTSPPAIQLTQLTQINEFFEFEIVKVLFWGYVVMTLPMTIAMVS
                     ISLTVLEWANQ"
     gene            complement(<1028935..>1032576)
                     /gene="NET1"
                     /locus_tag="KLMA_30474"
                     /db_xref="GeneID:34715750"
     mRNA            complement(<1028935..>1032576)
                     /gene="NET1"
                     /locus_tag="KLMA_30474"
                     /product="nucleolar protein NET1"
                     /transcript_id="XM_022818994.1"
                     /db_xref="GeneID:34715750"
     CDS             complement(1028935..1032576)
                     /gene="NET1"
                     /locus_tag="KLMA_30474"
                     /codon_start=1
                     /product="nucleolar protein NET1"
                     /protein_id="XP_022675605.1"
                     /db_xref="GeneID:34715750"
                     /translation="MFKLQIILVPASVNRSFNYGLPSISSDSSQLILPPQQQQLQQQQ
                     QQVPHGSQSVNNFGGQSVGLDPNVSTNTAYVSSFMTSHITRPKLKKFLIFTKPTNTLY
                     QLSQEILDKCNKIYPNLPPELEIDTLQDVDECDLDPDFIVKDVFNVFNTVRVILRNDV
                     DLDNSASRTESLYSTKRRKLNNGNSAAPAAALSSISSTGNVLDQPVTVAKRRSQVLKN
                     SALRISTPLAHQIYPPPSQRNQKQVNSDYEDDDYGEDELGDKSILPPPTVPQSPPIRI
                     SSSIGQKRLNINGYDDAVSKSETVDPSKSKQQRLPSGTPMKPINMVETPNKAGNISLP
                     QQQQQNQGLLRINSTPVVTNQRITSGMLRIPEPRISEMERTMHEGLSSPAAGLLPPKS
                     AKIPMKKPYVPEIDDSSSSDSGTNEINTRVVESGKPKDLMPLSSQGRAPSSIADDNGS
                     PTKKSPLDHSKVTQVKVAELPQRKSSLEAKVEKLAKNASELITENNHISNNTTRKDGF
                     SDSESESEESENDAANDTVRIRPAERTDGSFHKSDLLEILKGSKMDIPPGFKRVGSAL
                     QENDINKRSRKPYLTVLNKDIDNSEPDPRNILPSKIPRHAAQKAAQFISAGTSRKPLE
                     SSSSSSSAQSGEDSDSESGIETDHSTGNVDEVDLKKLNVHPLKPVVVPLEETQDDNTN
                     ISHNDSATRSDVLNDNLGQKETTGSNELSESSKPSQQKSDKVVGKNIELDNSQKDQMS
                     PSKLINLKPVQSVKASTPAPSQELHEKIDRQLSPSPVRNRKDYVSPEFIDDSDDASEK
                     QSPASTQNTQEKENTDPSSKASNTEADNKSDNKSRKMTPAMLKRKQEAEQRRLQREAA
                     RKAKQEEQERKRAAKEAAKKAKQEEAARKKAEREAAKKARQEQIARRKLAQENKKDKK
                     ESTALHRVNSVSSQTSPKLSQSSSPASDTDKKDIDNGKKAEVSGSSSQVSKLDELRSK
                     FAGGKSSANEVINKIAVNPVKLQLSSKSTSTSSSVSETEESSDSGDSSSSSSSSEDEA
                     SMSKKIRRGIVDTPRGVVGSISKKNLEKDTSELRDAPQSTQQKTATPLKVPVTKIMDY
                     ASPAGKSNDNTVLVSPPRNSVKTTRQSLARNSLSSLSDLVSRGVPEVKEKPTSKAVPE
                     PESSSSSDEGNDDEEISSDSDDDSDSSDSSDDDSGSNFINAKSASKALGKKKMDSGFS
                     SLIKDLKRK"
     gene            complement(<1032990..>1033895)
                     /locus_tag="KLMA_30475"
                     /db_xref="GeneID:34715751"
     mRNA            complement(<1032990..>1033895)
                     /locus_tag="KLMA_30475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022818995.1"
                     /db_xref="GeneID:34715751"
     CDS             complement(1032990..1033895)
                     /locus_tag="KLMA_30475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675606.1"
                     /db_xref="GeneID:34715751"
                     /translation="MDKIYVYAGENKAKIELTRIKDVPRIEDIIEYLHRMQDIFQLQL
                     GVVETITGNLKIRSSSQHDDSEDYGKPFYILEYCEGEDRYSLWRTSYEWKLSGAIATL
                     YGNNGPVEFPVALLDAFKNFKHKEEILNSLKEFNIKKAKALDWQMVAVELSKFIDDFE
                     KSSSEIDRHQLKTAIALTLLKCMVHSNKIALENTLLSYDAKMHQQESNVSSPSSTSTK
                     PTRATSVESDYTHMPSTQLQSNFNSFFQSMAENFETYDTEKQPSTRSLKLPPLTKVRS
                     NSNKRNPAGQVEKPTKKKSRRMSIK"
     gene            complement(1034322..1034394)
                     /locus_tag="KLMA_R317"
                     /db_xref="GeneID:34718691"
     tRNA            complement(1034322..1034394)
                     /locus_tag="KLMA_R317"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718691"
     gene            <1034749..>1037699
                     /gene="SPO22"
                     /locus_tag="KLMA_30476"
                     /db_xref="GeneID:34715752"
     mRNA            join(<1034749..1034797,1034929..>1037699)
                     /gene="SPO22"
                     /locus_tag="KLMA_30476"
                     /product="sporulation-specific protein 22"
                     /transcript_id="XM_022818997.1"
                     /db_xref="GeneID:34715752"
     CDS             join(1034749..1034797,1034929..1037699)
                     /gene="SPO22"
                     /locus_tag="KLMA_30476"
                     /codon_start=1
                     /product="sporulation-specific protein 22"
                     /protein_id="XP_022675607.1"
                     /db_xref="GeneID:34715752"
                     /translation="MNDISSAFKVNIGEFTENDLVDISAKIQSILPLITKYDKTFRSA
                     KVALEEDVLLSLENGATNLWNAVIICGKQDSDETLKQTLFDCKYFSCLLLGLHEALID
                     DPICKVRVFKCLIATTKYSIDQKLPSNLHEKIQKHCDGYFERVEIYFNGMKNVSKRII
                     EEYRRAKIEMYVLYAQDALSETDFKMAKFYEQKAQIEENISSLDANTITDICRTIYNS
                     AFTVFEAKSAETDFTELIWILKRLLSYLKMNIKGLSANTDYPNLKYTINLFLVNLAIE
                     DSTKKDLCQEYIKELINEYHQKIEPYKLAVKFHELHNPGDFEHIEEILMHMFTVVNVV
                     ANFDSVISFINHQAKLDTKSALRCLDYIFYNKINAEKDTNALELYLTSRVYVVSQSGT
                     MSNDEKVKDLSKVIQSIEKIMVKSLSRTCITGTITMLFNKGKLLFKAGKQRESVEWFK
                     LALNDTISAGYIDKGKIQRALQFAYIDLDEFTKVENVFNEMSHTDQRNALSQLNMFRV
                     FTHKNDLEAVKTCLSNLKESNDEKSIDSLILAVSECERSTDAAVFGMLCMFEKIQRVG
                     KESISSRGSSIICSLRYTTQMILKMTEKEDVQMFSKYLPLLHELLGSGIDFIKTAKVL
                     NTLSGKVEKSKIYDETISIDDIEWFASSCYNLARKFLGSELTTEIETLITDCKAYLDL
                     VPKEDLQQNQNLYYQYWEIRTEILALIHLGENTEWIALQQRCVEVLHSSKTFFISCEK
                     ALPSGLSINDVRMAEKEILLRSFEAALNTSDIKLLLQILDGSSNKDDMNLDEGFFTSF
                     QNFENVASDAFVTLFLKTIIQRNIDNTSLSNDTLSQWIRALLQYSSKEYQQESLLILK
                     QFEGRVKHVKDITSTEIEWLTTVIWNQGISHMITNDKNQGITWCKKAFEISQLSPNDA
                     LQNQLEKFWTDICSSLDLKNVVLSD"
     gene            <1038561..>1039973
                     /gene="SER3"
                     /locus_tag="KLMA_30477"
                     /db_xref="GeneID:34715753"
     mRNA            <1038561..>1039973
                     /gene="SER3"
                     /locus_tag="KLMA_30477"
                     /product="D-3-phosphoglycerate dehydrogenase 1"
                     /transcript_id="XM_022818998.1"
                     /db_xref="GeneID:34715753"
     CDS             1038561..1039973
                     /gene="SER3"
                     /locus_tag="KLMA_30477"
                     /codon_start=1
                     /product="D-3-phosphoglycerate dehydrogenase 1"
                     /protein_id="XP_022675608.1"
                     /db_xref="GeneID:34715753"
                     /translation="MAFGQQINNLQESFEAAMNLSNSPGAVSTSPTQSFMNTLPHRLS
                     AAKQQKALKPFSTGDIKILLLENVNQTAIEIFNKQGYQVEFHKSSLPEAELIEKIKDV
                     HAIGIRSKTKLTAEVLKHAKNLVVIGCFCIGTNQVDLDFAAKQGISVFNSPFSNSRSV
                     AELVIAEIITLARQLGDRSIELHTGTWNKVSAKCWEVRGKTLGIIGYGHIGSQLSVLA
                     EALGMNVLYYDIVTIMSLGTAKQVSTLNELLNKSDFVTCHVPATPETKNLLSGPQFAA
                     MKDGAYVINASRGTVVDIPALIQAMKAGKIAGAALDVYPNEPAKNGAGAFSDDLNPWT
                     SELVSLPNVILTPHIGGSTEEAQSSIGIEVATALTKYINEGNTVGAVNFPEVSLRALD
                     LDQENTVRVLYIHQNVPGVLKTVNNILSNHNIEKQFSDSNGDIAYLMADISNVNQSDI
                     KQIYDELNDTSYKISIRLLY"
     gene            <1040306..>1043110
                     /gene="RPN2"
                     /locus_tag="KLMA_30478"
                     /db_xref="GeneID:34715754"
     mRNA            <1040306..>1043110
                     /gene="RPN2"
                     /locus_tag="KLMA_30478"
                     /product="26S proteasome regulatory subunit RPN2"
                     /transcript_id="XM_022818999.1"
                     /db_xref="GeneID:34715754"
     CDS             1040306..1043110
                     /gene="RPN2"
                     /locus_tag="KLMA_30478"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN2"
                     /protein_id="XP_022675609.1"
                     /db_xref="GeneID:34715754"
                     /translation="MSVTSALPLLALLKENDNSIKAYALNSIKDVVDQQWSEISNEIT
                     EIEALYDDATFPDRKLAAIVASKVYYNLGEYELAVKYALAAEDYLNFDEQSQYVETIV
                     SHSIQMYIGLASQQYESSKDVKIDPHLVSIFERMLQKCVSAGEFKLALGIALESYRLD
                     VVEKLLTMQDTSANALKLCSYTLTVSTTALTNTHFKISVLKKLYDIVINMTSPDYFII
                     SKIIVQLNEPEYAKGLFSKLNATKSNDISYQIAFDLVNSASQGLLRDLLASLDPSVYD
                     PKLLDILSGIPTCDLQNTFLFENQNIDIALLNKMKSSLDGKFSLFHTAVSVSNAFMHA
                     GTTDDSFIRQNLPWLGKAQNWAKFTATASLGVIHQGNLSDGRKIMEPYLPGNGSKSRY
                     IKGGSLYGLGLIFAGYGKETTDYLKEQIQTNSSSVGEEDVDVLLHGACLGIGLSGMGS
                     NDLDVYELLKEVLYGDSAKSGDAAALAMGLILLGSGNESAIQDLLTYAEETQHGNITR
                     SLSVALALINYGREELADDLIDRLLGSENALLRYGGAFTIALAHAGTGNNKSIKKLLH
                     IAVSDSDDDVRRAAVTALGFVLIRDYTTVPRIVELLSESHNAHVRCGTAFALGISCAG
                     RGLQSAVDVLEPLLKDPVDYVRQAAMIATAMILIQQTEKTNPKVKAVNEQFISVISNK
                     HQEGLAKFGACVAQGIMNAGGRNVTIELENTEMGSLNTKAIIGLTMFSQFWYWFPLSH
                     LLSLSFTPTTIVGLRSTDLAIPKFSFKCHTKEGIFTYPPMFEEEVDKKIEKFAAAVLS
                     TTTKAKARAKKGKKADQEKQKQKDAEKKLEEKQEQEQEDKKKEESQRTDDYKVKYTAN
                     GYDIQNLSRVVPQQLKFISFSKDSRFVPIRKFRGNSGVIIIEDKTPEEPIELIKTVRQ
                     VKDVYAPLPTPFKVEDSLEF"
     gene            complement(<1043290..>1044966)
                     /gene="UTP7"
                     /locus_tag="KLMA_30479"
                     /db_xref="GeneID:34715755"
     mRNA            complement(<1043290..>1044966)
                     /gene="UTP7"
                     /locus_tag="KLMA_30479"
                     /product="U3 small nucleolar RNA-associated protein 7"
                     /transcript_id="XM_022819000.1"
                     /db_xref="GeneID:34715755"
     CDS             complement(1043290..1044966)
                     /gene="UTP7"
                     /locus_tag="KLMA_30479"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 7"
                     /protein_id="XP_022675610.1"
                     /db_xref="GeneID:34715755"
                     /translation="MAGKTHKKTQYSELQPRENQQKFERVSNDEDAKWSQKNLKKVKD
                     KKLKAGLKRIDQKYKEAVLSTAATEYLLPEERGYLEAEHELEKTFKFTQSEIKQHVDA
                     STANKALDLKLNEFGPYRVNYSRNGTHLLIAGRKGHVASLDWRKGELRGELHLGETVQ
                     AATYLQNEQFFAVAQKKYTFIYDHEGVELHRLKQHIEVKHMEYLPYHYLLATAGQTGF
                     LKYQDVSTGQLVSEIRTKLGPTTAMTQNPWNAVVHLGHSNGTVTLWSPSMPSPLVRLL
                     SSRGSITSIAVDRQGYYMATTGSDKSLKIWDIRNFKEIHSIENLPTPGTNVTISDTGL
                     LALSRGPHVTLWKDALKLGKAARPYFTSSGYQNRNTPYMSHLFAGNKVENLQFVPFED
                     LLGVGHQKGMTNLIIPGAGEANYDALEVNPYETSKQRQEQEVRSLLNKLPADSITLNP
                     NTIGNVDARATQVRLNAKDLAILTEKEQDKAKQNKDIPDVRPDVKGKNSGLRAFLRKK
                     TRNVVDDRKLRVQKQLEKEKENRQRREEVRKGERAEDHRDLVDEALSRFS"
     gene            <1045700..>1047040
                     /gene="URA9"
                     /locus_tag="KLMA_30480"
                     /db_xref="GeneID:34715756"
     mRNA            <1045700..>1047040
                     /gene="URA9"
                     /locus_tag="KLMA_30480"
                     /product="dihydroorotate dehydrogenase"
                     /transcript_id="XM_022819001.1"
                     /db_xref="GeneID:34715756"
     CDS             1045700..1047040
                     /gene="URA9"
                     /locus_tag="KLMA_30480"
                     /codon_start=1
                     /product="dihydroorotate dehydrogenase"
                     /protein_id="XP_022675611.1"
                     /db_xref="GeneID:34715756"
                     /translation="MKSSFVSLLQRGSIGSKQFIFFAKNEMSPLKAGVPGAKFLKYTV
                     GFTLGTLAGFYLTNSRSAIHEYVSCPTVRLLTPDAEAGHKLGIWLLKYGLAPRLWFDK
                     DEELLHVNVFGKTLTNPVGCAAGLDKDGEAIDGIFAGGFGYVEIGSVTPLPQPGNPKP
                     RFFRLPMDEAVINRYGFNSSGHDSVVKNLQNRVSSFINSYFCNDINAVENLSLYKNKL
                     LGINLGKNKNGDEVQDYLKGVEKFQKYADVLVINVSSPNTPGLRGLQKESILTNLLSQ
                     VVAKRDSLVSSGNVLGAKTHRPPVLVKVAPDLEEEEIKAIAEAAKKSKVDGIIVSNTT
                     IQRPASLITEDKNLVAQAGGLSGKPLKPLSLKALKAMAHYTKGSGLVLVGCGGISSGA
                     DAIEFAKAGATMVELYTSYAYRGPGLIARVKDEITEQLKRENKTWSQIIGEDVK"
     gene            <1047624..>1048733
                     /locus_tag="KLMA_30481"
                     /old_locus_tag="KLMA_30482"
                     /db_xref="GeneID:34715757"
     mRNA            join(<1047624..1047939,1048264..>1048733)
                     /locus_tag="KLMA_30481"
                     /old_locus_tag="KLMA_30482"
                     /product="glyoxalase super family protein"
                     /transcript_id="XM_022819002.1"
                     /db_xref="GeneID:34715757"
     CDS             join(1047624..1047939,1048264..1048733)
                     /locus_tag="KLMA_30481"
                     /old_locus_tag="KLMA_30482"
                     /note="cl00411, Glyoxalase/Bleomycin resistance
                     protein/Dioxygenase superfamily."
                     /codon_start=1
                     /product="glyoxalase super family protein"
                     /protein_id="XP_022675613.1"
                     /db_xref="GeneID:34715757"
                     /translation="MLSHVGVGTNDLQKAKKFYDAVLAVIGSDEGVVETVQSGHKRLV
                     YSDGKDLFLVSEPINGQPATVGNGVTIGFLCRSEEEVVKFHDVAVANGGVSIEDPPGL
                     RAHKLLLTIYTFKGTAEEEGHLPSNKKIKSMLYFNVNVGTNDIKRAKAFYDAVLGSIG
                     IGEGELVVNDSGHQKVFYRKDGEVFIVCKPINGEPANVGNGSTVGFRCGSPEEVDKFH
                     AAVVAQGGVNIEDPVGPRGERRYTGYFRDLDGNKIAAQYVKDD"
     mRNA            <1047624..>1048013
                     /locus_tag="KLMA_30481"
                     /old_locus_tag="KLMA_30482"
                     /product="glyoxalase super family protein"
                     /transcript_id="XM_022819003.1"
                     /db_xref="GeneID:34715757"
     CDS             1047624..1048013
                     /locus_tag="KLMA_30481"
                     /old_locus_tag="KLMA_30482"
                     /note="cl00411, Glyoxalase/Bleomycin resistance
                     protein/Dioxygenase superfamily."
                     /codon_start=1
                     /product="glyoxalase super family protein"
                     /protein_id="XP_022675612.1"
                     /db_xref="GeneID:34715757"
                     /translation="MLSHVGVGTNDLQKAKKFYDAVLAVIGSDEGVVETVQSGHKRLV
                     YSDGKDLFLVSEPINGQPATVGNGVTIGFLCRSEEEVVKFHDVAVANGGVSIEDPPGL
                     RAHSGFYLGYVRDLDGNKLCAFYNPPK"
     gene            complement(<1048825..>1049838)
                     /gene="GET2"
                     /locus_tag="KLMA_30483"
                     /db_xref="GeneID:34715758"
     mRNA            complement(<1048825..>1049838)
                     /gene="GET2"
                     /locus_tag="KLMA_30483"
                     /product="Golgi to ER traffic protein 2"
                     /transcript_id="XM_022819004.1"
                     /db_xref="GeneID:34715758"
     CDS             complement(1048825..1049838)
                     /gene="GET2"
                     /locus_tag="KLMA_30483"
                     /codon_start=1
                     /product="Golgi to ER traffic protein 2"
                     /protein_id="XP_022675614.1"
                     /db_xref="GeneID:34715758"
                     /translation="MSTELSAAEKRRLLRERRQQKFSNGGASSRLNKITGQQEGSFLS
                     SKSVLDEKKPAPAPAATTTATSFNANSSTSNADKSTEEIEEMLSRIPNQKAETEPDNS
                     ESNPEIALFQQLLKMQQQGSGIPAAGNGFGSQSPDASTSDLFTSLLNSDRNTTAAATA
                     AGQGSGGFVDESVLKYHQYKVSKLKSYITLLKWTILTPYVYFIMHPNPAATTIGQYSS
                     IASQLLEKSNFFSIFTGLEVIFISIYYQMLKKLQRKNNVTPTKNAGGIVKYLSMIPEG
                     ILPIKNVQGKIGLALEYFDVFSMYVTDICFVVVLFGLMKHFHASFPAVATTIEEPIVN
                     VIN"
     gene            complement(<1050164..>1051045)
                     /gene="SEC28"
                     /locus_tag="KLMA_30484"
                     /db_xref="GeneID:34715759"
     mRNA            complement(<1050164..>1051045)
                     /gene="SEC28"
                     /locus_tag="KLMA_30484"
                     /product="coatomer subunit epsilon"
                     /transcript_id="XM_022819005.1"
                     /db_xref="GeneID:34715759"
     CDS             complement(1050164..1051045)
                     /gene="SEC28"
                     /locus_tag="KLMA_30484"
                     /codon_start=1
                     /product="coatomer subunit epsilon"
                     /protein_id="XP_022675615.1"
                     /db_xref="GeneID:34715759"
                     /translation="MDFFAVKQQFYTGNYEETLTEVAKFNKTQDDTLTYYKNRALLAL
                     GQFSPTNSSSEALDTVFDAYYHFLQDTSSDLAKLEQAVDAAGRSPLALNLLVTALTIQ
                     GDFSKALEVAVEGIDSDQVTGTAELLLTAIQVTLLNNQPSLATTMFENFQALQEQSSE
                     DEIVLNLAESYINFNLAKEVTSSNFYFYDELSQTFPSWKTQLGLLSLHLQQANLPESK
                     AIIDLLESDFYTSKPEAAVYNADLLANKITYTILSGKDASQLRADLKQLKPTHPLCVV
                     DEANNKAFDQIVAKYSA"
     gene            <1052167..>1053972
                     /gene="ARE2"
                     /locus_tag="KLMA_30485"
                     /db_xref="GeneID:34715760"
     mRNA            <1052167..>1053972
                     /gene="ARE2"
                     /locus_tag="KLMA_30485"
                     /product="sterol O-acyltransferase 2"
                     /transcript_id="XM_022819006.1"
                     /db_xref="GeneID:34715760"
     CDS             1052167..1053972
                     /gene="ARE2"
                     /locus_tag="KLMA_30485"
                     /codon_start=1
                     /product="sterol O-acyltransferase 2"
                     /protein_id="XP_022675616.1"
                     /db_xref="GeneID:34715760"
                     /translation="MTDAIRDITEDKQFVRLRKLNSEDNGPRRPLKEDDIEDQGVEAI
                     DNVQNVVLKSSKDDGDLDLGSSETDDGETVLVKTTTLEQGDKHLHVFIQKLKGKERGR
                     FKKDTNEMQSMTRDVDWGSRGSIMDMMVTTPLRNHFQGPAIEQKYSKLKSTLKTNQIK
                     IDEDRIVEIANETITTDFSGFYVLFWMAVAFTVVKVTLQYYEDHDGDFSQSIILQYMT
                     TNLWKVALYDLAMYASTYVAFIIQYLCRKNVLPWKPTGRYLVMIFECLFLAVNIYLPK
                     KTFNYNWIAQIFLFLHSLVYLMKIHSYSFYNGYLWDITTELKYATKTIAKLKELQSPD
                     SNTEVLRKSIDFCEFELNSQSTTTKFPSNLTIKNYFHFHSFPTLVYQIEYPRTKKIRW
                     GYVFEKCCAIFGIIFIMMVVAQQFMLPVIVEAKDVGMSSYTVKEKMAIMPKLLLDLAP
                     AFIAMFLLVWYLIWDAILNCVAELTCFADRHFYSDWWNCCSWYDFSRLWNRPVHSFLL
                     RHVYHSSLSAYNISKIQAVLLTFALSAIFHEMAMYVLFNKVRGYIIVLQMAQIPFTAI
                     ANHPLLRDKKLFNNVVFWVGICLGPSITGLLYLIF"
     gene            complement(<1054228..>1054974)
                     /gene="ATP23"
                     /locus_tag="KLMA_30486"
                     /db_xref="GeneID:34715761"
     mRNA            complement(<1054228..>1054974)
                     /gene="ATP23"
                     /locus_tag="KLMA_30486"
                     /product="mitochondrial inner membrane protease ATP23"
                     /transcript_id="XM_022819008.1"
                     /db_xref="GeneID:34715761"
     CDS             complement(1054228..1054974)
                     /gene="ATP23"
                     /locus_tag="KLMA_30486"
                     /codon_start=1
                     /product="mitochondrial inner membrane protease ATP23"
                     /protein_id="XP_022675617.1"
                     /db_xref="GeneID:34715761"
                     /translation="MSNQLPPQNEELTKPNPPKAESDVQGFNWWRRTFQYKTGLGLTP
                     EEKVQYENDYKFVLQRQQCESCYHYRDWLLKYSPTVIFMTQQIAKLNNKRTNTDDMKF
                     DESKIICDVCPDWKSGGFHPELGILICQNRIKDKWHLEDTLSHELVHYFDNLKWEVDW
                     LNLKHHACSEIRASSLSGECRFMQEFARRGFNTGFKVEKGHQECVKRRATISVSGNPN
                     CKDMKHAEKIVDQVWDSCFNDTRPFDEIYR"
     gene            <1055521..>1056153
                     /locus_tag="KLMA_30487"
                     /db_xref="GeneID:34715762"
     mRNA            <1055521..>1056153
                     /locus_tag="KLMA_30487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819009.1"
                     /db_xref="GeneID:34715762"
     CDS             1055521..1056153
                     /locus_tag="KLMA_30487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675618.1"
                     /db_xref="GeneID:34715762"
                     /translation="MNIWIAASNGETELVEKFISQGQTANSKDDNGYTPVHAAAAYGH
                     IDLLKKLVHEYNGDVNIRDSDDDTPLHHCEDANTARFLIEQLGADHKLTNNEGKTCFQ
                     VWQETCDDNLELLKYAEEVLGESVFGSSLGIDQEQLKQFKDSIRYTLENDPVDETDPE
                     SLERRKKLESIIQGENAEEELEQYIRDMIHKQFFSGNAENDVSESNKRMK"
     gene            <1056575..>1057801
                     /locus_tag="KLMA_30488"
                     /db_xref="GeneID:34715763"
     mRNA            <1056575..>1057801
                     /locus_tag="KLMA_30488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819010.1"
                     /db_xref="GeneID:34715763"
     CDS             1056575..1057801
                     /locus_tag="KLMA_30488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675619.1"
                     /db_xref="GeneID:34715763"
                     /translation="MSSIWGSIAKGIDYVNDLNKGFFQLSFEEQQELGIWGRIKYYNW
                     NFEFAMLGIMVILFLISYYGKTLNNKYADKIFVTLNKFLLTELSFAKVGFSASGKKLP
                     YVEEQNNTWFTTFATGRSTIESVIIKAHLKPRHNPLALMTQVALANTFPSLVESDVNE
                     FISVTITPNGQFVATEDAKVSPNAAETLSKFKFITSIVNKSVMTKARDSNYFLSLTHT
                     SESDAIPLEYVFMSESNKLNGFIPHYTDSEFGELLTKCSKFLQFIAFTDLPEEKPITD
                     KLWDANQSPRCIIKTALITSDKDIELLKELISKVVEIFDTVTKEIQTKSTNTFVTADI
                     LKKSIQLRKEELAKIIKVMKQVEREMIQEKKLEEEKQKRKNLRNQHSEKELDKIEQKK
                     REKRERRMKNKQKVKM"
     gene            complement(<1058064..>1058468)
                     /gene="MRPL50"
                     /locus_tag="KLMA_30489"
                     /db_xref="GeneID:34715764"
     mRNA            complement(<1058064..>1058468)
                     /gene="MRPL50"
                     /locus_tag="KLMA_30489"
                     /product="54S ribosomal protein L50"
                     /transcript_id="XM_022819011.1"
                     /db_xref="GeneID:34715764"
     CDS             complement(1058064..1058468)
                     /gene="MRPL50"
                     /locus_tag="KLMA_30489"
                     /codon_start=1
                     /product="54S ribosomal protein L50"
                     /protein_id="XP_022675620.1"
                     /db_xref="GeneID:34715764"
                     /translation="MFIPTSACLSALTKRTKRVQVQLLKDFPKFQLRAGEVVNVKPSL
                     MRNFLHNENGARYILKESDIDQTLLSRSKKSSESSSQNVTKKAVPKEKNTKPVVAKQP
                     QQNGESKAPEAPSSALNQSITIEKVKIPGLEL"
     gene            <1059037..>1060428
                     /gene="RSC6"
                     /locus_tag="KLMA_30490"
                     /db_xref="GeneID:34715765"
     mRNA            <1059037..>1060428
                     /gene="RSC6"
                     /locus_tag="KLMA_30490"
                     /product="transcription regulatory protein SNF12"
                     /transcript_id="XM_022819012.1"
                     /db_xref="GeneID:34715765"
     CDS             1059037..1060428
                     /gene="RSC6"
                     /locus_tag="KLMA_30490"
                     /codon_start=1
                     /product="transcription regulatory protein SNF12"
                     /protein_id="XP_022675621.1"
                     /db_xref="GeneID:34715765"
                     /translation="MSVQQPPSKSETQQTQAMPVAQPTDMYIQPYLKKLIPELDGLRK
                     LQEAEQRIDLYLSRKKIDLHQNITQWTHSKFSDPEKNEVVRVFVSNTSENQPWQTNDD
                     TMQLDQASWTLRIEGRVLSDEKPDDPKRPKFSSFIESIAIDFKPDNQGQGNDEDDDNE
                     TDDQTTEGPVAKKPKTEDTQNVFEWHADPNAAVEFDGIDVTRKGTENVNCTITLQPKG
                     YTGEYLQFSPGLACIIGISKGTLHEAIYSLYKYILLNDLLTDNDETVAKESTNGEKVL
