GenomeNet

Database: RefSeq
Entry: NC_036028
LinkDB: NC_036028
Original site: NC_036028 
LOCUS       NC_036028            1421472 bp    DNA     linear   CON 23-OCT-2017
DEFINITION  Kluyveromyces marxianus DMKU3-1042 DNA, complete genome, chromosome
            4.
ACCESSION   NC_036028
VERSION     NC_036028.1
DBLINK      BioProject: PRJNA264644
            BioSample: SAMD00067077
            Assembly: GCF_001417885.1
KEYWORDS    RefSeq.
SOURCE      Kluyveromyces marxianus DMKU3-1042
  ORGANISM  Kluyveromyces marxianus DMKU3-1042
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1
  AUTHORS   Lertwattanasakul,N., Kosaka,T., Hosoyama,A., Suzuki,Y.,
            Rodrussamee,N., Matsutani,M., Murata,M., Fujimoto,N., Suprayogi,
            Tsuchikane,K., Limtong,S., Fujita,N. and Yamada,M.
  TITLE     Genetic basis of the highly efficient yeast Kluyveromyces
            marxianus: complete genome sequence and transcriptome analyses
  JOURNAL   Biotechnol Biofuels 8, 47 (2015)
   PUBMED   25834639
  REMARK    DOI:10.1186/s13068-015-0227-x
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1421472)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1421472)
  AUTHORS   Yamada,M. and Kosaka,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2011) Contact:Mamoru Yamada Yamaguchi University;
            1677-1 Yoshida, Yamaguchi, Yamaguchi 753-8515, Japan URL
            :http://ds22.cc.yamaguchi-u.ac.jp/~jo-sei08/index.html
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP012216.
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps and the
            genomic and proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: SPS phrap v. 0.990329
            Assembly Name         :: Kmar_1.0
            Genome Coverage       :: 8.4x
            Sequencing Technology :: Sanger ABI3730
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1421472
                     /organism="Kluyveromyces marxianus DMKU3-1042"
                     /mol_type="genomic DNA"
                     /strain="DMKU3-1042"
                     /db_xref="taxon:1003335"
                     /chromosome="4"
     gene            <1959..>4334
                     /gene="TY2B-GR2"
                     /locus_tag="KLMA_40001"
                     /db_xref="GeneID:34715998"
     mRNA            <1959..>4334
                     /gene="TY2B-GR2"
                     /locus_tag="KLMA_40001"
                     /product="reverse transcriptase"
                     /transcript_id="XM_022819272.1"
                     /db_xref="GeneID:34715998"
     CDS             1959..4334
                     /gene="TY2B-GR2"
                     /locus_tag="KLMA_40001"
                     /codon_start=1
                     /product="reverse transcriptase"
                     /protein_id="XP_022675854.1"
                     /db_xref="GeneID:34715998"
                     /translation="MSPPYSGGEEQIVPTPAPIRRVPPMEPPSPVEDSPPPLYGTDLD
                     DLFGESNINNYIPEDTDLLALNHESVPEPDTAVPETTNIEQDNVLPLETNENSNPPND
                     NSDQSGEGSGEESGEESGEESGEESGEESCDESGDESVDNRLKSIPIFNGNKHKDART
                     AEADLDSLYGGGDNTENNNGPTLEEVFRSIEEDPFMLTQKRPRSRARYRESNQDSCDS
                     GGDYESDSDSDGSSDESPQKGRKIQRVNYVNAVLKPVNVIPLNMSLNYSQAISRNRNE
                     EEKDAFQKAYQKEIAQLTKMNTWNEELIDASTLPKKKILNSMFIFTTKRDNSKKCRLV
                     ARGDQQAADTYDTELKANTVDNLALMTVLALTLDYNLTAFQLDISSAYLYADLKEELY
                     IRAPPHMNAKNKVLRLNKSLYGLKQSGANWYELIRSFLIKKCDLFEDRMWKCVFRDKE
                     PLKLIICLFVDDMLVVGNDVKYIKKFISKLSKRFDTKIVNDGSHRPEDGVNEYDILGI
                     ELEYKKKEYMKFGMQKSLEDKLPQLGIPLLPNTKIRKVPGVPGDYIFSGKELTLNERE
                     YKSKVKHLQKIVGLASYVGHKFRFDILYYVNILAQHQLYPSAKVLDRAAQLCQYLWDT
                     RDKKLVWHYSGPKENNVTAVSDAAFAGNQDFKSQSGTLFLRNNKPIAAKSRKIKLTCI
                     SSTEAEIYAISQSLPILRGLEHLVNKLQDTKVTVKVKTDSQPSMAIINGTDDSACLKK
                     HIGSRAMRIRDECDDLGLTLEYIPTKENNADILTKPLSVKLFKLLTEDWIQ"
     gene            complement(<6443..>8476)
                     /gene="FET3"
                     /locus_tag="KLMA_40002"
                     /db_xref="GeneID:34715999"
     mRNA            complement(<6443..>8476)
                     /gene="FET3"
                     /locus_tag="KLMA_40002"
                     /product="iron transport multicopper oxidase FET5"
                     /transcript_id="XM_022819273.1"
                     /db_xref="GeneID:34715999"
     CDS             complement(6443..8476)
                     /gene="FET3"
                     /locus_tag="KLMA_40002"
                     /codon_start=1
                     /product="iron transport multicopper oxidase FET5"
                     /protein_id="XP_022675855.1"
                     /db_xref="GeneID:34715999"
                     /translation="MADSGKFHRLWNLYEKIKTRESDIDLEDQVGVSDHKAGDTKPIE
                     SQSFISKHLRKILFVTSFLACCLIVGFIYGFEWNRGINNGVNQNSAEEISKPSWRLDT
                     QKNYTVDSSVWRAQKGHQNRHYFFNISKLVEVAPDGIKRNLTVINGQYPGPLIEANAG
                     DTLFIHVNNLMEDEPTTIHCHGLLFNHENNYYDGASSINQCPISPGHNFTYIIELDEK
                     QWGTYWYHSHYGAQYADGVFGPLVIHSEEEDQLLGSESKYDAEMVIMVNDYYHDIANN
                     YLADYLAPNNENNEPSPDDGLIQGANNFKYDAATYIVPNGETKEHDGEVYDATEAKYP
                     VMTLDKNKNYRIRLINAGFFLPFSFSIDEHHLSIIETDGANVAPTTVETIEMSVAQRY
                     SFILKKDSDNSDFFSLRVYFNAFCMAVDNPNFNPQIRGIISYDKSASTKNNTIDSVNS
                     VAWPYNGGDPRCRDMDQKTFHSVNEKVPKVVNNTNRPDRIVKLDVSFFIKERQLDRGY
                     FNDMTWKPLPDTENTLTHLAFNKSSLRGDFGELESKNNNQYLINLDKRGEIVDFVINN
                     YDDGSHPFHMHGYKFWLVGSSDRGYFKESYYEEDSLGLMNFDDAVQRDTINISGYGWA
                     VIRIIVDNPGVWPFHCHIGWHMESGLLLQLNSLENEYTSWNHFPQEWKDLCTT"
     gene            <9270..>10721
                     /locus_tag="KLMA_40003"
                     /db_xref="GeneID:34716000"
     mRNA            <9270..>10721
                     /locus_tag="KLMA_40003"
                     /product="probable acid phosphatase"
                     /transcript_id="XM_022819275.1"
                     /db_xref="GeneID:34716000"
     CDS             9270..10721
                     /locus_tag="KLMA_40003"
                     /codon_start=1
                     /product="probable acid phosphatase"
                     /protein_id="XP_022675856.1"
                     /db_xref="GeneID:34716000"
                     /translation="MRYSGLTLGALGALALKIAGVEADNSTSSTPTPRTYSELDPSLS
                     EIQAAASSAVTAHRTSDVKGAAVNRFYVIFLENTDYDKAAEDESLAWLAKQGISLTNY
                     WSLTHPSEPNYLASVAGDYFALDDDRFISMPSNVSNIVDLLDTKNISWAEYQEHIPYT
                     GFQGFNYSNQETFANDYVRKHNPLILFDNVISDKSRLANIKSFEDFNTDLKNKTLPQY
                     AFITPNMTNDGHDSNIKVAGDWSKSFLQPLLSDDYFMKDTLVLLTFDENETYGIKNKV
                     FSILLGGVIPDHLKGTSDDTFYDHYSQLATVEANWNLPHLGRHDVDANVLQIVANATN
                     ITNVEVDTRYMLNNETYIGYLNDDTIPLPAPNVTALNRNGKPILDSIKKVWADEYSSQ
                     VSASYFTATTTTVSGSFTDAATLVTSGADDSEKQTSGADSSATPTGAASSNSSKNSSG
                     NSTSKTKTSKGAASTINSISMGTLLALLCAMVI"
     gene            <11407..>12429
                     /gene="THI13"
                     /locus_tag="KLMA_40004"
                     /db_xref="GeneID:34716001"
     mRNA            <11407..>12429
                     /gene="THI13"
                     /locus_tag="KLMA_40004"
                     /product="pyrimidine precursor biosynthesis enzyme THI13"
                     /transcript_id="XM_022819276.1"
                     /db_xref="GeneID:34716001"
     CDS             11407..12429
                     /gene="THI13"
                     /locus_tag="KLMA_40004"
                     /codon_start=1
                     /product="pyrimidine precursor biosynthesis enzyme THI13"
                     /protein_id="XP_022675857.1"
                     /db_xref="GeneID:34716001"
                     /translation="MSSDKITFLLNWQAAPYHVPIYLASLHGYFKEEGIDVAILEPSN
                     PSDVTELIGSGKVDMGLKAMIHTLAAKARGYNVTSVASLLDEPFTGVLYLEGNGITTD
                     FKSLKGKRIGYVGEFGKIQIDELTKHYGMTPSDYEAVRCGMNVAKYIIEGKIDAGVGI
                     ECMQQVELEEHLKKQGKDPKLAKMLRIDELACLGCCCFCTVLYICNDKFLAENPEKVR
                     KFLNAIKKATTLMIQDPVKAWKDYVDFKPQLNNELSYKQFQRCYAYFSSSLYNVHRDW
                     KKVTAYGKRLDILPPDFVSNYTNEYLSWPEPKEVDDPLEAQKIIKAHQESCRDQGGFF
                     KRVSIP"
     gene            <13007..>13828
                     /locus_tag="KLMA_40005"
                     /db_xref="GeneID:34716002"
     mRNA            <13007..>13828
                     /locus_tag="KLMA_40005"
                     /product="UPF0317 protein C5H10.01"
                     /transcript_id="XM_022819277.1"
                     /db_xref="GeneID:34716002"
     CDS             13007..13828
                     /locus_tag="KLMA_40005"
                     /codon_start=1
                     /product="UPF0317 protein C5H10.01"
                     /protein_id="XP_022675858.1"
                     /db_xref="GeneID:34716002"
                     /translation="MSTPEDIRLQCRKEILTTHTSGLAPGYMQANLIILPSSVAEDFY
                     ALCKRNPVPCPLIGRTVGGPTALDNELLITNNSKNGFDIRTDFPQYCIYHKGKLQGTA
                     NNCLKQWQDGYVGFLIGCSYSFEGALIEAGLPPKNMIRGTNVTMYKTSKIMDPAGVFV
                     GCPYVVSMRPYKKKDIDTVRKVTSKYALTHGEPIDWGYDGANRLGIHNLNTPDYGDPI
                     DIQEDEIPVFWGCGVTPQLAVETLGDIIETEVISHSPGCMLVLDVTYDDYSKLKE"
     gene            complement(<14031..>15560)
                     /locus_tag="KLMA_40006"
                     /db_xref="GeneID:34716003"
     mRNA            complement(<14031..>15560)
                     /locus_tag="KLMA_40006"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819278.1"
                     /db_xref="GeneID:34716003"
     CDS             complement(14031..15560)
                     /locus_tag="KLMA_40006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675859.1"
                     /db_xref="GeneID:34716003"
                     /translation="MSDLSARNVTSSEDNYEMSKGKPSVAIPQVEGESGSIASFSLEE
                     EGINDENLEIDPKEEAAFVRKLDTRLLPMLTFMYFLSSLDRSNIGNAYTSGMREDLKL
                     TSKQYSNAVSVFYSTYLAAELPTTLILKKTKPKYYMSTLVFCWSIITLCNAFVHSYGS
                     LCALRVLLGTFEGGFFPAMTLIISIMYKKQEQGKRIAFFFLGSAISGAFGGLIATGLA
                     SMKKTGGLEGWRWLYIIEGLISVCASVWLFLELPADFNNIPYFNERETEIYRIRNKQR
                     TAYMGNEKFEWSYVFDALKDFKTYISFTIQFCQDTVLYGFSTFVTAILKLGLGYTSRE
                     AQYMSVPVYILAGIVFMISAFVSDRLKVRAPIFICYNLVGAIGYILLLSVSNNSVKYF
                     ACYLITFSLYTGTGLNIAWLTNNVAPHYKRATALGLNQTLGNVSGAVAGQIYTKAPYT
                     FGNSFSLGCIVLSNILAIGQIIVLKTMNKKRQRIIDGEIEDPYKGERRGDHALDFKYC
                     I"
     gene            <16482..>20342
                     /gene="OXP1"
                     /locus_tag="KLMA_40007"
                     /db_xref="GeneID:34716004"
     mRNA            <16482..>20342
                     /gene="OXP1"
                     /locus_tag="KLMA_40007"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819279.1"
                     /db_xref="GeneID:34716004"
     CDS             16482..20342
                     /gene="OXP1"
                     /locus_tag="KLMA_40007"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675860.1"
                     /db_xref="GeneID:34716004"
                     /translation="MTVLTETKEGTGIRIAVDRGGTFTDCIGNPGTNRQEDDVVIKLL
                     SVDPKNYPDAPLEGIRRLLEIMQNRKIPRGSPLDVSSVKSIRMGTTLATNCALERNGE
                     RCAFITTRGFKDSLLIGDQTRPDIFDLNVKKTKPLYEMVVEIDERVTLEDFSEDPEMV
                     KSLPDVADNTVMGASGEIVRILKRPDTSSIISTLKLIYDSGIRSIAVALLHAYTFPDH
                     ELLIGKLAQKIGFKHISLSSQVSPMIKFLPRAHSSVADAYLTPVIKTYLESIECGLTN
                     SNDTNVQFMQSDGGLVDGKKFSGLKSILSGPAGGVVGYSATCYDPENNIPLIGFDMGG
                     TSTDVSRFGDGKLEHIFETTTAGIVIQSPQLDINTVAAGGSSRLFWENGLFRVGPESA
                     TADPGPACYRKGGPLTITDANLFLGRLVPEFFPSIFGPNEDESLDLETTTKLFLELTK
                     TINNDLNASFTPDEIAYGFLKVANESMARPIRAITEAKGHTVQHHRLVTFGGAGGQHA
                     VAVADSLGIREVLAHRYSSILSAYGIFLADVVEEKQEPCSFILGDSSTLEKVNTKFSA
                     LCAKSKESLLSQGFSVSDLIFEKYLNLRYEGTETSLMILQEEDKNFSDLFTQSHMTEF
                     GFAFKDKNIIVDDIRVRTIGKSNVRKENSVDSQLAALPRNYIDKSSSASFSKSVYFDG
                     KRVDTPIYRIESMPLGSVIVGPAILADGTQTNVIPPNTEAVILKSHIFIKLLDQTEKL
                     NSTDTNAVDPVLLSIFSHRFMDIAEQMGNQLRKTSVSTNVKERLDFSCALFDQVGNLV
                     ANAPHVPVHLGSMSTCISAQAKLWEGKLKPGDVLITNHPDIGGTHLPDITIITPSFSE
                     ESGELLFFVASRAHHADIGGILPGSVPPNSKELYEEGAAIYSELITKDGEFQEALVRK
                     FLLEDPAKYPKCSGSRKISDNISDLKAQVAANNKGIQLIKNLIEEYGIEVIRTYMEAI
                     QQNASNTIKSMLKKMTKHFNKNEFSGEDMMDDGTVIKLNVKLDIENEKYIFDFSGTSP
                     QVYGNLNAPEAITNSAILYCLRCLVGEDIPLNQGCLKPLTIKIPKGSILSPTKGVAVV
                     GGNVLTSQRVTDVVLKTFNVMADSQGDCNNFTFGTGGKDELTGESKDGFGYYETICGG
                     HGAGCDSWRGKGWDGVDAVHTNMTNTRITDVEILERRYPVILNEFSIRENSGGLGKYR
                     GGNGVIRDMTFRKAMQASILSERRVVAPHGLEGGSDGERGVNIWVRHESNTMINMGGK
                     NTVPIQPGDRIIIKTPGGGGCGSI"
     gene            complement(<20548..>22500)
                     /locus_tag="KLMA_40008"
                     /db_xref="GeneID:34716005"
     mRNA            complement(<20548..>22500)
                     /locus_tag="KLMA_40008"
                     /product="cd12148 family transcription factor"
                     /transcript_id="XM_022819280.1"
                     /db_xref="GeneID:34716005"
     CDS             complement(20548..22500)
                     /locus_tag="KLMA_40008"
                     /codon_start=1
                     /product="cd12148 family transcription factor"
                     /protein_id="XP_022675861.1"
                     /db_xref="GeneID:34716005"
                     /translation="MASNKGKRACETCKKRKKKCSGELPCIYCVKIGNSQDCEYKTRL
                     PKKKVKVSERYITTLKSKVRLLESRLAKINSDNSDDEVQFTDELNPLVERGNSASPNI
                     VVEKNLGDSGCLSFLARIQNTLLNCTGMQSLDQDLSTKYVEFSQKLDWDILWEAYRDI
                     PSLDKARRLIRFAQRTVGADYLFVNNQYIENTIPRVFYKNKTEIEEQYSAVGFAEELA
                     LFYSYLAMGCLFQNPTSNEEWKENDRPNGFAYFEKALYIQGMILKYSDQSNGTNLVQS
                     FLYVAYYSLSVDKSSLAYVLVGNAIRIALVLRLHKRSNSQTSNRLFWLCFLYDRILAI
                     RFGFPLIIEEKDIDIPLYSAFDDNYLAVSLEKYHFEAQIALAKITTNIIKRIYTKNST
                     SFIHNCHSILKELKSWFDNLPPQLKFDYNNINPTTSRSTINLHINYNYLIILTTRSVA
                     FYVFNKVLSTGKTTDQLFVGNLKEIITILLESSISAAQIQSMILTKLYYNGKMMSRSF
                     LDSHYIFNSSIVLILAVFLRSLPNYLIGNVHDVSVLVSRVQDNLDVLQQISQYNVAAY
                     NLNKQLTELIELISCDKVQKQFQGSIQNLMMEQQQKNENDLGGLSHIDLSEVLDLIIT
                     NDEEGDAINSYFDEEDFIRYSNFNNF"
     gene            <23319..>25394
                     /gene="DUR3"
                     /locus_tag="KLMA_40009"
                     /db_xref="GeneID:34716006"
     mRNA            <23319..>25394
                     /gene="DUR3"
                     /locus_tag="KLMA_40009"
                     /product="urea active transporter"
                     /transcript_id="XM_022819281.1"
                     /db_xref="GeneID:34716006"
     CDS             23319..25394
                     /gene="DUR3"
                     /locus_tag="KLMA_40009"
                     /codon_start=1
                     /product="urea active transporter"
                     /protein_id="XP_022675862.1"
                     /db_xref="GeneID:34716006"
                     /translation="MQPVFSQGVGYGVILGLGVFFAVVMNTVTYLQNRFFSSKSSQAD
                     EFTAASRNVPLGLMVVSIVSSWCWSLTLLQSATESYNYGISGSYFYAVGGLIQVSVFS
                     IVASKVKANANLVTTFPEAGYLRFGNMGHLAFLWCGIACNTIVSACILLGGGAVINAI
                     TGMNTYAALYLVPLVCAIYVYFGGLRATFISDAMHTFPLLVFLIIFVFVIYGGGSSII
                     GSPGKMWDLLTEVAHKNPVNDNYHGSFLTFRSKDGGIFLFISIITGFGLVVLDQAYWS
                     RAIAAQPLKTSKAYFIGAVAWFVIPWTMGLCLGLGARATSLMADFPELSTSEISAGLS
                     AVAGASHLVGKAGTGMILVMIFLSVTSSFSGELIATSTLLSYDVYKKYIRKNASPHEV
                     LVVSKYCVFLWAIFAGSIASIFHAVGISMGWLFNFLGCATASGVFPVALTFTWNKLNR
                     WGAVSGSIGGMILAIIVWLITCKAYLGEINVDNLANRWVSFAGNATALFMGGILSIGF
                     SLWRPDNFDWDDIRNRTILSENLDDSKSKAFSTEKANAEGTEKIQYEVEVTREAEVFD
                     ESSSTSSGKVSRDLDLPQEEDIPLDKLRRQFKLFTILSITFAAIFAIAVPIPMIASPY
                     VYSKKFFTFVVVVNILWLFSTFFVCVILPVFESRHFLKKLILHVSGIRKADFGNNAKN
                     ETIVEEEDI"
     gene            complement(<25551..>26609)
                     /locus_tag="KLMA_40010"
                     /db_xref="GeneID:34716007"
     mRNA            complement(<25551..>26609)
                     /locus_tag="KLMA_40010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819282.1"
                     /db_xref="GeneID:34716007"
     CDS             complement(25551..26609)
                     /locus_tag="KLMA_40010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675863.1"
                     /db_xref="GeneID:34716007"
                     /translation="MSAESPLRVGVVGTGIFATKKHLPTYQKSNGKFKAVACFNRTKA
                     KAEKFAKVASIEPSKVYDDLDHLLKDETVDVVDVMVPVQFNYETAKKCIEAGKAVTLE
                     KPIEANIEQARKLVKLADSTDIPIAIAENWLHLECIKVVKEKLSKIGPIAAFTYNSTG
                     AFYPSGEYMGTSWRQHPQHIGGFLSDGGVHQLALLTTLLGEVGSIAAFSRQLREQSGA
                     DDIVFSSLKLKDSDVIGTFTYGSAFGATEKSIFLKVYGLNGSVLLNVSARNGATIKTM
                     IGATGEVEAKEETIQVKEQEFFGVEDEFANFHEAVVKKDKSLLKGSPRVAFHHLAVVA
                     AFLESAANGGSAVTVTEP"
     gene            <27260..>28171
                     /gene="ESF2"
                     /locus_tag="KLMA_40011"
                     /db_xref="GeneID:34716008"
     mRNA            <27260..>28171
                     /gene="ESF2"
                     /locus_tag="KLMA_40011"
                     /product="pre-rRNA-processing protein ESF2"
                     /transcript_id="XM_022819283.1"
                     /db_xref="GeneID:34716008"
     CDS             27260..28171
                     /gene="ESF2"
                     /locus_tag="KLMA_40011"
                     /codon_start=1
                     /product="pre-rRNA-processing protein ESF2"
                     /protein_id="XP_022675864.1"
                     /db_xref="GeneID:34716008"
                     /translation="MGKSYSDVDDFSSDDEDNQVLITQKNTKSVVQQDVPSEDEGAIS
                     EDEADKEADQETKDKEDDEESDDRSPAQKEEDLQALKQKQLKKLKSDRKSKHKTGVVY
                     MSRIPPYMKPAKLRQILSRFGEVDRLFLKREDEHKHQQRVKSGGNKKTMFEEGWAEFI
                     RKKDAKLCASTLNGNIIGGKKGNFYHDDVMNIKYLPGFKWADLTEQIARENDIRQAKL
                     QLEISQANKLNAEFIHNVEKSKMVQKIKASKSKRQGDSAENAEEEEIRRSFKQRKVAS
                     TRAAAPESQKQTKAQSETLNNVMSSLL"
     gene            <28541..>30656
                     /gene="NOG2"
                     /locus_tag="KLMA_40012"
                     /db_xref="GeneID:34716009"
     mRNA            join(<28541..29347,29913..>30656)
                     /gene="NOG2"
                     /locus_tag="KLMA_40012"
                     /product="nucleolar GTP-binding protein 2"
                     /transcript_id="XM_022819284.1"
                     /db_xref="GeneID:34716009"
     CDS             join(28541..29347,29913..30656)
                     /gene="NOG2"
                     /locus_tag="KLMA_40012"
                     /codon_start=1
                     /product="nucleolar GTP-binding protein 2"
                     /protein_id="XP_022675865.1"
                     /db_xref="GeneID:34716009"
                     /translation="MGTFKKEKQRRVREGNVKDGNLRVKGENFYRDSKRVQFLNMYKG
                     GRSVRNAKGDIIKAAPLQDTAAPTARVAPDRRWFGNTRVISQDSLSHFREALGDNKKD
                     SYQFLLRRNKLPMSLLDEKDTTESPTARILETEPFDKTFGPKAQRKKPRVAASSLEDL
                     ISSTENDNKTYEEKLELDSTLGLMGKQEEEDGWTQMTKEAIFHKGQSKRIWNELYKVI
                     DSSDVVIHVLDARDPLGTRCKSVEEYMTKETPHKHLIYVLNKCDLVPTWVAAAWVKHL
                     SKERPTLAFHASITNSFGKGSLIQLLRQFSQLHKDRHQISVGFIGYPNTGKSSIINTL
                     RKKKVCQVAPIPGETKVWQYITLMKRIFLIDCPGIVPPSSKDTEEDILFRGVVRVEHV
                     SNPEQYIPGILKRCKRQHLERTYEISGWKDSVDFIEMIARKQGRLLKGGEPDESGVSK
                     QILNDFNRGKIPWFVPPPEKDEKADSKDDGKKRSSSEKDEQEEKEAEKDTEKEQEEEP
                     VLKKAKKD"
     gene            <31010..>32371
                     /gene="POP2"
                     /locus_tag="KLMA_40013"
                     /db_xref="GeneID:34716010"
     mRNA            <31010..>32371
                     /gene="POP2"
                     /locus_tag="KLMA_40013"
                     /product="nucleolar GTP-binding protein 2"
                     /transcript_id="XM_022819286.1"
                     /db_xref="GeneID:34716010"
     CDS             31010..32371
                     /gene="POP2"
                     /locus_tag="KLMA_40013"
                     /codon_start=1
                     /product="nucleolar GTP-binding protein 2"
                     /protein_id="XP_022675866.1"
                     /db_xref="GeneID:34716010"
                     /translation="MQSVNNQINGMGNNEQFFGKGTVLPQMKQGMMFSPSMNATRMLP
                     QQAQQQAQLLQGLDNNNAGLQNSYLLKQKMDVVNNAFGQQQQQQQQQQQQQQQQQQGK
                     MAIPNNGQISMMMQNSMSGNIPQNNGIPQQVQVQFPLPVQQQQQQQQQNIPNNRDTIL
                     PNSSHTPISSPAHLLIRDVWQSNVNFEFAIIRKMIEQYKVVSISTEFVGTIARPIGNF
                     RSKTDYHYQTMRSNVDLLTPIQIGLSLSDLQGNKPDNFPSTWQFNFHFDVTKETVNSE
                     SLELLKKSGVILERHQQNGVDFDEFTQLMMDSGLLLNDEVIWISYHAAYDYGFLINRL
                     MNASMPNNKEDFEWWVQKYIPMSYDLNLINKLVHEVTQQHPHPPPPHLLQNQQQQQQY
                     TLELLADELGIPIFPLFSSAAGQSLLALLAYTQLGKLSMYKLRNGTDFSYYRNMIYGI
                     TQE"
     gene            <33137..>34657
                     /gene="BRE5"
                     /locus_tag="KLMA_40014"
                     /db_xref="GeneID:34716011"
     mRNA            <33137..>34657
                     /gene="BRE5"
                     /locus_tag="KLMA_40014"
                     /product="UBP3-associated protein BRE5"
                     /transcript_id="XM_022819287.1"
                     /db_xref="GeneID:34716011"
     CDS             33137..34657
                     /gene="BRE5"
                     /locus_tag="KLMA_40014"
                     /codon_start=1
                     /product="UBP3-associated protein BRE5"
                     /protein_id="XP_022675867.1"
                     /db_xref="GeneID:34716011"
                     /translation="MTTYDVKEIGYAFLKTYYERMHNDPSKLSCLYSSTAELTHINYN
                     DPIKHDKDYLNTVKLIGKDNINNFFTRNSKRVQDLKVKIDSCDFQSTGYESSSILILT
                     LGELCWTDSPSYRFCQCFILEPAEYNNKIYDLKNDIIRFIPALGPLEKPVSDKPSEQV
                     VVSGSIEKSAEKSVEKPMEKPVEKPAQEPVATPPVVTAKPVEITKPVPKKQDPPVAVA
                     VKSPLSEEKEKEKEKPSAASSVSQASKAKPKAEEEEVQKQSSSPTPSSTTTSTPIPTQ
                     TPTPVSTPNPASTSTSTNTNAPQTQAEPVKMTWAGKLNKTSKLTTNYIKVDVSTKKSK
                     SPPPNGFTKQNKKNKQQQQSKPIGDVIIQNSHGYYPVYVGNTNGLTASELEKALIKEY
                     GEVMKTTFQDSFAVVDFKEKSARDAAIEAQHLKVGERTINLNPKGDKASKYKSKNSNG
                     NSNNNNNNNNNSNGNGSFSHNSTHNTPSPSSDLPSSQNNSAYKKGSLKSRNDKSKN"
     gene            <35169..>36251
                     /gene="OCA4"
                     /locus_tag="KLMA_40015"
                     /db_xref="GeneID:34716012"
     mRNA            <35169..>36251
                     /gene="OCA4"
                     /locus_tag="KLMA_40015"
                     /product="protein OCA4"
                     /transcript_id="XM_022819288.1"
                     /db_xref="GeneID:34716012"
     CDS             35169..36251
                     /gene="OCA4"
                     /locus_tag="KLMA_40015"
                     /codon_start=1
                     /product="protein OCA4"
                     /protein_id="XP_022675868.1"
                     /db_xref="GeneID:34716012"
                     /translation="MLVPPANFGIPEEGIYRCSKLETINLSFLETLNLKTIIFVGGQL
                     PSNFFKEFFDTSGIEYFVIKTLGDSSSLIAPDQKKRQLHHRDESLVRKNGTEDDLATD
                     EGYRYSLTDQDDLMLIKSQSIQRIFKIMLDVSYHNVLLVDKTSVVIGILRKVQKWELS
                     SIISEYRLFTGKNRNYFAETFLELINIRLIQDDTETKPGASTSTPNSVRSRSPKRRIA
                     QQDRQTSSHTGETQLTTSQQDLNSQGTVIVQESDLLMPPEVPQHMMSMIQNMELNTEG
                     NIKTQQKPQGSMALGIFGNRYRLAFDRRERGEYTYYEPTSPKDAFSISVPREELLPTW
                     FKYQRDLWDQQHAVQEHNYYKESIFA"
     gene            <37386..>38723
                     /gene="LYS9"
                     /locus_tag="KLMA_40016"
                     /db_xref="GeneID:34716013"
     mRNA            <37386..>38723
                     /gene="LYS9"
                     /locus_tag="KLMA_40016"
                     /product="NADP-dependent saccharopine dehydrogenase"
                     /transcript_id="XM_022819289.1"
                     /db_xref="GeneID:34716013"
     CDS             37386..38723
                     /gene="LYS9"
                     /locus_tag="KLMA_40016"
                     /codon_start=1
                     /product="NADP-dependent saccharopine dehydrogenase"
                     /protein_id="XP_022675869.1"
                     /db_xref="GeneID:34716013"
                     /translation="MKNVLLLGSGFVAQPVVDVLSATEGISVTVACRTLQKAEALAQA
                     SGSKAISLDVSDAKQLDAALAQHDVVISLIPYTYHPDVVKSAIRLKKDVVTSSYISDA
                     LRELEPEIKAAGITVMNEIGLDPGIDHLYAVKTIDEVHKAGGKIKSFLSYCGGLPAPE
                     DSDNPLGYKFSWSSRGVLLALRNSAKYWKDGKIETVSSEDLMASAKPYFIYPGYAFVC
                     YPNRDSTLFKELYHIPEAETVIRGTLRYQGFPEFVKALVDMGMLKDDPNELFSSPIAW
                     NKALSSYLGAASSSKEDIIKAIDSKTQWKSDEDRSRILSGLAWLGLFSDKEITPRGNV
                     LDTLCATLEELMQYEEGERDMVVLQHKFGIEWADGTTETRTATLVDYGKVGGYSSMAA
                     TVGYPVAIATKRVLDGSLKGPGLVAPYSPEINDPIMKELKEKYNIYLKEKTID"
     gene            <39124..>39747
                     /locus_tag="KLMA_40017"
                     /db_xref="GeneID:34716014"
     mRNA            <39124..>39747
                     /locus_tag="KLMA_40017"
                     /product="protein MSO1"
                     /transcript_id="XM_022819290.1"
                     /db_xref="GeneID:34716014"
     CDS             39124..39747
                     /locus_tag="KLMA_40017"
                     /codon_start=1
                     /product="protein MSO1"
                     /protein_id="XP_022675870.1"
                     /db_xref="GeneID:34716014"
                     /translation="MSQNGSTNLWSKVKSSTKSLSSSIQNLTIKQEHDGDSPTSTLVH
                     KALVKYYSTQEPFQGYPEWLGHKADPSEERKHMTRRDEMDKTGSSQVPAGQRQGHGQP
                     QPPQQGYGQRQGNDHGHGIVPQRRTPGSSLFQGIVSSNNQNTVGSHASSVSTNAGMHS
                     FKSDPSLSTADRPSISSNSSRYDSVSSRLMQSRLRMNRVPSNPQFET"
     gene            <40048..>43938
                     /gene="OXP1"
                     /locus_tag="KLMA_40018"
                     /db_xref="GeneID:34716015"
     mRNA            <40048..>43938
                     /gene="OXP1"
                     /locus_tag="KLMA_40018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819291.1"
                     /db_xref="GeneID:34716015"
     CDS             40048..43938
                     /gene="OXP1"
                     /locus_tag="KLMA_40018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675871.1"
                     /db_xref="GeneID:34716015"
                     /translation="MSKIRIAIDRGGTFTDCIANPGSGNPDDDVVIKLLSVDPRNYPD
                     APLEGIRRLLEICEKKKIPRGQKLDISGVESIRMGTTLATNCALERTGERCALVTTKG
                     FKDALVIGNQTRPDIFDLAIKRPGPLYETVVEIDERVTLTDVDSDDIISRKDKDLRVG
                     KSGETVHILKKINEDEVRATLKILYATGIRSLAVSFLHSFTYQEHEQVVGRIAKEIGF
                     EHISLSSEISPMIKFIPRANSAVADSYLTPVIKSYLNGIESGLSEAQDTRIQFMQSDG
                     GLVDSHKFSGLRAILSGPAGGVVGYSATCYDPETNIPLIGFDMGGTSTDVSRFGDGKL
                     EHIFETLTAGIVIQTPQLDINTVAAGGSSRLFWKNGLFKVGPESAAAHPGPACYRKGG
                     PLTITDANLFLGRLVPELFPSIFGPNEDEPLDIEATTRAFEEMTDHINKDMGSSLAVD
                     EVAYGFLKVANESMARPIRTLTEAKGHVISNHRLVSFGGAGGQHAVSIAETLGIDTVL
                     IHRYSSILSAYGMFLADVVEEAREPCSYILDESSSNSMSLIYDKIDKLMQECTQILLR
                     QGFSEESIKIERFLNLRYEGTETSLMVSQDKDDNRGFAQKFHELHQAEFGFRFEDKNI
                     IVDDVRVRATGLSNVRQEESIDAQLSKISSTLESEITLPEPLFTKPVMFENGWIETPV
                     YSLDHLKIGSVVKGPAIIADGTQTNLLTPNSVGTILKSHIFIRIQENKPASSTTFNGV
                     NSHDVVDPVLLSIFGHRFMDIAEQMGNQLRKTSVSTNVKERLDFSCALFDKDGNLVAN
                     APHVPVHLGSMSTCIKKQAQLWKNKLNPGDSIVTNHPDVGGTHLPDITVITPSFDKTS
                     GELIFYVASRAHHADIGGILPGSMPPNSKELFEEGAAIYSEKLVENGKFDEKKVVKLF
                     FEDPAQYPGCSGSRKLADNISDLKAQIAANTKGIMLVSELVKEFGFNEIEKYMHAIQK
                     NASDTVKKTLKIVAHQLMQSQENLSRDSNNDVAIFESSDFMDDGTKICLNITLDPANE
                     KFTFDFTGTTPQVYGNLNAPEAITFSATLYVLRCLVNEEIPLNQGCLDPVDIIIPVGS
                     VLSPRQGAAVVGGNVMTSQRVTDVILKALGVQADSQGDCNNLTFGNDNFGYYETICGG
                     HGAGCFYWRKLPGQDESQVAWNGTSAVHTNMTNTRMTDVEIFERHYPVILRQFSIRSG
                     SGGIGRFTGGNGVVRDIEFTEPVQASILSERRVNPPHGLNGGHDADRGVNLWVQNKTQ
                     SVVNLGGRNTINAQPGDRIIIMTPGGGGYGVPDA"
     gene            <44511..>46196
                     /gene="YCT1"
                     /locus_tag="KLMA_40019"
                     /db_xref="GeneID:34716016"
     mRNA            <44511..>46196
                     /gene="YCT1"
                     /locus_tag="KLMA_40019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819292.1"
                     /db_xref="GeneID:34716016"
     CDS             44511..46196
                     /gene="YCT1"
                     /locus_tag="KLMA_40019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675872.1"
                     /db_xref="GeneID:34716016"
                     /translation="MISGASSSSSLENDDREVRDVEKFGKVTSLITEGHAIEHFSDDS
                     EIDVKIGAGTDSNSGKKYKIVSSRDADVTLEFLEQWDSKVPPITEEQEKRLSRKVTWI
                     VVSLTAFINLILYSDKATSSYASILGLFEEIGMTQNQYNNSNTLFYVGFIVGQVNLIF
                     VQKYPLKYVVSSMTALWTVLVFLHCTASSYKGWYALRFFLGFVESIALPCLNTTMSQF
                     LTADEKAATAPIFYSTCVGVTIPVGFIAYGVLNIKHSPVSLWKIFMIIIGGCTFLLTI
                     LILAVYPNNPTDAVFLNDEEKVWVIRRVQNTTNSSIEQKVIKKYQIKEALYDPISWLF
                     GLFFLLQQLANNLTYQQNILFKSIGNISSLDSTLVSVAAGGFAVICCIIATTFLLYQK
                     NFTAFSVVFWTIPSFVGSIAMVSLPFHAHIALLGMLCLASPAFGVPWILMFSWNSATC
                     SGYTKRLTRNAIVMFFYCVANLISPQLWQDKDGPRYYPAWIVQIVLSFSIAPLIALVI
                     WYILRKRNIERVKALSEEEKKFGLIEVNGEKLKANIAMLDLTDLENKTFIYPL"
     gene            complement(<46387..>47064)
                     /gene="UBC1"
                     /locus_tag="KLMA_40020"
                     /db_xref="GeneID:34716017"
     mRNA            complement(<46387..>47064)
                     /gene="UBC1"
                     /locus_tag="KLMA_40020"
                     /product="ubiquitin-conjugating enzyme E2-24 kDa"
                     /transcript_id="XM_022819293.1"
                     /db_xref="GeneID:34716017"
     CDS             complement(46387..47064)
                     /gene="UBC1"
                     /locus_tag="KLMA_40020"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2-24 kDa"
                     /protein_id="XP_022675873.1"
                     /db_xref="GeneID:34716017"
                     /translation="MLRSKRILKEIQAVKEDPEAQIELRFVNESDIHHMKGSFIGPRG
                     TPYEGGKFIVDINIPVEYPYKPPQMKFDTKVYHPNISSVTGAICLDILKNAWTPVITL
                     KSALISLQALLQSPEPNDPQDAQVAKHYLSDKKSFDETAALWTRTYATENGTNGSEDI
                     NGTSNEEQPDEADLYGIDQELVNQFIGQGFERHSVIEVLKRLNIKSMNLEDNDTANKI
                     LEELLKE"
     gene            complement(<47409..>48569)
                     /gene="CDC50"
                     /locus_tag="KLMA_40021"
                     /db_xref="GeneID:34716018"
     mRNA            complement(<47409..>48569)
                     /gene="CDC50"
                     /locus_tag="KLMA_40021"
                     /product="cell division control protein 50"
                     /transcript_id="XM_022819294.1"
                     /db_xref="GeneID:34716018"
     CDS             complement(47409..48569)
                     /gene="CDC50"
                     /locus_tag="KLMA_40021"
                     /codon_start=1
                     /product="cell division control protein 50"
                     /protein_id="XP_022675874.1"
                     /db_xref="GeneID:34716018"
                     /translation="MVRLFSRSRKHTDSDEGSAVRKSRKPPNSAFRQQRLKAWQPILS
                     PQSVLPLLIVIAAIFAPIGIGLIITVNNVENLSIDYSQCHKLASNDYKEIPSKYVKYH
                     FKNKVEEKPQWRLESSGDDQTCLLRFEIPHDIKKSVYVYYKLTNFYQNHRKYVSSFDI
                     DQLKGHAIDPDNLVSDCKPLREEDGKAVYPCGLIANSLFNDTISLSLNNTANKEESYQ
                     LTNKKIAWSTDRKRYKKTKYKASDIVPPPNWRKRFPDGYTEENLPDISKWEELQVWMR
                     TAGLPKFYKLAAKNENGTLKKGIYETSIGLNYPVQIFGGSKSYILTTNSIVGGRNMSL
                     GIVYLIVAAVAIMFAVIFVIKLVVTPRKMGDHSFLHFAEQDDETVPPASSST"
     gene            complement(<48873..>55292)
                     /gene="CDC39"
                     /locus_tag="KLMA_40022"
                     /db_xref="GeneID:34716019"
     mRNA            complement(<48873..>55292)
                     /gene="CDC39"
                     /locus_tag="KLMA_40022"
                     /product="general negative regulator of transcription
                     subunit 1"
                     /transcript_id="XM_022819295.1"
                     /db_xref="GeneID:34716019"
     CDS             complement(48873..55292)
                     /gene="CDC39"
                     /locus_tag="KLMA_40022"
                     /codon_start=1
                     /product="general negative regulator of transcription
                     subunit 1"
                     /protein_id="XP_022675875.1"
                     /db_xref="GeneID:34716019"
                     /translation="MSETQENSTLAKESHAIENKPSLYLNQDKETGNIQEVSSTFQGY
                     VFRQIRILVASATEENLFETQKHISLLLQRGSWSLYIDYWKLLVRLFSKDIEEANEIR
                     RLSEDKEKLADFKKPNIELLYILAYELSKRSPDTIEKVKESVFEKEFGESTFELLLAL
                     FETGDPDNTEALKSLNPQPPTNSLKELLKSKMSVSNIAQNLFAPENKPNFLTMLSEFL
                     KPLSGETLNDWIALILSEVLAPGSQTSTQQSQPQQQWAVQMPNVDNQEVAEAGEMGNK
                     VHTVIKSLGTTNVNWNRVFNLMSTKYFLNKSVNATLPSLNYLFCILNSGPLVDQFFAC
                     DWSLHFKLRLSYLMYQWNYNSECLDLTKLTNIKKINKSIPLTKNSLLSLVSVGKLNIE
                     LFLSRDEISKDVLFSSFHASFSEAYNNVPEYLAAVLISEAKYFALLVDNKSIIDELLI
                     SLIIKTYENNVVAFKELLKLISKQKVIDVSRGIVASQNQQTSNLIQTLHELNLLDEVM
                     EKFPVRESLKLCAPIVRLGYMDFTDYLNKNINLKSFSHVLEFLDSETNVDDIDSSVKA
                     LKLLDLNSLHRLITHTVGLKLSIEERTNLNNVIFKLLIAFPRLINYGHGHDEAIVANG
                     DHAPIPQDVEKKMQTYLQKMYNKEMAIKDIVDTLRKLRDSDDSYDQDVFCCIIHAVIA
                     ETTFFKEYPLEALATTSVLFGSMILFDLLRGYVLDVAFQIIFSFAKENPDSKMFKFAV
                     QALYAFRMRLNEYSAFCRRLLDEIPGLQTQPQIRQILEEAAASPNVEVAERKVPALVE
                     LSYFNINEVISPVVQETPPREVTERILFNVNNTTMSNFDTKIVELISVLEERYYQWFS
                     NYLVNQRAKTEPNNHTLYAKIIQTIDSKLLHAYMLNFTYKQLFIFLSTKELGQNEKTH
                     MKNLAAWLGCITLSLDIPIKHKHIAFRELLLDAHKKDRLTVIIPFVARVLMQSGESKV
                     FRPPNPWTMGILRVLLELNKKTDWPLSLSFEVEVLFKHLGLKFSDISPSHYLEVPDAA
                     EYLSGNLRHLSAEKQQLEQQQQLLLMQQYQQQLILLQQRHQQQIHPQQQPQQRIISNG
                     FGNTINEQTNIETTDTNYSTLVGKSVFVTHPDLKRLFQMAMSKSVREILIPAVEKASN
                     MAVQSTVNIVLKDFATEVDEQKLKTAAINMVQYLAQNVAHSISVPLLKDTIRNTTQSL
                     TPNLINMTNSPIAELNTAIDDNISIAVSPIEKAAVERAIQEVNEKLIQAVAVRRYHLE
                     RRADQPFVAQNINRFSMNLPDPLGLKPTGVTREQFSLYEQFPGSLGSDENRSPLQSIS
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLLLQQLQQNQNQNQNPNQVQ
                     GQTMNQPQGASQNMLNISGAFPPQAQPPQPAISAVHTELEQNHRVLLHLMDTLVSQIK
                     DYSDDTDFELQKDSTIKNTIVEILSFISRSNQKDQLSLKVSQAVVNSLFGSNESKLCR
                     DVLSLLLEKLCSLSMVARKDVVWWLVYALDPRKFNVPVVRSLLEVNLINIAELDAVLV
                     TAMKNGMTGATEFSMNLIRDTVMSDSPILMRLDFIRVLGYLRTVKTPEIKEFLDEYEQ
                     CLAVPVSKNTPVTKTERYYLVFTEWVKLQQRVESDDVVNTVFIRQLFDKGVIDNKEKI
                     IEFTKAALELSVNSFKQSDPTGEVFTSIDALSRLITALLVVQDFDVEERKEYLNLLLS
                     VVTLVFAKDHQTNNTSFNERPYFRLYSSLLSDWDKLRDHNFIRVSNPVIRKSLIEFDQ
                     PFFDIFASFLHSYQPIAFPGFSFAWITLISHRMFLPKVLRSKERYGWDKLVLLLIDLM
                     KFLSQYVKKGNIPDSISVIYKGTLRVFIGIANDVPEFLIQNHYKLVKNVPPTCLQLRN
                     IILSAIPKKMMITDPFSSEITEDNCVSIPKVFYDPSQDLKSLKKPVINYLRIPSTSIL
                     RTICGALFRTELEYENGIGYDENSVDVGLIHAIVTHVAVEVGLEVERASKNAVFNVKS
                     SYYTLLFGMLSDGNDEVKLHVIQAMVNQLRYPNVHTHWFNFALKLMFQSTEWPDDQLQ
                     TIQEVILRVLLERIIVNKPHPWGVVVTFMDLLRLEGPSMTEKPFVTSTPEIHTIIKNM
                     QKYAISS"
     gene            <55975..>59094
                     /gene="MSH3"
                     /locus_tag="KLMA_40023"
                     /db_xref="GeneID:34716020"
     mRNA            <55975..>59094
                     /gene="MSH3"
                     /locus_tag="KLMA_40023"
                     /product="DNA mismatch repair protein MSH3"
                     /transcript_id="XM_022819297.1"
                     /db_xref="GeneID:34716020"
     CDS             55975..59094
                     /gene="MSH3"
                     /locus_tag="KLMA_40023"
                     /codon_start=1
                     /product="DNA mismatch repair protein MSH3"
                     /protein_id="XP_022675876.1"
                     /db_xref="GeneID:34716020"
                     /translation="MYQPTISHFFKSSQASSSQEASSKEEIQKEDAGEVGENMNKQEL
                     INILDSDSDADSDIDVRIENGDIHKDSCPIDEQKEIGTDSVNGRDQKVKSVSLKLNGF
                     ASNGSISRQDNFNERLKSIMKKRSIGSLFSNESEEEADADEKKSKSAKKLKGSSKLTE
                     LDQQFKELKLNHMDTILCVRVGYKYKFFAQDAEIVSNILQIRLVPGKKTLDDSDPNDK
                     NYRKFQYCSIPDTRLHVHLQRLVYFNYKVAVVEQTETSALKKNSTNGNTLFAREIKNI
                     FTKVSYGVNESFNKAGDDVLGDLSSVWAISLNETSKLRKVTIVSVHLNSGEVIFDQFT
                     DDKLLNVNLEARIRHLNPTEVISEVELPASIKTIFTRINHDAQFYQSHKEDCPELMAI
                     LEHLDLHPDIKRLLSILHSYLSTFENNKVLYFPSNYSSFTSKHSMVLPNDSVVNLEIF
                     ENSTTHKTMGSLLWVMDHTRTTFGFRLLRKWISKPLIDIESIQQRQDAVTCIMAEVRN
                     IFFESLNEILSKSIDLERSLNRIAYGSTSRKEVYFFLKQIASFSSLFNSHHVYIKDQL
                     HNENSRIRNGSVLLYNILKELNDFFVTTNLPLLLEMINVDAALDKNVHKNAVEFFNLT
                     KYDSSATLLQKHRDIEDVKMELEEELHNIRKILKRPAMNYKDTKDYLIEVRNTQIKSI
                     PHDWVKINATKTVSRFRTPKTEALINKFRYHNDLLSILAEEEFKNFLNRIIKDYSHIK
                     KCINNLATYDCILSLAATSSNINYIKPCFTDKSQTLKVKNGRNPIIESLDVNYVPNDI
                     LMSSNKSKINIITGPNMGGKSSYIRQVALLVIMAQIGCYIPADSAELSICDRIFTRIG
                     SHDDLVKGKSTFQVEMSEVLHILNSATPQSLLLLDEVGRGTGTHDGLSISYAILEYFI
                     TLRERCPMVLFITHYSDLCRIDSPLVANYHMSFIEKYREGEKWANVIFLYKLVPGQTH
                     NSYGFNVAKLSNIPTNIINRAFEVAQEKLLSNKHNALIETINTMKNVNQRKITTEDIR
                     RIQFFTKDI"
     gene            complement(<59105..>61444)
                     /gene="FPK1"
                     /locus_tag="KLMA_40024"
                     /db_xref="GeneID:34716021"
     mRNA            complement(<59105..>61444)
                     /gene="FPK1"
                     /locus_tag="KLMA_40024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819298.1"
                     /db_xref="GeneID:34716021"
     CDS             complement(59105..61444)
                     /gene="FPK1"
                     /locus_tag="KLMA_40024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675877.1"
                     /db_xref="GeneID:34716021"
                     /translation="MDSVVIDKVDINQPDISNSRERSRNISSFSKLIPKSIWKSQQQQ
                     QQQQQSENPELSGHNSRELEENQVITHEPFHEAPAIVIEESKPVSRESMEQESPSSTP
                     KSSNAKESKFSLRLKKVFGKKDSSHASVESDLSIGTNNESSSDTRNDTSPPLNRFRTN
                     SDTEAKRNMYSAGSQLQSTPLTSPSKSILSLSSNLKHNSSSHNSGSTNLTPKIPASLE
                     MSDASTNGSGFASINNLCNVSTASLNLIDENEEVKNFDGSLSASTDKKNPAFTAPLKS
                     GSESPFLSSQAMKPFPGYEELDNSTHNRSGSGGTSIKPPLRRTASQPTDVNLNGTGKS
                     SPVSKEELSPRRGTVGADTSFMQPPRRSQRLRNKSFSNKFQDILVGPQSFEKIRLLGQ
                     GDVGKVYLVREKQTNRLYALKIFSKPEMIKRKKIKRILAEQEILATSSHPFIVTLYHS
                     FQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALEYLHLMGFIYR
                     DLKPENILLHQSGHIMLSDFDLSVQAKDTKNPVVKGNSSHLLVDTKICSDGFRTNSFV
                     GTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNQTFSNILKNEVVI
                     PNNNEISRACKDLIKKLLIKNENKRLGSKLGASDIKKHPFFKNVQWSLLRNQEPPLIP
                     VLAENGCDFATLSVNPKGSKEKKNSAEQRERLMFEEKVELDDQVSDNDPFHDFNSMSL
                     MKQDNDSLIYGDSTSYGKISYTPNQNRSRSNSHRSFFKR"
     gene            complement(<62128..>62526)
                     /gene="TRM112"
                     /locus_tag="KLMA_40025"
                     /db_xref="GeneID:34716022"
     mRNA            complement(<62128..>62526)
                     /gene="TRM112"
                     /locus_tag="KLMA_40025"
                     /product="multifunctional methyltransferase subunit
                     TRM112"
                     /transcript_id="XM_022819299.1"
                     /db_xref="GeneID:34716022"
     CDS             complement(62128..62526)
                     /gene="TRM112"
                     /locus_tag="KLMA_40025"
                     /codon_start=1
                     /product="multifunctional methyltransferase subunit
                     TRM112"
                     /protein_id="XP_022675878.1"
                     /db_xref="GeneID:34716022"
                     /translation="MKFLTTNFLKCSVKSCDNSNLNFPLHYDGANCQLEQDESIEFNP
                     EFLLRIIDRVDWPAVVTVAADLGNKELPQQKPEFEENLTDEDMVILRDLHTLLIQTNI
                     KEGQMECKNCGHVYYIKNSIPNLLLPPHLA"
     gene            <64095..>65150
                     /gene="ERG26"
                     /locus_tag="KLMA_40026"
                     /db_xref="GeneID:34716023"
     mRNA            <64095..>65150
                     /gene="ERG26"
                     /locus_tag="KLMA_40026"
                     /product="sterol-4-alpha-carboxylate 3-dehydrogenase"
                     /transcript_id="XM_022819300.1"
                     /db_xref="GeneID:34716023"
     CDS             64095..65150
                     /gene="ERG26"
                     /locus_tag="KLMA_40026"
                     /codon_start=1
                     /product="sterol-4-alpha-carboxylate 3-dehydrogenase"
                     /protein_id="XP_022675879.1"
                     /db_xref="GeneID:34716023"
                     /translation="MSTPEIKSVLLIGGAGFLGLHLIQQFHELTPRPNIHVFDVRPLP
                     DRISKQFTFDPSTIEFHQGDLTSPADVRKAIETSHAEIVVHSASPMHGNSQEIYEKVN
                     VKGTKNLLTVAKQCNVKAVVYTSSAGVIFNGQDIHNADESWPIPEVPMDGYNETKAIA
                     EEMVLQANDPEHDFLTIALRPAGIFGPGDRQLVPGLRQVAKLGQSKFQIGDNNNLFDW
                     TYAGNVADAHVLAAQKLLDSSAAKAVSGQTFFITNDTPTYFWALARTVWKADGHIDKS
                     VIVLNRPMAIAAGYLSQFFSKLLGKEPGLTPFRVKIVCAYRYHNISKAKKLLGYHPKV
                     DIEEGIKRTLAWMDEDL"
     gene            complement(<65188..>68787)
                     /gene="VPS8"
                     /locus_tag="KLMA_40027"
                     /db_xref="GeneID:34716024"
     mRNA            complement(<65188..>68787)
                     /gene="VPS8"
                     /locus_tag="KLMA_40027"
                     /product="vacuolar protein sorting-associated protein 8"
                     /transcript_id="XM_022819301.1"
                     /db_xref="GeneID:34716024"
     CDS             complement(65188..68787)
                     /gene="VPS8"
                     /locus_tag="KLMA_40027"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 8"
                     /protein_id="XP_022675880.1"
                     /db_xref="GeneID:34716024"
                     /translation="MTTNDTVSTPGNYTDFERFNPFKDNQDELLHVSWTSLQQIYPNL
                     SLYGGPTVIFPVQLFYVIGTAKGSVIIFTKTQFVQSVLSPSIKDFRSKVTSIDINQDG
                     THICAGYESGDIFIWDLNSDADNESNSNQKEAVLHIASHKGHMFNGISFIPGKHTNIV
                     ASDSTGHIVIHKGNRNHLWQLVPSSKEIMRLNPMTNPLLMTRIRNNGENYEAEHLMAV
                     LSSRSFAIISLSAPTMYTSRLVELPSKNSSAFGYIAWNSFNMNQVAFSVDNQLSLIDL
                     ENLQFQWSYEAPEPICKIDWLTDKIMTILLVSNRLLFIDTNAPNNEEDNAVLTSIDLL
                     VSDIIVPNSENHFAAIGSKIVVLTNYCLKVGKLNSWSDIVLYHIHQGNYINALGTLGF
                     CLQKTTSDSIIGLLRLEKEYDKRMEQIEPSFNNLTLATVQYLLKQSNIDYEKVMETAS
                     LVFDLGMIFSKEKMYGLLEQVGEALMIKHNDEFQEVLYEKIVNGTVTYLSPILFKAVM
                     EYTVSSGMERRLETILLSLDISTLDIDYAMRICKEFQLYPAIFYLWNTILDDYQRPLA
                     DIILFFAGKSEECVIIDENVKSAMLFDYLESTITGRIFPTEKRLVSAEELKVKNEYYN
                     LLFSGSTTEFPVGSGSKLLTKATATEEPVFPYASLLLDKDAGGFLKVLDVSFEDAVFN
                     ESPDRTFQFTRQYLIDALLDILRDSVQDSVKVQISIFICKNLPKYSQFIRLTNTVIES
                     LIDIIYSNKIKELEEPSEQCLEALLSFYTPTDVNLLIEKFSQSSFYHVKLLLYKKAAR
                     YADYLSLFLSDTNNNMSQDSLLSCLKLCQRASESSPVIHHQLNEVICHNFEKIVTSFQ
                     DMDVLVSIIECFDSSLQSNILSVSDKKLVLQYLRCLFCKDYHLSGPFLKEARIKYLSL
                     LYENNDEENITTWIETVDLKNVDIDSVVHIINNYNDSKTLVKLFIRLQRYKSAINEIN
                     SRINALLKDKNLEGINEFLDLGIVVSQSSDNATEEWVALLSNLVSQYPSLTDEQKSMC
                     DRSLQKLFIKLSDRKDENTTNYNDNYFGAIIMQIFEDKSLILNKIQDIKTVLLNIFTA
                     YSVEETTKLLILQIINQSASLDVSTYIRKRREGWAIKSYECEVCGKKIWGIGIENKIF
                     DIWEKNRTLDGKKSEIGDSGILVYSCGHGFHETCLKNMGQHAESYHCLLCDDH"
     gene            complement(<69325..>70387)
                     /gene="EFB1"
                     /locus_tag="KLMA_40028"
                     /db_xref="GeneID:34716025"
     mRNA            complement(join(<69325..69871,70308..>70387))
                     /gene="EFB1"
                     /locus_tag="KLMA_40028"
                     /product="elongation factor 1-beta"
                     /transcript_id="XM_022819302.1"
                     /db_xref="GeneID:34716025"
     CDS             complement(join(69325..69871,70308..70387))
                     /gene="EFB1"
                     /locus_tag="KLMA_40028"
                     /codon_start=1
                     /product="elongation factor 1-beta"
                     /protein_id="XP_022675881.1"
                     /db_xref="GeneID:34716025"
                     /translation="MSFSDFSKVETLQKLNTFLADKSYIEGTSATQADVAAFKAFQTA
                     YPEFSRWFNHIASKADEFESLPAATAAAAEAEEEEDDDDVDLFGSDDEEVDEAAEKLK
                     AQRLAEYNAKKAAKPKPAAKSIVTLDVKPWDDETDLEEMLANVKKIEMDGLSWGAHQW
                     IPIGFGIKKLQINLVVEDAKVSLDDLQQAIEEDEDHVQSTDVAAMQKL"
     gene            <71013..>72326
                     /gene="SFH1"
                     /locus_tag="KLMA_40029"
                     /db_xref="GeneID:34716026"
     mRNA            <71013..>72326
                     /gene="SFH1"
                     /locus_tag="KLMA_40029"
                     /product="chromatin structure-remodeling complex subunit
                     SFH1"
                     /transcript_id="XM_022819303.1"
                     /db_xref="GeneID:34716026"
     CDS             71013..72326
                     /gene="SFH1"
                     /locus_tag="KLMA_40029"
                     /codon_start=1
                     /product="chromatin structure-remodeling complex subunit
                     SFH1"
                     /protein_id="XP_022675882.1"
                     /db_xref="GeneID:34716026"
                     /translation="MSLLPQAYLSNFHNRVKNEDVPLFTAAQLSRNKRGKQVNYAEFD
                     NDILDEFLEKNDDDDLEEDDEDSESRRRGTDFYEHAEFSGLDGENEGVRRGIDEGGVE
                     GGTGGSSGEVGVDVSGAGGAGSSGDAGAGGDAGTGSASEESNRVKLNDLPDLDGQEDS
                     SPLAVLKYPRIRETFVQSRIAISYKDMLGESIQDPQEVETETPIMVPIRLNIEFSGHK
                     LVDFFTWNLNDHSMTPEQFAAILCQDLDFPVHTNPNNSPYTQIIAMINEQLQEYETLA
                     SLQVPDLHVVLNLTSNLDSKLYDDTFEWNLNDDSLCPEQFAELVVQDLGLQREFVPAI
                     AHSLHESLLKVKKDWLEGNLNLVHVENKAAFGFTSGIRLDIDTLGGDWIPKVEVLSQW
                     EIEKREIEKERNMRRLKRESAKVDDGRSRRRGKRRMDDLETTLRI"
     gene            complement(<72996..>73985)
                     /gene="TAD3"
                     /locus_tag="KLMA_40030"
                     /db_xref="GeneID:34716027"
     mRNA            complement(<72996..>73985)
                     /gene="TAD3"
                     /locus_tag="KLMA_40030"
                     /product="tRNA-specific adenosine deaminase subunit TAD3"
                     /transcript_id="XM_022819304.1"
                     /db_xref="GeneID:34716027"
     CDS             complement(72996..73985)
                     /gene="TAD3"
                     /locus_tag="KLMA_40030"
                     /codon_start=1
                     /product="tRNA-specific adenosine deaminase subunit TAD3"
                     /protein_id="XP_022675883.1"
                     /db_xref="GeneID:34716027"
                     /translation="MVKKHLNPTKIDFIQCIVEDCLWQIRDTKYVDIPDLVTAWSVDI
                     NPKESKSVIPFVRSIQDLDPQSFLHVKRIKKVDNSTLRVLIGSSEFLPDRQAFDELMA
                     NVSFRYENVRDDNKVPKIGPSTKTLMLTWSEKYWPLVWRGNPNDQILNDYIFDMKEIR
                     SILSQIAEESRKVMKNAGNEEVPVVSAFVNPKSGRVIISNDYRHSRSPLDHSIMVGIN
                     EVSKLEQTRRNRVRDGTASQEELEQGETYLCLDFDVYTTHEPCSMCSMALIHSRIKRC
                     IFINPMKGSGALKPESGNGYCMHSNRELNSKYEVFQWVGEDLQVPDVDPQLCA"
     gene            <74297..>76876
                     /gene="EST2"
                     /locus_tag="KLMA_40031"
                     /db_xref="GeneID:34716028"
     mRNA            <74297..>76876
                     /gene="EST2"
                     /locus_tag="KLMA_40031"
                     /product="telomerase reverse transcriptase"
                     /transcript_id="XM_022819305.1"
                     /db_xref="GeneID:34716028"
     CDS             74297..76876
                     /gene="EST2"
                     /locus_tag="KLMA_40031"
                     /codon_start=1
                     /product="telomerase reverse transcriptase"
                     /protein_id="XP_022675884.1"
                     /db_xref="GeneID:34716028"
                     /translation="MQIFGEYIHSLPCTKGIKQSSLFINQEQNGLSDLFTDYFIQSNS
                     KKCDIPEFTVSAITQSFHCDVIDTCILHLLHKSFTNNILTYGYQLAKNSDVVTKLFCH
                     SSNTNVTLLKSNVWKLLHELIGTENFMNILLNHSVYLNTGYYFRQIIGNPINAPQVPP
                     TWMNRKEHANVKARLTIDWNNVLYRNVKPQDHKILISPDAVLLFKEIFPNQIVGGKLK
                     GSKKVIMNNLRKCLKEFINNHYKVPFKYIGNKTCPKSSNDFYTSQKNVIRFLVISIRK
                     TIPLNLLGSPNNFSVLYKAVSALVRKTLHTRLSMEELSRGLRINDVNWYKKSGSEDKT
                     APRLEIYQHQIQSNLLNQLFFWLLSVYVPKLVSMFFYVTELSGTINVVYIRHDVWKSM
                     SRPFLKSYFKQYLLENKECQEHRSFSNSNFNHRNLRLIPKKSGSDFRVIAVPCKGINL
                     QEVSDYNDYFKNAVKPTKIILERLRIRKSTKFAKAFSPVEIPMIISEYKRKLINKYGF
                     VPNLHLLKFDIQSCYDSIPVDRVMKLIKREISSSKEFFLRSEDVLSLDSTRLKKRFFI
                     NGDSTKNKNDIVIDSVKSVVLSQLDILSVLEMELFKTSIVYRGKCYLRKDGLFQGTPL
                     SSVLVDILYDNLLESYEEFKHADDNNALIIRLVDDFLVISPSKPYIDKINAIAQLGFK
                     SFNAKVNPKKVLITSSELPGSESVPFCALQINLKTLEVWKDHSSYNVISGDFASTKQI
                     FEKLLWIFEMRLSYNMLDTNLNSLNIALLYMREVSLNLVESFISLFDKKKPTKTAFVQ
                     FMLNIFERIDLHLASNNITSAEKSSGLKRTMMSVFIQQLGLRRDKFKDILGTMDELNA
                     SII"
     gene            complement(<76912..>79161)
                     /gene="BUD6"
                     /locus_tag="KLMA_40032"
                     /db_xref="GeneID:34716029"
     mRNA            complement(<76912..>79161)
                     /gene="BUD6"
                     /locus_tag="KLMA_40032"
                     /product="bud site selection protein 6"
                     /transcript_id="XM_022819306.1"
                     /db_xref="GeneID:34716029"
     CDS             complement(76912..79161)
                     /gene="BUD6"
                     /locus_tag="KLMA_40032"
                     /codon_start=1
                     /product="bud site selection protein 6"
                     /protein_id="XP_022675885.1"
                     /db_xref="GeneID:34716029"
                     /translation="MDTPPVLKSASSVETSVTKLLISTKQLLQVLTQWSKGKSSERNV
                     SDVYVQLGNDFKLVSRHFTHAGVDISDLGDVPKDLRRILEVALRETASEDTLNKYLPQ
                     IREIIVRLLEKLKVKQALIKLNRNEDSTKFRYHQKQRSSVSSVVSNTTSLADTSPTVR
                     STSLAKPTSKSLNEQKSAPVLSLSEASTTDKDQNSIQSSTAKPVGEQKHYDTLEVPTS
                     SSESDALTQLKKGNNLQRRASKRFSAYHMAKLANQTAADPANSPSSKSLAKSTSINLT
                     ENESNNTRTDDHVRSRVSSSASVELHPYSGEQEASGSFDDNSNPNGSHDNIVIFLKVG
                     NKVKRCFTSPNLSFNKLRLLFVEKFAYSPGGDIFPEIYIKEPKYEAFYELEESQLHNI
                     KDGSIFQLQIPAPSLEQQLQKLNEVVVEKQATFFENIKTLIQEISTHPTTPSNHTSGI
                     INQTKSSDSSTVVDVDHHQEIAQIKHEMTILKQIHSSQKKTLENTITDISEKLQKFQS
                     LSVTTGKSANRDYMEKSQSKLSEVSDNLLSKVDDLQDVIEALRKDVAIRGARPPKKKI
                     ENVSLDLESAKNDLERMSKYIEVEKPNWKTIWEAELDRVCEEQQFMTLQEDLVFDLQE
                     DLKKVLETFELVKMCCEQQEKAPKKNKGNPILPIAKPGTFNMIRDQVLYEVQSLNPDH
                     DSRVEAIKKAEKLREREREYRENEAFEDELGNFVEKGNFKKAGGIEEIEKLRKQKDEE
                     NLRMNFGML"
     gene            <79450..>83847
                     /gene="MMS22"
                     /locus_tag="KLMA_40034"
                     /db_xref="GeneID:34716030"
     mRNA            <79450..>83847
                     /gene="MMS22"
                     /locus_tag="KLMA_40034"
                     /product="methyl methanesulfonate-sensitivity protein 22"
                     /transcript_id="XM_022819308.1"
                     /db_xref="GeneID:34716030"
     CDS             79450..83847
                     /gene="MMS22"
                     /locus_tag="KLMA_40034"
                     /codon_start=1
                     /product="methyl methanesulfonate-sensitivity protein 22"
                     /protein_id="XP_022675886.1"
                     /db_xref="GeneID:34716030"
                     /translation="MYNDSIVPNSEASDEEVVIPLCSELDSVSVNNTGDESNFEAPLA
                     VPASKATVLEQHGIEQYSNSIRRALRKRKAIQKMPYSLDRIRHRQMLQGYDVSNFDSV
                     ADNIDLLKDGYESPKKQQQKDINTSQISSSVQDIGYQEEGSVFSIRQRRHHHVHLLDD
                     DMDDEEDETTMAQSSFNINTSESDNEDVDDDPRLSQENNVLFRGRQINLKTGYKGLLP
                     KIAWEKALNSNGVTARYKERAERKLSRNQAQINEKGLAKRKVIRNKNASLNEKDLLNE
                     IVESDNEEDMPSAESFLKLMNEEQSKLERSDTMKDYFLKKYEPEMDTNSEDEDHVDSD
                     ALDIPNEGLELLTLEDTDKVDLGTIIIDDSEDKIDVERSRHATGVIDFMLSKNTRHST
                     DKMASNKPRIKNTGNKSSVHSKLFEKKRTRNTARSHTRGRISLMRKTNSSTASLKSKP
                     NTNNSANNTFQNSHSSNYDLQLDGTTSREQSFNEPVIIKNDDTNEKNTHKTVTAKKKK
                     KPKNRLFTVAPTSNAELNRKAMTFSTVVEEESGKFTLRKPPIKKRSFTLDDDKLLSED
                     NSTSTISSSLWKAIESSSEFPSPDIIRLTLNTKEYVISKFGSNSDNTVQDLLESLIKY
                     GGSDEEVKDLAKNLSEFLFSWNSSTIYDIIDRFHHEFRAKVNTLRERAKPIHFFLIAS
                     CQLFFLEISRYASCSLFVKNQMSEKITDHIVSFFKLYSKSGTKELDPDDPIMSEALVL
                     LSRVVTQLDCKEILWQKIRKNKFSTLVSTVIVETFPTLVPSWDIVKVKQEYEDAVAWI
                     KFIGICSNEPYEWDITNELALDLYEFFKMRKFEDFPQETVYQVYPVVPFPDDESRVTL