                     VKLDSSLAKLLTNVQLSAGKTTLKLSELPGLVKNHVKPIPPIKFNYVVRVDESSTLGD
                     FVFDMEVPKPSSPSAPADNLSKNELLLLNEYNTLSTAIEPQIQDLNKKTQLLKLQLNS
                     SAKKYQFFNRLASDPVPLLQDYMESSSQALKVLSGDAGFNEDSVRRAEFYKENESILF
                     ENISALLATGRMK"
     gene            <1060820..>1062352
                     /gene="THR4"
                     /locus_tag="KLMA_30491"
                     /db_xref="GeneID:34715766"
     mRNA            <1060820..>1062352
                     /gene="THR4"
                     /locus_tag="KLMA_30491"
                     /product="threonine synthase"
                     /transcript_id="XM_022819013.1"
                     /db_xref="GeneID:34715766"
     CDS             1060820..1062352
                     /gene="THR4"
                     /locus_tag="KLMA_30491"
                     /codon_start=1
                     /product="threonine synthase"
                     /protein_id="XP_022675622.1"
                     /db_xref="GeneID:34715766"
                     /translation="MSQSYRSTRSSDPATKTFEEAVIQGLASDGGLFIPSVIPHVSSS
                     DLFEKWSKLSFQELAYEIMKLYVSNDEIPEADLKELIKRSYSTFRSDEVTPLAKNITG
                     SDENLHILELFHGPTYAFKDVALQFVGNLFEYFLQRHNKDLPEDQRKKITVVGATSGD
                     TGSAAIYGLRGKKDVAVFILYPTGRISPIQEEQMTTVTDKNVQTLSVKGTFDNCQDIV
                     KAIFGDKDFNSKHNVGAVNSINWARILAQITYYFYSYFKATNGKKEKVKFIVPSGNFG
                     DILAGYYAKKMGLPVEKLVISTNENDILDRFLKNGVYERSDDVAATLSPAMDILISSN
                     FERLLWYLAREYIASGDDLKAGETVNNWFQELKTEGKFNVPKDLIEGAKKDFDSVRVS
                     NAETISAIKDVYQTSVNPKHYIIDPHTAVGVFAAKKQIANDNDKTIHYISLSTAHPAK
                     FADAVNEALSSFDDYSFDRDVLPAELKKLSTLEKKIKLVEKADVELVKKVIDEELVKM
                     NI"
     gene            complement(<1062458..>1064068)
                     /gene="CTR86"
                     /locus_tag="KLMA_30492"
                     /db_xref="GeneID:34715767"
     mRNA            complement(<1062458..>1064068)
                     /gene="CTR86"
                     /locus_tag="KLMA_30492"
                     /product="copper transport protein 86"
                     /transcript_id="XM_022819014.1"
                     /db_xref="GeneID:34715767"
     CDS             complement(1062458..1064068)
                     /gene="CTR86"
                     /locus_tag="KLMA_30492"
                     /codon_start=1
                     /product="copper transport protein 86"
                     /protein_id="XP_022675623.1"
                     /db_xref="GeneID:34715767"
                     /translation="MLEDVKDTIRKASGHSNEYDASINILNQIIRETTLEERRKELSN
                     SDDFFLELRDCAIIGKSTLLSEVCTVQYVRIVKAIVIISRNLSVENQASPQEILLPNA
                     LIDWYLSLMKQDAISYQDSKQIYVLICQFYFNCSRSNMLFDQSSFNSHMEFIIEMMKY
                     VNHEDALYAFSLFLSKAFVNESFLSLLINDSRALIVIYELLIMKIIEEKTEIPSILKS
                     KLDETSELSTLATVQLKILKYLITHESFGSLMKKLKELYNEEAFNSVLNISTMLITSS
                     DKWDLYQLTAISTWGMTFLEEYSDLVNKYFELELSDNPIDPSPIYKNLLSILDILTTL
                     AQYQHVQKFLVSYEGLQKIITLFDILEKKCLKIQFNKPSGFTYPDSNIQLNVKATDNI
                     GNIIKNADILNKRIKENKICDSNFPGIKCYLVELLGFMTYGQTEVQNLIRELHGLELV
                     LSNCIIDDNNPFIKERSIICIRYLLADNQQNQDFITKLEAKKAVNDDVLEKAGYRMNV
                     DGNGNVKLVSDDKNAVPESTLLSEIHKR"
     gene            complement(<1064408..>1067149)
                     /gene="PWP2"
                     /locus_tag="KLMA_30493"
                     /db_xref="GeneID:34715768"
     mRNA            complement(<1064408..>1067149)
                     /gene="PWP2"
                     /locus_tag="KLMA_30493"
                     /product="periodic tryptophan protein 2"
                     /transcript_id="XM_022819015.1"
                     /db_xref="GeneID:34715768"
     CDS             complement(1064408..1067149)
                     /gene="PWP2"
                     /locus_tag="KLMA_30493"
                     /codon_start=1
                     /product="periodic tryptophan protein 2"
                     /protein_id="XP_022675624.1"
                     /db_xref="GeneID:34715768"
                     /translation="MKSDFKFSNLLGTVYRQGNLLFSKDGSKLLSPVGNRVSVFDLIN
                     NTSFTFAYEHRKNVAVVDINKQGTLLLSIDVDGRGILVNFKTRNVLHHFNFKEPVHDL
                     KFSPDGKLFALAVGRFLQIWRTPETTEDRQFAPFVRYRIHAGHFSEITSLTWSKDSRF
                     IISASKDLTSRIWSVNAEEKNLASTTFAGHRDNVIGAYFSDDQEKIYTISKDGALFQW
                     EYTKRPGEEEDEDPEDEENIDLSKYSWRITKKNFFHSNRAKVKCSAFHSASNILTVGF
                     SNGEFRLYELPDFLMIQQLSMGQNAVNTVAINNSGEWLAFGSSKLGQLIVYEWQSESY
                     ILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDEHAAAVTAVEF
                     AKKGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNCLAVDPSGEVVCAGSEDSF
                     DIFVWSVQTGQLVDTLSGHEGPISCLSFSNENGVLASSSWDKTIRIWSIFGRSQQVEP
                     FEVFADVLSLSMRPDGQHVAASTLSGQILFFDITEGKQIGHIDGKRDIISGRHLEDRF
                     AAENSARSKYFTTIQYSFDGLSLVAAGNNNSICLYDIPNEVLIRRFTVSKNMTLNGTL
                     EQLNSNRMTEAGSLDLIDQDAENSDLEDRIDNSLPGSNRGGDLSTRRVRPAIRVTAIR
                     FSPAANAFAAASTEGLLIYSVDDSILFDPYDLDVDVTPQNVIQALEDKEYLNAILMAF
                     RLNESYLINRVYEAIPTNDIPLICNELPVVYVARILKFVGEYALESQHLEFNLLWIKT
                     ILTAHGTYIAANKHQFSSALRAVQRFIGRIAKDVVQTYKSNKYTLDFLINTDGSSAND
                     DGNLGNADLLLNNVEDEETNDTNSVNEDSDEGEWIGFEEKTSKLPIEEDDSDEDILL"
     gene            <1067819..>1068325
                     /locus_tag="KLMA_30494"
                     /db_xref="GeneID:34715769"
     mRNA            <1067819..>1068325
                     /locus_tag="KLMA_30494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819016.1"
                     /db_xref="GeneID:34715769"
     CDS             1067819..1068325
                     /locus_tag="KLMA_30494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675625.1"
                     /db_xref="GeneID:34715769"
                     /translation="MSSGKRNAVTGKLSSRVMNMKFMKHAEQVEEQKEEIENTKKLVD
                     SSEWQIETNEKLLKRLHSRAKVVEHVGFSALRTLSESTDNNSGNSDSTTLKKVVNPGR
                     RVFGSKISPVIQDTANSDNSDKKRSLGDEDEDIQTAELEKLWEAESQNKKRSANGKKN
                     KKQKKSSK"
     gene            complement(<1068413..>1069243)
                     /gene="YIH1"
                     /locus_tag="KLMA_30495"
                     /db_xref="GeneID:34715770"
     mRNA            complement(<1068413..>1069243)
                     /gene="YIH1"
                     /locus_tag="KLMA_30495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819017.1"
                     /db_xref="GeneID:34715770"
     CDS             complement(1068413..1069243)
                     /gene="YIH1"
                     /locus_tag="KLMA_30495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675626.1"
                     /db_xref="GeneID:34715770"
                     /translation="MVLSDDVKDEIDAIDAIYPDLLTKVNDDRIKIKVPQHENFTLQI
                     SFPTDYPTSEPPHLVEVSTSTKISNLYDTKYLLHLFSEVLDSVFHPGQVCIFDFLTEL
                     DGVLYAEDDTDLRADTASDEISDGIENLKIDPFEGWIASDPITDRKSTFIAFATKADS
                     EEEAFTKLDLLRTDNKIARANHLMIAWRIKGENGVSFQDCDDDGETAAGGRMLHLLTV
                     MDAWNVIVAVGRWFGGVHIGPDRFKHINSTTREVIVKGNFATPATGGGLTNNSSKKKK
                     "
     gene            <1069575..>1069922
                     /gene="TAH1"
                     /locus_tag="KLMA_30496"
                     /db_xref="GeneID:34715771"
     mRNA            <1069575..>1069922
                     /gene="TAH1"
                     /locus_tag="KLMA_30496"
                     /product="TPR repeat-containing protein associated with
                     Hsp90"
                     /transcript_id="XM_022819019.1"
                     /db_xref="GeneID:34715771"
     CDS             1069575..1069922
                     /gene="TAH1"
                     /locus_tag="KLMA_30496"
                     /codon_start=1
                     /product="TPR repeat-containing protein associated with
                     Hsp90"
                     /protein_id="XP_022675627.1"
                     /db_xref="GeneID:34715771"
                     /translation="MNKFEEFKAKGNNCFKQGQYNEAVECYKEAIKQDPTNPVGYSNC
                     AMALIKLDNFDSASQMCKRGLFYVNDTNDANKKIAEKLKWRLDVCTENMKDGLIPVEI
                     FEVDKLPEQYRDL"
     gene            complement(<1070082..>1075520)
                     /gene="FKS3"
                     /locus_tag="KLMA_30497"
                     /db_xref="GeneID:34715772"
     mRNA            complement(<1070082..>1075520)
                     /gene="FKS3"
                     /locus_tag="KLMA_30497"
                     /product="1,3-beta-glucan synthase component GSC2"
                     /transcript_id="XM_022819020.1"
                     /db_xref="GeneID:34715772"
     CDS             complement(1070082..1075520)
                     /gene="FKS3"
                     /locus_tag="KLMA_30497"
                     /codon_start=1
                     /product="1,3-beta-glucan synthase component GSC2"
                     /protein_id="XP_022675628.1"
                     /db_xref="GeneID:34715772"
                     /translation="MSSGNLDFVQSHADTLGFYSSSVERNNKSHGSNKKKKVILNYET
                     ELSYIFDDLCRTFNFQRDNAANMKDYLITMWESRNAKMSGRMEDLSLKSLLSIYEEYI
                     WGVHSNFTKWYRFVYGKNTIPPWFVASGPGRAITREVMTQLSLWLLVWGESNNLRVMP
                     ELLCFIYDIMMTEYKFHTDHKSKINREKDKYSKNSKTSKSSSKILADTASSSSSYSSS
                     KNIKKTHFLHHVVTPLYNFYQFQITWNKNNDHSHIIGYDDINQCFWSLNTIKQFKLKD
                     GTNYMDLPQELKYQKFNDIEWSKSLKKTYLESRTWYHLITNFHRILTIHISTFWYFSV
                     LNLKPLFTKYYVQTLDNKPDPFILFSIMSLTGTWSCIIALMAMVGEVLFVPKNSNLRR
                     PVKLRFFIIILLLWINLIPPVVILSFSDILRKKHINDNILNIASFVALAISFVTSVFF
                     SFVPLSKIHTLLDNSIIMGLNRYKDVSTYEGDSCPQLNDDNSEWNLSKARTNLNIINP
                     FTENWSRFESTEARFCSIGLWVMIWASKFVETFFFLCTSIKDPARDLFLSQMNCSGTD
                     SVLSTAICKNWTKLLLLLLIVTNFVLYLLDTYLWYVIYNTIFSLVRSVYMGMTQLTPW
                     KNVFMNLSSKMKLKLLPWNQEWDIALIADLWNEVVYSMYRENLICTEHVERLVFHLTN
                     DNNLLKPSLLTASNDHFFRSNLFKRSKEIQRRLTFFAQSLHCPLPDPGTVESMPTFTV
                     LVPHYKEKILLSLKDIVKAETINSNITLLEYLKLVYRTEWNSYIEETNKIMGKEFTSS
                     ESGNKDLKNLIDDESDEIDIKILDMKRSGINSVMNPFKFTGFKLEVPEQTIRTRIWAS
                     LRTQTLYRTISGFMKYVDAIKTLHKLESTKASDLISPSGKTSERQSVSSKAESKTSSQ
                     RSNKKRDKKNSKLSAKEKSSVNDSITQDEKSTAIAMKKFHMVCSMQRMDKFNDEEKAD
                     RDILLTAFPSLKIAYIEEKMDKAGGRKIYHSCLIDGFCDIDANGNYIPRYRIELSGDP
                     ILGNGKSDNQNHSIIFTRGEYIQLIDANQDNYFEECLKIKNILKEFDDSTYEVNNDEY
                     GSQYANDYDDSTCSPVAIVGTREHIFSENNGVLGDIAAGKEKVFGTFFARTLGYINSK
                     LHYGHPDFINSIFITTRGGVSKAQRGLHLNEDIYVGMNVLMRGGRIKHAEYYQCGKGR
                     DLSFNSILNFTTKIGSGMGEQLLSREYFYIGTSLPLDKFLSFFYAHPGFHLNNVFIYI
                     SLCLFLVIILNLAVVIDSSILCVYDVNFKQTDPWEPEDCLQLVPVLSWLRRSTIVLLF
                     ISMVSFLPLFLQHMNDRGFLSAIKRLSKQMISGAIFFEIFSSRIASHALITDITVGDA
                     KYLSTTRGLSFERIPFVTLFSRFASETSYFAGLALLVLTYASTVMWDISLLYFWIYFI
                     ALLLSPFIFNPSQFHWVEFIMDYKRSFSWFINWQRKVSWVKSTREQSTMLTLNSEEDT
                     KWHQVIFTNIWCYIIPQFFLTIGVVIPFIIMNINNVDSMRVDASLRLLVVTVFPIFVN
                     IVVLLFVFLVSSIYGLIVIQGKGQWLPKLLSRITVISGILSLCVGYMSLSFFQRWDLK
                     TILLGVLSSLMLQKLAYQIINGMILPRNWASDKTNESWWNGKWLKKNYSIFSPFMEFC
                     RKVLELSIFNVDFVLAHIIFLFQLPILLIPNIDMLHSLMLFWRKADIDARPIVFRDKR
                     KQQHQIHLYSLTFIAILGAVVTFSCLPVILNQIFVVDSENVLDVVAPLIQPPKSIALE
                     SEIGLSAYRNMMQAMFHKTKKVGLETSH"
     gene            <1078337..>1080325
                     /locus_tag="KLMA_30498"
                     /db_xref="GeneID:34715773"
     mRNA            <1078337..>1080325
                     /locus_tag="KLMA_30498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819021.1"
                     /db_xref="GeneID:34715773"
     CDS             1078337..1080325
                     /locus_tag="KLMA_30498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675629.1"
                     /db_xref="GeneID:34715773"
                     /translation="MKLSSVLLFAVTASTGVSHAASLQARDMDMDMDMDMMRDETSEH
                     NEVEHDSSPASTEVSHLEPVPHEPKHLHGQPILETHLTAAERLYWENYNTTTFFTTDK
                     GNRSAFWAHVFTLVTASVFLYPICLALNNIESGWYIPVLSLYNVTILVSLLCLSIFDA
                     SFPESWYAHNIYRPMSYILLIVTLVHFVSAIIVKTSKWISLRGYDRELGFELNDLTDE
                     GRFTPLQASEDGASSIHGKEETSRFGGPLGDKRASYDPRDSVGSPTTTLYDPHNPHDD
                     LRASRYRNDSNSFELDGEDLAKNFDLEDRLLDGEGFQLKHQSKTSIKRDTYLAKLFSS
                     PILQSIAVKFSAFFLFIFKCLNYPMMMYFFVYLSTGLAVGNLLGKEKRIFNLLAHWIK
                     GGVFISLGVVSLARYCGFGAKRGFAWNKIVIFKNQVDSNSLWFKLVPRGGITMEFFES
                     SLIAFYGCTNVFLEHLANPGGKWEAKDLQHVSIAFMYIGCGFCGILAEIKLSEWRYNH
                     VLKHTNIEPGVIHSGYPGYSPNPFPAFTIFWTGILMSQHAQASATSTTIHVQWGSLLS
                     YGSFFRIFTFILLMLVPNQNLDPSRPFTELITSFCMLCGGLVFMESTDQVVEAMEYRG
                     FTPMFTFNLSVGFVAIFMALEMALFMWKDWLKARMDNR"
     gene            1080967..1081062
                     /locus_tag="KLMA_R318"
                     /db_xref="GeneID:34718692"
     tRNA            join(1080967..1081002,1081015..1081062)
                     /locus_tag="KLMA_R318"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:34718692"
     gene            <1081328..>1081801
                     /gene="BUD31"
                     /locus_tag="KLMA_30499"
                     /db_xref="GeneID:34715774"
     mRNA            <1081328..>1081801
                     /gene="BUD31"
                     /locus_tag="KLMA_30499"
                     /product="bud site selection protein 31"
                     /transcript_id="XM_022819022.1"
                     /db_xref="GeneID:34715774"
     CDS             1081328..1081801
                     /gene="BUD31"
                     /locus_tag="KLMA_30499"
                     /codon_start=1
                     /product="bud site selection protein 31"
                     /protein_id="XP_022675630.1"
                     /db_xref="GeneID:34715774"
                     /translation="MPRIKTNRTKKAPEGFDKISNTLDEFAIQLKEVQNQKGSKLSSK
                     DTESTWRVFQIHHERSRYIYTLYYKRKAISKELYEWLLREKYADKLLIAKWKKKGYEN
                     LCCLNCIQSDKTVNGKTCICRVPRATLKDTAAKNNEPVTFQQCVHCGCSGCASTD"
     gene            <1082824..>1084521
                     /gene="HCM1"
                     /locus_tag="KLMA_30500"
                     /db_xref="GeneID:34715775"
     mRNA            <1082824..>1084521
                     /gene="HCM1"
                     /locus_tag="KLMA_30500"
                     /product="forkhead transcription factor HCM1"
                     /transcript_id="XM_022819023.1"
                     /db_xref="GeneID:34715775"
     CDS             1082824..1084521
                     /gene="HCM1"
                     /locus_tag="KLMA_30500"
                     /codon_start=1
                     /product="forkhead transcription factor HCM1"
                     /protein_id="XP_022675631.1"
                     /db_xref="GeneID:34715775"
                     /translation="MSRTENERQPLKEVGVNRKRLHSQMSSGSVEESRKTTSKSAEAY
                     DIDQGALTPPHSFVHRSSISESRTPNDKAIKTNPLSPELSSPIKPQRAKKMKSDQGRS
                     SGMNTVEEFLEHLSDESRVAALQDPNRKPPYSYAMMIVLSILQSDTGKLTLSQIYYWI
                     SSHFPYYKPKDAGWQNSIRHNLSLNEAFVKGGKSLDGKGHFWEIKPGYESRFLKNEEN
                     FSIEDFKMKLRRFKNISLEDSDDSLAVCSSTKSSSSNSSSNSTSSKSKRKGKGSSTSV
                     ENDKSNNFGDCCDTSVDQISDCEDDRNSLINIPSSPRQSHFSNSEKDGHYTRQYQTID
                     KDYPYYEEESIMKRQGSAHLGTSLKFHTRAANMYNHEYDDLMAATMSSPKFKKYTCSF
                     NTSFEPASPMTKLQLPMSQIAQSNIKTPVRDFSSTPLKFNILATPKDCNRELINPLTS
                     TKAWQSPSRLFEDYYASPVFFKNVVAHSIDDRMKQYETEKICIESPRKLSLKGQQSYG
                     VSNPAELIDHSKYSSNALFGVDVCSVWKRVIAHCNNDELVEENESKDTLAPPFDGMS"
     gene            <1085077..>1086255
                     /gene="RAD18"
                     /locus_tag="KLMA_30501"
                     /db_xref="GeneID:34715776"
     mRNA            <1085077..>1086255
                     /gene="RAD18"
                     /locus_tag="KLMA_30501"
                     /product="postreplication repair E3 ubiquitin-protein
                     ligase RAD18"
                     /transcript_id="XM_022819024.1"
                     /db_xref="GeneID:34715776"
     CDS             1085077..1086255
                     /gene="RAD18"
                     /locus_tag="KLMA_30501"
                     /codon_start=1
                     /product="postreplication repair E3 ubiquitin-protein
                     ligase RAD18"
                     /protein_id="XP_022675632.1"
                     /db_xref="GeneID:34715776"
                     /translation="MKRLTSPENVSNPRDFLETKVPELSDLDSLLRCHICKDFLNTSV
                     LTPCGHSFCSICIRKYLQQESKCPLCLTELTESMLQKEFLVQEVCASYTKLREKLLNQ
                     LTLPVDIERSKSEEIVLPDDDISTDVEVVGQKIPSYSAVSSPNINKKRKSSGITSLLM
                     KKPDMRHVKTAQCPICLKYLPLSELEGSHIDKCLNQETSLERSDSFEILEEQTQPPKP
                     QEKVSEEVISYHNDRYLNSGFKQRKENRLPRLDFQSLSTAQLKQKLSSLGIPYIGSKQ
                     QMIARYKHYEMLWNSNFLDSIEPVDETELKRRLASWENSHNLDHPTNSTSITNLIRGG
                     RRDNLASSMLKSFKTDKFDRKGWMHYHASTFKELKTEAMASKNQTKAEENRDNESKDE
                     "
     gene            complement(<1086376..>1089399)
                     /gene="SEC12"
                     /locus_tag="KLMA_30502"
                     /db_xref="GeneID:34715777"
     mRNA            complement(<1086376..>1089399)
                     /gene="SEC12"
                     /locus_tag="KLMA_30502"
                     /product="putative guanine nucleotide-exchange factor
                     SED4"
                     /transcript_id="XM_022819025.1"
                     /db_xref="GeneID:34715777"
     CDS             complement(1086376..1089399)
                     /gene="SEC12"
                     /locus_tag="KLMA_30502"
                     /codon_start=1
                     /product="putative guanine nucleotide-exchange factor
                     SED4"
                     /protein_id="XP_022675633.1"
                     /db_xref="GeneID:34715777"
                     /translation="MGKDTESTIYNIGYPIYGAKFLNDSTLLVAGGGGEGNNGIPNKI
                     SALKIDFTKKKIVKRFRELSLDDKDDSPTTLDCSNNVILVGCNEGSEKIKSGQGNNHL
                     RKYVYHNEHLKFVASIDLDGSTKPEDYTKLTCISSDASVAAIASSKVPTIIRIVNPAN
                     LRETYEVETGNDVKDLHFSPDGKVLSYITASTLEVMSVVTGNFIVRKTDFDSNWTMSK
                     IRFIDQDNVIIAATLTKGTGIVLIKVSLKSGVAKVVKSKLITNKFKGATSLDVDPSGR
                     LVAIAGNENSVVVVTLRNLRVVKFMKQVHSFAITRLVFSPDSKLLASVSAANTVHILK
                     IPPTLATSQSLMESTMVFFTNAIIVAIVAALAYYGKEHNLHIKALHFAQTQYKKLTEK
                     NDSSNYFVLHEYPEQTTLVGAVHTSHTPSLSYKETTISFSPEMTVGPHQTSADDFISY
                     TTDSSIIDINTTLNQLSNEEDVSKDNTEQASSTILANSAEKSSEPSLSSSSTTSISTG
                     KVKKEEKLIGSSSAAKDSAVKKASSSEESDQEDTVTLVVESAKKSTEIDLTPTPSQFN
                     ATDIEKREETVAHEVVSQKKTDDDKSSPDTENTINDDLANADEDIAPSSEPEEISEVV
                     VDIPIERTLNLINEENTIATQPVNRSSKQEENLTKESNNNIEVETPIIRADSSSTSAT
                     KTSVETNDVENISTESSVVEASIVETTSVETTSVETTSVETTSVETTSVETTSVETSS
                     EEPSAEESSTMKTTSVEHSTVETTNVQTSTVEASSSETSAMESSAEESSTVESSVEEA
                     SAVESKNLKSSTVESSVEDASALESKTLESSAVETTSTEASVVETSTTDTTSTMISEA
                     TSDILEKHAESVSPTVPVTDESFEVDEQIVTITEVVAHEIEAESSVTGQLLSGSVNSM
                     ISEMSEALTPSQEDITSIIIEDEYSLQSTTTQSPTNKITDSLESSEEDFIDSSASTLD
                     LDASSTLEGDIEAETVTKTETETAKASEVYIQDEL"
     gene            <1089885..>1090793
                     /gene="BUD17"
                     /locus_tag="KLMA_30504"
                     /db_xref="GeneID:34715778"
     mRNA            <1089885..>1090793
                     /gene="BUD17"
                     /locus_tag="KLMA_30504"
                     /product="putative pyridoxal kinase BUD17"
                     /transcript_id="XM_022819026.1"
                     /db_xref="GeneID:34715778"
     CDS             1089885..1090793
                     /gene="BUD17"
                     /locus_tag="KLMA_30504"
                     /codon_start=1
                     /product="putative pyridoxal kinase BUD17"
                     /protein_id="XP_022675634.1"
                     /db_xref="GeneID:34715778"
                     /translation="MVIGKKVLSIQSHVVHGYVGNKAASFPLQCKGWDVDALNTVQFS
                     NHPAYGFISGFKSNSDDLESIIEDGLVGGLKMKYNAVLTGYLPDTEGLRKIGTVVRKM
                     CEDDRDLKWLLDPVLGDDGKLYVPEATVAIYEQILRDGSVFLATPNQFELEILTGLRI
                     FDLASLKSTMKRFHELYPKVCYLVVTSVDFESDNFVSTCTDFTDYWYFTVPRIKAHFS
                     GSGDLFSAILMDLLLSSKDENVDLPLALNKALSLVDEVLQRTYDLTVKPTQEPEQPFR
                     INDLKIIQCKDLFRNVYVAKFKCNKL"
     gene            <1091152..>1092786
                     /gene="ATG15"
                     /locus_tag="KLMA_30505"
                     /db_xref="GeneID:34715779"
     mRNA            <1091152..>1092786
                     /gene="ATG15"
                     /locus_tag="KLMA_30505"
                     /product="putative lipase ATG15"
                     /transcript_id="XM_022819027.1"
                     /db_xref="GeneID:34715779"
     CDS             1091152..1092786
                     /gene="ATG15"
                     /locus_tag="KLMA_30505"
                     /codon_start=1
                     /product="putative lipase ATG15"
                     /protein_id="XP_022675635.1"
                     /db_xref="GeneID:34715779"
                     /translation="MKPKTTPRKRYSAKNASLVTLLIVLTLYLYLNKDIIESKYHRND
                     KFKDTHAVTADTTNLHTLRIKEIHFRPFNSTGRRKYGQVILTPELVADAKDRFSEAVS
                     VSGSRSEGQEEDDAYDTKLWSKSDSNPWTHEFKLKQQTIQMTRMAYRDPDYVESFLDF
                     ANENPTMAQKVHLEWVDENVLAPNVTDKDTIISLALMSSNAYVPLPFEGDWRNISGWD
                     HDANPDFPDGIGWDADGVRGHIFTNEDSSVVVIAIKGTSAQGLPGSGDDATTENDKLN
                     DNLLFSCCCARVSYLWTTACDCYVKSYTCDETCLEKELNRKDRYYQAVLDIYRTVIED
                     HPNAAIWITGHSLGGALASLLGRTFGAPAVAFEAPGELLATRRLHLPIPPGLPSYQEG
                     IWHIGHTADPIFMGTCNGASSSCSIAGYAMETSCHSGKVCIYDVVTDKGWHVNMLNHR
                     IHTVIDGVLNDYENVAKCEVPEPCNDCFNWKYIRGRDEPHSSSVTSSSSATNKKPTTS
                     VFTSTTSLTATTSSAEKTTSSCIGRNWIGICTRYGI"
     gene            complement(<1092839..>1095043)
                     /locus_tag="KLMA_30506"
                     /db_xref="GeneID:34715780"
     mRNA            complement(<1092839..>1095043)
                     /locus_tag="KLMA_30506"
                     /product="GAL4 super family protein"
                     /transcript_id="XM_022819028.1"
                     /db_xref="GeneID:34715780"
     CDS             complement(1092839..1095043)
                     /locus_tag="KLMA_30506"
                     /note="cl00068, GAL4-like Zn2Cys6 binuclear cluster
                     DNA-binding domain"
                     /codon_start=1
                     /product="GAL4 super family protein"
                     /protein_id="XP_022675636.1"
                     /db_xref="GeneID:34715780"
                     /translation="MEEDQSTKRVKKTASKRGTRGVKACEYCKRLKARCIPSPVAGKV
                     KCLRCDSLKRHCSFEDLFAGSSLPLNGQSDMFGGSVNENEHDAAHSELLKSLIKLGPV
                     SPGVLNLNLRYTKTIHENLLKVLSILENTTRIDNNTQQGQRIVNAGAIQQETSVGKDM
                     IASLENRETGVDATLIDAVDMITGSISKPGNNGDEVGSGKINKSIDTSPRNHSLADQN
                     TAYLSSSYTLMSQLVPKDHLPLLIRKLHDNSFTEIERTLNEDIVTMNIITLEESYMLM
                     QSFRNRYSDWCSFPKSASTEKLVSNIRSKNCTLLLTVACTLALRYTDDYHDLKTRCYK
                     NLLLKLRSDLESSLCYVPQTKEFLQAIVILSLYASSFSSDFLCVDAWYLSGLGTQHLL
                     TTGVAGSLLNRKKGGNDVLASAMNLLDPVMQSNFGNMNNSVFEETEQFEQLSTCRLWN
                     HLCLCHLNCCIASGRMCTIDDRRLDMCKVTLDLPHSTNFDGRMVAEIELSRIVYKFIQ
                     SLEFIDTSSRQPLDDVIKKLLNWLDNWKYLFAQPITQFVEFNYHYALCIVHYSWYHKL
                     YSSSLNQDSPLPSFLPSSGGSKTEVAHYLNQAYPLKKVVRSIPQAQLNIILDHAHKGL
                     TSIVNCPFDKFKFLSDHLVFSGVHLALICLLLLHEDYTLSKSVDIIPILSDVKKLSQR