                     FNTFINILESCTFKTSTLEKLTAMSKIHNLHSPSLLANRLNLLLTLASKSDYSYERRF
                     EELLEPYIMNNDITINNTMLKIMLEGALSFYKISYEKGYTVRGKFVPLLWKKVNIKYS
                     SMPDKIWRIFWKEFQDIIPQMKKSRVFLLKSFQPILHQALNLEKKLNQTTKLLNIYVD
                     NLSVLDLNWIQTHVLQILVSKAKGNVVYLHYYCKIAKFLTVRNNLTWWSLFHYNAFEE
                     NQTISINYYSFLAFECDENTFSQMKHILYQKILAYLLKKSDHVVVNLINTMSKRDPKM
                     KLKIRLTTINENTTILKQLLIALNTSGYTFLFDTFLDDLKTVFFSDSSKYASHKEIVL
                     FLNYNIIDVVRLNPVFIHLRSIFGIDDEESENSALREYLRTLPSDKSRLLYLIERIAS
                     TLENKMSIMSLMLTMKKVVKDKCFDDEIVAFSSMMYILPLNTTQCQLAPVFILRVIFL
                     KMLNDRIELYPLRPSENRPEPLMKLGYFLSNVICYYSKLLDRQNLDILKREHYRFFYN
                     LLRLLFGFSQYSTLKSFLQMELSCALPDFNTNLLASEGYPDTAFEKQIIEILSKYSFS
                     NFDIKEVFPTQEPLYQEVNYLTKIEREFI"
     gene            complement(<83936..>85474)
                     /gene="SWC4"
                     /locus_tag="KLMA_40035"
                     /db_xref="GeneID:34716031"
     mRNA            complement(<83936..>85474)
                     /gene="SWC4"
                     /locus_tag="KLMA_40035"
                     /product="SWR1-complex protein 4"
                     /transcript_id="XM_022819309.1"
                     /db_xref="GeneID:34716031"
     CDS             complement(83936..85474)
                     /gene="SWC4"
                     /locus_tag="KLMA_40035"
                     /codon_start=1
                     /product="SWR1-complex protein 4"
                     /protein_id="XP_022675887.1"
                     /db_xref="GeneID:34716031"
                     /translation="MSSSDILDVLNIKPKSSSPDTGVQGGSQVSVSAQGKSSVNKPQV
                     TGIQRELYNLLGDNSPAVPIKQNNKFKDLLNSTAKPSPWSYVEFEANKHVHIRHWVKG
                     SKELVGNSVEPSSFAKFDEHLSIPSFTEAEYAEFMKGHNDGNLEWAYDEIKYLFDLCR
                     RYDLKWFVIADRFSFNNNDRKVDDLKEMFYTVFQRYLLHRDPENPLIPQMNFPKEKEL
                     ERKKYLERLLKRTAAEIAEEEALIIESRKFEMAAKKTLQEREAVLQLLDHPHSDKPIS
                     QFLTSQGMSQLYANLLNDKNRKRKPDSTTPENPWMKQQQQFAQQRQQIQHQQQAKLSQ
                     EQLQQQQLQQQLQQQLQQQMQQENQQRHNAQQKQSKESSSTPSTKQSVELKTEGGQRL
                     NKKQKIELQNALRRKQDSEYAEHLLERFTLEERKNLGVIAHGEKLAPGVFLRSSKIPT
                     YKPAIQNKLVSTLQELGLPIRPAMPSLPVVQEHEKLLKRIVTLLELKKQMDKLTAEKQ
                     TIKP"
     gene            <85780..>87987
                     /gene="CUL3"
                     /locus_tag="KLMA_40036"
                     /db_xref="GeneID:34716032"
     mRNA            <85780..>87987
                     /gene="CUL3"
                     /locus_tag="KLMA_40036"
                     /product="cullin-3"
                     /transcript_id="XM_022819310.1"
                     /db_xref="GeneID:34716032"
     CDS             85780..87987
                     /gene="CUL3"
                     /locus_tag="KLMA_40036"
                     /codon_start=1
                     /product="cullin-3"
                     /protein_id="XP_022675888.1"
                     /db_xref="GeneID:34716032"
                     /translation="MPNIKPIISSRRYSRKVESTNEHWEILEDGINKIFQGKVSELSF
                     EKLYTTVYGLVLNKNGPQLQRMLSKLLSYHFGIVRDTLEQQTGLDALESLNLQWDEQK
                     VYLRQISDVFIYMDLVYSKRENKPDVSSLGSRLFVNQVIEPVSDMLKESLIDEINKAR
                     TTFNEYAGLEIVKNAISVLAKLEMKEGMSSIFLTDFEPFLLERSEIYYKSLHERLQQS
                     QEDNGWKDFNALLRLLNVEDEMCKRIFDDQDTILKFHKIAEKALVSDNIEEIAAYSLR
                     NIVKNSQIKEMSTLMSLSSSLKDRIVILERLSNCITDDVNSIQVDNTIRKKSGAAVKW
                     IQDLISLKIRYYDLVSQLSNDQALTYKYINEAFGKSINEIKVFPEFLSLYFDTLLKSP
                     DSNLKENITVVKNCIYFFKLFKDKDTFEVIYRQQLSRRLLQQKSDISEEQELILLLQE
                     DVGASYTSKLRGMLRDLHLSKAFIQKNKKMLPSNQLELNILTQMFWPLQKSDMNKQVN
                     IPDSLISLKSDFEKCYTMVHSGRLLEWMYHLSTIEIAYQFRDSYHELSMQMYCGIIFL
                     LFKDHQSLTFDEIVELTNLPVQEVRRNLISMSIAPKTRILRKSPPGKTVSNEDVFSIN
                     QEFSAPQRKVKVLMVLMNSNNGRPLTPNENSRTSIDKKLLDSRLSVVNATITRIMKQE
                     RKLHHSQLQERVSASVNLFEVNTSMFKTSLEYLINNEYIQRDFDNTTLYHYLP"
     gene            complement(<88016..>88717)
                     /gene="CWC24"
                     /locus_tag="KLMA_40037"
                     /db_xref="GeneID:34716033"
     mRNA            complement(<88016..>88717)
                     /gene="CWC24"
                     /locus_tag="KLMA_40037"
                     /product="pre-mRNA-splicing factor CWC24"
                     /transcript_id="XM_022819311.1"
                     /db_xref="GeneID:34716033"
     CDS             complement(88016..88717)
                     /gene="CWC24"
                     /locus_tag="KLMA_40037"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CWC24"
                     /protein_id="XP_022675889.1"
                     /db_xref="GeneID:34716033"
                     /translation="MFKRRVVKKTSVNKRQRINDETIPINNNDDSSVKPEINDDKKDE
                     NDNGSIESNETYLAKEKDEHTREIELRRKERLDLQQEVDEEIERQIKNKPSGFVKPIS
                     KNMKTVTVTDYQPDICKDFQKTGFCGYGDSCKFLHSRDDFAGGWKLNTDWQVDGSKEK
                     ELLDDLISEEIPFKCVVCEGEYKNPVKTKCNHYFCSSCFMNKMKTSTKCPVCGKETEG
                     VAKMATNLKNLLKKK"
     gene            <89114..>90751
                     /gene="PEX30"
                     /locus_tag="KLMA_40038"
                     /db_xref="GeneID:34716034"
     mRNA            <89114..>90751
                     /gene="PEX30"
                     /locus_tag="KLMA_40038"
                     /product="peroxisomal membrane protein PEX30"
                     /transcript_id="XM_022819312.1"
                     /db_xref="GeneID:34716034"
     CDS             89114..90751
                     /gene="PEX30"
                     /locus_tag="KLMA_40038"
                     /codon_start=1
                     /product="peroxisomal membrane protein PEX30"
                     /protein_id="XP_022675890.1"
                     /db_xref="GeneID:34716034"
                     /translation="MSDSKETRAQFLDTDKDESKVSGKASQTLRSALKKQEKEKQKRG
                     QGKDGGDVDSGKKDDDEKIVDSSPLLNSTPPTVSKALVKLYPYLILCNEILSLVTWTG
                     DDVWKSVLMVICYITTVLYFQVVVRYFGHFLFVGLLWGYSALDNFVEDTIKEKPTLDD
                     IVHVITCVYTKADLLLSPLSVWTTNDIKRLLLTMAFLSPIYVIVSIFIFSSQKLVLIL
                     GIYLLTYHSSWSRVTRRLLWKLKIVRLLVFYITGLDLSGVNKHQGGIFAAVHKKVKKL
                     SSNSLSAADADDGKPIRFTYVLYENQRRWLGIGWTANMLTYERSSWTDEFLNEAPSPE
                     QFKLPEEASGMAWRWVDKTWRLDMTNDGAIQLSSSRPKTTASPGKDDGFIYYDNTWKK
                     PSTEDSYSKYTRRRRWIRTAELIRTDSLSTVESSTDSVDGGSAQQTSGSERRKSVRIE
                     EPDNGSTGSISNQSNNSRKVSFSETSDVRIIPDSSFEGTGDADDENNSEVIENSANEN
                     FQRIETPSGLKTRTAQTQPSTDKQVDQDESSSTTTKV"
     gene            complement(<91297..>91533)
                     /gene="RPL38"
                     /locus_tag="KLMA_40039"
                     /db_xref="GeneID:34716035"
     mRNA            complement(<91297..>91533)
                     /gene="RPL38"
                     /locus_tag="KLMA_40039"
                     /product="60S ribosomal protein L38"
                     /transcript_id="XM_022819313.1"
                     /db_xref="GeneID:34716035"
     CDS             complement(91297..91533)
                     /gene="RPL38"
                     /locus_tag="KLMA_40039"
                     /codon_start=1
                     /product="60S ribosomal protein L38"
                     /protein_id="XP_022675891.1"
                     /db_xref="GeneID:34716035"
                     /translation="MAKEIADIKEFLELIRRQDVNSATVKINKKLNKNGKAFRQTKFK
                     LRGSRYLYTLIVNDAAKAKKLLQSLPPTFNVNKL"
     gene            complement(<92257..>93414)
                     /gene="TFG2"
                     /locus_tag="KLMA_40040"
                     /db_xref="GeneID:34716036"
     mRNA            complement(<92257..>93414)
                     /gene="TFG2"
                     /locus_tag="KLMA_40040"
                     /product="transcription initiation factor IIF subunit
                     beta"
                     /transcript_id="XM_022819314.1"
                     /db_xref="GeneID:34716036"
     CDS             complement(92257..93414)
                     /gene="TFG2"
                     /locus_tag="KLMA_40040"
                     /codon_start=1
                     /product="transcription initiation factor IIF subunit
                     beta"
                     /protein_id="XP_022675892.1"
                     /db_xref="GeneID:34716036"
                     /translation="MSESSGKDLVEEVGEEAFDGNDIENNEKKVYEESLDLDLSCARK
                     KIWLVRLPKFLAEKWRDRTRLHGQELGKVRINNSDHSIQLLLNEDEDNKDIPHEYDLE
                     LTKKEVANEYVFTEQNLKKYQQFAKELESNPELQRQAYLRKQEREEEMKKKQQQMKRK
                     YNKRRFQHRVMTDRDGRDRYIPYVKTIPKKTAITGKVYHECQVMPSIDDPNYHTIVEH
                     RRQIVRNIHKPTVTVLDQTPGVTMSNAGMSMRSDTSKFLKVGKEKKNNARAIRLPKKE
                     LLDLLFKLFDEYDYWSLKGLKERTRQPEAYLKESLDQVAMLVKKGPYALKYTLKSEYK
                     KLKEAERAATLGELAQNSEDAEQLAQEQLDQAQEHDQEEEELEGVEMEDVL"
     gene            <93700..>94230
                     /locus_tag="KLMA_40041"
                     /db_xref="GeneID:34716037"
     mRNA            <93700..>94230
                     /locus_tag="KLMA_40041"
                     /product="pre-mRNA-splicing factor 18"
                     /transcript_id="XM_022819315.1"
                     /db_xref="GeneID:34716037"
     CDS             93700..94230
                     /locus_tag="KLMA_40041"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor 18"
                     /protein_id="XP_022675893.1"
                     /db_xref="GeneID:34716037"
                     /translation="MANSVHPVEIRYSGKSDNSEKPETHGTSSPSVSLEDSCNEYIHE
                     ILVEWESHESQYNVVPLKRVKVALFPLLVALRKKELGPVQLNQLANVLDGILEEDFSR
                     AKQEYLTLSIGKGKFPIGLTNVGIHERKQVQSSQAEQNMILDDWCVNIKRLINFKQWL
                     ITHHTDTGEQPKPQGQ"
     gene            <94242..>94901
                     /locus_tag="KLMA_40042"
                     /db_xref="GeneID:34716038"
     mRNA            <94242..>94901
                     /locus_tag="KLMA_40042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819316.1"
                     /db_xref="GeneID:34716038"
     CDS             94242..94901
                     /locus_tag="KLMA_40042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675894.1"
                     /db_xref="GeneID:34716038"
                     /translation="MGGIVSGMVQSTATDFGTDYAMEKYEEFMGTKFQPVKDPYYVEM
                     SDGKRVRRRLPAYCTKQETKTWKRLQNRAWYDDRCFLGCGYLWIDWGIGWATVLSLIP
                     VIGPVLMYLVHSSTIEYARKRYELPESLVLKMHGNIMFDLLISLPPVIGTLFAWMSQC
                     STRNAAMVYNYVCKASWAREQAQREQGIHPQGPSEHTAPLPGQGAGPAAATTTTKTGL
                     N"
     gene            <95024..>96069
                     /gene="ECT1"
                     /locus_tag="KLMA_40044"
                     /db_xref="GeneID:34716039"
     mRNA            join(<95024..95042,95090..>96069)
                     /gene="ECT1"
                     /locus_tag="KLMA_40044"
                     /product="ethanolamine-phosphate cytidylyltransferase"
                     /transcript_id="XM_022819317.1"
                     /db_xref="GeneID:34716039"
     CDS             join(95024..95042,95090..96069)
                     /gene="ECT1"
                     /locus_tag="KLMA_40044"
                     /codon_start=1
                     /product="ethanolamine-phosphate cytidylyltransferase"
                     /protein_id="XP_022675895.1"
                     /db_xref="GeneID:34716039"
                     /translation="MYSIHASAQHPPIFPLAMQLKENRVWIDGCFDFTHHGHSGAILQ
                     ARRTIPLDQQQGAALICGVHNDADIEFNKGGKPVMQEEERYEHTLSNRWCDEIVRDAP
                     YVTDHRVLDAYGCKYVVHGDDITLDHDGKDCYQEMKDMGRFKVVKRTEGVSTTEIIDR
                     ILRDKGQNPHTGEVDSEALKRYSSDKSGYRPWCWVFGRDFDDVVVEGRGQLGNGNQWT
                     VVQESDGFDLFNVGHIQQLRKLKEQGKLVCCSMGTDPARHVYMTLEERCLSVLSCEYV
                     DAVVLKPEPQLTAGHSTSTDTVTITTSLKPEIINRISVNRDHYVKRNIKKGVTYDH"
     gene            complement(<96157..>96384)
                     /gene="STF2"
                     /locus_tag="KLMA_40045"
                     /db_xref="GeneID:34716040"
     mRNA            complement(<96157..>96384)
                     /gene="STF2"
                     /locus_tag="KLMA_40045"
                     /product="ATPase-stabilizing factor 15 kDa protein"
                     /transcript_id="XM_022819319.1"
                     /db_xref="GeneID:34716040"
     CDS             complement(96157..96384)
                     /gene="STF2"
                     /locus_tag="KLMA_40045"
                     /codon_start=1
                     /product="ATPase-stabilizing factor 15 kDa protein"
                     /protein_id="XP_022675896.1"
                     /db_xref="GeneID:34716040"
                     /translation="MARTNKWTNREAKADSRFFTHNGHFGEAPNAVKKQGSGKGNWGK
                     PGDEIEDLIETGEIKPVYNKSRRGSNSQSHY"
     gene            97261..97358
                     /locus_tag="KLMA_R401"
                     /db_xref="GeneID:34718699"
     tRNA            join(97261..97293,97307..97358)
                     /locus_tag="KLMA_R401"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:34718699"
     gene            <97983..>99413
                     /gene="NMA1"
                     /locus_tag="KLMA_40046"
                     /db_xref="GeneID:34716041"
     mRNA            <97983..>99413
                     /gene="NMA1"
                     /locus_tag="KLMA_40046"
                     /product="nicotinamide-nucleotide adenylyltransferase 1"
                     /transcript_id="XM_022819320.1"
                     /db_xref="GeneID:34716041"
     CDS             97983..99413
                     /gene="NMA1"
                     /locus_tag="KLMA_40046"
                     /codon_start=1
                     /product="nicotinamide-nucleotide adenylyltransferase 1"
                     /protein_id="XP_022675897.1"
                     /db_xref="GeneID:34716041"
                     /translation="MDPTKDPNFKSPQELDNESLQSNTDIPKIGPIIPYVLADYNSAI
                     DKPIHPRKYKKNAMKRKLAASMTPNKDASKNNASSSSGGGSGGGSGSGHGSKNGIIPM
                     KQEELQPVSAETSSGSESETSDSESLGAQPDPIDEAATAVAKVAAAAAAVNNTVSAVA
                     AEFNDPSAVDPTTSTSEFVDSSSSVPAVDPEITSRIHKFQIADLEEVPHGITRQANNL
                     KDYQFPTHRLKHRLRNPNKLPLVIVACGSFSPITYLHLRMFEMALDAISEQTRFEVIG
                     GYYSPVSDNYQKPGLAPAHHRVRMCELGCERTSSWLMVDAWESLQPTYTRTAMVLDHF
                     NEEINVKRKGVIKNDLGERMGVKIMLLAGGDLIESMGEPNVWADYDLHHILGNYGCLI
                     VERTGSDVRSFLLSHDIMYEHRRNILVIKQLIYNDISSTKVRLFIRRGMSVQYLLPNS
                     VIRYIQEHGLYVNQTEPVKQVIGNKD"
     gene            <99616..>100866
                     /locus_tag="KLMA_40047"
                     /db_xref="GeneID:34716042"
     mRNA            <99616..>100866
                     /locus_tag="KLMA_40047"
                     /product="putative cysteine synthase"
                     /transcript_id="XM_022819321.1"
                     /db_xref="GeneID:34716042"
     CDS             99616..100866
                     /locus_tag="KLMA_40047"
                     /codon_start=1
                     /product="putative cysteine synthase"
                     /protein_id="XP_022675898.1"
                     /db_xref="GeneID:34716042"
                     /translation="MFLPCKHHALVKLTNSSAPALNRPSLSTTPIMGSQKWKDCVCAV
                     SVVVALGSLFYAYKQKNSTTKLSHLSPPKDGVEDLIGNTPMVKIRSLSEATGLNVYAK
                     MELNNPGGSAKDRVALNIIKTFSEEQHIHGSKDKKNRVFEGTSGSTGISLALCCNAMG
                     FSCHISLPDDTSQEKLSLLTALGAIVNKVKPASIVDPNQYVNAAKACAESYTDGIGMF
                     ADQFENEANWKCHYATTGPEIFLQLDGKVDAFITGCGTGGTMAGVSRYLKEQRGDSVR
                     VILADPQGSGFYNRIKYGVMYDKVEKEGTRRRHQVDTLVEGIGLNRITKNFLKAEQYI
                     DDSVRVTDEEAIKMAKWLCINDGLFVGASTAINAVAVLKYAENLPKGSNVCIIACDSG
                     SRHLSKFWKEALAVDNNLSLSDIV"
     gene            <101094..>102812
                     /gene="SNU71"
                     /locus_tag="KLMA_40048"
                     /db_xref="GeneID:34716043"
     mRNA            <101094..>102812
                     /gene="SNU71"
                     /locus_tag="KLMA_40048"
                     /product="U1 small nuclear ribonucleoprotein component
                     SNU71"
                     /transcript_id="XM_022819322.1"
                     /db_xref="GeneID:34716043"
     CDS             101094..102812
                     /gene="SNU71"
                     /locus_tag="KLMA_40048"
                     /codon_start=1
                     /product="U1 small nuclear ribonucleoprotein component
                     SNU71"
                     /protein_id="XP_022675899.1"
                     /db_xref="GeneID:34716043"
                     /translation="MDTVIFVSPVFYFQDHSNIERWKSTKPKPGYVPILNSDLAKFEQ
                     TLKQAHGEYVRKTTDGKEQTDKDAKNKNSGDGNTDNSDTSSLKSRFVDLQSFLPISLE
                     QQLHTVCLGHVPLGLGVKGIDKVMEKLEQVFMKSLNAASKTEYIKQWSYVDCVNSLTV
                     YVSFREELAKDYGEIIGLIQQLIDGNSDGVSLFMDENTSRYVSDLKQESSSTVDDSVK
                     DEFWQLVDVLKAGPDSNNTHDKGSSVEYTVDMSTLSDLPSSSLDQLCKDIIEFRTRVI
                     TLEKEKRNKELIEAEKRRRQHLKQIFDKIKNAEGSSKSDRKNADDNEGDDDEEDDDDD
                     DDDEDDNEYQDEKDDYEVEQKRLKAETETQQNAYDNLVHEFQNKMLVEYSSLRQELHR
                     LQNYETQLHKNRGPLLKEFMHLASDPHYDHHRAYKETEQKADEQDRALEAKELEDRKQ
                     DSTTTPVTDSKPNAESAEPKIKLALRQQKQEEITEEEEQEEQEEQEVPEFLQKVELLK
                     KSGAVDELVKEFLGVYEPDLVEYIFDNIREHQSRETLEKELAETFDDDSPVLVDRIWA
                     AMETDA"
     gene            <103811..>106411
                     /gene="MSB2"
                     /locus_tag="KLMA_40049"
                     /db_xref="GeneID:34716044"
     mRNA            <103811..>106411
                     /gene="MSB2"
                     /locus_tag="KLMA_40049"
                     /product="hansenula MRAKII killer toxin-resistant protein"
                     /transcript_id="XM_022819323.1"
                     /db_xref="GeneID:34716044"
     CDS             103811..106411
                     /gene="MSB2"
                     /locus_tag="KLMA_40049"
                     /codon_start=1
                     /product="hansenula MRAKII killer toxin-resistant protein"
                     /protein_id="XP_022675900.1"
                     /db_xref="GeneID:34716044"
                     /translation="MQFSSIKVGLALLVLQSCAASVSAQGLFDFFDDALKKNTTTVDP
                     YAHEPTKSSSSKTELPTNFYDSFTFATPSTYSLVDPSSHKPATPSHTQLSSSSAEVSP
                     THAVSSSTTSLDASGAKSKPTDSASASSSSVSETTSTIKSSTATSETASSGTQTSSES
                     SVSKPSSSSATASSSSSSSSASASLSSSSSSSSSSSSSSIQPSASSHTPSSNEASSSG
                     MFSSSSTILSSSSSMITSSTTSEIIPSSSTSSTSEIVPTSSSSEIVPTSSTSSTSSSS
                     SVIIISSPSSSSSSTSAIIPTTSSIVSSSSSEEPTSSSTLSIVPISTTSLETSSTPIL
                     QLNTTTSAQTSEITPTTSLIPISTSEETSIPSSTSISTEVIPSSTSTSTSTSSAVWGS
                     ETLKISSSILPPTVTSTTAQITPVDNTTESTPQTQTPTFTPLTSTSTLPKLITESISE
                     PSSTSPVVQSPVTSAGSSSVVPSSVTVPLSTSTTSSQKVWLPTTMVIETNTEEGPSST
                     VSTSRIATETLPQAIAAATKVTQAAGYTLITIGFKKELNYPFAVSNPIANAQIFQYLP
                     QVLASPFEDKSNKFQNTSVLQLVPLKVDKKDYLVTVAQVYFPQDSTNALEALMLNTSS
                     DFYKNPDGLLKQLASYIDPSIPLTGLVESGSDSLISGGYNGGSGSESNSNSGSGSNSD
                     SDSNGSSKGGSKSKGGINLGSLDDNAYSTRSRLSSSTSGKSSNEGMDGKKIGILVGSI
                     AAGAIVALGGIYLLALRIRKQKKQILANPVADDQQSYDSYDYESSFDYNAGYEKDHAM
                     NDDQVSISPSAKINNWIDYNTYNEYPEDTQPTTNGIHGQRPPMPSSKTSNLKISRPIA
                     TENSLGWSDL"
     gene            complement(<106677..>107600)
                     /locus_tag="KLMA_40050"
                     /db_xref="GeneID:34716045"
     mRNA            complement(<106677..>107600)
                     /locus_tag="KLMA_40050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819324.1"
                     /db_xref="GeneID:34716045"
     CDS             complement(106677..107600)
                     /locus_tag="KLMA_40050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675901.1"
                     /db_xref="GeneID:34716045"
                     /translation="MFRRGLHTLATKEVVELAYSHSGGKSAKSHTLPAIIAIHGLLGA
                     KAHFKPLTRMLASDLDTDIYSIDLRNHGDSPMARPYDYITHTKDVINFIRTKIGPERP
                     VQMIGFSLGGKISLISALSDKVNVRSCTSIDIPPYETPELDDILTVNYETILKIINGE
                     NGYQIKKGEPNWQGKVMNLLRANKCNTNEGIVRYFAAGFVMNKVNKEKKDEFLDFKQP
                     LNEMPDLLDQVKAWPTKEELEANGFKYQTQTPILFCKATESPFIKRDYSLLGRQFPNY
                     TVEEFNTSHNIAHEAPEQFYKALLTFIKAHE"
     gene            <108204..>108794
                     /locus_tag="KLMA_40051"
                     /db_xref="GeneID:34716046"
     mRNA            <108204..>108794
                     /locus_tag="KLMA_40051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819325.1"
                     /db_xref="GeneID:34716046"
     CDS             108204..108794
                     /locus_tag="KLMA_40051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675902.1"
                     /db_xref="GeneID:34716046"
                     /translation="MSRLRKFEHQVLQHMLDDSDNDIIGDEDGVSFYPLDITEQEDLI
                     RRLELRNSSKNGTYLKILTFAYLIVCGMFILLATRIRRDNELMRSYRRIFLFSAQSIS
                     CSVITLRYEFFNNYFTRRRINFFLTSKRLNILNFTLLIFLLWIINSQDGPMAITLLCY
                     VPHLLFVTTIFVKRSMSSIESDLGLLRTLHYKFKNV"
     gene            complement(<108781..>109681)
                     /locus_tag="KLMA_40052"
                     /db_xref="GeneID:34716047"
     mRNA            complement(join(<108781..109419,109541..>109681))
                     /locus_tag="KLMA_40052"
                     /product="meiotic recombination protein REC102"
                     /transcript_id="XM_022819326.1"
                     /db_xref="GeneID:34716047"
     CDS             complement(join(108781..109419,109541..109681))
                     /locus_tag="KLMA_40052"
                     /codon_start=1
                     /product="meiotic recombination protein REC102"
                     /protein_id="XP_022675903.1"
                     /db_xref="GeneID:34716047"
                     /translation="MSKLDALYLSNDDFSIVSEWNCEIFLQNLSILHEDMIVIPSSNP
                     YSKIMINIDGLDEQILNDVYGKFCLGRAFWERLQFEPMFSMEDSTIICEIKCKQFGDM
                     KRGLLFDNPMSSKVHQTADIKAATLDKVVIDVKFHCKNYGDAVNRTDVFQLFNEYMNS
                     LVMSQLEFKIPLVFSHTTRYRLVEHEKYIGTVSKCLDNSQTVTPSIVKIISKDKTSTT
                     VFRILHDIAGAQKLVNKYKEHNGTTILPQVFEKTPTTAKRS"
     gene            109940..110015
                     /locus_tag="KLMA_R402"
                     /db_xref="GeneID:34718700"
     tRNA            109940..110015
                     /locus_tag="KLMA_R402"
                     /product="tRNA-Val"
                     /db_xref="GeneID:34718700"
     gene            complement(<110307..>112043)
                     /gene="THI3"
                     /locus_tag="KLMA_40053"
                     /db_xref="GeneID:34716048"
     mRNA            complement(<110307..>112043)
                     /gene="THI3"
                     /locus_tag="KLMA_40053"
                     /product="thiamine metabolism regulatory protein THI3"
                     /transcript_id="XM_022819327.1"
                     /db_xref="GeneID:34716048"
     CDS             complement(110307..112043)
                     /gene="THI3"
                     /locus_tag="KLMA_40053"
                     /codon_start=1
                     /product="thiamine metabolism regulatory protein THI3"
                     /protein_id="XP_022675904.1"
                     /db_xref="GeneID:34716048"
                     /translation="MEYADRYNLEPLIPLAEYLFHRLFQLNCHTVFGVPNYSTAKLYG
                     ALAATGIQWIQTINQLNTSFAADAYGRTIGISCYITSESAELAHINGFFGSYCEYVPI
                     LQLVILEHSHDLERLIGDVSIFHDIVDDPAEIDFGLRTLFWGKRPVYMGLRSKDISRL
                     VPSIALNQSILNKETPAPFSSSLSLSIARYQQRQQEQSIVGDIVDQILSKLYSCSTPI
                     IVVDALIDRYNYNDMLQNFLAETGIPFVTTLMSKAAINESLPNFIGTFLGTLSHPTVR
                     EYMNNSDCTLILGCVIDNFKNSYCRFSYKNKCQIMLWNDRVKIENNLIPDVPIHEILP
                     QLIAKIDASKLSNLYAVTVPDMVPRVEPKPVTFLRQEYLWFRMSTWLKEGDVIISESG
                     TSAIGLLRQKFPDNSRLVSQTIWNSSGYSIGACLGVLTAYRDLGKLDKHRIILIVGDG
                     SLQFTFQELSTILTQGFEPYIYVVNNQGYTVDRTLNKEKTHTNATYFDIQQWEILSIP
                     SLFNSRDYFKRKCMTVGELNSLLNDEEFNDPRRLKIVELILPSMDVPVLLEPHDDSSD
                     DELTPQSKRVRL"
     gene            complement(<112686..>115443)
                     /gene="RIM11"
                     /locus_tag="KLMA_40054"
                     /db_xref="GeneID:34716049"
     mRNA            complement(join(<112686..113896,114939..>115443))
                     /gene="RIM11"
                     /locus_tag="KLMA_40054"
                     /product="serine/threonine-protein kinase MDS1/RIM11"
                     /transcript_id="XM_022819328.1"
                     /db_xref="GeneID:34716049"
     CDS             complement(join(112686..113896,114939..115443))
                     /gene="RIM11"
                     /locus_tag="KLMA_40054"
                     /codon_start=1
                     /product="serine/threonine-protein kinase MDS1/RIM11"
                     /protein_id="XP_022675905.1"
                     /db_xref="GeneID:34716049"
                     /translation="MLKKIKEIIQPTTNPGGLSFSLSLSKSKRKIAAQIPPNSDKEEY
                     DKKRAQAKIEKLHRLYTHELDVELVLKHLSIEEEHREHVTCPSSGTSTTSATSITTNS
                     TTTTSTTSTTATSAAASDMGTFSTAPTNDTSASNSDKVRPPDPDAGAGACLDHIPRLH
                     SNNVNSNNIPQDKTNKQKKIEVVMVEVQTASASVTNGTGTGTGNGNANANANANGVNT
                     ETCTQRKVILGHSNPEQSVVISCGTPEIVGNGSFGVVFRTNVKETGEDVVIKKVLQDR
                     RFKNRELEIMKMIKHRNLIDLKYYFLEQSDQDLYLNLIVDYMPMSLYQRLKEFICVHR
                     PMDRYEIKIYMFQLFKSLNYLHQVVGVCHRDIKPQNILVDPSTFLLKICDLGSAKQLK
                     PNEPNVSYICSRYYRAPELIFGATNYTTKIDIWSAGCVMAELLLGQPIFPGESKIDQL
                     VEIIKVLGTPTRDEICAMNENYSEHKFPQIRPIPLNKIFKKETQETIDLLYYIMKYDP
                     NIRYSALQCMFNSEYFSDILDPQKSNASLIESLQLLDFEENELAGLTAEDLARFGAKV
                     IIPSS"
     gene            complement(<116107..>117123)
                     /gene="MDH3"
                     /locus_tag="KLMA_40055"
                     /db_xref="GeneID:34716050"
     mRNA            complement(<116107..>117123)
                     /gene="MDH3"
                     /locus_tag="KLMA_40055"
                     /product="malate dehydrogenase"
                     /transcript_id="XM_022819330.1"
                     /db_xref="GeneID:34716050"
     CDS             complement(116107..117123)
                     /gene="MDH3"
                     /locus_tag="KLMA_40055"
                     /codon_start=1
                     /product="malate dehydrogenase"
                     /protein_id="XP_022675906.1"
                     /db_xref="GeneID:34716050"
                     /translation="MVSVAVLGSSGGIGQPLSLLLKLDPRVSSLRLYDLKMSHGIATD
                     LSHMDSNSICEGFNTDEIALALKGAQIVVIPAGVPRKPGMSRDDLFKINAKIIKSLAL
                     QIAEHAPEARVLVISNPVNSLVPIVYETLKSVGKFEPGKVMGITTLDIIRSHTFLVDV
                     LGRKAYSVEKLRSAVTVVGGHSGETIVPIFTDQKFYRRLRDRELYDAYVHRVQFGGDE
                     VVKAKDGSGSATLSMAWAGYSFVKQLLNSLHLETGEDVHPIPTFVYLPGLPGGKELQQ
                     KLGTSVEFFAAPVKLSKGIVVEVEHDWVDKLNDAEKKLIAKCLPILDKNIKKGLAFSQ
                     QTKL"
     gene            complement(<117592..>118194)
                     /gene="CIN4"
                     /locus_tag="KLMA_40056"
                     /db_xref="GeneID:34716051"
     mRNA            complement(<117592..>118194)
                     /gene="CIN4"
                     /locus_tag="KLMA_40056"
                     /product="GTP-binding protein CIN4"
                     /transcript_id="XM_022819331.1"
                     /db_xref="GeneID:34716051"
     CDS             complement(117592..118194)
                     /gene="CIN4"
                     /locus_tag="KLMA_40056"
                     /codon_start=1
                     /product="GTP-binding protein CIN4"
                     /protein_id="XP_022675907.1"
                     /db_xref="GeneID:34716051"
                     /translation="MGLLQIIKEQRLKDHSQRVLVLGLDNSGKTTVLNQLLHEPIDRV
                     QPTIGFQIKTLKVGQKSLQMWDIGGQKTLRPFWFNYFEKTDYLIWVIDILDEGRLGES
                     LSLLEEIVEENDRINLQFEVFVLLNKVDLLPPAMSSSSSSSSSSPQAEHRGALLQRTV
                     DHVTEVTSRVLKMDESSVRVIPTSGTNGEGLDRLLLLLEK"
     gene            <118487..>120004
                     /gene="PSO2"
                     /locus_tag="KLMA_40057"
                     /db_xref="GeneID:34716052"
     mRNA            <118487..>120004
                     /gene="PSO2"
                     /locus_tag="KLMA_40057"
                     /product="interstrand crosslink repair protein"
                     /transcript_id="XM_022819332.1"
                     /db_xref="GeneID:34716052"
     CDS             118487..120004
                     /gene="PSO2"
                     /locus_tag="KLMA_40057"
                     /codon_start=1
                     /product="interstrand crosslink repair protein"
                     /protein_id="XP_022675908.1"
                     /db_xref="GeneID:34716052"
                     /translation="MKRVTKRVLRTQSRTLFDLRFVRVKSSVDSAGSGSSATESEIID
                     LTQSDDDVSVAGPEIEVKLDSSCEETEEPEPKVEPETKVEPETKVEPETKVEPEVQAT
                     TANKPARKPRVMPWFKKLAFNGITVSVDCFNCDKEPDIDLYFLSHFHSDHYGGLKKSW
                     CNGSTIFTSIHTANLVKWKFKVNQCKVVGLPLHEWTSLSENLRVVLLDANHCPGSVIF
                     LFHDSGDNSYVLHTGDFRANESIVQHVNAFLQGNKLQSIYLDTTYLNPHFRFPDLQKV
                     CDVTADFASLLVKKGLNNFINRANKQRSISQYLSLSQAKPILFVVLSYSIGKEHLAIA
                     IAKKINSKLYVPHTKYQLVKQYLSWFPEDLVTTDHTSANVHLVSMHTDLDKYLSQLSD
                     SVDSIVVFKPTGWTFSNQYDKSYMLWEDAQREKCVRETLESDTPFTVDHFIRQKKSQG
                     KIYQFNVPYSEHSSFKDLCFFSTSLMWDKIIPTVNLSRYQEMQHWFNIWKSYQKN"
     gene            complement(<120272..>121507)
                     /gene="GAT2"
                     /locus_tag="KLMA_40058"
                     /db_xref="GeneID:34716053"
     mRNA            complement(<120272..>121507)
                     /gene="GAT2"
                     /locus_tag="KLMA_40058"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819333.1"
                     /db_xref="GeneID:34716053"
     CDS             complement(120272..121507)
                     /gene="GAT2"
                     /locus_tag="KLMA_40058"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675909.1"
                     /db_xref="GeneID:34716053"
                     /translation="MTSMETITTAVSRKQSHSPSSSSASSSATTASITPPLLTRGVSY
                     HSVTSIPNLLNYDGQASSQIRSERRPAHRHVHSMTINTSSNPNINTNIHNNFGTSSSV
                     TGLVSLGSSPRSPLHHGNYQYGTRHQTSESLDFLADTAIDQNMNQEEFKRILQKLSDF
                     STQLRNQVANWELKSVGDVQMNDLSKLATETRSVLKNIDRLLELKSINEWSRKKPQLP
                     SINQLRNELQKPMVEFQFPSRPATKNVYNVNVRNNESHIPSASVSTTREKPSAHLGHK
                     VSKSEGSIIGTTHTFKVDKMKAKKRNSVSHQRKISIAAGDGTESCKHCHETVTPEWRR
                     GPYGNRTLCNACGLFYCKLVRKFSSRDANILMHYRKANSPEDRRVPENLNVPEAFVES
                     LKKDSSLDENFNVKPNTLR"
     gene            <122386..>123468
                     /gene="GID8"
                     /locus_tag="KLMA_40059"
                     /db_xref="GeneID:34716054"
     mRNA            <122386..>123468
                     /gene="GID8"
                     /locus_tag="KLMA_40059"
                     /product="glucose-induced degradation protein 8"
                     /transcript_id="XM_022819334.1"
                     /db_xref="GeneID:34716054"
     CDS             122386..123468
                     /gene="GID8"
                     /locus_tag="KLMA_40059"
                     /codon_start=1
                     /product="glucose-induced degradation protein 8"
                     /protein_id="XP_022675910.1"
                     /db_xref="GeneID:34716054"
                     /translation="MTNFKSGYERKSYTREQWLKVVQDCNPYDRSNNEQSTNEPRIPM
                     LLLNYFVVMAYEESSIRMAKELGYVTSNKDIEEFNSIYMIKKRAYIKELIKKGEILLA
                     MEKITEMFGIEVLENLNDHIMDEDLNFKLLLLNLIEMIRSHNRNDKGESQEQFVLDLI
                     SYAQDKLALKASSKKEYMKEVELVMTLLLFPLHDGEGETNGDYATDPSCKLPKKLKQL
                     YSLNLRTKVADLVNRKLLQSILPRINSQLEKSGLPDILGSSFQSNQVPTLTNVIRSIP
                     RENITTEKLSGELAYVEEKQGSSTSNNAEMCGIQGEIFEELGEDLDSYHIPNDVRLVQ
                     IMKLWVWCENKLHAADIGVPRVESDV"
     gene            complement(<123560..>124282)
                     /locus_tag="KLMA_40060"
                     /db_xref="GeneID:34716055"
     mRNA            complement(<123560..>124282)
                     /locus_tag="KLMA_40060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819335.1"
                     /db_xref="GeneID:34716055"
     CDS             complement(123560..124282)
                     /locus_tag="KLMA_40060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675911.1"
                     /db_xref="GeneID:34716055"
                     /translation="MNELVSKCLQFYLTVEGVMIYWLRKIEFFKQYTNDPLSARITLF
                     LVVMGGFALINELYITIQMSALQMDTWEQLNNTKLDEDFIRNHKFIHDDSYHATEWLD
                     EKSGLIIEEFESREKFFAKPVHVAHIYVKCQVIDSETETPLLKNPITFHIEFSPEEFE
                     SEKRPEFGCTLRLLRSKLYHFFKDGDFFDNSKYADKPFTITKNVKIYNTMKELLPTNM
                     DDIQLCFLKMETGSTITCEFIL"
     gene            <125228..>125839
                     /locus_tag="KLMA_40061"
                     /db_xref="GeneID:34716056"
     mRNA            <125228..>125839
                     /locus_tag="KLMA_40061"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819336.1"
                     /db_xref="GeneID:34716056"
     CDS             125228..125839
                     /locus_tag="KLMA_40061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675912.1"
                     /db_xref="GeneID:34716056"
                     /translation="MNSYLHLLLCFGNFLFCLAAESASSQALNQAKQEAASADINFFI
                     GFISDFNANQKSYTSYMKEAKMTMPQDIADYYFHLQQVTESTQLLEDIATSFPFSDFK
                     TFITAVPWYTQLLSQASITQFYVPEDFMTKQAEVQTSTLSGNITSSYGITTSHNFTQS
                     PTASNFTGNSSTLINNSTSINVGTNFGLYSPLVLLPALCVLFG"
     gene            complement(<125962..>126999)
                     /locus_tag="KLMA_40062"
                     /db_xref="GeneID:34716057"
     mRNA            complement(<125962..>126999)
                     /locus_tag="KLMA_40062"
                     /product="meiotic recombination protein"
                     /transcript_id="XM_022819337.1"
                     /db_xref="GeneID:34716057"
     CDS             complement(125962..126999)
                     /locus_tag="KLMA_40062"
                     /codon_start=1
                     /product="meiotic recombination protein"
                     /protein_id="XP_022675913.1"
                     /db_xref="GeneID:34716057"
                     /translation="MTDFSIPVRKYSFYTMLELAPQGFDMVKAPTLMDKWKHVSSEGR
                     IHLMFSNTIDNRLVMKVVSQPYLQELEVIDFCTLRDSFVGFSQEPFQFSAKAPSISCK
                     YLVRNDDMIVVRRFQLGFHNGVDFVQARDILHKLGFVVKPAVTTRTNTVVSQSQSFFF
                     PQNQTTQALNNNFSFYNPAPSNNANPWQNSQQNMFQSNNNMDFFLSQSTPVQAAKGTS
                     FQERMQTMVTQQTPEPSIEREKEKEQELEHPFNNIREVEQLFQKPNLQSLQKQEQIQL
                     PDTTASKLMASKKVGSDTIPEASKGDCDETPKNTMELVTMEKIRSKIKDPDFMAWVRS
                     VKYTRIPFQSD"
     gene            <127476..>128105
                     /gene="JLP2"
                     /locus_tag="KLMA_40063"
                     /db_xref="GeneID:34716058"
     mRNA            <127476..>128105
                     /gene="JLP2"
                     /locus_tag="KLMA_40063"
                     /product="protein JLP2"
                     /transcript_id="XM_022819338.1"
                     /db_xref="GeneID:34716058"
     CDS             127476..128105
                     /gene="JLP2"
                     /locus_tag="KLMA_40063"
                     /codon_start=1
                     /product="protein JLP2"
                     /protein_id="XP_022675914.1"
                     /db_xref="GeneID:34716058"
                     /translation="MVYFYKSQPSEDVSPHWLITGKDKFENDLLIKYGYRELQYYWFH
                     ADKYSSGHIYLQLRPDEKSLQDVPREVISDCLQLCKSESIQGNKLQQCTIIVTPWHNL
                     RKSGYMKPGEVSFKRMKDVQKMECFARDNAVLNRLKKTRIEVTEEVEKLLHEAKKSKD
                     GEFFINFLETNRERLLKEEAERLAMKKQKKKKKKLLDEDQESSPNLDVE"
     gene            <128395..>129966
                     /gene="RRB1"
                     /locus_tag="KLMA_40064"
                     /db_xref="GeneID:34716059"
     mRNA            <128395..>129966
                     /gene="RRB1"
                     /locus_tag="KLMA_40064"
                     /product="ribosome assembly protein RRB1"
                     /transcript_id="XM_022819339.1"
                     /db_xref="GeneID:34716059"
     CDS             128395..129966
                     /gene="RRB1"
                     /locus_tag="KLMA_40064"
                     /codon_start=1
                     /product="ribosome assembly protein RRB1"
                     /protein_id="XP_022675915.1"
                     /db_xref="GeneID:34716059"
                     /translation="MSKRTASDEGLENVQDRIVHSKTDASDLPAANAVNANEEDVEMG
                     EFEDPYGDDFESDGEIIEIDDAEDEDEEEMGEGADNEEFLEKKQQKAQELVEKDQKID
                     EEQGQQIWLPHLSKPLGPDEVLEADPTVYEMLHTVNVPWPCMTLDVIPDSLGSGRRSY
                     PQSILMATATQASKKNQNELMVLKMSQLTKTLVKENEDEDEDEEEDDDMDPIIENENI
                     PLKDTTNRLKVSPFANAAQEVLCSTMSENGEVYIYDLAPQVKAFDTPGYQIPKSAKRP
                     IHTIRNHGSVEGYANDWSPVIKTGALLSGDCSGQVFLTQRHTSKWVTDKQAFTVSNNK
                     SIEDLQWSRTESTVFASCGIDGHIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGY
                     LLASGDDDGTWGVWDLRQFTPQNASTASPVAQYQFHKSAITSISFNPLDESIIAVASE
                     DNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLLFVHWQKEVKDVKWHKQIPGCLV
                     STGTDGLNVWKTISV"
     gene            <130317..>133340
                     /gene="RIC1"
                     /locus_tag="KLMA_40065"
                     /db_xref="GeneID:34716060"
     mRNA            <130317..>133340
                     /gene="RIC1"
                     /locus_tag="KLMA_40065"
                     /product="protein RIC1"
                     /transcript_id="XM_022819341.1"
                     /db_xref="GeneID:34716060"
     CDS             130317..133340
                     /gene="RIC1"
                     /locus_tag="KLMA_40065"
                     /codon_start=1
                     /product="protein RIC1"
                     /protein_id="XP_022675916.1"
                     /db_xref="GeneID:34716060"
                     /translation="MLPVKPPQTFRLPKSHIEGVDEDVIETIASPNSNHFLLITKTRL
                     FVYQAKPFGPVACHERTQESIELFGCNAGLRDNLPSGSHVEGLLREQYCEPITDEKMY
                     FYVMTENNFLLVYEVYTRTSEGVVYKDYGIPLNIQEGGYSARSVVEDDTDDEVLTVFA
                     INESHKVIQNGYTISKQKGFLQFIRNDEVVEELPIRRAELRLHVVLKFDHNIIDCIGI
                     IAHDKNGANQTSEYLLVLFEHGLQVLKLEDFKLVENKLIHILDGKRLIYYSGEVLVIS
                     SNATSEKHSINHILFDKESVESQEVALKNGSNKFTCSTLFDQSLVLVFENIMVYYDIV
                     DRQLTGDLVGDSQIQKIICLSADSMLLLTDNNSVVFTSKWGNILQSIYIDENQFKLIN
                     CSAMDMKLLICGSDGKIQFWDLWKKLSSSLSNFRTSKVFTLINDNNDILLYSPMSESN
                     NTSSFQTIKLPTKTVNNNITICKVNGLLTLLVVYVANKEILLINFLNSNKWISFSQLN
                     IKGIDWLGDDYLMCHLIDEENDTEYIKCYHFPLLNHDSTELESFKIWEWEVPQGTKLN
                     GFYVNTLSTFKMLKFTDESKEDSEDTSRKLFVTSEIIMDLSNSQIVIFDALSSIHPTG
                     VNLVQKFHQFGTHQFPEKSLGRLKWIHKYKDGFIAWIGDRLVIIVQQEDKEWRFIVAY
                     DRVEQIIEIYEDNLVIVSGNEVLLYGFEHIWTVDEPLITTPVIEEEYPISISLDTATL
                     HNISSVTTQKLSKISMSHSVYLDMILDRNLKLGVDFNKIDEKYRDLKHYKFCLEKILS
                     NKILEHQSLDSILQLIDKYDKNSGGVSNVVGKLEIVGNCLRKIETKHWNYLFENLKLT
                     PRDLITKCIELSEAKILGTMLMVFLNYDEGETNDKDDKIVHDKKKTDSKPKTKGNKKK
                     GNKKDSNAKHKNNTKNQDSNAVSESNDSSVSTVLKDETIIAQVLKIFVSTATLSTSKE
                     QAQEFWDFALQLVRFLRALDSKGDTNLAQTCLDMI"
     gene            <133882..>134130
                     /gene="COX12"
                     /locus_tag="KLMA_40066"
                     /db_xref="GeneID:34716061"
     mRNA            <133882..>134130
                     /gene="COX12"
                     /locus_tag="KLMA_40066"
                     /product="cytochrome c oxidase subunit 6B"
                     /transcript_id="XM_022819342.1"
                     /db_xref="GeneID:34716061"
     CDS             133882..134130
                     /gene="COX12"
                     /locus_tag="KLMA_40066"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 6B"
                     /protein_id="XP_022675917.1"
                     /db_xref="GeneID:34716061"
                     /translation="MAEQQENPLHTVGFDARFPNQNQTKHCWQSYVDYHKCINAKGED
                     FAPCKVFWRTYSSLCPVDWVEKWDEQREKGIFAGDINP"
     gene            134693..134767
                     /locus_tag="KLMA_R403"
                     /db_xref="GeneID:34718701"
     tRNA            134693..134767
                     /locus_tag="KLMA_R403"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718701"
     gene            complement(<134936..>135865)
                     /locus_tag="KLMA_40067"
                     /db_xref="GeneID:34716062"
     mRNA            complement(<134936..>135865)
                     /locus_tag="KLMA_40067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819343.1"
                     /db_xref="GeneID:34716062"
     CDS             complement(134936..135865)
                     /locus_tag="KLMA_40067"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675918.1"
                     /db_xref="GeneID:34716062"
                     /translation="MKPTRIPNNLLRSSGLVQRPPKIITFDAYNTLYAIKRPVMEQYC
                     IVGKKYGIDANPKELTLRFPEVFNKIRSLYPLYGKKSGITADQWWENLIREVFKPLEI
                     PQEMVRDILIRFEGYEAYTVYPDVKEFLEKMRTKYPDVILGIISNTDPIVLKLLENIG
                     LKNYFDGNIYLSYDLEIKKPDPMIFQYAIADLFKRYDLQKEFGDLETFRKSGLIWHVG
                     DEEKNDLLGAHNAGINGVLVDRCNEFGYFNPPTENPENNKGLSENELSLRKVCNESES
                     SFEQSAAINDVIQVSEGQYVITNFKTLDTMLFY"
     gene            <136156..>137955
                     /locus_tag="KLMA_40068"
                     /db_xref="GeneID:34716063"
     mRNA            <136156..>137955
                     /locus_tag="KLMA_40068"
                     /product="DNA mismatch repair protein MLH2"
                     /transcript_id="XM_022819344.1"
                     /db_xref="GeneID:34716063"
     CDS             136156..137955
                     /locus_tag="KLMA_40068"
                     /codon_start=1
                     /product="DNA mismatch repair protein MLH2"
                     /protein_id="XP_022675919.1"
                     /db_xref="GeneID:34716063"
                     /translation="MSDGCFVCLLEKKGTTFKVIDNPISAVRELIENSIKAYSRTIKI
                     KLDALSGGYKYIQICDDGLGIEKSKRHQVFLQEKLTTTKGRSIRRKSLFKIGNTALKQ
                     GSIEVCTRTSLDKTAYQWDIAKSSIQNGIKFRNVVYHRGTKIIIRNLHESKKANEIQG
                     LNVDIIQKIRDIMCHFSLLHKKISFNLDLVHLLEDGSVLIQKKLPPLFHYDDRYHHFT
                     NIMKGFGNGSLFRCINNLACGKDFSASVIFPDILTQEPLVTKGSHRYPCINNTIQAAE
                     SKFGQRAIRFFTELYNEFNKPGPNFWFLQINCHHPQVRILFGERNRMTNGINVDSILL
                     TLRQKILELYKLDKPGSKLVTKEFSDVRTPDLIDSFPDRTCEGNNVVKDCEQDWVTDM
                     CDFQEIRSQNIGHGGVIYDFTNDLSDDEVETDDLVLSKTVSLSNPFILSRFRSRNVTA
                     SQKNQGCGSETVLDIPLISSRPFSSVSNDTCDNEHNKKRKLLDNSFSFEGDSTTLVDI
                     EEKTDAIQPRSLQSFYEGTKNLKVYRKVEHKDYTIRNLFKTSYKKELIWCYRKGMPSL
                     TLIDGIQEKMEQLDSNVDIQLSLLENGWFLISI"
     gene            complement(<138047..>141988)
                     /gene="POM152"
                     /locus_tag="KLMA_40069"
                     /db_xref="GeneID:34716064"
     mRNA            complement(<138047..>141988)
                     /gene="POM152"
                     /locus_tag="KLMA_40069"
                     /product="nucleoporin POM152"
                     /transcript_id="XM_022819345.1"
                     /db_xref="GeneID:34716064"
     CDS             complement(138047..141988)
                     /gene="POM152"
                     /locus_tag="KLMA_40069"
                     /codon_start=1
                     /product="nucleoporin POM152"
                     /protein_id="XP_022675920.1"
                     /db_xref="GeneID:34716064"
                     /translation="MDSGFGNSGFYTHNTSMWSESRRRDIRSRDRDPFRGGISGLKDD
                     EFSRPTDNMGTLNPGLSGFSGYTGGSGSGSSSNATKRTRKNGEYAETSIADLPLISTE
                     VLDEASQRRLAFVIFIIIQAYKIYDLILLKSGIPLSGLFLSNSRLNFVSKYIIIDSLF
                     FNCLPTFKIPKLKFKPLVVFLQIISFALLTVFLSSDKNFPLFTIIVSLWKQYNSRDLT
                     LTGDSVNPKQALNSAQHFKGAHTIKILPENTAYFNPSHSAFCLPMDQSGPALEIPIRV
                     NSSSTIGHVQLEFRDLYTNEVELWNFTKNDLKSLRKESSKDEAYKNIHYFSVPLDRIG
                     FYELKSVKDTNNMNLRIYKSQLVLPHCPLASIKGKGEKDRCIGDNDHVSIQVQGVPPL
                     KLTYSKTINGQKYVLEDPTLQPEYFESPLLSNSKFFSSLDTNDLKWARSYPIDIDLET
                     SAKEYGQHLYSIEKIVDGFGNTIDFTVMSSEVREKYDLVHQFYVHDLPRASLDEEMNP
                     NSAVRRSLVVKLDSGDFVKDAPFVVQLSHEDNNSNVNFIEKQFNEKELKFKVDEPGSY
                     NLLSIKSNYCNGAVIGKSNVLITKPIPPQLDIKSTPILDQCVGQVGLNFDLTFTGVPP
                     FYYKTKIYRMEKGERKLYETKKFTSQGTRNQFTYSPTSEGSYEIVFTELSNELFNSPI
                     PLDPKKNTFKTTMRVKPSAKIAGRMETKLCLGGKTKIPIKFSGEPPFTLNYDIVATSS
                     NKRASYNKDNIRSYSFDIETPNFNIGGDHILSLVSVKDASGCLVGLSGTDARITVRRD
                     IPVASFATSESNSQINIKEASSAELPLKLSGEGPFTVVFNYLNNKGEVKETKEAVFNS
                     NYKPVLKVQKEGLYRLVSVRDQSCQGKIVDPQNTFHVQYLAKPHFSVVDHNRISKLDA
                     FNYIKNDVCQGFEETIDLSLSGVPPFLIEYDMVSPLGDKHSSSVQVATKYASIKFPNE
                     IIGEYSIKVKSVYDSNYGKMDLQKISHRPSPIEIKQRVNPLPNIEFLDKGSTYRTCSA
                     NVDEAKLLQDIRLKVVQGTSPFSVSFSIYHESSSRTDTFTLHNVTSDNFDYKRLYEGL
                     SLGNHIVKIESVTDANGCSNDLLSTDNQISISITDVPRIALTESAMEYCVGDYVGYQL
                     SGSPPFIIKYEFNGKQLKSKERTSQFVRYASEPGTISISSIQDSTSQCIVDFTSPKMK
                     PEHDKLTLNVHPIPSVTVSQGKEIVEDIHEGDKAEVIFSFEGTPPFGLTYVRTENVDT
                     KKGKKQQIVETHKVSDIYAYEYRVLTSLQGTYEALEVSDAFCSAKNNALLD"
     gene            <142910..>144361
                     /gene="SMF3"
                     /locus_tag="KLMA_40070"
                     /db_xref="GeneID:34716065"
     mRNA            <142910..>144361
                     /gene="SMF3"
                     /locus_tag="KLMA_40070"
                     /product="iron transporter SMF3"
                     /transcript_id="XM_022819346.1"
                     /db_xref="GeneID:34716065"
     CDS             142910..144361
                     /gene="SMF3"
                     /locus_tag="KLMA_40070"
                     /codon_start=1
                     /product="iron transporter SMF3"
                     /protein_id="XP_022675921.1"
                     /db_xref="GeneID:34716065"
                     /translation="MVDTGISRILKRSHIEVFKKFVKFIGPGIMVSVAYMDPGNYSTS
                     VSGGAQFKYKLLFITFISNIFAIVLQCLCIKLGTVTGLDLAENCRRHFPKRWNYVLYA
                     FAELAIIATDLAEVIGAAVALNILFNIPLVWGVLLTILDVLIILIFYKPDEHSMKKVR
                     AFETFVGVLVGATVICFAIELFKITVPSKMEVFKGFIPSPIIFKEQQAMYISLGILGA
                     TVMPHSLFLGSSVVKPRVHEYDLKKYGKIKEQPSIGAIEYTLQYSYAELIISLFFIAT
                     FVNASILIVAGATLYGQPDAEDADLLSIYELLSQYVSPAAGLIFALAMLFSGQSAGII
                     CTMAGQIVSEGFLKWSLDPWLTRLVTRLIAIVPCFLVTIFLGEKGVSAILNLSQVVLS
                     LILPIVSAPLIYFTMNPSIMTVTDVDVTSNSAGSTADSSEETHLLSSKKSESVNYTNS
                     KTLSAVAFLIWLTIGTLNCYLVFSYLAGADVHF"
     gene            complement(<144586..>146067)
                     /gene="RSC58"
                     /locus_tag="KLMA_40071"
                     /db_xref="GeneID:34716066"
     mRNA            complement(<144586..>146067)
                     /gene="RSC58"
                     /locus_tag="KLMA_40071"
                     /product="chromatin structure-remodeling complex protein
                     RSC58"
                     /transcript_id="XM_022819347.1"
                     /db_xref="GeneID:34716066"
     CDS             complement(144586..146067)
                     /gene="RSC58"
                     /locus_tag="KLMA_40071"
                     /codon_start=1
                     /product="chromatin structure-remodeling complex protein
                     RSC58"
                     /protein_id="XP_022675922.1"
                     /db_xref="GeneID:34716066"
                     /translation="MTESLKEEFFENLAAVLRSASSKCRALDEKFPTEFFESNPKNIY
                     ESYVSFLRAKFDENPDIKIADDIESISISEKFANGDYQKHSDAVYRIYHDIKLVCSIL
                     IHYYSQGTRSYQMVDKFYKFASELILRECYRVGVQLINGSDADAALEESVFSRTISND
                     FLKISQVYQLPYAETLQTETKDGHLFSSVISRSSLDKRPKEVPHEEMHIVKILPQASS
                     QPANRLGFVAANTSHIPDPTISPTEIMTSFLHPNWYPLPTSKWLDYGQYQSFAPSISE
                     FKSVTDCSRKGDIWLEKVGYKMWYEMVTKEKKEKAAVEAKTEPKVETKEENNGEKEAS
                     NDAGETDEEKNATTDEEPENARESSEDEVVVMADQTKPVQINLKNLFEWQPSNEITEE
                     DIEAFKQGKQQQLLSEILLKLKDLKRKRVKLNKISKPTSEEVSLYHRAQNILREAILL
                     KQVKAVPKLYEKQFPVLSNNYAGGIPVVKTISTRKKKSKKAVN"
     gene            complement(<146424..>150218)
                     /gene="ECM16"
                     /locus_tag="KLMA_40072"
                     /db_xref="GeneID:34716067"
     mRNA            complement(<146424..>150218)
                     /gene="ECM16"
                     /locus_tag="KLMA_40072"
                     /product="probable ATP-dependent RNA helicase DHR1"
                     /transcript_id="XM_022819348.1"
                     /db_xref="GeneID:34716067"
     CDS             complement(146424..150218)
                     /gene="ECM16"
                     /locus_tag="KLMA_40072"
                     /codon_start=1
                     /product="probable ATP-dependent RNA helicase DHR1"
                     /protein_id="XP_022675923.1"
                     /db_xref="GeneID:34716067"
                     /translation="MGTYRKRWNEKARAGQMSKLKELKRVRNKQFTRAAAADSDSEND
                     SGSDNDDSGSDLESKKVPEDTNVAVLKPLTEEEKLEKKRKLEELFTPKETKISRTKKK
                     RLEKFIEHQLKREEKKVLIEKLQDYKIDTSLLTSSKNLGHGRKTKRQEIEEALKLEKQ
                     GLADEKTKEILYDEVEVKDWYADHPDSAGESDREEEDDEFSEVKSGGFVDNRPSKFGG
                     SGFGFGFANAKVVTKKTPKKKYNWRQKVEQEERKRRKQDDDQDFSSSEDEDEDEESEN
                     EDSVDVSSENNESSSGDEEQEESDEEEEEEESKTTVAEEFKQWANQEIKKLEGRDVEA
                     VMPKLDIKVERTERIEDMDDGLQGDNFNVDENLKRKAFYVKVQRSDEVQLVRTALPVF
                     AEEYRIMEAINHNDVVIICGETGSGKTTQVPQFLYESGYGNSSSADTPGMIGITQPRR
                     VAAVSMANRVSNEMGDHGEYVGYQIRFDSSTKQDTRMKFMTDGVLLREMMNDFKLTKY
                     SSIIIDEAHERNINTDILIGMLSRCVRLRAKEHAQDPVKNKKLKLIIMSATLRVSDFS
                     ENPALFPTPPPVLKVDARQYPVAVHFNRKTKFDYAEEAFRKTCKIHQRLPPGAILVFM
                     TGQQEITHMVKRLRKEFPFPKRQSLIQKDNIPTVRVDAATADVEAEDVDFSVAVKEEM
                     QFEEDLPSDEEGSDAEEEEEGFEETLEEGQTDRDPLYVLPLYSLLPTKEQMKVFRDPP
                     PGSRLCVVATNVAETSLTIPGVRYVVDCGRSKERKFDETTGVQSFEIDWISKASADQR
                     SGRAGRTGPGHCYRLYSSAVYERDFEQFSKPEILRMPVESIVLQMKSMAIHNIINFPF
                     PTPPDPSALAKAQKLLQYLGALDNNERITEDGRAMSLFPLSPRFAKMLLVGNENDCLK
                     YVVTIVSALSVGEPFLSEQELGISSFIPDANASNKENANKDEDDDEDVKRSVVEDPVD
                     HEAEERKRALRTRYIKSSMKFNKLDKFSDVLRLLSAVSALDYIPKEQHYSFMHKNFLR
                     EKTMEEILKLRKQVMFIIKSVTSKESVAVQVKDEDLKSSVPTETQIKLLKQMITAGFI
                     DQVAIRADQLFPEDVTINKSNISSIPYVPVLAEKTSEVEDLFVYIHPNSILNQCGEQP
                     PKYLVFHSLHINSNNERAKTRMKTLCDIKSTPLANVARKGSLLTYGKPITGQGLKPID
                     ISPTERYCYVVPRFGSPNDSDIKIGWELNPIPVHQVKEHGVWTVKKLLTPKAFKSHQV
                     KH"
     gene            <150554..>151528
                     /gene="SAS2"
                     /locus_tag="KLMA_40073"
                     /db_xref="GeneID:34716068"
     mRNA            <150554..>151528
                     /gene="SAS2"
                     /locus_tag="KLMA_40073"
                     /product="histone acetyltransferase SAS2"
                     /transcript_id="XM_022819349.1"
                     /db_xref="GeneID:34716068"
     CDS             150554..151528
                     /gene="SAS2"
                     /locus_tag="KLMA_40073"
                     /codon_start=1
                     /product="histone acetyltransferase SAS2"
                     /protein_id="XP_022675924.1"
                     /db_xref="GeneID:34716068"
                     /translation="MGSTPEKRRRSEAVEEVYGILDKRNIQYVQFGLNKRFSTWYGSN
                     VYFGKDKRTLGFKELNEEGSLPGSQNGHIGQNETDNSEYWLETLYVCEYCFRYTDIEQ
                     ELVMHEKCCTYKNHPPGKIYYRSPQYTIRRVKGSKHENFCQCLCLFTKLFLDNKSVYF
                     KVKQFEFYIVYATNSTVPMAFFSKDLYSYQENNLACILVFPPYQRKKLGTLLIEFSYL
                     LSRRQNIISGPELPLSPFGLIGYLKFWSFSIVWQLTEGELRDAAYITIREISEVTGFR
                     IRDVIQALKYLKCLRGDEINLNVIRSWARSNKVSQGFMIENEYVLFDD"
     gene            complement(<151590..>154985)
                     /gene="RAD5"
                     /locus_tag="KLMA_40074"
                     /db_xref="GeneID:34716069"
     mRNA            complement(<151590..>154985)
                     /gene="RAD5"
                     /locus_tag="KLMA_40074"
                     /product="DNA repair protein RAD5"
                     /transcript_id="XM_022819350.1"
                     /db_xref="GeneID:34716069"
     CDS             complement(151590..154985)
                     /gene="RAD5"
                     /locus_tag="KLMA_40074"
                     /codon_start=1
                     /product="DNA repair protein RAD5"
                     /protein_id="XP_022675925.1"
                     /db_xref="GeneID:34716069"
                     /translation="MTQEQKMEKPRFFKDEEEPILPGKDDQEDQEGQSRSLFVQDEDD
                     EDDEKERFCSCLQDLVGENSVSASQLLSLWQKYGRVENGISIAANKYFEEMEASERSK
                     NNDGSGDSVPIVIDLSDEDDDGDDELSVVSSSQVVSSKRTSSQAGFYSSEKDARMKED
                     TQAEWVRYVGTIYTTGFATRPTVKPVPVGSHLGFKKTVPKTLPLVSKSSSSQHCSHLV
                     RLMDLAQNRELGRIPEEIARIVYPLLDYRSEIRLEPYLLDNNGKRFSVGDDIYIRIEC
                     YLTSNIFTKAEEGAASIRSSLSNRTMDVSQLHRSEAIMALFDAINIKPVYGDTSKREI
                     ESIETQPKELPDSESDGSGFSATQFQEEAMNINQLKSFYRITQSADSLQKLPETTPDD
                     TVFNFQLRRYQKQSLSWMLKREYEYKHLSKEAAEMSIDGNSMNPLWKKFSWPDNRISK
                     HNDDDEEGEKFFYANLYTGEFSTVKPVIKAMVNGGILADEMGLGKTISALALICTASY
                     DEEYSTKLATTKSLSIKDVATKEASPTFFSQQTGKLSLSQQKNGNYAYKTTLIIVPMS
                     LLNQWQTEFEKANNDSSKRCEIYYGSNIKDIKSYVLGPNPPSVIITTYGVIQSEYGRG
                     RDSSNIFDVVFFRIILDEGHTIRNRMTRTSKAVIALRSSRKWILTGTPIINRLNDLFS
                     LVQFLNLEPWSHINYWNRYISVPFEKGKYEQAFDVINAVLEPVLLRRTKNMKDIDGEP
                     LVSLPPKEVVVEKFDLSPVENRVYQSLLKDAENSVKEGLAKGDLLKNYTNILVHILRL
                     RQVCCHLDLVKEAPKEENDEGDLENLDETSTPNITAMLALEKDSTSNKRMSSEKLTRL
                     NNAFNENHKATTSTPDFECAICTTESIQPISAISVTECLHTFCEQCLAEYIDFQHNKK
                     LPINCPYCREPISDTSILKLSEPIDTKKGYELVPFESHFQSTKIKALLKHLKQIQETC
                     PGEQVIVFSQFSSFLDILERELGSHLPKDQVKIYKFDGRLDMKERTRLLEQFHTKDLS
                     CIKLLLLSLKAGGVGLNLTCASRAFMMDPWWSPGMEDQAIDRIHRIGQQKTVKVVRFI
                     VNNSVEEKMLRIQERKRLIGDVVDGDEEQRRKKRVEEIQMLFQ"
     gene            <155505..>156482
                     /gene="DLT1"
                     /locus_tag="KLMA_40075"
                     /db_xref="GeneID:34716070"
     mRNA            <155505..>156482
                     /gene="DLT1"
                     /locus_tag="KLMA_40075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819352.1"
                     /db_xref="GeneID:34716070"
     CDS             155505..156482
                     /gene="DLT1"
                     /locus_tag="KLMA_40075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675926.1"
                     /db_xref="GeneID:34716070"
                     /translation="MVKSWYRIWYRTTQTIFVLLFISFSIVIPIDCAEQATSSNNNAI
                     NTFIVVGAAVALVIFVISISIARILIFRRALQDIPKAYIPVTTRDMPHKDSREYVIKT
                     MKRAGELTEKFKVPKEPVLHAGMEPNESDLFPPNLKYHDVLKFISDRFRFDGALLTTF
                     TNDKDLSITFRKALVSLSEKENKSEWKHLNHLLQLYDKFRFSGEPIERDEFIKFITLY
                     SYISDLSNSLRPLKTDERVSRFLHDRSEYDSNSFSRRGSDMSIGYLRPYPSNGVMPTT
                     TRQSHLGVPSSNINYYFDESDEPSENLEDYQRYHSILTRTDTFDTVIHR"
     gene            complement(<156757..>159333)
                     /gene="CBC1"
                     /locus_tag="KLMA_40076"
                     /db_xref="GeneID:34716071"
     mRNA            complement(<156757..>159333)
                     /gene="CBC1"
                     /locus_tag="KLMA_40076"
                     /product="nuclear cap-binding protein complex subunit 1"
                     /transcript_id="XM_022819353.1"
                     /db_xref="GeneID:34716071"
     CDS             complement(156757..159333)
                     /gene="CBC1"
                     /locus_tag="KLMA_40076"
                     /codon_start=1
                     /product="nuclear cap-binding protein complex subunit 1"
                     /protein_id="XP_022675927.1"
                     /db_xref="GeneID:34716071"
                     /translation="MILLDYEEESGYREFRPHYPKRQRLPPVVLLCKDMMPDIRTMGE
                     SAKAFPEDIKFLSEAIVHEFGNDEYFNNALLKTFRAVVLEQPHKQPGIALLIMVLNSF
                     KPEIGKSVLNYFFDQLQELMNSSHDASYETQSHDTGPWNKAKLILRLLSIMSPMISPD
                     DLIGLYKKFFEFAIELNNASDAKRSPLSEAIYTNTLLNVPYLFYFSSEHQETLKGMVE
                     ELLASVESDYHIKDTDLELLKPYNKNSPYEPVHWVKAILSNVKNALANDMQQVRDLFL
                     NYDSLLAKQETVHSFNEPLNLPTLEQIAEFAGLDKGFGSVDSLWKTPRYSFEVYLPNS
                     VGPFATVIPITTYAGMLFQDILIDIIESMEFNRIEVARQLVTIDLFFKSGIFTEPGLS
                     VAQLLEQFEENPTASTFKIEDLAVGAILELTFKLPTVSQSFAYFYSLLVEICKNSPKA
                     IAPVFGRAFRFFYNNLDKLDFELKARFLDWFSIQMSNFNFSWKWNEWENDSIQWGQTT
                     TYNPRMIFIKNLIRKELRLTSNSADVEESVTDEFQKYMNPSFITRDNLINYYASLFKD
                     EFVLDESDLRNNELYFRSPSFPFHEDVTRLLDFFHKQPDTRTVGELEDILKDITESNS
                     AIIQDVNRFAVTLLIQTVVFCGSRSLSHANKYIDDSKKELAAVLDQLEVSQEIKDQWI
                     CEAVVRYWDSNSQTGYLILDSFRYNGLVSNKAVLNFSLTEQYGVNMSLVDSTSIESIF
                     RLLNEMAVTEDKNVELFEYVFNRLVAAANTVVGEIGTADPIVAPDLESEIQTTEQELP
                     LLDLAWKYEGIMSFLKSILRKYADEYSVLTEQFIGNAMQSITHEPTKQQLSRYISEVS
                     QL"
     gene            complement(<160139..>163159)
                     /locus_tag="KLMA_40077"
                     /db_xref="GeneID:34716072"
     mRNA            complement(<160139..>163159)
                     /locus_tag="KLMA_40077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819354.1"
                     /db_xref="GeneID:34716072"
     CDS             complement(160139..163159)
                     /locus_tag="KLMA_40077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675928.1"
                     /db_xref="GeneID:34716072"
                     /translation="MDAGLAAARQQQQQRPGAGVSAMAQRRNELLHSDIGNIDITKEN
                     PIKKENVQPPVPVQQQYQQQYQYQYPQQQQQQQQQYQQYPGQYIPQGPPVSGGGGKYG
                     MDNERKSSMMSTSSTSFSNFFKGKNKKNKRNSRSQEAFDDRDDDGADVVLPENNGSFL
                     TFNDISSMRNNGGHAYGYGGHMDDTSPIIPTLVTSGGNASSMNNVEYRKHMVNQKKMA
                     LNSLAKQQAPPGVPGGPRAMSLQTYHQRPMVRPGPGAGPGPGPRGPPGGMPRGPPGPG
                     GAARVGSMPMPNGSRLNSLQGGGAPPPRMMGRPGPGPGYNNNNSPHYQYPQGPQGPGM
                     GPGPGPDPRTMSLTTDRRPMGPMGSMGPMGHPNGYGPLPPPQGGPRNGFGPRAQRGPP
                     QSGPRAMSLQSQSVPRPFYSAPTASQDNVLNRKQVPPPVAAAARPLAPPQQLPSNTNG
                     KGTSNSSSGSYASTNSVISGRVSENSSPTTPSNASSEEQNQIPTLPRSPLKYELHASV
                     ADDDVSGSHAYQNRALHSFNEDEEDEDQQTFIAKKDLSQAETPRNASDADSLIKLNIL
                     TLSKPARQVMDLDDQNGPNRHEHEHEYEHATQLETPLSETKSNHSETSNYNINLKPSS
                     ALVEGVHTDADSLFQFEKVEHDPPAHTRIASENPYNDIESEINGEIQDIGGGATASMG
                     RVATSKSGSSDFVDNTSEFDKSSRRSSSNFQKAKNFLLKIKGNKGHERKTSAIIPASS
                     RSSIILDDASLTNDTFKAKTSSASSDKRRRSYHSLFSSSSLSAGNPVEKENNVTTSAA
                     AAAAAAAMERPTRSSRSSTSMQLRKSLIISESTQIQEEPEEESPSQQSLQGAVPYTPS
                     YASVADPKQRVLITPEHINLLKQNSSLIQELQLVSTELAESIARETRLESELESRRNL
                     AEPESPSGLSFIDFETELRKKSSKIVELIQQLNEERLKRFIAEEQNLLYQHGIKPAPA
                     ELSLKITELKMQLDSKDQQLQSLQTQLQDLTFTS"
     gene            complement(<163696..>164915)
                     /locus_tag="KLMA_40078"
                     /old_locus_tag="KLMA_40079"
                     /db_xref="GeneID:34716073"
     mRNA            complement(join(<163696..164102,164312..>164792))
                     /locus_tag="KLMA_40078"
                     /old_locus_tag="KLMA_40079"
                     /product="v-type ATPase assembly factor PKR1"
                     /transcript_id="XM_022819355.1"
                     /db_xref="GeneID:34716073"
     CDS             complement(join(163696..164102,164312..164792))
                     /locus_tag="KLMA_40078"
                     /old_locus_tag="KLMA_40079"
                     /codon_start=1
                     /product="v-type ATPase assembly factor PKR1"
                     /protein_id="XP_022675929.1"
                     /db_xref="GeneID:34716073"
                     /translation="MSHSISLVEAAVVQASSVSASAASGLGMVGNGGTGSVDTSVSTG
                     VVSSVAASGSASAEGSSKGAHSSAHSSGSSASSGKTGSSGESGATSGASGATSGAGAT
                     SGSSAATGSAAGTASSTKGKSKASTSSNAAPGMVANPVNSKYGILLGLMMAGSFILGA
                     VYKCVSQPNPMASFFVALWESIFQPGTSPQLIVATHVSFALLLCVLGSQIYLTKNIHF
                     IALAVIAALLWVTVTWFIYELNRVKLQSNEDIARAQEKTGSGSDSASDKKLSSSSTSH
                     KPTADSNSPKPRKTKSRRA"
     mRNA            complement(<164304..>164915)
                     /locus_tag="KLMA_40078"
                     /old_locus_tag="KLMA_40079"
                     /product="uncharacterized endoplamic reticulum membrane"
                     /transcript_id="XM_022819356.1"
                     /db_xref="GeneID:34716073"
     CDS             complement(164304..164915)
                     /locus_tag="KLMA_40078"
                     /old_locus_tag="KLMA_40079"
                     /codon_start=1
                     /product="uncharacterized endoplamic reticulum membrane"
                     /protein_id="XP_022675930.1"
                     /db_xref="GeneID:34716073"
                     /translation="MSINSTLEHLIASICSHYKYIISLQEHHSTSQSTNYNYNITMSH
                     SISLVEAAVVQASSVSASAASGLGMVGNGGTGSVDTSVSTGVVSSVAASGSASAEGSS
                     KGAHSSAHSSGSSASSGKTGSSGESGATSGASGATSGAGATSGSSAATGSAAGTASST
                     KGKSKASTSSNAAPGMVANPVNSKYGILLGLMMAGSFILGAGI"
     gene            <167081..>167695
                     /gene="RPL15B"
                     /locus_tag="KLMA_40080"
                     /db_xref="GeneID:34716074"
     mRNA            <167081..>167695
                     /gene="RPL15B"
                     /locus_tag="KLMA_40080"
                     /product="60S ribosomal protein L15-B"
                     /transcript_id="XM_022819357.1"
                     /db_xref="GeneID:34716074"
     CDS             167081..167695
                     /gene="RPL15B"
                     /locus_tag="KLMA_40080"
                     /codon_start=1
                     /product="60S ribosomal protein L15-B"
                     /protein_id="XP_022675931.1"
                     /db_xref="GeneID:34716074"
                     /translation="MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRASRPSR
                     PDKARRLGYKAKQGFVIYRVRVRRGNRKRPVSKGATYGKPTNQGVNQLKYQRSLRATA
                     EERVGRRAANLRVLNSYWVNQDSTYKYFEVILVDPSHKAIRRDAKYNWICNPVHKHRE
                     ARGLTATGKKSRGINKGHKFHNTQAGRRKTWKRQNTLSLWRYRK"
     gene            <168489..>170261
                     /gene="ADE17"
                     /locus_tag="KLMA_40081"
                     /db_xref="GeneID:34716075"
     mRNA            <168489..>170261
                     /gene="ADE17"
                     /locus_tag="KLMA_40081"
                     /product="bifunctional purine biosynthesis protein ADE17"
                     /transcript_id="XM_022819358.1"
                     /db_xref="GeneID:34716075"
     CDS             168489..170261
                     /gene="ADE17"
                     /locus_tag="KLMA_40081"
                     /codon_start=1
                     /product="bifunctional purine biosynthesis protein ADE17"
                     /protein_id="XP_022675932.1"
                     /db_xref="GeneID:34716075"
                     /translation="MSDRKTAILSVYDKTGLLDLAKGLTEHNVRILASGGTARMVREA
                     GFPVEDVSTITHAPEMLGGRVKTLHPAVHGGILARNLESDEKDLKDQNIDKVDFVVCN
                     LYPFKETVAKVGVSIPEAVEEIDIGGVTLLRAAAKNHARVTILSDPRDYAQFLQDLKK
                     GEISADLRNKLALKAFEHTADYDTAISDFFRKQYSENKTQLALRYGANPHQKPAQAFV
                     ALREELPFKVLCGSPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVGLP
                     LTDVEKQIYFVADIENLSPLACAYARARGADRMSSFGDWIALSNIVDVPTAKIISREV
                     SDGVIAPGYEPEALEILSKKKNGKYCILQIDPNYTPDQMESRQVYGVTLQQKRNDAII
                     NKSSFKEIVSQNKDLPEQAVIDLTVATIALKYTQSNSVCYAKNGMVVGLGAGQQSRIH
                     CTRLAGDKADNWWLRQHPRVLGFKWAKGVKRPEKSNAIDLFVTGQIPTEEPEKSDYES
                     KFETIPEPLTAEERKAWLSKLTNVALSSDAFFPFPDNVYRAVRSGVKYIAAPSGSVMD
                     KAVFSAADSFDLVYVENPIRLFHH"
     gene            complement(<171319..>173313)
                     /gene="ASI1"
                     /locus_tag="KLMA_40082"
                     /db_xref="GeneID:34716076"
     mRNA            complement(<171319..>173313)
                     /gene="ASI1"
                     /locus_tag="KLMA_40082"
                     /product="protein ASI1"
                     /transcript_id="XM_022819359.1"
                     /db_xref="GeneID:34716076"
     CDS             complement(171319..173313)
                     /gene="ASI1"
                     /locus_tag="KLMA_40082"
                     /codon_start=1
                     /product="protein ASI1"
                     /protein_id="XP_022675933.1"
                     /db_xref="GeneID:34716076"
                     /translation="MKPSSALQNQSIFVEFPYLNQTDHYLINSSSIYAQLVNVPYRTV
                     RSLGSSIAQRFNSAPVQFPEEMNSTAVGGGDNYDDDLIYETNIFWIFAKFSVSSYAAT
                     CLFVAVVLNRLVNMGSLRSTNQQLRIALWAKVSFHLTGLVTIGYMLYQTGAQLGLYGS
                     AQATGQFLSRCYQIVCLSHCIETFIATTSNLKPLEESDFSLFELSSMFYQLSAQDASA
                     DMYAYTCFGCLMGRFIIHFVELLDIRKRRIIFSAVLNVSFSLFMVYRAFTTQEMDGAF
                     IYSFSAFKNIPKILSVSIILLSYVCYQLSCLVRKTTPFGSSDGVSRVEELKYHSFWSN
                     WVESLAISGEEDFFFVVMRFATFLCNPKQSQKHGIHREFEDVTLPTSMHKSYLISGYM
                     NRIDPPPIQELDFKRDVQTTSLWRQRVSWYTTMLGYLFEWTAKLWTRKRKDAAVKKPE
                     RNYNDFVTEKNYVKFLHVQNEKDTDKYLLPEEDYTEDYVPQDDDEYQDDDDDDDDDDD
                     DDEHQDNDNEELASDTQVTLAEELFGPQQIQEIISSPQEMSWYLSTWSILKYQALANE
                     QMLTRRKFAKHNEAYLLQDVISEIPPSEMSHHDHDTNHFDASDMTCVVCKTNQRNIIL
                     WPCKCFALCEPCRTSLGLRAFNTCICCRRQVSGYSKLNIV"
     gene            complement(173622..173736)
                     /locus_tag="KLMA_R404"
                     /db_xref="GeneID:34718702"
     tRNA            complement(join(173622..173666,173700..173736))
                     /locus_tag="KLMA_R404"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34718702"
     gene            <174051..>175463
                     /gene="AAT2"
                     /locus_tag="KLMA_40083"
                     /db_xref="GeneID:34716077"
     mRNA            <174051..>175463
                     /gene="AAT2"
                     /locus_tag="KLMA_40083"
                     /product="aspartate aminotransferase"
                     /transcript_id="XM_022819360.1"
                     /db_xref="GeneID:34716077"
     CDS             174051..175463
                     /gene="AAT2"
                     /locus_tag="KLMA_40083"
                     /codon_start=1
                     /product="aspartate aminotransferase"
                     /protein_id="XP_022675934.1"
                     /db_xref="GeneID:34716077"
                     /translation="MSNNFHLHLKRLPPTYFVQYYPLEHRKLLQYLPEVKKPNKPPPT
                     MSRTLLNSIEELPGDALFAIKQRLAEDPRDVKVDLGIGAYRDNNGKPWVLPAVRKAET
                     LIHADPSFNHEYLGINGLPGLTSGAARILLGETSNALAEKRVVSAQSLSGTGALHIAA
                     KFISKFFPEKVIYLSDPTWANHVSIFESQGLKTATYPYWDAATKSLNLEGFLKAIEES
                     PRGSVFVLHACAHNPTGLDPSESEWVQILDACVKNDIVPLFDSAYQGFASGSLDKDAY
                     AVRLGVSKFAESAPIFICQSFAKNVGMYGERCGCIHIVLPRPETGSSGRDVPQIAKAI
                     TSQLSKITRSEVSNPPAYGAKIVSKILNDEQLTAQWHEDMITMSQRITKMRHSLRDKL
                     VELGTPGNWDHIVNQCGMFSYTGLTKQMVERLESEHAVYMVASGRASIAGLNDNNVEH
                     VAKAIDEVVRHFQSSSSSKL"
     gene            complement(<175542..>177251)
                     /gene="fnx1"
                     /locus_tag="KLMA_40084"
                     /db_xref="GeneID:34716078"
     mRNA            complement(<175542..>177251)
                     /gene="fnx1"
                     /locus_tag="KLMA_40084"
                     /product="multidrug resistance protein fnx1"
                     /transcript_id="XM_022819361.1"
                     /db_xref="GeneID:34716078"
     CDS             complement(175542..177251)
                     /gene="fnx1"
                     /locus_tag="KLMA_40084"
                     /codon_start=1
                     /product="multidrug resistance protein fnx1"
                     /protein_id="XP_022675935.1"
                     /db_xref="GeneID:34716078"
                     /translation="MANELQPILSPAAGYLAMPEQQPLKGPEIDSELESSTIKKDWIV
                     LALFIGSFLSALDTTIVTTLLPTIASDLDASSQMSWIATSYLLSCSAFQPLYGKLSDI
                     FGRKPLLIWSNLCFGVGCIICGAPFTKSLWVLCLGRFISGVGGGGLTTLSTITTSDII
                     PLRQRGVYQGLGNIVFSLGCASGSLIGALLQQHLGWRWAFLVQVPLSLFSCVMIVVLL
                     HLPKDSPGRGLISLSGNNGSKKPLRLIIDDVRELVDVMGSFSLIVTMLLLMIILSVLD
                     NPSQLSSGTWVAFVTVLCLAGYVFVSTELSIDHPMVPLHLLGSNRTVLASSLTNWFFT
                     MSIMTLSYYIPVFWQTVYHFLPWQIGVRTVSNFFGIATGSMLTGIYMKRSGKYKTLSS
                     SVNFITVLGVLVIFGSTFNAHPNGVFEYLMLFVPGCGYASMLTVTLLSLIASVDSSQQ
                     AQVTSVQYAFRAIGSTLGVSFAGLIYQSRLHASLFHDILHNETLQDSYTAKQLKAWCY
                     KILENNSFDVSFDPLLQSLVTKCFQKSSRLVMGFAALTITLGFLSSLFIREHTLHTEI
                     GRR"
     gene            <177964..>178938
                     /gene="SED5"
                     /locus_tag="KLMA_40085"
                     /db_xref="GeneID:34716079"
     mRNA            <177964..>178938
                     /gene="SED5"
                     /locus_tag="KLMA_40085"
                     /product="integral membrane protein SED5"
                     /transcript_id="XM_022819364.1"
                     /db_xref="GeneID:34716079"
     CDS             177964..178938
                     /gene="SED5"
                     /locus_tag="KLMA_40085"
                     /codon_start=1
                     /product="integral membrane protein SED5"
                     /protein_id="XP_022675936.1"
                     /db_xref="GeneID:34716079"
                     /translation="MSVDIRNRTVEFQKRCAIISKKNRNSNGKVNEGSGSSGPSKSEF
                     QQKASHIAHEISNTAMQLGKLSQLAKRKPLLNDNPVEIMELTFLIKRRIYTIENELME
                     LNKLQIGTKQHKQNVMTLLNTKMKNISGNFKDVLETRQKLELENKDRLERLTQGSGDV
                     AGDGSNNEKGSGAINGHTGSLIGHGYNNVNPFISNLIEDETTKNAAASGANGSGLTLP
                     QDGNLLLLEEQRTDQRYLQERSNAIETIESTIQEVGNLFQQLAHMVQEQGETIQRIDE
                     NVGDIEMNIHGAQRELLKYFDNISNNRWMAVKIFAIIFVFFLLWVMVN"
     gene            complement(<179008..>179754)
                     /gene="SNF7"
                     /locus_tag="KLMA_40086"
                     /db_xref="GeneID:34716080"
     mRNA            complement(<179008..>179754)
                     /gene="SNF7"
                     /locus_tag="KLMA_40086"
                     /product="vacuolar-sorting protein SNF7"
                     /transcript_id="XM_022819365.1"
                     /db_xref="GeneID:34716080"
     CDS             complement(179008..179754)
                     /gene="SNF7"
                     /locus_tag="KLMA_40086"
                     /codon_start=1
                     /product="vacuolar-sorting protein SNF7"
                     /protein_id="XP_022675937.1"
                     /db_xref="GeneID:34716080"
                     /translation="MWGYFFGTPKQQKELPKKAIVDLREHIQLLNKKQAHLQTQIDQQ
                     QQLAKRSLTQGNKNNAKTYLKKKKLYESQLDKLQSQIDSLEQQLYSIENANLNLETLK
                     AMKQGASAMKNIHKGLDLDKVDDTMDEIREQVELNQEISEAISKPLIMQDELDEDELD
                     QELELLESEQQQQQQAQAQSLGQAAAAVGAPAPAHAVSQPSIDLPSVPNVKLSGPEKA
                     SGQAEAEAQEDEEEDEDERALRELQAEMGL"
     gene            <181541..>183400
                     /gene="ARN2"
                     /locus_tag="KLMA_40087"
                     /db_xref="GeneID:34716081"
     mRNA            <181541..>183400
                     /gene="ARN2"
                     /locus_tag="KLMA_40087"
                     /product="siderophore iron transporter ARN2"
                     /transcript_id="XM_022819366.1"
                     /db_xref="GeneID:34716081"
     CDS             181541..183400
                     /gene="ARN2"
                     /locus_tag="KLMA_40087"
                     /codon_start=1
                     /product="siderophore iron transporter ARN2"
                     /protein_id="XP_022675938.1"
                     /db_xref="GeneID:34716081"
                     /translation="MVTIDTEKLPEKYLETASPGDLGSPGDSGDTESPEKHLSATKSL
                     VIRKTEILADQYQSWPYRIALLFSAFLCAYGYGLDGTLRNVYTTYATSSYQTHSLLST
                     VSVINLVIAAAAQIFYARLSDVFGRLTLLIVSIVFYSVGTIIQSQAYDVQRYAAGAVF
                     YNVGMVGAVLQVILILSDFSSMRWRLLYTFVPSWPFIINTWISGNIVSAANPLDNWSW
                     DIAMWAFIFPLSCVPLVACMCHMRWKARKTEEWKELKIEQTYYQKHGLVSTLVQLFWK
                     LDVVGVTLCTLALGCILVPLTVAGGVSHKWNQGRIIAPFVLGWVVLLPMFIAWESKWA
                     REPIAPAKMLKDRGIWSALAIQFLTYFVYQMAAGYLYTILIVAVDESTKAATRITSVY
                     SFTAAVASPFFAFFVGQFKPKSGVRRLKPYIVVGVGFWLIAMGILYHFRSGKDSDKGI
                     IGALFLWGLSSTLFTYPITVSIQSITSHENMASVTALSYTVYRVGGAVASACSGAIWT
                     QLLYGNLLKQLDGDAALAKYAYGSPLAFVTEHPWGTATRQAVVRSYRYVQKYEVLVAL
                     IFCVPMFFFAMCLRDPPLTDEQAQKNLKEGEYVQTEDGDPIAEWISQKWGKLR"
     gene            complement(<183657..>184598)
                     /gene="YMC1"
                     /locus_tag="KLMA_40088"
                     /db_xref="GeneID:34716082"
     mRNA            complement(<183657..>184598)
                     /gene="YMC1"
                     /locus_tag="KLMA_40088"
                     /product="carrier protein YMC1"
                     /transcript_id="XM_022819367.1"
                     /db_xref="GeneID:34716082"
     CDS             complement(183657..184598)
                     /gene="YMC1"
                     /locus_tag="KLMA_40088"
                     /codon_start=1
                     /product="carrier protein YMC1"
                     /protein_id="XP_022675939.1"
                     /db_xref="GeneID:34716082"
                     /translation="MDSQQVMSEELFVSPQVVDDLTEIHGFNKTVKDVFSGTVGGVAQ
                     VLVGQPFDIIKVRLQTMPGNTTAWEAIADLVRYEGLRGFYKGTMAPLVGVGACVSCQF
                     GVNEAMKRMFKDINRSRGRFENSLSLGQYYTCGFVSGSANAVLATPIEHVRIRMQLQK
                     EALANAQYKSTLDCTGKLLKEGALMRGFSATLMRTSHGFGVYFLTYETLIGWQLSLGL
                     RRDQISAWKACLFGAVSGACFWAMTYPFDVVKSVMQADKLKNPAYGTNVVQVAKNIYK
                     ERGLRAFTKGFTPTMLRSLPVNGATFAAFEVTMRLLN"
     gene            complement(<185732..>186781)
                     /gene="YKE4"
                     /locus_tag="KLMA_40089"
                     /db_xref="GeneID:34716083"
     mRNA            complement(<185732..>186781)
                     /gene="YKE4"
                     /locus_tag="KLMA_40089"
                     /product="zinc transporter YKE4"
                     /transcript_id="XM_022819368.1"
                     /db_xref="GeneID:34716083"
     CDS             complement(185732..186781)
                     /gene="YKE4"
                     /locus_tag="KLMA_40089"
                     /codon_start=1
                     /product="zinc transporter YKE4"
                     /protein_id="XP_022675940.1"
                     /db_xref="GeneID:34716083"
                     /translation="MSMLSDVFIGAIGLIGGVDAHHSHSHGKDGHFHSHGNGGHFHSQ
                     YTQLVQAAFPFGARYNSVLASVYLGLLPCLLVMVLPGFQRGGTRMVRMMVPFAMGGIL
                     GDVLLHVVPELYGHGEESDLRVGYGIFGGIVAFMVMDKMMRVLGGDSHGHGHGHGHSH
                     SHSHASENEKEKKEEKTSLRASTYLNMVSESIHKAMDGLTLASSFYASKHAGSMTFIA
                     LALHEVPHELGDFAVKMSSGMSFGQAVRSEMVTCLGSLAGIAIGCMLNEAGGAGTASA
                     SASASASGTGSATGAWSSLVSAMSCGGFIYTSTVGVIPELLGEAGGPDQAGVLETVVQ
                     IACAFLGFHVAASMH"
     gene            <187044..>187730
                     /locus_tag="KLMA_40090"
                     /db_xref="GeneID:34716084"
     mRNA            <187044..>187730
                     /locus_tag="KLMA_40090"
                     /product="acyl-protein thioesterase 1"
                     /transcript_id="XM_022819369.1"
                     /db_xref="GeneID:34716084"
     CDS             187044..187730
                     /locus_tag="KLMA_40090"
                     /codon_start=1
                     /product="acyl-protein thioesterase 1"
                     /protein_id="XP_022675941.1"
                     /db_xref="GeneID:34716084"
                     /translation="MPPLSAVRVASRAQPTKNVVVVFHGLGDSGSGWTFLADFLQRSP
                     AFAHTRFVFPNAPNMRIDANGGMLMPAWFNLYDWENPEARIDVQGITDSLKVVDSYVQ
                     EQIDSGIPAENIILGGFSQGASLALASTVTSPHKLGGFFALSGFMGLKKHDLEPLAKN
                     LNQTTPVFHGHGTQDPVIPIHYGLEAKNFFEKQFHLSEYEFKAYNGMAHSTSPEEMQD
                     LVQFLLKIIK"
     gene            <194050..>196647
                     /gene="CLF1"
                     /locus_tag="KLMA_40091"
                     /old_locus_tag="KLMA_40092"
                     /db_xref="GeneID:34716085"
     mRNA            join(<194050..194198,194535..>196647)
                     /gene="CLF1"
                     /locus_tag="KLMA_40091"
                     /old_locus_tag="KLMA_40092"
                     /product="NEDD8-like protein RUB1"
                     /transcript_id="XM_022819370.1"
                     /db_xref="GeneID:34716085"
     CDS             join(194050..194198,194535..196647)
                     /gene="CLF1"
                     /locus_tag="KLMA_40091"
                     /old_locus_tag="KLMA_40092"
                     /codon_start=1
                     /product="NEDD8-like protein RUB1"
                     /protein_id="XP_022675942.1"
                     /db_xref="GeneID:34716085"
                     /translation="MQLKVKTLTGKEIAVDVAGSDSVYHIKELLEEKEGIPPSQQKLI
                     FQGKQVEEIIEANGTPECQEMSEMDSGGTDGPITADSILKSAYERKKPQQQATKVDIL
                     DLEELKDWQRRKRTEFETVLKRNRLDIRQWMRYARFEADHNDIRRARSVYERALLVDH
                     GFIPLWIQYIDSELKWKNVNHARNLLDRATNLLPRVDKLWYKYVFLEEALGNVGIVRG
                     IFTRWCSLEPGPNAWDSFVEFELRQSDFENVRNVYSKYVLVHPQVSTWLQWVRFEHMH
                     GDASSVRTVYSMGLDTLTAHSGTPLEDIEQLIESFASWEAEQDEIERARSLYRIALER
                     WPDSHALKEQQVKLEKKFGSSGVEDAVIEKRKAAYEEELESNHYDYSTWWVYLDLLES
                     KYPREVRQAFDRFVDMAQPTNSKIKDMSWKRYVKLCIRYLVYLELTVDDLAATRQLFQ
                     RLLDKIIPNKRFTFGKLWIMYAEFEIRQNDLTRARKILGMSLGKCPKPKTFKYYINME
                     MKLKEFDRVRRLYEKYLDFNPENVQAWLDYAELEENLGDEDRSRAIYKLSLSNSVGLP
                     LNDQLAIFQRFIAFETDASEYDNARALYNEYLILSEYDVNVWINWALFESTIPSQEQL
                     IAYQEAHEGDEDEDEEEEEFTFDITDENKKQTRDIFEKAIAYFKERQDAGKVKQLLES
                     LLEYEMVHGTEETVSKTKQRMPKTVKRKTIVDGIEQEVFVLELPEEPDDEINKVSKNL
                     LERARQWQQENSK"
     mRNA            <194578..>196647
                     /gene="CLF1"
                     /locus_tag="KLMA_40091"
                     /old_locus_tag="KLMA_40092"
                     /product="pre-mRNA-splicing factor CLF1"
                     /transcript_id="XM_022819371.1"
                     /db_xref="GeneID:34716085"
     CDS             194578..196647
                     /gene="CLF1"
                     /locus_tag="KLMA_40091"
                     /old_locus_tag="KLMA_40092"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CLF1"
                     /protein_id="XP_022675943.1"
                     /db_xref="GeneID:34716085"
                     /translation="MSEMDSGGTDGPITADSILKSAYERKKPQQQATKVDILDLEELK
                     DWQRRKRTEFETVLKRNRLDIRQWMRYARFEADHNDIRRARSVYERALLVDHGFIPLW
                     IQYIDSELKWKNVNHARNLLDRATNLLPRVDKLWYKYVFLEEALGNVGIVRGIFTRWC
                     SLEPGPNAWDSFVEFELRQSDFENVRNVYSKYVLVHPQVSTWLQWVRFEHMHGDASSV
                     RTVYSMGLDTLTAHSGTPLEDIEQLIESFASWEAEQDEIERARSLYRIALERWPDSHA
                     LKEQQVKLEKKFGSSGVEDAVIEKRKAAYEEELESNHYDYSTWWVYLDLLESKYPREV
                     RQAFDRFVDMAQPTNSKIKDMSWKRYVKLCIRYLVYLELTVDDLAATRQLFQRLLDKI
                     IPNKRFTFGKLWIMYAEFEIRQNDLTRARKILGMSLGKCPKPKTFKYYINMEMKLKEF
                     DRVRRLYEKYLDFNPENVQAWLDYAELEENLGDEDRSRAIYKLSLSNSVGLPLNDQLA
                     IFQRFIAFETDASEYDNARALYNEYLILSEYDVNVWINWALFESTIPSQEQLIAYQEA
                     HEGDEDEDEEEEEFTFDITDENKKQTRDIFEKAIAYFKERQDAGKVKQLLESLLEYEM
                     VHGTEETVSKTKQRMPKTVKRKTIVDGIEQEVFVLELPEEPDDEINKVSKNLLERARQ
                     WQQENSK"
     gene            complement(<196712..>198097)
                     /gene="BBP"
                     /locus_tag="KLMA_40093"
                     /db_xref="GeneID:34716086"
     mRNA            complement(<196712..>198097)
                     /gene="BBP"
                     /locus_tag="KLMA_40093"
                     /product="branchpoint-bridging protein"
                     /transcript_id="XM_022819372.1"
                     /db_xref="GeneID:34716086"
     CDS             complement(196712..198097)
                     /gene="BBP"
                     /locus_tag="KLMA_40093"
                     /codon_start=1
                     /product="branchpoint-bridging protein"
                     /protein_id="XP_022675944.1"
                     /db_xref="GeneID:34716086"
                     /translation="MESGNSDSKYDALWGTKVQNNEKLLQNRLPTVINGFLAPEHETA
                     YQVMYRIAEITSNLRMNNLTPPSGRMRSPSPPPVYDSRGRRTNTREQRYKRKLEEERH
                     RLVEIALKMIPHFVAPEDYRRPTKFQDKYYIPTEDYPDINFVGLLLGPRGNTLKKLQQ
                     ESGCKISIRGRGSVRSGKATTDLPKGAADMNEPLHCIIIADTEEKIPLGIKACESIVV
                     KAITSPEGQNDLKRGQLRELAVLNGTLREDNYVQTFGRKRLGTDVPSDTAKRFKRAES
                     GIPDPSRLPVSKSPSRASSVSTVDSQSHTVGQGRTASPAPASPAVQLDSTPFAANTPP
                     GITPTPATPGLSAPGMQAPGMQAPGMQAPGMQAPGMQAPGMQAPGMSAPGMSAPGMSA
                     PGMSAPGMSAPGMSAPGMSAPGMSAPGMSAPGLSAPGTQPPRLQPPGMQAPSTTSSTN
                     SNSINPTQESQ"
     gene            complement(<198465..>199603)
                     /gene="RPS13"
                     /locus_tag="KLMA_40094"
                     /db_xref="GeneID:34716087"
     mRNA            complement(join(<198465..198899,199583..>199603))
                     /gene="RPS13"
                     /locus_tag="KLMA_40094"
                     /product="40S ribosomal protein S13"
                     /transcript_id="XM_022819373.1"
                     /db_xref="GeneID:34716087"
     CDS             complement(join(198465..198899,199583..199603))
                     /gene="RPS13"
                     /locus_tag="KLMA_40094"
                     /codon_start=1
                     /product="40S ribosomal protein S13"
                     /protein_id="XP_022675945.1"
                     /db_xref="GeneID:34716087"
                     /translation="MGRMHSKGKGMSSSAIPYSRNAPAWFKGSSESVVEQIIKYARKG
                     LTPSQIGVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKHL
                     ERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN"
     gene            complement(<200084..>200527)
                     /gene="AIM7"
                     /locus_tag="KLMA_40095"
                     /db_xref="GeneID:34716088"
     mRNA            complement(<200084..>200527)
                     /gene="AIM7"
                     /locus_tag="KLMA_40095"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819375.1"
                     /db_xref="GeneID:34716088"
     CDS             complement(200084..200527)
                     /gene="AIM7"
                     /locus_tag="KLMA_40095"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675946.1"
                     /db_xref="GeneID:34716088"
                     /translation="MSNLYHLSTDTKNGIKKFRSATARSDDAQIQVIKIQPKPSYEII
                     IDDDEDLEDFKELSDLAELLPDNMPRFVLMSYPMTTRDGRKKTPLVMLYWKPPTVVSQ
                     EWKMLYAGALEMVRVECAVNKFIEVSSGLEDEDEIEELKQEIEAD"
     gene            <206072..>207802
                     /gene="TPO1"
                     /locus_tag="KLMA_40096"
                     /db_xref="GeneID:34716089"
     mRNA            <206072..>207802
                     /gene="TPO1"
                     /locus_tag="KLMA_40096"
                     /product="polyamine transporter 1"
                     /transcript_id="XM_022819376.1"
                     /db_xref="GeneID:34716089"
     CDS             206072..207802
                     /gene="TPO1"
                     /locus_tag="KLMA_40096"
                     /codon_start=1
                     /product="polyamine transporter 1"
                     /protein_id="XP_022675947.1"
                     /db_xref="GeneID:34716089"
                     /translation="MSSVAAPRPSYSSSSSSSNAPDTRPFQGDDLEKGTSGSGSTPGG
                     DQDDVQLKLVKTFTNAASETEIAVNRRLSRILTNTQNEPELIEVDYSDVPPMGGDRPY
                     PPALPDRAPYEVTFDGPNDPMHPFNWTFKKKLFLCILLGLNCISITVGSSIFASAVPH
                     ISADYHVIQVVAILGITLYVLGFAASPVIYAPLSELYGRQGVLLISSFGFALFQFAVA
                     TGENLQTILICRFFGGFIGAAPLAVVPAAFSDLFDNTQRGTAVTFFSLGVFVGPILAP
                     VFGSYIVQYTTWRWTEYVTGIFASVIFVLLCFFFEETHHPTILVQKAKMMRKKTGNWG
                     IHAAHEEVELSIKEICQKTITRPIYMLFTEPIIFLITLYNSFVYGILYLLLEAYPIVF
                     IEGYHFYANGELPYIALIIGMNFAAIVNIYMERDYVKRVVANNGKPVPEARLFPLMIG
                     GIIFPIGIFWFCWTANYHDSVHWIVPTIAGSFIGYGLMAIFLPCFNYIIDSYLFLAAS
                     AIAGNTFMRSSFGAAFPLFAGYMFRNMGTNWAGLLIGLFATAMIPVPFLFYKYGRLLR
                     QKSKYAYDLQ"
     gene            <208452..>210626
                     /gene="FRA1"
                     /locus_tag="KLMA_40097"
                     /db_xref="GeneID:34716090"
     mRNA            <208452..>210626
                     /gene="FRA1"
                     /locus_tag="KLMA_40097"
                     /product="putative Xaa-Pro aminopeptidase"
                     /transcript_id="XM_022819377.1"
                     /db_xref="GeneID:34716090"
     CDS             208452..210626
                     /gene="FRA1"
                     /locus_tag="KLMA_40097"
                     /codon_start=1
                     /product="putative Xaa-Pro aminopeptidase"
                     /protein_id="XP_022675948.1"
                     /db_xref="GeneID:34716090"
                     /translation="MSTVNMRPSLASIPGTATATAAGAPAHDSGAPRNFKPCANCTCS
                     YGQLSRKGRRSSVLLKQIASRRQSQMGGVSLRPTNESIYSTDSICQIKSIETSNRLAA
                     LRKQMSEHELCCYIIPSEDEHQSEYVAQADERRAFISGFTGSAGVACVTRDLLNFNTD
                     KPEGKAILSTDGRYFNQASQELDYNWSLLRQGEDPVTWQQWCINEAFEMSLALGGKLA
                     KIGIDPRLISFEQVKVFEAQIKDKCEESNAKVELVPVKQNLVDKIWSEFDTVPVRDLN
                     ELLLLERDFSGECFKSKRERLMETISKKNHGAQNLVICALDEICWLLNLRGSDIEYNP
                     VFFAYLLLSHDETFLFTDNPFDDKIQKYLTENNIQVESYQNIWTFLSDRATVLAEKKE
                     TILIPSNSSWEIVRKLHGSHVKRIQSPVEVMKAVKNQTELQNAHSAQVKDAVALVQYF
                     SWLEDQLVRQEKLIDEYKAAQKLTEIRKTAKNYMGNSFETISSTGANAAVIHYAPPEE
                     NSSMIDPSKIYLCDSGAQFLEGTTDITRTMHFTKPTEEEIRNYTLVLKGNLAIERLVF
                     PEGTSGYSIDVIARQFLWQHGLDYKHGTGHGVGSFLNVHEGPIGIGFRPHLANSPLEK
                     GNIITNEPGFYKDGEYGIRIENELEVKQAEGLQFGNRKFLRFENITMVPYCRKLINPH
                     MLTPEEKTTINEYHARIWATVVPFLQPSSIAFKWLKRETKPL"
     gene            <211515..>212204
                     /gene="ISA1"
                     /locus_tag="KLMA_40098"
                     /db_xref="GeneID:34716091"
     mRNA            <211515..>212204
                     /gene="ISA1"
                     /locus_tag="KLMA_40098"
                     /product="iron sulfur assembly-related protein"
                     /transcript_id="XM_022819378.1"
                     /db_xref="GeneID:34716091"
     CDS             211515..212204
                     /gene="ISA1"
                     /locus_tag="KLMA_40098"
                     /codon_start=1
                     /product="iron sulfur assembly-related protein"
                     /protein_id="XP_022675949.1"
                     /db_xref="GeneID:34716091"
                     /translation="MQRHIVTRINVCLLNPSVSVRHLSQGSLARSKRFLQTSQNGDEV
                     SSSSPSWPFNVELRATNNTGTNSVTGSAPSGGKKTWFTYSLPKNAGKEEAKEASKDTD
                     TQETQPVVAKKRVKRKLRPRKALISLTPNAISHLRGLLQQPEPKLIRIGVKNRGCSGL
                     TYDLQYITKPGKFDEIVEQDGVKVVIDSKALFSIVGSEMDWIDDKLSSKFVFKNPNSK
                     GTCGCGESFMV"
     gene            <214781..>217477
                     /gene="HSP104"
                     /locus_tag="KLMA_40099"
                     /db_xref="GeneID:34716092"
     mRNA            <214781..>217477
                     /gene="HSP104"
                     /locus_tag="KLMA_40099"
                     /product="heat shock protein 104"
                     /transcript_id="XM_022819379.1"
                     /db_xref="GeneID:34716092"
     CDS             214781..217477
                     /gene="HSP104"
                     /locus_tag="KLMA_40099"
                     /codon_start=1
                     /product="heat shock protein 104"
                     /protein_id="XP_022675950.1"
                     /db_xref="GeneID:34716092"
                     /translation="MNDETQFTNKANDILRTAQKLAQDHRHAQLQPIHLLAAFVEPSE
                     DGSIGFLQNIVELAKYDFDPLRRAINRHLVRTPSQTPAPLEVQPSYAFGQVLKDTLEI
                     KKQQKDSFVGQDHIMSALFKEATTQSIFKECSIDIEAVKQQMLELRGNQRIDSRGADT
                     NEKWEYLKKYAIDMTEQARAGKLDPVIGREEEIRTAITVLARRIKSNPCLIGEPGIGK
                     TAIVEGVAQRIIDDDVPQILQGCKLFSLDLAALTAGAKYKGDFEERLKGVLKEIEESK
                     VLIILFIDEIHMLMGQGVDDSANAANILKPALSRGGLKVIGATTTNEYRALVEKDGAF
                     ERRFQKIDVPEPTVRQTVAILRGLQPKYEIHHGVRILDSALVSAAQLAKRYLPYRRLP
                     DSAIDLVDISCAGVAVARDSKPEELDNKERELHLLQVEIKALERDEETDPTTKERLQQ
                     ARQKEASLNEELEPMRQRYQQEVDSHEQLRLAKKKLDELENKCLDAERRYDNATAADL
                     KYFAIPDVKKRIAELEQKVAEEESREGTETMVKNVVNSEVIAETAARMTGIPVNKLTE
                     SENAKLIHMERELSQQVVGQMDAVKAVSNAVRLSRSGLSNPNQPASFLFLGLSGSGKT
                     ELAKKVAGFLFNDEKAMVRIDCSELMEKHSVSKLLGTTAGYVGYQEGGFLTNQLQRKP
                     YSVLLFDEVEKAHPDVLTVLLQMLDDGRITSGQGKTVDCSNCIVIMTSNLGAQYLNAQ
                     TGSKVTEGAKELVMGAVKAHFRPEFLNRISSIVVFNKLSHKAIHKIVDIRIKDLEAQF
                     EDNDKNYKINVTPEARDFLANNGYSEDMGARPLNRLIQTEILNPMAIRILKGEIKDKE
                     TVNIQLAADGSHLEVLPNHPASTDVGDEEMDLDLEDDDLDLD"
     gene            216910..217724
                     /locus_tag="KLMA_R405"
                     /db_xref="GeneID:34718703"
     tRNA            join(216910..216943,217679..217724)
                     /locus_tag="KLMA_R405"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:34718703"
     gene            <223911..>226040
                     /gene="RIM4"
                     /locus_tag="KLMA_40100"
                     /db_xref="GeneID:34716093"
     mRNA            <223911..>226040
                     /gene="RIM4"
                     /locus_tag="KLMA_40100"
                     /product="meiotic activator RIM4"
                     /transcript_id="XM_022819380.1"
                     /db_xref="GeneID:34716093"
     CDS             223911..226040
                     /gene="RIM4"
                     /locus_tag="KLMA_40100"
                     /codon_start=1
                     /product="meiotic activator RIM4"
                     /protein_id="XP_022675951.1"
                     /db_xref="GeneID:34716093"
                     /translation="MSSQVAEGINARIDIDTASNTGKMNTTKDFDEKEYLNHGGDDDT
                     LNKSVINVEKHLKKLHVDHRPLLDNKLTPFLPDQLSEITSESDTESDTDSTNLLEDLS
                     PRAADEPSFSRPSSCIFVASLAASLTDSELNASVTKEFNKYGKIISVKVLRDPANRPY
                     AFVQYASDEDALNALSQAQGTTLNDRNIRCERAKVNRTVFISSSFTNPLESKLTAENV
                     IELMSKFGELEQVVPSRDQMYKKNYYPLEVASSWFVQYAYRDDAIRAYLQMKLNYDYM
                     VEWAQNVEVPPRFNLLLSKAKIGELERLERERLGKQPIFIDNKSIFIGQLNFKVTKPL
                     LLERFSKYGEIETCNLIHKQEQGKCFAFIKYKVAASAATALERENHSVFMDKILHVQI
                     REVSNSRRGSVDSSKSFQGPQLNLAPPPLNIGRRASTGSFNKIMYPLPAHLQSNIPSP
                     YVYASMQEPRRNTINAGSPTYRTTPPNFNHGGDPQSYYNERNHHSHHYYGSKNKTYAT
                     KAGNDVDEERTAPEGGMYSRKNQFDKKISNDNEQNTIEEEEDNDYENDEEREADETPF
                     LEHESNSSYTTFSAGTGTFPKHNNSNNTNYGKYHGHKWRRNIDGLRLNRMDPNFYYGP
                     PLYYSMEYCPPSGGPVVPPPSHIMQAPGTHLTGHGPPSQHSPFFYYFPMPPPTPTFTN
                     PFPHDHSGGFNYMDKPAPTHDKEELEY"
     gene            complement(<226644..>229244)
                     /gene="NPR3"
                     /locus_tag="KLMA_40101"
                     /db_xref="GeneID:34716094"
     mRNA            complement(<226644..>229244)
                     /gene="NPR3"
                     /locus_tag="KLMA_40101"
                     /product="protein RMD11"
                     /transcript_id="XM_022819381.1"
                     /db_xref="GeneID:34716094"
     CDS             complement(226644..229244)
                     /gene="NPR3"
                     /locus_tag="KLMA_40101"
                     /codon_start=1
                     /product="protein RMD11"
                     /protein_id="XP_022675952.1"
                     /db_xref="GeneID:34716094"
                     /translation="MHTNLPDSCLIGIALTVSTHSGPQLVYHYPPINYAAATNSKKDH
                     HLNKKKHHYSLDQEEEEAASDSSSSSDDYSSGLSDSELSTDYADTSSSDSDSSSSSLD
                     HHVHSPSLDSQHGSTTNMDESNNGRNNSVNISTAASVSNSGMLRSRQSQISANKLFQL
                     LNNGNNNNNNSTSLTNASGSLRDSLYSGFTDPYHHELDQDLDPELQQLVQELLDDSMF
                     QRDAFQDVSKVLNFNAEFVAELCCPRKEMCNTRFEFTVDDLCFLGLPIHADAKGRWKK
                     AKKRKHSSKKSATVKSSGRNRSNTEDSTNKNQRQQQQQQQDQPTTESDDESGQEGETS
                     KSEMLNEMYAANEEEFESLEKSINMFQVCFIMNPQIIEYNERVDDMYHFVVTRLSLIL
                     RYIQGKNGYVTKECANIIKCRDQVTKHSPIYKSLKSPWRKGKFLYERILYQSSLARAL
                     TKCFNCIKNNQIANLEIDRDKIVSLQIPIKTEFSVLPNLKEDPVIRGSYLSSILNESF
                     LGGSLSGGIAEDSENIYANHERMLDFGLLLLDEPENIVKGLENASFDNGITDLLLINL
                     VRQLKPTYRLFQYKALIKELLDSNDDSNYNDEFLETTLKSLCLHLIYWRHARLILPLS
                     PRYTYIVSPLAPISGFSNEDYAHAEYDTVFKKQNTLTSNTDDISLIYQNKKSFSDKFP
                     SLPSLPSFLQLISTQKPKPFGHIIPSNEHKAMYLNALAWLMRYGYLTQLLTFVYIRVD
                     KRIKIAVDEDLERDGIRSNKKGRSDNFVSGGENYNGSDFDDLEMLNDNDFTIILEPER
                     NTALEKRWLFKCAEALPPDLQVLFKQAVKYFNGKIPLEYVMIKENIPKHEMKRLLQAL
                     GNYVVEVKHW"
     gene            complement(<229551..>230597)
                     /gene="ADH1"
                     /locus_tag="KLMA_40102"
                     /db_xref="GeneID:34716095"
     mRNA            complement(<229551..>230597)
                     /gene="ADH1"
                     /locus_tag="KLMA_40102"
                     /product="alcohol dehydrogenase 1"
                     /transcript_id="XM_022819382.1"
                     /db_xref="GeneID:34716095"
     CDS             complement(229551..230597)
                     /gene="ADH1"
                     /locus_tag="KLMA_40102"
                     /codon_start=1
                     /product="alcohol dehydrogenase 1"
                     /protein_id="XP_022675953.1"
                     /db_xref="GeneID:34716095"
                     /translation="MAIPETQKGVIFYENGGELQYKDIPVPKPKPNELLINVKYSGVC
                     HTDLHAWQGDWPLDTKLPLVGGHEGAGIVVAMGENVTGWEIGDYAGIKWLNGSCMSCE
                     ECELSNEPNCPKADLSGYTHDGSFQQYATADAVQAARIPKNVDLAEVAPILCAGVTVY
                     KALKSAHIKAGDWVAISGACGGLGSLAIQYAKAMGYRVLGIDAGDEKAKLFKELGGEY
                     FIDFTKTKDMVAEVIEATNGGAHAVINVSVSEAAISTSVLYTRSNGTVVLVGLPRDAQ
                     CKSDVFNQVVKSISIVGSYVGNRADTREALDFFSRGLVKAPIKILGLSELATVYDKMS
                     KGQIIGRIVVDTSK"
     gene            <232593..>235280
                     /gene="CHO2"
                     /locus_tag="KLMA_40103"
                     /db_xref="GeneID:34716096"
     mRNA            <232593..>235280
                     /gene="CHO2"
                     /locus_tag="KLMA_40103"
                     /product="phosphatidylethanolamine N-methyltransferase"
                     /transcript_id="XM_022819383.1"
                     /db_xref="GeneID:34716096"
     CDS             232593..235280
                     /gene="CHO2"
                     /locus_tag="KLMA_40103"
                     /codon_start=1
                     /product="phosphatidylethanolamine N-methyltransferase"
                     /protein_id="XP_022675954.1"
                     /db_xref="GeneID:34716096"
                     /translation="MPTACESVTAAAAAAAATKRSRGIARPRSAPGHGPSAANSTGAS
                     TNANGGYFFTPPKTHDMVRSLFDPRLKKSFLECCITASIFANVFLCYYCCTRYSPETA
                     KTVFLAQYIFWRLSYNLGIGIVLHYQSHYESLTHFAKKHALFDKKNTHSALSRFVKFE
                     VAAKYPNASDLYKYPDEWNTWLVFRQFVDLILMQDFTTYMLYVAVCLPHRLILDNLAS
                     FNSIMVRTWLGVFMVLFNIWVKIDAHSVVKDYAWYWGDFFFLQDSDLVFDGVFNVFPH
                     PMYSIGYIGYYGLSLISGNHHVLFVSILGHCLQFLFLKYVETPHIERIYGSSSSSSED
                     GVGVVDGPESIDDKMVKQLVNYSKPLVTTFLGFRNFDKFRPTDYITLIAMASVVSAYF
                     ACNPSFVTISKITLAVKIATSVLNMVILNKQSRSKWFTKWYLQNGYNEIYAYQMWQFI
                     YNLSSTVNYVLLVLQCYCHFVKCGAGSYNTVTFGLLLLAIQIWCNSEVFDSIKEFGWF
                     YGDFFLPNLIDQRKLKNDGIYRYLNNPERVFGVAGIWGTVLINNFSNWNLWLATTWTM
                     FNWFTVKFIETPHLLKVYGTKPSSSGFEKTLTKYKFGKDFKSLIDKVDQLLDDYLFTS
                     LVPKVPENSSGKHSVSLHSDSGPEQQQRDRDWEAIINMLLIRENTVKNLHGSSRNVVM
                     DIVNLNEENIIEIPSEIEIKWSIGNELFHKNDWVGLYKVVETGEDRLTTKIPSQGHWT
                     AVCPDSSYSSSTHRKIQHFDSNNHFTYGTVVFDKNISSFEEGIYEFRYHSGNSHDVVM
                     ISKPFKLLFPHLKESISDADQLTTATKAFLKDCGVLVNGNRFDSNINRYFSGKTLQQW
                     YRATMGTYVSVDYMKRTNFDIDIITKKVWQVKQVLDSLE"
     gene            complement(<235496..>236194)
                     /gene="MTR3"
                     /locus_tag="KLMA_40104"
                     /db_xref="GeneID:34716097"
     mRNA            complement(<235496..>236194)
                     /gene="MTR3"
                     /locus_tag="KLMA_40104"
                     /product="exosome complex component MTR3"
                     /transcript_id="XM_022819384.1"
                     /db_xref="GeneID:34716097"
     CDS             complement(235496..236194)
                     /gene="MTR3"
                     /locus_tag="KLMA_40104"
                     /codon_start=1
                     /product="exosome complex component MTR3"
                     /protein_id="XP_022675955.1"
                     /db_xref="GeneID:34716097"
                     /translation="MSVQDRRRILGPAEAKPLSFAKITEETQDQTSNTKDKDSLFIST
                     DLITNANGSSYLEYIDKSSYQVLVMGSVFGPRPLRGSFQSSASLSIQFKEVTLEHFDM
                     GEIKEICTFLNNVFNAVVNLERYPKSGIDLFIDLVQYTQSDNTEKRSVIEILPTCINC
                     ITLALVDAGVEVIDLVSAGCVDNSVVAFIKNGQEIVGIWSDDSNVTDISKVVEDCKAK
                     YMENKQTLVQYLRQ"
     gene            complement(236495..236567)
                     /locus_tag="KLMA_R406"
                     /db_xref="GeneID:34718704"
     tRNA            complement(236495..236567)
                     /locus_tag="KLMA_R406"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:34718704"
     gene            complement(236592..236664)
                     /locus_tag="KLMA_R407"
                     /db_xref="GeneID:34718705"
     tRNA            complement(236592..236664)
                     /locus_tag="KLMA_R407"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:34718705"
     gene            <237092..>238561
                     /locus_tag="KLMA_40105"
                     /db_xref="GeneID:34716098"
     mRNA            <237092..>238561
                     /locus_tag="KLMA_40105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819386.1"
                     /db_xref="GeneID:34716098"
     CDS             237092..238561
                     /locus_tag="KLMA_40105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675956.1"
                     /db_xref="GeneID:34716098"
                     /translation="MFDKLKQKVFSSTREPRVLDIPPPGQINDNRIIYQSRSNYGVNF
                     GSLFVLEKYIYGSLFSAGGDVEFDAVTNQVKSTGVDDAAKRLSDHYDAYLNKVDWGWL
                     KSVGCTAIRLPVGYWHINNGALMSSDQKFYSLKDVYAKAAPWNRVKQVIAKANDNSIG
                     VLIDLHALPGGANTGEHSGEQSGGTATFFGNSSYVSSVTNTMIPFMVQDLQSNENMVG
                     IQIVNEADFDNDGSKEKSYYTKAVAKVRSVSGTWPIFISDGWWPQQFSDWAQSSNLYP
                     DVVIDSHVYRCFSDSDKSKSVPQIIQDLPGSVQYDQTKADFVVGEFSCVLDQQSWNKT
                     SGDHNTLVKQYGNTQTQLFTKEASVGWFFWTLQFEYGDGGEWGFVPMVNEGAIPKRPT
                     SWNKPSDSDVQKIITDHVNYWADKGGDKMEHWRFEDGLKNTLLDIESFVAFNNSLLGR
                     TCAWKHNRRAQYVRQKGDSQYMWEWDQGFDQALSNFNHY"
     gene            <239241..>239465
                     /locus_tag="KLMA_40106"
                     /db_xref="GeneID:34716099"
     mRNA            <239241..>239465
                     /locus_tag="KLMA_40106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819387.1"
                     /db_xref="GeneID:34716099"
     CDS             239241..239465
                     /locus_tag="KLMA_40106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675957.1"
                     /db_xref="GeneID:34716099"
                     /translation="MYQQQQPMYQQQPMYQQGPPQPMYYQQQQPMYQQPQQPVYVQQQ
                     PQRQEDDCCGTCCKMLMCCCLFELCCSMMN"
     gene            <240321..>241439
                     /gene="ARO3"
                     /locus_tag="KLMA_40107"
                     /db_xref="GeneID:34716100"
     mRNA            <240321..>241439
                     /gene="ARO3"
                     /locus_tag="KLMA_40107"
                     /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
                     /transcript_id="XM_022819388.1"
                     /db_xref="GeneID:34716100"
     CDS             240321..241439
                     /gene="ARO3"
                     /locus_tag="KLMA_40107"
                     /codon_start=1
                     /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
                     /protein_id="XP_022675958.1"
                     /db_xref="GeneID:34716100"
                     /translation="MFISNDRIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKI
                     IVDARNQVCDILNGKDDRLVVVIGPCSIHDPKAAYEYADRLKKLSDELSGDLLIIMRA
                     YLEKPRTTVGWKGLINDPDIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQF
                     LSDCFSLGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLQVAVDAMRAAAHSHYFL
                     SVTKPGVTAIVGTEGNEDTFVILRGGKKGTNYDAENVKLAQQELLKAKVVDAEGVQRR
                     IMIDCSHGNSSKDFRNQPKVAQSIYEQLTDGQNAICGVMIESNLVEGRQDIPPEGGRD
                     KLIYGCSITDACIGWDTTDEVLRLLAKGVQNRRAALKK"
     gene            complement(<241929..>242840)
                     /gene="MUM2"
                     /locus_tag="KLMA_40108"
                     /db_xref="GeneID:34716101"
     mRNA            complement(<241929..>242840)
                     /gene="MUM2"
                     /locus_tag="KLMA_40108"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819389.1"
                     /db_xref="GeneID:34716101"
     CDS             complement(241929..242840)
                     /gene="MUM2"
                     /locus_tag="KLMA_40108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675959.1"
                     /db_xref="GeneID:34716101"
                     /translation="MGNNMGQSVNFGLHTSSDSIGSHFHQGISGHRASVSSYWEQPLL
                     DNHSHSHSHNQNQGHSHSHNQSSTMTQSISHNANSSDIVAQNSSSSSNNTIIMDTSMN
                     AKSSGYNTTLDSEDMSADAFRLELQLKETQIESLELEIKKLKGIFNQGLTFKQQEEQK
                     LKKSKALTYDSEVQIPASLEIIFCKLSDSLKRKDQELQETKRRLEGIITAVALNPSNS
                     VTKFGRYDEEALAHKMVTRLETLMKENEEMAKMLSYGRSKETTIELELLRKENQELKD
                     RLRWMEHRKTAGPAVVSTANTITTDST"
     gene            complement(<243429..>245759)
                     /gene="UBP14"
                     /locus_tag="KLMA_40109"
                     /db_xref="GeneID:34716102"
     mRNA            complement(<243429..>245759)
                     /gene="UBP14"
                     /locus_tag="KLMA_40109"
                     /product="ubiquitin carboxyl-terminal hydrolase 14"
                     /transcript_id="XM_022819390.1"
                     /db_xref="GeneID:34716102"
     CDS             complement(243429..245759)
                     /gene="UBP14"
                     /locus_tag="KLMA_40109"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 14"
                     /protein_id="XP_022675960.1"
                     /db_xref="GeneID:34716102"
                     /translation="MSDFDICDIKVPNVIDNDDCVYCFETMKNKNTDTDHALIICLTC
                     FQCFCIDHWEFHQQVVVNETQTTHDLYLKVSKYLKPQRNDEEASTPPSEKKMKLEIKD
                     VNEDDLYDTHWTVGSLERGEMLSSDTLEVPQDWLNKVNEILNAKSSSYQDMSNTWTLE
                     LKPCQHIDNFDLSKCTPPPSTLSQCCSDCGLSSNLWLCLHCGNVGCGREQVGIQGNSH
                     ALKHYESARDHSLAVKLGSLTRDTADIYCYSCDEDVKFVNQQQWNEILEFWKVEVPEK
                     SKEKTLVELQVEQSLKWDFQMVDSSGKSLKHLKCGPEYGLGLLNLGNSCYMNSILQVL
                     LNGGVKHWNLSELGSFPDDVIYPRNNLICQLIKIRDAMTTFQSKYPDGVKPTSFKKVI
                     GGSHEEFSSGRQQDSLEFFTYMTDKLDKEVFKKRDSNPNDLFRCRMQDKIKCSDCNKV
                     KFMDQVAEVIQLPLQRSEEPQQLIDRIRDYFSGETIEYRCPTTKELTTAVKVPGFSTF
                     PHTLVVNPIRIELINWQPSKTSDQVFVPGVRDAELLDMTPFKAEGLLETEEELKEEDD
                     NAEEVQFNEVFLSQLKEMGFSENASKRALHATGNSNANDAMEWLFQHMDDADLNSDFK
                     PPKTQNKGPNVDQDALSNMVNMGLDPKLCRKALVLNNNDVNSSVEWVFSHMDDDGELP
                     ETEGSSNDDKNPIAKTYGVEAKNIAAAKYKLSAVVCHKGNSVHSGHYVAFIKKIVDGK
                     EQWVLYNDEKIILANDVTNFEEIEKNGYMYFFTLLE"
     gene            complement(<246122..>247630)
                     /gene="EHD3"
                     /locus_tag="KLMA_40110"
                     /db_xref="GeneID:34716103"
     mRNA            complement(<246122..>247630)
                     /gene="EHD3"
                     /locus_tag="KLMA_40110"
                     /product="3-hydroxyisobutyryl-CoA hydrolase"
                     /transcript_id="XM_022819391.1"
                     /db_xref="GeneID:34716103"
     CDS             complement(246122..247630)
                     /gene="EHD3"
                     /locus_tag="KLMA_40110"
                     /codon_start=1
                     /product="3-hydroxyisobutyryl-CoA hydrolase"
                     /protein_id="XP_022675961.1"
                     /db_xref="GeneID:34716103"
                     /translation="MLRYSRVPQASLRHVLRAKFAINQLRFMSEVKFRVDSTARVVTL
                     DRPKKLNALDVEMCNAILPTLHEYSKSDVNNVVILNSSGSPRAFCSGGDVAQVAKLAK
                     EGNFEYAKEFFTKEYSLDLTLAAMDKPVIAIMDGITMGGGVGLATHVPFRVATENTRW
                     AMPEMDIGFFPDVGVTFSVPKITTVGGSNGQLAQYLCMTGDILNGADAYVAGVASHYV
                     PHDQIENLQARLAELHLNLDKSEFAEHEAEMFDVVNQAIEEFNTPLPKDYKFKYSIDE
                     LNVIEQAFGIGNSLKQIFAALDEIAASQAETPAAKQFAAKTKEVLAGKSPVSLEIAKE
                     HFQRNSSTDIQTALTQDLITAVRMSEHSDLCEFANATSHKLLEKNKTPYPWKIKDLKL
                     SQLSTLLSQNPSKPLSLVRPANLVTFSEYPYHSKYQLPKESDVEQYITGADQQGRQTA
                     VTKKEAVKYFQQLNPVTKNKPGVDYLVSLIIDRKCAPNQDGFLRWKSPSSKL"
     gene            <248880..>250034
                     /gene="dsd1"
                     /locus_tag="KLMA_40111"
                     /db_xref="GeneID:34716104"
     mRNA            <248880..>250034
                     /gene="dsd1"
                     /locus_tag="KLMA_40111"
                     /product="dihydroceramide delta(4)-desaturase"
                     /transcript_id="XM_022819392.1"
                     /db_xref="GeneID:34716104"
     CDS             248880..250034
                     /gene="dsd1"
                     /locus_tag="KLMA_40111"
                     /codon_start=1
                     /product="dihydroceramide delta(4)-desaturase"
                     /protein_id="XP_022675962.1"
                     /db_xref="GeneID:34716104"
                     /translation="MTITHRDLKISDKSVEVPSTHEDLSVLHNYYWSAHKEPHAIRRQ
                     AIIKKHPEVQRLMGHEPLTKWIVIGVVSLQLSLAYYLRNTHPFTWKFFIIAYVFGATA
                     NQNIFLAIHELSHNLAFKKPIHNKLFAIFTNTPIGIPYSASFGPYHQLHHKFLGDELY
                     DTDIPTRYEAVLLSNILGKSFFATFQILFYAFRPMFVTSIKFTYIHLLNVVYQLVFDY
                     VWITKFGMYSYAYFIMSSFLAGSLHPTSGHFIAEHYLLNLEEAIVGGKLMLKLTPAEK
                     KPIYVTDTSKVSRDDVEFKEEYALETYSYYGILNFFTWNVGLHNEHHDFPFVAWSKLW
                     ELNKMCPEFYNDLPRHTSWCKVLYDFITKDDIVLYNRVKRVNKDYEQSKP"
     gene            complement(<250823..>253390)
                     /gene="AKL1"
                     /locus_tag="KLMA_40112"
                     /db_xref="GeneID:34716105"
     mRNA            complement(<250823..>253390)
                     /gene="AKL1"
                     /locus_tag="KLMA_40112"