                     LQKIREGELKSFWVEEVDLRIPSVILQYHKAIEGYLLDKFSAFDIQIDPNYI"
     gene            <1095846..>1096430
                     /gene="SLX9"
                     /locus_tag="KLMA_30507"
                     /db_xref="GeneID:34715781"
     mRNA            <1095846..>1096430
                     /gene="SLX9"
                     /locus_tag="KLMA_30507"
                     /product="ribosome biogenesis protein SLX9"
                     /transcript_id="XM_022819031.1"
                     /db_xref="GeneID:34715781"
     CDS             1095846..1096430
                     /gene="SLX9"
                     /locus_tag="KLMA_30507"
                     /codon_start=1
                     /product="ribosome biogenesis protein SLX9"
                     /protein_id="XP_022675637.1"
                     /db_xref="GeneID:34715781"
                     /translation="MVAKKRTGLRAKAARLSNVEAERDEDARVVSELPPDPKAFLHQH
                     RETKKEKLQAKSENFISRITEQNKNMSGISKSSLRRRKRKMRDELKPKMDDLLNSLQQ
                     EGVLDDEETTPGNKEEVVSVTKVTKSAAYGSVTANSTAVKGQLRKNEPNIKNQKGAKL
                     LAKQESKRFNEVLANEAFQKSPFEALKEAIRMRQ"
     gene            complement(<1096478..>1099465)
                     /locus_tag="KLMA_30508"
                     /db_xref="GeneID:34715782"
     mRNA            complement(<1096478..>1099465)
                     /locus_tag="KLMA_30508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819032.1"
                     /db_xref="GeneID:34715782"
     CDS             complement(1096478..1099465)
                     /locus_tag="KLMA_30508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675638.1"
                     /db_xref="GeneID:34715782"
                     /translation="MAKVEFSCVEEHYLKRELLRLELNNEFEGLNDALALRRFGHPFT
                     ADDPREFAHNNNNNSSKGLKKLRRISGSSEKKQDEEEDAEKKAKAQFASEFPVLNHFL
                     RNFVMTFPLLAPEMVRDPLFWQSKVQLFFEHFMSLPFSGSFDREELTKRKKMGLKLSK
                     GILLFYNSGLAVSNEHQYYEEEKYKISNKDSTKATKLNKFSMPTRESLRYLLTNEPVY
                     FNGIDINIVAVVGRHMLFPTEKKHHASSSSSFSSSTKHIASRWMKSNLGLDLSKIYYP
                     MDSGASKNKKHHYYFIIRVRKQDPQMEFYMYRPYDEFKKLAKDLKTTYPGKKLPQLPH
                     KNKIKASLKQQERTTRPAPASNHQTDDDPDEIEYEEFDDDGLDSAGTSAAQVNTLPRE
                     RMRTSLRQYLRSLCQDKEVATGIPLKKFLFGNTGRIQKEDFSEEIRKDIKNREFVDLT
                     NVERQIEFQKMAFERSLKLQESLKEFKTSLLKDQDVLLDLFREFKEKDSPTDLSPLLR
                     DFFDWCKIYISATVYQLFLGSDSGYELYKQVRRLHKLMPYTIMTQILRFTNPISIMKG
                     MMDLFMAQPFGGQSLLQTMFSTILADDLKSQNKVIEELDLLIRNSNEYGYEISTFFKE
                     VVFNDNNRTIIDMDAVHKDVKLTGLPIAIVVTMKGTELGRVSANALAELMESYSHWKK
                     EQQNNVELVEVKSEESLSNSAVTYFTRVKEYFQLLVKERDKRLMRQLWEDPELSQLIK
                     ASVALFYDPMIRVFKVARMDIAFRNFESFMDDLIVLLDATIDGNKGSVTATDIVSGIN
                     GLINKHEASFYQFAHDIYVNDTQGIFEGIITWLCSILNFLQQSKFGDPKNALDLGLLV
                     SQSDVDPVLLKDQLSKVIDKRLKSREIYSQLVKSKTERESIKKVTGKPSDENVKDLID
                     KQWKQLNNAVVLNEAPDFNLNDADLVDLDLDVKDYDYLQSNETDELEQKYKAVLDEQV
                     SITEIEKFLKLTFKPKLNEIFDV"
     gene            <1100016..>1101677
                     /gene="HNM1"
                     /locus_tag="KLMA_30509"
                     /db_xref="GeneID:34715783"
     mRNA            <1100016..>1101677
                     /gene="HNM1"
                     /locus_tag="KLMA_30509"
                     /product="choline transport protein"
                     /transcript_id="XM_022819033.1"
                     /db_xref="GeneID:34715783"
     CDS             1100016..1101677
                     /gene="HNM1"
                     /locus_tag="KLMA_30509"
                     /codon_start=1
                     /product="choline transport protein"
                     /protein_id="XP_022675639.1"
                     /db_xref="GeneID:34715783"
                     /translation="MGEIRSAGAVLEASSSSGFNDNTSDSGLKNVVHESRLEEQSTAG
                     SKENDAYGGAGGDLGEGQLRKSFSLWSILGVGFGLTNSWFGISVSMVTGIYSGGPMMV
                     VYGIIIIALISTCIAVTLGELTSAYPHAGGQFWWSLQLAPPKYRRVAAYLCGAFAWAG
                     AVFSSASTTLSVASELVGMYALTHPDFTVKRWHVFVCFEILHMFLMLFNCSGKALPLI
                     SSSSLYISLVSFFTITVTVVACSRGKYNDAKFVFATFYNETGWKNSVIAFIVGLINPA
                     WSFSCLDCATHMAFEVENPEKVIPIAILSTVGIGFVTSFCYVIAMFFSLQNLDKVTAS
                     NTAMPILEIYRQSTNSTAAAVVLGCLVLFTSFGCVIACHTWQARLCWSFARDKGIPYS
                     KYWAKIDPALGVPLNAHLLSGVLISLLGCLYMASTTAFNSLITGCIAFLLFSYSVPVV
                     CLLARKRNIKHGPFWFGKFGAFCNIVLLGWTLFAVVFFCFPSVMPATKNNMNYASVVI
                     VGFLLFFLIFWQVKGKNEFYLKGDENAESNNDSITTEEYVTLETK"
     gene            <1102156..>1103706
                     /gene="DBP3"
                     /locus_tag="KLMA_30511"
                     /db_xref="GeneID:34715784"
     mRNA            <1102156..>1103706
                     /gene="DBP3"
                     /locus_tag="KLMA_30511"
                     /product="ATP-dependent RNA helicase DBP3"
                     /transcript_id="XM_022819034.1"
                     /db_xref="GeneID:34715784"
     CDS             1102156..1103706
                     /gene="DBP3"
                     /locus_tag="KLMA_30511"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DBP3"
                     /protein_id="XP_022675640.1"
                     /db_xref="GeneID:34715784"
                     /translation="MSKSELKDKKRKVEDEELKSKKKVKKDKKDKKDKKDKKDKKDKK
                     EKKEKKEKKEKKTETAEKSDDSTESSKPVAQSTASKSEVEDFMKENEVTIEDPENANL
                     PPYLNFSDVSFIDEIQKQISKFPKPTPIQSVSWPYLLAGKDVIGVAETGSGKTFAFGV
                     PAINNIVTSKEKSPGIKVLVISPTRELASQIYDNLIVLTDTCGLHSCCVYGGVPKDQQ
                     RSDLRKSQVVVATPGRLLDLIEEGSVDLSNVNYLVLDEADRMLEKGFEEDIKKIIRQT
                     KTHGRQTLMFTATWPKEVRELASTFMNSPVKVSIGNRDELSANKRITQIVEVVDPFKK
                     EKKLLDLLKKYHSGPKKNEKVLIFALYKKEASRVERNLKYNGYDVAAIHGDLSQQQRT
                     QALNEFKSGKCNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTG
                     TAHTLFTEQEKHLAGALVNVLNGAGQPVPEELKKFGTHTKKKEHSAYGAFFKDVDLSK
                     KPKKITFD"
     gene            complement(<1104145..>1105140)
                     /gene="MNN10"
                     /locus_tag="KLMA_30512"
                     /db_xref="GeneID:34715785"
     mRNA            complement(<1104145..>1105140)
                     /gene="MNN10"
                     /locus_tag="KLMA_30512"
                     /product="uncharacterized alpha-1"
                     /transcript_id="XM_022819035.1"
                     /db_xref="GeneID:34715785"
     CDS             complement(1104145..1105140)
                     /gene="MNN10"
                     /locus_tag="KLMA_30512"
                     /codon_start=1
                     /product="uncharacterized alpha-1"
                     /protein_id="XP_022675641.1"
                     /db_xref="GeneID:34715785"
                     /translation="MSLGTPYTYAGDLDEKRGASLDSNYVSRFSKYKKYFLVLFTVLF
                     IVFWVSDFSLVKTEPSIVIILAANSGGGGVLKWKSEQEWAIERISIENKRAYAKRHGY
                     GLVIKDQVLSKRYSHEYREGWQKVDILKQTMREFPNAEWFWWLDVETLIMEPQMSLEE
                     HIFNRLDEIANRTLEDFNPLNIDVDLPYVDYSEEPDMLITQDCGGFNLGSFFIRNSEW
                     SRLLLDIWWDPVAYEQKHMVWEHREQDALESLYASEPWIREKVAFLPLRQINAFPPGA
                     CADFKYDLRYFYNEKDHDFVVNMAGCNFGRDCWGEMEQYTRLLQKLHGRWYSVFF"
     gene            complement(<1105671..>1107386)
                     /gene="PEX5"
                     /locus_tag="KLMA_30513"
                     /db_xref="GeneID:34715786"
     mRNA            complement(<1105671..>1107386)
                     /gene="PEX5"
                     /locus_tag="KLMA_30513"
                     /product="peroxisomal targeting signal receptor"
                     /transcript_id="XM_022819036.1"
                     /db_xref="GeneID:34715786"
     CDS             complement(1105671..1107386)
                     /gene="PEX5"
                     /locus_tag="KLMA_30513"
                     /codon_start=1
                     /product="peroxisomal targeting signal receptor"
                     /protein_id="XP_022675642.1"
                     /db_xref="GeneID:34715786"
                     /translation="MSADCSVGSNPLAQLNKHAHENPALRRGIPQSSNGGAAHQFKTQ
                     VNGVSNANLLQMDQFMNRSPGFRDPQLGHMPVPPLMQSHSKGPGISSVNQPQRSNNWA
                     NEFGVSSDPSTNLVNKNRMGNMGNMGNMGNTFEQVPNGNISSYRPGMTHMTRPMMHTG
                     VSSLQNYSHLAQRSQQPQMAKDENIMVDKQWDEQFEALEKGAFENLSLDDTKESAKDE
                     IVIEDGYQAEFQEVWDKLQTEAASNINYDNSDSQWENDYARYTSGKAVHIAPYKFDTE
                     NQYMHNPNAYEIGCILMENGAKLSEAALAFEAAVQEDPGHVDAWLKLGLVQTQNEKEL
                     NGISALEQCLKLDPTNQEALMTISISYINEGYDLTAFSMLNRWLDSKYPNLVPESKID
                     ENNIDRFNMSKQVITKFLQVANALPQVDPEVQLGLGTLFYANEEFDKTIDCFRAALEV
                     NPNDELMWNRLGASLANSSRSEEAIQAYHKALTLKPSFVRARYNLAISSMNIGCYKEA
                     AESLLSALSMHEVENVPVTGSVVQSNNILETLKRSFIAMDRRDLLEKVMPGMDLQQFR
                     NEFNF"
     gene            <1107843..>1109465
                     /gene="PRP28"
                     /locus_tag="KLMA_30514"
                     /db_xref="GeneID:34715787"
     mRNA            <1107843..>1109465
                     /gene="PRP28"
                     /locus_tag="KLMA_30514"
                     /product="pre-mRNA-splicing ATP-dependent RNA helicase
                     PRP28"
                     /transcript_id="XM_022819037.1"
                     /db_xref="GeneID:34715787"
     CDS             1107843..1109465
                     /gene="PRP28"
                     /locus_tag="KLMA_30514"
                     /codon_start=1
                     /product="pre-mRNA-splicing ATP-dependent RNA helicase
                     PRP28"
                     /protein_id="XP_022675643.1"
                     /db_xref="GeneID:34715787"
                     /translation="MTRPVSVDQLLAGDEEKKPKFLGKKRRLVESTEHIGSQTFKRST
                     TSRAGKYEDIQVTDVGSDSNDLRALAAKSAKMLREKNDREGKGRDAVGITDDYLGKHW
                     SDKKYDEMTTRDWRIFCEDFSISTKGGTAEKPLRNWHELNLIPPDLLDIITNKLHYKE
                     PTPIQRSTIPNVRNNRDFVGVASTGSGKTLSFLLPIFIKLSNRPPLNSITKLDGPVAL
                     ILAPTRELAQQIQREGSMITKLWKRPCNIVSIVGGHSLEEISASLRDGCDILVATPGR
                     LIDCLESHIVLLKQLELLVLDEADKMIDFGFEDQLTTILARTEALPNRQTMMFTATFS
                     PAIEKVANGYLKKSIYVTIGGEESKPNIKQIIEYVPDDDDQKFNMLTNVFLPKYKSPI
                     IIFINYKTTADWLFEKFKGTKFRVSTLHGSKSQEQREHSLKLLRNGKVDILIATDVAG
                     RGIDIPNVSLVVNFQFPKKFDSFVHRVGRTGRAGKSGAALTFLGDSEDEGLMTSLFDY
                     VKKNDVSGENYISKAARTRYSVERNAYKPIII"
     gene            complement(<1109757..>1110785)
                     /gene="CWC2"
                     /locus_tag="KLMA_30515"
                     /db_xref="GeneID:34715788"
     mRNA            complement(<1109757..>1110785)
                     /gene="CWC2"
                     /locus_tag="KLMA_30515"
                     /product="pre-mRNA-splicing factor CWC2"
                     /transcript_id="XM_022819038.1"
                     /db_xref="GeneID:34715788"
     CDS             complement(1109757..1110785)
                     /gene="CWC2"
                     /locus_tag="KLMA_30515"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CWC2"
                     /protein_id="XP_022675644.1"
                     /db_xref="GeneID:34715788"
                     /translation="MSADWRNRSARVQISESDLPSSVPPQTGLAFNIWYNKWSQGQSG
                     ISRFVSPYMLDPETDAGRTKGDKEGRIHFCLYFAKGMCCLGKKCTYLHHIPELDDFAR
                     LSLHSSALDCFGREKFADYRDDMGGVGSFKKPNRVLYVGGITGAINNKSLRPNQIENR
                     IKFKFSKLGELESVRYVESKNCAFVKFKLQCNAEFAKESMSNQTLLIPTDKEWDQRKD
                     GTGLLVKWANEDPNPAVRKKELEEQTQETLEAIKHLLAQNNNENSNKRTIEEVDDHTI
                     PDENSIHGAKTKNIIDRSLLRELRKRKVVITKGKEHFNGKHRNTVPSALLISQYSSDD
                     DEGDDRAS"
     gene            complement(1111035..1111123)
                     /locus_tag="KLMA_R319"
                     /db_xref="GeneID:34718693"
     tRNA            complement(join(1111035..1111070,1111084..1111123))
                     /locus_tag="KLMA_R319"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:34718693"
     gene            <1111581..>1112030
                     /gene="NHP2"
                     /locus_tag="KLMA_30516"
                     /db_xref="GeneID:34715789"
     mRNA            <1111581..>1112030
                     /gene="NHP2"
                     /locus_tag="KLMA_30516"
                     /product="H/ACA ribonucleoprotein complex subunit 2"
                     /transcript_id="XM_022819039.1"
                     /db_xref="GeneID:34715789"
     CDS             1111581..1112030
                     /gene="NHP2"
                     /locus_tag="KLMA_30516"
                     /codon_start=1
                     /product="H/ACA ribonucleoprotein complex subunit 2"
                     /protein_id="XP_022675645.1"
                     /db_xref="GeneID:34715789"
                     /translation="MAKDKSTSSEDNYEARLPAVLPFAKPLASKKLNKKVLKTVKKAS
                     KAKNVKRGVKEVVKALRKGEKGLVVIAGDIFPQDVISHLPVLCEDQSVPYIFVPSKQD
                     LGSAGATKRPTSVVFIVPGSNKKKEAKAKEEEYRASFDEIVKEVSSL"
     gene            <1112482..>1113909
                     /gene="SNU56"
                     /locus_tag="KLMA_30517"
                     /db_xref="GeneID:34715790"
     mRNA            <1112482..>1113909
                     /gene="SNU56"
                     /locus_tag="KLMA_30517"
                     /product="U1 small nuclear ribonucleoprotein component"
                     /transcript_id="XM_022819040.1"
                     /db_xref="GeneID:34715790"
     CDS             1112482..1113909
                     /gene="SNU56"
                     /locus_tag="KLMA_30517"
                     /codon_start=1
                     /product="U1 small nuclear ribonucleoprotein component"
                     /protein_id="XP_022675646.1"
                     /db_xref="GeneID:34715790"
                     /translation="MYGRKRQRPASADFHHVANKKQSYSLPHNASKLDNLWNVLPKVT
                     QDNKISQLPIERIIKHSQILIRITEEQRLKLPIFLADLRRALELETITLHESFVELKA
                     FTLLQASVAITAILNYLYRLSLRPEKDIKYWDVESACLLRGSLLVHKSVKIQQTETTS
                     DILFKRVPKRKSFKCQLSAITAVPQFKEVYLEGESVKEFMAGIITSMNNWRFRPVHAS
                     VNDLASQNIALLRQRITASTNELPILTKLFDPEILRSKNKQLINNDQSVLESYMKELI
                     EYNDKLPVINVSDSKSKQKTANGTAKAKSHTPSKVNNPTSRYKGGSNIPAVTPTSSSR
                     VGNHTKGQSPNPSLIPRATLNSAISSQDLQAYCIETIKSSISKVSAGSSFQIIKSYVK
                     YPKSHIDLIYDNLNQIKSTTNCNIVVLNLQTIHESNAWFQQLELDSNLNPPTNLTRVI
                     SVGGVGGKCKTALEMILTLLQTGSL"
     gene            <1114259..>1116478
                     /locus_tag="KLMA_30518"
                     /db_xref="GeneID:34715791"
     mRNA            <1114259..>1116478
                     /locus_tag="KLMA_30518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819042.1"
                     /db_xref="GeneID:34715791"
     CDS             1114259..1116478
                     /locus_tag="KLMA_30518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675647.1"
                     /db_xref="GeneID:34715791"
                     /translation="MFDRSKRKSFLFFGATSLDQKHKLPEERNNAMPRVTARNNMSHK
                     PLLKPRLNEKQTDEDDSKDTLTPLRTTDYSGNHYPVAKEGLPMRQSTIGKRRPPPPTD
                     ISNIRSSLDQKQSVNAPVPVEAMPTATVVALEESGPPATPFPSSPESDSSSQQSFNTL
                     EHDQISQNITEKKEFHPSHGRNKSEVEQLVDDLDDYISKANLNQSTTSLGDNIHRSST
                     PESREEEDNSDGSSQNVSPLYGRRPALIDVTDKVPNHWDEDEHQSEADQFSFNGSSNK
                     SMNDTLQYFENNSSHIGSTHSTSSDLQTFPKSSRFIVTNADDLGVRNEDNSESDVATN
                     EYNNFVQSTNTNREADVDIENEQIHENNDTLYDLKNGNEFERRNFRVVNEEKPNFYLN
                     DSTSEDDARSCGRTETNSITTSLERKSSLASSIKAGLLPTTSYNGSHQSSTAQEPTVS
                     SETETIKSRASTVSDSKKSFKSSTNIPDKNVRLISSYVEELRLLYFPTSNSLQLPPDL
                     PYALKNKNSLEQPQNIKVTIRTSTRQVGIKHGKAKQKLLTLETTNEEDEEENGELSGL
                     NNKSESTKVDHTKEFHTLFKKDEKISEADQDILDDIPGDEAYDSDDLMAPLRENPNQR
                     VHDNVSQTRLKRTDTVASYFTRNAARIRSGTLDGSYVPQLPLDTIKYETNDDLIPTPI
                     TPVFADKDQLAKNTHSHHSGPPKVAKDDGDYELDATDFGYYQGSEGTGLHITNPDSD"
     gene            <1116757..>1119675
                     /gene="SEC26"
                     /locus_tag="KLMA_30519"
                     /db_xref="GeneID:34715792"
     mRNA            <1116757..>1119675
                     /gene="SEC26"
                     /locus_tag="KLMA_30519"
                     /product="coatomer subunit beta"
                     /transcript_id="XM_022819043.1"
                     /db_xref="GeneID:34715792"
     CDS             1116757..1119675
                     /gene="SEC26"
                     /locus_tag="KLMA_30519"
                     /codon_start=1
                     /product="coatomer subunit beta"
                     /protein_id="XP_022675648.1"
                     /db_xref="GeneID:34715792"
                     /translation="MIVEVDEPAYTLVYDPNPSGVTYTISDFQRALEKGSDSEKIETM
                     KRILVTMLDGNPLPDLLMHIIRFVMPSKNKQLKKLLYFYWEIVPKLDGEGKLKQEMIL
                     VCNAIQHDLQHPNEYIRGNTLRFLTKLKEAELLEQMVPSVRACLEYRHAYVRKYAILA
                     VLSIYKVSQHLIPDACEVIDSFLVAETDPICKRNAFLGLAELDRESALNYLQENLTSI
                     DSVDTLLQNEFIAFIRKDAIKTPALVSQYIELLQDLLVSNRSSEVMYEAAITLTVLTN
                     KEGILLNVASKLIDLAAKESDNNIKLVVLEKIKEINEKNPGSLEDLTLDILRVLNSQD
                     LDVRAKALDISLELITSRNVDSVVKLLRKELQSTADSTNDKTLEYRQLLIKSINKVAI
                     MFSEVSANVISLLLDFIGNLSSESANDVISFTKQVIERYPELRSEILTTLIDALHEVK
                     SAKAYRGALWVLGEHAQSEAEIQSTWKHIRSSIGEVPIVQSELKKLQTDDEENEAEKV
                     PIVSTGPVVLPDGTYATESALSVSEKVKSTSKEEKEARPPLRRFILNGDFFTASVLAN
                     SIVKLVLKFEKISKNIAITNALKAEGLLILVSIIRVGQSNLVEKKIDEDSAERIMTAI
                     SVLMDETSSEETENERQLLNLAYLDATNSSYKSRVDVNLKKTASKRSKYVAKHGEAVD
                     KSITFRQFKDAGIHTGPVDSIEEDIKLATTGTLSYAKLQANSITSKLKKIVPLTGFSD
                     PVYAECYITNHQFDVVLDVLLVNQTKETLRDLHVQFATLGDLKIIDHPPSTNVIPHGF
                     HKITITAKVSSADTGVIFGNIIYDGGHGEDSRYVILNDVHIDTMDYVKPATCDDNSFR
                     KMWNAFEWENKLRIKSKLPSLRDYLDKLVEVTHMNVLTPEEALGEKDSRFLSCNLYSR
                     STFGEDALANLCIEKDPVTQEIVGEIRIRSKTQGLALTNGDNITRMGRNMNTVSVDRV
                     "
     gene            complement(<1119961..>1120833)
                     /gene="rplE"
                     /locus_tag="KLMA_30520"
                     /db_xref="GeneID:34715793"
     mRNA            complement(<1119961..>1120833)
                     /gene="rplE"
                     /locus_tag="KLMA_30520"
                     /product="54S ribosomal protein L7"
                     /transcript_id="XM_022819044.1"
                     /db_xref="GeneID:34715793"
     CDS             complement(1119961..1120833)
                     /gene="rplE"
                     /locus_tag="KLMA_30520"
                     /codon_start=1
                     /product="54S ribosomal protein L7"
                     /protein_id="XP_022675649.1"
                     /db_xref="GeneID:34715793"
                     /translation="MQIIRGFHSSSSASKAACSLVKPVHHLVKIDKQKLSPRFPELKY
                     SKNDIRSPAFKPVATHQDRVREHYYNTLQSDLLLINYQHKGETVRGLKFREWDGSSPY
                     HINREPRKPKGSKAQLPDIKPITWNNIPDIESVVINCYVRDAKENQYLPISAALQLQQ
                     ITGCKPKALYSRNDVPAWKVRRGTQMGAAVTLKGRPMSQFLSTLTEIVLPRIREYKGI
                     SNKSGNRFGGLSFGFTSDEVRFFPEIDANQDLWPVTFGMHININTTAQTDVQARTLVS
                     GFGFPFHGPEKLNQ"
     gene            <1121289..>1122905
                     /gene="GLE1"
                     /locus_tag="KLMA_30521"
                     /db_xref="GeneID:34715794"
     mRNA            <1121289..>1122905
                     /gene="GLE1"
                     /locus_tag="KLMA_30521"
                     /product="nucleoporin GLE1"
                     /transcript_id="XM_022819045.1"
                     /db_xref="GeneID:34715794"
     CDS             1121289..1122905
                     /gene="GLE1"
                     /locus_tag="KLMA_30521"
                     /codon_start=1
                     /product="nucleoporin GLE1"
                     /protein_id="XP_022675650.1"
                     /db_xref="GeneID:34715794"
                     /translation="MRFSFDELYEDVVSKNDTAFAPHEETEETEAEEEYTFIGDPADG
                     IQLKLPKYQNVIDDIDGNKSDLANAGSLDDIVEPAIAMMLSSLNLMLERNTVPHLGSV
                     SSAKMDSYKATHPITGSKDVVDEVSSSHVQLVNNSLETVWNDTINSVAATNQSLYKSI
                     KERKKREAEEKKRKELEAKQKAEAEEKRKRELEIKQREQQELERKKQEEKLKREQEEK
                     KAAALKLQKEKQEQEQNKLKQVKERTNFEEIESMFLKYKGMIQTIKSEIVEPVKKDAT
                     LKKTLAQHKRKINPKFGQLTNSTQQLSAITNELTSLVDQTKANPLAYKWILNFISKAI
                     VSQAESEARVKPESALPLGKLAINLLAKYPELKELLLARFIKKCPFIIGYSCNIDTEE
                     GRSRMGWKRQSNNKWEEDTSYDERMGGMVTLFAVITRLPLPPEYIQTQQHPFPISWSW
                     RMLARIANTPKQLLTNTHFVALACWWEAAARELSYAYNKQAFKLLEAVSADLTALVAD
                     MKFVGAARLRIINEEWHSTNNLVSFPEMTA"
     gene            <1123104..>1123667
                     /gene="FMN1"
                     /locus_tag="KLMA_30523"
                     /db_xref="GeneID:34715795"
     mRNA            <1123104..>1123667
                     /gene="FMN1"
                     /locus_tag="KLMA_30523"
                     /product="riboflavin kinase"
                     /transcript_id="XM_022819046.1"
                     /db_xref="GeneID:34715795"
     CDS             1123104..1123667
                     /gene="FMN1"
                     /locus_tag="KLMA_30523"
                     /codon_start=1
                     /product="riboflavin kinase"
                     /protein_id="XP_022675651.1"
                     /db_xref="GeneID:34715795"
                     /translation="MPEMTRKCDVPIPEAPEAPYPITTTYVDVIAGFGRGSSELGIPT
                     ANVPINDLPSIIQTLDTGVYFGWCRLKPMPGSEPKSEQRPDGRQVNYNNGTSLSDTDL
                     TVLPVVLSLGWNPFYQNKNKTVELHIIHEFATDFYGAQVKFNILGYIRPELDYTSKEA
                     LIADIHRDIDITKEKLQLPGYQKFKDI"
     gene            <1124021..>1126123
                     /locus_tag="KLMA_30524"
                     /db_xref="GeneID:34715796"
     mRNA            <1124021..>1126123
                     /locus_tag="KLMA_30524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819047.1"
                     /db_xref="GeneID:34715796"
     CDS             1124021..1126123
                     /locus_tag="KLMA_30524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675652.1"
                     /db_xref="GeneID:34715796"
                     /translation="MAKQKMSLIRRKLLVASFYSIWIILIGSAHVWPVLKAAVLSPLS
                     LLACFITLGIITSDYLTPNLAVISQEILFISDRVSGMTLMALGNALPDITSTYKAMKR
                     DATTLAIGESFGAIFFLLTVVIGSMLMVRNIQLSKRSEYTQGNFELDPDNIDAWDTIY
                     YNRNQFLRDLFMFAFLIIMNISFLRDGQIAFWECLVMCISYCLYAAYLIVSIQRPDVS
                     NRDENVPNITVTGPQIHEEDNMERFLKTVQDRRNYLRKKIRMYLRRRYKGCANLKLND
                     TLDLWENSTIFEHEVDQALSRATSPIARPLARSNSETNFQHLQSIPQLSLNGHAAAMC
                     TNGGTSIKDPNESKSDNSFSIVAPKPINTSRQMDLESQSIDSDDNFLQPGRMEAFRSI
                     SVDNLRMLSEQSSMLDEISELDFELNHGISAEPEDRWDSKLRIVKYLTDGGFTTSTFE
                     LLVILVTTPIIFLLTFIIPLHYPSQSGNQFFRIAYYTQCAFSPFISYLLVQREFNLWL
                     FGLGMLAGAILVSFYMAGKLHIKAKYISIFGFILSLSSISFIVGTVIDILTNWVEIFD
                     VSEAILGLTVFAWGNSIGDLVSNIAFTKIGVLEIALGSCFGSPLLYFLFGVGIDGLLV
                     ILQRNDSSEIKIWNRYIEFEVNDRLIVSCIGIVLAFGIFIFIVPLNRWKLDKKIGGLL
                     LLLYVSVTGINIKLELTM"
     gene            complement(<1126197..>1127837)
                     /gene="PRP42"
                     /locus_tag="KLMA_30525"
                     /db_xref="GeneID:34715797"
     mRNA            complement(<1126197..>1127837)
                     /gene="PRP42"
                     /locus_tag="KLMA_30525"
                     /product="U1 small nuclear ribonucleoprotein component
                     PRP42"
                     /transcript_id="XM_022819048.1"
                     /db_xref="GeneID:34715797"
     CDS             complement(1126197..1127837)
                     /gene="PRP42"
                     /locus_tag="KLMA_30525"
                     /codon_start=1
                     /product="U1 small nuclear ribonucleoprotein component
                     PRP42"
                     /protein_id="XP_022675653.1"
                     /db_xref="GeneID:34715797"
                     /translation="MDDETSLIGDSKLSELSILVCKFPKNLCYWENLLNHLLTKAQPI
                     SKSIDKDLLQLIRSTYQSLLWQFPFLENYHIEYGLLEFKLGNFEKFHAIFENGLQYFN
                     NRSLLIWVEYLRICNKLISNNKHLFQKYAFAESYIGLHFFAGEFWSMYLDEIKLRCKT
                     PQHYIRTLRKVIEIPMYEYAKFHNMWLQAIDDIRDLSQFRYFAEDEDLWKKLKIDTTL
                     QGRKGPHLQAAKKSLRKISKELFLVVHYEVMEIYELFESKIQKRYYISAEELIPRQEL
                     DTWMRYFEYVKNKKIPDLIHIQFQRAVLPLAHYDIIWLQYARFLVDDLNDLTAAKNIL
                     LQGLSFAHKRSKIISMLSGLLIRLGNISELHQLYEDLLKAFSNDLSYCDDFEIFVDYI
                     QYNLFLSSSSSKSRYSGTADNIELSDSLKDTIIKRVDVEKDHDRQYVLLNLVNQMYTR
                     FPTALVEEKIYQHIIERRLEQYKTNPKFWYSYCYLIWFDNNLSYSRRRKQILHDIIPK
                     AVNGGEIVISELQKFLSNYLPDDLESFTQKYLPGTNTQ"
     gene            complement(<1128222..>1129205)
                     /gene="HEM3"
                     /locus_tag="KLMA_30526"
                     /db_xref="GeneID:34715798"
     mRNA            complement(<1128222..>1129205)
                     /gene="HEM3"
                     /locus_tag="KLMA_30526"
                     /product="porphobilinogen deaminase"
                     /transcript_id="XM_022819049.1"
                     /db_xref="GeneID:34715798"
     CDS             complement(1128222..1129205)
                     /gene="HEM3"
                     /locus_tag="KLMA_30526"
                     /codon_start=1
                     /product="porphobilinogen deaminase"
                     /protein_id="XP_022675654.1"
                     /db_xref="GeneID:34715798"
                     /translation="MGEKRIIRIAGRRSKLAVIQSEQIKALIESKFPDVECPVLAVHT
                     LGDHVQSKPLYSFGGKAVWTKELEDLLYKEDDTRIDLIVHSLKDMPTLLPDGFELGCI
                     TKRIDPTDALVMPIGSPYKNLSELPDGSVVGTSSVRRSAQLKRRFPNLKFESIRGNVQ
                     TRLTKLDDPETPFKCIVLASAGLIRTGLESRITERFDSDTMCYAVGQGALGIEIRKGD
                     EEMKKILDEICDIPTTICCLAERSLLRTLEGGCSVPIGVVSNFDESKRLLTLKGIVIN
                     VEGTEWIEAEHSVTISDEREDSINCGKALAELLLEKGAQKILDSINLDKIA"
     gene            complement(<1129972..>1132089)
                     /gene="LYS4"
                     /locus_tag="KLMA_30527"
                     /db_xref="GeneID:34715799"
     mRNA            complement(<1129972..>1132089)
                     /gene="LYS4"
                     /locus_tag="KLMA_30527"
                     /product="homoaconitase"
                     /transcript_id="XM_022819050.1"
                     /db_xref="GeneID:34715799"
     CDS             complement(1129972..1132089)
                     /gene="LYS4"
                     /locus_tag="KLMA_30527"
                     /codon_start=1
                     /product="homoaconitase"
                     /protein_id="XP_022675655.1"
                     /db_xref="GeneID:34715799"
                     /translation="MLRVKKVSALPLPCSMLRSFSTSRALYAGQNLTEKIVQMHAVGL
                     PENKKVVSGDYVSIQPAHCMSHDNSWPVALKFMGLGASSIKNPRQIVNTLDHDVQNTS
                     EKNLTKYKNIENFAKKHGIDFYPAGRGIGHQIMIEEGYAFPLTMTVASDSHSNTYGGV
                     GALGTPIVRTDAAAIWATGQTWWQIPPVAQVELKGQLPEGISGKDIIVALCGVFNQDQ
                     VLNHAIEFTGDSLEKIPIDYRLTIANMTTEWGALSGLFPVDNVLINFYRNRLSKVGPN
                     HPRINESRIGELERKADELKADPDAKYAKKLVIDLSTLTHYVSGPNSVKISSTVQDLS
                     NQNIKVNKAYLVSCTNSRLSDLESAAKVVCPTGDINQVNKVADGVEFYIAAASSEVEA
                     DARASGAWEKLLKAGCIPLPAGCGPCIGLGTGLLKEGEVGISATNRNFKGRMGSKDAL
                     AYLASPAVVAASAILGKIASPSEVLASNADPKYTGVVASVEDAKESAGSSSTSTNEET
                     EAKGAIEILEGFPSEISGELVLCDADNINTDGIYPGKYTYQDDVPRETMAKVCMENYD
                     PEFQTKTKPGDILISGFNFGTGSSREQAATAILAKGINLVVSGSFGNIFSRNSINNAL
                     LTLEIPALINMLREKYHDKPKELTRRTGWFLKWDVSQAKVVVTEGSPDGPIVLEQKVG
                     ELGKNLQEIIVKGGLEGWVKSQL"
     gene            <1133660..>1134523
                     /gene="RTN1"
                     /locus_tag="KLMA_30529"
                     /db_xref="GeneID:34715800"
     mRNA            <1133660..>1134523
                     /gene="RTN1"
                     /locus_tag="KLMA_30529"
                     /product="reticulon-like protein 1"
                     /transcript_id="XM_022819051.1"
                     /db_xref="GeneID:34715800"
     CDS             1133660..1134523
                     /gene="RTN1"
                     /locus_tag="KLMA_30529"
                     /codon_start=1
                     /product="reticulon-like protein 1"
                     /protein_id="XP_022675656.1"
                     /db_xref="GeneID:34715800"
                     /translation="MSSEVKASKNCKECDILLWKNPVETGKIFGGALIALLIVKKVDL
                     VSLFLKLLYTVLFASASVEFLSKLVLNKGLVTTYGLKECPNVAGTIKPYVDEALKQLP
                     VYQAKFRQLLFASSPQRSFKAAGVVYASQKLISLMSLWTIALIATIGTFTVPIIYQTY
                     QKEIDQAVDQAVTVTKAKSAEYQKLVQEKATPYVKQLDEKLAPVTGFVKSKIPQSRTT
                     PESTTAKLAAEVPLEPTPSASATTSGASFPSVPKTDLKQSVQEVSDKIDDISADSLKQ
                     EIENHKATPAI"
     gene            complement(<1135640..>1137355)
                     /gene="HEM1"
                     /locus_tag="KLMA_30530"
                     /db_xref="GeneID:34715801"
     mRNA            complement(<1135640..>1137355)
                     /gene="HEM1"
                     /locus_tag="KLMA_30530"
                     /product="5-aminolevulinate synthase"
                     /transcript_id="XM_022819053.1"
                     /db_xref="GeneID:34715801"
     CDS             complement(1135640..1137355)
                     /gene="HEM1"
                     /locus_tag="KLMA_30530"
                     /codon_start=1
                     /product="5-aminolevulinate synthase"
                     /protein_id="XP_022675657.1"
                     /db_xref="GeneID:34715801"
                     /translation="MESVVRQSARVCPFMKSATGSVQNVKALKNANLPAIAQKCPFMG
                     RAMEQRRAYASASGSGAGSGAGAAAAASPAAVEARNASTASADATVLDHATNEASFDY
                     QGLFESELARKRMDKSYRYFNNINRLAKEFPMAHRQQEDDKVTVWCSNDYLALSKNQE
                     VIDVMKKILDKYGAGAGGTRNIAGHNKHALQLEAEIAALHKKEGALVFSSCFVANDAV
                     ISLLGQKIKDLVIFSDELNHASMIVGIKHAYTKKHIFKHNNLEELEKLLAMYPKSTPK
                     LIAFESVYSMSGSVSDINKICDLAEKYGALTFLDEVHAVGLYGPHGAGVAEHCNFEAH
                     RKAGIASPEFRTVMDRVDMITGTLGKSFGTVGGYVAASLKLIDWLRSYAPGFIFTTSL
                     PPSVMAGAAEAIRYQRSHLDLRQDQQKHTTYVKEGLSDLGIPVMPNPSHIVPVLVGNP
                     HLAKEASDILMHKHRIYVQAINFPTVSRGTERLRITPTPGHTNDLSDILLDAMEDVWS
                     TLQLPRVRDWEAQGGLLGVGDPNHSPEPNLWTEEQLSLSNDDLNPNVKHPIIEQLEVS
                     SGIRY"
     gene            complement(<1137956..>1139563)
                     /gene="ACK1"
                     /locus_tag="KLMA_30531"
                     /db_xref="GeneID:34715802"
     mRNA            complement(<1137956..>1139563)
                     /gene="ACK1"
                     /locus_tag="KLMA_30531"
                     /product="activator of C kinase protein 1"
                     /transcript_id="XM_022819054.1"
                     /db_xref="GeneID:34715802"
     CDS             complement(1137956..1139563)
                     /gene="ACK1"
                     /locus_tag="KLMA_30531"
                     /codon_start=1
                     /product="activator of C kinase protein 1"
                     /protein_id="XP_022675658.1"
                     /db_xref="GeneID:34715802"
                     /translation="MASNQQRNVYDNFLNMYAPGHEPGRNVPYPVDDLPQNGGSGVSN
                     NPFIDSNVPMRRQPVPAGATSQGGQIQQQQSFQQQQPEHQHQHEQHHHHQPAPPPSQQ
                     QPQQQPTERSAPPSRDLSEYSPEAIEFYRVYQQTINDANKFTKPVQLKWCETLLQYAF
                     KPSFLIRYNINAERLKRDLKESEMSQNKRTILEHALRVLTKLTQLNYPPALYLLGTLY
                     SHQPYIAIPKPMEIVNKNDAKALDYYRRAADLGHKEAMYRTGVCYEYGRGVDRSILGE
                     HESLKLAQKYYETGALSKGDSSSMYKLGMFYLKGLATKSGEIVIEKDPMQALYWFRMA
                     VKEIEIPNNPTGNSPTTLDSISPQAMMELGKIYGFEEIDDSTRQALLRNGISQNKVTA
                     IKYYYRCAHEFDYSLAQYKLGHFYEFGEMGLPVIPKKSIAWYAKSSMNKTKPNPMAMV
                     ALSGWYLTGAEGVLKPNDKEAFKWVSRASALSDGKLSRAEYALAFYLEKGLGCYPNPQ
                     EAHKHYQIAARLGHPKAIEALGLAPRQ"
     gene            <1140223..>1140807
                     /gene="COX20"
                     /locus_tag="KLMA_30532"
                     /db_xref="GeneID:34715803"
     mRNA            <1140223..>1140807
                     /gene="COX20"
                     /locus_tag="KLMA_30532"
                     /product="cytochrome c oxidase protein 20"
                     /transcript_id="XM_022819055.1"
                     /db_xref="GeneID:34715803"
     CDS             1140223..1140807
                     /gene="COX20"
                     /locus_tag="KLMA_30532"
                     /codon_start=1
                     /product="cytochrome c oxidase protein 20"
                     /protein_id="XP_022675659.1"
                     /db_xref="GeneID:34715803"
                     /translation="MVWPFSKKKSEEEKQVAQGTTTTSLSDAGADAKNELTNYSKGQK
                     FLLEDTKPRFSSESSSVAAREQERASLKEAWDTINFSDVTVSKVLSIPCFRDAGIGGF
                     TSMFVVGSVMFLYHKNPARAANWGVGGFMLGSIVGWEQCRMRRRRSFQIAAMAKQTVA
                     AKEKPMLHPVKNIDFVKAEWDERNKQAKPWYKFW"
     gene            <1141660..>1142631
                     /locus_tag="KLMA_30533"
                     /db_xref="GeneID:34715804"
     mRNA            <1141660..>1142631
                     /locus_tag="KLMA_30533"
                     /product="4,5-DOPA dioxygenase extradiol-like protein"
                     /transcript_id="XM_022819056.1"
                     /db_xref="GeneID:34715804"
     CDS             1141660..1142631
                     /locus_tag="KLMA_30533"
                     /codon_start=1
                     /product="4,5-DOPA dioxygenase extradiol-like protein"
                     /protein_id="XP_022675660.1"
                     /db_xref="GeneID:34715804"
                     /translation="MSWFSKLFTNTAKPASAAMTLSPSTVGAATPVFFVSHGGPTFMY
                     SDKEGGIMGGDYGAFKTVRKIGQTILQDIKPKFIVYVSAHWQSKADNLIEVSVPKSFG
                     KSGLENPLIYDFYGFPQYMYQEQFHSECDISVANDIVNTINHSNTGLKAKLSERGIDH
                     GVWVPLKIAFPNDDLVKNQIPLIQVSLTRNDYDFDSNFKLGELLAEYRSKGGVIIASG
                     MTVHNLGDMRNPGPKPYNEEFTKLLNDILLTKQQNKLGKFKAILQDAKQKELLLKAHP
                     SLEHFLPIIVALGAAEQNGDDVEKIKQLYNNSVESLGWGIYQFGDLL"
     gene            complement(<1142884..>1144299)
                     /gene="IVY1"
                     /locus_tag="KLMA_30534"
                     /db_xref="GeneID:34715805"
     mRNA            complement(<1142884..>1144299)
                     /gene="IVY1"
                     /locus_tag="KLMA_30534"
                     /product="protein IVY1"
                     /transcript_id="XM_022819057.1"
                     /db_xref="GeneID:34715805"
     CDS             complement(1142884..1144299)
                     /gene="IVY1"
                     /locus_tag="KLMA_30534"
                     /codon_start=1
                     /product="protein IVY1"
                     /protein_id="XP_022675661.1"
                     /db_xref="GeneID:34715805"
                     /translation="MDVSPERYAPHLSEFYSMMNGSDKTSGHIHKASPQVDHPKDFSA
                     HPMDDVVSTSTSTQNNLRRPSSIRSGVSGFSITELHALVTKEDIKKTQGSMKSLVGKI
                     TKYSEKLNELAQFSTEIAFELEDMARLKGCSDLTADKFINASGLFHLVSNHDRIISNC
                     CEEVVVKGLNQKVEKLDSDFKAEEITFKKQFKDQSIKLKLQERYSSAMAKRKIRNLVS
                     YRENLTILQHQLDQLEMLKHDYYQKSYGMVEATCQGVLKDIATLARAQIEISENIARK
                     GWSGGGLDNLIIDADDPFSTGNEDEADIDLTQLAQIPENASLDNSKSNMLTPKKQITP
                     PFNDNLLNQSDELLSSPAQISNNEGNANSNIIDEKGNTNSNTKSHPHDSSHSNETENE
                     NAITQYPETQSVNSVRIDKDKGDFEEDNFDNSFSLPLTNTSNNKGISSSSINDSPLSA
                     DNILEATGELNINDQSSTFSN"
     gene            complement(<1148370..>1148813)
                     /gene="MRPL28"
                     /locus_tag="KLMA_30535"
                     /db_xref="GeneID:34715806"
     mRNA            complement(<1148370..>1148813)
                     /gene="MRPL28"
                     /locus_tag="KLMA_30535"
                     /product="54S ribosomal protein L28"
                     /transcript_id="XM_022819058.1"
                     /db_xref="GeneID:34715806"
     CDS             complement(1148370..1148813)
                     /gene="MRPL28"
                     /locus_tag="KLMA_30535"
                     /codon_start=1
                     /product="54S ribosomal protein L28"
                     /protein_id="XP_022675662.1"
                     /db_xref="GeneID:34715806"
                     /translation="MILSPASSKNVSKVVQPSLNFIRGKRTKSKGGLNPQAQRIITQL
                     SVLSASRKQPKLLKLSREDLIKHDMIQACWSQYQRELREKRENQLRLQYEGMEKAMSL
                     LEQVDPELYAMANAPETGKRFPLELRVPTEYPPNTVWYYDYKKKE"
     gene            <1151305..>1151775
                     /gene="CGI121"
                     /locus_tag="KLMA_30536"
                     /db_xref="GeneID:34715807"
     mRNA            <1151305..>1151775
                     /gene="CGI121"
                     /locus_tag="KLMA_30536"
                     /product="protein CGI121"
                     /transcript_id="XM_022819059.1"
                     /db_xref="GeneID:34715807"
     CDS             1151305..1151775
                     /gene="CGI121"
                     /locus_tag="KLMA_30536"
                     /codon_start=1
                     /product="protein CGI121"
                     /protein_id="XP_022675663.1"
                     /db_xref="GeneID:34715807"
                     /translation="MAEYTLTYRVPQFQEYTISLQKYANVSNADVLRSKLMELPFAFI
                     DARTVISVEQISSAIYKALVESTYNRMRTKTLHSECILSLSPSSNIGDALKRFGIKED
                     STNLIVIKIVKNGDDEPFDGKTSIVGDLVPVSDEQFVTTADIETIKNVCIQTKR"
     gene            complement(<1151912..>1152868)
                     /gene="TFB3"
                     /locus_tag="KLMA_30537"
                     /db_xref="GeneID:34715808"
     mRNA            complement(<1151912..>1152868)
                     /gene="TFB3"
                     /locus_tag="KLMA_30537"
                     /product="RNA polymerase II transcription factor B subunit
                     3"
                     /transcript_id="XM_022819060.1"
                     /db_xref="GeneID:34715808"
     CDS             complement(1151912..1152868)
                     /gene="TFB3"
                     /locus_tag="KLMA_30537"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor B subunit
                     3"
                     /protein_id="XP_022675664.1"
                     /db_xref="GeneID:34715808"
                     /translation="MDEDEKKDMCPICKTDRYLSPDMKFLINPECYHKICESCVDRIF
                     SLGPAQCPYTGCDKILRRNKFKTQIFDDVGVEKEVDIRKRVFNVFNKTLEDFDYNQEE
                     YDKYLEEVEDIIYNLDHGIDMEQTEERLRTYEELNKQLIMANLERSKQDIANFEQRQK
                     FEKEMKLKKRMLEKQIEDEERANREWAKREIVNQLTVNDDAEEVIENVKKTVKLKKSS
                     ARRKLEELNKVLRNNPYMTMTNGRMKKKDNVPFTPFNGDRDLHKRYQLEENEYNDSFI
                     RELQKKKEYIASGFRADFVYDRMLTEAFMGLGCLIKEELQSS"
     gene            complement(<1153166..>1155079)
                     /locus_tag="KLMA_30538"
                     /db_xref="GeneID:34715809"
     mRNA            complement(<1153166..>1155079)
                     /locus_tag="KLMA_30538"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819061.1"
                     /db_xref="GeneID:34715809"
     CDS             complement(1153166..1155079)
                     /locus_tag="KLMA_30538"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675665.1"
                     /db_xref="GeneID:34715809"
                     /translation="MSKYEIGEIAQLYFPNEMFLNDDEIASAPESEKNSFDFTSLMQK
                     LKETRKTTIKYAGKGTTEGLHKSFQQEKFILPRNKENRDFNTNNSDEYDYEKETDSEI
                     ELSWRPLDEIALKRKALNRVGNCFKPMPGDDRDDNQKKGKFTGGCAQLLGFPAQTPAP
                     QEEAYMLDRGGSTEDIKSSVKKAHPVDFSTRRKPTQDENDKEYFEVEAVLGGIKDDIK
                     QTLQKVDDINKFIYSKIDSSTREANMDKQNEITRIETNDYQVSECIPGTFPERIIYLR
                     DIVQAPEEQTNHLKSIDWMKWLVSWPIKWKIAYYFGCHVLSFSNKDYSISQKSMDLLE
                     NNNTLTIPELDKLLGCYMAYRVISRNLYDISSALNEIYDYSYKFILQYDDLHPLQQKK
                     WKELFTYGALNISLVFFGTLTLEMFLSPGKTSSPVFGCLWNIGFGSSQKAGLAIMLTL
                     FYLNLTKETLHKFNIHVKKEIEKEKEEQFRTAQQSEFPNKLNLKERFSCTNVYPQKDV
                     SDIIVDENDQGTKDYCSALLESTPPFTRNADSLMAQSPLLKKSSNVIASDSIRLAPLS
                     QPEKGKGSWRNIEEVHLIKTSNKTSYDIFFAVLSKILILTSSLLQQPISTSKRLRPRR
                     ILRSIKKIVNTPL"
     gene            <1155587..>1157524
                     /gene="PMT7"
                     /locus_tag="KLMA_30539"
                     /db_xref="GeneID:34715810"
     mRNA            <1155587..>1157524
                     /gene="PMT7"
                     /locus_tag="KLMA_30539"
                     /product="probable dolichyl-phosphate-mannose--protein
                     mannosyltransferase 7"
                     /transcript_id="XM_022819062.1"
                     /db_xref="GeneID:34715810"
     CDS             1155587..1157524
                     /gene="PMT7"
                     /locus_tag="KLMA_30539"
                     /codon_start=1
                     /product="probable dolichyl-phosphate-mannose--protein
                     mannosyltransferase 7"
                     /protein_id="XP_022675666.1"
                     /db_xref="GeneID:34715810"
                     /translation="MAEKNTEYNPVKQGPYKSYLRHDYQYHIKNRESSVEKNMLFDLG
                     LNIAAVALLSIQHSGKLSKTSMDELYLWNQVEDVSNSKFFIASGVPLVVQLVSLASKR
                     FSLDLEFWKMINNVLLASFLVKLYHILRKVNVSVFVSAAITCMFSQVSLFQELVYTFN
                     LDTYHLLALALLVLHWRELQGSKDFSIKWFINMSFVSLSLIFSTSGKFIGLVSWLWFF
                     IISLKAFCTLVGDIEVSMFQLFVHFFVRFFFFVVLPFSTIYMSYCQLFNAFDVETPEL
                     ALMSSSFQHYVMGLHENVPSAIRNGSTIRLRHVNSLGGYLAPLEVQYTDTNDSLVTIS
                     NNPNDEASYWIIELVRDISSKKLPSNYSLSNSDRLKLRNKKTGQLLRGSEDKPPVSDK
                     EYDRRVSNTGDWGFSGDQDETWKLDILSAPTLRERLIPFKHRFMLYNPARRCSLLSHD
                     VNMPNWANNDQEVLCVESAVIDRASFYIDFVADPNLEILDAETDTYRWSSSFPTYKLV
                     LEYLQVQFKIDKGQAIHFEKESDEEGQNLSEHYLFFPLRFQESNRIGRLLWIGSTVAV
                     GLYALIQTYLWMNWSIYEDNLLGKKSLELMREEVSFESFLGWFLHLFIFNFSLHKNFS
                     VIQYLAAFFYAVNTLAQFLGI"
     gene            complement(<1157620..>1158054)
                     /gene="SRB7"
                     /locus_tag="KLMA_30540"
                     /db_xref="GeneID:34715811"
     mRNA            complement(<1157620..>1158054)
                     /gene="SRB7"
                     /locus_tag="KLMA_30540"
                     /product="mediator of RNA polymerase II transcription
                     subunit 21"
                     /transcript_id="XM_022819064.1"
                     /db_xref="GeneID:34715811"
     CDS             complement(1157620..1158054)
                     /gene="SRB7"
                     /locus_tag="KLMA_30540"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 21"
                     /protein_id="XP_022675667.1"
                     /db_xref="GeneID:34715811"
                     /translation="MTDRLTQLQICLDQMMEQFCGAVNYIDKNHGFEPSNETEEQMSD
                     PQAHVVEEKEFDKNIDELTTDIILKTRQIMALIDSLPGVDVSAQEQLHRIDSLQKQLV
                     KMENEKIKAIKRKDALLEKVRFLIEDFTVGINGSKAAFQAQS"
     gene            <1158296..>1158802
                     /gene="VMA22"
                     /locus_tag="KLMA_30541"
                     /db_xref="GeneID:34715812"
     mRNA            <1158296..>1158802
                     /gene="VMA22"
                     /locus_tag="KLMA_30541"
                     /product="vacuolar ATPase assembly protein VMA22"
                     /transcript_id="XM_022819065.1"
                     /db_xref="GeneID:34715812"
     CDS             1158296..1158802
                     /gene="VMA22"
                     /locus_tag="KLMA_30541"
                     /codon_start=1
                     /product="vacuolar ATPase assembly protein VMA22"
                     /protein_id="XP_022675668.1"
                     /db_xref="GeneID:34715812"
                     /translation="MSRDDLYLRLIKKLAEYDSLLEQLQSSFQDGFHHLSRANYHNKD
                     TLRGTYGRDYWDETYTGHRYVSIDGKHRIQEIAEPEYKEDQEEEAIPEKQDTEASHKL
                     RKRKQRKTLLEKAKKNPIYMFGGALSTPMSLRQSQSSFNSSFPVIYKLIELRYELNAL
                     LDQISPSV"
     gene            complement(<1159058..>1160179)
                     /gene="GIC2"
                     /locus_tag="KLMA_30542"
                     /db_xref="GeneID:34715813"
     mRNA            complement(<1159058..>1160179)
                     /gene="GIC2"
                     /locus_tag="KLMA_30542"
                     /product="GTPase-interacting component 2"
                     /transcript_id="XM_022819066.1"
                     /db_xref="GeneID:34715813"
     CDS             complement(1159058..1160179)
                     /gene="GIC2"
                     /locus_tag="KLMA_30542"
                     /codon_start=1
                     /product="GTPase-interacting component 2"
                     /protein_id="XP_022675669.1"
                     /db_xref="GeneID:34715813"
                     /translation="MNVPQIKSIWIDEDDETEKLYGLQAHQFMDSDDENELGVVMINS
                     DKPVLSNRKNIDLPPLPPNAYKDSSSKSSFLKKKKSLLKLFQNKSSKEESPKLKISVP
                     FGFSHISHADSRAGFDVPDPSPSSSSSHTRNASHSQLQNIPEGSAVRTDSINEQTASM
                     AKVFVTDAIPYTHQGLLSRASSAKRSSVGSSMYSNPRITSTSTMATSLLNDSNMRSIS
                     KLTTLEKTHLKHKYSKSESSDLDVEFLKNYQFPTLLEEQSILHVSTPEMNTKKDKFQW
                     ESPANSTDLLETMLLDDMKMVSRRSATSKQSLKRNSDPIMTPILKPSEYLDSPRTRRS
                     VDDVLLCYLQPSDAGSSLEETSSEFSFARNSKLYYKSNV"
     gene            complement(<1161888..>1162745)
                     /gene="RPP1"
                     /locus_tag="KLMA_30543"
                     /db_xref="GeneID:34715814"
     mRNA            complement(<1161888..>1162745)
                     /gene="RPP1"
                     /locus_tag="KLMA_30543"
                     /product="ribonuclease P/MRP protein subunit RPP1"
                     /transcript_id="XM_022819067.1"
                     /db_xref="GeneID:34715814"
     CDS             complement(1161888..1162745)
                     /gene="RPP1"
                     /locus_tag="KLMA_30543"
                     /codon_start=1
                     /product="ribonuclease P/MRP protein subunit RPP1"
                     /protein_id="XP_022675670.1"
                     /db_xref="GeneID:34715814"
                     /translation="MLVDLNVPWPQKDFNSPPSSKDIKLLQNTLATLHTLGYTHVAIN
                     FTVNQQDKFPSTLKEMNPINLTLFDEFVKSTGIKLYSRITIIIDDLSKGQPLTKICQA
                     YDIVAALPISEKAVTLAASNLDIDILSFSYDKRLPTLLKHHTMGGCIKRGVKVEIVYA
                     NALRDIRTRKQFVSNVKSVIRTCRNRGIVISSGATTPLECRNVISVASLLNFIGLPND
                     KCGKAMGELASLVLLNGRLRNKSYKQVVCIGNEDVVNEDLSEHGSYKIVKRKLSEKTD
                     PASNKRVKD"
     gene            complement(<1163226..>1166069)
                     /gene="SUM1"
                     /locus_tag="KLMA_30544"
                     /db_xref="GeneID:34715815"
     mRNA            complement(<1163226..>1166069)
                     /gene="SUM1"
                     /locus_tag="KLMA_30544"
                     /product="suppressor of mar1-1 protein"
                     /transcript_id="XM_022819068.1"
                     /db_xref="GeneID:34715815"
     CDS             complement(1163226..1166069)
                     /gene="SUM1"
                     /locus_tag="KLMA_30544"
                     /codon_start=1
                     /product="suppressor of mar1-1 protein"
                     /protein_id="XP_022675671.1"
                     /db_xref="GeneID:34715815"
                     /translation="MASNSAMTGEVSEIEVDVGVALKKQESVIDALSKKVVQMESVLP