                     /product="serine/threonine-protein kinase ppk29"
                     /transcript_id="XM_022819393.1"
                     /db_xref="GeneID:34716105"
     CDS             complement(250823..253390)
                     /gene="AKL1"
                     /locus_tag="KLMA_40112"
                     /codon_start=1
                     /product="serine/threonine-protein kinase ppk29"
                     /protein_id="XP_022675963.1"
                     /db_xref="GeneID:34716105"
                     /translation="MINSESVSRANSVSHTAATSAMLSNSQLLSPNTQVVVGTHKCEI
                     IEHLAEGGFAHIYKVKFLELTNEMDAGIETRLLKAGDVACLKRVIVPDENGLNELRNE
                     VETMKQLRGSPNIVQYYDSNASRRPDGSPGYEILLLMELCPKGSLLDYMNKKLATKLS
                     ESEILKIMFDVTNAIAQVHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSVCFPIV
                     STHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF
                     ELTGQFAILHSKYDIPQNAYSSKLINLIIIMLAENPSLRPNIYQVMYHICQILKCDVP
                     FSDKYELGPYDFDKYAQYHSKLQQIQYQMFELYNKKNITPVDIDNLNSLFIQNFEIAP
                     KEPVYKVSAAASQPDSSEDELDSDLEKMDEFYPTVEKLESGNLKGKDDNHLNVSSSSV
                     KKSNSRSTSEFSNRSQISLSSVDKGSFQGARTPPPPPAPISQSQLQLQLQYPQQQQTQ
                     QAQQTQQAQQQSQAQQQQQPKPKSQQQQQQNTENMSATKQHKQYNPFQAQYQPELGSS
                     DYFQADNDHYFKETPPMQKINDKASSYFHQPSPEDNKQPPSLQVPTQNHKFDTGVSIP
                     EVTTTNTNTEYLLDLSPPQGNVSNNNNNNNNHIVYSVSGGIPTTLPRNIPTNMPEQGL
                     SSQPLVQSISQQNQNSANVPPVHQPLQHRLDLTFDQVDLSKHSLTRQSDTEVEESVIS
                     DESISLDLKQTKTKEASAKPIHRPISPVLENNDFPKPKSKSSKAPQRKSLDLKYQEIN
                     LSSEDQRIQRKAAKPSFSRNSIRRSVEMERMKHDSNSSNSRDDSKESKRRSFFGVFK"
     gene            complement(<253855..>255597)
                     /gene="ORC2"
                     /locus_tag="KLMA_40113"
                     /db_xref="GeneID:34716106"
     mRNA            complement(<253855..>255597)
                     /gene="ORC2"
                     /locus_tag="KLMA_40113"
                     /product="origin recognition complex subunit 2"
                     /transcript_id="XM_022819394.1"
                     /db_xref="GeneID:34716106"
     CDS             complement(253855..255597)
                     /gene="ORC2"
                     /locus_tag="KLMA_40113"
                     /codon_start=1
                     /product="origin recognition complex subunit 2"
                     /protein_id="XP_022675964.1"
                     /db_xref="GeneID:34716106"
                     /translation="MTQEDLNDDGIVDHQDIFLSPSKLKSLSPIRSKSPKKSPRRSLI
                     LESIKVEESVKGSTIKDEDVEDDDEQEEDKYEDAVSETPRRRRKKVKVEEEDAPYQLG
                     DDPSVEATIKSEDSPVKKSPRRKLVFSNDQSSAASSPSKRTTNGTAQKINKLLLDDDV
                     LPEENIQDYKNIKLNLNPDFKPTPVPKDGEHSIAHDEQSQIYFFDGFEGYIDQTKILK
                     TEKRSKNSMSAAPSITRDEYNILSQLSNDIFHKTSIHAIQSIHKKLFQQFTFELLQGF
                     TLLFYGIGSKKKFLESFAFDFLSPKIAMLQNPDIQEDDECVPVFVINGYNTISKNVFL
                     DILKLLAEGETIEIMAQSNYWDNRIDLQMDRLLKYFSKRPPTVKMILLIHNLDGPSFR
                     KEQFQTRMSMLAQIKQICIIASVDHIQAPFLWDHFKAQSFNFVYHDITNFEPYIVETI
                     QSSHAVNLANNESTLFNATAAKYVLESLTDNSKRMYKILLQLLMEKQNKSKNKKTGGK
                     TTTGTEFAKLFEACTEQFVVSSEMSLRTMLSEFVDHKMAFITKNKMGKEIVDVKYSYG
                     DMEKLVKEIDAMVQ"
     gene            <256019..>256327
                     /gene="RPC11"
                     /locus_tag="KLMA_40114"
                     /db_xref="GeneID:34716107"
     mRNA            <256019..>256327
                     /gene="RPC11"
                     /locus_tag="KLMA_40114"
                     /product="DNA-directed RNA polymerase III subunit RPC10"
                     /transcript_id="XM_022819395.1"
                     /db_xref="GeneID:34716107"
     CDS             256019..256327
                     /gene="RPC11"
                     /locus_tag="KLMA_40114"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC10"
                     /protein_id="XP_022675965.1"
                     /db_xref="GeneID:34716107"
                     /translation="MLLVSKADSGIYKLSCGSCPYEFPIDGIEVYDRKNLPRKEVDDV
                     LGGEGAWDNVDQTGAQCPNHDQCGGDKAYFFQLQIRSADEPMTTFYKCVNCGHKWREN
                     "
     gene            complement(<256498..>257469)
                     /gene="HEM13"
                     /locus_tag="KLMA_40115"
                     /db_xref="GeneID:34716108"
     mRNA            complement(<256498..>257469)
                     /gene="HEM13"
                     /locus_tag="KLMA_40115"
                     /product="coproporphyrinogen-III oxidase"
                     /transcript_id="XM_022819397.1"
                     /db_xref="GeneID:34716108"
     CDS             complement(256498..257469)
                     /gene="HEM13"
                     /locus_tag="KLMA_40115"
                     /codon_start=1
                     /product="coproporphyrinogen-III oxidase"
                     /protein_id="XP_022675966.1"
                     /db_xref="GeneID:34716108"
                     /translation="MTDSAVPMRKKMEELIRRKQKEITKGLEELDTVQFRADSWTRGN
                     DGGGGTSMVLQNGSTFEKGGVNVSVVHGTLTPPAIRAMKNDHKNLHLPIDPETGEPDA
                     SGVRFFACGLSMVIHPINPHAPTTHLNYRYFETTHADGTPQAWWFGGGADLTPSYLYE
                     EDAKLFHQLHKDALDKTDVTLYPKFKKWCDEYFYIKHREETRGIGGIFFDDLDDRDPD
                     VLLNMVENCFDAFLPSYTEIIKRRMNMPYTEEERQWQQIRRGRYVEFNLVLDRGTQFG
                     LRTPGSRVESILMSLPVTASWLYDHHPEPGSREDKLLQVLKNPIEWV"
     gene            complement(<259348..>259590)
                     /locus_tag="KLMA_40116"
                     /db_xref="GeneID:34716109"
     mRNA            complement(<259348..>259590)
                     /locus_tag="KLMA_40116"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819398.1"
                     /db_xref="GeneID:34716109"
     CDS             complement(259348..259590)
                     /locus_tag="KLMA_40116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675967.1"
                     /db_xref="GeneID:34716109"
                     /translation="MCQEKKRKRAVFLACAWAWYFVLGMGMGIVIVRDVGGEEGREGG
                     SCASLLLALALALPMISRAYTEYTPLRQKSHAPCPN"
     gene            <260836..>261948
                     /gene="NRG1"
                     /locus_tag="KLMA_40117"
                     /db_xref="GeneID:34716110"
     mRNA            <260836..>261948
                     /gene="NRG1"
                     /locus_tag="KLMA_40117"
                     /product="transcriptional regulator NRG1"
                     /transcript_id="XM_022819399.1"
                     /db_xref="GeneID:34716110"
     CDS             260836..261948
                     /gene="NRG1"
                     /locus_tag="KLMA_40117"
                     /codon_start=1
                     /product="transcriptional regulator NRG1"
                     /protein_id="XP_022675968.1"
                     /db_xref="GeneID:34716110"
                     /translation="MSIVRPNMPFLGDFAWGPGSSRTHPGGSLYASEASGSSRSNSDS
                     VNQEVNSRYDYNYGNSSSHGTDAAVAAAAAAPRPILPPLHSVILNSYSAVPLVASSRA
                     ASSTSSSSISLSPMATGSSPVLPLVHPMPTVSVEMEAKRSLDRFLFNGPGNETYVSGC
                     RPAPLLTTCSFTSVSHSHPHSHNHGISRSHVHPIHADQQAAIGSNSPGHGHGPVLGTV
                     SVPVPVPSNSQNTNHHGTVSQEHSTDRTENTDCLKNTTTTTTTNIGNNDKFKKSPSVS
                     SSKKSKLSQGKSISSNRSLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHKCQ
                     FPGCTQRFSRHDNYIQHYRTHFKNHPNAVKPPPIDT"
     gene            <262969..>263871
                     /gene="SLT11"
                     /locus_tag="KLMA_40118"
                     /db_xref="GeneID:34716111"
     mRNA            <262969..>263871
                     /gene="SLT11"
                     /locus_tag="KLMA_40118"
                     /product="pre-mRNA-splicing factor SLT11"
                     /transcript_id="XM_022819400.1"
                     /db_xref="GeneID:34716111"
     CDS             262969..263871
                     /gene="SLT11"
                     /locus_tag="KLMA_40118"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor SLT11"
                     /protein_id="XP_022675969.1"
                     /db_xref="GeneID:34716111"
                     /translation="MDQDTEVKICDRCLPAESGTPTLVKYPNGKECKLCTFPFDSYSY
                     KLKHNSFQTICCARCANKNSICQVCLNDFEYGIPMHLRNSMKQIMNQEADTIIPKNDM
                     MKRFVGLSSKKVAPLDLDKLRKEADTIRKWKVRELPFHSNINTSKDILFLYNIDQKQT
                     ESQIASFLITASNNNLERENIVLKLNKSLKVGTVTFKHDAELWTQKLVSLLPKFKVGE
                     SLEKSYLDLPSGRVFITSYLLHNDENEPVDITRINVEHAYSSLVQKIILKDAASISGE
                     IKDKTRKLKKGAKKTLRVRQKLDL"
     gene            <265022..>265444
                     /locus_tag="KLMA_40119"
                     /db_xref="GeneID:34716112"
     mRNA            <265022..>265444
                     /locus_tag="KLMA_40119"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819401.1"
                     /db_xref="GeneID:34716112"
     CDS             265022..265444
                     /locus_tag="KLMA_40119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675970.1"
                     /db_xref="GeneID:34716112"
                     /translation="MSTPEQAVRSLLRSIYLSNEPVPLESIMALQELLGSDLQFDQNG
                     KDKGMSEYYIDSLPRVPKNKLKTEDTCAICQCNFLEDPYPLVAKLPHCNHTFDLECLS
                     VWLQSNHTCPMCRDDLTSKHLDIDTSQCELEEDFNMYG"
     gene            complement(<265503..>266117)
                     /locus_tag="KLMA_40120"
                     /db_xref="GeneID:34716113"
     mRNA            complement(<265503..>266117)
                     /locus_tag="KLMA_40120"
                     /product="30S ribosomal protein S10"
                     /transcript_id="XM_022819402.1"
                     /db_xref="GeneID:34716113"
     CDS             complement(265503..266117)
                     /locus_tag="KLMA_40120"
                     /codon_start=1
                     /product="30S ribosomal protein S10"
                     /protein_id="XP_022675971.1"
                     /db_xref="GeneID:34716113"
                     /translation="MFRNGFRGILRQQSTVAGPRTLPFNAKETPIPKNVEAVYHAPLK
                     IEPVHKDLVADIQLKSYDNENLDFFSSFVLRAGYYLGIPMKGPKPMPTKRERWTVIRA
                     PFVMAKSKENFERHTHARLIRLYDTNVEVVETLLSYISKHSMSGVGIKCNLYQREPVD
                     LQSKKEDLDVEKFDMSSQLHGLDDAVGAKVVELLKNPEFSKHFK"
     gene            <266414..>267328
                     /gene="TRM7"
                     /locus_tag="KLMA_40121"
                     /db_xref="GeneID:34716114"
     mRNA            <266414..>267328
                     /gene="TRM7"
                     /locus_tag="KLMA_40121"
                     /product="tRNA (uridine-2'-O-)-methyltransferase TRM7"
                     /transcript_id="XM_022819403.1"
                     /db_xref="GeneID:34716114"
     CDS             266414..267328
                     /gene="TRM7"
                     /locus_tag="KLMA_40121"
                     /codon_start=1
                     /product="tRNA (uridine-2'-O-)-methyltransferase TRM7"
                     /protein_id="XP_022675972.1"
                     /db_xref="GeneID:34716114"
                     /translation="MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLDDDFNFLEDAVR
                     VVDLCAAPGSWSQVLSRRLFVEGRDNSDRKIVAVDLQPMSPIDNVITLQADITHPRTL
                     QTITDLFEGEKADFICSDGAPDVTGLHDLDEYVQQQLILSALQLSTCLLRKGGNFVAK
                     IFRGRDIDMLYSQLGYLFDKVVCAKPRSSRGTSLESFIVCLGYNPPVGWEPKLDINVS
                     VEDFFQGCDIGKLSLDDEGGKLLDYREEPRSIAKFIACGGLSSFDSDATYHVDPSSSA
                     LDPVQAPTNPPYKKALELKRKGKMSRAI"
     gene            complement(<267397..>269349)
                     /gene="KRS1"
                     /locus_tag="KLMA_40122"
                     /db_xref="GeneID:34716115"
     mRNA            complement(<267397..>269349)
                     /gene="KRS1"
                     /locus_tag="KLMA_40122"
                     /product="lysyl-tRNA synthetase"
                     /transcript_id="XM_022819404.1"
                     /db_xref="GeneID:34716115"
     CDS             complement(267397..269349)
                     /gene="KRS1"
                     /locus_tag="KLMA_40122"
                     /codon_start=1
                     /product="lysyl-tRNA synthetase"
                     /protein_id="XP_022675973.1"
                     /db_xref="GeneID:34716115"
                     /translation="MSNFLLIKPKLKNFDILRKFIESTSRTKLHLSVEDRFIGITVLE
                     GVSLLIRNQNPTAEKMSQPHEVAQATEAVANLHLDEVTGEMVSKSELKKRIKQRQVEA
                     KKAAKKASAKPVPEPKKKVNTDAFADLDPSQYFEARSRQINELRKTQSPNPYPHKFQV
                     SITLPEFLAKYAHLKRGETLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQ
                     LQDYHQESSYEDDHSLIKRGDIVGVEGYVGRTSPKKGGEGEISVFVSRIELLTPCLHM
                     LPTDHFGFKDQELRYRKRYLDLIMNKDARNRFITRSKIISYIRKFLDTRNFIEVETPM
                     MNVIAGGATAKPFITHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGID
                     MTHNPEFTTCEFYQAYADVYDLMDMTEIMFSEMVKEITGSYVIKYHPDPNDPAKEMEL
                     NFARPWKRINMIEELEKRFNVTFPPGDQLHTAETGEFLKKVLKDNKMDCAPPLTNARM
                     LDKLVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTEL
                     NDPFDQRARFEEQANQKAQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTD
                     SNTIREVLLFPTLKPEIVKEEKEKKA"
     gene            complement(<269743..>271605)
                     /gene="BAP3"
                     /locus_tag="KLMA_40123"
                     /db_xref="GeneID:34716116"
     mRNA            complement(<269743..>271605)
                     /gene="BAP3"
                     /locus_tag="KLMA_40123"
                     /product="valine amino-acid permease"
                     /transcript_id="XM_022819405.1"
                     /db_xref="GeneID:34716116"
     CDS             complement(269743..271605)
                     /gene="BAP3"
                     /locus_tag="KLMA_40123"
                     /codon_start=1
                     /product="valine amino-acid permease"
                     /protein_id="XP_022675974.1"
                     /db_xref="GeneID:34716116"
                     /translation="MTDEARKDRGGNIHEKSSNETEISVSTEKQSLEVRNGLFQRFVD
                     SFKRAEDDDDGEINLDVLESCDERRARMHHHDAADVVLSNVTSNPNHKGPVIASSKLK
                     STIQPRHTIMMSLGTGIGTGLLVANGKSLYFGGPGGLLIGYVLVSIISYIMMQAVGEL
                     ALAYPKLPGNFNAYQAIFISPAWGFATVYLSLLQWLTVLPLELITGTLIVQYWNDKIN
                     PDVFVVIFFVFLLAVHYYGSGRCYAEFEFIFNSCKVLMIIGFVILGIIINCGGAGKDG
                     YIGGKYWKKPGSFAEGSAGSQFKGVCYTLITGFFSYGGQELFALTVNESVNPRKAIPS
                     ATKKSIYRILFIYLLTMILIGFLVPRDSDELMGAGGSATHASPYVIAISSHGVKIVPH
                     IVNAVILISVISVGNTALYTGPRLLNSLAEQNMAPKILNYVDRRGRPLVALVICSVFG
                     VIAFAAASKNEEQVFTWLAAIAGLAELFTWTGICLSHYRFRRACKVQNRPIDDLGYVS
                     TTGEWGSLYAVFFNILVFIAQFWVALFPMDNKGKADAEAFFESYLAAPIWIVLYFGYM
                     LYTKDFTFLVPLKEIDLDSYRKRYDPEILRQEDLEHKEKVRSKGWWYKLYDIWC"
     gene            <274220..>275281
                     /gene="DET1"
                     /locus_tag="KLMA_40124"
                     /db_xref="GeneID:34716117"
     mRNA            <274220..>275281
                     /gene="DET1"
                     /locus_tag="KLMA_40124"
                     /product="putative phosphoglycerate mutase DET1"
                     /transcript_id="XM_022819406.1"
                     /db_xref="GeneID:34716117"
     CDS             274220..275281
                     /gene="DET1"
                     /locus_tag="KLMA_40124"
                     /codon_start=1
                     /product="putative phosphoglycerate mutase DET1"
                     /protein_id="XP_022675975.1"
                     /db_xref="GeneID:34716117"
                     /translation="MKPRLILLIRHGESESNKDKKVNEHTPNHLIPLTKNGMNQARMA
                     GIEILKLLNVDDDSLIQKIEQEQDHPDDRKKLEQNYKRVRTSKDTDIVFYTSPYRRTR
                     ETLKGIIEMIDRYNELNTGIKVCEGESYQPLGTRRLAHWQCPAFPSAVFENSASVTNL
                     RKVHTTGVPTTTDSSTSDQNQNQKNFLHYRVKEEPRIREQDFGNFQQTESMTEVMNTR
                     ANYGHFFFRLPQGESAADVYDRCSGFQESLFRHFERSGGKKRDVVAIVTHGIFLRVFL
                     MKWFRWTYEEFESLMNVPNGSVIIMELDETLDRYVLRTKLPKWTTTGCDDAAAGASTS
                     GSNSSCAQKHCQCEPTAIV"
     gene            <276219..>276965
                     /gene="TPI1"
                     /locus_tag="KLMA_40125"
                     /db_xref="GeneID:34716118"
     mRNA            <276219..>276965
                     /gene="TPI1"
                     /locus_tag="KLMA_40125"
                     /product="triosephosphate isomerase"
                     /transcript_id="XM_022819408.1"
                     /db_xref="GeneID:34716118"
     CDS             276219..276965
                     /gene="TPI1"
                     /locus_tag="KLMA_40125"
                     /codon_start=1
                     /product="triosephosphate isomerase"
                     /protein_id="XP_022675976.1"
                     /db_xref="GeneID:34716118"
                     /translation="MARTFFVGGNFKMNGTKASIKEIVERLNSASIPSNVEVVIAPPA
                     AYLDHAVSLNKKAQVSVAAQNAYLKASGAFTGENSVEQIKDVGAEWVILGHSERRTYF
                     HETDEFIADKTKFALDSGVKVILCIGETLEEKQKGITLEVVQRQLQAVLDKVQDWTNV
                     VVAYEPVWAIGTGLAATSDDAQDIHHSIREFLAKKLNKDTAEKIRILYGGSANGKNAV
                     TFKDKADVDGFLVGGASLKPEFVDIINSRV"
     gene            complement(<277303..>277992)
                     /gene="ALG14"
                     /locus_tag="KLMA_40126"
                     /db_xref="GeneID:34716119"
     mRNA            complement(<277303..>277992)
                     /gene="ALG14"
                     /locus_tag="KLMA_40126"
                     /product="UDP-N-acetylglucosamine transferase subunit
                     ALG14"
                     /transcript_id="XM_022819409.1"
                     /db_xref="GeneID:34716119"
     CDS             complement(277303..277992)
                     /gene="ALG14"
                     /locus_tag="KLMA_40126"
                     /codon_start=1
                     /product="UDP-N-acetylglucosamine transferase subunit
                     ALG14"
                     /protein_id="XP_022675977.1"
                     /db_xref="GeneID:34716119"
                     /translation="MLFALLWCILLWIITLCLVRICAVIPLFSSSKRHATADADAKDL
                     VLFVFLGSGGHTGEMLRLLDHYQKAIIEGATTIHVGYSDEDSLVKFKDKIGAIVSSKQ
                     LQVKIEYHHFKKARDVGSSVAGSVISIIETLITSMTITYNIKKSMRGKPNLTLLNGPG
                     TCCIITVWLKLYHLFLWQPSKIVYVESLARTNRLSLTGKILYPLADEFVVQWPDLLPA
                     YPRAKYYGILV"
     gene            <278818..>279180
                     /locus_tag="KLMA_40127"
                     /db_xref="GeneID:34716120"
     mRNA            <278818..>279180
                     /locus_tag="KLMA_40127"
                     /product="chaperone protein htpG"
                     /transcript_id="XM_022819410.1"
                     /db_xref="GeneID:34716120"
     CDS             278818..279180
                     /locus_tag="KLMA_40127"
                     /codon_start=1
                     /product="chaperone protein htpG"
                     /protein_id="XP_022675978.1"
                     /db_xref="GeneID:34716120"
                     /translation="MSRSKSGLKRSTVILDDNMVREYKLALEKLTLDNTKQAHAHTQA
                     PKQINTSDSASSISSMLSRDNSIMDLLLIDEDESEFLDGEETSEVVFLSKGQSQLDFQ
                     LDLWENDTAVLSRTPLEF"
     gene            <280291..>280872
                     /gene="HSP26"
                     /locus_tag="KLMA_40128"
                     /db_xref="GeneID:34716121"
     mRNA            <280291..>280872
                     /gene="HSP26"
                     /locus_tag="KLMA_40128"
                     /product="heat shock protein 26"
                     /transcript_id="XM_022819411.1"
                     /db_xref="GeneID:34716121"
     CDS             280291..280872
                     /gene="HSP26"
                     /locus_tag="KLMA_40128"
                     /codon_start=1
                     /product="heat shock protein 26"
                     /protein_id="XP_022675979.1"
                     /db_xref="GeneID:34716121"
                     /translation="MSFNSPFFQFFDAINQEVDQFNRLLNNSGFIAPRQIEDESSGNS
                     KQVAKQNQNANSLSSFFQDPWFADFGKDLIPPLDILDHEKEYEVHVSVPGIKDKKDIG
                     LEYHQEANEIVISGEIPDITTEETKDSAKIRERRYGKFKRVVRLPKYPGVDADNIKAN
                     YTNGVLVLTVPKLKPSEDEKAKVRKIEVGDAKL"
     gene            complement(<281654..>282694)
                     /gene="EMP70"
                     /locus_tag="KLMA_40129"
                     /db_xref="GeneID:34716122"
     mRNA            complement(<281654..>282694)
                     /gene="EMP70"
                     /locus_tag="KLMA_40129"
                     /product="transmembrane 9 superfamily member 1"
                     /transcript_id="XM_022819412.1"
                     /db_xref="GeneID:34716122"
     CDS             complement(281654..282694)
                     /gene="EMP70"
                     /locus_tag="KLMA_40129"
                     /codon_start=1
                     /product="transmembrane 9 superfamily member 1"
                     /protein_id="XP_022675980.1"
                     /db_xref="GeneID:34716122"
                     /translation="MVHSLYSALKNDLARYNEMNLDNDFEEETGWKLIHGDVFRSPER
                     AMLLSVFVGSGAQLALMTTTTILFACLGFLSPSSRGSLTTVMFLLYAIFGSFGSFTSM
                     ATYKFFNGKNWRTNLVLTPILIPGSILAVVVALNFFLIFVHSSGAIPFKTMIVIVFLW
                     FIVSIPLSAIGSLMAWKKCNWDQHPAKTNQIARQIPFQPWYLKTLPASLIAGIFPFGS
                     IAVELYFIYSSLWFNKIYYMFGFLFFSFLLLILTTSLITILLTYYSLCLENWKWQWRS
                     FIIGGCGCAFYVFCHSILFTKFRLGGLTTVVLYLGYSSLISGLCCLMTGAIGFLSSLL
                     LVKKIYSCIKVD"
     gene            <284491..>286449
                     /gene="TRS85"
                     /locus_tag="KLMA_40130"
                     /db_xref="GeneID:34716123"
     mRNA            <284491..>286449
                     /gene="TRS85"
                     /locus_tag="KLMA_40130"
                     /product="transport protein particle 85 kDa subunit"
                     /transcript_id="XM_022819413.1"
                     /db_xref="GeneID:34716123"
     CDS             284491..286449
                     /gene="TRS85"
                     /locus_tag="KLMA_40130"
                     /codon_start=1
                     /product="transport protein particle 85 kDa subunit"
                     /protein_id="XP_022675981.1"
                     /db_xref="GeneID:34716123"
                     /translation="MSLRFSYEKYMNLIQYPEHWGNPIPQEISKKVIYNTLSPCICVQ
                     SNSVLDNHLREMYNIDSVSMLFRYFGDYIQDRDQIASASNLNLDGVNNGGAGVKSRRR
                     HRSDSLSQRQASECVRFTRSLEDLISIDSEDHILQPNDIDRFLSQYLEKLEPLMEKHD
                     SPSKILKHSIYHRFFITLSSINLSRYHTFHHPVAALLPIDITKGQGYDYAKEILISFK
                     NLHNNLSHFPEFININDILPIFVLCYDENSREQWEAVQSLIKSLKKQLFVESVPIPLF
                     TTYEHAPLTTLHSPITVSLHEQVFSMSNPVSINVPSILLNHIYDTITSIVEGLMIPFM
                     HRKLVFWDETVLQPRKSIFQSNKFFRKFISPKTNHPTPHKIIKNQDTGAEDIMFPAGS
                     PEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFEAYPQYLAPCLEAKSVSLLMGAQNII
                     TAKTIKTEVDPLMKRAIEQYKKEDGKHDLHLIHCILTFSDLLLSLSDTWVSSPLAINY
                     LTYILNFNLLGPYASVIIWERIAYAYEICIDLRVSEHTLPRVDELKALDIDDESRESI
                     AEKGNDYEENRWENPDKLVFDNLRSEGLTRFRKYSLYQLVAAKKWTELHKDNQAKWCM
                     YQATPVYEKLKLSKREDGLFHRLNVSLS"
     gene            complement(<286566..>290180)
                     /gene="RAX2"
                     /locus_tag="KLMA_40131"
                     /db_xref="GeneID:34716124"
     mRNA            complement(<286566..>290180)
                     /gene="RAX2"
                     /locus_tag="KLMA_40131"
                     /product="bud site selection protein RAX2"
                     /transcript_id="XM_022819414.1"
                     /db_xref="GeneID:34716124"
     CDS             complement(286566..290180)
                     /gene="RAX2"
                     /locus_tag="KLMA_40131"
                     /codon_start=1
                     /product="bud site selection protein RAX2"
                     /protein_id="XP_022675982.1"
                     /db_xref="GeneID:34716124"
                     /translation="MVYMLKQIISLCVLIYLTGFTLGSQLSNIEKLLNISHYETPKWS
                     PPDVTYMNDFGDLTIISYTGEQNFTIQANDSALLYYSNDTFVKLFDTAQDAKIEKIVP
                     YQDDSFILSGSGQINGIDLGHQVLLNLTSLTTKPLLSNPIKNVNALLAVNNSVIIAGN
                     FSYKVSNVTGHGVVMWDGSDNSTKLLPFGGFSDNSTVNSIVQLDNENILFAGEFQNIQ
                     NSTLLRQLSNGSNGTSHKDIADLQFDQSVSLKLSSVIGGNVQQDALFCPSSGDSNGWL
                     VSGSVPSSLQINLKNEIRPSKVRIYNSLDQDSEVSLFRIITSPSNGIMNLTYLDPSSG
                     EIKQCDAWCPLLSSKTLTELYQNSSSAIRSVPIDNNSTNLKWSDSYQEFAFVNDVPVT
                     MLQFFALDSYGSNVALHSVELFETEFMVYANNTYNEPNCESTTDYSKSELSADNWYII
                     NSGSNYMATNIQNNKPYVNFFPNITYPGQYTLNMYTPGCLNDNSCSQRGIVNVTLMDP
                     SSNEILATKLIYQTNDQDKFDPLFSGFLQSTPEVILSWDQALGENSIMVADRLGVITE
                     SIDTKKIYGNSTFELNGLFQYNTKNISKPFSETNDTLSNYAVDNFPGNASLFAALFGD
                     ELLIAGNFNGISKVDLDNDTLISSSQRLGTTGFTTGIFEYSEGLLFTGSFDANGQNQH
                     EILSYDGNSFNSFGQLSEDIANVVNFTVDGSELLLFDQAYIFNVSSNGYISNSSTFAI
                     SGVSSGANRHNDSLLFGSILKKTIGNLNDMAVLSPDGQVSSPNLPQFPATYRPYKATY
                     INDTTVVYALQEVNNNSTSYRVVLTSTNSTSSQLLQLEWSEPINTLLFNERENILAIG
                     TNGTSKLNQNDVQFSVVNLTGFESVAKQSFDGTQCVNSMVSFEKNNSILVGGSYKVEG
                     CQDICLYDYRSDQWKNFLNGSISGKINQLQFSNEGSTLLIGGLLQVDNKTDIQLLSLN
                     LTSNNLSVIKSGSKPLVSFSLIGQSIDNIIAQTEDDLEQIQNGNVKSILPQLNENSSI
                     AGFTVLSYQNSKKRADTSHIILLDGELNAHDFGTLNSMVYDDASQEWSPFFVTSGSKD
                     SQNQLPGSFFQDIDNLYLSSSQTVLTSNNSSHAPVSTPKPTPTKKPSHKKKNKINRGW
                     IVLIGLALALATISVIGLIGALFSYLFMSHKGYESLKPRINQDEMLDTIPPEKLMKFI
                     "
     gene            complement(<293372..>295915)
                     /locus_tag="KLMA_40132"
                     /db_xref="GeneID:34716125"
     mRNA            complement(<293372..>295915)
                     /locus_tag="KLMA_40132"
                     /product="transcription activator"
                     /transcript_id="XM_022819415.1"
                     /db_xref="GeneID:34716125"
     CDS             complement(293372..295915)
                     /locus_tag="KLMA_40132"
                     /note="osmotic-stress induced"
                     /codon_start=1
                     /product="transcription activator"
                     /protein_id="XP_022675983.1"
                     /db_xref="GeneID:34716125"
                     /translation="MNPTSARTTDSTSALNTSLNVTQALQEHAHRDREGKEVESEAGG
                     GAGAGAGSGSSSREDADSADTTQSHHGDETVSGNSLGNVEDEDEDGDVDVGVDVDVDI
                     DVDDYSTEANASEDSLSHKKEHKQDKFTLNTAEADCVLMNMYFILNDMFLTLDADKSI
                     DQFTDVVTKSLEMYRTVGRLPIALARTMEITDMVPLATLKSTTLPCILRYYKWCSVRS
                     QDPLFPNTLVTSDKCYRFIQDDIRICHHDSSTIKLLLEAIKTLFELQQKVLEYAEIIG
                     SDSISVFHWDNIDFEQISKAIFSPEAEAFRASKQRNSTSSLTGMHFQNTLRVSESVRR
                     DSEISISDGSSAAAAASVAAETSSARAGTDGHNRRSNTNRDYTDHDNGNGIGNNGGRN
                     NSTGNNTNRNTNNNNSNNNSDGNNDGNTSNTNANNSNSVNNNNVNGSGNGQGSRTQRV
                     TSQQDTLIIQQTHFEDSTNENYDSPSQYFMSPESLSLHQKVQDLSNENQQLKEQVTCL
                     TQNIQYLLDNPDIMKKNDQLRDTKLMPKDLQSSSHFKNQDQVLAASISKFMPTSAVEN
                     QIDQLLDNNIPYPFTFNPQSFTRNQLSPGINHTELDNSKRNFNNLGHFNKHQHQSMSN
                     TATTLDPLSLVGELPSQSPDLDLDFQRIHEHPSSHHQHASKQQDTHGNLAHHLPTQSH
                     SEKKRSISKRGKTVLMKDMGTSSVSKGQQFKPPVGPNGKTYLVTPEGYLNIDMKNDLD
                     SVYSIYNEFIQSLKPQINAFVEDYGRSRLARFHKKRTFQKRKAFCSFVETISASSNLP
                     PEKVLDFVDEIRMQNDHSVVWVCNNLNQLKTDLAKQLPNLAKFIDNSPV"
     gene            complement(<298754..>301093)
                     /locus_tag="KLMA_40133"
                     /db_xref="GeneID:34716126"
     mRNA            complement(<298754..>301093)
                     /locus_tag="KLMA_40133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819416.1"
                     /db_xref="GeneID:34716126"
     CDS             complement(298754..301093)
                     /locus_tag="KLMA_40133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675984.1"
                     /db_xref="GeneID:34716126"
                     /translation="MFGSRKSRSSLSISQQRMLSHSMSGMSLQSGPKMVYYVGVDVGT
                     GSARACVIDQLGNILSLAERPIQRQELKPNYITQSSHEIWGAICHCVQSVVRDSGVDP
                     STIHGIGFDATCSLVVVDEDNEDVAVGPDFTDNKQNIILWMDHRAMDETNEINATGDK
                     CLKYVGGQMSVEMEIPKIKWLKNNIPAEKFARCKFFDLADYLTFKATGLEIRSYCSTV
                     CKQGLLPIGVEGSKNGWSKEFLEAIGLPELVENDFHKLGGSVNDASFLSAGECIGTLD
                     EESALELGLSTHCVVGSGVIDAYAGWVGTVAARTDVDIPALVQADSEKHGIDRATGRL
                     AAVAGTSTCHIAMSRDPIFVDGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPA
                     YAELSQLADAASVSKFDYLNSRLELLTQQRKVSSVVALAKHLFFYGDYHGNRSPIADP
                     NMRAAIIGQSMDNGIDDLCIMYLGACEFIAQQTRQIVEQMCNAGHELAAIFMSGGQCR
                     NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDACAQLPAPAENSTVQH
                     KDVSIRRKSSLSRKDFQGLNSGGDSRPDSRSRSKSGSRSRSGSGNDSFLGGANALKPL
                     TSFSKVKTTTDLHSPYTAPSATASTAQISTTSGGYPFPIMTASDNAILEDDSNTDTDD
                     DDDGVDPKDDSLTFNAKTEKSKDAENSAQHTKARALRELTKDKLWEVMYNMTGGGKVV
                     WPADDDSPDRRLLDVKYKIFLDMAQTQRTYRKMVDEVAK"
     gene            complement(<301764..>303050)
                     /gene="ARP6"
                     /locus_tag="KLMA_40134"
                     /db_xref="GeneID:34716127"
     mRNA            complement(<301764..>303050)
                     /gene="ARP6"
                     /locus_tag="KLMA_40134"
                     /product="actin-like protein ARP6"
                     /transcript_id="XM_022819417.1"
                     /db_xref="GeneID:34716127"
     CDS             complement(301764..303050)
                     /gene="ARP6"
                     /locus_tag="KLMA_40134"
                     /codon_start=1
                     /product="actin-like protein ARP6"
                     /protein_id="XP_022675985.1"
                     /db_xref="GeneID:34716127"
                     /translation="MNEPTLVIDNGSYEIKFGTKEFDTPLLALNCLTKDKYSRYHISN
                     QTKRMRDISEAMIRRPHELGQLVSWELEREIWDYCFYNEDEFKWKLTHENDTKDHHLV
                     VSETLMTIPELSKNMDQVVFEEYDFQSMFKGPPAQFVPFYNGTYIDDTLKERQQPAGN
                     RDYKDFQLVIDSGFNCTWVVPIIKGVPYYKAIKKLDIGGRFLTGLLKESISFRHYNVM
                     EETILVNNIKEQCTFMPPESYFDSFHHKMSTCVEYVLPDFQTSFLGYVKQRGSHTQTN
                     NNKPTDPASLPSQVQSINLTDEIFAVPETFFHPEIAQVLKPGIIETILECINMCPTVV
                     RPLLVANIVCTGGNFNIPNFHKRLQTELQRQCPIDWNCKVHLPSIPNKSLHTWHSMRD
                     FAQSDQFKAARVTREEYLEHGLDWCTKNRFGYQQWM"
     gene            <303403..>307548
                     /gene="SMC4"
                     /locus_tag="KLMA_40135"
                     /db_xref="GeneID:34716128"
     mRNA            <303403..>307548
                     /gene="SMC4"
                     /locus_tag="KLMA_40135"
                     /product="structural maintenance of chromosomes protein 4"
                     /transcript_id="XM_022819419.1"
                     /db_xref="GeneID:34716128"
     CDS             303403..307548
                     /gene="SMC4"
                     /locus_tag="KLMA_40135"
                     /codon_start=1
                     /product="structural maintenance of chromosomes protein 4"
                     /protein_id="XP_022675986.1"
                     /db_xref="GeneID:34716128"
                     /translation="MSGDEAIPHLHESPDLKRPRISESPTRTPRKLILGSPERKYVVS
                     NTQSQSQPTTATSNTMDPPNLHPPVSHAVRGREYSQSPPRSPTRSPTRSPTRKLELIR
                     LSPKKANRLELQKMHESKTQTIQRLCIDKLILNNFKSYAGVQEIGPFHTSFSAVVGPN
                     GSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPDLPSCSVQIHFQYVQDMENG
                     ETKILHSSGKLVVERRAFKNNSSKYYVNGKESNYTEVTRLLKDEGIDLDHKRFLILQG
                     EVESIAQMKPKADKDGDDGLLEYLEDIIGTADFKPQIERCLNEIETLNDICLEKENRF
                     ELVDKEKQSLESGKAEALEFLEKEKKHTEIKSKLLQHKIWSNDKKLASTIKKINSLKE
                     EFKQEKEVHANLQQKATNLSSNLEDIRAQIHKLDAKYKESHSKKRTLEKEYISIEEKL
                     KSVNRKLKAAEKAFQQSESDAKHATDELEQLNKKNEEYQIELTELFQTLDAEKEKLRK
                     IKLELHEKTKDLSQEIELIEKQLEPYNNQIRDKQSEIKLSEAKISMLKSTHNNLKSER
                     DRILKTIDDLKANDEKTIENLENLTNEREKVKTRIASAEKEIFEAKNQISKMREVLIQ
                     QRQTVEEAKSNLSGYQNKSTVLEALKKLQNSGRITGFHGRLGDLGTVDDKYDIAISTA
                     CPRLDDIVVDTVECGQQCIDHLRKNKLGYGRFILLEKLRSFDLRKIQTPEGVPRLFDL
                     VKPMNDIFKPAFYSVLRDTLVAENLQQANRVAYGSRRFRVVTLDGKLIDLSGTMSGGG
                     GAPQSGAMRSKSDSSGNYSREDVLRMESQLSAKETNFNSAISTLHEMESALQKLTDRL
                     PAIDVDISKTQLEQESRVAELTSYNQRLSQIDDELSDHENNQLPLINEQNNLSKLREE
                     LSSVLNQSKSNQDKIDRLKEIIMQKGGLELQMQISKVDSLEKRIEIIQDKQKKDKAKC
                     RKLELDIKRRLKDKTKYSDEANSCTSEIDTLSIRLDGVQKDKNELDNFLLTLNDQESE
                     LKEKEDNVKEELAGIEKDLNDFKAKELTFTEKLNNFESVKLQITNDLEKFNNELSNLK
                     IRDVVYLLAKLEEGILVESDEQLLPNNEVQNASITHDGDGDGDVEMTDVSMQQNDKIV
                     IDESLSILSESELECIDVEVLNLELQQLQDYLDNFTGDINVLEEYARRLAEYQRRKLD
                     LNQAVAKREEVRGRCERLKQERLEKFLEGFGIISMTLKEMYQMITMGGNAELELVDSL
                     DPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL
                     DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQHLVGIYKNNNMTRSTTLQNVDVL
                     HTV"
     gene            complement(<307534..>316377)
                     /gene="CSF1"
                     /locus_tag="KLMA_40136"
                     /db_xref="GeneID:34716129"
     mRNA            complement(<307534..>316377)
                     /gene="CSF1"
                     /locus_tag="KLMA_40136"
                     /product="protein CSF1"
                     /transcript_id="XM_022819420.1"
                     /db_xref="GeneID:34716129"
     CDS             complement(307534..316377)
                     /gene="CSF1"
                     /locus_tag="KLMA_40136"
                     /codon_start=1
                     /product="protein CSF1"
                     /protein_id="XP_022675987.1"
                     /db_xref="GeneID:34716129"
                     /translation="MDSSSSFSPVSISNEKNLSIPFLVDWILTVVLCILVPFYFGRIS
                     AWILTQAVNVLLWRRHKVKITIQSIKISFLGGRIFFKNLTIVTRDSTISFLEGSFTWR
                     YWLLHTRVRGYDSESRTGLDAINNEKLPARFLLQCSGVEIFVYNHFDAYESLLKEHFA
                     TAGDDYAYSDSNDDDKATELTEQDGSNSKTSNTSGSAASCVNDTKTGSKLPILAGVFP
                     IQLAANRGALVLGNRNTKHVGVFSFEQAKGIFDIHTSASKLDYYRKKLSLDLTDTSFQ
                     LRTNLGYQNDNPIKTFVVEKTMDKVLQSVSSHWNKFLGIIWRGHQLQSNDQLEYLESW
                     KGLDIYQKHKKDENDDIDVIEFQDQEYARYSKIMKADKISLNYYYDIPGVEQQENSFT
                     ANTKVDTTERQHTPGEEEEEGEEEEQNSYSLAPIPPEFGCDIVVSTAAIYYGPWSNAH
                     MQDIIRLFSPIITRDTIPKTPSTDGKLRQYETFKVSINFSDNSILHIPTREPSKDEDF
                     LKRFKETGDTHRAFGWLNISLKDGSELLFNIALCSKNNYIPNELFINLLEPEVKSSVN
                     HEILFKAKSQSITADVGYPTKWNGEAEWMFQLKSFGAELFLLKDHINLISDLFQDFSS
                     RATHEYDLFRPFVYNIDWSFTDFKLILNVNDANIINNPLDYNENCFLSLSGQSLRTTV
                     NLPFKSIDSPYHQSTFSISSPIVILSILPPSWNTLNEFLDEKTFGECPNFTLTGSYLS
                     HSSVDLDNVDLIEMDIRSSSTKFLSFGFVVRYLMNIKLNYFGEFNHFKTTEEYSNDLR
                     AKEESLSSSRDTYSTTDDFSSIVSSVESESSGLSDEIAIDESAFLRKKNETDVWITFF
                     VEDGTIVVPQKIYNSKSSYLLSFNSLEFDMRYTNYYMDLSLALSRINICRDDNFSFGK
                     DIRLPQEKPSDYGIIDGLHIHGHRMFGVPPNEETYLCKWDIGVGSIKTDTTLDFLVTL
                     FESLKKLGFSYKDMENLLIYNSKSPEDITSLSISLVGIALCVRSAVPDESINIALKDI
                     SINSWDLVNESYSKRLDAKIKSLFIDAVNKDGEKAFSLETSVDLSCFPIKKNFKNHKF
                     EQRKCVLVNDSPFHRCKFLLNLDDLKESSLYNDLFGSITPSICMPSLAEPLTEQTFDK
                     IFELLLGNLSNLVTFDADDQDTRYLMEDTSSIETNYGLSRIRSNRIKDYLVNTRSNSS
                     TQNISIHLGPINISITPEVFSILAGIIKCMPKTDIFDTMDFYEMSVLELYSEALQNDS
                     KVMNISLVSDQITVNIRPQSKIAESDEKNNSMLISISKLSILSQTKSTAKISAELDVV
                     TKGNSSDSTLMCDVDDLKISINKTPSNTMISQDSIATFYLSTLNTVLCTDIDMRSRLQ
                     IGTVRLSFSDDDVDMITDFTILLVSSFSNSVQKIKSSLEMKKDDKIIMLLKIAQLGQS
                     NGIDSVPYVITKPAYITRLSKYHVRDNSSWRAITRLRFVSRNIPETDYNKIFTDFNEL
                     EKTESSEVRSRFLEVFSHWKNWDVTEIEQSALFEFIFPIPIEDNDDSSYKDAKLSFEK
                     IHLEVNSIRQASLLVIKQLDIILRKLTLDSILDFDSIDYDKKELDVGISTGSLYVAVN
                     EDHVRKAVLLSRKLETKQKKSLNISKSFALRINQCSLGLKNLTIVVSTTEYKASIDLN
                     DALIIALKTTFERNSVFSVKYSSGLIAFGFSYLNQNLLRIQISSIEESFIGMETDGIY
                     LNRLNVGEVIIDSSETTLQHLIEHSKSLKLMLNNMKGDSKQISVPGQEDGDKKTKYIL
                     KSLVALEAFELKTSLFSPFDLKFKLTTVGIISELGRKRSISANYEELLLDIFMNSYKL
                     VRIFNSTTRIDFKDDILLNDVDVDITTLKVTLCDNRFQFDNIIQSIQNLLAQREKRPS
                     DIKCEGTDQNISKPWSFNLNCAYMGFLIEIDKTNYVIEINESSLSYLKKPSSNIKTNK
                     VEPNSNVWFNTQSLCFLVVHPDIPSTLSKVLDIGATFKLTEDSSKSALQVESHYTRLS
                     LCSSTLFSILFLIREGKMLFHDIPSFFSDDNSPTTPKDSSFLQKLSINVLSYKLCLGW
                     LFEGENRQPGIMLGYESLFMAYERPFGKLTFVDGYVSIAQGKQSNDFYITDGIPKFNR
                     SHLSSMQLNFWFHEKNLKKDLFIRMNADSIDVSVMTDIVDVAASTVASIKEFQRKLSS
                     INERYDSNNSNEDHRGEKFSSKVLIPSINSINCVVNYGGGTIKLFNPTDVTELDQKSS
                     FELTSPSSEVSVSYLFDVNKEKNHWIRSYVNVESTHNILYSSCVPVLVNLQEEMEQLL
                     GGFNTNNTSTAPNDEVTTKAEFQKSHFDYNNLLKNFDVAFIIHIGKQDITLSCEPKAK
                     IQADLGFSNFKISLFTNPSINDNSVSVSLQWSKIEINTRHVFSREISSSAGIDDVLLD
                     VILTEKENISIYGHIMFSGTKLYMNLKQLQDISLFLDIWSPKIKKNESSRVKGLQAPK
                     TKSKPVSESSATKIPWVYRIIFKNTSASIDMDPSLGSINFQAPSFWISSRHSIDWSHS
                     VSFFLKDMKSNSEGRLGGSLEIGNLLFDSSVNWPIRNHKFEAPLVKVSVTVGYLSIKL
                     GFDYHSFLIAVAHDIRFALWNERDESGLLKDLLAVSATCGSINVFLTALSSANLYDIH
                     NTFERLRMENKKSYVQTLKESNPESSGRIRAKNSSLVEPLRLRTNLVAEIGSFRLQVF
                     PSTLFDSEVLVLKATKMNVEATTQTEQKTKTDLTWQIHDININLARFNNDLTDDNFST
                     ISVEEYNSIASAVDGDIILAAPSVFVGITTWQKIPDTRIELLYSSSFGDKVDIKWNLD
                     PINFIREMWATHVRALSARRGHAEASPSKPFFEDENIAEKIKIVDLGTKYQYVPLDEP
                     HIEMPLLKDLGNATPPIEWFGVNRKRFPGMTHQLVVVPLQKLIYVAEGRYNNILGDNL
                     NSV"
     gene            <316603..>318345
                     /gene="GAA1"
                     /locus_tag="KLMA_40137"
                     /db_xref="GeneID:34716130"
     mRNA            <316603..>318345
                     /gene="GAA1"
                     /locus_tag="KLMA_40137"
                     /product="GPI transamidase component GAA1"
                     /transcript_id="XM_022819421.1"
                     /db_xref="GeneID:34716130"
     CDS             316603..318345
                     /gene="GAA1"
                     /locus_tag="KLMA_40137"
                     /codon_start=1
                     /product="GPI transamidase component GAA1"
                     /protein_id="XP_022675988.1"
                     /db_xref="GeneID:34716130"
                     /translation="MALVEKLQRRIISIGLIPKLISKLTQLSLLCCVFGVGWLLILLP
                     SDGQFRRTYISENALLPSQAYSYFRESEWNILRGYRAQLDIFQHVSQIPDINAEVAKW
                     LQDFGVKTSVYKDENYGETLYGIFHAPRGDGTEAMVIAAPWYNEDGKFNTGGTALAIS
                     LTRFFSRWPVWSKNIIIVLSKDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTND
                     RFDYVQIHYDGLNGETPNLDLVNTAVHITEHEGMKVSIHGIPFAELDDNDYNSRLKTM
                     LLGIKDSVLAGIKKCHGNEAFSGWRIQAITLKAVGTNGPHDITTFGRIPEALTRSVNN
                     LLEKFHQSFFFYLLLAPRYFVSIGTYLGTAVVVSVAFVLACLDQVLNNKFSGLPLLSV
                     YNIWSALAFGIALMASFITSQFFFYLPQAELLLLVNVGLAALPLALRNRIKIQEPFSY
                     RFKAFAYMYMAIVLTSLLVLNYSLAMVMGVLAFPMTRTTTILKSDIRLSLRNFVLVLI
                     SNPFIATWAVVNLVEPSLSGTKVFYALIDAWQQLGCWTWYILCVGWYPSWLLVTYANI
                     EANELPIENEVKKD"
     gene            <318665..>320077
                     /gene="FOB1"
                     /locus_tag="KLMA_40138"
                     /db_xref="GeneID:34716131"
     mRNA            <318665..>320077
                     /gene="FOB1"
                     /locus_tag="KLMA_40138"
                     /product="DNA replication fork-blocking protein FOB1"
                     /transcript_id="XM_022819422.1"
                     /db_xref="GeneID:34716131"
     CDS             318665..320077
                     /gene="FOB1"
                     /locus_tag="KLMA_40138"
                     /codon_start=1
                     /product="DNA replication fork-blocking protein FOB1"
                     /protein_id="XP_022675989.1"
                     /db_xref="GeneID:34716131"
                     /translation="MTANDLNEQNEFKSTNALTEASEEDEGDFVVPRMGVDVMDLKAD
                     LDTELLSDGRHQIEKEINTVKGQLTQPMYDLLVSDSLTKENLLQVSDKVNPSTVENKF
                     VLLKRRYYVHDNLLHDVKRRDLVVYEPNKLFDLIISTHILNNHASPKVVYNILSSYYA
                     NVTQYFCKLATSYCSKCIKEGSSKQHKKFKHENIHANLVPLGRCHIEIFAPFDPETEG
                     SPLKIENKYPYVLYCRDYYSRYVWLEPLKSVQLSTLLPTMAKLFFTMVRMPIFIDTCT
                     LDKQDMFDVCEHIARKYKIKIGLGMNSSTSFQKSGIKRLKTLLLQNKKACLKDWNMCL
                     KLAVHRINQTYCDRVRGVPSDMLCASIPNLNRKFRTLQRRIIATLMGHHVVQFEETGG
                     MIYLEDQNNPNLLSFEDFDDGEEQDEEDDEEEEEEEEEEEEEDDANSDSPVESIHPLK
                     KRNQEGQYDIATKKKHKSNS"
     gene            complement(<320576..>322204)
                     /gene="ALT1"
                     /locus_tag="KLMA_40139"
                     /db_xref="GeneID:34716132"
     mRNA            complement(<320576..>322204)
                     /gene="ALT1"
                     /locus_tag="KLMA_40139"
                     /product="probable alanine aminotransferase"
                     /transcript_id="XM_022819423.1"
                     /db_xref="GeneID:34716132"
     CDS             complement(320576..322204)
                     /gene="ALT1"
                     /locus_tag="KLMA_40139"
                     /codon_start=1
                     /product="probable alanine aminotransferase"
                     /protein_id="XP_022675990.1"
                     /db_xref="GeneID:34716132"
                     /translation="MLSARTCLNAKSQLGVFKLTLKASSIVSASTSSATLRIVVMPSI
                     SNLQQYNNYSTSPKPAPKLTLDDVNENILKAKYAVRGRIPMRAEELKAQLKKDPASLP
                     FKKIINANIGNPQQLDQKPLTFYREVLSLLQHPELLDEADETLLSLYKIDSIQRARKL
                     LEEVGGSVGAYSQSQGVQGIRETVASFITKRDDGEIAYPEDIFLTAGASAAVSYILSM
                     LCKGPSTGVLIPIPQYPLYTASLALNNSKPLPYYLREEENWSTDPEEIEEVVQDAIKK
                     GVKPTCLVVINPGNPTGAILSVNAIESIFEIAAKYGIVVIADEVYQENIFKGSKFNSM
                     KKVLRNLQKVHHGKFDNVQLASLHSISKGVSGECGQRGGYMELVGFSHEIRQVFLKLA
                     SISLCPVVTGQALVDLMVSPPKPGDASYEQDQQQRNHIHEALEERATKLFETFSRLEG
                     IECRKPQGAMYLYPKLDLPFKAIQEASHKEMEPDEFYCSELLEHTGICTVPGSGFGQV
                     PGTYHLRTTFLPPGTEWVDAWEKFHREFYDRYRD"
     gene            <323969..>325309
                     /gene="DNAJA2"
                     /locus_tag="KLMA_40140"
                     /db_xref="GeneID:34716133"
     mRNA            <323969..>325309
                     /gene="DNAJA2"
                     /locus_tag="KLMA_40140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819424.1"
                     /db_xref="GeneID:34716133"
     CDS             323969..325309
                     /gene="DNAJA2"
                     /locus_tag="KLMA_40140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675991.1"
                     /db_xref="GeneID:34716133"
                     /translation="MVQSLYEVLEIETGASEVEIRKAYRKLALKYHPDKIVDEDEREE
                     SEAKFKEITAAYEILSDPELREKYDTYGDAGFGAGGPEEDYEFDDFMNFFQQYQRQQG
                     QGQGYGAGFGGGSFGQPEAESMRTPDSRINYKMTTKQLYMGKTVTFQLKRKCLCAHCG
                     GTGLRKKHFQKPEIYCTSCNAQGFKERITRLAGGYMVKERVVCDTCKGKGKYRKKSSS
                     DGCKHCAGKGLVVEEKPQTVYISRGSRHGDEFRLPQMADMEYGKETGDVVVVIEEDSS
                     GSHQLERKGNDLHCTLNISLVDALTGFSTTVCETFDNRRLHLTIPPGKVVRPGNYFKF
                     EGEGWPISNGASFGDMYVKINIEFPKDNWFNEKSEITALRNILPGLKSKESKQPDPLN
                     TEEVFKYSILQSHDELPDYLAQEREKFNKQQQEEQRQSAFDNDYTQMPSECATQ"
     gene            complement(<325549..>326391)
                     /locus_tag="KLMA_40141"
                     /db_xref="GeneID:34716134"
     mRNA            complement(<325549..>326391)
                     /locus_tag="KLMA_40141"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819425.1"
                     /db_xref="GeneID:34716134"
     CDS             complement(325549..326391)
                     /locus_tag="KLMA_40141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675992.1"
                     /db_xref="GeneID:34716134"
                     /translation="MGNEGKENEISVQEYDNTSGLRTPLNQVKRSDSMIRGNRRPLAS
                     KDNNRTQSMLSVKNNAVGSHVDHTLKRPASNLVKNMPENKLKKYGSVLGMNSFMPRTK
                     SLVLKDTELNERSEEEEEEENDEEDLPLFSTGNKTGLGLGFGSGLKALIKEKEDELQI
                     EYAPKRQEELPHVPNGYEPFDQESIEKLKNHKSPFQVDPLHFDKDEYNNDNDLGTEPQ
                     LLSIESPKDDIISPYKHSGDYHNQHSSTTMELASDNESITIDLGEEYKGNGLNISELN
                     SLLD"
     gene            <326970..>327866
                     /gene="GEP5"
                     /locus_tag="KLMA_40142"
                     /db_xref="GeneID:34716135"
     mRNA            <326970..>327866
                     /gene="GEP5"
                     /locus_tag="KLMA_40142"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819426.1"
                     /db_xref="GeneID:34716135"
     CDS             326970..327866
                     /gene="GEP5"
                     /locus_tag="KLMA_40142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675993.1"
                     /db_xref="GeneID:34716135"
                     /translation="MSRAQLRRVAKLYESLHPITKDALASITSNPTYAQRITLGKLQQ
                     FNETPTRKTLERLVYSVHFHMLNELPPYLQGLRDYPEELAKFWPYEFQHSILDIENVN
                     VNSLAMLWSQKNPNVLSHQTYDRHRWLGPPKSKKFNEEKVAQLTGVEKLNFQNSKERL
                     DLSKEQRDQILQLTFKHYLFLKINPKLCATKKLPVPIVEIGMKPDGYDIADVRIDNLF
                     RKKVQFVTETLYLQNPPISEESEYTLQSIIHDPFTIRPVRRLYKAISSKAFLFKDGEF
                     KISDLARDGFVLGNQPEDELKI"
     gene            <328276..>328626
                     /locus_tag="KLMA_40143"
                     /db_xref="GeneID:34716136"
     mRNA            <328276..>328626
                     /locus_tag="KLMA_40143"
                     /product="54S ribosomal protein L34"
                     /transcript_id="XM_022819427.1"
                     /db_xref="GeneID:34716136"
     CDS             328276..328626
                     /locus_tag="KLMA_40143"
                     /codon_start=1
                     /product="54S ribosomal protein L34"
                     /protein_id="XP_022675994.1"
                     /db_xref="GeneID:34716136"
                     /translation="MSFLAKNLVQWMPKRTFTSLSSFSPLRSLNGSIHRPLMHTNPME
                     VTLNNQPQGTRVSVFGTLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSKSGQQI
                     LKRRKAKGRWYLTY"
     gene            complement(<328786..>329586)
                     /locus_tag="KLMA_40144"
                     /db_xref="GeneID:34716137"
     mRNA            complement(<328786..>329586)
                     /locus_tag="KLMA_40144"
                     /product="54S ribosomal protein L1"
                     /transcript_id="XM_022819428.1"
                     /db_xref="GeneID:34716137"
     CDS             complement(328786..329586)
                     /locus_tag="KLMA_40144"
                     /codon_start=1
                     /product="54S ribosomal protein L1"
                     /protein_id="XP_022675995.1"
                     /db_xref="GeneID:34716137"
                     /translation="MMWPRLFTRQFQTTAFRLAEESSSKLSREQIRKKELRKMAQRRL
                     QAKTPASEHPLYMPVSQALRYLRAIEVGQPASQQTITLSTIIVSERGVPPLTGNVSFS
                     KPLKEVKVAVFTNDEAQTALMKDTYKVHLVGGTDLLNQIKEGKVNIDFDKAFATPDVV
                     PQLAQLGRILGPRGLLPTVKKGTVAENLESLVQENMNSVPFRQRGNSISLGVAKTYFS
                     DREVLENLLATEKAFKEAIASQQTKKPSILGQTTLTSTHGPGIVIDFA"
     gene            complement(<329941..>331686)
                     /gene="TMA64"
                     /locus_tag="KLMA_40145"
                     /db_xref="GeneID:34716138"
     mRNA            complement(<329941..>331686)
                     /gene="TMA64"
                     /locus_tag="KLMA_40145"
                     /product="translation machinery-associated protein 64"
                     /transcript_id="XM_022819430.1"
                     /db_xref="GeneID:34716138"
     CDS             complement(329941..331686)
                     /gene="TMA64"
                     /locus_tag="KLMA_40145"
                     /codon_start=1
                     /product="translation machinery-associated protein 64"
                     /protein_id="XP_022675996.1"
                     /db_xref="GeneID:34716138"
                     /translation="MFAKEPHIKPLSNLKNSDRKKLQATIKSKINENYSLPTPVIKQT
                     SFQVQNLAGFIYTDETNKPIWFKTKFEDQLYPTIYNLWKFQEQLLPIILTHDFVIEEH
                     ILGGANLMLPGTVPPFDSRIKKGTVVGIASTKEPLLVKAVGVAEMDLYGITHVIGTKG
                     IAVRVVHYLDDGLFKAFKVDIDPPVFEHIDTGSSNREDEVESSTNIESEGEEEEGEEE
                     EAEEEEEKEGRNENDEEVEELAETLDQLSCEDVDHMLLRAVKYTIKFDSKVTLPMVAS
                     TFISNHVLKNLPDVDTSVVNLKKSSWKKATKFLKYLEDEGYIKLKGKNDNFTVISIDK
                     NHKTLENMEPYKTLASSVKKSTGTENSNSAKKKNSAYSGENLYKPMSSAQKLIIETTG
                     DVPKQYYTQQELKKILDSYISQKKLIDPNNKSLVKFDDTLFKMSNKSTQNGGINSISR
                     ALLLSPTFLSKNFNTYHQIYKPDGSPLLKSPEKGTIPNIEIVTEKKIGRKIITRVSNF
                     EKFKIDDEELAAALRKKCSGSTTIGESKTLKTKEVQVQGPHGAIAISILNDYGIPTKW
                     ISFENKVKPKQKKKI"
     gene            <331881..>333887
                     /locus_tag="KLMA_40146"
                     /db_xref="GeneID:34716139"
     mRNA            <331881..>333887
                     /locus_tag="KLMA_40146"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819431.1"
                     /db_xref="GeneID:34716139"
     CDS             331881..333887
                     /locus_tag="KLMA_40146"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022675997.1"
                     /db_xref="GeneID:34716139"
                     /translation="MTSSAMDFIVNSQVLLRKYINGYSISISEDQSLVCLWNTGSELE
                     IYRSNGGYLINKVGNKEQNRRLIDVRWFGTQLFCNYNNGSVLVYKEGRELVKQLTFMP
                     KGTRTKCIFYDSIQLEDDRYSMTEGALLKYMPKLNKWDTVKNQLDNELILGNDSAGKG
                     VIDVFASIDAKTNKLVLSIEGTLNIKLGDKLKLPKDINRLMRVSVGKFLCMNKASQYQ
                     IVNLTFLQDQNFYKLIKTTQEYGALMKYLKQLHRHIGMKLVDPYFQFVDTLWKEAHRK
                     ALQELFYVGITDPELMQELHEIQLQSFRIEKWQSLSMNLCSNSISLIVSCMLPLIERM
                     VVLAATIEALCEAITLISFPEEKGFTSELRQHTLRMLKSLRVQTAELMKVKKSHNVGF
                     EWIQVITERLSKMEKDRRQTSSSSPATTGVGGSNGNSNSAGRSGGTTESSASLKKRLY
                     LSTVEDFLTSDMVPQNQYEWVKNTFPREFIQTQTEFDRIMRDYTLRWLKKQISAEYEQ
                     PKFIELEDTDYGKSDSTTPICDVQIIQGLSKLPRALFVTPIELILVNLETQKIESRCP
                     TPLPSTRLASAVTALNSDLDVLRNKSAAKPRIQLIPIKNSVSLPTTLSTYYLMPLRQI
                     VTITPNNDIDLSVNKGGGAQQSPISPSKTRDLSASTFSIHIQSA"
     gene            <334734..>337481
                     /gene="SUL2"
                     /locus_tag="KLMA_40147"
                     /db_xref="GeneID:34716140"
     mRNA            <334734..>337481
                     /gene="SUL2"
                     /locus_tag="KLMA_40147"
                     /product="sulfate permease 2"
                     /transcript_id="XM_022819432.1"
                     /db_xref="GeneID:34716140"
     CDS             334734..337481
                     /gene="SUL2"
                     /locus_tag="KLMA_40147"
                     /codon_start=1
                     /product="sulfate permease 2"
                     /protein_id="XP_022675998.1"
                     /db_xref="GeneID:34716140"
                     /translation="MVSHQLVSDRGKNYDSVDGDSINKYSDESPDFDQLEQEYDDLKT
                     SEIIAPHISNGHSIGSSPRHHHLYDDMHLDSIVDTTYQDEESILKGTSTGKTGIEDVT
                     VRNIYTYDSLQVPNYEEPIVNLKDAYDEKIKPYVRLQSVTDYLLSLFPLLKWIHHYNL
                     SWLYNDVVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFVGAFIYSFFATSKDVCIG
                     PVAVMSLETAKVIARVTKKVGDSNPEITAPIIATTLSLICGAIALGVGLLRLGFLVEF
                     ISLNAVAGFMTGSAINIVAGQVPALMGYGKAVNTRAATYKVIINSLKHLPDTKLDAVF
                     GLIPLVILYVWKYFCGTLGPKLVDRYVTRRDPKRASIYKLVLFYAQALRNAFVIILFT
                     LISWGITRHKKKKDYPISVLGKVPSGLKHVGVMKLPDGLVSHLGSELPSAVIILVLEH
                     IAISKSFGRVNDYKVVPDQELIAIGVTNLISTFFNAYPATGSFSRSALKAKCNVKTPL
                     SGLFTGSCVLLALYCLTGAFYYIPKACLSAVIIHAVSDLVASYKTTWNFYLMNPLDFV
                     CFLVTVLITIFSSIENGIYFAMCWSAAMLLLKVVFPTGQFLGYVELCEVTNAEVNKSI
                     DRIIIAEPSKDGSSDDNTTDSNGKPVENVKIQVNSNKLTDQESTTGAAAAAGNLNHAH
                     LQYHVKWMPLDNNYQHELNPEVVVHPPPPGVIVYRPTESWTYVNCSRQYDKIFARVKE
                     LTRPGKSARHVRKVDRVWNDPGEWEPPYLLRKLFKFKKSDSSSADLEGRQVQDSRPIL
                     KVLAMDWSQVNQIDSTGIQNLVDLRKAINKYANRQVEFHFSGIISPWIKRGLVNAGFG
                     TINEEFSDESLLVGHTSYNLVKSRGEHEDEEQTVALYTANGVNLPFFHIDMPDFHKWH
                     L"
     gene            <337664..>338881
                     /locus_tag="KLMA_40148"
                     /db_xref="GeneID:34716141"
     mRNA            <337664..>338881
                     /locus_tag="KLMA_40148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819433.1"
                     /db_xref="GeneID:34716141"
     CDS             337664..338881
                     /locus_tag="KLMA_40148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022675999.1"
                     /db_xref="GeneID:34716141"
                     /translation="MQRENKSAQCLHIYLYIKRGGQKGRPRRRQTKPSFQLCGSEVVG
                     KCVIVVTSATMATPLLKQVRLGRSGLKISPIVVGCMSYGSKDWAPWVEDDRGKIFEIL
                     KYCYDHGLRTYDVADMYSNGLSERLLGEFLAHYKIPRERVVILTKVYFPVDEELEMKH
                     GGLEAGSAEAAQQELDLANQQGLSRKHILAGVEASCGRLGTYIDVLQLHRLDRETPME
                     EIMRALNDVVESGKVRYIGASTMRATELADLQAIAERRGWHQFISSQSCYNLLYREDE
                     RELIPYLERHGLGMIPWSPNARGILCRPAADHAKSQRAKTDPTIKRRAMDHLEAQEVE
                     IIDRVQEIADKRGTSMAVVSSAWVLAKGGYPIVGLSSIERVQEILGAAEFKLSEEEVA
                     YLEEPYLPKKMIL"
     gene            <339934..>340185
                     /locus_tag="KLMA_40149"
                     /db_xref="GeneID:34716142"
     mRNA            <339934..>340185
                     /locus_tag="KLMA_40149"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819434.1"
                     /db_xref="GeneID:34716142"
     CDS             339934..340185