                     GADEVVQKSIESVVSSLKNLSHNQQVLEAKFEDLLKNQANSDAAINDLSAEVSKISKI
                     VAEQQQLLQNGINLDSSAGGAGTLSLSSSGGYGNISPPHRGPGRPPKKASSILANGER
                     RAKLPFPTDHISKSKRFFVDPDKEKSSHVEDPFDHGETSNTTPQEPKKRRGRPSKKAS
                     TWDAQNASSSSVSKRGHKESTPSESSSAHAPKYTTSRRKSQRIKPGSTQQYDEQSDLS
                     SSFSGASDNETQDDDNGTAAADDSEEAAARKQKELERRRDERERMLVTMKYSDRNVTR
                     NFMELNKDLFMAMKQEERKKRMTAIQFDNGVPLGKYQLSNKPIEPLAVSKIPFSLSQS
                     SELQSPLPKMPESAQSTTANSGISDDHISNQPDSAGSNTNTGSSTQDNVSRGNNEGDG
                     NHTQQSNSPSIAGSRGYSSEAPKRSSSTFDEQSKTSKDLEGPRKVKILSILNNEGSPE
                     VKKELDSNAPQGGEIDANNSSPASADSSGIFAGNLSISYLNNNEPPRKKRLLSVNDRR
                     KMSKMIPMLPEKKDKRGRPSSNNQSQENAASLLMSSPVELYCREGFFYRKGSTVPITA
                     GEYLDLKFRHKEEELIKLTMHEEDYAELTRQDRINAYFLKPDVEIESSMACQVLSNVI
                     LTERYVNSLEYFLMEFRWENRLVSLGLKLRESKRTWQRRKALFALFEFWRDKSKDKRG
                     FKNYTLLHAIKEMENYRVFINRSVSWFYNHITLLKMILFDLCDNTSTHWREWMFARGS
                     ELPIVGENGVTVTTINREIDNMLVLDFLEDGSRNSHKKSSNIPYKENSEGPPEESVEA
                     EEKKEPVVYVQTMGGSQRDTATEEVENSKQSTEGPDESEEPQAQSTNVEEQQTEKEKQ
                     VDSAANDTVTTTPAENNELKEPSQQEPLPEEHS"
     gene            complement(<1166629..>1167786)
                     /gene="PAN5"
                     /locus_tag="KLMA_30545"
                     /db_xref="GeneID:34715816"
     mRNA            complement(<1166629..>1167786)
                     /gene="PAN5"
                     /locus_tag="KLMA_30545"
                     /product="2-dehydropantoate 2-reductase"
                     /transcript_id="XM_022819069.1"
                     /db_xref="GeneID:34715816"
     CDS             complement(1166629..1167786)
                     /gene="PAN5"
                     /locus_tag="KLMA_30545"
                     /codon_start=1
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="XP_022675672.1"
                     /db_xref="GeneID:34715816"
                     /translation="MKVYSKQAQTNNQNMTAQPSVYILGFGAIGSLLGVHLQKYGGTK
                     VTPLFRSLGRLSDFKTNDYEVSIKPLYDSSLEILTERFPDASCPENFKGKIDNLIVTC
                     KTYQTADALRPFLPYLDNNSNIIMIQNGLGVSEVLKEQVFNGGDLKPNLFQGVIAHGI
                     FQDSEIKNQYNHAGFVDCKISKLPENDNDIIETFADLEALKQNELIKMLNSLDRSLGV
                     VHMTYQELLLGQLEKFLVNCCINSVTSIIDCMNGELANCAGPIFQSIIEEAINVFHTA
                     YKPLFDYEDIYKGAKHGQLPKLNVAGRLNVTTMLENTMHVGCVVNGGNSSSMRQDVLN
                     LRETEIDYINGYVVTLCKKFSLPESNAKVNRTIQELVKLRLKLNQTRKAGQ"
     gene            complement(<1168106..>1169740)
                     /gene="SSZ1"
                     /locus_tag="KLMA_30546"
                     /db_xref="GeneID:34715817"
     mRNA            complement(<1168106..>1169740)
                     /gene="SSZ1"
                     /locus_tag="KLMA_30546"
                     /product="ribosome-associated complex subunit SSZ1"
                     /transcript_id="XM_022819070.1"
                     /db_xref="GeneID:34715817"
     CDS             complement(1168106..1169740)
                     /gene="SSZ1"
                     /locus_tag="KLMA_30546"
                     /codon_start=1
                     /product="ribosome-associated complex subunit SSZ1"
                     /protein_id="XP_022675673.1"
                     /db_xref="GeneID:34715817"
                     /translation="MSGPIIGIAFGNTSSSIAYVNPKNDVDVIANPDGERSIPSVLSY
                     VGDDEYHGGQALQQLIRNPKNTIINFRDFIGLPFSECDASRCAAGAPVVEIDGKAGFV
                     VKRADDVEEKLTVDEVVSRHLKNLKLAAEDYIGQTISKAVLTVPTNFSDAQKKALKDA
                     ASAVDLEIVYFINEPSSALLAHVEEFPTDKDQNVVVADFGGVRSDAAVIAVRNGIFTL
                     LATEHDAKLGGDNLDAALIDFFASDFEKKNKSNPKKNARSLAKLKANAQLTKKTLSNV
                     TSATISIDSLADGFDYHSSINRMRYELVANKVISQFTAFIEKVIKKADLDTLDIDSVL
                     LVGGTSFTPKLATNLDFIFPENVDILSPQSKNATNNPNELAACGAALQAELLNAYDAD
                     ELAQSLEPIVINTPHLSKHIGLVDSKGEFVPVLLAETSYPIKKTLKLKKAAGDFTIAI
                     HEAEHHIKETVVEPAPKEEKAEKDDEEDDESDWSDEDDEPEVVREKHYTLGNKLMELG
                     VKDVKGLELVFTIDKEGKLTVAARDLKSNTVVKGEL"
     gene            <1170296..>1172152
                     /gene="TFB1"
                     /locus_tag="KLMA_30547"
                     /db_xref="GeneID:34715818"
     mRNA            <1170296..>1172152
                     /gene="TFB1"
                     /locus_tag="KLMA_30547"
                     /product="RNA polymerase II transcription factor B subunit
                     1"
                     /transcript_id="XM_022819071.1"
                     /db_xref="GeneID:34715818"
     CDS             1170296..1172152
                     /gene="TFB1"
                     /locus_tag="KLMA_30547"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor B subunit
                     1"
                     /protein_id="XP_022675674.1"
                     /db_xref="GeneID:34715818"
                     /translation="MSETHTGAATFKKVHGMIRIDEDASPATLVWRSTDGDKSTTVLL
                     NMVDKLQATPANSDKMMLRIVGKIDPNMKKRKDNEGNEIPVKAPVYMFTFNNRTVMDN
                     IKETLQHIIARYKDEEATEERHKNEPETEAQDNPAASVTPQPAHLPQDLINTTTLDTS
                     LTKSKLLSNLKLQQSLLKESRELMTIFQDTVIKSGLPPHEFWSTRIPLLRAYALSTSQ
                     KTGPYNVLSTIKPVASSDNKVNVNVSREKIHTIFQNYPIVRKAFDDNVPKNFKEQEFW
                     ARFFSSKLFRKLRGERIMNHDRGDMIIDRYLSLDQEYDRRDDELLQHPVRKIIDIEGN
                     INDDPVKKGHRPDFTMRSGIDPNGNSDGGMAILKGMNRLSEKMVESLENEYSRANLPQ
                     EDPDKEEREEILFSDLDEDTPTDYAEIKLKRKVLDAKNRQMHKENSAISWEEVKHEIN
                     SITSILDTSILDLTTLTHITADVTKTINQRIMKAVKVNAKQSKHMNGDTLLGSTMSGT
                     SMFQEAKESASHLPPDILESCRLLNSSCCEFLKHFYINFQSGDPRKTNLVKKLYKSLM
                     DCQEKIDSLLNSVDTEENQEIAKYCKAYLVHVLDSVGLGINKYRALVKGTAA"
     gene            complement(<1172279..>1173742)
                     /gene="RRP3"
                     /locus_tag="KLMA_30548"
                     /db_xref="GeneID:34715819"
     mRNA            complement(<1172279..>1173742)
                     /gene="RRP3"
                     /locus_tag="KLMA_30548"
                     /product="ATP-dependent rRNA helicase RRP3"
                     /transcript_id="XM_022819072.1"
                     /db_xref="GeneID:34715819"
     CDS             complement(1172279..1173742)
                     /gene="RRP3"
                     /locus_tag="KLMA_30548"
                     /codon_start=1
                     /product="ATP-dependent rRNA helicase RRP3"
                     /protein_id="XP_022675675.1"
                     /db_xref="GeneID:34715819"
                     /translation="MAKVEKKQVSKKNSEVLSLAEKIKRKALEKQKESAQHNSDSEPE
                     IRSNDDSRKVEQDGEGESEETFESFSELDLVPELIEACKNLNYAKPTPIQSRAIPAAL
                     KGNDIIGLAQTGSGKTAAFAIPILNQLWHDQQPYYACILAPTRELAQQIKETFDSLGS
                     LMGVRSTCIVGGMSMMDQARDLMRKPHIIIATPGRLMDHLENTKGFNLRKLKFLVMDE
                     ADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKY
                     QTVDTLIQTLMVVPGGLKNTFLIYLLNEFIGKTTIVFTRTKANAERISNLCNLLDFSA
                     TALHGDLNQNQRTGALDLFKAGKRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYI
                     HRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKLPKENVDKDAILALRDTVDKA
                     NGEVVMELNRRNKEKQARSKGRRGRMAFKDNMDREER"
     gene            <1174140..>1175561
                     /gene="SSF1"
                     /locus_tag="KLMA_30549"
                     /db_xref="GeneID:34715820"
     mRNA            <1174140..>1175561
                     /gene="SSF1"
                     /locus_tag="KLMA_30549"
                     /product="ribosome biogenesis protein SSF2"
                     /transcript_id="XM_022819073.1"
                     /db_xref="GeneID:34715820"
     CDS             1174140..1175561
                     /gene="SSF1"
                     /locus_tag="KLMA_30549"
                     /codon_start=1
                     /product="ribosome biogenesis protein SSF2"
                     /protein_id="XP_022675676.1"
                     /db_xref="GeneID:34715820"
                     /translation="MAKRRSKNRTHVKPSPEELKKIPKSMVIRVGQTSLSSHSLNQLV
                     KDFRNIMQPHTAIKLRERKSNKLKDFVVMCGPLGVSHLFIFTQSEKTGNVSLKIARTP
                     QGPTITFQVQDYSLSKDIKKFLRRPKSLGKEDILNPPLLVLNGFHIKGNEDEEAANVE
                     KVIVSMFQNVFPPLNPSKIQLNTIKRVFMINKDAATGEISLRHYAIEVREVELSKNLK
                     KLYKSKQKLSKPVPNLHRKDDIASLILDHDIGAYTSESEIEEDAIVKVMDKDNQHIKH
                     LPHHASKKKTEHSTKPNGESHDNDGDIPMKDEEEQVEHQQQQEEDDYQSAQQPKKKAI
                     KLTEIGPRLTLKLVKIEEGICAGKVLHHEFVKKSDAEIRALEKRHAEKMRLKEQRRKE
                     QEENIARKKAAKEAKKQRKLERRKARELANAKGDGSDADNSSASDSSDSEDSDSSSSE
                     NNYSDVPEDLDSDLFSDVDEGAN"
     gene            complement(<1176798..>1177784)
                     /gene="PIB1"
                     /locus_tag="KLMA_30550"
                     /db_xref="GeneID:34715821"
     mRNA            complement(<1176798..>1177784)
                     /gene="PIB1"
                     /locus_tag="KLMA_30550"
                     /product="E3 ubiquitin-protein ligase PIB1"
                     /transcript_id="XM_022819075.1"
                     /db_xref="GeneID:34715821"
     CDS             complement(1176798..1177784)
                     /gene="PIB1"
                     /locus_tag="KLMA_30550"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase PIB1"
                     /protein_id="XP_022675677.1"
                     /db_xref="GeneID:34715821"
                     /translation="MAFSSTAAAGASLQDASDALSAGEPMGSRNELRMGGHRNTQYVN
                     EFGEWEKDEDVTECLSCGVKFSFIMRRHHCRCCGRIYCGNCCYKYAWYDKNRVKVVVK
                     SPTEKEVEPYRTCDSCYENLSQMKLLRTPWGDIQLPRNSSRTGNLGNSSSFLDNANSS
                     VRPFFEVSKNNNVVETVRDAESERSSARQIAPNSDEDYERCPICNFDLRVLGTNELAQ
                     QEHVTECIQQAELAQQQHNMVGSPTYQNRMLVYKIPENTTNIQECPICFEEMVPGEKV
                     GRLECLCVFHYECIKSWFKKKSQKLMQQNSGTEASLLMLGKNYCPFHDAIYY"
     gene            <1178219..>1180513
                     /gene="SEC18"
                     /locus_tag="KLMA_30551"
                     /db_xref="GeneID:34715822"
     mRNA            <1178219..>1180513
                     /gene="SEC18"
                     /locus_tag="KLMA_30551"
                     /product="vesicular-fusion protein SEC18"
                     /transcript_id="XM_022819076.1"
                     /db_xref="GeneID:34715822"
     CDS             1178219..1180513
                     /gene="SEC18"
                     /locus_tag="KLMA_30551"
                     /codon_start=1
                     /product="vesicular-fusion protein SEC18"
                     /protein_id="XP_022675678.1"
                     /db_xref="GeneID:34715822"
                     /translation="MEKFGLSGKLPSFGKATHTPAVPNMSNVDMTPKQLRVANCPNNS
                     YALANVAAVSPVDFPDNIYVIVDNLFVFSTRHSNDVQPGTVGFNGNQRTWGGWSLNQD
                     VQVRPFDLFQQSGKHAYLGSVDLEISFRSRGKAVETPFDQDDLAKQFLKSFESQIFSP
                     TQYLIFEFKGHIFDLRVRSTQTIDLGDVEVVAPISTSIESKAILIKQTQINFFKGRDG
                     LVNLKSSNSLRPRSDAVIRPDFKFEDLGVGGLDREFTKIFRRAFASRIFPPAVIEKLG
                     ISHVKGLLLFGPPGTGKTLIARKIGTMLNAKEPKIVNGPEILSKYVGSSEENIRNLFK
                     DAEAEYKAKGEESSLHIIIFDELDSVFKQRGSRGDGTGVGDNVVNQLLAKMDGVDQLN
                     NILVIGMTNRKDLIDSALLRPGRFEVQVEIQLPDEEGRVQIFEIQTKKMRENNMLASD
                     VNLKELAALTKNFSGAEIEGLVKSASSFAINKTVNIGKGATKLKTKDIANMKVTRQDF
                     LNALQEVTPAFGVSEEDLKTCIEGGVFKFSNSVEDILKNGARYVRQVRESDKSRLVSL
                     LVHGPPGSGKTALAAAIALKSEFPFIRMISPEEIAGMSESAKIAYIDNTFRDAYKSPL
                     NILVIDSIETLVDWVPIGPRFSNNILQVLKVYLKRKPPNNRRLLLISTTSAYSVLKQM
                     DILSCFDNEIAVPNVSNLDELNNIMIDSGFLDDAGRVEVIQKLSQVTASLNVGVKKVL
                     TNIETARHDEDPVNELVDLMVQSS"
     gene            <1180761..>1183541
                     /gene="TIF32"
                     /locus_tag="KLMA_30552"
                     /db_xref="GeneID:34715823"
     mRNA            <1180761..>1183541
                     /gene="TIF32"
                     /locus_tag="KLMA_30552"
                     /product="eukaryotic translation initiation factor 3
                     subunit A"
                     /transcript_id="XM_022819077.1"
                     /db_xref="GeneID:34715823"
     CDS             1180761..1183541
                     /gene="TIF32"
                     /locus_tag="KLMA_30552"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3
                     subunit A"
                     /protein_id="XP_022675679.1"
                     /db_xref="GeneID:34715823"
                     /translation="MAPPALRPENAIRRADELVSVGEPMAGLQSLFDLLSSRRSRFAD
                     AATLEPIIFKFLELGVELRKGKMIKEGLYQYKKHMQHTTEGLHSVGAVARKFIDLIEK
                     KMTTVQAQADAKDQANEADDDLEGGVTPENLLVSVYEQEQTVGGFNNDDVSAWLRFTW
                     ESYRTTLDFLRNNSQLEITYAGVVNRTMQFCYKYNRKNEFKRLAEMLRQHLDAANYQQ
                     QRYGHHTVDLSDADTLQRYSDQRFQQVNVSVKLELWHEAFRSIEDVHHLMRIAKRPPK
                     PSVLANYYENLAKIFFVSGNYLLHAAAWEKFYNLYLKNPNATDEDFKFYASQFLLSAL
                     AIQLDDLPIAGFDPQIRLCDLLDLESKPKRKDLIAAATDSKILEKADPEILKFFDILE
                     TNFNVRTVKDQLSELLPKLQDKPYFAQYVTPLRNLFIRRSIIEVAKEQTSIHLVELHE
                     LLSLPAPFELSVFELEKYLIQAAMDDYVSITIDHETDTVTFAQDPFDAWQASLVETAS
                     DETKENDSEEETQEGSEESSEEEQVEQVFTRNSEVRSKLTDLSKILKANEEYEKGSYY
                     LRVKLVREELVRQKEEVIKREKEAAEIRAKNNAERKKRNEEEKKLAAKRAMEERHRRM
                     IEEKAAVESSMEKEAERRAQEMMEREREAIHEQEMKKLIEETNANGVIYIDPKEAKNM
                     TSEKINQMVIEQVAKNKKDMTERMTFAFKRLDHLERAYRQMELPLLEKDAQQQKDRDM
                     ENYEAFKKKLIESAKADFEKKLELHNRLNKIYGSFKEYRTAVSKAKKEQIEQEKELKK
                     SQLEEAKKQRIEQVRKERYEAKVAEIKAAIEAEEQRKEALAKEAELEKRRAERDRINR
                     ERDEIARKQREIEELLEKKNSASRASASPIPARASPSPAASTSTPPPSNKPMSMAEKL
                     RLKRMQKEAGRG"
     gene            <1183921..>1184511
                     /gene="Plekha8"
                     /locus_tag="KLMA_30553"
                     /db_xref="GeneID:34715824"
     mRNA            <1183921..>1184511
                     /gene="Plekha8"
                     /locus_tag="KLMA_30553"
                     /product="glycolipid transfer protein"
                     /transcript_id="XM_022819078.1"
                     /db_xref="GeneID:34715824"
     CDS             1183921..1184511
                     /gene="Plekha8"
                     /locus_tag="KLMA_30553"
                     /codon_start=1
                     /product="glycolipid transfer protein"
                     /protein_id="XP_022675680.1"
                     /db_xref="GeneID:34715824"
                     /translation="MSTFFDDMKRSFEAVPLDSDKKISTPEFLEASESLVKLFDVIGN
                     PAFGMVQNDLTGNIEKVRKRYLAKPDESAKLQDLVTNERAEGQKTASEGLLWLNRGLQ
                     FTAQAMTETIENPSMELPESFTNAYKKTLSKHHNMLLKPVFKFAMKACPYRKDFFEKL
                     GADQDKVNKQLEAWVAALSNIVAILLEFLATTCKDL"
     gene            complement(<1185656..>1187699)
                     /gene="ECM33"
                     /locus_tag="KLMA_30554"
                     /db_xref="GeneID:34715825"
     mRNA            complement(join(<1185656..1186860,1187642..>1187699))
                     /gene="ECM33"
                     /locus_tag="KLMA_30554"
                     /product="cell wall protein ECM33"
                     /transcript_id="XM_022819079.1"
                     /db_xref="GeneID:34715825"
     CDS             complement(join(1185656..1186860,1187642..1187699))
                     /gene="ECM33"
                     /locus_tag="KLMA_30554"
                     /codon_start=1
                     /product="cell wall protein ECM33"
                     /protein_id="XP_022675681.1"
                     /db_xref="GeneID:34715825"
                     /translation="MQYKNGITAAAILAASVQAANSTSSVPSSCSIKSGATASAQADL
                     DKYAGCSTIVGDLVLTGDMASAALAGVQEIDGSLTVKNATSLTQFSADSLQKISDTLT
                     LQELTVLDTASFGSLAEVDTIQFITLPAVSSIITKLTSAKQIIITDTALESIAGFEEL
                     DEVEVFNVNNNKGLATIKSKLKHVTNALEVTFNGQSADISFDDLEWANNITLRDVSSA
                     SFASLSSVNESLGFINNSISSIDLSTLQKIGGSLSIVSNDELTSLNFDNLTSVGGGFV
                     IANNSKLAKIDTFGDLTTIGGAMVVTGKFGDLGFNSLKSVKGGAEVESTSSNFSCDAL
                     NKLQKKGGIQGDSFVCKDGATSTSVKLTATSKSDDDSTSTADSSSGSASATSTSKTSK
                     SKGAAAANFNAPGSSLMGAVAAVAYALL"
     gene            complement(<1190736..>1190912)
                     /locus_tag="KLMA_30555"
                     /db_xref="GeneID:34715826"
     mRNA            complement(<1190736..>1190912)
                     /locus_tag="KLMA_30555"
                     /product="conserved hypothetical transmembrane protein"
                     /transcript_id="XM_022819080.1"
                     /db_xref="GeneID:34715826"
     CDS             complement(1190736..1190912)
                     /locus_tag="KLMA_30555"
                     /codon_start=1
                     /product="conserved hypothetical transmembrane protein"
                     /protein_id="XP_022675682.1"
                     /db_xref="GeneID:34715826"
                     /translation="MKFSTTFALISAAMVSVASAKDNSSNGSSTNAAPGAAVNAVGSS
                     LAGAAVAGAIAFLM"
     gene            complement(<1192739..>1194442)
                     /gene="GAD1"
                     /locus_tag="KLMA_30556"
                     /db_xref="GeneID:34715827"
     mRNA            complement(<1192739..>1194442)
                     /gene="GAD1"
                     /locus_tag="KLMA_30556"
                     /product="glutamate decarboxylase"
                     /transcript_id="XM_022819081.1"
                     /db_xref="GeneID:34715827"
     CDS             complement(1192739..1194442)
                     /gene="GAD1"
                     /locus_tag="KLMA_30556"
                     /codon_start=1
                     /product="glutamate decarboxylase"
                     /protein_id="XP_022675683.1"
                     /db_xref="GeneID:34715827"
                     /translation="MLHKELDVEESKRFFHHSHGPMKGDPDGFGLLPDGSRVQSVKDT
                     RVDKYSVPNKGLHDENVYNLIKNELRLDGNPVLNLASFVNTFTDDFAQRLIDENLNKN
                     LADNDEYPQLIHMNERCIAMLARLWQADTTRDKPLGCATTGSSEAIMLGGLAMKRQWE
                     KKMKAAQKPITKPNIVMSSACQVALEKFARYFDVECRLVPVDTEYGYHLNPNKLWDYV
                     NENTIGIFVILGTTYTGHLENVEEVGKVLDQIEAQNPEWSNKNIPIHVDGASGGFIVP
                     FAFTESQMAKYGLGRWGFNHPRVVSINTSGHKFGLTTPGLGWIVWKNDEYLLPELRFK
                     LKYLGGIEETFNLNFSRPGFQVIHQYYNFLTLGKQGYYEKFNQSIFVARSFAWKLLRD
                     PDLKDIFEVVSCLHEKMNSSTIANSIDDYWESPHQFKPGIPLCAFKLSEKFKAEHPEI
                     PQSIISTLLRQKGWIIPNYPLPQSTDGSDKKEVLRVVFRIEMKLDMCLLLVQDIFAII
                     EKLIKSYEYLNIHSTNNNHAVFKILSTLSNADMDAVIQDLSEIEIEKQKHVKKNYRGT
                     C"
     gene            complement(<1195134..>1196225)
                     /gene="SPE2"
                     /locus_tag="KLMA_30557"
                     /db_xref="GeneID:34715828"
     mRNA            complement(<1195134..>1196225)
                     /gene="SPE2"
                     /locus_tag="KLMA_30557"
                     /product="S-adenosylmethionine decarboxylase proenzyme"
                     /transcript_id="XM_022819082.1"
                     /db_xref="GeneID:34715828"
     CDS             complement(1195134..1196225)
                     /gene="SPE2"
                     /locus_tag="KLMA_30557"
                     /codon_start=1
                     /product="S-adenosylmethionine decarboxylase proenzyme"
                     /protein_id="XP_022675684.1"
                     /db_xref="GeneID:34715828"
                     /translation="MVEEPIEFEGPEKLLEIWFYPKKTKVPHAEKSLRSIGYDKWEEL
                     LKLVKCEILSTISTDEMDCFLLSESSMFVFDHKLMLKTCGTTTTLLCLPKLFELIRDE
                     LQWNFQCEDGVLNHPYKVFYSRRAFMFPQSQRSIHRSWSEECNYLDKFFVSGKSYVIG
                     RVEQNDHWNLYVTKTNKDLCTEANDDCEEDFTLEMLMTGLDNNQSQQFVTKEPREIDG
                     HVIGNKMTKAASIDQIYKFDTSKINFNIDSFGFQPCGYSCNAVVDQSYYYTIHVTPEQ
                     DWSYASFESNVILHNIKSTSTKFDVVNKVLGIFQPLDFCMTIFIKANAVECVDIDFPC
                     SKVANYRKEDKIVHDLDDYQLIYIRYTKI"
     gene            <1198026..>1198649
                     /gene="HSH49"
                     /locus_tag="KLMA_30558"
                     /db_xref="GeneID:34715829"
     mRNA            <1198026..>1198649
                     /gene="HSH49"
                     /locus_tag="KLMA_30558"
                     /product="protein HSH49"
                     /transcript_id="XM_022819083.1"
                     /db_xref="GeneID:34715829"
     CDS             1198026..1198649
                     /gene="HSH49"
                     /locus_tag="KLMA_30558"
                     /codon_start=1
                     /product="protein HSH49"
                     /protein_id="XP_022675685.1"
                     /db_xref="GeneID:34715829"
                     /translation="MNTVYVGNLDPKVNRALLYELFVQVGPISYIKFPKEKTNDDDSS
                     EHMNMKYAFIKFVNDDVDYACKIYDSKVSLYGKPLKVRRSNKQTEVSDFDVGAKLFVK
                     NLDESISLSQLINIFNKFGKLLKKPEIFYLQSGTLRCAYVWFTTFKNSDEALHQLNGT
                     TLANREIYVDYAYKDDKQRTAKHGDDVERLLDAERSKNFTLLNQKDL"
     gene            complement(<1198655..>1200010)
                     /gene="GNT1-B"
                     /locus_tag="KLMA_30559"
                     /db_xref="GeneID:34715830"
     mRNA            complement(<1198655..>1200010)
                     /gene="GNT1-B"
                     /locus_tag="KLMA_30559"
                     /product="glucose N-acetyltransferase 1-B"
                     /transcript_id="XM_022819084.1"
                     /db_xref="GeneID:34715830"
     CDS             complement(1198655..1200010)
                     /gene="GNT1-B"
                     /locus_tag="KLMA_30559"
                     /codon_start=1
                     /product="glucose N-acetyltransferase 1-B"
                     /protein_id="XP_022675686.1"
                     /db_xref="GeneID:34715830"
                     /translation="MMLKRKIRLILLVILIFLGITLSVDGIMKFQLNKKVDYYLKFFD
                     KNKDKIDNMYDPLNIKQIPFSAIDQLFKKRSSETKPIEWDKYAYVNYVTDSNYLCNTL
                     LQFTKLRDAGSEADLVALITTSLLKKANENESLGLLLQKIKGVSDRVKVQEIEPVVQP
                     NDHTPWSKSLTKLAIFNLTDYERIIYMDNDAMIHDKMDELFFLPSYVKFAAPISYWFV
                     NPEGLATARTDIKKLYKNNKLDPIEKKIISRVKNSLPIYNHLPNLPQHFYSKSMNFII
                     DIDGFQKSDNKVKFATHFMVIKPDADLANNIRDNILPKYVKAKESYDMDLINDELYNF
                     KELIYYQFKIFRKVQHLFEPSVLVLPYTKYGLLTGSINDKRSQEILKNGIIGYDRAES
                     DSIKDAKFIHFSDYPLSKPWLYSSTDDIQCKHDGYSEEMCKYWKSLYSEYLEKSAMCG
                     V"
     gene            complement(<1200299..>1204861)
                     /gene="RKR1"
                     /locus_tag="KLMA_30560"
                     /db_xref="GeneID:34715831"
     mRNA            complement(<1200299..>1204861)
                     /gene="RKR1"
                     /locus_tag="KLMA_30560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819086.1"
                     /db_xref="GeneID:34715831"
     CDS             complement(1200299..1204861)
                     /gene="RKR1"
                     /locus_tag="KLMA_30560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675687.1"
                     /db_xref="GeneID:34715831"
                     /translation="MSFGSASYTDSLKGLGLGYNGLKVSLNYFDGLPVLQNIQNPELQ
                     IIFKSLLKRDNITKEKALNELLSLVKDDDKYSIFYDDIVVLSWCQMYAKLISSDSKII
                     RSQSHHFTSMLISRLKKSAAKFLKEMVPLMLSGIYDYDIAVSKSCNDYLLECFGSSEK
                     VDSLWNLFSTETLNFIKEVILVESPTTISEEKYSSKQNVELRYNQLLLSSIRVLTKLI
                     STVDISSEKMEILHNIVSEKHLWSNLSLQDTKETSIFQALLHLMVQLRSKQLFRKNKE
                     ALKISSKNLLNSLSQVKARSLISLSSILPDILITLLDMNKYKDGKFWSYEKSSKEHLK
                     HFLSLGSGISNPIYYNLVYQLSLECSLLVFNEWVLIWQNFLKQEGERRILGRNGYKPL
                     VEAWKYYIRFMDSISTLDDDCKMQQELEVTLLLNNKNLKEIPELIELLIKSHWDYAFL
                     YEEILRLLPSGKEDRRKELLFISNACTILCETDISLIHQICSNIIDTLEANDQVDLTS
                     YYGFNIFDQLIKASKTDIANDIELFVKLLPTLVTVEFHEIPMKIMIDYCNTNFLTSHT
                     WVEYLDDFILALSQLDLPLRQVLSFLDKLDNTIIETLLNSSQALNDLINDYVSNYKFE
                     DGLIFKSKLLTAPLLLSLYEASKKQNKNAMFNKFVTELPESSIAYRNLLTESDFFYES
                     LMLDNDFKIPHIVHTDEKIANRFVTSLTDTTLTEYLSGNEKIEEFVKQLSKDSLVTKK
                     LLNLDFDSVFFSYIKELNPSTTLSAPFGLLPLALSQKGTPTADSYFGLIKLSQVVDSL
                     LTLYPDESTTSNVIFLTRCYEVMIDYNSLFDQQFTYFHKNTLYSRDLKIDFKDLLKCI
                     FSEHNIDELGNIFDDKDNEVICFYNCRITYRISLNSIDYLSASQFEEAFESIEKKARK
                     LLSSKILDVSSTLSLFAVICAAVKFNKSSNKLGVLRNYILSELVGVDNPSLDELKRFK
                     TLLLFLIQLLTFSQEDVETYQVEERRLNMALLSISKWMQSEQWYDDCYNEIRIIVLGF
                     FEKLQHLANKLDLSERIEESTIQLLQDSIGFLEIEETPYYDLLRYEVFSLLNSVQNTI
                     SIWSIFDLSTIVDIAFKNMIENSRVSNAYCNPLSKILKSLPTKEKTKIFDDLISVFFD
                     PKLPLILMNVLLNELKSIIKEQQEELVVEYELSKASSANLIDEDRTSPNAITVEIPPL
                     LIESLKSRMPHDYLEYQDLNSFMRYLNYCQVLIFYFDDVSYDIRQKYIQQLKEQDLIN
                     GLLDFLTDQMTLSYTKYWDTIDISDALAYPNSVDRGKLEPVDECNIMMEFLLYKFFTI
                     FGSLVGQWWNNIKSRSFKDTVSNFVTRYISSKLIENELERTKLGLQKFDKNDLNLSIK
                     VNKNNNEIKACYLIDDHKLEVAFKLPSNYPLQNVQVHGVSRVGVTEQQWKSWIISTQR
                     IISNMNGSVVDSLELLSKNVKLQFSGFEECAICYFIIHAIDGKLPTKICPTCNNRFHG
                     ACLYKWFKSSGNNTCPLCRGEFNLRK"
     gene            <1205438..>1205986
                     /gene="SBA1"
                     /locus_tag="KLMA_30561"
                     /db_xref="GeneID:34715832"
     mRNA            <1205438..>1205986
                     /gene="SBA1"
                     /locus_tag="KLMA_30561"
                     /product="co-chaperone protein SBA1"
                     /transcript_id="XM_022819087.1"
                     /db_xref="GeneID:34715832"
     CDS             1205438..1205986
                     /gene="SBA1"
                     /locus_tag="KLMA_30561"
                     /codon_start=1
                     /product="co-chaperone protein SBA1"
                     /protein_id="XP_022675688.1"
                     /db_xref="GeneID:34715832"
                     /translation="MSVHTPEVLWAQRSSADDASKNLLFITINIPDCTNPKLELTENS
                     LEFSALSKYHSENGIKYHLHIDFYKPIDTEASEKKVANGRNYFLLLRKKDLDAEYWPR
                     LTKEKLKYHYIKTDFDKWVDEDEQEEHLEADNDLMSQFSQMGGAGFPGMDQGGDFNPA
                     DFGDSESEDGDDAEEEDESKTA"
     gene            complement(<1206197..>1207087)
                     /locus_tag="KLMA_30562"
                     /db_xref="GeneID:34715833"
     mRNA            complement(<1206197..>1207087)
                     /locus_tag="KLMA_30562"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819088.1"
                     /db_xref="GeneID:34715833"
     CDS             complement(1206197..1207087)
                     /locus_tag="KLMA_30562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675689.1"
                     /db_xref="GeneID:34715833"
                     /translation="MPIEESPTEVILTHPEDSSTKVKILKYGATVFSWELKGEEQLWL
                     STAAKLDGSKPVRGGIPLVFPVFGKNHDDEHLSKLPQHGLARNSVWEFLGQTKAEPLT
                     VQFGLGPEFANPELTKLWPFEYSLILSVELGKEYLKTEIEVLNTSNTETLKFNWLFHT
                     YLKIHDIEDTLVSNLNSSKLYDQMLKESYVDKQPVVTVHEELDRIYQNVEEDRLIQVV
                     DKGHPVHTLKRHNLPDTVVWNPWIEKSKGMGDFEPKDGYKTMICIEPGHVHDFVKLPP
                     GEKWVASQVLYKDELKFQSV"
     gene            complement(<1207517..>1209178)
                     /gene="PRR1"
                     /locus_tag="KLMA_30563"
                     /db_xref="GeneID:34715834"
     mRNA            complement(<1207517..>1209178)
                     /gene="PRR1"
                     /locus_tag="KLMA_30563"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819089.1"
                     /db_xref="GeneID:34715834"
     CDS             complement(1207517..1209178)
                     /gene="PRR1"
                     /locus_tag="KLMA_30563"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675690.1"
                     /db_xref="GeneID:34715834"
                     /translation="MEEAQTLSETGTQLPLSETPKLEQGEFPGAHKKEQLSRIESKFN
                     NRDRGGNDVDMLPTPTGRVFESPVRANTSRSPTSESMIQIQKRRTQVPQAKTEKELLD
                     SNNVSNQYIFNQRENILDRELSKLGTYANLDAEQNLKGRILSEYIPNNSLQPGSAGQR
                     SISLTGENDVLNLEKPNLKKEVIVETVETIELSPPPSSTRPDENELADGTLIKGYLVN
                     SKERKSYYWRKVVEIGSGNFSTVFLYENADDIPGAEASSPELKQVAVKHIKYPQELLS
                     SSSPNSPKYKELLSRVESSLKRELTTLISLDHPCIVKLFGINDTAFITEDRPLCGRRK
                     LSALPRCDMVMSFCAGGDLFDLASKSKIPDWLLTRILAELSMAIKYLHDNLVIHRDIK
                     LENILLRYRLADMLSLHENPEQLNSQNLIELADFGLCKKISPDEMCTTRCGSEDYVSP
                     EILLGLPYDGRLSDCWAFGVIGYALLEDRLPFDPIPGQSSRRTRSIAHRIARCDWKWL
                     KVSEIEHPAKEIVNHTLVRKSERWTINQIYDTPYIHDVVETLNFV"
     gene            complement(<1209811..>1210884)
                     /gene="APN1"
                     /locus_tag="KLMA_30564"
                     /db_xref="GeneID:34715835"
     mRNA            complement(<1209811..>1210884)
                     /gene="APN1"
                     /locus_tag="KLMA_30564"
                     /product="DNA-(apurinic or apyrimidinic site) lyase 1"
                     /transcript_id="XM_022819090.1"
                     /db_xref="GeneID:34715835"
     CDS             complement(1209811..1210884)
                     /gene="APN1"
                     /locus_tag="KLMA_30564"
                     /codon_start=1
                     /product="DNA-(apurinic or apyrimidinic site) lyase 1"
                     /protein_id="XP_022675691.1"
                     /db_xref="GeneID:34715835"
                     /translation="MSFVRSTTSKFKFGAHVSGAGGISNSVSNANAIGCNSFAMFLKS
                     PRQWVSKPYPEKEISKFKENCEKFNYNPLTDILPHGSYFINLANPDQEKAEKAYGAFI
                     DDLIRCEQLGIGHYNFHPGSSLDGDHQEQLKQLAKYINKAIKETSFVNIVLENMAGHG
                     NLIGSDLHDLQIVIDMVEDKTRVGVCVDTCHTYAAGYDISSQESFDRFWKEFDEIVGM
                     KYLKAIHLNDSKAPLAANADRHELLGQGYLGLAFFNIIAHSEFLQGIPIVLETPQKDD
                     NGYGEEIKLLEWLENLQKQENDKEYVEKCATLSKLGEKSRKEFQAKLDKKQKTAKGKA
                     KTTATKRKGPSITEQLTAKKPKK"
     gene            complement(<1211196..>1212341)
                     /gene="FEN1"
                     /locus_tag="KLMA_30565"
                     /db_xref="GeneID:34715836"
     mRNA            complement(<1211196..>1212341)
                     /gene="FEN1"
                     /locus_tag="KLMA_30565"
                     /product="structure-specific endonuclease RAD27"
                     /transcript_id="XM_022819091.1"
                     /db_xref="GeneID:34715836"
     CDS             complement(1211196..1212341)
                     /gene="FEN1"
                     /locus_tag="KLMA_30565"
                     /codon_start=1
                     /product="structure-specific endonuclease RAD27"
                     /protein_id="XP_022675692.1"
                     /db_xref="GeneID:34715836"
                     /translation="MGIKNLASLISEQVPNAIKNRDIKYFHGRKVAIDASMSLYQFLI
                     AVRQQDGVQLAGEDGETTSHLMGMFYRTLRMIDHGIKPCYVFDGKPPELKKYELDKRK
                     VRREDTEAKLKEATEQAEIIKHERRLVKVLPWHNEEAQKLLSLMGIPYVVAPAEAEAQ
                     CAELAKSGKVYAAASEDMDTLCYQTPVLLRHLTFSEARKLPIQEFDTDVIYNTLDLTQ
                     SQFIDLGIILGCDYCEGIKGVGPVNALKLIKEHGSLENIVEKFENGEISNGRWKIPEE
                     WQYKEARALFMEPDVIPSDQITLKWEEPKADELIEFMVKEKGFNEDRIKSGIERLRKG
                     LKVGVQKRLDSFFKIQPKTKEELAAAAQKAKDAKKKAAAKGKIGKRR"
     gene            <1213389..>1214564
                     /gene="ABF1"
                     /locus_tag="KLMA_30566"
                     /db_xref="GeneID:34715837"
     mRNA            <1213389..>1214564
                     /gene="ABF1"
                     /locus_tag="KLMA_30566"
                     /product="transcription factor BAF1"
                     /transcript_id="XM_022819092.1"
                     /db_xref="GeneID:34715837"
     CDS             1213389..1214564
                     /gene="ABF1"
                     /locus_tag="KLMA_30566"
                     /codon_start=1
                     /product="transcription factor BAF1"
                     /protein_id="XP_022675693.1"
                     /db_xref="GeneID:34715837"
                     /translation="MHAHHHHHHQNGHTNGHGNSGDDVSEQEAQQDDEDDDAAVTAAI
                     AAAVAAVADSQETIKGPFAVTKIEPYHNHPLESNLSLQRFVLTKIPKILQVDLKFDAI
                     LESLCNDEDNTVAKFRVAQYVEESGIIDIIKQRYGLTDAEMDKKMLSNIARRVTTYKA
                     RFVLKRKKEGVYMLPNGHQISGADQHQHQLQHQHQHQHQHQHQHQHQHQSQDQHQNQH
                     QQHVGNDNHVYQDRIHSQSDQDEAGVHNLDDNNVRVAAAAAAAAAAALQSRDSHVSEE
                     LKRTLEQVQDEDGIEDDNHSSKRQLHRSDRDRVAEALKMATRDILSNQNVDSDVNVDV
                     DLVTGHKQLSPHDDMAEQLRLLSSHLKEVEAEENVSDSNLKKDDVQDENIQPELRGQ"
     gene            <1214854..>1216557
                     /gene="ATP25"
                     /locus_tag="KLMA_30567"
                     /db_xref="GeneID:34715838"
     mRNA            <1214854..>1216557
                     /gene="ATP25"
                     /locus_tag="KLMA_30567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819093.1"
                     /db_xref="GeneID:34715838"
     CDS             1214854..1216557
                     /gene="ATP25"
                     /locus_tag="KLMA_30567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675694.1"
                     /db_xref="GeneID:34715838"
                     /translation="MLRPVSALLRYKLGYICRRTGPSLLYRNFSKTCLVTQENKPWYL
                     NVPEVKDTDNSSPFITPITFPSTPVPHSVKIISEHLNDKLAVTNIIVFDTAHSNTTTS
                     IHSMAKYVIIGTVRSFRHLQSCNDELVKFVKAEFGCIPKSEGLITSGILKKRQRRINR
                     KTNIGKVTKKEQDESGWCLIASNVDGVFINIMTEERRNELNLEELYCPPEDMEQYQKK
                     QQEQQAKSFVDEEDNVLLGLRKLMMKNTRRYYSTAAKNSTSVTLEEALTIQDLKAASN
                     LLQQEPKPYLTITSVLGSLPTLIEIDTKGWVELFNQATSTQHHLDEEYWSSRFKFFQL
                     LYLSKTNNLLNSEQRKNGDVISLNQELNYFINDFFRFKQAMLYQPTREELIKFIQICN
                     HYINMQPNYNGLMSANFWITRALKSYQYNDPEAVHDPRVVRLLLSSMHKGTSNLNALY
                     EYIHLITNEFKLNHLSDNIIKEIIGALVETANWAVLFRFWNHCLIEFGGDSGLWAFFL
                     KSLLEKNDPYILAQLMEKGNLIWIYRAKVEINPELKKVLVELFDKFDNRYTNLKTLLN
                     L"
     gene            complement(<1216602..>1217540)
                     /gene="KTI12"
                     /locus_tag="KLMA_30568"
                     /db_xref="GeneID:34715839"
     mRNA            complement(<1216602..>1217540)
                     /gene="KTI12"
                     /locus_tag="KLMA_30568"
                     /product="protein KTI12"
                     /transcript_id="XM_022819094.1"
                     /db_xref="GeneID:34715839"
     CDS             complement(1216602..1217540)
                     /gene="KTI12"
                     /locus_tag="KLMA_30568"
                     /codon_start=1
                     /product="protein KTI12"
                     /protein_id="XP_022675695.1"
                     /db_xref="GeneID:34715839"
                     /translation="MPLVLLTGFPSSGKTTVAKKIVSLIQQTIDSNEKLSNYSVVYHS
                     DETLNISHDDYIGSNEERRARSKIMSVVKRDLSRQKVVVVDSLNYIKGFRYQLHCEVK
                     NVMTTYCLIHTACPITTLVEWNSKETETHTPWEPEFLNALIQRYEEPNPQTRWDSPLF
                     TILTPQDDVSAIYEDISKALFPTVFKSKTDDRDAEKILQQLKPNNATILKAASHTNSL
                     QILDSETSAVVKSIMEYMQHNVVSGGISRIILTPDHSDIDDPACLYVDVSLQNCTMPQ
                     LQRIRRQFVAMNRLRNLEADRVKPLFVEYLNKNLNI"
     gene            <1217890..>1219038
                     /gene="MTG1"
                     /locus_tag="KLMA_30569"
                     /db_xref="GeneID:34715840"
     mRNA            <1217890..>1219038
                     /gene="MTG1"
                     /locus_tag="KLMA_30569"
                     /product="mitochondrial GTPase 1"
                     /transcript_id="XM_022819095.1"
                     /db_xref="GeneID:34715840"
     CDS             1217890..1219038
                     /gene="MTG1"
                     /locus_tag="KLMA_30569"
                     /codon_start=1
                     /product="mitochondrial GTPase 1"
                     /protein_id="XP_022675696.1"
                     /db_xref="GeneID:34715840"
                     /translation="MQLSYSRVIKRCQSSFVPRMVFPDFNIPTTDFKGHQMKAIQRSQ
                     NLLPQLNLLVELRDSRAPIATRNLIFDYLSMEKKVERLVVYTKTDQYDPVIKDSLDKW
                     HKEVGEDYIMIDARSKKGSEDLLHILKWKYDQFIIKEDPAKKAVGLPLGYRILIGGMP
                     NVGKSTLVNSLRFTGYNKLTSLDGSKPKKVAKTGGQAGVTRSTSECIRISDHKGGIFL
                     YDTPGISLPGKAMSKQRMLSLSLCGCVKSNLVDPVIQADYLLYLLNLQGKFQMYSRYT
                     NRPTNNIDVLLNGIRRKVGMTNENAAAIYWTDAWRQGRILKSGFKSGSKKTNGSLSAL
                     FELEPLLDTFQYKKTMEEELEILKGWDILSRPNFNKKEKHLSKANKLF"
     gene            complement(<1219346..>1221709)
                     /gene="SET3"
                     /locus_tag="KLMA_30570"
                     /db_xref="GeneID:34715841"
     mRNA            complement(<1219346..>1221709)
                     /gene="SET3"
                     /locus_tag="KLMA_30570"
                     /product="SET domain-containing protein 3"
                     /transcript_id="XM_022819097.1"
                     /db_xref="GeneID:34715841"
     CDS             complement(1219346..1221709)
                     /gene="SET3"
                     /locus_tag="KLMA_30570"
                     /codon_start=1
                     /product="SET domain-containing protein 3"
                     /protein_id="XP_022675697.1"
                     /db_xref="GeneID:34715841"
                     /translation="MSEKGPPENAHDQSLLDDASTLLMFSKRTNSVGSTSDESKDDVK
                     SEIRTHRMTPTSSLNQRDNGMNLHVNTLASPGPASVALVNDEDEEETLRSNNGKDRRD
                     SGDKSKKNGSKKGMVAAAALAQAATVPLPLKRKAESNDSTLKPDSKGKINEHEISALT
                     SGTEKAKTEKPETKTIVEAEKDKSESDRFASVPKSYIVDPDDGVITCICGFNDDDGFT
                     IQCDHCFRWQHAICYGIEDERDAPDDFLCNICNPRVVDVKMAKRKQQERIRNIQNRKR
                     RRVPNNGNKNGNTTSTSMEEVNRKESTSNSKETRNGSVPDLQDQRAELTKAVTSTDPL
                     TNIVLINTKDAYPAVYLPLERNDYKDKYTERFVKDHSNDDWVLPCLKPVFTPIPIEIK
                     SYSDASHSRVFPGYPKLGVYVKQNCHEGDYIEEFLGEVDFQRKYLEDPRNNYRVWGTA
                     KPKVIFHPHWPIYIDARLSGNLTRYLRRSCNPNVELATIKVSNGKGEYEVKFVLRALR
                     PINKGDEIHIKWDWDLRHPIWKLINQNENIDSIEEPKKYWLIHSVDTVLGSCDCACGN
                     NNKDCYLLKVKRYSQSLFRSVKSKMNNRYKLNEILHGNKLEMKKQTPILCKLAHAAIS
                     DAARASEVLLKFNATKLKVLEEQDHQLDKKTPLLENATNIRGKKYRVSKTKKQTGSSP
                     MKSIISSTEGPFSFNETKVKNPADLAIPISLTITEEKSFSTQDVATHPEEITVDRASS
                     SQNNSIHHTNTLKHRASSQSSSPNTNPHSQMKKKLSFADYKKKIKPA"
     gene            complement(<1222475..>1223797)
                     /gene="fap2"
                     /locus_tag="KLMA_30571"
                     /db_xref="GeneID:34715842"
     mRNA            complement(<1222475..>1223797)
                     /gene="fap2"
                     /locus_tag="KLMA_30571"
                     /product="L-saccharopine oxidase"
                     /transcript_id="XM_022819098.1"
                     /db_xref="GeneID:34715842"
     CDS             complement(1222475..1223797)
                     /gene="fap2"
                     /locus_tag="KLMA_30571"
                     /codon_start=1
                     /product="L-saccharopine oxidase"
                     /protein_id="XP_022675698.1"
                     /db_xref="GeneID:34715842"
                     /translation="MSGYEVVIVGGGVFGLSSAVQLARTNYKVIVIDKFPIPSPLSAA
                     NDYNKIVRLEYNDMVYAELAVEAMGYWNGEDSSLLPARLLHDCYSHCGRISVVQDPKT
                     RRYAFDESSLRLLQEKFSRCRDVKEFKDLTCGGKFPQLSDGQRYDIFRYNPDCGIGFA
                     RESLLKMKRYAESLGVVFQENDGVVEVEKFRDGSQSVVVRCESGKRIHGKKVVIACGA
                     NTSAILPMQRYVKATGLYVGHVQLSDEEYQKFKDIPVIFNSSVGYIFPPDAQTKMIKI
                     CTSAMSAYDGKSNGSYPVYRTLEPHTAPSIPISAAVRIRTVLGKYLPSLVFTSGTQSQ
                     LRDIIDCKICWVSDTANSDFIIDEVPGMSNVYVCCGDSGHAYKFLPNIGKYIQQKLEN
                     KLPEPLARKWSFREANWNDAEIEWRVEPTKLAIQDVEWFKESYGHAKL"
     gene            complement(<1224476..>1226833)
                     /gene="IME2"
                     /locus_tag="KLMA_30572"
                     /db_xref="GeneID:34715843"
     mRNA            complement(<1224476..>1226833)
                     /gene="IME2"
                     /locus_tag="KLMA_30572"
                     /product="meiosis induction protein kinase IME2/SME1"
                     /transcript_id="XM_022819099.1"
                     /db_xref="GeneID:34715843"
     CDS             complement(1224476..1226833)
                     /gene="IME2"
                     /locus_tag="KLMA_30572"
                     /codon_start=1
                     /product="meiosis induction protein kinase IME2/SME1"
                     /protein_id="XP_022675699.1"
                     /db_xref="GeneID:34715843"
                     /translation="MPGLKLQPADSFVPPDVNNPPFYIPLKNIDSRYNVIQELGKGSF
                     GSVTLAETLFDMKKSSQEISSMYPETLMDQCLIRNVEQENWYYKKKGIVAIKTMMNRL
                     STLHDYTRVREIKFILQIPAHKNLVTVYEMFIDDSLYHLHIVMECMEQNIYQLMNHRK
                     RRVFSLPTLRSILFQILAGIKHIHDHDFFHRDIKPENILISPSHRYFSKKWLEDDNYP
                     DNYVVKLADYGLARHVNNRSPYTTYVSTRWYRSPEILLRKGYYSKPLDIWAYGCVVVE
                     LATFSPLFPGSDETDQIWRILDLLGSPDHSTNGKEHFGGTWPDCKSLYQALNYEFPYV
                     EGKTIRDVLPNPQLEDLYDVVTSCLKWNPNDRASANELCALPYFKEYVIKEAKMAKAD
                     GGDISNGKEGSMIASKLGINSLASNQWSRILSGLPPKADIGIVPNFNNPQKALKIEKV
                     NHSILSQEQQQHQKEQQQKRSGVASWFKFSTNKNHVNVNPNEKAYGKALLTDAIDENN
                     SNKNRRIDERLSGEIPQLQQKQQLHDHKHTNHHHHHHHHHNQQQQQQQQEHVDILAGH
                     NDRMDELNIINHANNDNEVFTIELDDSMETMTGSQQISKELNEKVELYQESSNSQLEI
                     DNGDLDINDVSDAVQMDQENYRIHVLNEYDTDENLADEIQAIDEDENTDNIVRNSQDL
                     ENDEDDDPDSLLNYYQEMMAKKLPPNGTKGHYTHSNGVCPTLSDRMAIDDSIDLQEQI
                     PRNLLERAVQQRVLDCLLDSSEQISQNLIQNSNSHNHSIHDGLSF"
     gene            <1230748..>1233657
                     /locus_tag="KLMA_30573"
                     /db_xref="GeneID:34715844"
     mRNA            <1230748..>1233657
                     /locus_tag="KLMA_30573"
                     /product="conserved hypothetical transmembrane protein"
                     /transcript_id="XM_022819100.1"
                     /db_xref="GeneID:34715844"
     CDS             1230748..1233657
                     /locus_tag="KLMA_30573"
                     /codon_start=1
                     /product="conserved hypothetical transmembrane protein"
                     /protein_id="XP_022675700.1"
                     /db_xref="GeneID:34715844"
                     /translation="MSSNPNERFGFGLLRKKQPKQKRQGRNETNEDGSESSDGYSDLD
                     ADYVSSSNLNLPSFRPSGKSTDELRGSGSRGPSRNLSPSDSGQGHLKTDDLNQRRQMI
                     EDDAIATIRDNSGADRCFDDVDDTESEASAHGSAASPVSSPSRSKRLQFKSRPSIIPE
                     EVVAPDEKDYTYEEKDNDDKTPMHEQDDTVSTQSSETKMDHFRNLFRRRSTIRGPSSE
                     TRPRRSSTARRGSIGMRNLSGGIEDDEANEGFLQKFLNMTGGGLVPGVTGGEAPAEDD
                     HERVSGQQNLEDPLPMEDIDAAAQQIVQAHSNMAKRNPSVSQGISGGSYSVAGHADPG
                     SPQRPTNGAERYQDPESIDPHDPITRKVSNSSDPLATPHGAVSPFDQSADGATMVSSD
                     HNDAFYVPAMGHYDDIDDQEDMEPLMVEGSYIAPANRVRGGVLGSLLKLYQNPDDMAS
                     KSQVSLNESSIEQTPDPGDQNDASGAASKKNFNPFHKKTKSQTTLADGEKPSADNNLP
                     NFKATRPKPKMKAAKFKKKQATEARITVHIADLLQRQRFILRLCKALMLYGAPTHRLE
                     EYMVMTSRVLEIDGQFLYVPGCMIISFGDMTTRTSEVQLVRCNQGLNLWKLHGVHSVY
                     KQVVHDIMSVEDANIEIDRILNGKNLYPPWVSVFLYGFCSSMVTPFAFGGDWVNMAVA
                     FGIGLCVGLLQFIVSQKSNLYSNVFEITASIVVSFCGRALGSIPNSNICFGASVQGSL
                     ALILPGYIILCGSLELQSRNLVAGAVRMFYAIIYSLFLGFGITLGAALFGWLYHGASN
                     ETTCAKSISPWYRFIFVPCFSIGLGLINQARWSQLPVMTFISCCGYVVTYFSGKHFAN
                     STEFTSSLAAFVIGIMGNLYSRIWKGLAVSAMLPAIFVQVPSGVASQSSLLAGVQSAN
                     AIVHNGTTTVVQNTGSSTSFGITMIQVSIGISVGLFASTLFVYPFGKKRTVLFTL"
     gene            <1234078..>1234947
                     /gene="MPD2"
                     /locus_tag="KLMA_30574"
                     /db_xref="GeneID:34715845"
     mRNA            <1234078..>1234947
                     /gene="MPD2"
                     /locus_tag="KLMA_30574"
                     /product="protein disulfide isomerase MPD2"
                     /transcript_id="XM_022819101.1"
                     /db_xref="GeneID:34715845"
     CDS             1234078..1234947
                     /gene="MPD2"
                     /locus_tag="KLMA_30574"
                     /codon_start=1
                     /product="protein disulfide isomerase MPD2"
                     /protein_id="XP_022675701.1"
                     /db_xref="GeneID:34715845"
                     /translation="MKLPLFLLFLIASVYAVVESVTSLDQFYDKVNDFDPTNPRYVVV
                     KYYTNWCHHCKKLKPVFEQLSESPVLDQMPVIDPALTKGSQFTFFEVECELFGSVLCS
                     RLEGYPAVEVIKPLRAELDIKRGDEGKNWFGRVIHRILNGGLNPRWVLDSRRVVTFEG
                     NRDLDVFERFLERVVEQDQWERLVDVITSDECPAEDDLCKQGREYYLSMYDDAEYEKK
                     LEELEKEIAASTSVPKELTLKYQILNKIYELNHPTTFVEPEFDPVEAAMAAGMFKDDS
                     EPELNTQLRQDEL"
     gene            complement(<1235017..>1235940)
                     /gene="APD1"
                     /locus_tag="KLMA_30575"
                     /db_xref="GeneID:34715846"
     mRNA            complement(<1235017..>1235940)
                     /gene="APD1"
                     /locus_tag="KLMA_30575"
                     /product="actin patches distal protein 1"
                     /transcript_id="XM_022819102.1"
                     /db_xref="GeneID:34715846"
     CDS             complement(1235017..1235940)
                     /gene="APD1"
                     /locus_tag="KLMA_30575"
                     /codon_start=1
                     /product="actin patches distal protein 1"
                     /protein_id="XP_022675702.1"
                     /db_xref="GeneID:34715846"
                     /translation="MGVLDFFKSASKSQKDDAQTTAKIKEIIDICDPEQCSGGCTDSN
                     TLDKDEHVFANLKIEHETPLFGSSRSSKIHFVVPTSQSDWAHDACMEKKNSVQYNIQS
                     WISKNADQFTNIDSPGESLLCSVSSLPIDLLDIQVMKGTKNDVLIFPHFLRLKAVRSE
                     TVNDVLQEIVPLLLHNNREALLAKDYIQEITDDSFVFLCSHRTRDKRCGVTAPILEKH
                     FNKNFQRHGIYRDNSDFRPHGARVAFVNHVGGHKFAANVIIYLKKSAKLVWLGRVTPV
                     HVEAIVDCLVVPDEPKLPFPEMVRCVQQYQF"
     gene            <1237729..>1241151
                     /gene="HAL9"
                     /locus_tag="KLMA_30576"
                     /db_xref="GeneID:34715847"
     mRNA            <1237729..>1241151
                     /gene="HAL9"
                     /locus_tag="KLMA_30576"
                     /product="halotolerance protein 9"
                     /transcript_id="XM_022819103.1"
                     /db_xref="GeneID:34715847"
     CDS             1237729..1241151
                     /gene="HAL9"
                     /locus_tag="KLMA_30576"
                     /codon_start=1
                     /product="halotolerance protein 9"
                     /protein_id="XP_022675703.1"
                     /db_xref="GeneID:34715847"
                     /translation="MNNSNGEPDAGMASHKEDAGNAGVAGADFETTDQSMTRSTKKRV
                     SKACDRCRKRKIKCNDLDPVSGKCANCIKFKAACTFHYHEEMMRRNNMKSHSRRDKFN
                     TTAELNLKNTINNAVHGAASRRGGIVTDLDTPTPTVLSNASSSDGLGPSAAVSSGQMG
                     MGNMGDAVSNSMMSLANSQVPYIQYHNPVSSNMVYPSHAHYNGIPGQSHMVAQPPQPV
                     LAMSPVPPQQHMHMHQAHAHAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
                     AQTQTQTQGQHQHQHDLSGSVETPNSSHHYQHSQNKQHQHQHQHHHQQQQQQQQQLVG
                     SDIEDFDPPHQLAELAQKVEIVGRKMTVLLDWCGKMDWIGRQCEELLNKTERERELKE
                     SEENKSKLYAATKRYMSCQFTTNTLPELKAKVNPEMTKEEFTEPLRPIKALVSKWYFI
                     QMKRLSQNLLDENQLHPLPSPNKCRRIMEIYYNMLSSEDLNVIEPKACRKIFEKYFSS
                     GPKEISYSEHLIINTLMCLGSLYSRYSVLQSSHYRKDKIDFTPEKLFQIESDCYQNSL
                     YYYHKISLVSEGLHSIQGLLLFYTYIKASVSAEAALNVFVVAIKFARDLKLSCLDNFN