                     /locus_tag="KLMA_40149"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676000.1"
                     /db_xref="GeneID:34716142"
                     /translation="MFFTRALRSSATIAINHAAQTSAKTAAKSGRHIGEAWAVTEAKR
                     LVPTLGLYATFIATVLGWPLLYRKVDLGIGINGLEAPKH"
     gene            complement(<341806..>343500)
                     /gene="TRM1"
                     /locus_tag="KLMA_40150"
                     /db_xref="GeneID:34716143"
     mRNA            complement(<341806..>343500)
                     /gene="TRM1"
                     /locus_tag="KLMA_40150"
                     /product="N2,N2-dimethylguanosine-specific tRNA
                     methyltransferase"
                     /transcript_id="XM_022819435.1"
                     /db_xref="GeneID:34716143"
     CDS             complement(341806..343500)
                     /gene="TRM1"
                     /locus_tag="KLMA_40150"
                     /codon_start=1
                     /product="N2,N2-dimethylguanosine-specific tRNA
                     methyltransferase"
                     /protein_id="XP_022676001.1"
                     /db_xref="GeneID:34716143"
                     /translation="MLRAAFQTLKARLGGKTPVDATSIDVSQFKIVQEGEAKILFPNK
                     ETVFYNPIQQFNRDLSVTCIKAWDEIYQEEARERREAKKNQANSKNQGKKRALAETSE
                     NNTDSSDALKKRKLNEDESNAVAVSGPVVKPYIKILEALSATGLRAIRYAKEIPNAKM
                     ITANDLLPDAVESIKRNINYNGVQDKVVANLDDANVLMYRNKSTNTKYHVIDLDPYGT
                     VTPFVDASMQCIEDGGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMAGHDATHESALR
                     LVLNLLGQSAAKYKKTIEPLLSLSIDFYVRVFIRVKTSPIEVKNLQSNTMVGYMCSGC
                     GAYHTQPLGRQQERQTKKGNKFTKFSLAQGPPVDRHCSYCGSVHHIVGPMYGGPLHNR
                     DFIERVLRINKEDHKDDVYGTRKRIEGMLTLAKNEITAPFYFTPNSVSSILKFQVPPL
                     KSVVAGLGSLGYQCSLTHAKASSLKTDASWDAIWYVMKKYCLEHENVDVEKMNKNGNG
                     YKIMTNENIGKNAEWDEKISFEPNEHSGKFEKLRKLKIVRYQENPTRNWGPKARPQ"
     gene            <344036..>344617
                     /gene="DPB4"
                     /locus_tag="KLMA_40151"
                     /db_xref="GeneID:34716144"
     mRNA            <344036..>344617
                     /gene="DPB4"
                     /locus_tag="KLMA_40151"
                     /product="DNA polymerase epsilon subunit D"
                     /transcript_id="XM_022819436.1"
                     /db_xref="GeneID:34716144"
     CDS             344036..344617
                     /gene="DPB4"
                     /locus_tag="KLMA_40151"
                     /codon_start=1
                     /product="DNA polymerase epsilon subunit D"
                     /protein_id="XP_022676002.1"
                     /db_xref="GeneID:34716144"
                     /translation="MPPKGWRKDSGGNYPNTSYVKEQEKISIDDLLFPKSLIMSLAKE
                     SIHSAFQNGDEERRVTVSKDAALAMQRSATVFVNHLLTFAQMNAKKNNRKSCNEHDIM
                     MALDTLGFGALKSILVEKMEGYQKAMQWKKQNKQNKNDANGDIIMDEDEDEDEDEEEE
                     EEEGTEEAVSGQDKGQAAEDGTDVEPKKRKTDQ"
     gene            complement(<344716..>345414)
                     /gene="NYV1"
                     /locus_tag="KLMA_40152"
                     /db_xref="GeneID:34716145"
     mRNA            complement(<344716..>345414)
                     /gene="NYV1"
                     /locus_tag="KLMA_40152"
                     /product="vacuolar v-SNARE NYV1"
                     /transcript_id="XM_022819437.1"
                     /db_xref="GeneID:34716145"
     CDS             complement(344716..345414)
                     /gene="NYV1"
                     /locus_tag="KLMA_40152"
                     /codon_start=1
                     /product="vacuolar v-SNARE NYV1"
                     /protein_id="XP_022676003.1"
                     /db_xref="GeneID:34716145"
                     /translation="MKRYTVSFVEVWDGDKVISSWFDYEKGGNKNGYGSMDKGENEQK
                     ALFHRLISDMVIRTVVDLPGNKVTKTSMDLIDGYDCYYTTADDSKVIVCFVKEAVPKF
                     LPLRLLSELKNLNNDTDEKLQNNVNNQLDKFHEELLSYRTEGQEIGNATEEELQKIIA
                     IMNDNIDKFLQRQERISLLVDNTNQLNENSFKFHRKSSKIMRKMWWNNVKFYSIIAFI
                     VIVIIAIMFLILLH"
     gene            complement(<345798..>347312)
                     /gene="fmo1"
                     /locus_tag="KLMA_40153"
                     /db_xref="GeneID:34716146"
     mRNA            complement(<345798..>347312)
                     /gene="fmo1"
                     /locus_tag="KLMA_40153"
                     /product="thiol-specific monooxygenase"
                     /transcript_id="XM_022819438.1"
                     /db_xref="GeneID:34716146"
     CDS             complement(345798..347312)
                     /gene="fmo1"
                     /locus_tag="KLMA_40153"
                     /codon_start=1
                     /product="thiol-specific monooxygenase"
                     /protein_id="XP_022676004.1"
                     /db_xref="GeneID:34716146"
                     /translation="MRVTGIKLVALDPSKIRRVAVIGAGPVGSGLTKALLNEKHFDEV
                     KVYEKRSTFGGLWNYTKPSLKQANATSCPEVPCENPRVRLQPQNGGSDASSPLFQTAV
                     YKYLDTNVPKILMEYKGHKFPPGTPLFPLREQVLDYIVKYSKPIEKYVSFNSEVVKVS
                     YDDETSKYLVKTLNLLNNNVTEEKFDAVSVATGFYDLPFIPSRPGLKEWHVAYPSSVS
                     HAKDFDCPEDFKDVQGEILIVGNSASASDLAFELALHLQRPVYKSKRSENKLPAPFDP
                     NIKDVPDIKQFNPETKTVSFVDGTELKNVEKVIFCTGYLKSLPFLPTKDEPGVGNSIL
                     SGLIGDGRRVQNLYNHILPISLPTFGIIGLPRFVLPTRLSETQGAWLSRVWSGRIQLP
                     SEEIQQKYHDWFVEQSGEGNKHHDLNFPWDVQYSQRLNREIRHAGNGGYFGVEWRGDQ
                     IKARSSIKALKEGYTAHFKATGKRAESIEELIESGYFKWPEDAKSCVQVPTFVP"
     gene            complement(<347917..>349281)
                     /gene="GIS3"
                     /locus_tag="KLMA_40154"
                     /db_xref="GeneID:34716147"
     mRNA            complement(<347917..>349281)
                     /gene="GIS3"
                     /locus_tag="KLMA_40154"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819439.1"
                     /db_xref="GeneID:34716147"
     CDS             complement(347917..349281)
                     /gene="GIS3"
                     /locus_tag="KLMA_40154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676005.1"
                     /db_xref="GeneID:34716147"
                     /translation="MTMLVLNSGAMPILSHITQTTRILESPVSKYTYKNKNKHKHNKQ
                     KAGTKAMRSGLEEDACMMDTSTLTPSLSSVLHQIKQTNRERRNTGSTLGSSSESVLSL
                     REYESSSDGALSDILGQKEIEGPGLGLDPFCIDDEADDDGFPECNHPLRDSRSSSVST
                     SRSKNRRRSRSTSTSTSRSRSTDTLCAPSPHTKIYNLGDLDLTDTLSTEDIVQPIKPI
                     YERPKCKRMSVCSVIQDGSSDGKRPRRNSRFTPIFLENEVVEMEHWPNTTQQQQDLGV
                     QDGIVELDMTLKRTRQQSLNPSFLRLYALETSMKQKNLLPDLNLDESILQKLSIQDIA
                     HLNVPSDPSNKITPQQIKLALITRKKLWTDMCRITRTDLHGEYTPSNLRFVRDTRAPE
                     TNDQPAEATSLVRMNSEVKPWSQPEMSKPTMFKPCGRIPLGRNVNSKDIQYVVKGWCD
                     YRFA"
     gene            complement(<350397..>352655)
                     /gene="IOC2"
                     /locus_tag="KLMA_40155"
                     /db_xref="GeneID:34716148"
     mRNA            complement(<350397..>352655)
                     /gene="IOC2"
                     /locus_tag="KLMA_40155"
                     /product="ISWI one complex protein 2"
                     /transcript_id="XM_022819441.1"
                     /db_xref="GeneID:34716148"
     CDS             complement(350397..352655)
                     /gene="IOC2"
                     /locus_tag="KLMA_40155"
                     /codon_start=1
                     /product="ISWI one complex protein 2"
                     /protein_id="XP_022676006.1"
                     /db_xref="GeneID:34716148"
                     /translation="MNRSRRTRRSRSESEEQAAAGAEVEAVSVEAEAEAIAPTGTDAP
                     AGTDDAPAVSWDSFLERTTANQLNKLMPIPLDFVPFQDLIQSWYYQYSVMWLSNVCSG
                     YWTQGFTSGKPWFTEITFDERLMLLDYQAGWSLHEEETASAAAEAAEEEGGEDEGGET
                     GSTNLFRAILLRLLRSLEQDKTVRLEHWDEIVKYHIFNSKQRASLLWYTEDVNCKFSE
                     LNVVQQFEIIFHVIKLVERKNIGFRNYLQNHLDNFQFPEIWENDTTSLVVLPTGKIIR
                     KQVSMSESTSSSSKQGPSIPIKLQNCVVVEQTETTIDVIHLDYSDEIDAYLGDVKIEY
                     ETLAHDYRSFVEYLETLDDEDFQEFFQGLIEYHAEAEVYGRKLYANRLKQQSLQALMV
                     RRKRSSRLVAREEEHQKKELETKWYDKLERREQFLRHRNRVLTRRTKKLKDYLWSLLW
                     EKFEKDFTQEKLRRRNNNNNNNGGAGAEPEPSQLQIEEIDAHVIEFGRNFKQWIVPID
                     EDAYAYKDDEIDTLELPVELCITQQDLDNLEKFGIPTKQYKVDSQNWYLDCKSGKHGI
                     NDFKKVKDHKIVCCEKTLRWELWEEQDPKVIEILSHGHDHLLTPRELGAVTMYDENLR
                     RRSSRRDESASDKVSHVENRPTDRKPFDVTEPFLSARTLHQMEQELRNNFAAEVALIR
                     TAEKKKAEEKEKRKRIKEEKKRQAQAKQNVIVQTVPQTVPQVSTQTAPQVSAQTVPQT
                     VPQNAPPTTSPQ"
     gene            complement(353003..353415)
                     /locus_tag="KLMA_R408"
                     /db_xref="GeneID:34718706"
     tRNA            complement(join(353003..353061,353381..353415))
                     /locus_tag="KLMA_R408"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:34718706"
     gene            <354251..>357760
                     /gene="KIN1"
                     /locus_tag="KLMA_40156"
                     /db_xref="GeneID:34716149"
     mRNA            <354251..>357760
                     /gene="KIN1"
                     /locus_tag="KLMA_40156"
                     /product="serine/threonine-protein kinase KIN2"
                     /transcript_id="XM_022819442.1"
                     /db_xref="GeneID:34716149"
     CDS             354251..357760
                     /gene="KIN1"
                     /locus_tag="KLMA_40156"
                     /codon_start=1
                     /product="serine/threonine-protein kinase KIN2"
                     /protein_id="XP_022676007.1"
                     /db_xref="GeneID:34716149"
                     /translation="MPSAQDYHVNPHFQMGEREPEREPGSVGQAPKAPATPRMMGRRG
                     SENPGLMPPASISNGQGQVQGQGQGQASVPGSVQTPVQTPVQTQGAAHSHSSDVASNN
                     KPFHRKSLGDWDFLETVGAGSMGKVKLARHRVTNEVCAIKIVNRAAKSYMHKQNQLPP
                     PKTEEELLERKKKLEKELSRDRRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEY
                     VSGGQLLDYIIQHGSLREKHARKFVRGIASALQYLHQNNIVHRDLKIENIMISTSGEI
                     KIIDFGLSNLYDFKKQLHTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVIYVLVCGK
                     VPFDDENASVLHEKIKKGKVEYPQHLSIECISLLSKMLVVDPVKRASLKQVCNHQWMQ
                     RGFDFPPPSYVPHRVPLTVEMLDINVIKEMHRLELVHDINDAFQVLRDIIESPEYKEL
                     SRQYWFNVQNSNSQDDPTRAYSPLLSIYYLVDEMLKRKLAKRLQKQQQLQQFQQQQQQ
                     QQQQQQSIRSAASYGSQDAYQAQSSSMFPAAQVDTSIPQPDHSPPKTLQQPVSVNNSK
                     SRYATSSAQNSRTTPSTNSNNTNVPPTGNTNSPSAYIPSNVERASNITASPVKNKQLP
                     EIMIPPKLTVPELAYTSPTRKSSENNPDIDTVMSPSPGPAEYNPQHEQSKPLQQQQQG
                     QHQHHSGKYIFGSEGGGSSTANAEKPRIGSIFRRLSQRHRHGHSISQAQGPLHNQTQM
                     QESRSSLEPSASAMTRNRKTHTRTVSEHVPSTSSRYTSDAYYTERIPRDMQGDLPALP
                     PNADVLVKQQEEKLHDLKLNNSDLEDQSENEMNNKIDENQPLALLSAPKGKKLHPSAR
                     AKSVGHARRESLKYSRPPVPETEITTATIDNGLEQTQVRSNDDGFLQSNSDNNLMAVD
                     DISPWEELTDEQIIERASKAPPGSMPSIDFPRSLFLKGFFSVQTTSSKPLPVVRYKII
                     STLKKLNIEFKEVKGGFICCHRQSYVSQEQPPGHGRHPSIIINESSSMESNGSTLNSH
                     RRQHSIPSRHGSVRRHGSIKQPGIPATPLAATTHERNLSITSPRTSNAQILEEVSTAS
                     LETLNNQEDILTNSKAHDMNIFMIDNKSSEQSSKERPPLKFEIHIVKVKLVGLAGVHF
                     KKVSGNTWMYKELASHILKELNL"
     gene            complement(<359675..>360694)
                     /gene="HRT3"
                     /locus_tag="KLMA_40157"
                     /db_xref="GeneID:34716150"
     mRNA            complement(<359675..>360694)
                     /gene="HRT3"
                     /locus_tag="KLMA_40157"
                     /product="F-box protein HRT3"
                     /transcript_id="XM_022819443.1"
                     /db_xref="GeneID:34716150"
     CDS             complement(359675..360694)
                     /gene="HRT3"
                     /locus_tag="KLMA_40157"
                     /codon_start=1
                     /product="F-box protein HRT3"
                     /protein_id="XP_022676008.1"
                     /db_xref="GeneID:34716150"
                     /translation="MDEGIDAITLWEQGTAKERAGAMTDAIKYYRKALKIEPNVEKIY
                     RKKLHEEWKLSEELKKLELSEGAENASTNEQSEEIPQEEIDLPPCWILEMLSDEILLR
                     IINEIVLSSAETWVNLSLTCKKFNALCFSDSTPYRTFARYIYSRQVYNENEMRLNGIS
                     DVQTLADTIWGQNYKKMLTERPYIKFHGVYISVVNYLRHGSIPEGSSSLLNPIHMITY
                     YRYLRFYPNGSCLRLLTTNDPSIVVPSFSIENQPDIKDADICTWSLSLDEGLGRLAIK
                     RTRTKDELEFLEELQISNQGHRPFNKLKWINSSATKLDGTVMEFSLQKEKPFIFSRVK
                     YYSTD"
     gene            complement(<361133..>362947)
                     /gene="CHA4"
                     /locus_tag="KLMA_40158"
                     /db_xref="GeneID:34716151"
     mRNA            complement(<361133..>362947)
                     /gene="CHA4"
                     /locus_tag="KLMA_40158"
                     /product="activatory protein CHA4"
                     /transcript_id="XM_022819444.1"
                     /db_xref="GeneID:34716151"
     CDS             complement(361133..362947)
                     /gene="CHA4"
                     /locus_tag="KLMA_40158"
                     /codon_start=1
                     /product="activatory protein CHA4"
                     /protein_id="XP_022676009.1"
                     /db_xref="GeneID:34716151"
                     /translation="MPMSPIDPNSNKTHLACQNCRIKRRKCDMERPCSNCVKCGLECI
                     TVNSDKRRKRATSDYVEKLEAEIEDLKKTIENLKADKIDTSPDLSPTPNSTSMLPPRN
                     PSWKPFLANIRSPAPASPKSDSVTLKNTQVVASSIYSNDSLAISKSFSEEVNRDMSSN
                     LRTLSRSPVILPALSLFFKWLYPGHYTFIHRETFLSAFFGDTSTKGYYCSKELVFAIA
                     ALGSKLSDKNEELYSKSQEYYTLAKTKVLNKIFQLDGSTASYSSSSKLAIIQTLLCLA
                     FYDIGNGENPLAWYESGLAFRMAHEIGLHLNPEAWDDVYDDKLSQIDIEVRSRIYWGC
                     YIADHLIAVLFGRSNSLRLSNSTIPETDELPNIDTGIEDYQYDPKIVTSIAKPLKKII
                     VLSRITEVFASKIFIHAGSLTERSDYLHKFNIEILNWRRDLPDEFKLTKTTLINFDYN
                     PILAHVWYHYFIIVLSYNKPFIDSLPESKETIEDAIEELYFLLRSFMKKFKTFQKSNI
                     YMVYSSMLAIQCLKTGNINKDRLSTFLEFLGSSTLNYDLARKFYDNEMKISSTNNKNK
                     VENTALLGTLSNGNEFAFEYNFDFTLLNEIDSLIGGTQ"
     gene            complement(<363317..>364546)
                     /gene="ECM18"
                     /locus_tag="KLMA_40159"
                     /db_xref="GeneID:34716152"
     mRNA            complement(<363317..>364546)
                     /gene="ECM18"
                     /locus_tag="KLMA_40159"
                     /product="protein ECM18"
                     /transcript_id="XM_022819445.1"
                     /db_xref="GeneID:34716152"
     CDS             complement(363317..364546)
                     /gene="ECM18"
                     /locus_tag="KLMA_40159"
                     /codon_start=1
                     /product="protein ECM18"
                     /protein_id="XP_022676010.1"
                     /db_xref="GeneID:34716152"
                     /translation="MSVKRSLPLKILRRGMSQPKEEAFKRSSWKLWWDNIQHDSRDNL
                     RDLQRSLMDELDFEPGISVENSMSMGQINQWRVSNPAAKAITVPTLLVHGYAATSMTY
                     FRNFEGLSRSAKDLYAIDLPGNGLSKELPLEPEGINKPKRLELIETVKGQYVRLQEPI
                     DEQVYKKHLQHYEDYHLEALEEWRKANNLSKINLVGHSYGGYVSFKYCLKYPENVNKL
                     CLVSPLGVERSIYSVNNHFKPDVDYVIQREDPSQPTFTNNRNLPKLLLQYQNKTLRWL
                     GPLGAKACWGYVNASYGRVPSVAYREYVFQLVYGKGIVTDNAITVFNQLFSRALLAYD
                     PIMDGLNRLKVPKLMMLYGAHDWMNRAAGALAIDEFNSIRKKYDGTFYIVDKAGHNLM
                     LDNPEEFNARLIEFLKD"
     gene            <366115..>367080
                     /gene="SWF1"
                     /locus_tag="KLMA_40160"
                     /db_xref="GeneID:34716153"
     mRNA            <366115..>367080
                     /gene="SWF1"
                     /locus_tag="KLMA_40160"
                     /product="palmitoyltransferase SWF1"
                     /transcript_id="XM_022819446.1"
                     /db_xref="GeneID:34716153"
     CDS             366115..367080
                     /gene="SWF1"
                     /locus_tag="KLMA_40160"
                     /codon_start=1
                     /product="palmitoyltransferase SWF1"
                     /protein_id="XP_022676011.1"
                     /db_xref="GeneID:34716153"
                     /translation="MLLLFLLLVVSQVGLLVFSPLLSDKPVFKWYYERVYCPLFTDYS
                     RHRWKFWVVPLFYLSILLYCTYIYYKNVRSAVEDHLYVIETVFIPFMIAFTLLTGVLS
                     VFVKPLEIIEAPRFEPDYAIFYPGINCQSCHAVKVPRSKHCSLCRRCIPLQDHHCIWI
                     NNCVGYGNYEYFYPFLLANCTILSYASIRLFSMLRVLRVVSKHFLSLFLLTTAFALLA
                     IIFTYYQLKLVQEGMTNNEQDKWYLVHEHMRDGNLFKDNNGSLYYRTSSGVEGIDDTF
                     YSTNLYDHRKYKLNNPSRIHSAEELTNIYDRGDFWKNLVERISVL"
     gene            <367564..>372306
                     /gene="ARO1"
                     /locus_tag="KLMA_40161"
                     /db_xref="GeneID:34716154"
     mRNA            <367564..>372306
                     /gene="ARO1"
                     /locus_tag="KLMA_40161"
                     /product="pentafunctional AROM polypeptide"
                     /transcript_id="XM_022819447.1"
                     /db_xref="GeneID:34716154"
     CDS             367564..372306
                     /gene="ARO1"
                     /locus_tag="KLMA_40161"
                     /codon_start=1
                     /product="pentafunctional AROM polypeptide"
                     /protein_id="XP_022676012.1"
                     /db_xref="GeneID:34716154"
                     /translation="MSVELSKVSILGQDTIHVGYQIQEHIVKTTLEQCKSSTYVIIND
                     TNVYQVPYYHDLVELFEKSLPETSRLLTYVVKPGEANKTRETKAQIEDFMLNEGCTRD
                     TVVIAIGGGVIGDMIGFVAATFMRGVRFIQIPTSLLAMVDSSIGGKTAVDTPIGKNFI
                     GAFWQPQFVFVDIKWLETLPKREFINGIAEVIKTACIWNGEEFSRLEANAESFLSIVN
                     NSQTVSIFSPRAKETVELTYTNIEAILEHIYKLVLESIKVKAHVVSSDERESGLRNLL
                     NFGHTIGHAYEAILTPQALHGECVSIGMVKEAELARYLNILSPTQVARMVKILAAYGL
                     PISVNEKWFKELTLNKKTPLNTLLKKMSIDKKNDGSKKKVVILEKIGKCYGTSAQIVS
                     DDDLRFVLSDETLVYPFNDIPKNQHKTITPPGSKSISNRALILAALGEGTCKIKNLLH
                     SDDTKHMLNAVQQLKGATISWEDDGETVVVSGHGGSTLTATSDPLYLGNAGTASRFLT
                     TVAALAKKDGNHDHVILTGNARMQERPIGPLVDSLRSNGVHIDYLNKEGSLPLKISTE
                     TSFKGGRIELAATVSSQYVSSILMCAPYAENPVTLSLVGGKPISQLYVDMTIKMMAAF
                     GITVTKSETEEYTYHIPKGNYKNPPEYVIESDASSATYPLAFAAMTGSTVTIPNIGSA
                     SLQGDARFAVDVLRPMGCHVVQTETSTTVTGPERGQLKPLKHVDMEPMTDAFLTASVV
                     AAICNDGTSNTTTIEGIANQRVKECNRIEAMITQLAKFGVAANELPDGIQIHGVNSIS
                     ELKTPPESGIETYDDHRVAMSFSLLAGLVNSENKSKTTVSPVRILERHCTGKTWPGWW
                     DILHSELGAKLNGAEPLKAKALDSRKSVVIIGMRAAGKSTVSKWCAQSLGYKLIDLDD
                     EFERQYGKGSVKDFVAEKGWDEFRREETRIFQNVIAKYGDKGYVISSGGGIVESPDSR
                     KALKAFSNDGGFVLHLHRDIEETIIFLNNDPTRPAYIEEIRDVWERREKWYHECSNFT
                     FFAPHCSNDIEFRKLKQVFNHFIRRILGVEEVHIPKSRSAFVCLTFGDLADHVEKLEE
                     ITYGCNAVELRVDHLSNYSSDFVTKQISLLRTATNSLPIVFTVRTVSQGGKFPDDAEN
                     LLEGLFNVALKNAVEYIDLELTLPNKLIYKVLNRKGTTKIIGSHHDFAGKFKWDDSEW
                     ENRYNQALSLDVDVVKFVGTAEDFADNLALERFRSQHTSKPLIAINMTEKGKISRVLN
                     TVLTPVTSSLLPSASAPGQLTLAEINNLFHKFGGLPAKQFLVIGSPIGHSRSPILHNT
                     GYKLLGLPHNFDKFETDDIEQVKKEVLSRPDLGGLAVTIPLKIQIIKYMDELTEAAKT
                     IGAVNTVIPLGDNKFRGDNTDWLGIKKSLTSNGVPNSVHGTSGLIIGAGGTSRAAVYA
                     LKHLKCDKIYMINRTSEKLHDVKSNFPEEYNIVVVESAEQLDAINDEISVAVSCVPAD
                     KPLDSELLNKLERFLAKGTGSLKPTLLDAAYKPTVTPVMRIARDKYYWNIVPGAEMLV
                     HQGVEQFSRWTHYKPPFKAIFEAVTNEV"
     gene            <372535..>375942
                     /gene="MTC5"
                     /locus_tag="KLMA_40162"
                     /db_xref="GeneID:34716155"
     mRNA            <372535..>375942
                     /gene="MTC5"
                     /locus_tag="KLMA_40162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819448.1"
                     /db_xref="GeneID:34716155"
     CDS             372535..375942
                     /gene="MTC5"
                     /locus_tag="KLMA_40162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676013.1"
                     /db_xref="GeneID:34716155"
                     /translation="MTGYIGGDPYASPTFGKSLSLRVDGGFNAVSINPSGRDVVLASR
                     KGLYIVDLDDPFSEPRWLHHITSWEVADVQWCPHPAKHHWVISTSNQKAIVWNLSRSS
                     SKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAWDMRSPKKPYYRTSNWRSG
                     AAQVKWNHKNSNVLATSHSNILYIWDVRKGTTPLSVLKGHEGSINSIDFNPFNESEIM
                     SSGNDASVRFWDYNNVGHELQRTITTDFPVWRGRYLPFGDGYCIMPMSGGNNSVYLAS
                     ALHDPIDSEPQTSKLQATYVFKGHTDRVTDFLWRSRHSYNTTVDDREFQLVTWSKDCD
                     LKLWPVPEMIYEKVHYECGRELSSKLPNYNYESFRNEPESQLFDSNYKNVEVPRETFV
                     TKSGLSQWKAKNKIDQLQWISGVRMHNTESPHDFFEDTRLNNLGEEVTAVGHKFPRIV
                     FEKISVSTGELVLTLNGPWVEDDPERYIFMRIVINFPPDYPMKGNEPVFKIEENRDLN
                     EHKRAEIMDHLKEITKKYVNSNRYCLEPCLQYLLGERVNLDISDSEDDNKIFSFEFED
                     ITSVEHSTIESSEDESVDGTDMSSVSNDDFAEREEGSLHLYSSVSEGKFDSTPVPNGC
                     GAVWTAQGTLVCFFRTESKVERKQHNILDVGRTGIGGFMKSKNIHVGASQTLKEMDTT
                     TENKPKTYRETLSVNSLHRTESNQSSGSDSEDSDDSYADFLHDILKNDITLRTKMPAI
                     PQMFHDEMRSSTSTSGKTNDSNKRSKSSITIQDFSHLVPDKRELAKEYILFGESPESV
                     AKYNAGIAEKYGYEDIAQCWRMISNILIGRGDSNFYNYSWDQHTLGGTLLVKRLFEYF
                     EKCQNLQMLAMMSCIFVKLGRPDDNRTARPAQPQTLSENIISFYNNEYESSPHVHSNH
                     GSFYSNDMNTQNARLRYGSTQAPSINDGSSIISEDYFHQNHHSNGNKNGKNHTNTTGY
                     ADADSVLPDIKIKLIHDEVLDLAFEGQEPSLVDAKDESKFRNYRTQYAEMLYIWGLPM
                     DRAELLKFNVNLNTELDYLHAIEHDAGLDIYKGVSNQWIESDEYPLSRNCCYCNLKVD
                     RLVFVCGNCQHVTHRLCALKWWKIDDECPSGCGCHCIDNFDVSETLS"
     gene            <376175..>377215
                     /gene="ERG27"
                     /locus_tag="KLMA_40163"
                     /db_xref="GeneID:34716156"
     mRNA            <376175..>377215
                     /gene="ERG27"
                     /locus_tag="KLMA_40163"
                     /product="3-keto-steroid reductase"
                     /transcript_id="XM_022819449.1"
                     /db_xref="GeneID:34716156"
     CDS             376175..377215
                     /gene="ERG27"
                     /locus_tag="KLMA_40163"
                     /codon_start=1
                     /product="3-keto-steroid reductase"
                     /protein_id="XP_022676014.1"
                     /db_xref="GeneID:34716156"
                     /translation="MPSSKIAVITGTNSNLGLNIAYRLIEKSKPEETLTIVVTSRTLP
                     RARECIEFIEKFVEKAGRKGSVNYDYLLVDFTSMVSVLDAYYTLTNRYDYINYFFVNA
                     AQGVYAGIDWIGAVKEVCANPLEAVTNPTYKIQKVGVKSKDGMGLVFQANVFGPYYLI
                     QKILPLLEAGKGTVVWISSIMAAPKYFSLQDIELLKSDVSYEGSKRLVDLLHIATFKE
                     MQQKGVRQYLTHPGIFTSLSFFQYLNVFTYYGMLLLFYLARWIGSPWHNIQGYKAANA
                     PVYVATLANPHFEKQHMKYGSATFRDGMEYIKTDEVDVTGSEDVYKYIKELKSKWDEK
                     LKDQIKPTRAAL"
     gene            complement(<377366..>379315)
                     /gene="SAC6"
                     /locus_tag="KLMA_40164"
                     /db_xref="GeneID:34716157"
     mRNA            complement(<377366..>379315)
                     /gene="SAC6"
                     /locus_tag="KLMA_40164"
                     /product="fimbrin"
                     /transcript_id="XM_022819450.1"
                     /db_xref="GeneID:34716157"
     CDS             complement(377366..379315)
                     /gene="SAC6"
                     /locus_tag="KLMA_40164"
                     /codon_start=1
                     /product="fimbrin"
                     /protein_id="XP_022676015.1"
                     /db_xref="GeneID:34716157"
                     /translation="MNVIKLQRKFPEFSQEELFETIEQFRNIDLEDKGWVEKPQILES
                     ISKSGLASYDEARETLKSVDVDASGRVELDDYVELMAKLRGNGSSGAAAPPTSFPNVS
                     QGKVPPAVPSKPQSVGLQHKGSGGKAQIIVGGSTSGTTHTINEEERRAFTTHINSVLA
                     GDPDIGHRLPFPTDTFQLFDECRDGLVLSKLINDSVPDTIDTRVLNWPKNNKALNNFT
                     ASENANIVINSAKAIGCVVVNVHSEDIIEGKEHLILGLIWQIIRRGLLSKIDIKLHPE
                     LYRLLEEDETLEQFLRLPPEQILLRWFNYHLKQAGSNRRVSNFSSDIKDGENYTVLLN
                     QLDPSQCSLAPLQTTDLLQRAEQVLDNAEKLDCRKYLTPTALVAGNPKLNLAFVAHLF
                     NTHPGLDPLDENEPIEIEEFDAEGEREARVFTLWLNSLEVDPPVVSLFEDLKDGLVLL
                     QAYDKVMPGSVNWKVINKRPSSGAELSRFKALENTNYAVELGKSRGFSLVGIDGSDIV
                     DGNKLLTLGLVWQLMRRNIVNTMNELATTGRDMSDSQILKWAQDTVNKGGRSSTIRSF
                     SDPSLSNAHFLLDVLNGLAPGYVDYSLVLPGKTDEEKYANARLAISIARKLGALIWLV
                     PEDINEVRSRLILTFVASLMALNKK"
     gene            complement(<380525..>382525)
                     /gene="CDC45"
                     /locus_tag="KLMA_40166"
                     /db_xref="GeneID:34716158"
     mRNA            complement(<380525..>382525)
                     /gene="CDC45"
                     /locus_tag="KLMA_40166"
                     /product="cell division control protein 45"
                     /transcript_id="XM_022819452.1"
                     /db_xref="GeneID:34716158"
     CDS             complement(380525..382525)
                     /gene="CDC45"
                     /locus_tag="KLMA_40166"
                     /codon_start=1
                     /product="cell division control protein 45"
                     /protein_id="XP_022676016.1"
                     /db_xref="GeneID:34716158"
                     /translation="MYVGINGFVNVYDKILHRCSSHSSCQLVIFVSCLNIDALCASKM
                     LSSLFRKQLVQSQLVPVFGYSELKEHFQRLDENINSVIFVGCGGMIDLESFLEIDAED
                     NSIPTETDTNKETEAQRFKREIYVLDCHRPWNLDNLFGSQYITCFDDGTVEESLKTQK
                     DAYYRLIEIENELGEELDDDDDDLDDQEDQVAQKSNENENEGDNEEDDDDDETILRKR
                     SSEELDERKVRKQQKREFHELEKLLQEYYSQGSTVLNSLSVQIYSLLSGIGETNLDYL
                     WLCILGVTSLDNSYPLVYNRLVPLLKDEVKRLTPSEKTKTPDSLNLEIRPDYSLFLLR
                     HTSLYDSFYYSTFVNAKLSLWNENGKKRLHKMFARMGIPLTIAQENWIYMDNSFKRDL
                     SVLFDKNLDRYGLQDIVRDGFLRTFGYRGSISASEFVESITALLEVGDGSNALENSII
                     SGVSQDNAGKNKPDEENREYEETEEQRIDRILKSRQKKWVSNFWCSWDVLDNNMDILN
                     QGIKHATFLQKSVFETGVAILEKRLVKHLRIYRLCVLQDGPDLHFYRNPLTLLRLGSW
                     LIEYYAENDEKHLLPLVLASLDETTDTYLCAGIAPRYPRGLDILKQQQHKTLNNFTVA
                     FQQVAAETGAKVRIDNFESSIIEIRKEDLQPFLERLTLSGLI"
     gene            complement(<383290..>384345)
                     /gene="SEN2"
                     /locus_tag="KLMA_40167"
                     /db_xref="GeneID:34716159"
     mRNA            complement(<383290..>384345)
                     /gene="SEN2"
                     /locus_tag="KLMA_40167"
                     /product="tRNA-splicing endonuclease subunit SEN2"
                     /transcript_id="XM_022819453.1"
                     /db_xref="GeneID:34716159"
     CDS             complement(383290..384345)
                     /gene="SEN2"
                     /locus_tag="KLMA_40167"
                     /codon_start=1
                     /product="tRNA-splicing endonuclease subunit SEN2"
                     /protein_id="XP_022676017.1"
                     /db_xref="GeneID:34716159"
                     /translation="MAKGSYGNKLRYKHPLPIEAEPVPSLWKQPIQTLVWILDWALGW
                     TNTRIIDVEINDIGQILVSDQWQMKYLWEHGFFGTGQLSRSEPNWHERTKSRLQLEDG
                     SSINLEVVTDVRRRQRLEFKKLRAEFEAKKLEMRRQGIVDEAFLEQERLFLKAQRDKE
                     LAFEKENADITKIREEDELIIDGGEVIQLEKLQLMPVEAMFLSYAVPVLKIKLPELTA
                     SLVPELTSFNDIKKLLHQYVAYHHYRSKGWCVRSGIKFGCEYLLYRRGPPFQHAEYGI
                     MVLDAEQSNDYTWYSSAARVVGGAKKQFVLCYVELLTTEDDVCRLWKEGRYNELFASF
                     KIHEFLYKRWVAGKNRD"
     gene            complement(<385096..>399840)
                     /gene="MDN1"
                     /locus_tag="KLMA_40168"
                     /db_xref="GeneID:34716160"
     mRNA            complement(<385096..>399840)
                     /gene="MDN1"
                     /locus_tag="KLMA_40168"
                     /product="midasin"
                     /transcript_id="XM_022819454.1"
                     /db_xref="GeneID:34716160"
     CDS             complement(385096..399840)
                     /gene="MDN1"
                     /locus_tag="KLMA_40168"
                     /codon_start=1
                     /product="midasin"
                     /protein_id="XP_022676018.1"
                     /db_xref="GeneID:34716160"
                     /translation="MSSSTFINLDTDVVTEKLSVFQKAFPQQHVRDFYRFDSKLTTEE
                     NLSNLASWSLREDLTIPHLYTYKNIFLDCCARWVLKSESSQLVPVLHALGRMVGLFPE
                     ATQLIESFLNEHTHYFNAMLQTYPSQDSQDIIKILLAFYRLIQYDKVRFEKYMNTRTL
                     NMLLEHDSPAILLLVLKVLNVILEMAENAYEGLYEKYITQGNTQKAILDQFEGAENVD
                     YQFLDLNEAKRLSNYHSLPNNTNELVLSISGQKVPSKLIPIDTTQLSPLIVEVCGVFI
                     TRMSHSSITKGDKPQLEHSSDLVYTESAESALKSLAQGIQCNKPTMLVGKAGSGKTFL
                     INELSKRMGCHDSVVKIHLGEQTDAKLLLGTYTSGEKPGSFEWRSGVLTTAVKEGRWV
                     LIEDINKAPTEVLSVLLTLLEKREISIPSRGEVIKAANGFQLLATIRLDDHHSSKRPL
                     TNDIDLIGLRLWEMVSVNEPSEKELELILQKRFDILKALIPKLINTYKCVKDIYRNPQ
                     FVSLNKGVHPRVVSVRDLVKLCQRVTLLFESNNISKPDQLIESSVYDNIFAEAVDCFV
                     GSISEYRAIQPLVQSIGEQLEVSTSRISLFLSKHVPEIETSGNEVIIGRAHLQKPKLT
                     IHKRSANSTSFAFTNHSLRLMEQIGVSVKMCEPTLLVGETGTGKTTVVQELAKLLNKN
                     LTVINVSQQTESGDLLGGYKPVNCKTVAIPILEEFEGLFISTFSMKKNEKFYKLLHKC
                     FSRSQWKNVSKLWKEAIKMAHSILNKEPKQKPDSENKKKRKLDPESKQLLIQKWSEFE
                     KTVEAFEIQSSTLEQSFVFNFVEGSLVKAVRNGEWLLLDEVNLASADTLENIADLLSE
                     RDSRSILLSEKGETESIKAHPDFRIFACMNPATDVGKRDLPPGIRSRFTEIYVHSPDR
                     DITDLLSIIDKYISKYSVSDEWVGNDIAELYLEAKRLAEENKIVDGSNQRPHFSIRTL
                     TRTLLYVTDIVHIYGLRRALYEGFCMAFLTLLNLPSEELLHDIIKKHLLGRMKNPHSV
                     MSQVPPSPGTDYVQFKHYWMKCGSSDIIEQPHYIITPFVEKNMLNLVRATSGRRFPVL
                     IQGPTSAGKTSMIKYLADITGHKFVRINNHEHTDLQEYLGTYVTDDTGKLSFKEGVLV
                     EALKKGYWIVLDELNLAPTDVLEALNRLLDDNRELFIPETQEVVHPHPDFMLFATQNP
                     AGLYGGRKVLSRAFRNRFLELHFDDIPQSELEIILKQRCEIAPSYAKKIVEVYRQLSL
                     NRSANRLFEKKNSFATLRDLFRWALRPAVGYEELAANGYMLLAERCRSTEEKEVIRKV
                     IESVMKVKLDMDNYYAKLEEPSLMETDSTVVWTKGMRRLAVLVNSCLKNNEPILLVGE
                     TGCGKTTIFQLISKYFGKDLITINAHQNTETGDILGAQRPVRKRSEMQARLNSLLRTV
                     LGDPDLEATLEELLFSYDKLSKEEVSEELQNEISSLRDSLKILFEWADGPLVNAMKSG
                     NFFLFDEISLADDSVLERLNSVLEPERSLLLAEKGTVDSFITASDGFQFFATMNPGGD
                     YGKKELSPALKNRFTEIWVPSMEDFNDVEIIVSTRLREEVKDLAKTLVKFSEWFSKKF
                     GNGKTNTGVISLRDILAWVDFINSTLTEVKDKNACLYHGAAMVFIDALGTNNTAHLAA
                     NESKLREQKQECVQVLSALCEYDLIPFFDKKVDVELNDRELKCGEFTLERSSNVISDN
                     SFKINAPTTAMNLMRVVRALNVKKPILLEGSPGVGKTSLIAALAEYTGNSLTRINLSE
                     QTDLVDLFGFDAPGERTGEFIWRDAPFLRAMQKGEWVLLDEMNLASQSVLEGLNACLD
                     HRGEAYIPELDKVFTRHPNFLVFAAQNPQYQGGGRKGLPKSFINRFSVVYVDMLTPED
                     LLMIATHMYPNIDRDISSKMIKMMSRLEDDVSNKKLWGNAGSPWEFNLRDTLRWLKLL
                     NSASICKDITTADFLEIIVKQRFRSPEDRSHATNLISEIFGEISERDPIFKVGTSYLQ
                     VNAEVIDRNPIIQFDTLQNLVPLQCNFNVYESVLRCVKHNWPLILVGPTNAGKTNAIK
                     FIASIIGKKTVEFSMNSDVDSMDILGGYEQLDINRKLSTTVNSLLNTLQELLTVNLSS
                     GTEGEILSAAFDLYDFISKVSVSSSNFHTVVTLFKKLYDVIESNDLLDSLNDSIQLLN
                     KTIQKPAAVKFEWFDGMLVKAVEEGHWLILDNANLCSPSVLDRINSLLETNGTLIINE
                     CCLTDGKPRVVQPHPDFRLFLTMDPKFGELSRAMRNRGIEVFMDDLSNRASSQDRRLL
                     GFEISSPSSVGDDIQTQFESLQLSSSHGAKKPLASYMSSRSSKLLPLAAIHDFALRGD
                     IAPYLISTIPQSATSLIPLWSMNVQNSKLYSEVELCLEMDLVVNFLRETGKLSEINAV
                     YQPLENTAPGIVLNVSDFCNHQSLIPTLNSYIQSTIAKSAPLSLTSESVFFFALSWYL
                     LDAKHRIEFAEKKAINGKVNELSYLELSAAASLGKNIKNPPKIKIFKLLRDILKLSLS
                     SISNVPLFSERNIYKAFFELYGLWHGTFSVAQEKDEAKLRVYQELFMEWLNSFTSDLP
                     FALDFKNLLAEVSQPNSLTTGASMSLIWEEYRKTYPITAETWDLLLQLESLSRDFDFM
                     TSRQFSDSYPVIQELLQSLHNLYDDILNNETAHFAEIIEEARKAISKLDEISASFLIQ
                     RKHYFAEEFTSVIRLLINDFGHTRNIIEEISSNSLISAIDIIKLKSDDWVYPPIFNQL
                     WKKEGDKFISRTNTIFKPVMIESIFMKCEKFEEVSGSQLDQALRDAQLLAKTMVKSSR
                     KILDDQNIVYAKILKDWCLKIISLHLGVTIDETRSLSMEEITLKVNESEISWFKPVFN
                     KFLGPAIFLIESNVNIKTLGKAWVLFAAGLLQLYVPSSSYDPAIRDYVVYDNYITHKE
                     LSESLINNWKCVGNVLVGDHTIYSERLIPPIDTNDAPKKPRVFRPSRSIDPLFDEWSA
                     FMASSVDLSPVMNLLDSVLDNTNISEDRLKMFDQNTSQFLERLSTTYQVYSDINDIFA
                     GYIYAMKFGFNMLSLGTEDESKSLEVSPLFSVDCTMLTTEESIILPLTKLNPYLKARN
                     HNSYDVEKVLTYFLKLCVLHKEDNGMVESLNQVLQPLYYRWSLRRMKNEQEAEQKGSL
                     FKYSDESNDVEAEFKKMFPDYEDSLSLEDVSSKSDEATLSDLYFDIAKTYMDIFDKSS
                     STSITEVVREGSTVVAQLLECCQDFKMYNLNEATLLATLDTLTTKSMNFKKATDNKTF
                     DFYRGNSISETKKAMKFIESLWNHVNELLKEWPEHATLLELYRVCEEFMSYAVSTPMA
                     RLLQKLEQIYTFIVEWQKYASSKVSLQSHIDSVTGIIVSWRRLELHTWKALFELEDAN
                     STKSIGNWWFYLFETIIISTDNAESDISTKCSSLLAALNVFFSKSTFGEFQNRLKLVK
                     AFCKHVYLLYGHGSIVCQALDNLVTFYEQFTDIVTDKISKEKKTLEKEISEVILLASW
                     KDVNIDALKQSSRRSHNNLFKIVRKYRSLLATPMSSIIESGIDPTLKVKSTYNATTIA
                     HFRSIDLIWAKSLVTTIPDWDSRTKALKDIDLIDKNLAIYTNKIGTQTYPDLLEYALY
                     VSSEAKRLREETPSVYKKDKKKLLSTLKSQKQKLLSDTLKELKRIGLKANYREDIRKV
                     QQSVISVLTNSKSFKSTVLNSCDPYFFRILDLLPRLKNAVASPCGDIPVAYIERGMAM
                     TENLVFSLIATREPLSKFAITYSKLDHLRSDLENVSLDCKVMKHATLSYNMQSFAYVC
                     KWFPQLIDYVVQFLQNSPDCQLSNSTISSLINYKNTIVDFAWQSGKFRVYTDETEQLL
                     QRFGDCINKFIAEFSETDQNVSFVFNVLISWLQRGYTTMENMSDTIPMEEIDGKLRRI
                     STSILLSVQKLLDNKVELSEENDKWLVECNKKIMTDIKLANSEKIHALIDDLILTLKK
                     HSFNPINSPLASAAVSFTMPIINHYFVMLNNILNSTSENYYKCSKSTYVFATLLYNLA
                     KDGFCSPEPPSEETEDNNLQEGTGLGDGDGAQNNSKDIEEDEDLLEDAQTENKDKRDD
                     SDDEDNEEEDDAVDMEGDIAGDLENISDQEDKDNNDEEEEEEDLDEEIDNLDEDDPNA
                     LDEKMWEEQAEDDSKEKDSNNVPEQSKEDDVQASEEQADNNDMKPEDKPNEDQQNAED
                     GEENDDEDGEEEDVGEQEDEVRNDDNEELESNVPEVETMDLPEDMNLDSDQGSDNEEE
                     GSEAEDEFEDKMDVDEEESDSENKAGDKMTETENQEDEDGDEDVDMDEEDNAEEEQEQ
                     EEENEGDVENTDDVEIKEEGVQSDNELEQEQEQEEESKAEAGGEDAEDVEGLDGLDAI
                     DDKDQINTEAAVEQDAGAKGEGSNAIDSEEQNDIGSSGMAQSQIQEDNQEDIMDVSRK
                     EAQESLKQLGDSLKEFHRRHQEIKEASTNSEDQQEDSANQVPDEFEHVDGANTETDTQ
                     ALGTAEKDQLTGFDEDLAIDDEINEQEAEDANVESGEQEQITEPMEIDESDQIQNGDA
                     DNEENNGKSKGAFIGERKFEEESADLFKQEDLSDENDLDQMLNEVDNEVTEENSTAVA
                     PRSLDEARVLWKRSEQETSDLAAGLSEQLRLILEPTLATKLRGDYKTGKRLNMKRIIP
                     YIASQYRKDKIWLRRTKPSKRQYQIMIAVDDSKSMSESKSVDLAFQSICLVSKALTQL
                     ESGGLSIVKFGETVREVHPFNMPFSTESGSQTFQWFDFQENRTDVKKLVAESIKIFER
                     ARASENNDLWQLEIIISDGVCEDHETLVRLVRRARENKIMLVFVVINGINSNESIMEM
                     SQVKYIPDEYGNMKLSVQKYLDTFPFEFYVVVNDINELPEMLSIILRQYFSEMAAM"
     gene            <400332..>401507
                     /gene="REX3"
                     /locus_tag="KLMA_40169"
                     /db_xref="GeneID:34716161"
     mRNA            <400332..>401507
                     /gene="REX3"
                     /locus_tag="KLMA_40169"
                     /product="RNA exonuclease 3"
                     /transcript_id="XM_022819455.1"
                     /db_xref="GeneID:34716161"
     CDS             400332..401507
                     /gene="REX3"
                     /locus_tag="KLMA_40169"
                     /codon_start=1
                     /product="RNA exonuclease 3"
                     /protein_id="XP_022676019.1"
                     /db_xref="GeneID:34716161"
                     /translation="MQRNVMMNKRLRPSDMKMQPAPYQVRVDIVKKIYTQLKKFRQQE
                     ADSETQKTSVRWEHEIAKVSKSKQGYMFNASVMLRNIIKYKGDLDDKGAPLDTKSSLI
                     KKSAVLEKLRTLLLDEETLSRNGFFVNMYDTEPESNQDSNFMECCRCETKFDISKIME
                     PTVCQYHVQRKVYNRESKKREFPCCGASLESYSDFSAGCSKASHHVYKFENFTRLSEV
                     LPFKSLKDVDGEENVLALDCEMAFTSKGYEMIRLTIVDFWTSKIVYDKVIKPLGEVID
                     LNSKFSGIHHIDDSAPTIHETEKDYIGPNMINKNTLLIGHGLDNDLRVMRIVHDKIID
                     TAVLYPAGKFKSSLKNLSFEVLSRKIQGGEHDSSEDAIAAMDIIKKKIGVPLDKTSW"
     gene            complement(<401499..>402179)
                     /locus_tag="KLMA_40170"
                     /db_xref="GeneID:34716162"
     mRNA            complement(<401499..>402179)
                     /locus_tag="KLMA_40170"
                     /product="filament protein FIN1"
                     /transcript_id="XM_022819456.1"
                     /db_xref="GeneID:34716162"
     CDS             complement(401499..402179)
                     /locus_tag="KLMA_40170"
                     /codon_start=1
                     /product="filament protein FIN1"
                     /protein_id="XP_022676020.1"
                     /db_xref="GeneID:34716162"
                     /translation="MDSPSKKPLQDISNNASPPSSSSDEVFKRLSMSPTRNHRLLDKP
                     AVRLSPQQRIQTPKRLPSPDILKPTQSLDRYDRPKSKVVKINEIVFPNSPTKTTNVLK
                     NVPVSGGDGSLSRIRNRFKINNPSPVKMNLLDRLHQEESPQTKKELTTHDNDASVAKG
                     LHHNYTKGSRVERTNRKTRSKSVMFKLPEDRLIALELNEMKKLNNDLLSRVAELEERV
                     STLERKLP"
     gene            complement(<402475..>404064)
                     /locus_tag="KLMA_40171"
                     /db_xref="GeneID:34716163"
     mRNA            complement(<402475..>404064)
                     /locus_tag="KLMA_40171"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819457.1"
                     /db_xref="GeneID:34716163"
     CDS             complement(402475..404064)
                     /locus_tag="KLMA_40171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676021.1"
                     /db_xref="GeneID:34716163"
                     /translation="MLHLLPNEIWLEILGYLNQSDKCSLMLVSHAVYDKTVSSLYKNL
                     YLNERPIVTIPEYPFFGNNWSTLAFSEPTRSSLKFQSLYNTLSRNVELCQLIHKVHCT
                     WHLNRTLLTRFTRLICEHGSNVTYFENFLYIETFETLSKSALAPRLQSLDIVPHAKLP
                     GNAYASYLPSVTTMANKFNWSNIKSLTIYVDVLMWFPNFVKLSEKLQLTELCLNLRND
                     TFPGLDQITSNNSVVKFSDLFDVNTLETLSILSWYEAETFDVYAKYGLSDLASFTNLK
                     EVSLLSIFYNEEFLVSLLSNLSTLERLKLDFMFDHALSRNVINILSNIRTLKYLDCKF
                     DDLDEPILNIVELDDFAIFELNQMCLCETCKTVYRDVILKKYFPNKNAFMIQNANDIH
                     SRHFLNHIFKLYPIIPYFHMITTSPCIAYRSRSVEELAKKSNELLNDLFYEYESDTSD
                     TKITADDIISLYHCICHSMKRSFDFFLNLFPRLEILVINDVPTIVDQECGQKFMKPIF
                     YSSGYKTNQVYEIVTDESLFD"
     gene            complement(<404840..>406198)
                     /locus_tag="KLMA_40172"
                     /db_xref="GeneID:34716164"
     mRNA            complement(<404840..>406198)
                     /locus_tag="KLMA_40172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819458.1"
                     /db_xref="GeneID:34716164"
     CDS             complement(404840..406198)
                     /locus_tag="KLMA_40172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676022.1"
                     /db_xref="GeneID:34716164"
                     /translation="MDIVDNSEPMIKIPELLPHENIYKIQVGSKLFKISGASLSSDGP
                     SFFTDYFNAQKDSPQVLILDRSDRVFENIMNHLQGYPLSVLDERDFITLFLDSLYYRL
                     PRLKRMLQKYDYYFINIGGKHFKFSKSLFDRPGDSPNYFNLLIDAMLVDVENVFHEKQ
                     MIRPPSHFIPFVTRSSVLFQEILNLLTDDDYVVPSHISISNLLKECKFYCLLNLQQRL
                     IPHRITRNPFCKREEITMKLHHLRRTGIKLLAQDTDIKACEIRSDSESSEDLYLCPQK
                     KRKLEASPAEWDMVSYQRPYVDKEPRDLIVQFDATEMTLFFNKRMKTIHVQVANENDC
                     HILKNLLADINRKHNIEDSSFQFPQFQGYVFITCITMADLTVNGLPCKNLCSKIDEIK
                     TNEQIFDFCNRDGMMPGLSLHVIGPSLWRIGVKDQHIILLPLKLNCISNLRQFNMNLQ
                     FL"
     gene            <407750..>408259
                     /gene="AHP1"
                     /locus_tag="KLMA_40173"
                     /db_xref="GeneID:34716165"
     mRNA            <407750..>408259
                     /gene="AHP1"
                     /locus_tag="KLMA_40173"
                     /product="peroxiredoxin type-2"
                     /transcript_id="XM_022819459.1"
                     /db_xref="GeneID:34716165"
     CDS             407750..408259
                     /gene="AHP1"
                     /locus_tag="KLMA_40173"
                     /codon_start=1
                     /product="peroxiredoxin type-2"
                     /protein_id="XP_022676023.1"
                     /db_xref="GeneID:34716165"
                     /translation="MSTKLPETKFQYVRIIPSQEGTEACTFPVETSFSEFKGPIVITG
                     APAAFSPTCSISHIPGYVEKLDELVKAGASQVFVVTADNPFANNAWAKKLGVKDTDKI
                     KFITDSGAKFSQSLGYALPIGDGVYWASRYLVIAKDGEIIYKAVEEKPASEVTVSSVD
                     NALDQLRKL"
     gene            complement(<409511..>409888)
                     /locus_tag="KLMA_40174"
                     /db_xref="GeneID:34716166"
     mRNA            complement(<409511..>409888)
                     /locus_tag="KLMA_40174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819460.1"
                     /db_xref="GeneID:34716166"
     CDS             complement(409511..409888)
                     /locus_tag="KLMA_40174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676024.1"
                     /db_xref="GeneID:34716166"
                     /translation="MQFSTVATFAAVAAVASAQNITTATATENATTLVTITSCSEDKC
                     HESVSPALVSTATVTVNDVITEYTTWCPLTATTEAGVPKNTTVSPAPKPTTTQSQSEY
                     TGAAAKAFPAAGALVAGAAALLL"
     gene            <413454..>414851
                     /gene="HOG1"
                     /locus_tag="KLMA_40175"
                     /db_xref="GeneID:34716167"
     mRNA            <413454..>414851
                     /gene="HOG1"
                     /locus_tag="KLMA_40175"
                     /product="mitogen-activated protein kinase HOG1"
                     /transcript_id="XM_022819461.1"
                     /db_xref="GeneID:34716167"
     CDS             413454..414851
                     /gene="HOG1"
                     /locus_tag="KLMA_40175"
                     /codon_start=1
                     /product="mitogen-activated protein kinase HOG1"
                     /protein_id="XP_022676025.1"
                     /db_xref="GeneID:34716167"
                     /translation="MSNEEFIRTQIFGTVFEITNRYTNLNPVGMGAFGLVCSATDTLT
                     NQPVAIKKIMKPFSTSVLAKRTYRELKLLKHLRHENLICLEDIFLSPLEDIYFVTELQ
                     GTDLHRLLQTRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKIC
                     DFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPG
                     KDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVTSLPHRDPVPFSTRFQNLEPEAID
                     LLEKMLVFDPKKRITAADALAHPYLSPYHDPTDEPIAEAKFDWNFNDADLPVDTWRVM
                     MYSEILDFHQIGDPQINTNATFDDQVAAATAAAAEAATKQQQQQQPQSQTQSQAQTQQ
                     QQQQQQQQQQQQQQTLTQAQAPQVQVSPGELAVPSNANSHSNSNHSFSIGPDPANETL
                     TNLANQADQYVTKFE"
     gene            complement(<415170..>419717)
                     /gene="YCF1"
                     /locus_tag="KLMA_40176"
                     /db_xref="GeneID:34716168"
     mRNA            complement(<415170..>419717)
                     /gene="YCF1"
                     /locus_tag="KLMA_40176"
                     /product="metal resistance protein YCF1"
                     /transcript_id="XM_022819463.1"
                     /db_xref="GeneID:34716168"
     CDS             complement(415170..419717)
                     /gene="YCF1"
                     /locus_tag="KLMA_40176"
                     /codon_start=1
                     /product="metal resistance protein YCF1"
                     /protein_id="XP_022676026.1"
                     /db_xref="GeneID:34716168"
                     /translation="MGQSERAALIAFASRNTTECWLCRDKEGFGPISYYGDFTVCFID
                     GVLLNFAALFMLIFGTYQVVKLSKKEHPGIKYRRDWLLFSRITLVGCFLLFTSMAAYY
                     SSEKHESIALTSQYTLTLMSIFVALMLHWVEYHRSRISNGIVLFYWLFETLFQGSKWV
                     NFSIRHAYNLNHEWPVSYSVYILTIFQTISAFMILILEAGFEKPLPSYQRVIESYSKQ
                     KRNPVDNSHIFQRLSFSWMTELMKTGYKKYLTEQDLYKLPKSFGAKEISHKFSERWQY
                     QLKHKANPSLAWALLSTFGGKILLGGIFKVAYDILQFTQPQLLRILIKFVSDYTSTPE
                     PQLPLVRGVMLSIAMFVVSVVQTSILHQYFLNAFDTGMHIKSGMTSVIYQKALVLSSE
                     ASASSSTGDIVNLMSVDVQRLQDLTQWGQIIWSGPFQIILCLVSLYKLLGPCMWVGVI
                     IMIIMIPINSVIVRIQKKLQKIQMKNKDERTRVTSEILNNIKSLKVYGWEIPYKAKLD
                     HVRNDKELKNLKKMGCTLALASFQFNIVPFLVSCSTFAVFVFTEDRPLSTDLVFPALT
                     LFNLLSFPLAVVPNAISSFIEASVSVNRLYAFLTNEELQTDAVHREPKVNNIGDEGVK
                     VSDATFLWQRKPEYKVALKNINFSAKKGELTCIVGKVGSGKSALIQSLLGDLIRVKGY
                     AAVHGSVAYVSQVAWIMNGTVKDNIIFGHKYDPEFYELTIKACALAIDLSMLPDGDQT
                     LVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLL
                     HSKTKVLATNKISVLSIADSITLMENGEIIQQGTYEETNNTTDSPLSKLISEFGKKGK
                     ATPSQSTTSLTKLATSDLGSSSDSKVSDVSIDVSQLDTENLTEAEELKSLRRASMATL
                     GSIGFDDDENIARREHREQGKVKWDIYMEYARACNPRSVCVFLFFIVLSMLLSVLGNF
                     WLKHWSEVNTGEGYNPHAARYLLIYFALGVGSALATLIQTIVLWVFCTIHGSRYLHDA
                     MATSVLKAPMSFFETTPIGRILNRFSNDIYKVDEVLGRTFSQFFANVVKVSFTIIVIC
                     MATWQFIFIILPLSVLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGLTTIRG
                     YSQQTRFVHINQTRVDNNMSAFYPSVNANRWLAFRLEFIGSIIILGSSMLAVIRLGNG
                     TLTAGMIGLSLSFALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAPYIIEDH
                     RPPASWPEKGDVKFVNYSTRYRPELELILKDINLHILPKEKIGIVGRTGAGKSSLTLA
                     LFRIIEAASGHIIIDGIPIDSIGLADLRHRLSIIPQDSQIFEGTIRENIDPSKQYTDE
                     QIWDALELSHLKNHVKNMGPDGLETMLSEGGGNLSVGQRQLMCLARALLISSKILVLD
                     EATAAVDVETDQLIQKTIREAFKERTILTIAHRINTIMDSDRIIVLDKGRVTEFDTPA
                     NLLNKKDSIFYSLCVEAGLAE"
     gene            420230..420305
                     /locus_tag="KLMA_R409"
                     /db_xref="GeneID:34718707"
     tRNA            420230..420305
                     /locus_tag="KLMA_R409"
                     /product="tRNA-Val"
                     /db_xref="GeneID:34718707"
     gene            <420606..>423866
                     /gene="YCS4"
                     /locus_tag="KLMA_40177"
                     /db_xref="GeneID:34716169"
     mRNA            <420606..>423866
                     /gene="YCS4"
                     /locus_tag="KLMA_40177"
                     /product="condensin complex subunit 1"
                     /transcript_id="XM_022819464.1"
                     /db_xref="GeneID:34716169"
     CDS             420606..423866
                     /gene="YCS4"
                     /locus_tag="KLMA_40177"
                     /codon_start=1
                     /product="condensin complex subunit 1"
                     /protein_id="XP_022676027.1"
                     /db_xref="GeneID:34716169"
                     /translation="MSSFQLTEYLSSFQHTDKSTYKELPTPGAKLNHITDTLALNSEY
                     ELSDDTFEVLVDLAHSYFHLSYNVKQQLIYLVSSCLSNLSTLIHSNYQVDEDTLQSWK
                     INLQKWGYLVHVLLVFMQDDLLNSPHQQQQQQKKEEIKLYSALLEILLPSIINLASIP
                     QLPKLFDTLLERDVFVGIFLKPLFTLVECEPLIKINHVKTMIIKIIAIFVKNDNQSQL
                     VQNFVMANLTYFPQLTNFNAELLTYINDEFDYPQLTEDILRSISVKEFNAKDLSGPKS
                     ISNFLIKISELSPRVVLRQMTSIIRLLNNSSFTLRCSVVEACGNIAVDISSDPDLYQH
                     YKEQNDTLLELLDERFQDSNPYVRCKAIQSWIKICDLKIKFNHHRLLVTKLAVRSLQD
                     KSSLVRKNAVKLLSKLLFTHPYDQMHGSQLKLHDWKHRLHNLMEHDFDEDDKKIKLTE
                     TYYKDAITFIESLHDAIEHSVPLLFSRNKSEVLETMDFLVLCDAFDLELSSLGIKKML
                     HLVWFKNSNDEGINIADHLVTCYKQLFLTTPDHFNYKERSAFIAKNLINLTLDASVSD
                     LASLERLIGLMYDSKLIDYNDINALWMIYQSLLTDGKIGGAEFSTSEIYGAITVLGML
                     ALADNEVGLRGLPHILKVGFDHGKLPIIKMTCVILQRMVPSENTDIPHHEEVLQILHN
                     LVISSTDDHEYYSMCEHAINAIFEISKRPDIICNQIIKEKTMITFGELRNKEGEDSTN
                     QKSLGSRLTSLSQLLFIVGQVCIKIIIFLEKSEAEFKKTKIQYESLKSATNENTTTDA
                     DNSMANTSEQQKELDLIGGTNEDDFSDAIQYIKENELLFGPNSLLAKYGPLVEEIVTN
                     YDKFNDKYLQRNAVLCLTKMMCVSSRFCEKNLSLLITIMERSPDPIIRSNAVLGLGDM
                     AVCFNNLIDENTDFLYRRLHDDNLMVQKTCLMTVTFLILAGQVKIKGQIAQMAVLLDN
                     PDQSISDMCKLFFTELSTKDNAIYNGFIDIFSGLSSDEELPNDSFKTIIKYLLTFIDK
                     DRHQKQLSEKLLSRILKAETQRQWDDIAFVLNQLPNKSEKVQQVLDEGFKLVSARD"
     gene            complement(<424094..>425251)
                     /gene="HEM15"
                     /locus_tag="KLMA_40178"
                     /db_xref="GeneID:34716170"
     mRNA            complement(<424094..>425251)
                     /gene="HEM15"
                     /locus_tag="KLMA_40178"
                     /product="ferrochelatase"
                     /transcript_id="XM_022819465.1"
                     /db_xref="GeneID:34716170"
     CDS             complement(424094..425251)
                     /gene="HEM15"
                     /locus_tag="KLMA_40178"
                     /codon_start=1
                     /product="ferrochelatase"
                     /protein_id="XP_022676028.1"
                     /db_xref="GeneID:34716170"
                     /translation="MIRREVGSIMRAPVFKGLARFYSSKKGPTAVVFMNMGGPSTVPE
                     TYDFLYQLFSDYDLIPISKKYQPILAKYIARFRTPKIEQQYREIGGGSPIRKWSEYQS
                     AKVCKILDETHPETAPHKPYVAFRYARPMTDETYKQMLKDGVTRAIAFSQYPQFSYST
                     TGSSINELWRQIKKQDPERQISWSIIDRWPTQPGLVKAFAQNITKKLEEFPAEIRDKV
                     TILFSAHSLPMDVVNTGDAYPAEVGATVYHVMKELKFKNPYRLVWQSQVGPKPWLGAQ
                     TAQITEFLAPKEPGLVLVPIAFTSDHIETLHEVDLGIIGESKYADKIKRCDSLNGNET
                     FIEGLAELVKDHLDNGPRFSKQLPLDFTLGKSSDGVESLEELFNENPTKAK"
     gene            <426231..>428090
                     /gene="ALE1"
                     /locus_tag="KLMA_40179"
                     /db_xref="GeneID:34716171"
     mRNA            <426231..>428090
                     /gene="ALE1"
                     /locus_tag="KLMA_40179"
                     /product="acyltransferase for
                     lyso-phosphatidylethanolamine"
                     /transcript_id="XM_022819466.1"
                     /db_xref="GeneID:34716171"
     CDS             426231..428090
                     /gene="ALE1"
                     /locus_tag="KLMA_40179"
                     /codon_start=1
                     /product="acyltransferase for
                     lyso-phosphatidylethanolamine"
                     /protein_id="XP_022676029.1"
                     /db_xref="GeneID:34716171"
                     /translation="MYNPIDAQLQLLAEKCGLDEVTLKLAICLFASFPLNGILKRLPD
                     ERITLKCYFIIAISAFYIFGVLNLYDGFVTLFISTMFTYVITRYYQSRFMPYVNFVFV
                     MGHLAVNHMHAQFFAVYDPSKIDITGAQMVLVMKLTSFAWSYYDGTLADQKTLTEYQL
                     ARSVQKHPSVLRFLAYAFFYPSLLTGPSFDYADFESWLDCEIFRDLPESKKPRRKWKK
                     DPTIRRQIPKSSGVAIVKILQGISWLAMSFVAKDYFYPEYLFTPEFANEKSFIYKIHY
                     LFVLAFAYRFKYYAAWTISEASCIVCGLGYNGYDKKLNKIKWNRVQNIDIWKLEMAQN
                     THETLEAWNMNTNKWLKNYVYLRVAKPGAKPGFRSTLFTFLTSAFWHGTRPGYYLTFA
                     TGALFQTCGKIYRRNYRPIFMAKDGKTPRKFKFIYDIITFYVTKLAFGYLVQPFVILD
                     LGNSLYVWKTVYFYIHIGILATFFVFKGPFSKQYVKWLQSFQPVQVEMKRKKKLEDEL
                     ASGSGSLSSIIAQKQAFEKAEAEAEAEFELAMDLGIPSVDLDKDHLDEAKKELKEFRR
                     QYEEWRNEKGLEIEEENLRRAYDKFTQQFSSAKNQKRMSFSDYSPTPIEKKKD"
     gene            complement(<428236..>429054)
                     /gene="MED4"
                     /locus_tag="KLMA_40180"
                     /db_xref="GeneID:34716172"
     mRNA            complement(<428236..>429054)
                     /gene="MED4"
                     /locus_tag="KLMA_40180"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819467.1"
                     /db_xref="GeneID:34716172"
     CDS             complement(428236..429054)
                     /gene="MED4"
                     /locus_tag="KLMA_40180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676030.1"
                     /db_xref="GeneID:34716172"
                     /translation="MSTPMRIASSTSVVTQPVSGQERIGEELQSVGIYQDLERYEETI
                     QKLSESVDSFKPDLSLITKIIECDRNLYKTLEGFHEYYKIKIELDKLEEEQKEIGRKT
                     KFMLENLNSCFQSLNELPMLEQVEFEQETMLKQREKIHSKVVLDYAMKLAKFTRFPPT
                     FDKSMVGPNNFIWPAEDSLRKGMLAMASLKKKELLGAALDDDNNDDDGNANIDEANKQ
                     TEGSPKPEEEDVAKERRGSYEFAANGKEQSDDKPEGDADLELDLDLDLFNPDEF"
     gene            complement(<429383..>430207)
                     /locus_tag="KLMA_40181"
                     /db_xref="GeneID:34716173"
     mRNA            complement(<429383..>430207)
                     /locus_tag="KLMA_40181"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819468.1"
                     /db_xref="GeneID:34716173"
     CDS             complement(429383..430207)
                     /locus_tag="KLMA_40181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676031.1"
                     /db_xref="GeneID:34716173"
                     /translation="MKRSPLDVVDSTECASSDGDLSDGSSNNHHFKPQAFVKAKRQKT
                     KLEESPVDSDCEDDYLTFEIEGEEDSTKLAKPVEHVPLSKLLPKGLKMMQSMGYKAGD
                     DQKASGLIPIEIKTDRVGIKIKSHEKATGTGDLTNDNAETHFRERVAARNKMEHKQRI
                     LKQMQKIAFTLTGDVDLLSSTSDPRDFNVLWRDYAIELLKEITATDSSESESELAMPE
                     DDELVMFHQLSTDEQIEKLNTFLRAELRYCFYCGSKYKNDEDLYSHCPGFTEEDHQ"
     gene            complement(<430653..>431708)
                     /gene="DCS1"
                     /locus_tag="KLMA_40182"
                     /db_xref="GeneID:34716174"
     mRNA            complement(<430653..>431708)
                     /gene="DCS1"
                     /locus_tag="KLMA_40182"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819469.1"
                     /db_xref="GeneID:34716174"
     CDS             complement(430653..431708)
                     /gene="DCS1"
                     /locus_tag="KLMA_40182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676032.1"
                     /db_xref="GeneID:34716174"
                     /translation="MVETDSVSFKTLIKAFQFSRVLNSNPQTKSISLLGTIQGKDAIV
                     TLEKTHFQFDEVVDNPNSSTLSLHQCESEYSCMNSIETLKPIANNDIYFWGMSVMKQD