                     HLPREEFLQIRSIWLYCYLNDSALSLALSNPPIIHESDMSVSLGRNYFKTLRTSCPIS
                     NSPDGDVIQAVKSEGLLLETVKKNPWYFSVILNYYRATLCKISNKITRHLFSVDATST
                     MTFNEIVAKIIEIKDDLVEFSDNMPLYLVQDNQRTFLARIYHALTGTQTIVNFKLMSA
                     LITEIHIKREALFVILSNFAQAFLNDNKDLIEDNSRDDCHELWRFFEMNKVKSYKATL
                     NALKAIDFKDHTILHHKQHFLYDFFTVIISTAFYVIDNIDTSASFELLCLLKDLYYRV
                     TSGASAEEIHVHQDVKWLLSIFLLSFLLETASIHYKNKNTLSFSYPMDDDRYRMVMKE
                     ITTAFIRETEQVMTVYNKGRSPTEKESDTVTKTDKVPTWILLKLFDVVDLPEEDSLQN
                     WWDSKTKSEHESADIDDNSTSAAATTTVSTTAEDKDSNSPDTSMKLSETKNKQNTARE
                     YELGFNFNERWLPADMKFFGQDALSNTNSKNNFDFNFMQSSTLFEDINSLNR"
     gene            complement(<1241332..>1242348)
                     /gene="ARA1"
                     /locus_tag="KLMA_30577"
                     /db_xref="GeneID:34715848"
     mRNA            complement(<1241332..>1242348)
                     /gene="ARA1"
                     /locus_tag="KLMA_30577"
                     /product="D-arabinose dehydrogenase [NAD(P)+] heavy chain"
                     /transcript_id="XM_022819104.1"
                     /db_xref="GeneID:34715848"
     CDS             complement(1241332..1242348)
                     /gene="ARA1"
                     /locus_tag="KLMA_30577"
                     /codon_start=1
                     /product="D-arabinose dehydrogenase [NAD(P)+] heavy chain"
                     /protein_id="XP_022675704.1"
                     /db_xref="GeneID:34715848"
                     /translation="MKYTYNPPAMLHPLSTEIYFTFNNGNKVPAFGLGTAAQLNRVSE
                     TKQAVKAAVKAGYRHIDTAWAYGVEEYVGEALQELFEEGVVKREDLHITSKVWHTMWD
                     EVDRSLNESLKRLRLDYVDLFLQHWPLCSQKVHDPHFVDQTAKDPVDENGKPLYDERG
                     DWIQTYKDIEKIYLDPNDTRVRAIGVSNFPIEYLERVLNECKVVPVCNQVELHPHLPQ
                     RDLCDFCREHNILVTAYSPFGGNDAPLLNAPIIREMCAKYDATSNEILTSYHLRQGTI
                     VIPRSLNPTRIAANKSFIPLSEEDINKLNEFGKQNRKRLINSPTFAVIPSFKEDFIRD
                     QKQS"
     gene            complement(<1242808..>1245678)
                     /gene="MSH2"
                     /locus_tag="KLMA_30578"
                     /db_xref="GeneID:34715849"
     mRNA            complement(<1242808..>1245678)
                     /gene="MSH2"
                     /locus_tag="KLMA_30578"
                     /product="DNA mismatch repair protein MSH2"
                     /transcript_id="XM_022819105.1"
                     /db_xref="GeneID:34715849"
     CDS             complement(1242808..1245678)
                     /gene="MSH2"
                     /locus_tag="KLMA_30578"
                     /codon_start=1
                     /product="DNA mismatch repair protein MSH2"
                     /protein_id="XP_022675705.1"
                     /db_xref="GeneID:34715849"
                     /translation="MSSRPDLKFSDVAEERGFYKRFLQLPQKSANTLRLVDKSEYYIV
                     IGDDALFVADQVYHTSSVLKDCKIDPSTLRQFNVQGPLKYVTMSLQIVGNLLKMALMD
                     LGKKVEVYDKTWKLQRTASPGNIEQVDDLIVGSLETNIVLASLKFNFNGTGATNYCTI
                     AVSFIDNTNYRIGLFDLLDNEVFSNLESCLIQLGIKECLIPDLRDNPTMENDLKKILS
                     VIDRCSCVASFVKASDFNGKDVESDLAKLCGNELSLSVSKFSANALGACNVLLQYLNI
                     MSDETNLGNFEIVEHSLSQFVKLDASAIKALNVFPAGSQNTSATMSVGSSQKCTSLFQ
                     LLNKCKTNAGVRLLNEWLKQPLTDIEHINKRHDLVEFFMDQLELRSTLQEECLPSVPD
                     IRRLTKKLNKNGNLEDVLKIYQFAQTIPTITDLLKQTTDELGSEKIQTLVREILLEPL
                     LSNAEPLEKFKELVETTVDLEAYEETNEFMIKVEFNEQLSIIRKQLDQLKGDIRKIHL
                     EAADDLGFDPEKKLKLENHHLHGWCMRLTRNDAKSLRQHKKYIELSTVKAGIFFSTRD
                     LKHIAEETSELQKRYEQQQASLVKEIVSITLSYTPVLEKLSIVIAQLDILCSFAQVSS
                     YAPVPYVRPKMHSMHDPNRKTELIASRHPIVEMQDDVTFICNDVKLVQDESEFIIITG
                     PNMGGKSTYIRQIGVICLMAQIGCFVPCDEATVAVVDAILCRVGAGDSQLKGVSTFMM
                     EMLETASILKNATQNSLVIIDELGRGTSTYDGFGLAWSISEYIATSIKCFALFATHFH
                     ELTTLEDKLKNVSNMHVVAHIDDNGAHNSNDITLLYKVEPGSSDQSFGIHVAEVVQFP
                     NKIVNMAKRKAAELEELKSNSDSLKKLKLTSDQIVTGTDALKRSLKKWCDYLKDNQLT
                     ERLSDPAVQEECIDKLKTHIDDLSKEEGTSQTFVDWIRETLL"
     gene            complement(<1246197..>1248536)
                     /locus_tag="KLMA_30579"
                     /db_xref="GeneID:34715850"
     mRNA            complement(<1246197..>1248536)
                     /locus_tag="KLMA_30579"
                     /product="uncharacterized protein JIP4"
                     /transcript_id="XM_022819106.1"
                     /db_xref="GeneID:34715850"
     CDS             complement(1246197..1248536)
                     /locus_tag="KLMA_30579"
                     /codon_start=1
                     /product="uncharacterized protein JIP4"
                     /protein_id="XP_022675706.1"
                     /db_xref="GeneID:34715850"
                     /translation="MIEPVDPLYYRKVQFCLDGDGTGCDDKSGGSANSLVTLNGEKLV
                     PTVSWDTVPIEGSGADDEVDDYMSYEPLNLDSSMDYLYSGETELDYMKNPARSKNYLS
                     QAPTSRVRGSSPVRLGFGVASSAQQLDVGVRDTAAKIMIGPGGEIRRRDYPSRPILVS
                     NALIKSQYHKDWKKKWRKQVETVEYRIGKAQSEYFKYPEILFPEQKVDLTDAPVVNEN
                     GEVIEKRKRANLRRQLRVIRTPTGIAKTPRTVLVHISGRRHTWVALDWAINQLANDTD
                     YIVILANIPERMTSDRHRSLSRSRSRSASRSRSRSRSRMRSLSRNRDIRAGTGDDVIY
                     DDYDPSDDIWCDGYTVGEVNALLQRLIDYCTIIMGDRKVKLTIEIVVGSTSKVLINSL
                     NAYAPDFFVIGTPVDRDGSNNIVIHRCRHLSPVVMQNFPIPLFVVAARKMGWFELRLQ
                     REILLKQKQIQSSRVVPNINTSTNIDKLDGTSRQTDSSDEDEADNISHLSLDDMEKTV
                     NTIKQLRRRYRSLLEKKMGLLDVDSTLSTKQRHFEKIDSTINATLNFNKELESLGDAE
                     YVMQIRKTWTGGIRPRITKKKSMLDVSDVPRKKPSNVNPSTAPAINIAKVTKLSQQGD
                     KKKDLTPSSVSSRPSNANPAAIKFAHSVKPKDGMSAIQRIKTVEANNSELSPLERDLS
                     SISLVPVRSHQPKSESDSTLRKVMSTTSLDKKERKRSRLFTFLFGGNQNSSSVSDSNS
                     DLSPSLSFTSSRRGSMSSQSSGESKKKRGLYLFKKLDHI"
     gene            complement(<1249050..>1250962)
                     /gene="ARL8A"
                     /locus_tag="KLMA_30580"
                     /old_locus_tag="KLMA_30581"
                     /db_xref="GeneID:34715851"
     mRNA            complement(join(<1249050..1249940,1250504..>1250962))
                     /gene="ARL8A"
                     /locus_tag="KLMA_30580"
                     /old_locus_tag="KLMA_30581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819108.1"
                     /db_xref="GeneID:34715851"
     CDS             complement(join(1249050..1249940,1250504..1250962))
                     /gene="ARL8A"
                     /locus_tag="KLMA_30580"
                     /old_locus_tag="KLMA_30581"
                     /note="cd04159, Arl10-like subfamily"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675707.1"
                     /db_xref="GeneID:34715851"
                     /translation="MPAEEQSAQSIIAHMNKDHKLALEDFLYVYGKVPITEEISNVRM
                     QEFALDHMTITFEHSAIEFDVEKYIPIDPPLKDFSEARSRLVPMAKEAAAKRGFSHIR
                     INEISKPRTILEHLIIVLVLLPFVAYVHRGILEFLPLPQSVLDFIGKDVVLSYESAEL
                     GMDCFYHLWNKLREWFQYLGTQRRLSIAVIGLQNSGKTTFTNLLVGQEFETDTIPTLG
                     INIRETRLPNHTQLRIYDLAGQTRFQKLWERCFQEADLLVYMLDLSDLTNWESAKAKL
                     HDVIITTNIDHIPILVLGNKVDLLPKFQPDVQLEDTRNGTNSNSNSGAGTGVNISSTS
                     ATVFSNPSTAATTKKRRKSRSVEQSTRQQTWKYVSPLLHNYEFEDIPKYDLNTENQHV
                     LSKIEILSKELGIDLKHGLLHLPHDAKVKLNRDIALFSISCKDKTLLDPVIEWILEL"
     mRNA            complement(<1250321..>1250962)
                     /gene="ARL8A"
                     /locus_tag="KLMA_30580"
                     /old_locus_tag="KLMA_30581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819109.1"
                     /db_xref="GeneID:34715851"
     CDS             complement(1250321..1250962)
                     /gene="ARL8A"
                     /locus_tag="KLMA_30580"
                     /old_locus_tag="KLMA_30581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675708.1"
                     /db_xref="GeneID:34715851"
                     /translation="MPAEEQSAQSIIAHMNKDHKLALEDFLYVYGKVPITEEISNVRM
                     QEFALDHMTITFEHSAIEFDVEKYIPIDPPLKDFSEARSRLVPMAKEAAAKRGFSHIR
                     INEISKPRTILEHLIIVLVLLPFVAYVHRGILEFLPLPQSVLDFIGKDVVLVSVMIGA
                     SVCHAAEGYFLLRPKLNYYRVPTDYLVEWYFFCMLEGYGAVRRFDKLAYKRTH"
     gene            <1252290..>1254110
                     /gene="SNF1"
                     /locus_tag="KLMA_30582"
                     /db_xref="GeneID:34715852"
     mRNA            <1252290..>1254110
                     /gene="SNF1"
                     /locus_tag="KLMA_30582"
                     /product="carbon catabolite-derepressing protein kinase"
                     /transcript_id="XM_022819110.1"
                     /db_xref="GeneID:34715852"
     CDS             1252290..1254110
                     /gene="SNF1"
                     /locus_tag="KLMA_30582"
                     /codon_start=1
                     /product="carbon catabolite-derepressing protein kinase"
                     /protein_id="XP_022675709.1"
                     /db_xref="GeneID:34715852"
                     /translation="MSYQANQQPAQGQGHHQRHGTAHPQGQHIGKYQIIKTLGEGSFG
                     KVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSK
                     DEIIMVIEYAGNELFDYIVQRDKMPEQEARRFFQQIISAVDYCHRHKIVHRDLKPENL
                     LLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVI
                     LYVMLCRRLPFDDESIPVLFKNISNGVYTIPNFLSQGAANLIKKMLIVNPLNRITVHE
                     IMQDEWFKVDLPDYLVPAETPQQETPEQKQVDGVPAGTSNPPAPSEVIDDTLVQMLSK
                     TMGYDTDEIYEALESNEDHPSLDEIRDAYQLIRENRNLINDIKANKQQSNDLDTFLSQ
                     SPPSYEHSANKHSMSSKRSRPHSNSKRTQQRTYQYHYGSETQDGDSTIAILPSSLPQI
                     HRANMVAQGSQAAAKISPLSTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAK
                     PSEEDLWTIRVRWKYNVDMPDDEMKNKCIPDLMKMVIQLFQIETNNYLVDFKFDGWES
                     SNGVAYTSRNDDEMSTFSAYPFLHLATRLIMELAVNSQGN"
     gene            complement(1254382..1254452)
                     /locus_tag="KLMA_R320"
                     /db_xref="GeneID:34718694"
     tRNA            complement(1254382..1254452)
                     /locus_tag="KLMA_R320"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718694"
     gene            complement(1254565..1254641)
                     /locus_tag="KLMA_R321"
                     /db_xref="GeneID:34718695"
     tRNA            complement(1254565..1254641)
                     /locus_tag="KLMA_R321"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:34718695"
     gene            <1255832..>1257634
                     /gene="SMF1"
                     /locus_tag="KLMA_30583"
                     /db_xref="GeneID:34715853"
     mRNA            <1255832..>1257634
                     /gene="SMF1"
                     /locus_tag="KLMA_30583"
                     /product="manganese transporter SMF1"
                     /transcript_id="XM_022819111.1"
                     /db_xref="GeneID:34715853"
     CDS             1255832..1257634
                     /gene="SMF1"
                     /locus_tag="KLMA_30583"
                     /codon_start=1
                     /product="manganese transporter SMF1"
                     /protein_id="XP_022675710.1"
                     /db_xref="GeneID:34715853"
                     /translation="MREDVNAPPLESKTFEVHEEYLDPQSMLELSLAGGASKLSVRQR
                     LYLRCKKIMRKENDGKKGSSSSDDAASQYSIHAQVPNRSREKLGFFGKIKDVLRKYMK
                     FVGPGLMVSVAYMDPGNYATDVSAGASNRFSLLCIVLLSNIIAIFLQSLCIKLGSVTG
                     LDLSRACKKHLPKWLNLIIYVFAECAIIATDIAEVIGSAVALNILLKIPLPAGIIITV
                     IDVLFVLIAYKPGTSSMRFIRMFEYAVALLVFGVVICFIVELGYLPKTSVRSIFRGYV
                     PSKQMFEHNGMYTATSILGATVMPHSLFLGSGLVQPRLLEYDVDHGYYDLLPKEIEED
                     NESTVKQKQDLDTLREQRYFDYQPTTSAIKYALKYSIAELAITLFTFALFVNSAILIV
                     SGATLYGSEQAVGAGLYTIHDLLSDTLAPIAGTVFMLALLFSGQSAGIVCTIAGQIVS
                     EGHLDWNFKPWKRRLITRGIAIVPCLAVSLAIGKSALNKALNASQVVLSILLPFLIAP
                     LIFFTCKKSIMRVKVNDKDEQAYAEAAMDPDGGVVEVDPEAEETTSGERPAKYIDMSN
                     NWITTIIAFVVWLFISMLNVYTIVQLGISHGDIS"
     gene            complement(<1257770..>1258264)
                     /gene="SNX3"
                     /locus_tag="KLMA_30584"
                     /db_xref="GeneID:34715854"
     mRNA            complement(<1257770..>1258264)
                     /gene="SNX3"
                     /locus_tag="KLMA_30584"
                     /product="sorting nexin-3"
                     /transcript_id="XM_022819112.1"
                     /db_xref="GeneID:34715854"
     CDS             complement(1257770..1258264)
                     /gene="SNX3"
                     /locus_tag="KLMA_30584"
                     /codon_start=1
                     /product="sorting nexin-3"
                     /protein_id="XP_022675711.1"
                     /db_xref="GeneID:34715854"
                     /translation="MSPQRQFQSFTTTAESSLSHTNHKQLSGATIYDEPENFLEVEVC
                     NPKTHFPSGDSKGMYTDYEIICRTNLPGFPKRQSSVRRRYSDFELFRKLLIKELQLSN
                     HPKVSVPHLPGKIVLSNRFSDAVIEERRQGLHKWLGSVAGHPLLQTGSKVLIRFMQDP
                     VFNG"
     gene            <1258562..>1259038
                     /gene="HAP5"
                     /locus_tag="KLMA_30585"
                     /db_xref="GeneID:34715855"
     mRNA            <1258562..>1259038
                     /gene="HAP5"
                     /locus_tag="KLMA_30585"
                     /product="transcriptional activator HAP5"
                     /transcript_id="XM_022819113.1"
                     /db_xref="GeneID:34715855"
     CDS             1258562..1259038
                     /gene="HAP5"
                     /locus_tag="KLMA_30585"
                     /codon_start=1
                     /product="transcriptional activator HAP5"
                     /protein_id="XP_022675712.1"
                     /db_xref="GeneID:34715855"
                     /translation="MEQITSNDQVQLPEEEVETGLEVDEDEEGIDVFHNVGQGLTGRY
                     REIMIQYWQELINEIESTNEPGSQFQDDFKSHSLPLARIKKVMKTDEEVRMISGEAPI
                     LFAKACEIFITELTMRAWCVAEENKRRTLQKQDIADALQKSDMFDFLIDIVPRNIQ"
     gene            <1259576..>1262065
                     /gene="PTA1"
                     /locus_tag="KLMA_30586"
                     /db_xref="GeneID:34715856"
     mRNA            <1259576..>1262065
                     /gene="PTA1"
                     /locus_tag="KLMA_30586"
                     /product="pre-tRNA-processing protein PTA1"
                     /transcript_id="XM_022819114.1"
                     /db_xref="GeneID:34715856"
     CDS             1259576..1262065
                     /gene="PTA1"
                     /locus_tag="KLMA_30586"
                     /codon_start=1
                     /product="pre-tRNA-processing protein PTA1"
                     /protein_id="XP_022675713.1"
                     /db_xref="GeneID:34715856"
                     /translation="MASSVDPLLQLQQAADMAMQHMPEQMLPKVLETGITLFMNDKKN
                     IGFSRFSTQLLLDLLVHDKIPSSEKPFIVRQHIDALWEMAETRDYITFKNCILCLGNI
                     YDQLFDLVAKTSDEKLWSTLVRFKDLVVANWKTCYPLQLPQSDLNNHGKGTGVKLANV
                     KFISKIIIIHTSGPGISIGSIPNNHPVISNKQALEDEAKVLLDKLLAFLIEEPMMCAP
                     WFTGILHCFSFIMKQRPMATIRIASGLLRFNIDMKFQRDDEPTLQYRLAKRFVERCYR
                     NLVQFGLKNRLIKDSGSMTQYKNKLAKISQTLFVIGEEAKAKGILNFDPAAVEHKMTP
                     ADKKKYNRVKEVNDSSSDSSTGVSSATVKSPSPVQITPIISPPMGNTMMNNMHNSSTP
                     PLLNNFQQQPQTLGHMQNAAPPPDLAALKALQSYAFTKSTTKHPHFLNPAHTSVDNSF
                     AAIFSLMNPVSSGFDVSKLSQDTMVKLCTEALGNTDTGTAINGLSIVASRYTDLINKW
                     LQNNVQQQQQQQQQQQQQSIQNNNRDMNNVSSTKRAREDDSVTETLIQNNVEENKETK
                     VEPTALSMEGSETNSQASVPDTKRMKFERAEKPESTSSSNVQLKAPSLTNQEKIEHLK
                     RIVHNILQISTKDNINNPISQKQERNPLDKILLLNWNNKTSWVFLLSRLCSRGVSSNE
                     EMRQVITKAIFDYFCEDFQNRITLVLEWLSEEWYSEDLESDSQEHPIYNEWSLKVLDF
                     MIPKLDDSHRRLFIRMVSEMPLLSQDHIDKMKSLCLDPTRSVLGFQSLKFMLMFRPPV
                     RKYIKVALESMAQVDETIKPQCELLLQKYFS"
     gene            <1262887..>1264296
                     /gene="VTS1"
                     /locus_tag="KLMA_30587"
                     /db_xref="GeneID:34715857"
     mRNA            <1262887..>1264296
                     /gene="VTS1"
                     /locus_tag="KLMA_30587"
                     /product="protein VTS1"
                     /transcript_id="XM_022819115.1"
                     /db_xref="GeneID:34715857"
     CDS             1262887..1264296
                     /gene="VTS1"
                     /locus_tag="KLMA_30587"
                     /codon_start=1
                     /product="protein VTS1"
                     /protein_id="XP_022675714.1"
                     /db_xref="GeneID:34715857"
                     /translation="MSSQKMMSSLPGRAQSPVGLPRGAHPGAVLLSPQSSSANLQSLG
                     TNPTSPSQQPLFLNDLLDQQQFSLDSQLHLRGDMGRPSNMVSPLSNSAMNPTGSNGST
                     FLDSFSRPTSSMAASHQPLPLQQSNNNANVVVNFTNDVNQLCNWISMLTPAQQNTVMD
                     NLLSSLNEEVLHNTKLKLDSLVHSGYISPTLGPIASPVPSKVQSHLHQAENPQPLNLD
                     SVLNGDNIYRQWSPLPQHTANPLQQPMYDYLNDIPRPSSADPYTAFKKSGPTSGVVNS
                     INMNNASNSHNGNSSGNKNNNNNNNSAATNSNNNTIGSAGMATSNSTNSHVSRKTSNQ
                     NHYLNRPQSPAAGKANAYNKPSLNTSLSNSGNALTTVNSASSTTSNSNGTNNSMNAKA
                     LCDPKLLKNIPAWLKSLRLHKYSEALGGKPWYELIYLDDEALEKMGVSALGARRKLLK
                     AFSIVREYKANDMIDPSAF"
     gene            complement(<1265136..>1266746)
                     /gene="PDE2"
                     /locus_tag="KLMA_30588"
                     /db_xref="GeneID:34715858"
     mRNA            complement(<1265136..>1266746)
                     /gene="PDE2"
                     /locus_tag="KLMA_30588"
                     /product="cAMP phosphodiesterase"
                     /transcript_id="XM_022819116.1"
                     /db_xref="GeneID:34715858"
     CDS             complement(1265136..1266746)
                     /gene="PDE2"
                     /locus_tag="KLMA_30588"
                     /codon_start=1
                     /product="cAMP phosphodiesterase"
                     /protein_id="XP_022675715.1"
                     /db_xref="GeneID:34715858"
                     /translation="MAVHVCCIGPCIDVVKRLSKDPNVALERFENVSQLLLNLFKRRL
                     CDPDVTFEGPCVLLCYEPVKTKLRSTSPLNSLGPKALSYCIRDMFPCFNLITIPVNEF
                     MDYYDTVVIPKLVPGMDDTDDNLDRLSNIYRWMYSDSDLILDKEEVKGGDPASGSGSD
                     NGPTSKSYVPCCSDNLYTMASHLAYLSPDVKNSHEMIPVWDYLDFTDLVQAQLKNDND
                     FYWKSLDSWNFCAHSLSCTELVWCSYLILNKLSKQCNLSHTPPGKNRLLLMLLNIEAT
                     YHQTNKFHNFKHAVDVLQATYRLCHLLELPSLPSFLLCIAAIGHDVGHPGTNNMLFNR
                     YHSPLSQYYKEQSVLENFHADVYLDILSRYWPGLSHEFTTIKDSIIATDMALHNHYVE
                     TIKQETVPTLAGLTSLIIKAADISNVTRPLLISAKWAALITMEFTECALLEKNLIEWQ
                     KNGSNSSMKISHKLPVEFIGTVELPSTIDELLKRYPSIPKGQTFFIDTFALSLFSGLG
                     LKFKQLYFLVDNVESNRKFWIEKGLEQG"
     gene            <1268103..>1268630
                     /gene="GCV3"
                     /locus_tag="KLMA_30589"
                     /db_xref="GeneID:34715859"
     mRNA            <1268103..>1268630
                     /gene="GCV3"
                     /locus_tag="KLMA_30589"
                     /product="glycine cleavage system H protein"
                     /transcript_id="XM_022819117.1"
                     /db_xref="GeneID:34715859"
     CDS             1268103..1268630
                     /gene="GCV3"
                     /locus_tag="KLMA_30589"
                     /codon_start=1
                     /product="glycine cleavage system H protein"
                     /protein_id="XP_022675716.1"
                     /db_xref="GeneID:34715859"
                     /translation="MFSVSRTAFVSVSSRAARSNVSRLFLRAQSTNALNQSQLPFTFS
                     PTGPKTVKYTSQHEWIAAHEDGHAFIGITKYAADALGDATYIELPELDTELEVGESFG
                     SVESVKSASEVYTPVSGVVVEANEALSDSPQLINSDPMGEGWIVKVKLNDEAELQSED
                     LLSLEQYEAHLKEDH"
     gene            complement(<1268761..>1269093)
                     /locus_tag="KLMA_30590"
                     /db_xref="GeneID:34715860"
     mRNA            complement(<1268761..>1269093)
                     /locus_tag="KLMA_30590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819119.1"
                     /db_xref="GeneID:34715860"
     CDS             complement(1268761..1269093)
                     /locus_tag="KLMA_30590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675717.1"
                     /db_xref="GeneID:34715860"
                     /translation="MSSVAANRSIEGPIAQRITTKIHSTFPDLSHFAIFNDSYKHSGH
                     HGIQDAENKIESHFRLEIVSGLFQGKPLPARHRMVYKTLQDELNDGVHALQLITRTPE
                     EHAKKQNQ"
     gene            <1269465..>1269740
                     /gene="AIM1"
                     /locus_tag="KLMA_30591"
                     /db_xref="GeneID:34715861"
     mRNA            <1269465..>1269740
                     /gene="AIM1"
                     /locus_tag="KLMA_30591"
                     /product="bolA-like protein 3"
                     /transcript_id="XM_022819120.1"
                     /db_xref="GeneID:34715861"
     CDS             1269465..1269740
                     /gene="AIM1"
                     /locus_tag="KLMA_30591"
                     /codon_start=1
                     /product="bolA-like protein 3"
                     /protein_id="XP_022675718.1"
                     /db_xref="GeneID:34715861"
                     /translation="MFRNTLLTIGRRLYSLTPEEKLITDKLSKELKPSSITVSDISGG
                     CGSMFSIDVTSEKFQGLSIVKQHKLVNDILKDDIKRWHGLQLRTRKE"
     gene            complement(<1270061..>1272271)
                     /gene="PRT1"
                     /locus_tag="KLMA_30592"
                     /db_xref="GeneID:34715862"
     mRNA            complement(<1270061..>1272271)
                     /gene="PRT1"
                     /locus_tag="KLMA_30592"
                     /product="eukaryotic translation initiation factor 3
                     subunit B"
                     /transcript_id="XM_022819121.1"
                     /db_xref="GeneID:34715862"
     CDS             complement(1270061..1272271)
                     /gene="PRT1"
                     /locus_tag="KLMA_30592"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3
                     subunit B"
                     /protein_id="XP_022675719.1"
                     /db_xref="GeneID:34715862"
                     /translation="MTSLETALESLKIEDIPVDDIDFSDLEKEYQVSDDGVNFDNFLV
                     VDGAPVAPESKVPVLQKVLTKLFSQAGKVLDMQIPVENGKTKGHLFIEMDSINAAREA
                     IKQFNGKKLDAKHRLLVNSMNDMEKYGSDDFSTEFEEPTVPDFAPTDFLRSWLQNKDG
                     RDQFVLQKGDMTRVFWNRLAHQPDPVCEARKNWSNHIVKFSPKGTYLLSFHDQGVTSW
                     GGPNFERLKRFYHPGVSRLDVSPTEKYLVTFSMTPLQPDENTPFGPESQGHQICVWDL
                     ATGYLLKTFGIPPNAKLEWPLIRFSYDDKYCGRLGPNALALYEIENNFQLLDGKIHKV
                     EGIQDFSFAPKGVQLVYNKRKSDPTTLLAYWTPETNNQSCKAFLMTLPNKRIVKTVNL
                     VQVSNVSIHWHDQADFICFQVDRHSKSKKTFFTNLEICKLNESEIPVEKIEMKDRVLA
                     LAFEPKGDRFVTISKMDNGGIDENPMYPKNFIKFFAPEKKDKDKDLDVLPDTLKWKLV
                     KTVDQQYSNCISWSPAGRFVAVCAIVNGKDIKKASLDFYDFDYTGEKTLNEVKDVKAS
                     LQAVAHIDNQFFTDLEWDTSGRFLAAWSSYAKHKLENGYTVYNCCGEAVRKEIVDQFT
                     NFVWRPRPESLLSNADKKKARKNLKQWSVKFEEQDAMESDSALRDLILKRRAELSQWV
                     AYREQSKERLESEDHYTIFDNFVQDKSDESQYVTVEEVKEEILEETQEEVESFE"
     gene            <1272770..>1274959
                     /locus_tag="KLMA_30593"
                     /db_xref="GeneID:34715863"
     mRNA            <1272770..>1274959
                     /locus_tag="KLMA_30593"
                     /product="spindle pole component SPC72"
                     /transcript_id="XM_022819122.1"
                     /db_xref="GeneID:34715863"
     CDS             1272770..1274959
                     /locus_tag="KLMA_30593"
                     /codon_start=1