                     LELNPTAKINLIWPATRVHIEKYDKQVFHIVRETPEVYKRIVQPYIDQMIDNGRLQWV
                     HNILYNGAESDRVVFKYFDDEKPNDGFVVLPDMKWDGVNMDALYLVAIVNRDDIRSMR
                     DLKPEHQSWLIELKNKIRTVVPSCFNYLVGADQLRLFIHYQPSYYHFHVHIVNIKHPG
                     LGDGIAAGKAHLIEDVIEDLNYLGPDGFMRKTMTYVIGENHDLWKSGLEEVLQKQMQE
                     DGIPEPPKITNDFEQEQ"
     gene            complement(<432410..>433054)
                     /gene="SEC22"
                     /locus_tag="KLMA_40183"
                     /db_xref="GeneID:34716175"
     mRNA            complement(<432410..>433054)
                     /gene="SEC22"
                     /locus_tag="KLMA_40183"
                     /product="protein transport protein SEC22"
                     /transcript_id="XM_022819470.1"
                     /db_xref="GeneID:34716175"
     CDS             complement(432410..433054)
                     /gene="SEC22"
                     /locus_tag="KLMA_40183"
                     /codon_start=1
                     /product="protein transport protein SEC22"
                     /protein_id="XP_022676033.1"
                     /db_xref="GeneID:34716175"
                     /translation="MIRSTLIFRDDGLPLCASVDDDTDPSLQEQKKKVKILISRFTPS
                     SANEATMESGDFDIHYIRQDSVVYIAVVERNYPRNLAFSYLADVQQEFEHSYGAQLSK
                     SNVRPYEFVSFDGFLQKTKKVYNDRRVQGNLDQLNQDLKGVKQIMTKNIEDLLYRGDS
                     LDKMSDMSASLRQDAKKYRTSAQKINFDLLMSQYAPIAILAFFFVFLLWWVFLR"
     gene            <433668..>434204
                     /gene="DDP1"
                     /locus_tag="KLMA_40184"
                     /db_xref="GeneID:34716176"
     mRNA            <433668..>434204
                     /gene="DDP1"
                     /locus_tag="KLMA_40184"
                     /product="diphosphoinositol polyphosphate phosphohydrolase
                     DDP1"
                     /transcript_id="XM_022819471.1"
                     /db_xref="GeneID:34716176"
     CDS             433668..434204
                     /gene="DDP1"
                     /locus_tag="KLMA_40184"
                     /codon_start=1
                     /product="diphosphoinositol polyphosphate phosphohydrolase
                     DDP1"
                     /protein_id="XP_022676034.1"
                     /db_xref="GeneID:34716176"
                     /translation="MAFKKTETARVGRENQLYSAVTGARLVAGCIILDETRTKVLMVQ
                     SSAHKKRWVLPKGGIESDERDFESAARRETWEEAGATGDIVKALGSIEDMRPPKNWNP
                     DISSFESSTDEQVNKWPPRSEFHFFEMVNAKLESEYPECKTRNRKWFTYQEAKDNLLH
                     AKRPELLEALNRSSIKKD"
     gene            complement(<434256..>435164)
                     /gene="GET4"
                     /locus_tag="KLMA_40185"
                     /db_xref="GeneID:34716177"
     mRNA            complement(<434256..>435164)
                     /gene="GET4"
                     /locus_tag="KLMA_40185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819472.1"
                     /db_xref="GeneID:34716177"
     CDS             complement(434256..435164)
                     /gene="GET4"
                     /locus_tag="KLMA_40185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676035.1"
                     /db_xref="GeneID:34716177"
                     /translation="MSDKLQRTLQRFNSRIEAGDYYEAHQTLRTIANRYIRAKKYDES
                     IDLIAHAAGAFLKSKQGGSGTDLIFYLLEVYDLASVKCDDASVSRLIQLLVLVDKDEP
                     TLKDLVTGMNNWSVKHSDYKFGDPYLHSAIAMKLLEGGYTYEAERYLVLGTGESMRHY
                     VDLLWDWFEQSGEDASNFADFASRLVFNYLFISNIEYALEGLNELLTRFIDRTGAEFE
                     STEKGPYKLKVFSSNESLNFLQLLIIACQTKERVLFGNLKSQYPSLAHKYNSELQYLG
                     QEYFGIKVEKPINFLQDMMSGFFGGK"
     gene            <435524..>437899
                     /gene="SEY1"
                     /locus_tag="KLMA_40186"
                     /db_xref="GeneID:34716178"
     mRNA            <435524..>437899
                     /gene="SEY1"
                     /locus_tag="KLMA_40186"
                     /product="protein SEY1"
                     /transcript_id="XM_022819475.1"
                     /db_xref="GeneID:34716178"
     CDS             435524..437899
                     /gene="SEY1"
                     /locus_tag="KLMA_40186"
                     /codon_start=1
                     /product="protein SEY1"
                     /protein_id="XP_022676036.1"
                     /db_xref="GeneID:34716178"
                     /translation="MSEHKEAIQLINEDKEFNGGTLDYFSECVGDKNVGTGYHVISVF
                     GSQSSGKSTLLNKLFRTKFDTMDAQVKRQQTTKGIWLSHSSYVYNSLGEEASSDETPD
                     FFVLDVEGSDGAERGEDQDFERKAALFALSVSEVLIVNMWENQVGLYQGNNMGLLKTV
                     FEVNLSLFGKSEKRHKVALLFVIRDFTGQTPLESLETSLVIELEKMWSQLSKPKGCEE
                     TSFHDFFVPSFFGMGHKVFQPEQFDNDVKALGDMFVDKKMQFFKDEYHTHLPLEAWSL
                     YAENCWEQIEHNKDLDLPTQQVLVARFKTDEIATAAYNTFLASFNSDIDGKYSTMSSE
                     ELASALKHLKSTCLDENYDPSASRYAKTVYAERRIELSNQLDSKINETIENCLAITTK
                     QLLDQFHKDVKDKSVKLSFKKKIESAHEKALKGFKDYTSPFAKYGFVANLEDQISNFE
                     TRISTETEELQERELDAIVGRFNKGLSNKLKESILRLLSKPTTNIWVDIMKEFNKFLD
                     NTFSKYTDEHGNIDFQTGASQSKNESTAIDMKKNAWSFLDHTIHSHLTEDNAVDILRN
                     IFINKFRYDDEGMPKFWKNEAEVDAAYRSAKTDSLKVLDALSIIKDSNNVEILVPENL
                     IDQNAEDGDDYYGDSDEELGLYHQHRFSHVFSELQKDKIISKFKQFTDLTIIEAKRSI
                     INTTERIPLYMYALVVALGWGKIMTILKNPATIFLSIIVLAGVYVIHKLNLWGPLYQF
                     ANQATGQATMTLKQTVRNLVLDEDPKPVSTEKYSGDLKARKEDPSKESTHL"
     gene            <438186..>439145
                     /locus_tag="KLMA_40187"
                     /db_xref="GeneID:34716179"
     mRNA            <438186..>439145
                     /locus_tag="KLMA_40187"
                     /product="non-homologous end-joining protein 1"
                     /transcript_id="XM_022819476.1"
                     /db_xref="GeneID:34716179"
     CDS             438186..439145
                     /locus_tag="KLMA_40187"
                     /codon_start=1
                     /product="non-homologous end-joining protein 1"
                     /protein_id="XP_022676037.1"
                     /db_xref="GeneID:34716179"
                     /translation="MSGIQNTDNKWIFIRVNDGLALAKVTKGLSTIDCVYKLLDEDRL
                     EQFQISSKELLKASTKEEGLIDTLQDIYTILSEESNAKFESLGSKMFLSIQRKDSSEI
                     VLEVETSSVDESREQTLLHECTGYLMKNAVVGNHIRTYISHLALEKDRAIEFLGNTAK
                     DYGASNTILKWAPVNSPNYKSLMKFDPSLAWAESFPNGSVNLDIIDLNELNEITHKSA
                     AVSIRSYNKDKDVEEEEKTTGQEIWDSNVGESNLEDDSLLAQFNLDESLKLTSSSPVK
                     LKVADDSILDVEIKNQDNHSISDSESATDIEYESPRKRSRHEK"
     gene            complement(<439177..>440499)
                     /gene="SWT1"
                     /locus_tag="KLMA_40188"
                     /db_xref="GeneID:34716180"
     mRNA            complement(<439177..>440499)
                     /gene="SWT1"
                     /locus_tag="KLMA_40188"
                     /product="transcriptional protein SWT1"
                     /transcript_id="XM_022819477.1"
                     /db_xref="GeneID:34716180"
     CDS             complement(439177..440499)
                     /gene="SWT1"
                     /locus_tag="KLMA_40188"
                     /codon_start=1
                     /product="transcriptional protein SWT1"
                     /protein_id="XP_022676038.1"
                     /db_xref="GeneID:34716180"
                     /translation="MLNSKYASKSDKSRGVVKTHKYDLDELHKELGIESETPEEDPTK
                     KDTVVGHLEQNVHDNNDNGNFDEDMMDLDDENEVSFVSDLIQHHRDGQHYNESDSMDL
                     SLDLATGIDQQNDSPTIAARTVLVVDTNFIVSHLNTLEQLRLLSAQYHHRILIPTTVV
                     QELDGLKNSDKVTSSDYNSRHQSLGKLARAANDWIYKQLANLESSVIVQKMNQRYNYS
                     LTKDDAILDCCLYFAQALQDFVVLLSNDKNLCLRALSEHLLTVSYRKGMTAELIASMV
                     YKENLATRQNIQVPKPIEREPTYNGVSSSDFHALAVSAYDEFFNVIVEAIDRTMIRIY
                     GDELMFTSYSRKEMTDFKAVARVIYKHYIAVFSDFFRNSGISHNDWKQLPNELVEVPV
                     SVHQLKAFVTFWSKIVQALCKEDADVDSEASSKFFHTWLQRCSELGPA"
     gene            complement(<441340..>441543)
                     /gene="RPS28"
                     /locus_tag="KLMA_40189"
                     /db_xref="GeneID:34716181"
     mRNA            complement(<441340..>441543)
                     /gene="RPS28"
                     /locus_tag="KLMA_40189"
                     /product="40S ribosomal protein S28"
                     /transcript_id="XM_022819478.1"
                     /db_xref="GeneID:34716181"
     CDS             complement(441340..441543)
                     /gene="RPS28"
                     /locus_tag="KLMA_40189"
                     /codon_start=1
                     /product="40S ribosomal protein S28"
                     /protein_id="XP_022676039.1"
                     /db_xref="GeneID:34716181"
                     /translation="MDSKTPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTTRTIVRNV
                     KGPVREGDILVLMESEREARRLR"
     gene            complement(<441950..>444494)
                     /gene="RED1"
                     /locus_tag="KLMA_40190"
                     /db_xref="GeneID:34716182"
     mRNA            complement(join(<441950..444271,444393..>444494))
                     /gene="RED1"
                     /locus_tag="KLMA_40190"
                     /product="protein RED1"
                     /transcript_id="XM_022819479.1"
                     /db_xref="GeneID:34716182"
     CDS             complement(join(441950..444271,444393..444494))
                     /gene="RED1"
                     /locus_tag="KLMA_40190"
                     /codon_start=1
                     /product="protein RED1"
                     /protein_id="XP_022676040.1"
                     /db_xref="GeneID:34716182"
                     /translation="MFSLEYGILEVIVHIGQILNLRSFISDRWWFKLADIKVPRRSEG
                     LESLTQSLLNYGISRGNIHNWKAIMLLLGLFYQQSDIRRYIITQLREVYNYRIGEILD
                     SLNSFQLANYLMELIVNCFPKKHNSRATVLSAPQFWRDPAKTKSFFSDELYPHRAKHG
                     EDAIIQLVLSRFGNFFTNFGSVKKAIYIIGKSSGVKTLTKHQSYLQVLHQSLYFWDGE
                     GLFFEINPRKVTITRDLRDTLKVTLNDTFSNCILSPHSAWLTTLNKTTSFQFQTNEPS
                     TSEMIWNATKLPKISEVQTYISLRFPSSFDDGIIQSSVQESGAHTNNDPIPNTGKTPI
                     EGSSFAMGQVTDTFGTPNKTSDSYIGGQDMEQAIDDSVFSSSQAPETPRKLKMSVFDD
                     SIEHDDQSPLAIAQKRKIVRATSKTLGVLKEEFKRQEPVNVISSAYDIPEEVEEADIS
                     PLKPPPPPPANIFQSKTTKLVPAKDNSSGVKKVTDMFKPLMKKKEAAVLDDIFALPLP
                     KGKKKKSDSEKKQSVLNNFRPVVYVPSQDQPPAKSKLVAAVNKNNKLVVKKKVAVVPT
                     VPEGAISKKRKRVENNEDVFALSGDDEQTPPKRVTRSSKGKKGEAASLETKTISDAPS
                     STPHPKTTDVPNRPGGSNSVLNGNNAADAAEPTPEKDISNKGDENKTRDDSTLRNDKS
                     MMNESTNTDISMLNSITATTPFTSGYSKMPAFQGSFTNQLQEQIYHSVMNFSNELARK
                     ISLINGEMNKKIVNELSEKYKTMFQELQSSFQNDVEKITGFVGEIKDMLHLPEEELLK
                     LIRDKQFHT"
     gene            <445063..>447477
                     /gene="GLN4"
                     /locus_tag="KLMA_40191"
                     /db_xref="GeneID:34716183"
     mRNA            <445063..>447477
                     /gene="GLN4"
                     /locus_tag="KLMA_40191"
                     /product="glutaminyl-tRNA synthetase"
                     /transcript_id="XM_022819480.1"
                     /db_xref="GeneID:34716183"
     CDS             445063..447477
                     /gene="GLN4"
                     /locus_tag="KLMA_40191"
                     /codon_start=1
                     /product="glutaminyl-tRNA synthetase"
                     /protein_id="XP_022676041.1"
                     /db_xref="GeneID:34716183"
                     /translation="MTSVDELSTLFAQVGFEEPKVKEILKNAKVSSSLESAIKLASSD
                     FPWNKNTRALIHTLASSLKGAEVPHLDYIVNGIQKGELKTALQIDAALKYLKSKGADA
                     TVEEMNQESGVGIEVSEEQVRTRVAKYLDDNKDSILKERYKAVPGLFAKIKALPELKW
                     AEPRLFKPIIDEEVLKVLGPKDERDLVKKEKKPKGDKKGNQKEDKKKEEAEGPKRSMF
                     TEGFLGDLHKVGENPQAYPELMAEHLKATGGKVHTRFPPEPNGYLHIGHSKAIMVNFG
                     YAKYHNGVCYLRFDDTNPETEAPEYFESIKNMVAWLGFKPWKITYSSDYFDKLYELAE
                     TLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGERKACVSRDRPIEESLTEFRKMRDGF
                     YKPGEAILRMKQDLNSPSPQMWDLIAYRVLDAPHPRTGTKWRIYPTYDFTHCLVDSLE
                     NITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAKLVNGGY
                     VSGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTTNIQVVRFESAIRKYLEDTT
                     PRLMFILDPVEVVVDNVDEDFEVECTIPYRPNTPEFGDRMVPFKKRFYIERSDFSEDS
                     ENKEFFRLTPSQPVGLIKVPYTVSFQSLEKDADGKITRIHVKYDNEDAKPKKPKTYIQ
                     WVPISEKHNSPVRVAETRVYNQLFKSENPSAHPDGYLADINPDSVVVYKNSVSEYNIN
                     NVIKNSPWVVNNAKQSEFYVEEEKGRKEVCRFQAMRVGYFTLDSDSTDDKLILNRIVS
                     LKEGTK"
     gene            <447756..>447947
                     /locus_tag="KLMA_40192"
                     /db_xref="GeneID:34716184"
     mRNA            <447756..>447947
                     /locus_tag="KLMA_40192"
                     /product="translation machinery-associated protein 7"
                     /transcript_id="XM_022819481.1"
                     /db_xref="GeneID:34716184"
     CDS             447756..447947
                     /locus_tag="KLMA_40192"
                     /codon_start=1
                     /product="translation machinery-associated protein 7"
                     /protein_id="XP_022676042.1"
                     /db_xref="GeneID:34716184"
                     /translation="MSSRQGGKMKPLKQKKKQAQDLDPEEQAFKEKQKADAAAKKALM
                     SNIKAGKPLVGGGIKKSKK"
     gene            <448453..>449091
                     /gene="YPT6"
                     /locus_tag="KLMA_40193"
                     /db_xref="GeneID:34716185"
     mRNA            <448453..>449091
                     /gene="YPT6"
                     /locus_tag="KLMA_40193"
                     /product="GTP-binding protein YPT6"
                     /transcript_id="XM_022819482.1"
                     /db_xref="GeneID:34716185"
     CDS             448453..449091
                     /gene="YPT6"
                     /locus_tag="KLMA_40193"
                     /codon_start=1
                     /product="GTP-binding protein YPT6"
                     /protein_id="XP_022676043.1"
                     /db_xref="GeneID:34716185"
                     /translation="MSGASGKTLRKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATI
                     GIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSHVAIVVYDVTNRKSFEYI
                     DKWVEDVKMERGEENVILVIVGNKSDLVEERQVSTEEGERKTAVLNAKLFIETSTKAG
                     FNVKTLFKKVAKLLPEFQGAQSTPLDNDTNDKKPGVINISAPEEPQQNNNCC"
     gene            complement(<449347..>451116)
                     /gene="LCB5"
                     /locus_tag="KLMA_40194"
                     /db_xref="GeneID:34716186"
     mRNA            complement(<449347..>451116)
                     /gene="LCB5"
                     /locus_tag="KLMA_40194"
                     /product="sphingoid long chain base kinase 5"
                     /transcript_id="XM_022819483.1"
                     /db_xref="GeneID:34716186"
     CDS             complement(449347..451116)
                     /gene="LCB5"
                     /locus_tag="KLMA_40194"
                     /codon_start=1
                     /product="sphingoid long chain base kinase 5"
                     /protein_id="XP_022676044.1"
                     /db_xref="GeneID:34716186"
                     /translation="MSKIGRSRYQVVYTRAVIGENGLLIKDQCSGPSRHSPGFVDNGR
                     YNGGAGSGAGSGAGAYNDDDDDDDDDSPSLQSSSVFETTSLISCVTCISDVESRDENE
                     SLLLPSNTVIPYAKILDVSNVDDADLGGGSGVGGVANESPWPEHTALIEVTFAKPRRN
                     YLVPKKIKLRVDTSTLPNMGTDIAEEILNRSYKNTKRKKSILVIVNPHGGKGKANKLF
                     LSKAQPLLVASGCKVVVKETTYHLHAVDIAKNIDIDEYDVIACASGDGIPHEVMNGLF
                     MRPDRVKAFQKLAITQLPCGSGNAMSISCHGTSNPSYAALALLKSVEARVDVMCCSQP
                     SYANQPRLSFLSQTYGIIAESDINTEFIRFLGPARFELGVTLNVLQRKKYPCDIYVKY
                     AAKSKNDLKDHYLEHKDRLNNLKNDLEAVSGSTLDVPSLSKNSNLDDVVLTDDSFKLK
                     WPLSDDVPEDWERIDPALTHNLGILYTGKMPYIAPDTKFFPAALPDDGTMDFVLTDSR
                     TPLTRIAPILMSLDRGTHVLQPEVEHSKILAFKLIPYAKNSVISVDGENFPYETLQVE
                     VLPKLVKTLLKNGSYVETDFESM"
     gene            <453465..>457346
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_40195"
                     /db_xref="GeneID:34716187"
     mRNA            <453465..>457346
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_40195"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819484.1"
                     /db_xref="GeneID:34716187"
     CDS             453465..457346
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_40195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676045.1"
                     /db_xref="GeneID:34716187"
                     /translation="MLDTGAQISVVTDLKLLHNYTSNITRNITAANMGTLNTMGEGIL
                     ILRLSNNVVVQFPAVYSEETPSNILSVMQLTAKQKITVDFYQRKMLVQDHNINIDIIH
                     RNGFYWLSSEYLVLNETNIHSPADDDSPVSISLCHIRENTVPKKKWSLEFIHNLLAHV
                     NIKQIRKSISNGDIRFIKLEDIDWSDMNSFTCQYCNIGKGKFHDHFTDSRDVYMKKFK
                     KFEYLHTDIMGPFREDNTIPPNYLITFSDEVTKYRWIFPMSLASEHQVSAIMRKLISN
                     IRTQQGVRVKEILMDQGSQYTGRMVRDLLDEFGIEGKYTSTGDKRSNGVAERLNRTLL
                     DDARTLLASANLPEFLWYDAAEFAVIVRNSMHMRKLDGSPNMAAGLGGIAINKILPFG
                     QPVVVYYNTGKKTLPRGKIVYALHPAKQSDGYTFYDPSSKQTMETTNYKIINTIQGDY
                     LNSEENLDTLNQVDDIVRQRSNDPSTDSQRHITHRNQREQDYISQERDPTDEPQQPES
                     DSTETHGNYLRTHKNEFQKGIATHTLGKDSRYPVRNSSDVPSQSPQEVQETLPVALSP
                     ASPPNNIFISQERLMEEEARSVKHPTKHVPAENGKRPAQRDELGVSTKRPNTKASPEQ
                     CSPIPEHLSHNDDTTDTSSLNEEERRSLYDKLSAKYRDSSIELQSTDSLYGGGGSDIG
                     DLSNPDKQIMGIISCTKTELKINDSKSDQNHEHQIDAIVNMLIQENPVQTYDNIKHEN
                     RVKIPLVNSLKMVRSLPNTKIDRSLSYSQAITKNSNHQEREAFKEAYDSEIAQLMRRG
                     TWDTTEVDIKSIEPHKLLNTMFIFTTKRDGRKKCRLVVRGDLQHWSTYEKHLESNTIH
                     HYALMTILSVALEENMIVKQLDITAAYLYADLKEELYIRTPPHMKMPNKAFRLRKSLY
                     GLKQSDANWYGTITSFLKERCGLKEDKIWSCVFTKEPPLSIIVCIFVDDIIVTGKDTQ
                     EIERFLEQLRSTYETKLVHDGKMGEDGTARYDILGLDLEYKRNGYMKFGMLDILSHKL
                     PLLNLPLREGSRYNQAPVSSSSEPPKVDKNLYVTEKDYKSNVKKLQQVVGLLSYVAHK
                     FRFEALYHVNVLAQYQLYPTDEVMKWANESVQYFWNTKEKRLVWTKNKTPVDYEFTII
                     SDASDRCEPEGKSRLGWFYEIYGHKISARSTKSSYVCDSSTGAEICAMKEATKFDFAI
                     SALLFTLTGKRPRVRLLSDNKPALGRITNPNSTVSPFKPTFTRTMELREKHNEGLCDF
                     TYIPTEQNVADILTKVLSAKRFNRLTNGWLI"
     gene            <457883..>459223
                     /gene="PTI1"
                     /locus_tag="KLMA_40196"
                     /db_xref="GeneID:34716188"
     mRNA            <457883..>459223
                     /gene="PTI1"
                     /locus_tag="KLMA_40196"
                     /product="protein PTI1"
                     /transcript_id="XM_022819486.1"
                     /db_xref="GeneID:34716188"
     CDS             457883..459223
                     /gene="PTI1"
                     /locus_tag="KLMA_40196"
                     /codon_start=1
                     /product="protein PTI1"
                     /protein_id="XP_022676046.1"
                     /db_xref="GeneID:34716188"
                     /translation="MHDSQNDPRSRKSRHELTPANLSSTIHFTEIPLHWNKATFTSVV
                     TGSGFIVSVNLKYFKNEEVDSENENGNGNDIDASKNADDGEGEGQGDRTGIEWIDVDY
                     RNASTANRALNSLNKIRNFPCKMSVIIPEKWEAKMEREAELKPMEFTRDSFPWNDRLE
                     LPFEMVSEVPLPRRPAPVVQTTASTGDSSSSSTTSTTTSQNNTASTNAASDNLASKAN
                     ETPANQIQFPDILARASKHLPAYQPGSMTAPDIVSQNLSKIPTLQMIEILSNLKILAN
                     QQNKMPQLEQFLKTNIDLTVAVTQAMLEMGLINYHVTTNVLQSMSHAPLQSPPPPPPV
                     PAQPQPQPQPQQMMMHPTDSNSNNNANQTPILEQAVPVQPVASMPAPALAPAPAPAPA
                     PATGPRFNEQKLALLPQDQQNMIRTALQMSINNIAALPPDQQKLIQQLRNDYLL"
     gene            <459999..>461417
                     /gene="UGA1"
                     /locus_tag="KLMA_40198"
                     /db_xref="GeneID:34716189"
     mRNA            <459999..>461417
                     /gene="UGA1"
                     /locus_tag="KLMA_40198"
                     /product="4-aminobutyrate aminotransferase"
                     /transcript_id="XM_022819487.1"
                     /db_xref="GeneID:34716189"
     CDS             459999..461417
                     /gene="UGA1"
                     /locus_tag="KLMA_40198"
                     /codon_start=1
                     /product="4-aminobutyrate aminotransferase"
                     /protein_id="XP_022676047.1"
                     /db_xref="GeneID:34716189"
                     /translation="MSIAAKYYPNEPVEPKVQTTEIPGPVSKAKIASLGKVFDSRPAY
                     FVADYSKSVGNYIVDVDGNEYLDLYAQISSIALGYNNPALIEAAKSDKMIRALVDRPA
                     LGNFPGSDLEDILKQLLKFAPKGQDKVWNGLSGADANELAFKAAFMYYRQLQRGGHGA
                     EFSEEETSTVMKNSTPGSPDLAVLSFKRAFHGRLFASGSSTCSKPIHKLDFPAFNWPH
                     AEYPSYKYPLTSYEEENKKEDDRCLAIVEDLIKSWPTPVAALIIEPIQSEGGDNHASK
                     YFLQSLRDLTLKYNVVYIIDEVQTGVGATGKLWCHEWADIQPPVDLVTFSKKFQSAGY
                     WFHDERFIPNKAYRQFNTWCGDPARMIIAGAIGQEVVDNKLVDQCARVGDYLFAKLEK
                     LQEKYPTKFGNLRGKNRGTFIAWDLESPAQRDQLLKILKSNGCNVGGCAEKSVRLRPS
                     LTFEEKHADIFVNALVKSVEQL"
     gene            <461794..>462330
                     /locus_tag="KLMA_40199"
                     /db_xref="GeneID:34716190"
     mRNA            <461794..>462330
                     /locus_tag="KLMA_40199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819488.1"
                     /db_xref="GeneID:34716190"
     CDS             461794..462330
                     /locus_tag="KLMA_40199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676048.1"
                     /db_xref="GeneID:34716190"
                     /translation="MTNYPDVAAWDLDYTVWPCYCDTHITPPLRPEVNSDGQVLEIVD
                     ARGYKVALYKEIPRIMEDLKMHGVKLLSASRTWAPDIAIEMLKVFKIKVNGELVTLFS
                     LFDDLNWGDHSKVNHIRSGVKHVYGNDNLKSLKICLFDDESRNRDVERYGVKYLHIKD
                     PVQGPDWKMYESYLASLK"
     gene            complement(462462..462533)
                     /locus_tag="KLMA_R410"
                     /db_xref="GeneID:34718708"
     tRNA            complement(462462..462533)
                     /locus_tag="KLMA_R410"
                     /product="tRNA-His"
                     /db_xref="GeneID:34718708"
     gene            complement(<463228..>464037)
                     /locus_tag="KLMA_40200"
                     /db_xref="GeneID:34716191"
     mRNA            complement(<463228..>464037)
                     /locus_tag="KLMA_40200"
                     /product="probable inorganic polyphosphate/ATP-NAD kinase"
                     /transcript_id="XM_022819489.1"
                     /db_xref="GeneID:34716191"
     CDS             complement(463228..464037)
                     /locus_tag="KLMA_40200"
                     /codon_start=1
                     /product="probable inorganic polyphosphate/ATP-NAD kinase"
                     /protein_id="XP_022676049.1"
                     /db_xref="GeneID:34716191"
                     /translation="MLAILCLLFTLNPFWAAAQNTNGHVGPVSISSLGLKDFFDCLRK
                     YHDFKTDIGYKTGRTGIIVNLSLDELGTRTNDAVQDCYRANEFGLLQMDYIMFVGNVS
                     GNFTPIAAANTDSTIIFSMMTDVQLPVGEEWRGNGVMGNSTEDTLTRRANSNMVIKFI
                     KSAWQDQTTSDTVTNVCNSRYKATGSISMSTSTTGIHHATAWSHHQCQKKGRDDYKGE
                     TEVNYRNTQYWVYSYENYWLYAGAMSPGILGDYWGQGATQAVCGYWNDCSD"
     gene            complement(<468158..>469036)
                     /locus_tag="KLMA_40201"
                     /db_xref="GeneID:34716192"
     mRNA            complement(<468158..>469036)
                     /locus_tag="KLMA_40201"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819490.1"
                     /db_xref="GeneID:34716192"
     CDS             complement(468158..469036)
                     /locus_tag="KLMA_40201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676050.1"
                     /db_xref="GeneID:34716192"
                     /translation="MMTIKQSNLVLPPISSILPPQYFSNDMVAQPPSPSQSCPSPSAS
                     TSIAYLNVNQFNSPEQYSNLTQRYTTNNATYNISSNNSSSGSTYSVTNFVSADEQQGL
                     DPNTVSRRGSAFNNDLNGMTAGRVHTLGQYNGSYNSVSLSHPQIPSAMVQSSPPTALS
                     TIVPTRRNSMYQLPPPPTPPSIHASHQPTYQEHIQNHNQQDNHHHLHHHHNGHTLSGK
                     GNRSIGRSHVCEQCGKQFTRPSALRTHMLVHSGAKPFKCTWDDCNKTFNVKSNLIRHL
                     KLHKERSSKVPSQSPK"
     gene            <473575..>476826
                     /gene="ENA5"
                     /locus_tag="KLMA_40202"
                     /db_xref="GeneID:34716193"
     mRNA            <473575..>476826
                     /gene="ENA5"
                     /locus_tag="KLMA_40202"
                     /product="sodium transport ATPase 5"
                     /transcript_id="XM_022819491.1"
                     /db_xref="GeneID:34716193"
     CDS             473575..476826
                     /gene="ENA5"
                     /locus_tag="KLMA_40202"
                     /codon_start=1
                     /product="sodium transport ATPase 5"
                     /protein_id="XP_022676051.1"
                     /db_xref="GeneID:34716193"
                     /translation="MGSTKSREIPANSPYAKTDFHAMPIEQVEKVLSTHVHTGLNATQ
                     IAERLALIGENTLGDDSKIDIKSILISQICNAMIMVLLISMVIALAIKDWISGGVIAF
                     VVGVNVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSKELVPGDICIIKVG
                     DTIPADLRLIDSINLETDEALLTGESLPVAKEHSEVYEVDTPVGDRLNLAFASSTVTK
                     GRATGIVIKTALNTEIGKIAKSLKSEKSLVSRDESKSFTQNLCATLKQSAGTFLGTNV
                     GTPLHRTLSKLALLLFAIAVVFAIVVMATQKFHVNKEVAIYAICVALSMIPSSLVVVL
                     TITMSAGAKVMSTRNVLVRKLDSLEALGAVSDICSDKTGTLTQGKMIAKQIWIPQFGT
                     ISVQNSNEPFNPTIGDIHLIPRFSPYQYKHDDQEDVGIITDFKERYLSNNLGQLNVKL
                     FGEWLYAATLANIANVFVDSETKEWKAQGDPTEIAIQVFATRMDLPRHVLTGEEIEDN
                     ETSNKKFNYKHLAEYPFDSSVKRMSAVYENSEDPESPVYEVFTKGAFERVLDCCNSWY
                     KSPNGPPQPLSDDDLDDIMKNVDSLSNEGLRVLAFAKKSYGKAEFVENKQQLLKERDF
                     VEKDLVFLGLIGIYDPPRDESHSAVKRCHQAGINVHMLTGDFPGTAKAIAQEVGILPH
                     NLYHYPKEVVDVMVMTASDFDALTDDEIDLLPVLPLVIARCAPQTKVRMIEALHRRNK
                     FCAMTGDGVNDSPSLKIADVGIAMGINGSDVAKDAADIVLSDDNFASILNAVEEGRRM
                     SENIQKFVLQLLAENVAQAIYLMVGLCFIDRDGVSVFPLAPVEVLWIIVVTSCFPAMG
                     LGLEKASVDVMEKPPKDAKAVVFTWEVIVDMIVYGLIMAACCMVCFVTVLHGTGDGEL
                     GTNCNSDFNSTCHLVFKSRAAAFATMTWCALILAWEVVDMRRSFFMMNPESETPYTQV
                     FKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKKVFLHYNISYEWGFAVGYTVLFWISC
                     EVYKYIKRRYYRNKDRVNNPENDLEQRRMHDPFEQYTSSFSRMNTFHNDEKTF"
     gene            <478263..>481064
                     /locus_tag="KLMA_40204"
                     /db_xref="GeneID:34716194"
     mRNA            <478263..>481064
                     /locus_tag="KLMA_40204"
                     /product="transcriptional regulatory protein UME6"
                     /transcript_id="XM_022819492.1"
                     /db_xref="GeneID:34716194"
     CDS             478263..481064
                     /locus_tag="KLMA_40204"
                     /codon_start=1
                     /product="transcriptional regulatory protein UME6"
                     /protein_id="XP_022676052.1"
                     /db_xref="GeneID:34716194"
                     /translation="MQGEPLGHHAHNGTGPASMPALDRGLANSHNMTMNMNMDMNLDS
                     LDSVSPPPRYPVERKTNAAAQVHALTAQRAVVENDEKQLQLQMQMEGRMGVEKEWEKS
                     KTLQTTSLPWNDTRHSMSGEHVQASVQAQTGKRDEETPSAAATTTKTTTTTNNNTLLQ
                     PRLNPLIHLAMSHIPAPNNTPVEAADMTPLSGNAYGDSARNPEPLASTNGNDSAGSNN
                     QNMAGRLAARGHELQEKNMSSEAGSASTSTASAAHGSSVTDGKGLSATDGLSGGSGHK
                     VRVSGNIVGSVVSGAYENTRSPVLLFNSENGSGNNIQRSGGADRVGGTAAAAATGTTT
                     SSTNGHVGPTTSTSSSPPNTTSAATATAATASNGNSKGNINATKTDAAAADRNNGNTA
                     SSSSAPAQGPAVVVPSISSSVFGTQGDPNSTDRDIHAGSNAMTPRRLHFDSSTEKIDP
                     GAGISSISAQKINITSLLNSRSTAESISPPPSAVDHEYSINFPSSAASNTHSSGSFLQ
                     PKYPQHQHQQQHQQHPRLASAMNRMVSPNYLFETEQTQNAFGNIPSASAQSNANANSG
                     SGGSTIQGASITYQPKYFNTKFDELRNRVLLGSSTGFPKLDATHKYPYSNSIPGSGSN
                     SNSNPMSISNPNAHNEQDSNVDAEAAAIISQMRSSPLPAFNEHFGPGTHGSRPNSSLS
                     NQSLQNGSYNQFNKRLLPKPVLRVNQRQFPNNNSQDENAIAEEDDDDDDDDDDEYHEG
                     GYANSQNGGTNVSDTVAWNKNGKRRLSRRKSGPPHYNSQLKGAKQEHVQFLSADISED
                     NVHFKRSRSSSLSLEPTGLLSPNSKRAKQLKFKESNYNNDVSNEEMVKSSDQIKKRNA
                     TGARSRTGCWICRLRKKKCTEEKPQCQNCVRLHLECFYDIVKPDFISDPAKKAAKLDE
                     IKKKTKEAKRQAMKKKTWL"
     gene            complement(<481835..>484714)
                     /gene="EBS1"
                     /locus_tag="KLMA_40205"
                     /db_xref="GeneID:34716195"
     mRNA            complement(<481835..>484714)
                     /gene="EBS1"
                     /locus_tag="KLMA_40205"
                     /product="protein EBS1"
                     /transcript_id="XM_022819493.1"
                     /db_xref="GeneID:34716195"
     CDS             complement(481835..484714)
                     /gene="EBS1"
                     /locus_tag="KLMA_40205"
                     /codon_start=1
                     /product="protein EBS1"
                     /protein_id="XP_022676053.1"
                     /db_xref="GeneID:34716195"
                     /translation="MNGDTSSSSSPSSSYSQSPNGSATMTTATTMGATPKSELQQTFV
                     GFQKQLQSVLEIDFFRDDSLVKGALQMIHSKIGQMLVQALVPGPSGSNGSSGSAGTAG
                     SQAGSGPEIVSSDAHVVLDLTWKHVHYPIFKYFQNWRSRNVAEGSRPNYAGHRQLNSV
                     LQKIYPHINRLYQSHVELIFAHYDLAELVPSDTKSKLIVSSGAQEEAQAQAQAQAQAL
                     GALAQGITALKAKDPFSIDCVMALQRCLLYIGCAQRYKIMMEHLSDKYQQADFQKPFK
                     YFDIAFTIVPSVGETFLQRGICYTHTKNFGNAAYQFVRSSLSRIPSDAGVPNFKNLLG
                     DSNGSLFKKLLVSLDDLKVQETIKKRIINMEIMEFYILPLIGSYIFPQTWKSNRHSDR
                     LKHFQTLLFDKIEIRYIKNISMIFQDLILLIGSFHINQMINPATSSAPVSALNDRKVV
                     NGNGSTNNNNNNNNNNISHSSENKLLEFIFKFFTHLIDKVIMKEFKNSEMFQYLAMVR
                     IMMCWIKSHKNVLRFAHRYNPFCQSMANLTNELLACNEWSIDFENLHRPTRSYFYEED
                     IMLKEFSPVKFNLSDFNDEKLLTMDNLPDRLAGKTKSKPRAKEEHLSRVQVVVYSNKK
                     FLEKNCCGFKLDAEKKRYTHTAVKRGKANNNNSNSNNNNNNNNTVPNFSKSESAGKNF
                     TVDGNNSETKSFPQKNGFSVAFTSRDNGVNPPTNTVEISTTPNYGAETHETVIPNNVW
                     NYSGSSVPQAPMTFNVAPSFSVSTVIERHETERTFNMYNKTELSTASNSTCNSNGSVT
                     SHFSPMNSQNISSNPLSSTNTNSSSLDSRENSSGPSETQKLNVQNLSTFNNYLQNTSH
                     DSHISIFARDNVVMSSQASNSAGLYEQAHQRTYMGSQYAQFHNPFNSFPSQFDHLHNA
                     ETQPQNPMMARRDSQFFPNNGSMQGDHLPSMAQKVDDQFNFFFYT"
     gene            <486381..>488387
                     /gene="TOP3"
                     /locus_tag="KLMA_40206"
                     /db_xref="GeneID:34716196"
     mRNA            <486381..>488387
                     /gene="TOP3"
                     /locus_tag="KLMA_40206"
                     /product="DNA topoisomerase 3"
                     /transcript_id="XM_022819494.1"
                     /db_xref="GeneID:34716196"
     CDS             486381..488387
                     /gene="TOP3"
                     /locus_tag="KLMA_40206"
                     /codon_start=1
                     /product="DNA topoisomerase 3"
                     /protein_id="XP_022676054.1"
                     /db_xref="GeneID:34716196"
                     /translation="MVKVLCVAEKNSIAKNVAQILSGGRSTMRPSTSPYIKNYDFQYD
                     FQWLNMGRCNVTMTAVAGHLMNLAFPQREFGWGKCDPNALFDAPTIDEMDDKIVKNLQ
                     NEGRHATHLMIWTDCDREGECIGWEIVQAVGRSNPRLVSQGQGQGYGQSSAIYRAVFS
                     HLDPSHIIYAANNPRSLDQRQVDAVRARQEIDLRAGLAFTRLLTGSYRSLLQSDHEYI
                     QLAKKSDKPIISYGTCQFPTLGFVVDRYERVVNFVPEQFWHITLSVKDTDGSDSKVKF
                     QWERGHLFDRLAVLTIYESCIEKSEDKAKVIHVSSRETKKYRPLPLTTVELQKNCSRF
                     FKLSAKKTLDAAEKLYQQGFISYPRTETDKFPTKTDLKSLLAKHKDHSEWGSYVENLL
                     DENSQSTNKFQWPRAGSHDDQAHPPIHPILCVDISRSDNRMSSDEKTVYNYVVKHFLA
                     CCSTDARGRSTTLRLNWGDETFYANGIQVLERNFLDIYQWADWKSNDTLPAFQMNDQV
                     IVSKTEMKSGQTSPPKHMTESELIMLMDANGIGTDATIADHIEKIKSRNYIKVQAGSG
                     SGAKKSNAVFIPTSLGRSLVHGFEKIGLEESFSKPFLRRDLEQDLQRICGGSKEKKEV
                     VSMIIEMYRNYYQITTNQMGNLIKVYNDIKAESQAHIAQRNRAS"
     gene            complement(<488569..>490704)
                     /gene="MSC2"
                     /locus_tag="KLMA_40207"
                     /db_xref="GeneID:34716197"
     mRNA            complement(<488569..>490704)
                     /gene="MSC2"
                     /locus_tag="KLMA_40207"
                     /product="probable zinc transporter MSC2"
                     /transcript_id="XM_022819495.1"
                     /db_xref="GeneID:34716197"
     CDS             complement(488569..490704)
                     /gene="MSC2"
                     /locus_tag="KLMA_40207"
                     /codon_start=1
                     /product="probable zinc transporter MSC2"
                     /protein_id="XP_022676055.1"
                     /db_xref="GeneID:34716197"
                     /translation="MPQSTTSQSKANRLLSQIPLTLLYPTLLLSNNLILTVHENILDQ
                     SDSHVPLLIQYLVLPTFASSLITLCCQYLRTFNNHGLTLLILFLVMLLNLFLGPVEAS
                     TLSVLLLQLVTATDYNLWKYSILPLLSIGIDYYDNSLSFTTILSYVLLLSILVLQKRS
                     KRSLNFLDHIKVPKWALFLTSMISLAIMYMWVHLSKENQTEITKINYSMLFVFLGCAI
                     VLLLVCHDIKSTLGNEPLARVWQNQYSATIIGTMAMILKYLSFNSISSSLISDILTIL
                     FIVSSAVLTRHIEYDSLSRFIKTDEEVDKHCEHHSHTHSNSVHQHSHDGSIDGLVEKE
                     FLTTSSLLMELVTNKETKSIFSFLLLNTAFMFVQLLYSFRSHSLGLLSDSLHMALDCT
                     SLFLGLLAGVLSKHSASDEFPFALGYLETLAGFTNGVLLIGIVMEIFIESVQRIFNPV
                     TILGTTELLVVSVLGLLVNVVGLFAFDHGHAHSHDHDSNDNMRGIFLHVLADTLGSVG
                     VIVSTLLTKIFKLQIFDPIASFFIAVLILLSSLPLLKSTGSSMLLKVDDKKHALLKNV
                     LNQISTTPGVTGYTTPRFWPESSSSSGHSHGHSHGHSHSHVHEPSNETSHSHSHHGPD
                     EKKDSHTHSHLHDTQNGQVTNSGKPSKTILVGYIHIQYADGENSTIIKKRVERVFENA
                     NIKVWIQVESQNSACWCRATSLKDQAIVM"
     gene            complement(<491328..>492050)
                     /locus_tag="KLMA_40208"
                     /db_xref="GeneID:34716198"
     mRNA            complement(<491328..>492050)
                     /locus_tag="KLMA_40208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819497.1"
                     /db_xref="GeneID:34716198"
     CDS             complement(491328..492050)
                     /locus_tag="KLMA_40208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676056.1"
                     /db_xref="GeneID:34716198"
                     /translation="MSFKTVSSKVAATIDQELMGPVGFTLQQLMELAGLSVAQAVLHQ
                     FPVQPSKNQVLVISGPGNNGGDGLVCARHLKLFGYEPVVYYPKRSGREEFYGQLVKQL
                     EFFNVPVLGQGPDEGKWVEYLEHEKTVCVVDSMFGFSFHPPLREPFNDILSRLKKLEN
                     KVPIVAVDVPSGWDVDNGPVDEKSIQPNTLVSLTVPKPCAKFLKPEANHYVGGRFVPK
                     HFAQKYGFEPFEYQGGSQVLKL"
     gene            complement(<492384..>493514)
                     /gene="GCR2"
                     /locus_tag="KLMA_40209"
                     /db_xref="GeneID:34716199"
     mRNA            complement(<492384..>493514)
                     /gene="GCR2"
                     /locus_tag="KLMA_40209"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819498.1"
                     /db_xref="GeneID:34716199"
     CDS             complement(492384..493514)
                     /gene="GCR2"
                     /locus_tag="KLMA_40209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676057.1"
                     /db_xref="GeneID:34716199"
                     /translation="MSEIGSTEHSSPTGIMHHQGKLDVFLIRGYQLISNGEVLNLSEL
                     LSSSINANQQSPISMKRLDNRHLEYFQKLSQLYNALVSVVPLDEQSSVPKSNIELFQR
                     FQQILKEILLSYEESPYNRYFLRLDEQSWKIRDDVEDPLWQILTLNIDKVYDRKTGTI
                     GPLRQRKSTTTSARESPVLAPRRKSAITSPGFTLAQVDNKLEQVGRGQDQDYYTNIQT
                     SAHHTPNGQFEWPSAMAISNNVSKIIEKSNSEGQTTRKRPRIYGDVNSREEEVVEELL
                     QLRNPQGTNHSQPTSTATAPPTVAPMNSLEDSHQKKGQQHTTPDVTISAYERLLKEKD
                     QRISILQNDLEQQRKEIIWLKKLLMEDMKYLRSSLSANTNNR"
     gene            <494319..>495986
                     /gene="SHS1"
                     /locus_tag="KLMA_40210"
                     /db_xref="GeneID:34716200"
     mRNA            <494319..>495986
                     /gene="SHS1"
                     /locus_tag="KLMA_40210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819499.1"
                     /db_xref="GeneID:34716200"
     CDS             494319..495986
                     /gene="SHS1"
                     /locus_tag="KLMA_40210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676058.1"
                     /db_xref="GeneID:34716200"
                     /translation="MSISSASQVLSPNMNYVGTLRRKKEKRGITFSLMLVGASGTGKT
                     TFANNLLESTVFPHRYQQDVPASTNNENVKIVQPTKVVTFNSSNGIPSYMSPFDPASP
                     FLEPGITVTSTALEITTKANDDGDNSVPEKINFFLTDTLGLGENLNNELCFDEIVSYL
                     EQQFDSVLAEETRIRRNPRFQDTRVHVALYFIEPTGHGLRELDVETMKRLSRYTNVLP
                     IISRADSFNPEELKRFKKNIMEDIDRFNVPIYKFEVDENEDDLETIEENRALANIQPF
                     SIICADQRDSVTGKYYRQYPWGKIDIDNENISDLKLLKRVLFGSHLQEFKDTTQNLLY
                     ENYRAEKLASVPSWDIENSTVSDQGAAEDPNTSATNNGNIMNGLTRNSTAPSLSNFAS
                     LINTGKFKSQQSLAVPPQSDTPETPKLNSVDEKDEVSTLPSVNSPRSISAKIQTSPER
                     TKLRNISENVPYMLQHERILARKQKLEELEAQSAKELQKRIQELEKKAIELKMKEKLL
                     RQNSLTHSQSQESINSSATRQQSVSGTVNIKKEETYNDLASIVSKRD"
     gene            complement(<496697..>498745)
                     /gene="WHI3"
                     /locus_tag="KLMA_40211"
                     /db_xref="GeneID:34716201"
     mRNA            complement(<496697..>498745)
                     /gene="WHI3"
                     /locus_tag="KLMA_40211"
                     /product="protein WHI3"
                     /transcript_id="XM_022819500.1"
                     /db_xref="GeneID:34716201"
     CDS             complement(496697..498745)
                     /gene="WHI3"
                     /locus_tag="KLMA_40211"
                     /codon_start=1
                     /product="protein WHI3"
                     /protein_id="XP_022676059.1"
                     /db_xref="GeneID:34716201"
                     /translation="MSITNANVNGMNTNPMMIHPSLDTKYQLHRGFSTSSEQLSTVNP
                     SNGSPTHVNGAAIPRHHSDHSGSPLNLSSVLNTLSINSGNQPQTPSMGIYLLKLRNVP
                     SDINLREAHALFALAHGVLSIDVVPSEDSQPYIVAKFESQHLACQYASILNIKSQIFG
                     PMYPFKVSVEVIDELTNQQLFFQTNSPQLQPQLNTNSFQLPSSGSVSSNVAPTLTSPP
                     QSSSRKRPSLLGQRSRFSFSDPFGNENPPLAPLQATSQTPFQNIDAGKSFLLMEGDGI
                     NDTIWGSNPSLTANVNNIVAGNFNQQAQPQSQQQAQSQQQQQQQQQQQQQAQSQQQQQ
                     QPSQQPQPQSQPQQIVDWSNSKSAGARKTSGSIFAGPQQANASVPALQSTPDGNPQLT
                     VSQQINGRSSASISSKPVTPTSSTSHTPHKSGSRTNINNNPSSGIHNANNSGNINSSS
                     NSNSNSNNNSQSQPIARSVASVLQNTPGISQVDLSLLARVPPPANPADQNPPCNTLYV
                     GNLPPDATEQELRQLFGSQKGFKRLSFRNKNNNNSGHGPMCFVEFEDVAHATRALAEL
                     YGSQLPRPVGAHNTKGGIRLSFSKNPLGVRGPNSRRSGSSGSGQSVSGPNNAQSSNGI
                     STNPSSTSNNNNGSGSSSNIAGSSGNNNNINNGSIPNAANDLTSNSTANYSYLNAFSK
                     "
     gene            complement(<501899..>502747)
                     /locus_tag="KLMA_40212"
                     /db_xref="GeneID:34716202"
     mRNA            complement(<501899..>502747)
                     /locus_tag="KLMA_40212"
                     /product="solute carrier family 2"
                     /transcript_id="XM_022819501.1"
                     /db_xref="GeneID:34716202"
     CDS             complement(501899..502747)
                     /locus_tag="KLMA_40212"
                     /note="facilitated glucose"
                     /codon_start=1
                     /product="solute carrier family 2"
                     /protein_id="XP_022676060.1"
                     /db_xref="GeneID:34716202"
                     /translation="MAKKRLTKSKSLSKSGSCAGAETREEKEKDISAAKSKKHLNSPK
                     REKNRAPKLNECKPLSEKVNVSGTATTSGGKDSIVWRELHFNNDSPTQASLESPFVFK
                     EATKSPRSSVCDMQLNAMFETTTQNKGAFMHATLSSKSMRNDSYVSTMSRRPSRVSSF
                     TSYSSIDNGYEVTYSPMQAFEEAQSPRIVGRDLDLEIEQDQIAFPALSLNERTLLRLK
                     VANLLNFCENGAKKSNETIIGDKPNAARGWDNVPSCCMAYSLQNNNKYPPNEVYEIRE
                     LAMKLK"
     gene            complement(<503337..>506086)
                     /gene="FMP45"
                     /locus_tag="KLMA_40213"
                     /old_locus_tag="KLMA_40214"
                     /db_xref="GeneID:34716203"
     mRNA            complement(join(<503337..505137,505275..>506086))
                     /gene="FMP45"
                     /locus_tag="KLMA_40213"
                     /old_locus_tag="KLMA_40214"
                     /product="MOG interacting and ectopic P-granules protein"
                     /transcript_id="XM_022819502.1"
                     /db_xref="GeneID:34716203"
     CDS             complement(join(503337..505137,505275..506086))
                     /gene="FMP45"
                     /locus_tag="KLMA_40213"
                     /old_locus_tag="KLMA_40214"
                     /codon_start=1
                     /product="MOG interacting and ectopic P-granules protein"
                     /protein_id="XP_022676061.1"
                     /db_xref="GeneID:34716203"
                     /translation="MKFKGLVSSLSFLFLLGSGLLTFFVILSGSKTTGVMRHFYWFEA
                     DTRGFSGAPSTTRWYNYKWCAYENDKVGSCSGKKADMPFSPKDNFGNSPNLPKQFRKH
                     RNTYYYLSRVGWAMLLIGLFFLIIALLPVLLSIFRVGIATVLSTLSVWAALFFITVAA
                     CLYTACYVKGRNAFHDAGRHAKMNKKMFAFLWTSVFLLLLSSLWSLILSTFFGIQKTR
                     QRKEYQYEGNSSRDDSYNVEKGTYDSGVREPYSEKRKWWKPRTKKKANTVVTVVYNNI
                     VNKVKGNDEGSESGKNPENHSTEQNHAHGEQPHDHSQHHNHNHHGHALTDDNDKSHPD
                     TPAKEDSNDHNLGKSHPHNPNPQVGTSTAPDKNSDTKSFSTTRNIGDPTLSRDSNSRA
                     PAPNSTPFGHNKKKEPLQKTDTPTTAQPGHRRKSSFNKQAILATLGLGKSDDEKSKAK
                     KHGGNGPKHDSPKNQVPEKSKQTKPDVPLGGETAGIQSKKNPESAPDANNKDHPDSSQ
                     NPASPSDPTKPPLKGSATENLHNNSEPLNKDPRETVTEPLKVKDDDISAGQGKSKQST
                     LEPKKFAAVNATPALSSEEKRENPHPSQNTSQYVDPKQFDPKVFAVPSDDNKDDAGLH
                     RGEENDAPIVEPVFEPKEPEEEPMEEPMEEPKEEPKEEPKEEPKDENTLDPSKNDSSP
                     SEKPLQHKESNFLDSVMGAVGLGKHHQPSNTEITSQKDGTSPDDYSNVPSKVEKGSLT
                     DKSIADADSEKSHDQMRSHNEIPGTFSSHSKSLVDPSKPTYSTTEHREYTSSGPQGHT
                     RNVSVGDDAPQDAEMSSPHENKTSANDYHYDSSQEAVPRSAQKDQPQEGTDPKEEHQN
                     LIQKMQNQIKSSLR"
     mRNA            complement(<505271..>506086)
                     /gene="FMP45"
                     /locus_tag="KLMA_40213"
                     /old_locus_tag="KLMA_40214"
                     /product="SUR7 family protein FMP45"
                     /transcript_id="XM_022819503.1"
                     /db_xref="GeneID:34716203"
     CDS             complement(505271..506086)
                     /gene="FMP45"
                     /locus_tag="KLMA_40213"
                     /old_locus_tag="KLMA_40214"
                     /codon_start=1
                     /product="SUR7 family protein FMP45"
                     /protein_id="XP_022676062.1"
                     /db_xref="GeneID:34716203"
                     /translation="MKFKGLVSSLSFLFLLGSGLLTFFVILSGSKTTGVMRHFYWFEA
                     DTRGFSGAPSTTRWYNYKWCAYENDKVGSCSGKKADMPFSPKDNFGNSPNLPKQFRKH
                     RNTYYYLSRVGWAMLLIGLFFLIIALLPVLLSIFRVGIATVLSTLSVWAALFFITVAA
                     CLYTACYVKGRNAFHDAGRHAKMNKKMFAFLWTSVFLLLLSSLWSLILSTFFGIQKTR
                     QRKEYQYEGNSSRDDSYNVEKGTYDSGVREPYSEKRKWWKPRTKKKANTVVTV"
     gene            complement(<507472..>510162)
                     /gene="CDC13"
                     /locus_tag="KLMA_40215"
                     /db_xref="GeneID:34716204"
     mRNA            complement(<507472..>510162)
                     /gene="CDC13"
                     /locus_tag="KLMA_40215"
                     /product="cell division control protein 13"
                     /transcript_id="XM_022819504.1"
                     /db_xref="GeneID:34716204"
     CDS             complement(507472..510162)
                     /gene="CDC13"
                     /locus_tag="KLMA_40215"
                     /codon_start=1
                     /product="cell division control protein 13"
                     /protein_id="XP_022676063.1"
                     /db_xref="GeneID:34716204"
                     /translation="MVTHQYEYISGPEHLNHFYQHGSVVSKHIHFVSILDRISYKKDD
                     KCTFYFDNFTKGKRGLNTYIGKINNSNSDCDSLLRMFLPLFLDKLGLSHNDIDFSADF
                     TLDDLSEKRVPIINVKGLFVTAYDKATLKIHELNVIDMKSFVKCFLKKDSLQDNFKLF
                     RPTIDKLLRNLQKREKVESNFKFCEMEIYTDCLRSYFTELISKENNPYPVLNPLFIPQ
                     NSNNDTLNEFDSQANSQSVTDTEHFSEKGISSSNKRDASDDIVGSGSSGRANDQDDSG
                     IESIEDKIYKDGSGEQKRNLTVPSANDIRKPKRIKVTEIGVLKRGHQIPHPHPDISSY
                     QLPFGANSFSEARNDQDIVDNYSFSSATIKPNGISEAKSKRFYRISDCRIVGFTPNQF
                     LDDRLDSLEDNKFQIFIYAKELPPPLPVFIPEYNCYEVTVSNISEFFHNIGIKSYPSS
                     IQNCLSDLKKKINQSFYNITIFKATYSLGPSETVGWVLHSITCKSPTISPPIQPSEQQ
                     NQFPLVHVSDIIASTNSQYYTIFGLAVTVKYDGGKTVVLSFTDFTSNPKVNYGYDSFL
                     GSFHERIPENQHVHALIYLNRVESLNQKLQNVTKMGLIDCADKGNSNITHRSIIFKFS
                     VKCQLFQGKLNTVILDAEPITPKTPLTTEEYKYLKPLRTKVFRRMPSEVLKLYNLTMA
                     RFLPISKYNSNNAEPELHEEQVFVNTNTNAAEKVDYTALIQGETNSDDMEELREKDAM
                     LPIKILGSRNPSSVKISDIKNNRNIDSQDKKINATIMGVTQDRKNVTIYLTDRDYATG
                     MVIEDPYKNLLKIQIWGKQNLEFFFGDSNYMQRIEELRQCIGSTIPFTVIPRILRIND
                     YSYIKIWSPIYTTLESLLIFKSIDFQHDTLKYENSSGNED"
     gene            <510400..>511980
                     /locus_tag="KLMA_40216"
                     /db_xref="GeneID:34716205"
     mRNA            <510400..>511980
                     /locus_tag="KLMA_40216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819505.1"
                     /db_xref="GeneID:34716205"
     CDS             510400..511980
                     /locus_tag="KLMA_40216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676064.1"
                     /db_xref="GeneID:34716205"
                     /translation="MSSSDRRRYPKLKKKGLPEHKELVTQDDWYEEAVKLEDGAERWF
                     LSDIRKTLKGYSEAMVAYERALNAENSNAEDTYNIHYNQTRLLLKIYTDYANVDGYIN
                     LLQYVNLDGLDLSSVITSIETIVTRFETVLQAYPEKVGWDFLFNTLISYYTFIESENN
                     TSGYALISTLEHFISHFHHLINLELELLESEERSDNVDEAFEEAQFQRDNLAEQSKIN
                     LNTGGGIKTREEETAKTELALSTEAFDKEVMTDSLALGYKLVYEVMATICRTENLKDE
                     MLLNIAQKNYLTEMLSKFVPQLDEMAANLEAHHPHNFSELVTIKKSIESLKWIYQRDL
                     ESFLKSLDNSDKEGLMSNVELLELAVETFPPEKSWEIRTHLSKTLANLQNILAKEQSD
                     IITGRIKNKDNELSPIVFKLCDIMINRSDNELYRCMIKKAELDQHAEPHTIKEGHLKT
                     IEILERNATTLLTNAKDIAHRSCGFSEYITDKLKRNYIFGQATLRLQMLESTSTALPE
                     DLEDHPYYQALHSAVIRI"
     gene            <512417..>515470
                     /gene="CHS1"
                     /locus_tag="KLMA_40217"
                     /db_xref="GeneID:34716206"
     mRNA            <512417..>515470
                     /gene="CHS1"
                     /locus_tag="KLMA_40217"
                     /product="chitin synthase 1"
                     /transcript_id="XM_022819506.1"
                     /db_xref="GeneID:34716206"
     CDS             512417..515470
                     /gene="CHS1"
                     /locus_tag="KLMA_40217"
                     /codon_start=1
                     /product="chitin synthase 1"
                     /protein_id="XP_022676065.1"
                     /db_xref="GeneID:34716206"
                     /translation="MSYNYNGHAYYSRAESSDEHYEHQQDTYPMYDRSTHFQGDYTNQ
                     NERELAQEEEPVSQRQPYGSQYTGQYPAADAYEQPGDMQYYEAPAIQVEASSPIADTY
                     NRSFLNPLQGNDQTQFVQPGFNDNRYFDRQSYRDDEVRSSTSATDFYSNQDTRPILNQ
                     PHHLYNFEQQNDPENPVYVDQNGDDYQINTYLNSNGDMVDPFAAGRENEQQEWEQHEY
                     DYDDKDGGSSSISNMNDMATIDGIPTAKKEFDEESTDLGEHASHGIQRRPTVIRKFKL
                     CQGNFIFDCPISTQLLGQYSTGTDKDKLSNEFKFMRYQAVTCEPNEFQHNNFTLRQLM
                     YPYPRVTELMIVITMYNEDDILLGKTLKGVMDNIRHFTSRKNSKIWGPDAWKKICVCV
                     VSDGRSKIHERSLALMSALGCYQDGFAKEAINDKKVVTHVYEHTTKVNISSVSAKNVD
                     LTYGDGTIPIQMVFCLKEKNQKKINSHRWAFEAFAEVLNPNVIVLLDAGTMPGKDSIY
                     ELWKEFKDPQVGGACGEIKADLGRGFTKLLNPLVASQNFEYKMSNILDKTTESNFGFI
                     SVLPGAFSAYRFEALKGEPMRKYFMGDDLNATVFISNMYLAEDRILCFEIVTKANCNW
                     VLRYCRGSYGATDVPERIPEFILQRRRWLNGSFFAALYSFLHFYKIFSSGHSLGRKVA
                     LVCEFIYLLLTTLIAWFSLSSFFLIFRILTLSIAISYPDKRAFSVLSVLFLWLYGLAV
                     LVTFILSLGNKPKGTPTFYLSTFIFFAVLMIYMLVCSIYMSVHSIKHLVDSGQGLTKS
                     STFRDLVISVLSTYACYLLSSIIYLHPMHMLTSLVQYLMLSPSYINVLNIYAFCNVHD
                     ISWGTKGATAKPLGSIQSKDDGTVKMEIPILAHEIDENFNKFVQILTEPKPKEIEAPP
                     SAEESQSSYYAMVRSLVVIFWVISNFLVIAAVLETGGISQYEEIHDLTKDAAASATIK
                     SRKILSSKSTTYCYIILFLVAFTAVFRFIGCSMYCFGRTMRKLTF"
     gene            complement(<516147..>517136)
                     /gene="GAP1"
                     /locus_tag="KLMA_40218"
                     /db_xref="GeneID:34716207"
     mRNA            complement(<516147..>517136)
                     /gene="GAP1"
                     /locus_tag="KLMA_40218"
                     /product="glyceraldehyde-3-phosphate dehydrogenase 1"
                     /transcript_id="XM_022819508.1"
                     /db_xref="GeneID:34716207"
     CDS             complement(516147..517136)
                     /gene="GAP1"
                     /locus_tag="KLMA_40218"
                     /codon_start=1
                     /product="glyceraldehyde-3-phosphate dehydrogenase 1"
                     /protein_id="XP_022676066.1"
                     /db_xref="GeneID:34716207"
                     /translation="MVSIAINGFGRIGRLVLRIALERKNIDVVAINDPFISVDYAAYM
                     FKYDSTHGKYKGEVSHDGSNLIINGKKVAVFQEKDPATLPWGKLGVDIAVDSTGVFKE
                     LDSAQKHIDAGAKKVVITAPSKTAPMFVVGVNEDKYNGEKIVSNASCTTNCLAPIAKI
                     INDEFGIEEGLMTTVHSITATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVL
                     PELQGKLTGMAFRVPTTDVSVVDLTVKLAKAATYDEIKAAVKKVSEGKLKDVVGYTED
                     AVVSSDFLGDTHSTIFDAAAGIQLSPKFVKLVAWYDNEYGYSTRVVDLVEHVA"
     gene            <519483..>520529
                     /gene="ADH2"
                     /locus_tag="KLMA_40220"
                     /db_xref="GeneID:34716208"
     mRNA            <519483..>520529
                     /gene="ADH2"
                     /locus_tag="KLMA_40220"
                     /product="alcohol dehydrogenase 2"
                     /transcript_id="XM_022819509.1"
                     /db_xref="GeneID:34716208"
     CDS             519483..520529
                     /gene="ADH2"
                     /locus_tag="KLMA_40220"
                     /codon_start=1
                     /product="alcohol dehydrogenase 2"
                     /protein_id="XP_022676067.1"
                     /db_xref="GeneID:34716208"
                     /translation="MSIPTTQKGVIFYENGGQLYYKDIPVPKPKSNELLINVKYSGVC
                     HTDLHAWKGDWPLDTKLPLVGGHEGAGVVVAMGDNVKGWKIGDLAGIKWLNGSCMNCE
                     ECELSNESNCPDADLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGVTVY
                     KALKTAAMKAGDWVAISGAAGGLGSLAVQYAKAMGFRVLGIDGGEGKEELFKSLGGEV
                     FIDFTKSKDIVGEVIKATNGGAHGVINVSVSEKAIESSIEYCRSNGTVVLVGLPKDAK
                     CKSDVFNQVVKSIHIVGSYVGNRADTREALDFFCRGLVHAPIKVVGLSTLPEIYEKME
                     QGKILGRYVVDTSK"
     gene            <521070..>521948
                     /gene="MRPS9"
                     /locus_tag="KLMA_40221"
                     /db_xref="GeneID:34716209"
     mRNA            <521070..>521948
                     /gene="MRPS9"
                     /locus_tag="KLMA_40221"
                     /product="40S ribosomal protein S9"
                     /transcript_id="XM_022819510.1"
                     /db_xref="GeneID:34716209"
     CDS             521070..521948
                     /gene="MRPS9"
                     /locus_tag="KLMA_40221"
                     /codon_start=1
                     /product="40S ribosomal protein S9"
                     /protein_id="XP_022676068.1"
                     /db_xref="GeneID:34716209"
                     /translation="MFSRLSAVSLRQGFVVQRRLFSYARPLLNSGSQATANQNTARET
                     NNEYQYSGTRIVPKLSTFYSANPHHEAHIDNLEALMRKYIKYPTVQVEERPMWLSLQE
                     YALIGGGSRLKSTQYKQLLFLLNRLNSIDPQLMVPEISNTLAKYHKKTKLQPQRDTLK
                     ELDEFGRSLAIGRRKTATAKVYVVRGEGQILVNDRALNDYFVKMKDRESIMYPLKAID
                     SVGKYNIFAMVSGGGTTAQAEAIMHAIGKALVTFNPLLKTRLHRSGVLTRDYRHVERK
                     KPGKRKARKMPTWVKR"
     gene            complement(<522136..>522453)
                     /locus_tag="KLMA_40222"
                     /db_xref="GeneID:34716210"
     mRNA            complement(<522136..>522453)
                     /locus_tag="KLMA_40222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819511.1"
                     /db_xref="GeneID:34716210"
     CDS             complement(522136..522453)
                     /locus_tag="KLMA_40222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676069.1"
                     /db_xref="GeneID:34716210"
                     /translation="MDEEKRLKSQLRGKLWFYVESIIKRELPDDVKYTSKFVNTLMEL
                     VYQQICEVGGDLEAFAAHAGRNVVTSEDMLLRTRKNKDLQDFLKLRLLELRESNPARE
                     SKR"
     gene            <522857..>525508
                     /locus_tag="KLMA_40223"
                     /db_xref="GeneID:34716211"
     mRNA            <522857..>525508
                     /locus_tag="KLMA_40223"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819512.1"
                     /db_xref="GeneID:34716211"
     CDS             522857..525508
                     /locus_tag="KLMA_40223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676070.1"
                     /db_xref="GeneID:34716211"
                     /translation="MSKYTLSYGFLPPSNNTDTTHLLPITSITRLDSTVITAGRDGNV
                     IIEESHTKLAVHSDWISGIACLSATKFLTVSHDFTICYNWQTTAWNHRIVGYHDDYVK
                     GIALIGFHDMKCKFATVGLDKKLKIWELDLFEVENEDDEEAKLIGEFDNATKQDAGSI
                     YCVAATESTVIFGDNDGRLRWYDVENNRLIRSLDDAACVNLKTLKILDDNKTVMSTGA