                     /product="spindle pole component SPC72"
                     /protein_id="XP_022675720.1"
                     /db_xref="GeneID:34715863"
                     /translation="MSDSDSVATGTTLRSSAVMENDLSEGIQKLNIALDSLDGNSGRS
                     KGVHTAGVSLEDYYDDAETENTTSETDTGLSGMDIFQYIDSDTRWSKDDAILARTGQQ
                     RKKTHISGSLKLPVLGDSSSIGTEIETLKRQVVQYRIKIKALTEIVKQINLRSNDDTP
                     LIKYISAVDGANNNVPTAVNSETATKMASLQAENKKLTDNLEEKNKKLIKLKEELVRN
                     KTDYETMLEEVNDYLQHNENISENVNEILRFLLENIDLTAEERDNLVKATSFESNFID
                     IKIKALSVNVDKIVSELKSLKEKTSTTPNDEPSESRSLSMTNNSNLDTTEMLDSRIES
                     IIETMHEKYHSFLQSIQHKLDKNTFLENALKEKMQQQKIILESISHMEPELPPNNNQK
                     SLELQRSGSDFFSSIDDLSKRASMDLSKSYQDHVDALNNMLQSYKQEIEDKDKELKEL
                     RSQLRYSYQNTTELDLVNKIKEQSLTLEENSARWHRQVLDYDEKIATLQKEKHALSEE
                     CNRVRKELQEFQEQSSKEVADLRKKLNVAMRKSSYYLDDNQALQEQLEELGNEYHALH
                     EDNIRLRELVGKSTEMGHQSNQLLIMKSNLLDHLKAIFDSFERVLQKDSVEQAFTKIQ
                     HLEQLDSSKYFKKTIVKLDSVFFFLERAVNSIVTEHVELLLKEKDWPDNEYDESTNKQ
                     NKLKIEELRKKWIGERERRKLESEAATNRINMLQLENEKLREQLGIH"
     gene            complement(<1275100..>1275959)
                     /gene="PRE10"
                     /locus_tag="KLMA_30594"
                     /db_xref="GeneID:34715864"
     mRNA            complement(join(<1275100..1275892,1275943..>1275959))
                     /gene="PRE10"
                     /locus_tag="KLMA_30594"
                     /product="proteasome component C1"
                     /transcript_id="XM_022819123.1"
                     /db_xref="GeneID:34715864"
     CDS             complement(join(1275100..1275892,1275943..1275959))
                     /gene="PRE10"
                     /locus_tag="KLMA_30594"
                     /codon_start=1
                     /product="proteasome component C1"
                     /protein_id="XP_022675721.1"
                     /db_xref="GeneID:34715864"
                     /translation="MFKCWIVFSPDGRNFQVEYAVKAVENGSTSLGIKCKDGIVLAVE
                     KLITSKLLVPGKNKKIQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKLYSTPIPV
                     PAFADRVGQYVQAHTLYNSVRPFGVTAIFGGVDSDGAHLYMLEPSGAYWGYKCAATGK
                     GRQSAKAELEKLSNGESELTAREAVKEAARIIYAAHEDNKEKDFELELSWCSLSETNG
                     LHKEVPKDLFDEAVEYAKKELGDDSDSDSDDDSADEETKEKKDEDGDIEIS"
     gene            <1276586..>1278571
                     /gene="GEM1"
                     /locus_tag="KLMA_30595"
                     /db_xref="GeneID:34715865"
     mRNA            <1276586..>1278571
                     /gene="GEM1"
                     /locus_tag="KLMA_30595"
                     /product="mitochondrial Rho GTPase 1"
                     /transcript_id="XM_022819124.1"
                     /db_xref="GeneID:34715865"
     CDS             1276586..1278571
                     /gene="GEM1"
                     /locus_tag="KLMA_30595"
                     /codon_start=1
                     /product="mitochondrial Rho GTPase 1"
                     /protein_id="XP_022675722.1"
                     /db_xref="GeneID:34715865"
                     /translation="MTKNRIRIVVCGDNGVGKTSLIACLVKDQFLPWLQDVLPPITIP
                     KDFSSSRYSPENTVVVDTTNSDLVTLHKELKNADVIWLVYCDHDSYERIALYWMMMFR
                     SLGVNLPVVLCRNKCDDEAEMLLSSSNYMDSDDDQLDNKIEDEEFIPILREFKEVETC
                     IKTSAKFKVNVNQAFYLCQRTITNPVAPLFDARIGELKPLGVLALKRVFMLSDMDQDG
                     FLNDDEITKLQKKCFSKTIDVNELQFLKDTLINISSPNQEYEDYVLYVPGRGFTKDGF
                     LVLNKIYAEKGRHETTWSILRAFHYTDTLTINEKILHPKLDIPQSSSVELSPLGYRFF
                     VDMFLKYDRDNDGGLNNDELHLLFKTTPGLPRLWIETNFPFSTVVNNSACITLQGWLA
                     LWSMTTFIDYSVTTEYLVYLGFDKDAKDAIQITKPRKKRRRNGVFYRAPVTDRKVLNC
                     FILGKGNSGKSSLLESFLGRSFSEAYSPTIRPKVAVNSLELKGGKQYYLILQELGEQE
                     TPILENRDKMNECDVLCLCYDSSDPESFSYIVNLINKFGYLKELPIVFVALKADLDKQ
                     QQRCSIQPDDFADQLFIDHPLHISSTWPSSLNELFIKLTETALEPITSTAGLGPAVLT
                     KDIDYRQSVVAISSVIGFASLFTFTALKIYSSFKNNN"
     gene            complement(<1278606..>1281683)
                     /gene="OAF1"
                     /locus_tag="KLMA_30596"
                     /db_xref="GeneID:34715866"
     mRNA            complement(<1278606..>1281683)
                     /gene="OAF1"
                     /locus_tag="KLMA_30596"
                     /product="oleate-activated transcription factor 1"
                     /transcript_id="XM_022819125.1"
                     /db_xref="GeneID:34715866"
     CDS             complement(1278606..1281683)
                     /gene="OAF1"
                     /locus_tag="KLMA_30596"
                     /codon_start=1
                     /product="oleate-activated transcription factor 1"
                     /protein_id="XP_022675723.1"
                     /db_xref="GeneID:34715866"
                     /translation="MPSGTTSTSGNIAGAQAGSTNGGTARTAAAAAAADKRANDNMDK
                     RSNENNENGSSGVAKRQRLSFVCQACRKNKTKCDREKPRCGRCVKYYLKCVYDVEQQK
                     PPRVPSKDAIIKRLTGEVEYWKRKAEEMQGSNMGSPNISETDTVATNNISNGSNSNNS
                     STNNNYDKNKKEKSVDGISLLADVSALSPKPMTVKRSSSMVPDPQEMQLNFYREFPQI
                     TMKYSMKRDVKPISAFAHVYRDKLLSLFGASIFSSASKNALIHSLPTDDTNPFHKSET
                     QFKQNAIFLRDSMIQLCETEIEKQKVIEFTNRIMGEQDEKKEHSSLFISLMKAKLENK
                     HIEDSCSRGRMSPELSQLKENLEKALPTLDDMEIYKSHFYEYIYPNIPFLDIELFEEG
                     LKELLSPNDGTDGKNVIITLGTRNIRSKICLIATLINVLRISYLCMIFTFNTSRVPVF
                     DAATLKVLTTSPMTSTLIMLSQECISSVNLLSWTTEDGIIALMYHWAVYVFTSEEGDC
                     YLGQPTDALISLVSNLAINIGLHRDPSHYKILNDPTICDPRIIRLRKRLWLCIFIMCR
                     HETTLKARYHQNSHISPTGFSISDDSSKSLWFQDFGNPDSSDLFSLNMNSWTIKRHQL
                     FLLLSETDAVTMNLDTYMTLYDLDAWLEKVKTMLDEEFPLDNLINGATNSKTFNLNLK
                     GNKQIPVNFLYIENALSFQSQLIARMAMLRITTCLMAHFENRLSETAHDYTPYFVKYF
                     IESFRSLLELLKLYQSYLSGDYDSAISPYMRYATDKICEVCLSSVLLTFLGMLIRVTH
                     TEYCLVKRTVDRKGLYEPTSYIPKEMKENEEKLATVTAIKKGLETAMQTLLSLITKRL
                     RFTYFSAFKMSIFFDYVLQIIKKQDILGVLNRVFDLSFSPKVRKEVYMGTGVDINDKQ
                     AVMLALDKGNRISVASNERFQEILAVMEALQISPNNTSNEEPINNYENGTLSTLDKVS
                     HHDTSERLSTFPLQTGHPTTHDTDLIDAYNMTTLFDGTAFDLFDYDFLLGPSE"
     gene            complement(<1283054..>1285822)
                     /gene="OAF1"
                     /locus_tag="KLMA_30597"
                     /db_xref="GeneID:34715867"
     mRNA            complement(<1283054..>1285822)
                     /gene="OAF1"
                     /locus_tag="KLMA_30597"
                     /product="peroxisome proliferation transcriptional
                     regulator"
                     /transcript_id="XM_022819126.1"
                     /db_xref="GeneID:34715867"
     CDS             complement(1283054..1285822)
                     /gene="OAF1"
                     /locus_tag="KLMA_30597"
                     /codon_start=1
                     /product="peroxisome proliferation transcriptional
                     regulator"
                     /protein_id="XP_022675724.1"
                     /db_xref="GeneID:34715867"
                     /translation="MDSTQEAAFKTRKRYKLSFVCQLCRKSKTKCDRKKPVCGRCDRL
                     NKPCVYDLEYQTLPRKPNKDATLARLQKELEYWKYFAKAKLMEKKQGTTANNHENPVD
                     IERRGNKIAKDHIINLANFHPQLFYQDSRFNELKVFTNMAQIKHDCFLATLLGTFVAS
                     TPKEELLRNVSPYLTFNLDNDNPKYIDRVLHLRQSLLMRFTTETQCNRIQDFTDRLLT
                     GREVLINYRTAFFVTMFSNVFFRCKIGDSKKPNGEYPPHLEQLISDANALLPNKNALL
                     LYKRYFYLRLYHIYPYFDIKLFESALNEILVQDPERPNRLKFSMGTSNFRYKLSNVAL
                     LLLILKLSYYSLQSVIDTDYNAEFCSSDFLKQNQVSDQCIVFAEICLAKMCVFDGTNE
                     VQISCLLFIWVFFCVGNGDVDGVFGRATDMVTEMLSNLAIDNGLSRDPSQFQEYQQYP
                     SVGYRLQNFRRKLSLNVIITSVYSGLLMGNFSSSIWDDAKNFLRLNGGRDEYMGLVRR
                     SMGEEVDPFELKIHSVLFKNYKMLVLLMDFEKLVKKDAAGLSLSEIDFTTRSVLDALN
                     LNFSMDFDYIGGPKSFNVVLSHNEGRGVSAKDGGRSRNDCSPSSITSSSSSSNTNSNS
                     SFSSNSNPNSIVCDVIDSYHNIQMHILVRNLMIHLFKSLFLYFEDSCAMGNVENLVHY
                     KRYLLEATRHTLELAKLSLQILEGVFDRVLTDGSNMEKCKLSIETIFPTILYSLLGFG
                     MRLAHAEVGIAQNIDTFSASRTIPMNDVDVDIEIDVSALKKRLKLLSQLRKDTFYAIR
                     RLADAMSASFQYKNFCTFRTLLFLDAVIKLDMSEGLMDMVYYALEPRNNVFGDQHEDM
                     KQLFTHTLGLNVDRPQEMITKLENAQFFSVIDEKFLEETASLMRSLGFSQNALLQASH
                     TLIGVQGR"
     gene            complement(<1286378..>1288918)
                     /gene="OAF1"
                     /locus_tag="KLMA_30598"
                     /db_xref="GeneID:34715868"
     mRNA            complement(<1286378..>1288918)
                     /gene="OAF1"
                     /locus_tag="KLMA_30598"
                     /product="oleate-activated transcription factor 1"
                     /transcript_id="XM_022819127.1"
                     /db_xref="GeneID:34715868"
     CDS             complement(1286378..1288918)
                     /gene="OAF1"
                     /locus_tag="KLMA_30598"
                     /codon_start=1
                     /product="oleate-activated transcription factor 1"
                     /protein_id="XP_022675725.1"
                     /db_xref="GeneID:34715868"
                     /translation="MGSHAAIKELEKEVTYWRNVALGIETESEYEQDTRKASIYSLTK
                     FLTDDNDPRANSIKLNFYEVYPRLISKGCIRQDINPFSVNYLLFADPYVSLFVKFVFQ
                     TPYRKGLRGNFQVDTEPQQDLDASSILKILKLNESAFEKLSASKKEKVNEFIEQIITQ
                     NYQPNMDTRNNEVFMNLLNTMSSPKFIEDKCLYGQYSPLLLTYISRIQNELPSLSTIR
                     LLLNNYYQHIYPMFPCLDIDLFEELITSVLEADRNNIERIVLNLGTTNIKLKLFNIAI
                     LFLLLQLSISHLKLRLFDHRSMQDDVHHKYDDERAWIQSLSKSHENLTYISAELLSIL
                     NVYQSRTEEIITWHMLLWSILAHNPDCCSIYNDSTTEGVVSLVGPLVLDLGLDRDPSN
                     FLKPTGNMKIDPRYKNYRRRLWMCYCFMSRFEVTVKGKSAQKNSANLAAIPGITDRDN
                     GWTLYSSLYKKDMVKPNEAELEILGLVYKFAQFCAVFKPMDELLRSTDSYLTLTQVEK
                     LYQEISIYIDPEFKKTTEGTERWVHNPTIGITYNIDDIERILAVERQIVARNSQLTLC
                     GMMVQYFNSLKNQDSYILDRVLLYCERVFSNICEGVKYLSQYFNVRYTENIDTTGKFY
                     TNRASQVYLSRCALQLVSHILKVDHMIGLSKRRSNQQSFLYEDHLAQPEGNKVNIQRR
                     QYIILRTKLLSILEEVHSNSSEELRYNYMSGFRYALIGDCTMHFLKQDGRRFLMRDIL
                     LSDSGIHDGTFTEGNFHLLSVEEKESMLLDANELIRLGEKDLQILVDTVSTFVDETSE
                     PENSSVMPQNLFAYTATTTDTMVNQFSLELAGVSADFDIVFGNTNFPE"
     gene            <1289553..>1290314
                     /gene="AIM2"
                     /locus_tag="KLMA_30599"
                     /db_xref="GeneID:34715869"
     mRNA            <1289553..>1290314
                     /gene="AIM2"
                     /locus_tag="KLMA_30599"
                     /product="protein AIM2"
                     /transcript_id="XM_022819128.1"
                     /db_xref="GeneID:34715869"
     CDS             1289553..1290314
                     /gene="AIM2"
                     /locus_tag="KLMA_30599"
                     /codon_start=1
                     /product="protein AIM2"
                     /protein_id="XP_022675726.1"
                     /db_xref="GeneID:34715869"
                     /translation="MASNPPGKCCVEGFYHEGTPSGKTSELYGLETYVAGPESSKDGN
                     VLVILTDVYGIKVNNVLLIADQLAAISGYKVYVPDFLFGDEVGNDVVMMDGTFDVAGW
                     LQRHNVEKTHGLVNGFLTSLKSDVKPNKIGVIGYCFGAKYAIKQIDSESGLADVAAVA
                     HPSFVDIKEVEAIGKRPLLISAAENDTIFPEELRRQTEDSLKKMGANYQLNIFGTVAH
                     GFACRGDLSVPQVRYAQDKTIEDQVSFFKFYFNNV"
     gene            complement(<1290607..>1292958)
                     /gene="FLC2"
                     /locus_tag="KLMA_30600"
                     /db_xref="GeneID:34715870"
     mRNA            complement(<1290607..>1292958)
                     /gene="FLC2"
                     /locus_tag="KLMA_30600"
                     /product="flavin carrier protein 2"
                     /transcript_id="XM_022819130.1"
                     /db_xref="GeneID:34715870"
     CDS             complement(1290607..1292958)
                     /gene="FLC2"
                     /locus_tag="KLMA_30600"
                     /codon_start=1
                     /product="flavin carrier protein 2"
                     /protein_id="XP_022675727.1"
                     /db_xref="GeneID:34715870"
                     /translation="MRSLSLLVTFVATLMLLPFASALKYIQTSSLLTCMENSQFSASF
                     FDVTFFPHNRSAIFNVDATTTISEKVVAKAELIVYGLNVLNKKFDLCELKENAVCPLS
                     AGRIEVKSSYTLDKDNDLTKKIPGIAYTVPDLDAQVRVIAYSSSDTAFATPLACVQAV
                     LSNGKTVQTKYASWAIAAISGLGVLTSAIVSVIGHSTTAAHIASNSISLFVYFQNLAI
                     TSMMGVARVPPIAAAWTQNFQWSMGIINVKFLQDIFDWYVKATGGTPVVVVSNKDILS
                     VSVQKRGLSSHIKDFARKSISNIQPSIQKRTLIDSGYDFSKLLSNTELYTTNERNTTD
                     YSTKVLVLTGIKRVAYLGGIELSNVFLTGIVFTLFFLFCMVVGMAVFKAVIELLTKAG
                     YMKETSKFYEYRRSWGSIIKGTLYRICIIAFPQVSILSIWEFTQRDSVAVVLDAVAVL
                     AIISILLVYGVSRVVLRGRESTRLYKTPAYMLYGDSTFLNRFGFLYVQFKAELYWWLM
                     PLLGYTFLRSLFVAVLQGEGKPQAMIVFIIELAYFVALCWARPYLDKRTNAFNIVIHA
                     LNLFNSLLFLFFSNLFGQPSVVSSVMAVILFVVNAVFALFLMIFTIVTCVLALVYKNP
                     DARYQPMKDDRVSFIPKVQPKNDAGELFDLGRTVMNNNDGSPVEFEMKHPNSSARLLF
                     DEDIDESNSTYDVGSQSRRFDSGSVNEPLQPTSAVMGDNTTNYARIPAAPSGNLRKPE
                     TSFSTNTQYQGYSGSNPYLNENPSYTSFNKPKKSSPENNMPYL"
     gene            complement(<1293832..>1295493)
                     /locus_tag="KLMA_30601"
                     /db_xref="GeneID:34715871"
     mRNA            complement(<1293832..>1295493)
                     /locus_tag="KLMA_30601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819131.1"
                     /db_xref="GeneID:34715871"
     CDS             complement(1293832..1295493)
                     /locus_tag="KLMA_30601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675728.1"
                     /db_xref="GeneID:34715871"
                     /translation="MRFLREQFRKEVTWNKTYDDPGKLDSQSSPSENHNIDDYPQDTE
                     KSYEIVTEGIVAEDSAKASNGEKKGFFAQLPILWPIFTCGAGLFSDGYINSSIGAVST
                     CLAQIYGKQYSNSSAIQNVSSIAFAGIVLGQLSFGYLADHYSRKLAMLLGNLILIVFS
                     ILVAGAWGAGTTSTKAGGLFTAITAYRFFLGIGIGSEYPSGSTAAAEACALLPAKKRN
                     RWFIWFTNLMLNWGGLFAAIVPLVLVCIFGEHRLQWVWRLTLGLGAIPPLSLFILRLK
                     FKESKSFTTSRFNKVMPYKLVFKFYWFRTTIISIIWFLFNFSSYAFGIYSSLIIKNLL
                     GKNKPGAKASLKESFSWNVLFTFFYIPGGYLGAVFADYIGPRLTIGLGLLAQAFVGIG
                     MTCGFVTLEKHIAAFTVIFGIFTSLGDFSTGDNIGLIAAKSYATPVRGTLYSISAASG
                     KIGAFVGTYVFPQIIKNAGGSNTTNGMRAPFWVATALCMFSGFLALLFLPELDPDAIV
                     EEDRKFHEYLESSGYDMSTLGVRAEDSEDVEESVEVLNTQSSGKI"
     gene            <1297809..>1299932
                     /gene="ACS1"
                     /locus_tag="KLMA_30602"
                     /db_xref="GeneID:34715872"
     mRNA            <1297809..>1299932
                     /gene="ACS1"
                     /locus_tag="KLMA_30602"
                     /product="acetyl-coenzyme A synthetase 1"
                     /transcript_id="XM_022819132.1"
                     /db_xref="GeneID:34715872"
     CDS             1297809..1299932
                     /gene="ACS1"
                     /locus_tag="KLMA_30602"
                     /codon_start=1
                     /product="acetyl-coenzyme A synthetase 1"
                     /protein_id="XP_022675729.1"
                     /db_xref="GeneID:34715872"
                     /translation="MSPAVNTATPQDPIITMKNASATDASSKEKKTFEYEHLTSVPVV
                     HPIPITERLSAEAARNYKPNLPGGFEEYKALHKESLENPAKFYHERAQLLNWFKPYDQ
                     VFIPDSEGKPTFENNAWFTNGQLNACYNLVDRHAFSQPDKVAILYEADEPGQGYSLTY
                     SELLEQVCKVAQVLQYSMNVRKGDTVAVYMPMIPEALITLLAITRIGAVHSVVFAGFS
                     SNSLRDRINDAYSKTVITTDESKRGGKTIETKRIVDEAVKETPQVTNVLVYKRTHNKH
                     IRYVPGRDLDWDEELKKYKSYYPCEPVDSEHPLFLLYTSGSTGAPKGVQHSTAGYLLQ
                     ALLSMKYTFDVQKDDVFFTAGDIGWITGHTYCVYGPLLSGCTTLVFEGTPAYPSFSRY
                     WEVIDKYQVTQFYVAPTALRLLKRAGDSYTEGFSLKSLRCLGSVGEPIAAEVWEWYSE
                     KIGKNELPIVDTYWQTESGSHLVTPLAGGATPMKPGSAAFPFFGIDLAVLDPTTGEEQ
                     TGQHAEGVLAIKRPWPSFARTIWKNNDRFLDTYLKPYPGYYFTGDGVAKDKDGFFWIL
                     GRVDDVVNVSGHRLSTAEIEAAIIEDDMVAECAVVGFSDELTGQAVAAFVVLKNKSSL
                     TAASDSELQDIKKHLILTVRKDIGPFAAPKLIVLVDDLPKTRSGKIMRRILRKILAGE
                     SDQLGDVSTLSNPGIVKHLIDSVKL"
     gene            complement(<1300167..>1301219)
                     /locus_tag="KLMA_30603"
                     /db_xref="GeneID:34715873"
     mRNA            complement(<1300167..>1301219)
                     /locus_tag="KLMA_30603"
                     /product="DNA polymerase alpha subunit B domain containing
                     protein"
                     /transcript_id="XM_022819133.1"
                     /db_xref="GeneID:34715873"
     CDS             complement(1300167..1301219)
                     /locus_tag="KLMA_30603"
                     /codon_start=1
                     /product="DNA polymerase alpha subunit B domain containing
                     protein"
                     /protein_id="XP_022675730.1"
                     /db_xref="GeneID:34715873"
                     /translation="MLVNLVSAFFSSNDTEISESARPQFCHGVQEDDIDLQLRSLLYC
                     YTRLNIEKLSPFYPVDSNPQTGEQLGDGSVVLDEVYNLERFKSMLREDPHRILVDWCK
                     NKARLMCILSGNPIRSHTPLPKDFPFLVLKPDSSEDVYVKKLVLESRLYQEHDIPLTW
                     KIQCLQDIIKKQYSVLPTKRQVFNKQDRWQIMIKYLSKLAERVQIERVYKAYSTQNLS
                     SRRLSNTSDPGNDTLRVSEKPLSTPSTPNRGLRSKPSMTILRLDNSVRSRMSPSLTGS
                     PTRNAPNSPALQSRSPSPKKQSNRSTNANLFSITPDHSANNSPLYQQSRSCVVKRLQR
                     EKRAILAETGKTFIAL"
     gene            <1301543..>1302628
                     /locus_tag="KLMA_30604"
                     /db_xref="GeneID:34715874"
     mRNA            <1301543..>1302628
                     /locus_tag="KLMA_30604"
                     /product="probable 2-nitropropane dioxygenase"
                     /transcript_id="XM_022819134.1"
                     /db_xref="GeneID:34715874"
     CDS             1301543..1302628
                     /locus_tag="KLMA_30604"
                     /codon_start=1
                     /product="probable 2-nitropropane dioxygenase"
                     /protein_id="XP_022675731.1"
                     /db_xref="GeneID:34715874"
                     /translation="MANRKVLTELLGIKYPILLSPMAGVSTPELAAIVSNEGGLGSLG
                     LGASPVEKSREAIFKTQLLTDKPFQVNFFCHEQEPLNKTAANGWTSFMEPIFGKFGAT
                     PKKELKKIYKSFLEEPKMLELVLDTKPKAVSFHFGVPSKEIIQELKRANIVTMATVTQ
                     ISEANVARQAGIDILVAQGVEAGGHRGMFNPSVDPGILTKDLVMLLVSKIGDPYGIPI
                     VAAGGIMRGRDIKEMYRLGADGCQLGTAFIQCKESGASEAYREALFKPKIITQITDSI
                     SGRPARAIFNSWHSEVDIPSRPQRPCYPNAYDLGKQLHSVSSSVENSNTNNPSSFGIH
                     WAGSNVIKSRRLDASKLFQTLVQEIDE"
     gene            <1303020..>1303748
                     /gene="MRPL11"
                     /locus_tag="KLMA_30605"
                     /db_xref="GeneID:34715875"
     mRNA            <1303020..>1303748
                     /gene="MRPL11"
                     /locus_tag="KLMA_30605"
                     /product="54S ribosomal protein L11"
                     /transcript_id="XM_022819135.1"
                     /db_xref="GeneID:34715875"
     CDS             1303020..1303748
                     /gene="MRPL11"
                     /locus_tag="KLMA_30605"
                     /codon_start=1
                     /product="54S ribosomal protein L11"
                     /protein_id="XP_022675732.1"
                     /db_xref="GeneID:34715875"
                     /translation="MLSTILKNSITAVRASYAGPSFVKRFASTNAAAASESIRTTVKP
                     LNSRKTFLIDSYKHMMDTSPVLLFCHHNNLMKGENAHFRSELNKIGAKLTILRNNLFQ
                     VYLRTSRNPDPAAPVKRSEQDWNHPLLPLFKGPTAAISFKETDPAKVKKVMKLLEKSQ
                     DKLFIIGAKVENDAYDLKKLQSFKDLPTKTQLQSELLGLLHILSGAGLVQTLEAGSNM
                     LYLTLKSHEDNINPENKKKDDEGN"
     gene            <1304037..>1304879
                     /gene="TRM8"
                     /locus_tag="KLMA_30606"
                     /db_xref="GeneID:34715876"
     mRNA            <1304037..>1304879
                     /gene="TRM8"
                     /locus_tag="KLMA_30606"
                     /product="tRNA (guanine-N(7)-)-methyltransferase"
                     /transcript_id="XM_022819136.1"
                     /db_xref="GeneID:34715876"
     CDS             1304037..1304879
                     /gene="TRM8"
                     /locus_tag="KLMA_30606"
                     /codon_start=1
                     /product="tRNA (guanine-N(7)-)-methyltransferase"
                     /protein_id="XP_022675733.1"
                     /db_xref="GeneID:34715876"
                     /translation="MSSNSRRQAYRAEKQDHRNELKHVKIDESVVEKVDKLSLPKKKF
                     YRQRAHSNPFSDHQLEYPLSPDAMDWSKLYPYYYDEDKKQMTKEVTVADIGCGYGGLM
                     IDLSPAFPDKLILGMEIRVQVTNYVEDRIIALRTNHAKENKEAYQNINVLRGNAMKFL
                     PNFFHKGQLEKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLREGGIIYTITDVLDL
                     HEWMVRHLTEHPLFERLSKEWEGEDKCVSIMRNATEEGKKVERNKGDKYIACFVRLPT
                     PEIV"
     gene            complement(<1305121..>1307148)
                     /gene="STL1"
                     /locus_tag="KLMA_30607"
                     /db_xref="GeneID:34715877"
     mRNA            complement(<1305121..>1307148)
                     /gene="STL1"
                     /locus_tag="KLMA_30607"
                     /product="sugar transporter STL1"
                     /transcript_id="XM_022819137.1"
                     /db_xref="GeneID:34715877"
     CDS             complement(1305121..1307148)
                     /gene="STL1"
                     /locus_tag="KLMA_30607"
                     /codon_start=1
                     /product="sugar transporter STL1"
                     /protein_id="XP_022675734.1"
                     /db_xref="GeneID:34715877"
                     /translation="MSDSKKSEVQRDSLSPLERIGTNAPDDRIKSSDLTKHGHPSLFQ
                     DDVPKNNGNEFLQFRSSFNTSNTTGANGGSNGPNNAPFDQQRIPPNYTDHLQVKDSYL
                     TGRSLLYFTSIFVSLGVFLFGYDQGVMSGIITGPYFKLYFNNPSAATIGTMVSILEIG
                     ALVSSLMVSSIGEKFGRRFTIKYGSLIFIIGGLIQTVSWRMGCLVFGRIISGVGVGLL
                     STIVPIYQSEISPPHNRGKLACIEFTGNIIGYASSVWVDYACSYIKSNTSWRLPLFIQ
                     CVMGLLLFLGSFVIVETPRWLLNHDHDIEGLVVIADLHSDGDVLDSKSHEEYRLIKEA
                     VLISRLEGEKKSLRFAFKRYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWVGR
                     EALLMTGINAIIYTLSTVLPWKLVDKWGRKPILLSGALVMGTALLSISISLWANISAT
                     PRLVVIFVIIFNAFFGYSWGPIPWLYPVEIAPSTVRSAMASASTATNWLFNWLVGIMT
                     PILQEKIHWRMYLIHTLSCYLSAWVVLKVYPETAGLRLEDMDSVFDDRSSTFSFHSGA
                     SVDMEQQSHHVNQGNDIAPSTRSRKSMQSLSQSVFGKDEITPPTLAQVLKWKDEKIDK
                     KPLKKIMRRGSETVSLIYNKVRNLAGTNPSDQIEYGAVSNSQPVDDETPSS"
     gene            <1308667..>1310220
                     /gene="SCW4"
                     /locus_tag="KLMA_30608"
                     /db_xref="GeneID:34715878"
     mRNA            join(<1308667..1308688,1309025..>1310220)
                     /gene="SCW4"
                     /locus_tag="KLMA_30608"
                     /product="probable family 17 glucosidase SCW10"
                     /transcript_id="XM_022819138.1"
                     /db_xref="GeneID:34715878"
     CDS             join(1308667..1308688,1309025..1310220)
                     /gene="SCW4"
                     /locus_tag="KLMA_30608"
                     /codon_start=1
                     /product="probable family 17 glucosidase SCW10"
                     /protein_id="XP_022675735.1"
                     /db_xref="GeneID:34715878"
                     /translation="MQEGRLWKVARKQAIHQQTLIRIEIRSNKKMRFDSVLSNALVLA
                     SVASGAAVHKHAEQEKRDVTVVVTNFVNVNGQVAAPDQTSTAYGAASSSP