                     DGSVKLWDIETGKCLKTRKLEHAIWSVEGNSSGNLYLGDSAGNILLLCHDKVSFIYEN
                     NQEEKSYRSGGILAMSIIDDEVWFSNSGNSNLNKLNLKTKELKVIQGGHALLRCSLLT
                     NRRHVITENTLGSLQKWDIVSCELVENISKDEGTFDEVVRKRNPKEVLPHWCTVTIKR
                     GILFVKINERFLNTEVYGSALTDYEIVNADKADDINFDERYNLGRIAINSLLHGFIEY
                     ELAKDRKFREEKTAIKKQTPPSTPNILRRHSSMVLEHTGSEHKDKNKEKRRLSIFTKF
                     TQSNNTTPQNSAPNTPNGMMDTHQGIIEENESGAMPMMLPGPATAPNNSIKPIHIPLS
                     RTTTDHSMERSATPSSTFGFHNKVSRMKFDTGSTEDIPSSSSIGNGEVKFKFTSRNFS
                     SGNSAETKKSGLFLNEYIDEVYQSYLRQPPNSSSSFMKFGKRIADTLFIRDSTRPVVK
                     IKSGCILTVNHWREGSTGETISFSTYLPPPTYTSSDLVDNFSTYESLEKHLPIWLGKI
                     LFKEDKVVKNYPKITFIIQPWVDTEFESSEDKEHGSQSKKSGFYRKIKPHESPLMLPK
                     INDANVRLTAAEMIKAKKVKQYIVDRFETRTPEMKNKEDPSDWLEILCKGTVLENDIT
                     LSAIRTLYWKSNTDIVLEYRRKNPVSS"
     gene            <526004..>526651
                     /gene="RPB5"
                     /locus_tag="KLMA_40224"
                     /db_xref="GeneID:34716212"
     mRNA            <526004..>526651
                     /gene="RPB5"
                     /locus_tag="KLMA_40224"
                     /product="DNA-directed RNA polymerases I"
                     /transcript_id="XM_022819513.1"
                     /db_xref="GeneID:34716212"
     CDS             526004..526651
                     /gene="RPB5"
                     /locus_tag="KLMA_40224"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases I"
                     /protein_id="XP_022676071.1"
                     /db_xref="GeneID:34716212"
                     /translation="MDQEQERGISRLWRAFRTVKEMVRDRGYFITQEEIDLSLEDFKV
                     KYCDSMGKPQRKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITE
                     KNFQTGIFIYQSGITPSANKILPTAAPAVIETFPEASLVVNITHHELVPKHIRLSDAE
                     KKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVIKIIRKSETSGRYASYRICL"
     gene            complement(<527082..>527831)
                     /gene="RIB7"
                     /locus_tag="KLMA_40225"
                     /db_xref="GeneID:34716213"
     mRNA            complement(<527082..>527831)
                     /gene="RIB7"
                     /locus_tag="KLMA_40225"
                     /product="5-amino-6-(5-phosphoribosylamino)uracil
                     reductase"
                     /transcript_id="XM_022819514.1"
                     /db_xref="GeneID:34716213"
     CDS             complement(527082..527831)
                     /gene="RIB7"
                     /locus_tag="KLMA_40225"
                     /codon_start=1
                     /product="5-amino-6-(5-phosphoribosylamino)uracil
                     reductase"
                     /protein_id="XP_022676072.1"
                     /db_xref="GeneID:34716213"
                     /translation="MVLLPLKKDLVPFLEPYLPDEERDADKEKPYVILTYAQSLDSRI
                     AKIKGTRTFISHEETKTMTHYLRYKFDAIMLGCGTVLVDDPGLNCKWWPEDEKPEHLA
                     GISPRPIILDPNCKWKFADSKMKKLYEAGDGKAPIIVVKELPSEPEEGVDYLVMRTNF
                     TGKMDWSDMLVQLKSKFNVKSVMVEGGGIVINDLLQRPNLVDALIITLGATFLGSEGV
                     EVSPLVEIKLKDVSWWTGDLDTVLCSRLVTH"
     gene            complement(<528417..>529202)
                     /gene="SPP381"
                     /locus_tag="KLMA_40226"
                     /db_xref="GeneID:34716214"
     mRNA            complement(<528417..>529202)
                     /gene="SPP381"
                     /locus_tag="KLMA_40226"
                     /product="pre-mRNA-splicing factor SPP381"
                     /transcript_id="XM_022819515.1"
                     /db_xref="GeneID:34716214"
     CDS             complement(528417..529202)
                     /gene="SPP381"
                     /locus_tag="KLMA_40226"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor SPP381"
                     /protein_id="XP_022676073.1"
                     /db_xref="GeneID:34716214"
                     /translation="MAKAMAIRHFRGRGADSGQLSRSSSSSASEDEPENHAAEEPHKE
                     PPASSDSSDSDEDSSSSSSDEDSDDGPALVKPVFLKRKRPGPNQGTQDLDDDDNSNAN
                     SNANDNQEPNPTLVRAAHFATATHQEKLLASNTFDTSIAAQVMALDDTDDLDPEQELH
                     DWQQRHHSRIAREREKKLQAQLEIEEQEMRRSTNLSPDAESTTTSTTTTTTAPVPTSS
                     HATTKPLRKPSSNPARLSKSNMQLPNIHTSPSSHHDTEYSYIE"
     gene            complement(<529338..>530333)
                     /locus_tag="KLMA_40227"
                     /db_xref="GeneID:34716215"
     mRNA            complement(<529338..>530333)
                     /locus_tag="KLMA_40227"
                     /product="POU domain-containing protein"
                     /transcript_id="XM_022819516.1"
                     /db_xref="GeneID:34716215"
     CDS             complement(529338..530333)
                     /locus_tag="KLMA_40227"
                     /note="class 3, transcription factor 4"
                     /codon_start=1
                     /product="POU domain-containing protein"
                     /protein_id="XP_022676074.1"
                     /db_xref="GeneID:34716215"
                     /translation="MKLSTLFISLVLALGSVDAHKKHNNGHHKGHRKGGHHHKANLTR
                     EFAAEVARTIVNHGDVLHVSTLREDGYPVTMPEYYVSSDYCKGVESTGNPILVLMNVS
                     STLQHFKDNGKLTMTVEGRKHHAPVMESPRANLFGTLKEVETSDALKACFAKRHPDSA
                     SWLPGTDGLVHDAAFYEFDVEKLYYVGGFGNVAYIGDIDGELYHSSQPLKHGKHHHKG
                     GKAKDESEKEVVEKPKESLAEKLKAWVFASAGETDRYVEQHPFSNEVKNDDETKSEKS
                     VVGKKHKKNKNKGCHGKKKSEAAGAADEASSGSGSGPSSSWESAKALLLDVVNKY"
     gene            <531166..>536505
                     /gene="UTP10"
                     /locus_tag="KLMA_40228"
                     /db_xref="GeneID:34716216"
     mRNA            <531166..>536505
                     /gene="UTP10"
                     /locus_tag="KLMA_40228"
                     /product="U3 small nucleolar RNA-associated protein 10"
                     /transcript_id="XM_022819517.1"
                     /db_xref="GeneID:34716216"
     CDS             531166..536505
                     /gene="UTP10"
                     /locus_tag="KLMA_40228"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 10"
                     /protein_id="XP_022676075.1"
                     /db_xref="GeneID:34716216"
                     /translation="MSSLRDQLAQVAQNNATVALDRKRRQKLHSASLVYNPKTAATQD
                     YEQIYETALESFHSLVELDSRFKVFGNSLFSETSVSIDRNVQTKDQIKDLDNAVNAYL
                     MLVSSRWHLTPALHATEWLIRRFQIHIHNAEMLLLSTLNHYQTPVFKRILNIVKLPAL
                     FNPFSNFVRNDKNPTDLTLIKLFNDMDFLKLYSNYLSKVIKQKVTYTNQLLFTTCCFI
                     NVIAFNATDEDKLNKLVPIILEISAKLLASDSSDCQMAAHTMLAVFATALPLNKNIII
                     AATETILANLKEANVKKSALLTIFKLFQTLKGQGNIDQLPIKIYKLFDNSFTLEYLLD
                     YLNTANKESSSADKFFTAYIRSVIRYDHDKLNKIVKLLRLIKLQKYEVRSIITDLIHL
                     SEVLEDKSQLVEVFEYFISINESLVLKCLQALNLSGEAFEIKLTTSLFSSKDASEQSG
                     EDIMKALDNSKTAANNGANGSTVPFKEFMTKNSEFISTKAESMIVAADEKFVKLLSLF
                     IEAVGKGYQPGLFLSSFFTTLESRITFVLRIVVSPGSPVALRLIALTQLSKFINGIDE
                     QTDIFSFVPILITALSDVSKSVRSNAKKVLQQISKRPFTGKYFLSNKLYGDDQKVPML
                     SPKDSKPWLSNFLNEYIIENTDISSLIIPSKNDMVYMLFWCNQALYVPLAYSKMVLLN
                     VVTSVPQYNSSYSKVFETFMANYISERGVWENKCMKNKTNFKMFEEAVCSIVAPKEKN
                     AFVIDFIINCLESEHEQLSGIMAKKLLAVYPTLKYPNQLKIVQSIIDSSTEKELSYDS
                     IEILQSLPISTDIFVSILKSNTINNDDQTDLTKRRRRRSSTVNKNALQKEDVSQIAEL
                     HLKKITIVLETLDKLKVEGNESLLNSLFTLLSDLETLDHDGGLPVLYAQETLSSCLLN
                     SISSLKVSDGSMKLSSIRADILVAAIRASSSPQMQNKLLLVIGALASISPETILHSVM
                     PIFTFMGAHTIRQDDEFSTLVVERTISTVVPALLKSAKGENKSDEIEFLLMSFATAFP
                     HVPKHRRVRLYSTLVQELGPSTAIAPFSFLIAHQYSSCLEKFKIAESKSYIEFFKTFS
                     GKFDVIDLLHGYNELFSLIELLDYESLHSKSSQTRTLFSNGITNMSKSELFNLKKNAL
                     DFIDKVIGESKSDYYNTSSNLKLRLLGVLIDSTLDDTVKDQLRDTFSTLLGRTLLMIN
                     STDDYAVQKRLSSGKTEDEENSESENEIDHKDLKEVLFNLLSHILELLPIGDFVASTL
                     PLLQGKTDESVRHHLTLVTANKFNEEPIDSFEVANDVLQTLVNIVENEQESTSMLQVT
                     LNTIGSIVSRFGDKLDSSVLMKTMDNACKLLKSGTTEIEISSLTVLATVIQVLGVKTI
                     AFYSKVVPVTIDIFRKIQNTQNELKEQLQLAIILLFTAMIKKIPSFLLSNLQDVFVIL
                     FNSDEVADSVRLSVISLIVEHIPLNDVLKTLQKVWLSDVSKNGDSVAVSLFLSTLEST
                     VEAIDKKHATQQSPVFFRLLLNLFEYRSICDFDENTINRIEASAHHIANMYVLKLNDK
                     VFRPLFALVVNWAFNGEGVTNTDMPKEERLIAFYKFYNKTQENLRSIITSYFTYLLEP
                     TTKLLNQFISGEVKNTNLRRLVLICLTSSFKYDREEYWKSTSRFELVSEALINQLSNI
                     EDVIGKYIVKAIGSLATNNAGVEEHNKIMSDLMISHMKSTCQTREKFWAVRSMKLIYS
                     KVGDGWLVLLPRLVPIIAELLEDEDETVEYEVRSGLVKVVENVLGEPFDRYLS"
     gene            <536872..>537609
                     /gene="GMH1"
                     /locus_tag="KLMA_40229"
                     /db_xref="GeneID:34716217"
     mRNA            <536872..>537609
                     /gene="GMH1"
                     /locus_tag="KLMA_40229"
                     /product="protein GMH1"
                     /transcript_id="XM_022819519.1"
                     /db_xref="GeneID:34716217"
     CDS             536872..537609
                     /gene="GMH1"
                     /locus_tag="KLMA_40229"
                     /codon_start=1
                     /product="protein GMH1"
                     /protein_id="XP_022676076.1"
                     /db_xref="GeneID:34716217"
                     /translation="MSELPRTVRDFQPNHSNGMIPIVIKRLFKSPKNLDFETASWEMI
                     NLVIKPRMAFKSFYYKRQTKESWARDDPSFFILQIGLLTLSSMVWSVVYGHSFGQFLK
                     MMIYMIFIDFFAFGAIMATFFWVILNRPFFKFRSALSARVEWAYCFDVHCNAFLIIWC
                     LLYFLQFLLLPILNLHAWIALLLGNLLFCTAVGYYFILTFYGYSQLPFLKNINFILLP
                     SLLMAILFFVSLFGIKLVDKFSFYNIS"
     gene            complement(<537726..>539210)
                     /locus_tag="KLMA_40230"
                     /db_xref="GeneID:34716218"
     mRNA            complement(<537726..>539210)
                     /locus_tag="KLMA_40230"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819520.1"
                     /db_xref="GeneID:34716218"
     CDS             complement(537726..539210)
                     /locus_tag="KLMA_40230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676077.1"
                     /db_xref="GeneID:34716218"
                     /translation="MTTTTQKKTSFSELSSLLQGSNHTQLRHSRQPSLKTAKSLYTVP
                     EVKAETSGSESNESKQRTNRFQLTNSSHQLLSNIRSKKHSQTQCVIISEQKQERKGSA
                     QFPVNGGVPLRKTFSNPINRFEYQKTYTVRPKSSSTLAIPTVNTLSSKSSEEVEEREE
                     AEEEEDEDAEKEEGDNKGGYLPESSSKPRKLSPSPIPGLQDELQTGKKSNKTFSENYV
                     LQVKFEDSEDKLVVDTHYNSATSSNQSPLTKKVVLEQNMPISRRDSLTLEQFNSDLKS
                     NQPLISQISRTQLKMDQLRSKSSDIRNSIHTADDIISLLNQTANSSLSSNSLSPQKDV
                     WKVTAQGKFWLNSDLSTNLMYQQLNLQYQSIQRLNVNKRRVLVSKLTELLRKLEKKGS
                     HLNQKSSSLSTKQRKEMSPDSTTSLITLENFVSLNALTHLDEFPDIKDERLKAILIEG
                     RKSSGEAWEQCEQREFVSYEPNYSNYSKNSNPASLISNRYSARS"
     gene            complement(<540181..>545124)
                     /gene="SPO14"
                     /locus_tag="KLMA_40231"
                     /db_xref="GeneID:34716219"
     mRNA            complement(<540181..>545124)
                     /gene="SPO14"
                     /locus_tag="KLMA_40231"
                     /product="phospholipase D1"
                     /transcript_id="XM_022819521.1"
                     /db_xref="GeneID:34716219"
     CDS             complement(540181..545124)
                     /gene="SPO14"
                     /locus_tag="KLMA_40231"
                     /codon_start=1
                     /product="phospholipase D1"
                     /protein_id="XP_022676078.1"
                     /db_xref="GeneID:34716219"
                     /translation="MLQEKEGQKRYSNGEVIPGIKDEAGELSMRKNAEEEHPDSGSQL
                     SKAAANNAQNVDKNGDEIRSSSAPLDDQDPLFKGENINQSDFEASVKNLTFMGVPNSS
                     VFEGRTASSDGTHNDPHANAINGHTTDGSNGPKRPNISAINDHSRSHSVSNVNSSSNN
                     SRGFSMSYQDRFWKKEIGQVFRRFSKITTTTNNKGHEQQQTQNEDGAKVDQVLNEHDA
                     YVQSMASDFIDTMLAGAPAALLAGSIFLKDDNGVTRAPLLLTMLSIRISPMQNSTHLH
                     LDIKRRSSITSSVHSDEPMQGGGHHSILGQNLHSRYKLDLEYGLGENRLKWSIIRSYK
                     DIASLHNRLKLISFQQNTVNKLYIDNNRYSELHLPHFPRFDDVFKRKKTDSPERKTKK
                     NTGSVYTPANENFTPRSSTQLSTHRYQSKHLQSLIEEQDDRNKPMHLRIERYLKLLNV
                     VLSLRPQANRLFQFYEMSPIGTLLSYENGYHGKQGYMVVRSTAKAQGWRVSHFKFNDF
                     KAMIERHTTKWFLIRHSYITYVSDIYSTTPLDVFLVDPEFKISCSGYSMKDIEDSFEN
                     PSYHENVKNKISTKLLITVENRERKMQMIVKSEYIMKQWVRSIYEMSKSTVWSQKHRF
                     DSFAPVRKNALCKFLVDGRDYFWSLSEALRMAKDVIFIHDWWLSPELYMRRPVRGNQI
                     HRIDRILKEKAEQNVKIFIVVYRNVGSTVGTDSLWTKHSLLSLHNNIHVIRSPNQWLQ
                     NTYFWAHHEKFVVIDNTVAFIGGIDLCYGRYDTPDHSLHDEETELENQIFPGKDYSNA
                     RVCDFYDLDKPFESMYDRSIVPRMPWHDVQMMTVGEAARDLSRHFVQRWNYLLRQKRP
                     SRPTPLLTPASDLTEEELNNSAFFQDLKPHSTCEIQVVRSAGNWSLGLKKTEHSIQNA
                     YLKLIETSDHYVYIENQFFVTSSSWDGVVIENKIGDALVDRIVKANSEGKAWKAFIVI
                     PLMPGFNAEVDEAEGSSVRVIMQCQYQSISRGETSIFAKLKKLNIDPLQYIQFFSLRK
                     WSTIGVDKKLVTEQLYVHAKVMIVDDRSCIIGSANINERSMLGNRDSEVAVVVRDTEL
                     IKSKMNGEEYLAGRFPWELRQRLMREHLGCDVDMVELIERKFEKLRLTAKQNYETLHT
                     VSEETNTNITEANMIESSMVELAYREILNEKCSRLWEKKHGSSTENYGVINPLENSKD
                     SDDSSEESMQGNKPAPLPEHKGNKYLHIDGKAAYHSFNYRAGEANMGIRDKKNISSDA
                     RLTNNSLHARDVDGHGPDNWKNTNSHPVMYNDVTKQLKAWAEEVLNKNLDENENEKLS
                     TILPDKTNVKAYLDNPNILNVNKWNMLKRICYLQYLSFKKEKDLYEVQKNGEVTIAKQ
                     KSLPSQVANLENEQLDDQMVEGMLQQLLPPIGKQNSSISSVQYIDPYQFDDPLHPSFS
                     QDLWFTIALRNTIIFRMVFHCQPDNSVQTWREYKEFQTFYKEFDMYQDKAILSERKEK
                     GQEPPKIVEDRSAMNTLDNVPDDDISIATTIEKGRTLGEVSAGALGASGDEGECDQID
                     ALAATPEAVPSQSERAGNPSSHPQTPPENTFRMKMNNQLLYGTKDRMFDRRTARKLLE
                     RIHGHLVVFPVDWLCKEVESNNWFYNVDRLPPIDIYD"
     gene            <546919..>548496
                     /gene="GZF3"
                     /locus_tag="KLMA_40232"
                     /db_xref="GeneID:34716220"
     mRNA            <546919..>548496
                     /gene="GZF3"
                     /locus_tag="KLMA_40232"
                     /product="protein GZF3"
                     /transcript_id="XM_022819522.1"
                     /db_xref="GeneID:34716220"
     CDS             546919..548496
                     /gene="GZF3"
                     /locus_tag="KLMA_40232"
                     /codon_start=1
                     /product="protein GZF3"
                     /protein_id="XP_022676079.1"
                     /db_xref="GeneID:34716220"
                     /translation="MTFEEQSSTMVVSKPALLSDVRDQISGDMGESNGSSNTSVAVGS
                     SGGTEKAELYPVISNDSSAGSSRKSGGSGSGNIDDSGKDIKPNNPASNPVCKNCYTST
                     TPLWRRDEHGSVLCNACGLFLKLHGRPRPISLKTDVIKSRNRKSTHHDSPNDKKKKDR
                     EPGSAAVNPAAKKRKTNDSPQYEQIQQLAGQLAKTVTSPTPNGNWQSQQPQQAQQVQQ
                     NSQSAESVDDIKYQKILPKNNQGKGNPLPHLSNILSTPSADYSTPNSPRLSSIQRQAP
                     PLATINEILTNSRNQQGGNSTQLASINSISSNSNNCNNNVGHTEVNQKSLGQLSSIMN
                     NQSLGNPSNGGRNNGNTSTLSPSLLNQQLSQPNQPSQQQQQQQQQQQALLQDKKPLHF
                     SASPPSLEPQQTAAHSTTSSSNSVPFHHQQQQLKQEQQMNMVSDLTHSVNNISANGIT
                     TSSLHFPGSPVIKEEEKPSLSLILQSQEEVIKLKTRISELELVTDLYKRHVFELDSRC
                     KALENELLAVQRQNQNK"
     gene            <549021..>549620
                     /gene="DID2"
                     /locus_tag="KLMA_40233"
                     /db_xref="GeneID:34716221"
     mRNA            <549021..>549620
                     /gene="DID2"
                     /locus_tag="KLMA_40233"
                     /product="vacuolar protein-sorting-associated protein 46"
                     /transcript_id="XM_022819523.1"
                     /db_xref="GeneID:34716221"
     CDS             549021..549620
                     /gene="DID2"
                     /locus_tag="KLMA_40233"
                     /codon_start=1
                     /product="vacuolar protein-sorting-associated protein 46"
                     /protein_id="XP_022676080.1"
                     /db_xref="GeneID:34716221"
                     /translation="MNLENTLFQLKFTAKQLNRQAAKAAKEEKQEINKLKKILNESEE
                     IGKLYASNAIRKRNERVQLLKLASRVDSVASRVQTAVTMRQVSSSMAQVCRGMDKALQ
                     SMNLQQITMVMDKFEQQFEDLDASVNVYEGMGESTDAVVVDGDKVDELLSQVADENGL
                     ELKHSAALSDLPEVKEPSVPVVNEGKEDKLAERLRALRS"
     gene            complement(<549749..>551401)
                     /gene="CCT7"
                     /locus_tag="KLMA_40234"
                     /db_xref="GeneID:34716222"
     mRNA            complement(<549749..>551401)
                     /gene="CCT7"
                     /locus_tag="KLMA_40234"
                     /product="T-complex protein 1 subunit eta"
                     /transcript_id="XM_022819524.1"
                     /db_xref="GeneID:34716222"
     CDS             complement(549749..551401)
                     /gene="CCT7"
                     /locus_tag="KLMA_40234"
                     /codon_start=1
                     /product="T-complex protein 1 subunit eta"
                     /protein_id="XP_022676081.1"
                     /db_xref="GeneID:34716222"
                     /translation="MNFGNQTPTIVVLKEGTDSSQGRGQIISNINACLAIQETLKPTL
                     GPLGSDILIVSSNGKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVT
                     ILAGELMKEAKPFLEEGISSHIIMKGYRKAVDLAVSKIQEIAVDISNENNSRTLLERC
                     ARTAMSSKLINNNADFFVNMCVDAVLCLDQNDLDDKMIGIKKISGGAMEDSLFVDGVA
                     FQKTFSYAGFEQQPKTFKNPKILSLNVELELKAEKDNAEVRVEHVEDYQAIVDAEWQI
                     ILDKLKQIEDTGANIVLSKLPIGDLATQYFADRNIFCAGRVASEDMNRVIQAVGGAVQ
                     STTSDIKPEHLGTCELFEEVQIGSERYNLFKGCPEAKTCTLLLRGGAEQVIAEVERSL
                     HDAIMIVKRALQNKLVVGGGGAIEMEISKYLRDYSKTIAGKQQLIINAFAKALEVIPR
                     QLSENAGFDSVEILNRLRMAHSKGEKWFGVDFDNETIGDNFSKFVWEPALVKINALNS
                     ATEATNLILSVDETIKNKESDSAGASMAPPQGRGRGMPMPMQ"
     gene            551961..552075
                     /locus_tag="KLMA_R411"
                     /db_xref="GeneID:34718709"
     tRNA            join(551961..551997,552031..552075)
                     /locus_tag="KLMA_R411"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34718709"
     gene            complement(<552350..>554479)
                     /gene="MDV1"
                     /locus_tag="KLMA_40235"
                     /db_xref="GeneID:34716223"
     mRNA            complement(<552350..>554479)
                     /gene="MDV1"
                     /locus_tag="KLMA_40235"
                     /product="mitochondrial division protein 1"
                     /transcript_id="XM_022819525.1"
                     /db_xref="GeneID:34716223"
     CDS             complement(552350..554479)
                     /gene="MDV1"
                     /locus_tag="KLMA_40235"
                     /codon_start=1
                     /product="mitochondrial division protein 1"
                     /protein_id="XP_022676082.1"
                     /db_xref="GeneID:34716223"
                     /translation="MTSNTGDQFANLGKALSTTASALFSSQPMEDTILSYSSPYKKLL
                     HQTITNTGGGSSLVKLRNEPRQSKGKNNGFQNIYSTSKGFFQNSFSDSKTTFKVLSYL
                     SDELLEDIPAESSHEERKLITEHGNKKNKKVRSKHDSTLFQGFEASLPVINETIETQK
                     KLIKNDDMKSITESAEMSSSTNEIETEDEEFTLPNHLSTEKLRSTYSTSFLKDAAKSI
                     TDNLDLLEIQKNLASSEIRELDIKLEKLKTMRELVFKRVAKIEQQEMFLEKHLKSVKD
                     RIDMIIEFNMDKEENLTDKEGPNELSELSPPSGETTDSYATAATTPLENKGDDSSVNP
                     LLSKSIYQELKNRESGKNDESLKKHRSTKKLKESSVYNRHRHRKIQPTLQQFYEPGSK
                     IASISKAHEEEIICLDFDVPFGTMCSAGNLDHSIKVWDLSKKKQIASMDGHLASISCM
                     QMDQYSTLITGGRDAVLKLWDIDKAVTESSTDVDDDNDACVYTFDAHVDEITAISFDG
                     DNLVSGSQDRTIRQWDLNNGKCVQTIDLSFATGPMRSQRDSSLYNSILLTKEPPAIGA
                     LQCFDAALATGTKDGIVRLWDLRSGKVVRTLEGHTNAITALQFDSINLVTGSMDRSIR
                     IWDLRTGTLSDVFAYENPVTSLHFDLDRIVIANNEPTVKIYNRKDGNHWFCGDENQDT
                     GNVEFVKYKHGYLVEGRSSGDINTWAI"
     gene            complement(<554813..>555655)
                     /gene="SPC34"
                     /locus_tag="KLMA_40236"
                     /db_xref="GeneID:34716224"
     mRNA            complement(<554813..>555655)
                     /gene="SPC34"
                     /locus_tag="KLMA_40236"
                     /product="DASH complex subunit SPC34"
                     /transcript_id="XM_022819526.1"
                     /db_xref="GeneID:34716224"
     CDS             complement(554813..555655)
                     /gene="SPC34"
                     /locus_tag="KLMA_40236"
                     /codon_start=1
                     /product="DASH complex subunit SPC34"
                     /protein_id="XP_022676083.1"
                     /db_xref="GeneID:34716224"
                     /translation="MSESLDYCLELLTKSAESISTLYFKPPGIFQNAIVPCNSKSYSD
                     LIVKLIRDGDSIEEVSLYNSTNDGNLKRKDGKVGIYDHLLEREASLKRNRTSVLPDSG
                     PITYIPKEFYLNQNDHVIRKKQKTARDFIFDGTHSDELGIYDVLLKKFHKNIQIEQFL
                     YALQNGSVITGEDVSRRKTLFVEDFPVSIILTVFQEIIDQWPLAEYKDRFEKLMSVYN
                     ELQSDISELKDKVKQQESEFQHDPLPGRDSVSSLIEKEESEIKRLEEELEILANKHDV
                     MNTD"
     gene            complement(<555920..>557077)
                     /gene="gcp"
                     /locus_tag="KLMA_40237"
                     /db_xref="GeneID:34716225"
     mRNA            complement(<555920..>557077)
                     /gene="gcp"
                     /locus_tag="KLMA_40237"
                     /product="putative glycoprotein endopeptidase KAE1"
                     /transcript_id="XM_022819527.1"
                     /db_xref="GeneID:34716225"
     CDS             complement(555920..557077)
                     /gene="gcp"
                     /locus_tag="KLMA_40237"
                     /codon_start=1
                     /product="putative glycoprotein endopeptidase KAE1"
                     /protein_id="XP_022676084.1"
                     /db_xref="GeneID:34716225"
                     /translation="MVNLNTIPPRNGRDYYLAIGLEGSANKLGVGIIKHPLLKKHENS
                     DLSHECEVEILSNIRNTYVTPPGEGFLPRDTARHHRNWVVRVIREALDEANISDPSEI
                     DVICFTRGPGMGAPLHSVVIAARTLSLMWDVPLVGVNHCVGHIEMGREITRAKNPVVL
                     YVSGGNTQVIAYSEKRYRIFGETLDIAIGNCLDRFARTLKIPNAPSPGYNIEQLAKQC
                     KNKDKLVELPYTVKGMDLSMSGILQYIDTLAKDLFRNNKKNKILFDQKTGEQLVTVED
                     LCYSLQENLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQEMMAHMCKDRSNGQVH
                     ATDDRFCIDNGVMIAQAGLLEYRMGQIVKDLSETIVTQKFRTDEVYIAWRE"
     gene            complement(557481..557552)
                     /locus_tag="KLMA_R412"
                     /db_xref="GeneID:34718710"
     tRNA            complement(557481..557552)
                     /locus_tag="KLMA_R412"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:34718710"
     gene            complement(557574..557646)
                     /locus_tag="KLMA_R413"
                     /db_xref="GeneID:34718711"
     tRNA            complement(557574..557646)
                     /locus_tag="KLMA_R413"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:34718711"
     gene            558154..558276
                     /locus_tag="KLMA_R414"
                     /db_xref="GeneID:34718712"
     tRNA            join(558154..558187,558239..558276)
                     /locus_tag="KLMA_R414"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718712"
     gene            <558740..>560269
                     /gene="cys2"
                     /locus_tag="KLMA_40238"
                     /db_xref="GeneID:34716226"
     mRNA            <558740..>560269
                     /gene="cys2"
                     /locus_tag="KLMA_40238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819528.1"
                     /db_xref="GeneID:34716226"
     CDS             558740..560269
                     /gene="cys2"
                     /locus_tag="KLMA_40238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676085.1"
                     /db_xref="GeneID:34716226"
                     /translation="MGVALLSTSLRSFGTACSHTRTDWKRCISTAGSPTNPAMQFPCL
                     DRLEQKTAKLRGDDSEKSSQEYKSSSCYMEEDPTSASSKHDPVYGKVKTGFKIFSSDD
                     PIFLDYGGVLPNFKIAYETWGNLKEDKSNAILIHTGLSASSHARSSSLNSKPGWWENF
                     IGPGNPIIDTNKWFVICTNVLGGCYGSTGPSSLDPGDKKPYATRFPMLSIQDMVRAQK
                     RLIDHFGIKTLKASVGSSMGGMQSLAYGQLFPDSVEKIVSVSACAMSHPSSIAMRHAQ
                     RQVLMADPNWNRGFYYPSDEHPNRIPPHVGMKLAREIATVTYRSGPEWESRFGTERLD
                     DDMPPVLCPDFLIETYLDHQGEKFSLEYDANSFLYISKTMDLFSLSYSHKERSEKRRR
                     QTENNFKQGSLPSLKLPDEPYKYRKKRRTTTVEESRADLSKGMEPLQNKEILVIGVKS
                     DSLFPYWQQREIVKLLNGPNDKVKHVELDENASLYGHDTFLLDLDVLGSSIGKFLRDE
                     L"
     gene            complement(<560445..>561293)
                     /locus_tag="KLMA_40239"
                     /db_xref="GeneID:34716227"
     mRNA            complement(<560445..>561293)
                     /locus_tag="KLMA_40239"
                     /product="37S ribosomal protein S28"
                     /transcript_id="XM_022819530.1"
                     /db_xref="GeneID:34716227"
     CDS             complement(560445..561293)
                     /locus_tag="KLMA_40239"
                     /codon_start=1
                     /product="37S ribosomal protein S28"
                     /protein_id="XP_022676086.1"
                     /db_xref="GeneID:34716227"
                     /translation="MNSYIVPMLRTGFVRPLARPFSSTAIASSTKSVKFLKAQRRKQL
                     NEAKQNKIKNSLDDVDPVLGRPDTPFINRVMAELQEPNVLIPGYERSEVEKLLVSIEE
                     TKKTQASLAGLDSLVEDQSIKDLNNKHEAIFRILNMRNASNAEALKMAIKLAREEFQR
                     FPGDTGSSEVQAAVMTVRIQNLAKHVKENKKDFKNIRALRMLVQQRQSILRYLKRDKP
                     DRYFWAIQKLGLSDNAAMSEFNMDRRYMQQYKFFGDVILIKDSNKVADAKRKAARKEK
                     MFSSEQ"
     gene            <562059..>562709
                     /gene="GAR1"
                     /locus_tag="KLMA_40240"
                     /db_xref="GeneID:34716228"
     mRNA            <562059..>562709
                     /gene="GAR1"
                     /locus_tag="KLMA_40240"
                     /product="H/ACA ribonucleoprotein complex subunit 1"
                     /transcript_id="XM_022819531.1"
                     /db_xref="GeneID:34716228"
     CDS             562059..562709
                     /gene="GAR1"
                     /locus_tag="KLMA_40240"
                     /codon_start=1
                     /product="H/ACA ribonucleoprotein complex subunit 1"
                     /protein_id="XP_022676087.1"
                     /db_xref="GeneID:34716228"
                     /translation="MSFRGGNRGGSRGGSRGGFRGNSRGGFGSRGAPMGPPDSVLEMG
                     AFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCSEGVK
                     AESFNEGDKFYIAPDKLLPIERFLPKPKVAGPPKPKRKRSAAPGGRGGSRGGFGGSRG
                     GFGGRGGSRGGFGGGRGGSRGGFGGGRGGSRGGFGGSRGGSRGGFGGRGGSRGGRY"
     gene            complement(<562946..>564037)
                     /locus_tag="KLMA_40241"
                     /db_xref="GeneID:34716229"
     mRNA            complement(<562946..>564037)
                     /locus_tag="KLMA_40241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819532.1"
                     /db_xref="GeneID:34716229"
     CDS             complement(562946..564037)
                     /locus_tag="KLMA_40241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676088.1"
                     /db_xref="GeneID:34716229"
                     /translation="MKQSVRQLLQVDIKSIVKNTKVNSQTSDGVLTPKRQKQVSKENS
                     RKTKGSDKFQTTIKSLYDRYNKHYPEPKRSDLALVNFFFNKAKVQFEWSAPTFNDIPG
                     EKVRRAMEKRQKAAQILLEEEKSYISSKSLASDPNLSMLESEFTHLEHKDQNKLYHGK
                     TEGIPFELINQLPEIAFLGRCNSGKSTLLNNITTEVTRNHLNEYANASKKAGFTKTIN
                     CFNVGKRFRIIDTPGYGTKGTAEQGRLTMDYLQKRRELRRSFLLISANQGFSEYDATM
                     VDLLVSNGIPFEIVLTKMDTVKDMTQVERIIEESNVLNLPTSPRFIFLNSMTNKHCQK
                     RFGIDILRYVILDACGLSPGVKPSKIKKN"
     gene            complement(<564367..>568032)
                     /gene="MSN5"
                     /locus_tag="KLMA_40242"
                     /db_xref="GeneID:34716230"
     mRNA            complement(<564367..>568032)
                     /gene="MSN5"
                     /locus_tag="KLMA_40242"
                     /product="protein MSN5"
                     /transcript_id="XM_022819533.1"
                     /db_xref="GeneID:34716230"
     CDS             complement(564367..568032)
                     /gene="MSN5"
                     /locus_tag="KLMA_40242"
                     /codon_start=1
                     /product="protein MSN5"
                     /protein_id="XP_022676089.1"
                     /db_xref="GeneID:34716230"
                     /translation="MDGLGASQVVTALEVIYDPKTENVKRVEAQKFLDEVKDREESPF
                     WGYEIALNNPQNSILKHFGLGLLVNALKRNWSGYDEEKRLTLRKWIVELNYRVQPNDP
                     RYIKEKLAFLWVEVAKRVWGEALKIEEPSQQQLEESWVDMDRCLTELWQMSEESRELA
                     LIIFRTLFEDTFLLEDVAILKRLPIIQPLCIMIVCPMEMFSAKYKYSGKWELFKSNPK
                     GWFALFSEELNAALDVNNAQYIVRLLETLKSCLNWPLSDVIISNDIFSALLRCLTKDI
                     PKAQSIALDSIHILLTRPYSNTDHYNLIVNRVFDSMTLMDTIYSQLQFDPTEGVDEAK
                     YPIMKKFVDMITCLYTCVLKISDLQNIEAYMKLVLKTTYNPSLIVSGLSLDLWCACLR
                     NDDFLPILDKLVIPDLLEFAGNALIYYEQIDDHVSKNFVEVDFQSTSEYENYCSSYRK
                     RLRDIIRLISCVQLDFAYDWLCERLNKYFSSQYGQQVLSATYLDHKSEPYLSALTQFM
                     IVECFINGCIRWKIWYTDEATFNQKLDVILGKVETLSNQLLALNLREPLLLKKQIQNF
                     ALFLTILKDNVLFTLLEKIITTATLEYPEIDMNEKNQQSDAVRDLRYACGIELNRMAL
                     LMPASLEPIYPDLENVVAGILPKLSSHETISFKSFLLTIVLKSGLPNKEEKFAQLVDP
                     ELAAWSDKGTVVGLTDLPWFLERLGIVKIAEYFQKRNIDENSDLLSIQMDEDGKKLKA
                     DLTQHWQTIFPVRATRMFIHYSMQSVKGNDEFRMLQELWKPRIVPFLPYILRLLYQLQ
                     SYHNPANWTSLPTVVQSFVRVSTVERFWEAGATNKSKDEFIDEHNKALQTVRDFADSV
                     GHIVRYTREYVLLVLASMSGLGTIFFEVNDLANLIMDSIAIYTPDGEISPGVSTHGWK
                     HIINVAVRPMLRNCPDECAPQFMSVFLPKLFKTLDLLLEKRWSAYSQSEVNPPPRDED
                     EMTEEILEENLLRQFTTVVVRLLIDSVGQVGSHAQASKMRVSVHQMKMRKIIFEDINI
                     LAPFLRLLNRLVSVRDSKCSFNSILILKSCLAETLAKDPEVDRFYTTEVVPNLILNVL
                     TQRAFKDSFYEALYAFTVIFLTLSKEFDYFNQYLYDLSRGYNIEELYNTLKQVDNYKD
                     QRVVAAEFIDWMKNIYGDQDDNHFSADQEAKIKQRREAVIARASEQLLGKNKPESNMF
                     EDPNIEGDVLGGLFENN"
     gene            complement(<568606..>569487)
                     /gene="RPF1"
                     /locus_tag="KLMA_40243"
                     /db_xref="GeneID:34716231"
     mRNA            complement(<568606..>569487)
                     /gene="RPF1"
                     /locus_tag="KLMA_40243"
                     /product="ribosome production factor 1"
                     /transcript_id="XM_022819534.1"
                     /db_xref="GeneID:34716231"
     CDS             complement(568606..569487)
                     /gene="RPF1"
                     /locus_tag="KLMA_40243"
                     /codon_start=1
                     /product="ribosome production factor 1"
                     /protein_id="XP_022676090.1"
                     /db_xref="GeneID:34716231"
                     /translation="MAVDEIRIKNKQKRQKLFAELKDQQNKERHTMRRARAKEERENP
                     ELKEKRLAENVPNTIDNLRVYDETMGQDIEGEMDDLSRFFNNGSEPPKILLTTNVNAK
                     KKAYEFANVLIEVFPNVTFVKRKFGYKLKEIAEFCNNRNYTDIVIINEDKKKVTGLTF
                     IHLPDGPTFYFKVSSYVEVEKIVGHGRPTSHIPELILNNFSTRLGKTVGKLFQSIFPK
                     NPDFEGRQVITLHNQRDYIFFRRHRYIFRNEEKVGLQELGPQFTLKLRRLQRGIKEET
                     EWEHKPSMDKEKKKFVL"
     gene            complement(<569972..>574465)
                     /gene="PDR5"
                     /locus_tag="KLMA_40244"
                     /db_xref="GeneID:34716232"
     mRNA            complement(<569972..>574465)
                     /gene="PDR5"
                     /locus_tag="KLMA_40244"
                     /product="ATP-dependent permease PDR15"
                     /transcript_id="XM_022819535.1"
                     /db_xref="GeneID:34716232"
     CDS             complement(569972..574465)
                     /gene="PDR5"
                     /locus_tag="KLMA_40244"
                     /codon_start=1
                     /product="ATP-dependent permease PDR15"
                     /protein_id="XP_022676091.1"
                     /db_xref="GeneID:34716232"
                     /translation="MNFGIKSQSEPSNYQPEYHGFDQQVERQVKELARSLSRASIDKQ
                     RYPAAFNSHISTNDESEHDDNKSITSIFSGVHEGVNPVYLDPSAPGYDARLDPNSEHF
                     SSAAWIKNMVAFSMQDPEYYKHYTIGCCWKDLRAFGDSNDVSYQSTVTTLPGKYLGKI
                     KRHFSATKEEDLFDILKPMDGLVKPGELLVVLGRPGAGCSTLLKTISANVEGYSIDPN
                     STISYNGLDPKVIKKHFRGEVVYNAEGDIHFPHLTVYETLYNVALLATPSNRIKGVSR
                     EEFAKHITEVAMATYGLSHTKNTKVGGDLVRGVSGGERKRVSIAEVTICGSKFQCWDN
                     ATRGLDSATALEFIRALKTSTDISGSTAVIAIYQCSQDTYDLFDKVCVLDEGFQIFFG
                     YAKDAKKYFENMGYVCPPRQTTADFLTSVTNPAERIVNQDYVKEGRFIPSTAKEMEEY
                     WRNSPEYKQLRADIEEELSKDSAKSLQELEESHIARQSDGQRKGSPYIVNYGMQVKYL
                     TLRNILRIRRSYSITLGTIVSNTCMSLILGSAFYKSMKHTTTNTFFFRGAALYISVLF
                     NAFSSMLEIFSLYEARPIIEKHKRYSLYHPSADALASMISELPGKFITAVFFNVILYF
                     MANFRREPGPFFFYFMMNFLSTLVMSSIFRCLGSAAKTLPEAMVPSSVLLLIITLYVG
                     FTIPKKNMLGWSKWLWYINPVSYVFESLMINEFNGRDFPCAVFIPSGPGYENVSATEK
                     VCNTVGSKPGLPYVSGKDFIVQSYGYDPSHRWRGFGIALAYFIFFSAVYLLFCEYNES
                     AVQKGEILVFPKAVLKKAKKEALSRPKSDVETGEDPEGGITDRKLLQDSQEDSNESVD
                     EKQSAIALEKSGAIFHWRNVCYDVQIKKETRRILSNVDGWVKPGTLTALMGSSGAGKT
                     TLLDCLASRVTMGVITGDMFVNGHLRDNSFPRSIGYCQQQDLHLSTATVRESLRFSAY
                     LRQPSSVSIEDKNRYVEHVIRMLGMEKYADAVVGVTGEGLNVEQRKRLTIGVELAARP
                     KLLLFLDEPTSGLDSQTAWSVCQLMRKLADHGQAILCTIHQPSALLMQEFDRLLFLQK
                     GGKTVYFGDLGHGCQTMIDYFERNGAHKCPEGANPAEWMLEVIGAAPGSSTTVDYHEI
                     WRNSEEYRMVQKELDWMEVELAKKPMDTTEEQKEFGTSLPYQFKIVTKRLFQQYWRTP
                     SYIWSKVMLTVLPQILLGFTFFKAKLTLQGLQNQLFAIFTFTIVFSPACEQYLPMFVS
                     QRDLYEARERPSRTFSWLAFIFSQFVVEIPFNVILGTVAFFVFYYPVGFYNNASYAGQ
                     LHERGVLFWLLCIEFYTYISSMGQLCMGGLEHDALAANIASIFFMISLLFSGVFGGPG
                     VLPGFWNFMYRVSPLTYLMDGLISTGIANTKTQCAPYEFVHFSPREGQNCGTYMTPFI
                     KSHGGYLQNPEDNSDCRFCRISESNTFLKNYKSDYREDGGTLVYFLCTSFSTGAAVCS
                     CTG"
     gene            complement(<575958..>580505)
                     /gene="PDR5"
                     /locus_tag="KLMA_40245"
                     /db_xref="GeneID:34716233"
     mRNA            complement(<575958..>580505)
                     /gene="PDR5"
                     /locus_tag="KLMA_40245"
                     /product="pleiotropic drug resistance family protein"
                     /transcript_id="XM_022819536.1"
                     /db_xref="GeneID:34716233"
     CDS             complement(575958..580505)
                     /gene="PDR5"
                     /locus_tag="KLMA_40245"
                     /codon_start=1
                     /product="pleiotropic drug resistance family protein"
                     /protein_id="XP_022676092.1"
                     /db_xref="GeneID:34716233"
                     /translation="METDSSSSKPDGYHGLDSKTEEHIKALARTLSRTSLNRQISLQA
                     SGNGASKFDEVKSIFSSSYSGVNPVFLDPSAPGYDARLDPNSEHFSSAAWVKNMVAFS
                     MQDPDYYKHYTIGCCWKDLRAFGDSNDVSYQSTVTTLPGKYLGKIKRHFTATKEEDVF
                     DILKPMDGLVKPGELLVVLGRPGAGCSTLLKTISANVEGYSIDPNSTISYNGLDPKVI
                     KKHFRGEVVYNAEGDIHFPHLTVYETLNIVALLATPSNRIKGVSREEFAKHITEVAMA
                     TYGLSHTKNTKVGGDLVRGVSGGERKRVSIAEVTICGSKFQCWDNATRGLDSATALEF
                     IRALKTSTDISGSTAVIAIYQCSQDAYDLFDKVCVLDEGYQIFFGYAKDAKKYFENMG
                     YVSPARQTTADFLTAVTNPAERIVNQDYVKEGRFIPSTAKEMEEYWRNSPEYKQLHAD
                     IEEELSKDSAKNFQQLQESHVAKQSKGQRKGSPYIVNYRMQVKYLTIRNIMRIKRSFS
                     VTLGSIFGNIFMSLILGSIFYKSMKHTNTNTFFYRGAAMFTAVLFNSFSSMLEIFTLY
                     EARPITEKHKRYSLYHPSADALASMMSELPAKIVTAICFNLILYFMANFRREPGPFFF
                     YFMMSFLATLVMSSIFRCIGAAAKTLSEAMVPSSILLLAISLYVGFSVPKKSLLGWSK
                     WIWYINPVSYVFESLMINEFNGRDFPCAVFIPSGPGYENVSATEKVCNTVGSKPGLPY
                     VSGKDFIVQSYGYDPSHRWRGFGIALAYFIFFSAVYLLFCEYNESAVQKGEILVFPKA
                     VLKKAKKEALSRPKSDVETGEDPEGGITDRKLLQDSQEDSNESVDEKQSAIALEKSGA
                     IFHWRNVCYDVQIKKETRRILSNVDGWVKPGTLTALMGSSGAGKTTLLDCLASRVTMG
                     VITGDMFVNGHLRDNSFPRSIGYCQQQDLHLSTATVRESLRFSAYLRQPSSVSIEDKN
                     RYVEHVIRMLGMEKYADAVVGVTGEGLNVEQRKRLTIGVELAARPKLLLFLDEPTSGL
                     DSQTAWSVCQLMRKLADHGQAILCTIHQPSALLMQEFDRLLFLQKGGKTVYFGDLGHG
                     CQTMIDYFERNGAHKCPEGANPAEWMLEVIGAAPGSSSTVDYHEVWRNSEEYRMVQKE
                     LDWMEVELAKKPMDTTEEQNEFATSLPYQFKIVTTRLFQQYWRTPSYIWSKAFLTVFS
                     QIFIGFTFFKAKLTLQGLQNQMFATFTFTIIFNPACQQYLPLFVSQRDLYEARERPSR
                     TFSWLAFIYSQIIVEIPFNILLGTVAFFVFYYPVGFYNNASYAGQLHERGVLFWLFCV
                     EFYIYISSMAQLCIAGLEHAESAGNISSILFTMSLMFCGVFGGPGVLPKFWNFMYRVS
                     PLTYFIDGLLSTGLANTKAVCADYEYVHFNPKSGQTCGKYLANYIKAFGGYLANPDAT
                     NDCSYCKISESNTFLQSFKSSYHKRWRNFGIFLVFIVFDWAACMFLYWLARVPKKKNR
                     VSNERNPDKLNNQENKNKEEV"
     gene            <582393..>584375
                     /locus_tag="KLMA_40246"
                     /db_xref="GeneID:34716234"
     mRNA            <582393..>584375
                     /locus_tag="KLMA_40246"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819537.1"
                     /db_xref="GeneID:34716234"
     CDS             582393..584375
                     /locus_tag="KLMA_40246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676093.1"
                     /db_xref="GeneID:34716234"
                     /translation="MTSMQYTLASPIEFLSRLLDRKINESVGVTEETVDDIQRRYLFM
                     EFISSETEYLEMLKLFEQTYLAKLNRSDHLAWQMTYRIVQNLVSGHDKLLRKVFEWLE
                     LPISVDDNKAEINWELHVSQIGDKFQSLESLSGFIQVYVQKLLELEPHYKDYVYHYSL
                     CNTFKKHGIFNAKLVKQLSQMEPMLKKFQQQRLNSQSTDLFRRNISFESLRHLPVARL
                     GHYKVFFDSFLKSTEAFPSQTSGRNSASTNQSRSDVQSVVAQISPRPTASFSDDYSFT
                     DNLEVFKVCIMSVQHMLLRIDGVNFSNIVDKQTQRISTKLKFKYPEEYVPVSALGIPH
                     LTGILNTVWVEVSESQKVWTNTVRSIDSWRRKKTLYPYFVPKGKQLGAFLYKSYLILA
                     RIPMVSVNDLQNQPVDTQWSIKFALPLTNCKIIPIDKEQNKYNEIGLQDDLEPNIKLF
                     KLEWFLYGDVFETIFVFDNYYDYNQWFQHLQTIIDLNGFTSKPMEAESVENYYQMGNS
                     AYAPLRIAPKLTFADAVSKTANQNLTRRQYSLINHQVHDYYYYTSFKLNISFNAMKCG
                     PTNDKSGIVFSRDKYSFLERQLLMIQHPYALGPLESRYSNPITDFQTESNLRSDSNIG
                     SLLATNMSLAPSHTPSLRSFTTLRSKCSDFKALFKK"
     gene            complement(<584712..>585050)
                     /gene="RTC3"
                     /locus_tag="KLMA_40247"
                     /db_xref="GeneID:34716235"
     mRNA            complement(<584712..>585050)
                     /gene="RTC3"
                     /locus_tag="KLMA_40247"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819538.1"
                     /db_xref="GeneID:34716235"
     CDS             complement(584712..585050)
                     /gene="RTC3"
                     /locus_tag="KLMA_40247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676094.1"
                     /db_xref="GeneID:34716235"
                     /translation="MSSPIKYFYKGEETDFIIFVNSEEKVQDYLKNSNINNLTEAVSL
                     FKVFANQDARGSEGELGEASKSQIENEFGPKKTTEEVLDLILKNGKPLSSTNVNKKKY
                     SSTNDSNGAY"
     gene            complement(<585768..>590378)
                     /gene="SWR1"
                     /locus_tag="KLMA_40248"
                     /db_xref="GeneID:34716236"
     mRNA            complement(<585768..>590378)
                     /gene="SWR1"
                     /locus_tag="KLMA_40248"
                     /product="helicase SWR1"
                     /transcript_id="XM_022819539.1"
                     /db_xref="GeneID:34716236"
     CDS             complement(585768..590378)
                     /gene="SWR1"
                     /locus_tag="KLMA_40248"
                     /codon_start=1
                     /product="helicase SWR1"
                     /protein_id="XP_022676095.1"
                     /db_xref="GeneID:34716236"
                     /translation="MSENRDWDQTAKARFEYELLTNELFHLCEFTSLVDFDPLFRNSS
                     DSFRNFLVERNLDIESAIQGDDAADTSASRRLKRRHAAVIDQLRSLVDSQYDEARMRM
                     DIQAGARGKKREQKEIATEEPESNAEVPRPSKKRHTNGTASSKKKSHIKKEESSDSTA
                     VPAKRQKTKAKTSSRKGSNTSSNTSSNTNSKATPSSRSNKTKQKVSKSQAELVEPKED
                     PEKDAIKDNDNDNGTNKNDDSKTPDIQGTVQTDYQPKALIKSDDQEFYFTSSSEDEDD
                     QEVLGQKKRNNRLLKKLKVKIHVHPPKQTITNPAHVIKPEFDNVHSFLESFKILDEDM
                     TLDEYDDYIKEQRKVAAQIRTGFERGALRYDPQTDSLQSIALKDVMPPANSIEPISLY
                     YKEQTKHTHQEHLINQGIVMSKAFQENRRARIAKARRVAQIVESHFKHIAGAEERKLK
                     EEERRKKNLARSAMQAVKKRWTMAEKAYKVLKKDEMERLERIQGKQHLSEMLEQSTQL
                     LGAQLNQIESSAHPSDDSATNSDISEDESDSDDADEDEDGDDSDEMMSTSSSESEKEI
                     DEEKNENDMQLSVEELRMKYAALDEASENVAEKELPQNGDSKSVFSEESDSASDSMED
                     SLSSSDSEDDVEDDGVHDETPGLSALLGNIDDREEDDDDDDVHFNSDDELGSVTPDAT
                     TDMKTEELPSPPKSDIDNVDEKSGQNTETVDPLAVADVPVPSLLRGTLRIYQKQGLNW
                     LASLYNNKTNGILADEMGLGKTIQTISLLAYLACEKENWGPHLIVVPTSVLLNWEMEF
                     KRFAPGFKVLTYYGSPQQRREKRKGWNKPDAFHICITSYQLVVHDQHSFKRKKWQYMI
                     LDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQNNLAELWSLLYFLMPQTALENGK
                     VSGFADLDAFQQWFGRPVDKIVETGENYEQDEETKKTVSKLHQVLRPYLLRRLKADVE
                     KQMPGKYEHIIYCRLSKRQRFLYDDFMSRAQTKETLASGNFMSIINCLMQLRKVCNHP
                     DLFEVRPVLTSFCIENSVTKAYCDLNNYINHILHENEFGKVVDLSTLNFLFTPNDFYL
                     STNHSEKINQLKCVDSITKEIMNLKKLNESGMTISDLDFQDLNKYYSYAKHNRINEMI
                     DQLEQLRYLNELRCAKKPMYGSNVVNLLTMGPKKFMDCNFTQDCIKPLETRLINGKDT
                     IEKFAVITPAVVTLDIRERTVGVDDENHCFKKHLKNQLVSTMRSLDNPFHQLQTKLSV
                     AFPDKSLLQYDCGKLQKLAQLLQNLKDNGHRALIFTQMTKVLDILEQFLNFHGYLYMR
                     LDGATKIEDRQILTERFNSDPRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDK
                     QCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRHLDNVVIQTGDFTTDYFTKL
                     SVKDLLGAEAPVELNDDKPLIQDEQNLSKLLLQAEDEDDAKAAKSALREVNVDNEDFQ
                     EGSVDPQGEHTDGEDVQSDNEYGGTNHVEEYMVRFIANGHYY"
     gene            <591720..>593552
                     /gene="ERC1"
                     /locus_tag="KLMA_40249"
                     /db_xref="GeneID:34716237"
     mRNA            <591720..>593552
                     /gene="ERC1"
                     /locus_tag="KLMA_40249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819541.1"
                     /db_xref="GeneID:34716237"
     CDS             591720..593552
                     /gene="ERC1"
                     /locus_tag="KLMA_40249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676096.1"
                     /db_xref="GeneID:34716237"
                     /translation="MSKQFKHTTQERRSSVIYSNSNGKAGLFSPQDYIPGDKAQTFLE
                     SDLDEESLLATNNSRTLQQEYGSTEETDHNNRGSTGNLELRSSLPKNLIQEERDLLVD
                     NKLYDTTHEHETRESTAYNSLTGNTPSFEDDREVIETWEDAIESGKQITTTYKREASV
                     ITTNALPLVVTFVLQNSLSLASIFSVSHLGSNELGAVTLGSMTANITGFAAIQGLCTC
                     LDTLCAQAYGANRYHLVGVLFQRCAIITILLSIPILFVWWQWSEQVLSLFIPERELCA
                     LAAKYLQVVSLGIPGFILFECGKRFLQCQGIFHASSIVLLVCAPLNAIMNYLLVWDKN
                     IGIGYLGAPISVVLNYWLMTLGLFAYTYFTRNEINPMKCWGGLIKPHQIFKNFKKMFS
                     LALPGIIMVEAEFLGFEILTVFASHLGTNELAAQSIISTVASLAYQIPFAISISTSTR
                     VANFVGASLYKSCVITCKISLLLSFIISSLNMALIYKARYVIANLFSSDVKVVNLVTG
                     ALPILAFMQIFDAFNASTAGCLRGQGQQKIGGIINVFAFYCIGIPMSYTLTFYCNLGV
                     KGLWLGITSALVVMSVCQSYAVFHCNWKDIIRAAKSRNSEGTAV"
     gene            complement(<593901..>594836)
                     /locus_tag="KLMA_40250"
                     /db_xref="GeneID:34716238"
     mRNA            complement(<593901..>594836)
                     /locus_tag="KLMA_40250"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819542.1"
                     /db_xref="GeneID:34716238"
     CDS             complement(593901..594836)
                     /locus_tag="KLMA_40250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676097.1"
                     /db_xref="GeneID:34716238"
                     /translation="MILRESLLQKSKRLRFKFTYKLNEMLENIEQIIQTFQTRVDSLQ
                     NDWNVLSDAVTDDNSPSVSSQIFLLKSKLDLIQQQHTSIIVDLGMIKTHFLPQEEDLN
                     NQFLTEENHESLSENKENRVPILDEDDEEEEENGTENGSISLRIPKIFKEEFKNEVLF
                     SNSNKESISSMQQNAKYKVLKSLYQNKSKITSSSSSSPKDISNFDNYQLVMSDCPKSV
                     HDLYQEFYTDTKVQIMHFEEKYGVGQLSKLPKLRTYQRRNALVNAINKYAKGKGIGID
                     EAIDHFQGIVNENEKTIPWLYNNLAKILERYGIVQ"
     gene            complement(<595333..>596496)
                     /gene="CIC1"
                     /locus_tag="KLMA_40251"
                     /db_xref="GeneID:34716239"
     mRNA            complement(<595333..>596496)
                     /gene="CIC1"
                     /locus_tag="KLMA_40251"
                     /product="proteasome-interacting protein CIC1"
                     /transcript_id="XM_022819543.1"
                     /db_xref="GeneID:34716239"
     CDS             complement(595333..596496)
                     /gene="CIC1"
                     /locus_tag="KLMA_40251"
                     /codon_start=1
                     /product="proteasome-interacting protein CIC1"
                     /protein_id="XP_022676098.1"
                     /db_xref="GeneID:34716239"
                     /translation="MAVRTKKSKSSNTKKEASSNGPSSSTRSKTNKGNTKQSAETEII
                     PVERVMNAVKSLQEYLKEHGTDESSLLDDSELKSQLQLVVVNTESFSGSLKNFKPKLV
                     TVPHSVYKPWKEASTTMVKDFKTLLILKDADANAVSSDDLIDLLPEHITIDSIVTGKD
                     LKTKYKAFEKRRAFVQDFSLILADDSIVTALPKLLGGKAYSKLSTTPIAINTRSDNKF
                     NKTTLVNSIKKVYDTKIPTKIPRGNTLNVHLGSLEWFSPEQLAENIVSVAKQFIEKYN
                     IRTVLLKSNESPVLPLYVNLDVLDTLVKSKQDSKVSVESDVVEIDGVEIQLSQFDKSL
                     LQIANPDELDTLFAKQIKQAKRNLEEVEKEEEKEKEHKEVAHVSNKKQKKAAK"
     gene            <597203..>597727
                     /gene="ELF1"
                     /locus_tag="KLMA_40252"
                     /db_xref="GeneID:34716240"
     mRNA            <597203..>597727
                     /gene="ELF1"
                     /locus_tag="KLMA_40252"
                     /product="transcription elongation factor 1"
                     /transcript_id="XM_022819544.1"
                     /db_xref="GeneID:34716240"
     CDS             597203..597727
                     /gene="ELF1"
                     /locus_tag="KLMA_40252"
                     /codon_start=1
                     /product="transcription elongation factor 1"
                     /protein_id="XP_022676099.1"
                     /db_xref="GeneID:34716240"
                     /translation="MGKRKKSSRGPAKKVVQRLDTAFNCLFCNHERSVSVTMDKKNNI
                     GSLHCKICGQSFQTRINGLSQPVDVYSDWFDAVEEVNEGRHSESEDENSDSDYESDSD
                     AEPKTNRRKPVGIYSDEESDEEVSKASGTRNNDEDGEDSGDDEGDEDDDDDDDDGRIS
                     SKRGRAAWMDSDDE"
     gene            complement(<598199..>598645)
                     /gene="COX6"
                     /locus_tag="KLMA_40253"
                     /db_xref="GeneID:34716241"
     mRNA            complement(<598199..>598645)
                     /gene="COX6"
                     /locus_tag="KLMA_40253"
                     /product="cytochrome c oxidase subunit 6"
                     /transcript_id="XM_022819545.1"
                     /db_xref="GeneID:34716241"
     CDS             complement(598199..598645)
                     /gene="COX6"
                     /locus_tag="KLMA_40253"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 6"
                     /protein_id="XP_022676100.1"
                     /db_xref="GeneID:34716241"
                     /translation="MFSRSLLRAAMPARTVAPVMLRSAAAAPRMAQLPSQFVAVRNYS
                     AHEEETFEEFTARYEKEFEEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARKVND
                     LPTAIRVFEALKYKVENEEQYKAYLDELKDVREELGIPLKEELFQH"
     gene            complement(<599687..>600358)
                     /locus_tag="KLMA_40254"
                     /db_xref="GeneID:34716242"
     mRNA            complement(<599687..>600358)
                     /locus_tag="KLMA_40254"
                     /product="calcipressin-like protein"
                     /transcript_id="XM_022819546.1"
                     /db_xref="GeneID:34716242"
     CDS             complement(599687..600358)
                     /locus_tag="KLMA_40254"
                     /codon_start=1
                     /product="calcipressin-like protein"
                     /protein_id="XP_022676101.1"
                     /db_xref="GeneID:34716242"
                     /translation="MENGPNDDFVTDTVIITSKTQDVCSAPLFDQIVDKVQDDVVDES
                     QVYGSKAVQVIALTGFKRVLVISPTYQISRKVKALGEHFPECKFGYSIIDHVPDPKSM
                     HMVTRTKTFLEVPESKTVFLISPPASPPPDFDYSRLEDWPNRDTGHGHGESVETPDPK
                     PKSSTDSAVNDKKADSYTKKKVLDNGRFKIFVESSDDGSESPTDLHRVKTSMPPVSTF
                     DDIED"
     gene            <600650..>601252
                     /gene="TMA22"
                     /locus_tag="KLMA_40255"
                     /db_xref="GeneID:34716243"
     mRNA            <600650..>601252
                     /gene="TMA22"
                     /locus_tag="KLMA_40255"
                     /product="translation machinery-associated protein 22"
                     /transcript_id="XM_022819547.1"
                     /db_xref="GeneID:34716243"
     CDS             600650..601252
                     /gene="TMA22"
                     /locus_tag="KLMA_40255"
                     /codon_start=1
                     /product="translation machinery-associated protein 22"
                     /protein_id="XP_022676102.1"
                     /db_xref="GeneID:34716243"
                     /translation="MPLTNVVYCGVCGYPTEYCEFSGKFKRCKAWLEENHPDLYAKWY
                     GDDTEEVAKQLAESSIGGEREEKLEKALEKLERKQQAREERELAKKLSSKVIIKREAR
                     TKRKCMIAISGLEVFEIDMKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEA
                     YIHSLLEEKGMKEVKVEVIDAAKKKKKPETTGTPGSDTKK"
     gene            <601655..>603841
                     /gene="YPP1"
                     /locus_tag="KLMA_40256"
                     /db_xref="GeneID:34716244"
     mRNA            <601655..>603841
                     /gene="YPP1"
                     /locus_tag="KLMA_40256"
                     /product="cargo-transport protein YPP1"
                     /transcript_id="XM_022819548.1"
                     /db_xref="GeneID:34716244"
     CDS             601655..603841
                     /gene="YPP1"
                     /locus_tag="KLMA_40256"
                     /codon_start=1
                     /product="cargo-transport protein YPP1"
                     /protein_id="XP_022676103.1"
                     /db_xref="GeneID:34716244"
                     /translation="MTKGVKINSKIGNDTSIEHALESRLIGSNVFQSSDPLLDQLLSI
                     HHRAHYHVHVSEKTKNSALKSLLVELSKVEAIPKGLHMDIADNIQGVIYSEIGDKKTA
                     SSYVSKELVGTESQYKRFYKMLELERMFYNGNIHVDKFSPKDMSIPHLTDGLTWYYLL
                     AIVKELDLSHLKATSPFHWLLLTVSGHASDTDLFSYGQSLLKSCDFPSADKSNNPELE
                     QFHIVLQQYFLQNSSNAKNEWEQFIIDSIEKTFQSTAVAKTAMLFYQKRDLKRSVLNF
                     TNLVNYSNKHYELNKKYPDLIDLVSSYQVILSTCKKDYEPFYIHSTVASDFLHLLQRL
                     HEKYKIPIVEKEKVIEGASETLKLCLAIPIANVISYSWETLYETNKNNLSTLLNNDQL
                     YFLTNALQTSFNTSVSLKFKFAYHLAMLRQVDQCITYLKKNILPYYPEHFASWHLLAL
                     CESCINEDLQVSFKIINSVIQSMCDLYDEGREFTVGEKWQFINIKITQIQLVRDMFAL
                     QDALEILPEVFELYNQLFSDEKRSLGVEYNQSNEYLLQMIWLFALELYLENNDTENVN
                     AALKEFKNVTTKFVNLNQNIAHGYVLITNGQSDKALHEFEKVLHFDSTSIEALLGLAK
                     VVFPEENLGVDMELKQNPALLENQGLDSPSSTSLQTSSAVARLKFLFEQLVDRSIEGY
                     QTPAVWWYLSKVYEVYNDSARQQDALWQCIKFEELLPVRDFKYCNF"
     gene            <604164..>606440
                     /gene="PMT6"
                     /locus_tag="KLMA_40257"
                     /db_xref="GeneID:34716245"
     mRNA            <604164..>606440
                     /gene="PMT6"
                     /locus_tag="KLMA_40257"
                     /product="dolichyl-phosphate-mannose--protein
                     mannosyltransferase 6"
                     /transcript_id="XM_022819549.1"
                     /db_xref="GeneID:34716245"
     CDS             604164..606440
                     /gene="PMT6"
                     /locus_tag="KLMA_40257"
                     /codon_start=1
                     /product="dolichyl-phosphate-mannose--protein
                     mannosyltransferase 6"
                     /protein_id="XP_022676104.1"
                     /db_xref="GeneID:34716245"
                     /translation="MGMISRASGFLPQSSELQLRERKKHFKGTENVNDLLGLNEPQEK
                     FKNNNIKKRILCDRDHYIHKIVCFSLTVLSFLLTLYKIDRNNLVVWDEAHFGKFGSHY
                     IKHEFYHDVHPPLGKMLIALGEYLSGFDGNFEFNSNTTYPPEVNFKFMRQYNAVFNAL
                     CTPLTFYAAKNLNFDMMTVYLVALMVCLEHSYIVLGKFVLLDSMLLFFTLLTFYCLTQ
                     LYRLRKYQFTKKWALWLIATGISIGCVCSVKWVGVFVTAVVGVYTVLELYSLRWNKGI
                     SKTKYIGHWLIRIVTLILLPFFLYMVFFKIHFLLLYKTGPGDSSAHSLFQANLEGNEI
                     QSGPRNVAFGSEITLRSHGLSPGLLHSHPQSYPGGSNQRQITGYGHRDSNNNWILKFS
                     RSSGKTIDEKEYQNNPILVKDGDSLRLVHKNTKNNLHTHEIDSHVSSGNYEVSGYGDE
                     IVGDFKDDWVIEVVEQLPTKNKTLEKIELIHPLTTNFRLRNKELGCYLAATGLSYPSW
                     GYNQGEIVCKYPWNHHDKSTWWNIEDHINPKLPLDDKFAPPPSRFWTDFIVINFAMAA
                     SNNALIPDLDKEDKLASEPWEWPTLHRGLRMCNWGDETVKYYLLGSPFNTWITTLSLP
                     ILLILLAMKYFKYQRQSIKLNEDEIWSIISTAILPFLGWCFHYIPFFIMGRVTYIHHY
                     VPALLFAIFCFGYVIDSIFATTNKILKIFIYIILYIGCGVVHWYFSPLCQGMPGSSMK
                     YLYLQLIPTWDVTNAKYY"
     gene            complement(<606482..>608854)
                     /gene="ELP2"
                     /locus_tag="KLMA_40258"
                     /db_xref="GeneID:34716246"
     mRNA            complement(<606482..>608854)
                     /gene="ELP2"
                     /locus_tag="KLMA_40258"
                     /product="elongator complex protein 2"
                     /transcript_id="XM_022819550.1"
                     /db_xref="GeneID:34716246"
     CDS             complement(606482..608854)
                     /gene="ELP2"
                     /locus_tag="KLMA_40258"
                     /codon_start=1
                     /product="elongator complex protein 2"
                     /protein_id="XP_022676105.1"
                     /db_xref="GeneID:34716246"
                     /translation="MLSEEGIFIGANKQTQVSDYNERKQIVAFGAGKNIALWKPMDPS
                     NLGVYRTLKGHVAEVTCIRFVTGTDLMISASEDFEVRVWKFVNIDGVETADCIQVLHH
                     HSHTITTVTVLNNLLVVGCADGSTSVWSFISDQYVLQQEVSLGFGVFPLCLALHMVQE
                     NHYILAVGGTSPNIFIYTIVTNSLEVTSIQFATKLEGHEDWIKSLVFREAAPGDYLLA
                     SGSQDRYIRLWRLKISDKADSEVKEKNKLTLLTNKVYKFSISPVVHVSINFEALIMGH
                     DDWISSLQWHKTKLQLLTSTADTAVMVWEPDNVSGIWICSARLGELSSKGASTATGSS
                     GGFWSCLWFTHNEKDFILTNGKTGAWRIWTSTDGMMWNQELGITGPTKSVTDVSWSLN
                     GEYLLSTSLDQTTRLYSEWIYDADGNRRTKPSWCEMSRPQIHGYDMICVEPISNTRFV
                     SGGDEKILRSFDEPKAVALLLNKFSGVSIEEESHLPDSAALPALGLSNKATNDVDENE
                     SDEDPDARETAETKNISYDLIKELQTPPLEDQLQRHTLWPEIEKLYGHGYEISCLDVS
                     EDKKLIATACKSNNAQHAVIRLFDAETWNQIPEVLSFHNLTITGLRFSKDNRYLLSVS
                     RDRLWALWQRNFENNTFKLVCSKEKPHARIIWDADWFPLSVGLAFVTASRDKTLKLWR
                     IVDKEGKEEVELENTIKFNEPVTAVSVHKELFDDRVIIAVGFESGSIEILAYNNGFTQ
                     LQPVDSKVTPADKINRLRWSSLTREGKLLLGVASADTSVRIYSVNNGLLR"
     gene            complement(<609312..>611063)
                     /gene="ILV3"
                     /locus_tag="KLMA_40259"
                     /db_xref="GeneID:34716247"
     mRNA            complement(<609312..>611063)
                     /gene="ILV3"
                     /locus_tag="KLMA_40259"
                     /product="dihydroxy-acid dehydratase"
                     /transcript_id="XM_022819552.1"
                     /db_xref="GeneID:34716247"
     CDS             complement(609312..611063)
                     /gene="ILV3"
                     /locus_tag="KLMA_40259"
                     /codon_start=1
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="XP_022676106.1"
                     /db_xref="GeneID:34716247"
                     /translation="MFSQSCVRRFSTTRNVGKKLNKYSNIITGPKDQGASQAMLYATG
                     FKDEDFSKAQVGVGSCWWSGNPCNMHLMDFNNRITASVNKAGLKGMQFNTIGVSDGIS
                     MGTKGMRYSLQSREVIADSFETIMMAQHYDANIAIPSCDKNMPGVLMAMGRHNRPSIM
                     VYGGTILPGSPTCGSAKIPEKIDVVSAFQSYGQYLSKEFNETERLDVVQHSCPGPGSC
                     GGMYTANTMASVAEVLGMTLPNSSSFPAVSQEKLAECDSIGEAIKKTMELGITPRDVM
                     TKEAFENAITYVVATGGSTNAVLHMVAVAYSAGVKITPDDFQRISDKTPLLGDFKPSG
                     KYVMADLIKIGGTQAVIKYLYEEGLLHGNTMTISGETLAERAAKAPALADGQDIIRPL
                     SNPIKPNGHLQILYGSLAPGGSVGKITGKEGTYFKGKARVFDDEPSFISALEKGEIKK
                     GEKTVVIIRYEGPKGGPGMPEMLKPSSALMGYGLGKDVALLTDGRFSGGSHGFLIGHI
                     VPEAAEGGPIGLVYDGDEIIIDADNNKIDLLVSEETLAERRSKWTAPAPRYTRGCLSK
                     YAKLVSDASHGCVTDLN"
     gene            <611624..>612226
                     /locus_tag="KLMA_40260"
                     /db_xref="GeneID:34716248"
     mRNA            <611624..>612226
                     /locus_tag="KLMA_40260"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819553.1"
                     /db_xref="GeneID:34716248"
     CDS             611624..612226
                     /locus_tag="KLMA_40260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676107.1"
                     /db_xref="GeneID:34716248"
                     /translation="MSVNRKLKQCRTLSLCYCLSTYINFGGFLFSFPVRVLENGSPVV
                     FWLSAYSLGVCLFSHYLVKRVWYSRPKFYSLAVIAVIGVSTLVAAALCTWSFVYFCGG
                     YIHGVKFSLPQKKGSVDVTERLATTTTLCFVVALFELLCIIITFLLYQRLNIDWAKAA
                     VWLRKESPERFPTNQHGSDEKYIKYNDPDRCILEGQYNVL"
     gene            complement(<612397..>623748)
                     /gene="TRA1"
                     /locus_tag="KLMA_40261"
                     /db_xref="GeneID:34716249"
     mRNA            complement(<612397..>623748)
                     /gene="TRA1"
                     /locus_tag="KLMA_40261"
                     /product="transcription-associated protein 1"
                     /transcript_id="XM_022819554.1"
                     /db_xref="GeneID:34716249"
     CDS             complement(612397..623748)
                     /gene="TRA1"
                     /locus_tag="KLMA_40261"
                     /codon_start=1
                     /product="transcription-associated protein 1"
                     /protein_id="XP_022676108.1"
                     /db_xref="GeneID:34716249"
                     /translation="MELSDTRERMNSFVDRINEAPNVVAKHAVFSELYDVLDVVTSSL
                     EYDEFLKKIMPLILKQLKEVDISMDAFSPEHKLRNTCLELLNRCPLNDKMEPMALEVL
                     KCLLEILTSENDENGVLCMKILTSLFKCYKQQLENEVNSFIKIIVGIYENVPSLVASA
                     FPEDEEDIMSATGIPSNKTSYDESNINTNDEDGLENLSTSSKKTLVKSTESFKTLSEC
                     PITMVTLFSSYKHLILVDLPTFLPLIIDLLTLEVKQQRLTREELEAKGEKLIGVSPKI
                     KNRTTFCEYVLAQIKATSFLAYVFIRGYATDVLKLHVKKVPDLVMRLLQDCPSESSSA
                     RKELLHATRHILSTSYKKLFLPKIGLMFDQNVLIGDGFTSYEMLRPLAYSTLADFIHN
                     IRSELAMSDIEKTVKMYTSFLLDESLALTVQIMSAKLLLNLIERILTLGKKDPQEAPK
                     AKKLLMTIIEAYTARFKILNSQHKKILQQHKIYEQNKAKKAKEIQSQIAKGRHDIDEY
                     MVSILKSSEGLTSLAEHSEIIKRDQEGDIIMEDSSVIASNNNNVEVPNGELSKVDENS
                     SNPESEEKVTENVSASESKSKKPEDQMLDLTDIQNLSPIVLFQTTSNDPLKDAFYLFR
                     TLLSFLKTIIHDLKVFNPPPNDYTTMNPKMWSALSRVFSYEEVMVLKNLFHECIAGLH
                     LFSSNPEGIDPSTVKEHFDITTPSLPVAATKDGRELMDYFAIIFMQIDSPVFNEIVES
                     EIDFIYESLLRDSALLHVAQSFLTSEITSPNFTGILLKFLNSKLPELGNVDSNKSNIL
                     IRLFKLSFMSVNLFPITNEAVLLPHLNDLILNSLKYSTKAEEPLVYFYLIRTLFRSIG
                     GGRFENLYRSIKPILQTLLQSLNKMIQTACRPHERDLYVELCLTVPVRLSVLAPYLNY
                     LMKPLVYALVGFPELITQGLRTLELCIDNLTPEYFDPILEPVVGDVIKALFDLLKPQP
                     FNHQISHTTVRILGKLGGRNRRFIEAPKDLKTKSELDIEVDGWFKIYGFNADVPLSIT
                     PGISSAADILKDYRIDLFYRKSAYNYLAAVLKLLLSSVGSVPDTLTASLQKGVKLLCA
                     DELNDNVEFNDEKIKDLRKFNNSEELLLKLLECLFYAASIDELKDDVTQLVKKVVTHF
                     SLLQVNEALSEKRRQPHVFSVDVKQPDVCISCDILLKAIKNGLCSYLEESRSLSVEAI
                     KQVHDIGKIIYGEDVYLEHSFITTLMRTFIHQFYSETYYEKRAGVIGIQTLLKDLMLP
                     VEYVKNFQYGLTSGLIFVLKDTHPEAPAFITEDAKNLLFHVIETTCADVKEENLGDKH
                     LQNSITDIVCELSNPTEIVRNVCQECLERISKLTSIPVVTLMDHAKNFLLSPIFAKPL
                     RALPFSMQIGNVDAIIYCLRLPNSFLKFDEELFRLLHESIALVDADDISLASTQRITE
                     YQTSQQLIKLRVVCIRLLAQALLNPEFANAQNGSIRIKVLAVFFKTMLKPSPEIIEAT
                     YEALKVVLAENSKLPKELLQNGLKPMLMNLSDHRKLTVPGLQALAKLLELLIAYFKVE
                     IGKKLSDHLDAWCKIEVLDTLFGKEIFQQTPAKIICSIFNIFHLLPPQAGIFLNELVF
                     KLISLEQKLRLQLDSPFRVPLAKYMDRFHTQVLTYFKNNMRSRQLVLLMCSIIQKPEA
                     PTLRQIFEPNLKDFLNFYNEQIIENPVRTVSFFANSVDLVYVYHKLNSDGWILQNTDI
                     LIDLKKMLTTVLKLINESNFNIDILQLNQSIQKFQKMYLAYLKQKKNNVPLFLEIIEF
                     SFTHELKMLNELNFFIFDDIICSGDVTVKSEYILGCLTYAFDNSKSLKARNFVLKKVV
                     NAILIHEYQTHNTLESLITPGNKIFSFLQDNMWHPTTMSPLLSTSAGKFDATRFELLQ
                     LTAIILKYAPSIVETLKKDIIKFAWRFIKLEDIQLKQAAYVTTSLFISKFDLPLNIIT
                     QVFVAVLRVHQIEARFMVKEALDLLAPVISSRSKNTDESTVWVNWVRRIILESDFQQN
                     TILYQFLISQKDIFCEYKDMFIPNIISYIGRLTLLTNPSSENQTLTIDLCDLVMYWEK
                     RSSSENIDGKDIDMENNGNIVSSSSTSLSQREAFAAFLIRFICVSNHRACETPLGSKA
                     LSVLTELLSIGYLPEAVVKLSYFEKFLIQQDLESSNILYYCMNALDVLDIIFKTKDPK
                     WIVANLKTIQNLLDKCLHANHHDLQETLQKVLSTVLQAVKADEPSFAIEEDSDSKVFV
                     SSISSIISDNLNGTTSVAAGVILCWTLFVNIPSQIDSLLPLLMKTFNKLCKDHLTISQ
                     PKDASAAEDARITTKLLKKVLYMLSFKVSTLGDSRRPFLSTVALLIDRSMDQNFLQKI
                     VLIARNWVFTNEIFPTVKEKAAILTKMLAFEIRGEPHLSKQFYKIILELFENKKYNNS
                     EITVRMEQPFLVGTRVSDIETRTKLMKILNESLDSDIKERLYYVVRDQNWEFVADYMW
                     LNQACQLLFGACDMEHVVMLKDKFPLSPLDAIERNIVLEDSDKQVENSELYKLVEEHK
                     KFIDEIHSIKCKDLIRPLIDIFYHSPEAVRSTWVNFFPVAYKSIPRNEKYGFVRSLVA
                     LLSKDYHSKQASVHINIISTILESVSKIESLELPPHLVRYLGITYNAWYQSINLLEQI
                     QETSTIDNSKIVETNEDALLELYSSLQEEDMFYGLWRRKAKYTESSIALSYEQIGLWD
                     KAQQLYEAAQVKARGGFLPYSESEYELWEDNWILCASKLQHWDILTELAKHEGFTDLL
                     LECGWRVAEWNADREALEHSVKSVMDVPTPRRQIFETFLALQQFGETKKGDQEVRRLC
                     DEGIQLSLKKWSTMPKRFTPAHKALLHTFQQYMEFLEATQIYANLATTTVQNLDTKAQ
                     EIKRVLQAWRDRLPNIWDDISIWDDLVTWRQHAFNVINSAYLPLVPALQQANSNSNIN
                     THAYRGYHEIAWVINRFAHVARRHNMPDVCISQLARIYTLPNIEIQEAFLKLREQAKC
                     HYQNMNELTTGLDVISNTNLVYFGTVQKAEFFTLKGMFLSKLRAHDEANQAFATAVQI
                     DLNLAKAWAQWGFFNDRRLSEEPKNISFASNAMSCYLQAAGLYKNSKTRKLLSRILWL
                     LGRDDSSNSLAYAFDSFRGEIPVWYWITFIPQLLTALSHKEAFLVRKILIRIAKSYPQ
                     ALHFQLRTTKEDFAVIQRQSLALARTQGETGNAEGNDPSKQTSADSSRANSQTKPQDQ
                     EKYANNRQPWEYLEELNGILKTAYPLLALSLESLVDQINQKFKTNPDEDLFRLINVLL
                     IDGTYNYNRLPYPRENPPLPSSTEANLIRFSENLLPPNIRVKFNADFIEGKPNFEVYI
                     KRLRFWRNRLENKLDRASKVESMEAICPNLSNFHHQKFEDIEVPGQYLLNKDNNAHFV
                     KIGRFMPEVDFTRGTHTSHRRLTIRGHDGSLHPFAVQYPAVRHSRREERIFQLYRLLN
                     ERLRKNVQTRRRNIQFTVPIAVPLSPQVRVMSDSSSFKTLHQVYDEFCAKKNLDRDAI
                     QDFITEQLNVAHDKVLPPPDITAVKVEIFSSIHSLFIPSTLLKDYYSKIFTEFEDFWL
                     FRKQFSSQYASFVFMTFMLSINNRSPHKIYVDEKSGNVHTLEMLPSRYSYERVNQYAK
                     QFEANLPNSAPVFHNNEPVPFRMTPNIQKLIGDSAMEGIFSVGLFVIARALMEPDHEL
                     NTYLSLFIRDEVISWYSSINRSIVEDPHLYAIVLTNVDLIIRKVAQFGHMSSTPSVST
                     QYVLDAISAAVSPRNLAKCDQSFMAWL"
     gene            <626214..>627902
                     /gene="YPS7"
                     /locus_tag="KLMA_40262"
                     /db_xref="GeneID:34716250"
     mRNA            <626214..>627902
                     /gene="YPS7"
                     /locus_tag="KLMA_40262"
                     /product="aspartic proteinase yapsin-7"
                     /transcript_id="XM_022819555.1"
                     /db_xref="GeneID:34716250"
     CDS             626214..627902
                     /gene="YPS7"
                     /locus_tag="KLMA_40262"
                     /codon_start=1
                     /product="aspartic proteinase yapsin-7"
                     /protein_id="XP_022676109.1"
                     /db_xref="GeneID:34716250"
                     /translation="MIKILLSLVFLLLAQLVHSNKDETPHIIVGRDYSGLYYVNTTFG
                     TPGQEQQLRVDMSQPYTWVVSGEIYPQCNKLNSGCLTGSLYYPLESTTSHEEDNGEYV
                     RLQFLDLISINGTKYNDNMNFTNAVIESNGSTYEKNNTMWNEQDGWLSINKTSFIVAN
                     ETGSLVQGSLGLVGPINDPASDPQSSLNFDESYYFLSHLKNDGVIESSSYSLWVNNDT
                     DDDINQLLTNDNIGRLLLGAVDPKYYEGELVSFQAIPFKDEQSGFLSYGYPIVPMSKI
                     SITNNNNEALNLTDSNFLQPVFLHSRYLYSYLPLSVIIQVAIQTNAVYVQSLDRWLVA
                     CEIGDLGSNIEFEFGNLTIGVPTVDFLGATNNVNTNSSLHFTNGKEACYLKMYPNYAT
                     SFSVLGKSFIKNAYIVHDIESGQIAMAQAAFPSNVEKASNSSAAKKIQSSTIPYAITN
                     NVTHQLTMSNSLAKVSSDLLDKYTATIRSDGEIFTGRSFYDTSRTSTIESHTPTSTAE
                     EQTSTKQNSKTGTSTAAASRTKPVLTTFSQKDDNPWLFPLAFALVGLFGLSLSL"
     gene            <628493..>631210
                     /gene="SFB3"
                     /locus_tag="KLMA_40263"
                     /db_xref="GeneID:34716251"
     mRNA            <628493..>631210
                     /gene="SFB3"
                     /locus_tag="KLMA_40263"
                     /product="SED5-binding protein 3"
                     /transcript_id="XM_022819556.1"
                     /db_xref="GeneID:34716251"
     CDS             628493..631210
                     /gene="SFB3"
                     /locus_tag="KLMA_40263"
                     /codon_start=1
                     /product="SED5-binding protein 3"
                     /protein_id="XP_022676110.1"
                     /db_xref="GeneID:34716251"
                     /translation="MSIDGLANGVSNIHLQQNGDQPLHNEAKKHRRPNRAYHNFSNPA
                     VGTGKDLSLSNSADIPSIPYNGALASDNPYNPPIAGTEASVLNSPSMNAPQPTGTHFL
                     PNQRMENQQIMLQKSFLTATDSVPPLSTSQYYAEDQGSCDPRLMALTMYNVPDDEHLR
                     AATKLPVGVTVKPFAVLIPNSELPTVDATMESDGPMRCRRCRSYVNPKYQFTFDSKMI
                     CNLCHIKTNVSTSQFSPVGPNGMRADTFNKPELVKGSVDFLVPATYNVNPKEKTVPLH
                     YVFLLDISAFANENKSSLAAIEGIRASIEYMIENQPNCKVAIIAFDDWIRFFNLRADL
                     EQTQEYIINDPNDVFLPLQKGLFALPSEAMHVIQDVLVKLETYITDERFSHRSQCCYG
                     SALEAARLALDEATNKQGGKIIACLNTIPTTGHGNLSLMRDDGLKKNLKCSDEFYKKL
                     AKSFLSSWIGLDLFVTSTAFIDLATTAYPVIATSGKLHHYSNFNINKDEFQYVNDIIK
                     SVKDTVGYQGMLKVRSSSGLSVYNYYSESVKNSDQDPVIPVLSRNQSFDVLFKYDDKL
                     KVGEDVYFQAALLYTDFDGNRKVRVINTNAAVTSEVVEIFKFVNQDVVTSIMEKDVLT
                     NLGDCNFKEIRQIIDSKVTDIFTQYRGLCGGSPGGQLILPDSLKTLPMYMLAFEKSEL
                     MKQNKTTARDNNRVYDYYKLLSFPSSQLSYKLYPQIIPLHEYLEDNDLTFYDENDQLL
                     QFNNIETLSVRSGHQHLANGGCYLIFQGEKCYLWFNENTNPMLIKDLLAYDGPYNELD
                     LFDGRLPELNTAINIKARNVIKNWKQNTNLDYLAVVPLRPNMDPYYSHVMNALMCEDR
                     SIEMVESFDNYLINLHRNIKENIEKDKYVKIYKGSEDGHENFAQKFVHF"
     gene            <631971..>635181
                     /locus_tag="KLMA_40264"
                     /db_xref="GeneID:34716252"
     mRNA            join(<631971..632278,633888..>635181)
                     /locus_tag="KLMA_40264"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819557.1"
                     /db_xref="GeneID:34716252"
     CDS             join(631971..632278,633888..635181)
                     /locus_tag="KLMA_40264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676111.1"
                     /db_xref="GeneID:34716252"
                     /translation="MYRSDSQRSGRQRPYSVNNPFRNASHDSSINQYETDQEFQSWIS
                     QNARPTPYSSGRRHDSALSFTDSIEESPEFDDDFSTDDYFIDVQSNNNSSTRAYSDSR
                     RMSPPVPANSNNPFLSDLSPEELNSGRSRSFKENQPRQQPSKQQHPTAAEEKEALRRK
                     YLQIDNEDIPPPRRSSPRNPRHAELPPSYDEVAGSKSRSNGYPKEKSSSGERSRSHSD
                     RERDREHRPKDRDREREREKERRARHRGESGTNGSSSHRHRKSSSGRKSSSPDKRDKS
                     KGPLPKNVDTIDKLDVTGLFGGAFHHDGPFDACTPHRNKNTKAAPVMAFPADGPNSSI
                     AGPTATKSVIKEVFGHDDVDDDYLYKPNGSTIINSSTTTVDAIKPNSNDVTQFDAKMK
                     TELVHGPTTAGLGSTTFLDGAPAAPAAIKDAANKESSGIQRKKSFSQRLKVGTNKYDD
                     VRLRKVSSDSTPNSPSMLEHSSFDNPRNDNYYYSGKDNGNDNDDYYVGTSSSGVRFDS
                     NSGPKKESTSNKLLRRVKSLKVSRR"
     gene            complement(<635819..>636706)
                     /gene="MRP1"
                     /locus_tag="KLMA_40265"
                     /db_xref="GeneID:34716253"
     mRNA            complement(<635819..>636706)
                     /gene="MRP1"
                     /locus_tag="KLMA_40265"
                     /product="37S ribosomal protein MRP1"
                     /transcript_id="XM_022819558.1"
                     /db_xref="GeneID:34716253"
     CDS             complement(635819..636706)
                     /gene="MRP1"
                     /locus_tag="KLMA_40265"
                     /codon_start=1
                     /product="37S ribosomal protein MRP1"
                     /protein_id="XP_022676112.1"
                     /db_xref="GeneID:34716253"
                     /translation="MFRRAVQNKIFLRSYITPSLEHLAQDQGLSGLFSKEGLKSAWFD
                     RAEHYTEKLNVFSANTDQKPLETIIHENANVSSKKQIFNYASLLYNLKFSMSSLQGCS
                     IPLPAEKPDRSQLVKTPDLTLSYGNEPLSTGNERLHQALVHSFGSIVEFRTLLLNSNN
                     AISGDGFTWLVARQFNTADSSAIKFDQLFIVNTYNAGSPFNSNRVGSFKHLEESIKKK
                     NDEEYKASKLETAIDAAVYPKTKYIPLLAIDASPKAWLTDYGVFGKQQYLDRVWESIE
                     WKVVENRLPAFEAKAFNNL"
     gene            <637596..>639965
                     /locus_tag="KLMA_40266"
                     /db_xref="GeneID:34716254"
     mRNA            <637596..>639965
                     /locus_tag="KLMA_40266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819559.1"
                     /db_xref="GeneID:34716254"
     CDS             637596..639965
                     /locus_tag="KLMA_40266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676113.1"
                     /db_xref="GeneID:34716254"
                     /translation="MRNSTFSHSFKVSTIMEAGSYAVLHDHFTEMRTRWFEKVMNSPK
                     VVGASVGFIFPLIILSYCNESVNSILAFCWQCFIKPFTSETNNHNQQHNLEQFYKSQA
                     KLYDRTRRILLQGREESLKLSLSHLDKREGNVWVDIGGGTGYNISHMSILTDLSKTFK
                     KIYIVDLSPSLCEVARERCKKNGWNNVEVICGDACDFEIPEEAAQLITFSYSLSMIPS
                     YYAAVDHALDLLDGKSGIISCIDFGVTNNAMLVGRINTLGGMINRHIPWLYRTFWRLW
                     FEFDKVFLDPGRREYLEYRFGTIKSLNCYNNKLGKIPYYIWLGCNKDHEKHLQVRFTE
                     LAPTSPYLAPVNSSLTDNKSIPQALVAALDNSRKGLPYPSLFYQKQHWRVYYDELNPE
                     YNQFKSSYIYAFTWEDPIEDVKILNIQSDDTILAITSAGDNILHYASLAKPPKRIHGV
                     DLNPCQGHLVELKLAAIKALEYDQMWSMFGLGKIENFREILLNKLAPHLSSNAFQYWY
                     ENGDKAFNPNGQGLYDTGFTKWALRLARWIFTITNITDEVSMLCAATSLKEQRRVWDE
                     KVKPVLFNKLIGKLLVGNPMFLWSALGVPKNQAKMMGTSTLQYLIDTLDPIIDKYLIS
                     NDNYFYYLTLKGQYSHDSCPAYLKDKNFSILSQEDSGSSLDRIRLHTDTLKNVCERLS
                     EKMVSIAIIMDHLDWFDPRSTAVDDEVQALFKVLDAKGRVMLRSASKNPWYIKSFEKH
                     GFKCKPVSVRYPGKCIDRVNMYASTWICQKITTHIKPTRRVSTLELESS"
     gene            complement(<640326..>641753)
                     /gene="OCH1"
                     /locus_tag="KLMA_40267"
                     /db_xref="GeneID:34716255"
     mRNA            complement(<640326..>641753)
                     /gene="OCH1"
                     /locus_tag="KLMA_40267"
                     /product="initiation-specific alpha-1"
                     /transcript_id="XM_022819560.1"
                     /db_xref="GeneID:34716255"
     CDS             complement(640326..641753)
                     /gene="OCH1"
                     /locus_tag="KLMA_40267"
                     /codon_start=1
                     /product="initiation-specific alpha-1"
                     /protein_id="XP_022676114.1"
                     /db_xref="GeneID:34716255"
                     /translation="MGVPRISRRARYLCGLTVTLYFLFSVQWNTLKVNTHFYNSMHTL
                     LPSTAQVDDLNLKNLEVVDPSSTSYDLLDLRVQLAREFPYEPSQPIPRKVWQTWKTNG
                     DAPSFPSNFKSYQKKWIATCENRSPTYQYNLITDEQMLPLLKQVYGGVPQVVRAFESL
                     PLPILKADFFRYLILFARGGIYSDMDTFPLKPLDTWPSTSKSFRAGLKNPIKYRDSID
                     GLDAFEPPEPGFVIGIEADPDRDDWADWYARRIQFCQWTMQAKPGHPLLRELISNITA
                     TTLHSVQKLKSSLPLNDADIVEEFEDDYNINMRDRRKFDKNYDHKQKKNAKNIDGTDI
                     MNWTGPGIFSDIVFQYLNNIIQKNNNILIFNDNINDMDGKRKESKDETTMKFYKDISK
                     NLQSQNPTFFWGFFSLMTKPALIDDVLVLPITSFSPDVGQMGSNSMDDEMALVKHLFE
                     GSWKEEKSDDKEEKETSSDNDEKNE"
     gene            complement(<642339..>642989)
                     /gene="PNC1"
                     /locus_tag="KLMA_40268"
                     /db_xref="GeneID:34716256"
     mRNA            complement(<642339..>642989)
                     /gene="PNC1"
                     /locus_tag="KLMA_40268"
                     /product="nicotinamidase"
                     /transcript_id="XM_022819561.1"
                     /db_xref="GeneID:34716256"
     CDS             complement(642339..642989)
                     /gene="PNC1"
                     /locus_tag="KLMA_40268"
                     /codon_start=1
                     /product="nicotinamidase"
                     /protein_id="XP_022676115.1"
                     /db_xref="GeneID:34716256"
                     /translation="MGARALLIIDIQNDFLPPDGSLAVQDGDAIIDPVIKLLNEKKWD
                     CVAMTKDWHPSDHISFAKNHGLPDYSAFTYESPVPGSTEKQEATLWPVHCVQESWGSE
                     VPERLMKELQKQEVPHTVVNKGFLADREYYSGFNDIWNDHRTELDDFLKKNNVSEVYL
                     VGLALDFCVMNTAISAAKLGYKTTILKDYTRAIKNDPKSVETLIKDLHSRFNIQIE"
     gene            <643873..>646380
                     /locus_tag="KLMA_40269"
                     /db_xref="GeneID:34716257"
     mRNA            <643873..>646380
                     /locus_tag="KLMA_40269"
                     /product="protein MTC2"
                     /transcript_id="XM_022819563.1"
                     /db_xref="GeneID:34716257"
     CDS             643873..646380
                     /locus_tag="KLMA_40269"
                     /codon_start=1
                     /product="protein MTC2"
                     /protein_id="XP_022676116.1"
                     /db_xref="GeneID:34716257"
                     /translation="MDYESRVSSKAAVGLETVFKKLAAKDTEDSLRVELWYELLDVLR
                     YVGKRDLSLEKCDWDSVCDNLLERLLISISLTDDLDLGVGVDLFGYVFAYCSVFPNLQ
                     QIVIRFIKKLDDSGLLRQLLWKVCCSSKNGNGDQELQGAVSVTTNKNNKNTCSIGLYD
                     VVFQLEAFEKLDESVWKFLDLNLGVVLIKNWIPSWKSWISPFRDQGKYFNPITFLLNE
                     RLLIKLVNDYELDIAIANFQAFPEKWEAFSKHDMGAVQYFMLKCARRAVKCSRLITAE
                     FFLQVTEFFSKTMKDDKFQLIARDHSGTIHFQIIMEFIDHPKLNLLEESHLALLLRSS
                     LDHILGQCLIHNHIPRLHSTLGKLGTTQSLPSLINLLQYTLSRYCLKIMECAQNGVDM
                     EDMPHWYKKMTNLYVPSWFEEFRPLVPPISKGLFGDGENSIELEEESHSFRENFKNIF
                     ESLQLTVTLNEQILKFYGEIDLNPFKLNSETISSTVKNIQSITTSKYFKMYYVPLFTT
                     LLISDQLLLNDGDNFQTFLDDSTKAIGAKRLFRHCVKQSEHLIHNYGNIGLYHFVMFL
                     SQISVESLLLQKLSIKLLNHLFFQGDKQWVLQLCLSNELTLQSLHDYILLWNDGSESY
                     SSFFTEVFKKPQPTIEMKSVVIGDFVELLTDEKYYNQNKSKNVINKPKTKYNTNASAF
                     VPNDLTSLHMHTPKRSEYSQQQYPLNPSPNIYGFSNTRGFEANKITGSNNNTTNNTGS
                     NNHTHNHANSNNSIIPTSKKIPLSDCYSTLFSSEQPTRSHAAQSWPLSPSIPQQDNTA
                     AIRLVNTGKSYILGGHNRAVNNSRTKSVHVDDFEQSR"
     gene            complement(<647047..>649191)
                     /gene="KNS1"
                     /locus_tag="KLMA_40270"
                     /db_xref="GeneID:34716258"
     mRNA            complement(<647047..>649191)
                     /gene="KNS1"
                     /locus_tag="KLMA_40270"
                     /product="dual specificity protein kinase KNS1"
                     /transcript_id="XM_022819564.1"
                     /db_xref="GeneID:34716258"
     CDS             complement(647047..649191)
                     /gene="KNS1"
                     /locus_tag="KLMA_40270"
                     /codon_start=1
                     /product="dual specificity protein kinase KNS1"
                     /protein_id="XP_022676117.1"
                     /db_xref="GeneID:34716258"
                     /translation="MASKNFATRRKRTRTLDGVGEESRLRSQYVDDHRNDQMVAAATG
                     AAAAAAAAMRNSSSTGGIGMQNPFMDEFMASSNNDILTSDSLRDTLLMDMDGPGQQPM
                     FLGSNNVNSSTSNVSVINSSAGPSQQLVDLDDSAVEFVNSVNYTSAKKVKKQRTVSLP
                     QLPHARLIYESRSSDRKTQNDDELLHVSGTTTQTVDGNKIIKLPVIRSVSPSPLTDYR
                     SGVVKNNNGSVGVGSMGSMGGMNRNDLAFNATRRVSKSPSKFSSILKKTPLRSGMQDK
                     PPVIESFQTDKEGHYVYQENDIFAKNRFQALQLLGQGTFGKVVKCRDYLNDITVAVKI
                     IRAVDRYRQAAKTELRVLQTIKENDRLGQYQCLLLREFFDYKNHICLVTDLYGRSVYD
                     FMTNNGYARFPGSHVQAIGKQLVRSVCFLHDLGIIHTDLKPENILICDETCVEQQLPK
                     QILDTLTERRKRASGGKRKILINPEVKLIDFGSAVFHNEYHPPVVSTRHYRAPEIVLG
                     LGWSFPCDIWSIACVLVELVTGESLYPIHENLEHMAMMQRINNESFPKKMVDKMFFKV
                     ENKYGNIPTDLQATVVKYFDRETGQLQWPVRNSKGNIVTKDKSWKRVMTSCDRLDAFI
                     SKKLQMDYGPWLEIHWDMDYESNWNLISSKNHDERNIDKNVFSFWYQFVNLCRRMFEF
                     DPTKRITAQEVIEHEWFNIGILDEGITHYGRL"
     gene            complement(<650461..>651171)
                     /locus_tag="KLMA_40271"
                     /db_xref="GeneID:34716259"
     mRNA            complement(<650461..>651171)
                     /locus_tag="KLMA_40271"
                     /product="zinc finger protein"
                     /transcript_id="XM_022819565.1"
                     /db_xref="GeneID:34716259"
     CDS             complement(650461..651171)
                     /locus_tag="KLMA_40271"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_022676118.1"
                     /db_xref="GeneID:34716259"
                     /translation="MEQEKKMMMTTTTTTKLTTATTPSASATATATPTTTSTPIIGKS
                     NMYGVSGMGHKHYYSALPPLRALFRESANMPLSNTPRVLPRIDQLTINCGPSSLNCDD
                     TMTKRSPPPKPHHDHDSAQNSVHTPVHTPVHTPVQPESFDIEFRKLQEQLLRDRPEPG
                     YVNEWNRKQGRGARYKKKIHVKTCHICHKEFSRPSTLKTHIVVHSPVKPFKCTHPGCN
                     KSYNVKSNLRRHEKKHQL"
     gene            complement(<652687..>653748)
                     /locus_tag="KLMA_40272"
                     /db_xref="GeneID:34716260"
     mRNA            complement(<652687..>653748)
                     /locus_tag="KLMA_40272"
                     /product="v-type proton ATPase catalytic subunit A"
                     /transcript_id="XM_022819566.1"
                     /db_xref="GeneID:34716260"
     CDS             complement(652687..653748)
                     /locus_tag="KLMA_40272"
                     /codon_start=1
                     /product="v-type proton ATPase catalytic subunit A"
                     /protein_id="XP_022676119.1"
                     /db_xref="GeneID:34716260"
                     /translation="MSEIKGRCTSADNREPWGVVDAMNSSYSIREFDAGEMDDILSET
                     SSDLDDFGGLARKNSGKDSTSSNSRLISVGSVEGSAELPGSSESSSRNAKTTSRGITK
                     DKAGAGTGSRFSKLQSIIIGISLVAGLINITLLTVLARDMRSFIKNNELDCDGAGGFR
                     EKLTCQFDAYMGHRAHAYETVHGKKHISPVLSTFLELPAALPALPSLPTVSVSQQYRE
                     YSSLLSSTYTRYASLCHKRIEQVYSNGNKLMQSEKVQSVKRLAGRSKQAAKDRIVAAS
                     NATKFRLNMVKEVYWPRQREWLHKLQTEVQTHTKEQYLSFKNRVQNAKDVSIPRLWHK
                     SHDKVSTNYHRVLALLRIN"
     gene            complement(<654250..>655893)
                     /gene="NUP49"
                     /locus_tag="KLMA_40273"
                     /db_xref="GeneID:34716261"
     mRNA            complement(<654250..>655893)
                     /gene="NUP49"
                     /locus_tag="KLMA_40273"
                     /product="nuclear pore complex subunit"
                     /transcript_id="XM_022819567.1"
                     /db_xref="GeneID:34716261"
     CDS             complement(654250..655893)
                     /gene="NUP49"
                     /locus_tag="KLMA_40273"
                     /codon_start=1
                     /product="nuclear pore complex subunit"
                     /protein_id="XP_022676120.1"
                     /db_xref="GeneID:34716261"
                     /translation="MFGIGRSTSAGPAGNTGGGLFGNNNQGGNTGFMNNNNNNTQGQA
                     PGGLFGNNQQNSAAGSLFGKPAGATTNTSGGLFGNNNNATQTGTNTGGLFGNNNNSLG
                     TNTGGGGLFGNNNASSNVGGNTGGLFGNTTQNNNNAGTGGGLFGNTAQNNGTSGAPGG
                     LFGNNNASTNTGTGGGLFGNNNTTATTGGTTGGLFGNKNTSTNTGGLFGSNNNTNMNA
                     GTTGGLFGNNSTSTNNAGNTGGLFGNKNATSNLGGTTGGLFGAQSTQPSGGLFGSKPA
                     QTGSSLFGNTNNNNAGSLGTSTGGLFGSKPTTGGLFGNQQQQQQPQTGGMSLFGNQQQ
                     SQLQQPQQSAINYINQLAVTPMTKISELPIQVRQEIEQLDQFISTQVSLSKHLNADLQ
                     DHTELLESIPRDVKYLQKLHFNATRSLSSDLKKIDAIKSLVDKDVTQLENFAIMLQQL
                     VTKGFKISNVEIDKFFQEKLIVYKNKLNDYNDTLSNIDNAVAGLENDMFGNDSTEDDD
                     TKVGVNIIVSVLMEEFKLFMDTAERIAELHQKCKEIVVK"
     gene            <656444..>660865
                     /gene="XRN1"
                     /locus_tag="KLMA_40274"
                     /db_xref="GeneID:34716262"
     mRNA            <656444..>660865
                     /gene="XRN1"
                     /locus_tag="KLMA_40274"
                     /product="5'-3' exoribonuclease 1"
                     /transcript_id="XM_022819568.1"
                     /db_xref="GeneID:34716262"
     CDS             656444..660865
                     /gene="XRN1"
                     /locus_tag="KLMA_40274"
                     /codon_start=1
                     /product="5'-3' exoribonuclease 1"
                     /protein_id="XP_022676121.1"
                     /db_xref="GeneID:34716262"
                     /translation="MGIPKFFHFISERWPQISQLIDGSQIPEFDNLYLDMNSILHNCT
                     HGDGTEVNSKLSEEDVYSRIFSYIDHLFHTIKPKQTFFMAIDGVAPRAKMNQQRARRF
                     RTAMDAEKAMQKAIENGDELPKGEPFDSNAITPGTEFMARLTDNLKYFIHDKISNDTR
                     WQNVQVIFSGHEVPGEGEHKIMDYIRAIRAQDDYNPNTRHCIYGLDADLIILGLSTHD
                     HHFSLLREEVTFGKRSSSVKTLESQNFYLLHLSILREYLELEFQEITDALQFDYDFER
                     VLDDFIFVLFTIGNDFLPNLPDLHLKKGAFPVLLQTFKEALQHMDGYINEQGKINLAR
                     FSIWLKYLSDFEYLNFEKKDIDVNWFNQQLENISLEGERKRQRMGKRLLMKQQKKLIG
                     AVKPWLLKSVQRKMTPDVDENDIEIFPLEEKEVVLANLDFLKEFAFNLGLILAHSQSK
                     DMYYFKLDLDSINMQETDEEHEARIHETRRSIKKYEQGVVIASEEELEEEREIYSERF
                     VEWKDKYYKDKLEFSIKDTDKLKEMTENYVEGLQWVLYYYYRGCPSWSWYYRYHYAPR
                     ISDIIKGIDQKIEFEKGTPFKPFQQLMAVLPERSKNLIPVVYRPLMYDEHSPILDFYP
                     NEVELDLNGKTADWEAVVKISFVDQKRLIEAMAPYDAKLSPEEKKRNSFGTDLIFIFN
                     PQVDTIYKTPLSGFFNDIEHNHCIEREFITESPENIKFLFGLPKGAKLGASALAGFPS
                     LKTVPLTAGLEYNSSVVFNFPSKQQSMVLHIQDVFKENHISLSDLAKRHIGKVIYSRW
                     PYLRESKLLSIITEDTIYESISTGKTSKLMERRPQDFERKEFRELKHSLKSNYQRTKA
                     VILDDVYAVAKVIPVNGLVRNQDGSYSKSFSDEIEFYPLQLIVEDVENKDERFAEKEA
                     LPIDKEFPEGSKVVFLGDYAYGGEATIDGYNSATRLKLTVKKSSIRAEPNIGKVRAKL
                     DSQALKYYSTQAFSKITRVHPLFLSKITSRYLVVDSKKKSYNVGLMIKFKARNQKVLG
                     YARCSSNNWEYSDLARGLLEQFRSTFPEFFIRLSNSKEQAIPSITDIFSDKSPVEADA
                     ILKSVADWVSEARKPFVVVSLESDSLTKASMAAVESEIIKYVSLPDSTEEKKLAKVPR
                     EAILNAESSYVLLRSQRFHLGDRVMYIQASGKVPLHSKGTVVGYTTIGKNVSIQVLFD
                     NEIVAGNNFGGRLQTRRGLGLDSSFLLNLSDRQLIYHSKASKDVQKKSTTTSNSKQSM
                     LAKKKKVEELKKKQAHELLNHIKKDNGKEENGSETSGQTGPQISVNALNPSAASNVFN
                     AVLNQIQPVMQHPIPQPPPGTALPYNFPVPPSMMVNGVAPPHMMPPQFLPNGQPMAPI
                     PVPQYSQAPKVEQPVNEPAVDEEASRSLKNLLLHDDHEKPSGKSGDVGNSSGKPTRGR
                     GGNRGRGNNRGRGGSRGGKRGGFSRGGKASGKSENSA"
     gene            complement(<661014..>661841)
                     /gene="CWC26"
                     /locus_tag="KLMA_40275"
                     /db_xref="GeneID:34716263"
     mRNA            complement(<661014..>661841)
                     /gene="CWC26"
                     /locus_tag="KLMA_40275"
                     /product="pre-mRNA-splicing factor CWC26"
                     /transcript_id="XM_022819569.1"
                     /db_xref="GeneID:34716263"
     CDS             complement(661014..661841)
                     /gene="CWC26"
                     /locus_tag="KLMA_40275"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CWC26"
                     /protein_id="XP_022676122.1"
                     /db_xref="GeneID:34716263"
                     /translation="MSLNDFLAKAYGSKSGDKKSKKAKAKNKKLSSPGKPDSDSIIST
                     SSIDIVDNSSKIVDTNKKDITSGQSGEVLWKNLETKQLEPLKLTPSDDANVELNKKEQ
                     MSSGAFAGLHTAEEIEKQIANKEQLDIKEAGILTGNQTTTYRDEKGKIIHGYEKKMEE
                     KRDMENLAKVRREEEIKIRNMGEVQLSNINEKKSKDTSLLIEDPLLLSNSSKKTPTSL
                     LGRKLYDKRYPENRFGIAPGYRWDGVDRSNGFEAKWFKKSNEITEAKLKERSSNRDF"
     gene            <662143..>663180
                     /gene="SAE2"
                     /locus_tag="KLMA_40276"
                     /db_xref="GeneID:34716264"
     mRNA            <662143..>663180
                     /gene="SAE2"
                     /locus_tag="KLMA_40276"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819570.1"
                     /db_xref="GeneID:34716264"
     CDS             662143..663180
                     /gene="SAE2"
                     /locus_tag="KLMA_40276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676123.1"
                     /db_xref="GeneID:34716264"
                     /translation="MSQETEESLESWLHNLEWSQLLSLQKQLVSEMDRRYCELSTTKE
                     INVKNELDEMVEELPSTQFDPVLHKTHSKRCGTDLSAGRRTIKKEELSEAISLRRNME
                     LLSSPLKENEIILDSQASDILKEQDTNIRLSQQAVDLKQRLPKSPVKRTLFSQSSTEN
                     NKKQKCMIDFNINPITKKPWIYEDFKPNDSMSDKKGKRTSKKVARFHEKAGSPIKDKQ
                     RTILNDNGLLETVDHQTQRQQQQFTPKKQEIPDLHFEDDSFENLRVRSKSPPGYGRLN
                     FPTTQERIDDKEESKKLLYQKTKERFLEATNNLVPITEREFYFRNSKLNDIVDDGNFT
                     WTAEELKIFTR"
     gene            <663527..>664876
                     /gene="NUF2"
                     /locus_tag="KLMA_40277"
                     /db_xref="GeneID:34716265"
     mRNA            <663527..>664876
                     /gene="NUF2"
                     /locus_tag="KLMA_40277"
                     /product="probable kinetochore protein NUF2"
                     /transcript_id="XM_022819571.1"
                     /db_xref="GeneID:34716265"
     CDS             663527..664876
                     /gene="NUF2"
                     /locus_tag="KLMA_40277"
                     /codon_start=1
                     /product="probable kinetochore protein NUF2"
                     /protein_id="XP_022676124.1"
                     /db_xref="GeneID:34716265"
                     /translation="MSKDVFPLLELGELVTCLQSCDFSLATEENISRPTSQYVITLYK
                     QIIDSFMGVSPDSLLSDKTLFDTGSSDTQQPPLYMETVKVLALNKICFKFFQDIGVSD
                     FNMMDLYKPDSLRTRRLLSAVVNYARFREERMFDCDKFMSKTEFLLNQLRSKFDDYNY
                     LQQRINKHRNEIELKDGETIETLQHQNRHLEQQITKLKNLQETLNMDYNTYKSRKQSL
                     LNDLEKFGFELIELEFERNKLEKHAKTDLNELNENIEKLSTLLNTHQNNLDNLEQKHR
                     KLRTSMNTFQALAQELYEVLQIISTDLQEAHLKEANLIDMREQYLQTDEKLNNILSAG
                     VMVKLKILQSQLDNQKQKLRQLREETKVKQDKNEETLQLLQKQYTDEVVPELRAAEAE
                     VENEIINGAIKDHKREIEQLKQQFQAEVKDIDLEYTLLSDHINRYMEEMLRVMTGAV"
     gene            complement(<664931..>665692)
                     /gene="PRP11"
                     /locus_tag="KLMA_40278"
                     /db_xref="GeneID:34716266"
     mRNA            complement(<664931..>665692)
                     /gene="PRP11"
                     /locus_tag="KLMA_40278"
                     /product="pre-mRNA-splicing factor PRP11"
                     /transcript_id="XM_022819572.1"
                     /db_xref="GeneID:34716266"
     CDS             complement(664931..665692)
                     /gene="PRP11"
                     /locus_tag="KLMA_40278"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor PRP11"
                     /protein_id="XP_022676125.1"
                     /db_xref="GeneID:34716266"
                     /translation="MDYQNRAGSKKGGGGIASDSQQNLQRRKQVQDLLSNGEEVPFTF
                     QQDQEGSKFRANPDIYRNHSGKLVCKRCKTMHVSWSSVERHLMGKKHQLNVLKSTARN
                     GKSKENEENVRDQEFQQQVNDLRANLSYNGIKPEVQVVKVKHPEKDLFGICVRVKYDN
                     EHRKKSLKEDSFIPFIRILSDLELNNSDASNAKYLVVAFEPFENVGIQLPNNEIELND
                     YDPSEPYAIDDLNRKCTYWDVDSGEFYIQLFFRHN"
     gene            complement(<666025..>667361)
                     /locus_tag="KLMA_40279"
                     /db_xref="GeneID:34716267"
     mRNA            complement(join(<666025..666465,666801..>667361))
                     /locus_tag="KLMA_40279"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819574.1"
                     /db_xref="GeneID:34716267"
     CDS             complement(join(666025..666465,666801..667361))
                     /locus_tag="KLMA_40279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676126.1"
                     /db_xref="GeneID:34716267"
                     /translation="MLGRSGTHFQLQQVRHISKRTIAYPPYPFSLLANKNRKIRHDSN
                     LKYAMRQFLGPKNFKGEYIYNRYFSPPQDHKPKYVTPDLERGQSLRDPVTGEVVKYTN
                     DKNVVPVSGRSPFAPRGDRMLRPFPQNEHCRTNFIIDEDMRLEIYEKVQIEKLSAQEV
                     SRAYGLKVPRIEAIVKLVEIEKQQEKYNRIKPQQRVMADTLFKMFPVFKPSNNENLSE
                     IPIPSKALSSRFLTIAESQPFGPVDAAKVLELEPAAVTLEKLSTEGEHAIGHDKFVSH
                     KNKKKVVYGELLEGERSKLKFVHSQVGKVGFRYGSGNRDNRKNRAIGFNELGKMVYL"
     gene            <668250..>670286
                     /gene="MPS3"
                     /locus_tag="KLMA_40281"
                     /db_xref="GeneID:34716268"
     mRNA            <668250..>670286
                     /gene="MPS3"
                     /locus_tag="KLMA_40281"
                     /product="spindle pole body assembly component MPS3"
                     /transcript_id="XM_022819575.1"
                     /db_xref="GeneID:34716268"
     CDS             668250..670286
                     /gene="MPS3"
                     /locus_tag="KLMA_40281"
                     /codon_start=1
                     /product="spindle pole body assembly component MPS3"
                     /protein_id="XP_022676127.1"
                     /db_xref="GeneID:34716268"
                     /translation="MVIDSITKTETLGEEQGSRMDRSRLYNKSIREAYENMVRESGSG
                     ISTSSDSVPRRGFVSGYHDSRDSRDSQKMSSPEGLSHNAGQVADFENSEFSDNEAVED
                     EQDGRDSESDYLQFKKSLIQDDEWLDDESDTDYTEEADRSFLLDNNDDELYSDGYEED
                     SGSGSFARNRSRSRYGYLGDSDVSELRSNWISSKFWVLLSVIISLWFVGSWISSNASS
                     PLTPDLNKRINMLQNQLNQLNHERDLQKKKYQSDLDQNVKLIIQQFEKNIKRILPKNI
                     KDFSKIYSSMENLESKVDTLNEKIAWNNVNETLSRLNDVLPTEIPVIIDSDRVAENGN
                     ITEKQVLLIPELHNYLAELIPALINSSIDVQSILTTSTFKYDLNNYVKEILSNEFQFI
                     ERTQFIQEMQSYMQVIKEELSKELESKTSHLQSPQQISTLVLKKMVHRIYNSNQHQME
                     SSLNKATFSQGAKILNHLCSKTVKGSTTPVDLLQDCSFGCSTSTYWHCDSKNCQWAIR
                     FDEPLFLTKISYLHGRFSHNLEVMSAAPKVISIYVKPLTPSKDLQKMPKWMRDSSYVK
                     LGSLHYDLYSKLIKQDFLLPDWFIKSKTLVRSMIFVAEENHGNKDYTAMRKFIVNGVT
                     PKDLQLMNSFPADWAHMTPEYSVSVEEQERARLSEVATWQDQQVPSFGEDEIVD"
     gene            <670988..>672625
                     /locus_tag="KLMA_40282"
                     /db_xref="GeneID:34716269"
     mRNA            <670988..>672625
                     /locus_tag="KLMA_40282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819576.1"
                     /db_xref="GeneID:34716269"
     CDS             670988..672625
                     /locus_tag="KLMA_40282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676128.1"
                     /db_xref="GeneID:34716269"
                     /translation="MVGLTLKSAFQFKRKTSDKAYSGGGRLSRLASVANELHPQDYDA
                     LQPLLTLLNIQGQKCYASEAISGVFIAKVEDRGFVPVSKFSLIGTTLRLYVRSNDLNN
                     AVEDVIDIDIKLLWDHRISKNGDNYLLSFYSNNDISLVSLNEKDVLQVSKLISLAQFE
                     YGSLFKSLTATIISSVGLKIPDIHVILNNNFSFKDWCYIYLNNEWVKVWCHVDKRKKP
                     GDPKGKAKVKFYRDDKSTSKKNLICFISDLDPVEEVFLTTEPFIPTKVDGVNWDLERL
                     KTLSHSGLNTSDALDTFMENLDTVSVLGTVNWVNPESASDSPRSSRSRSSSFAWVSKS
                     PRARGLSMSDTKLQSRSAKASSTTLTDLPTSPVSKSHKRVMSEASMSSTTPIDLDDAS
                     FESSSERFLFKPIPHAGVHHLETIIRFLLPIYDCLQLYGRPASFRNGREDYHSLTFGL
                     PKLPSVDFFSKGELENLFSESAMDFDLNTLDRWKYFKSALRECYEDESRTSTQSFRTL
                     SSSLNHSLVRIPLSPSSNSKLQYSTTCNNSNDSPPIL"
     gene            <673198..>674805
                     /gene="CCT3"
                     /locus_tag="KLMA_40283"
                     /db_xref="GeneID:34716270"
     mRNA            <673198..>674805
                     /gene="CCT3"
                     /locus_tag="KLMA_40283"
                     /product="T-complex protein 1 subunit gamma"
                     /transcript_id="XM_022819577.1"
                     /db_xref="GeneID:34716270"
     CDS             673198..674805
                     /gene="CCT3"
                     /locus_tag="KLMA_40283"
                     /codon_start=1
                     /product="T-complex protein 1 subunit gamma"
                     /protein_id="XP_022676129.1"
                     /db_xref="GeneID:34716270"
                     /translation="MQAPVVFMNTSQERTTGREAQIANITAAKAVADVIRTCLGPKAM
                     LKMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGE
                     ILAQCAPYITEKNIHPVIIIQALKRALSDALEVVKQVSKPVDIENESAMRKLIQAAIG
                     TKYVNHWSEKMCELALNAVKTVRVDLGSTSQGETNYEIDIKRYVRVEKIPGGDVLESK
                     VLKGVMLNKDVVHPKMSRLIENPRVVLLDCPLEYKKGESQTNIEITNEDDWNRILQIE
                     EEQVRLMCEQILAVKPNVVITEKGVSDLAQHYLLKGGCSVLRRVKKSDNNRIARVTGA
                     TIVNRVEDLKETDVGHDAGVFRVELIGDEYFTFLDDCKNPKACTIMLRGASKDILNEI
                     DRNLQDAMAVARNVMLSPSLSPGGGATEMAVSVKLTEKAKQLEGIQQWPYQAVADAME
                     CIPRTLIQNAGGNPIRILSQLRAKHAQGNFSYGVNGDNGNIVDMVEYGIWEPEVIKQQ
                     SIKTAIESACLLLRVDDIVSGVRKQEQ"
     gene            complement(<674917..>677817)
                     /gene="BUB1"
                     /locus_tag="KLMA_40284"
                     /db_xref="GeneID:34716271"
     mRNA            complement(<674917..>677817)
                     /gene="BUB1"
                     /locus_tag="KLMA_40284"
                     /product="checkpoint serine/threonine-protein kinase BUB1"
                     /transcript_id="XM_022819578.1"
                     /db_xref="GeneID:34716271"
     CDS             complement(674917..677817)
                     /gene="BUB1"
                     /locus_tag="KLMA_40284"
                     /codon_start=1
                     /product="checkpoint serine/threonine-protein kinase BUB1"
                     /protein_id="XP_022676130.1"
                     /db_xref="GeneID:34716271"
                     /translation="MVPIHFDELEGHKENIVSLTGGRSASRLLKSMKKPLETSYDIRL
                     SFEKRIHDTLDELDDPLEVFIEYINWIHDTYPSPTTRQSGLPEILERCIEYCKTIDTY
                     KNDVRYVKIWLQYIEFFAIRPEEKKDMFVYMMRLKIGDKLTLFYESFAQLLINRDAFG
                     NALDLVDRGIEKGARPLVRLKRFRMQIEKILQTRGLVGQDIQRNSIPFEIQGELVLGR
                     YIMDVHQRNHRSINGNFDNNSISGNTSEERSHSSQRSAGTGKLQIFSDKNDVEQGSSN
                     FKFDGDNFSIPSFTERNKENSIKPIPLKSGSVIAPLNQSNEYLPRDVDRIPIFRDDLG
                     RTSPVYKIIEVPGRKPEKVQINFNLLYPTDNEEYCLEEVLAIAKNCYTKKKTSSLKHS
                     LDETTTERTPPLKMKGLKPKSPEYQKVTTTSILPLKGDVEVNGMTGHSDGKSKSPTVT
                     MFSKDAMNEVYSMFNQSYHETKLYSDHDDTTTGKFTMFENFQDDLSTKNLDDLTEVKQ
                     PSEKIGSLDSNNVTPAKDNDVESTTPAYKSKLQEYMTPIQERAESTFKSVISQEDDMT
                     EESRRKSINSINTAESSPFLTQPQRLLDNSSRYQIVENPLSLQLRTELLASLNPPLAT
                     YPTYYEYSQQLKMSSLLKRIQKVSKNMNKNPIVDFKKTNDLYCIRRELGEGGYATVYL
                     AESSTGQLNALKVEKPASVWEFYILKQIERRVPDENILKSIINVSALHCFQDESYLVL
                     NYANQGTILDLVNWEREKNGGALDECLCMFITVELMRVLECIHDVGIIHGDIKPDNCM
                     IRFQKVSHLGKYFANGENGWNSKGIYLIDFGRSFDLSLFPLGTKFKSNWKTDQQDCPE
                     MRENRPWSYEADYYGLAGVIFCMLFGHYIETVKVQNDRYKLKSSLKRYWQQDIWGPLF
                     DLLINSGNHGSTLKSDLRSYRERMELYLERDSGMKLRNIVLNLESDLEHLGK"
     gene            complement(<678170..>680356)
                     /gene="VTC4"
                     /locus_tag="KLMA_40285"
                     /db_xref="GeneID:34716272"
     mRNA            complement(<678170..>680356)
                     /gene="VTC4"
                     /locus_tag="KLMA_40285"
                     /product="vacuolar transporter chaperone 4"
                     /transcript_id="XM_022819579.1"
                     /db_xref="GeneID:34716272"
     CDS             complement(678170..680356)
                     /gene="VTC4"
                     /locus_tag="KLMA_40285"
                     /codon_start=1
                     /product="vacuolar transporter chaperone 4"
                     /protein_id="XP_022676131.1"
                     /db_xref="GeneID:34716272"
                     /translation="MVKFGEHLKRSLIREYSYYYISYDDLKAELEDSLESNNGVWSEE
                     LETQFLESLEVELDKVYTFCKVKHNEVLRRVKEAQEQVSVAFHSLDSNTPVTDLDFQI
                     LEEELSDIIADVHDLAKFSRLNYTGFQKIIKKHDKNTKFILKPVFQVRMNAKPFFKEN
                     YDELVVKISQLYDIVRTRGNPVKGDSAAGGKQQNFVRQTTKYWVHPDNITELKLIILK
                     HLPVLVFNTNKEFEKEDSAITSIYYDNEDLDLYYGRLRKDEGAEAHRLRWYGGMGSDT
                     IFVERKTHREDWTGEKSVKARFALKEKYVNDFLHGKYTVEQAFAKMRREGKKSIQEIE
                     SLEALATEIQYTMLKKKLRPVVRSFYNRTAFQLPGDARVRISLDTELTMVREDNFDGN
                     DRTNGNWRRMDIGVDWPFNQLPEKDVCRFPYAVLEVKLQTQLGQEPPEWVRELVGSHL
                     VEPVPKFSKFIHGVATLLNDKVNLIPFWLPQMDVDIRKPAIPTNINITRPGREDDEEF
                     EDTEDEELAAPANSYDIEEAAGDVPVNRGAGQPTGVSSAPNYGAITENANVPSNSSEN
                     AAEILRKIRQASNPVTKYWYTLVYHIDHYLYGDQISKVPQGTVFDSYVSAPPGKTICV
                     PVRVEPKVYFATERTLLSWVSVGLVLGGVSTSFLTYGTPTTMVASIGFFITALVTIWL
                     STYTYCKRVVNIRMKRPIDYEDKYGPPMICAFLMASILFTFFCNIV"
     gene            complement(<680690..>681181)
                     /gene="RPC17"
                     /locus_tag="KLMA_40286"
                     /db_xref="GeneID:34716273"
     mRNA            complement(<680690..>681181)
                     /gene="RPC17"
                     /locus_tag="KLMA_40286"
                     /product="DNA-directed RNA polymerase III subunit RPC9"
                     /transcript_id="XM_022819580.1"
                     /db_xref="GeneID:34716273"
     CDS             complement(680690..681181)
                     /gene="RPC17"
                     /locus_tag="KLMA_40286"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC9"
                     /protein_id="XP_022676132.1"
                     /db_xref="GeneID:34716273"
                     /translation="MRILEERNAFMSDYEALQFLVSLQKEHRWTSDSRDRKNKHAKPY
                     YHPELQMITRDTVRYLTQRSTPAPEEQEEQEDQEQEAQAEKPKPKPKSTLLHLTTQQF
                     TELMQQLNHYPLYKAEKLQIVNQLPTNLVHLYSIVEECESRLDEGQVTSLLEAIERTC
                     LIH"
     gene            complement(<681556..>682935)
                     /gene="CRH1"
                     /locus_tag="KLMA_40287"
                     /db_xref="GeneID:34716274"
     mRNA            complement(<681556..>682935)
                     /gene="CRH1"
                     /locus_tag="KLMA_40287"
                     /product="probable glycosidase CRH1"
                     /transcript_id="XM_022819581.1"
                     /db_xref="GeneID:34716274"
     CDS             complement(681556..682935)
                     /gene="CRH1"
                     /locus_tag="KLMA_40287"
                     /codon_start=1
                     /product="probable glycosidase CRH1"
                     /protein_id="XP_022676133.1"
                     /db_xref="GeneID:34716274"
                     /translation="MRYSCIASAIALSSSVAYAQEAACNPLKNSSCSPDPALGGSISV
                     PFTEESSHFPRYAKAGNITYSDNGAEMTIAKRFDNPSVVSDFYLMFGKVQAIIKAAPG
                     QGIISSFYLQSDDLDEIDIEWTGTDITQVQTNFFSKGVTGSYDRGQFHGVDDPQGKYH
                     NYTIDWTKDQIDIYVDSALVRTITSDNGQGYPQSPMRIFIGNWAGGDPDNQPGTIEWA
                     GGVTDYTKAPFSMFVKDLVAVDYSTGSEYSYSGTEGTSDSIEAKDGKVYGRYDDAVAD
                     FDKLVNGGTVADSEGSSSSSSSASESSTSSASSASATSSSKTTATTTTSSSSEKKTAS
                     STSTSVSSSLSQNVTTTTVNATQITSKLTSSTSSLVSINNSISASRTSALNTSSTLVT
                     STLAADEKTETLSADTTTAAPLSSQSANATVSSTKSAASSSLKTSDTNGAAQTLPQLL
                     AFIPAALLL"
     gene            complement(683606..683720)
                     /locus_tag="KLMA_R415"
                     /db_xref="GeneID:34718713"
     tRNA            complement(join(683606..683650,683684..683720))
                     /locus_tag="KLMA_R415"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34718713"
     gene            complement(684111..684186)
                     /locus_tag="KLMA_R416"
                     /db_xref="GeneID:34718714"
     tRNA            complement(684111..684186)
                     /locus_tag="KLMA_R416"
                     /product="tRNA-Val"
                     /db_xref="GeneID:34718714"
     gene            complement(684211..684283)
                     /locus_tag="KLMA_R417"
                     /db_xref="GeneID:34718715"
     tRNA            complement(684211..684283)
                     /locus_tag="KLMA_R417"
                     /product="tRNA-His"
                     /db_xref="GeneID:34718715"
     gene            <684693..>685055
                     /locus_tag="KLMA_40288"
                     /db_xref="GeneID:34716275"
     mRNA            <684693..>685055
                     /locus_tag="KLMA_40288"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819582.1"
                     /db_xref="GeneID:34716275"
     CDS             684693..685055
                     /locus_tag="KLMA_40288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676134.1"
                     /db_xref="GeneID:34716275"
                     /translation="MIWKRSIIGQLNTGRLAFSHIRQFHASSPALYKKWNELKKDDKQ
                     EFIKNFVSLYKEKHPCSKSNVMYRALASEMDEYNDTPYVFGVLYNEIRAVEKGESTDN
                     QKGVGPMGDPDFVKLLYK"
     gene            complement(<685206..>685676)
                     /gene="APS1"
                     /locus_tag="KLMA_40289"
                     /db_xref="GeneID:34716276"
     mRNA            complement(<685206..>685676)
                     /gene="APS1"
                     /locus_tag="KLMA_40289"
                     /product="AP-1 complex subunit sigma-1"
                     /transcript_id="XM_022819583.1"
                     /db_xref="GeneID:34716276"
     CDS             complement(685206..685676)
                     /gene="APS1"
                     /locus_tag="KLMA_40289"
                     /codon_start=1
                     /product="AP-1 complex subunit sigma-1"
                     /protein_id="XP_022676135.1"
                     /db_xref="GeneID:34716276"
                     /translation="MSQIKYMLLASRQGKTRLIRWFQTLDPKQKTQILREVTTTVLSR
                     KSKMCNILEYQDHKVVYKRYASLYFIAGIDSESDNELLTLEIIHRFVETMDKYFGNVC
                     ELDIIFNFSKAYSILDEMIMCDGSIIETSKEEVIHAVASMDAIESNDDLDRVLS"
     gene            complement(<685944..>686843)
                     /gene="DPH5"
                     /locus_tag="KLMA_40290"
                     /db_xref="GeneID:34716277"
     mRNA            complement(<685944..>686843)
                     /gene="DPH5"
                     /locus_tag="KLMA_40290"
                     /product="diphthine synthase"
                     /transcript_id="XM_022819586.1"
                     /db_xref="GeneID:34716277"
     CDS             complement(685944..686843)
                     /gene="DPH5"
                     /locus_tag="KLMA_40290"
                     /codon_start=1
                     /product="diphthine synthase"
                     /protein_id="XP_022676136.1"
                     /db_xref="GeneID:34716277"
                     /translation="MLYFIGLGLSYETDITVRGLNAIKQCSRVYLEHYTSILMTASLE
                     ELEEFYGKKVILADRELVESGAEEILRDADKEDVAFLVVGDVFGATTHTDLVLRAKQR
                     KITVEVIHNASVMNAVGSCGLQLYNFGQTISMVFFTDSWRPDSWYDKVWENRKIGLHT
                     LVLLDIKVKEQSIENMARGRLIYEPPRYMSIAQCCEQLLEIEETRGTKAYTPDTPCVA
                     ISRLGSATQSFKAGTIKELAEYDSGEPLHSLVILGRQTHELEIEYLLEFCDDKEKFKE
                     DVLKDQEYFKPAPWVPPEEDLEE"
     gene            <687195..>688976
                     /locus_tag="KLMA_40291"
                     /db_xref="GeneID:34716278"
     mRNA            <687195..>688976
                     /locus_tag="KLMA_40291"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819587.1"
                     /db_xref="GeneID:34716278"
     CDS             687195..688976
                     /locus_tag="KLMA_40291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676137.1"
                     /db_xref="GeneID:34716278"
                     /translation="MTDSERQPLLQEPNQGERDIAIETEGVTKAKHEKTYWNRVRILL
                     FGIGLIVVGLIFFVLVYVTRVVPNDESFKEYAGNITNVDVQDVSFDGWTHINKQRYYK
                     IKLQSSVWLDYEAGSSISDSQKQIASFLGGKIAREVCFDLNKLDTYQQENDTTQISLG
                     SIIIPETVCIDLRHNKTTDLDLLVLIKPNTDKLIPILKQIWEKKYEGLNIWSSVNLDL
                     KKKIFSREFVLWKFNQVHLYWQDFGIWERLLTSLRHLSENINDTVEQIEINDITLKEL
                     KNGYEVYCSVGVPNPLPESHINLSPEVILAPQIQWYPTLPGCLKNEGIELENVIISSP
                     ELDWNSMLSDFVNLTIKANLIGELPDDFLNHVCSSDDSNIITPMSKFLSNLLDPKSLI
                     DMKIECSSLEKPSKSKAILEDYDIIRPFLDTSFSLNYTVNIDDIVQEVNTRGIKLEWS
                     TDFLGRRRLNIKGKIVAKVQIPFYQVKEDTTLSMERIKGHTKLYHNDVHMLTVPLDYW
                     TNCSSQVILDESDPTKSYFDVSFDIDNDQVIVEDTLELTHCINEIVFKGESLIFLKGK
                     LDLMVTTSIGDIVLLKLPGEGSTIVRA"
     gene            <689419..>692979
                     /locus_tag="KLMA_40292"
                     /db_xref="GeneID:34716279"
     mRNA            <689419..>692979
                     /locus_tag="KLMA_40292"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819588.1"
                     /db_xref="GeneID:34716279"
     CDS             689419..692979
                     /locus_tag="KLMA_40292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676138.1"
                     /db_xref="GeneID:34716279"
                     /translation="MKPTNIAMDKKSGKSCLVCRRRKVRCDRVKPVCLVCVKHGSNME
                     CNYEEQKRDIKFVSMKTPEMSTKIKKRQPEKSSTKSQGNATVVKELDVLKQKVQSLES
                     LLINNITPTEHKVSQSKYSKTVPSSSIDDEFQSLDLSHYKDFNFYQDLETVDVRGGRL
                     SFIGALNCMSMSRVDPYLMTITTLTRKAHHDRSSSFIRYLGNRKYSNLEYIPELAKEV
                     LVAKSSDKNTVMDAMIEIDNDHSEKNKKKRSRETGNSNGEDSSVTSSNDELDNELDDN
                     EKEMTENDVKGQEQREKFARKYLEDQNMDGILTKNNKSSRPSLSEILNHSTLAKSSDV
                     SPESNTSPIPRQAVENTASVPRELNIKKDSLNMRSEVTNNSSSLQSVKNDTPIGFADD
                     ETEALYYLNLLLPPARVIWIHVSNYFSSPLNALYPFSTEDWFTDILAGLIGPPSESED
                     PPVLKVVKKLDFSKIAILFVIMRLSYLMYPSDLEHCSTEEEKYVVSHEIGPVYIEVAN
                     LCIRMFNLFRRGVLPVLHCLLLLRVYRRYAPEEGDIADGADSSNFTGLLVQIAESLGM
                     NTDAEKSYQLTNFEIYLHSWRKAWYTIYFLDISEAMNMGNCFAIDTDQFNTKLPTIKK
                     NPNYGMPDFILHPSHEMASVDCCQKNYEFSLYVRDLLKIVMSKRLNTPCNVIMDHINK
                     VERNLKDRYAKSLSSIIALPSSGPQESIEKCNIFRFYVETQSMLLMIQLRLFIHLENN
                     HTDSNSGSFSKPFQLFKKCLSLYIDLEPLLILLFFHDKNDDKNNSYIDKIFGTRTKII
                     ILQTCNHIFVRFQIVLHILLARLLHLYHGYLKNPEPMIKNSEDFLKIKSLVVKIIENA
                     LDKLEFANSITQSLSGNQFQAWRLSKGNGFLYSIFKEKNDNIFDPNAPTNLKFQKLSM
                     QRDNFGNNILPDNLNPLKQLPKYNNFLNLELSQFEELYSIINSTRWSIFNSVIDKDKL
                     KAAMNFRSSKQKNPAMSQKKKFRSKGHRSSLTSKSKSSSNNNGHRFSGTPSNSSSDAI
                     DFTPQVSQIKVNEVDTHWFNTILRNNNTYPNWNRDNFERNIAPSGGIPSQSPVVIDAN
                     GSFSDFAKSNFTSLDESISTTSFLHENLIQQLQIISGKPSVSFNNNNNNNNNNNKNSI
                     KLTSADNDVEPKYHHSQQKTNFNSIIDSTDLDYLLFNGDI"
     gene            complement(<693057..>694832)
                     /locus_tag="KLMA_40293"
                     /db_xref="GeneID:34716280"
     mRNA            complement(<693057..>694832)
                     /locus_tag="KLMA_40293"
                     /product="leucine-rich repeat-containing protein 6"
                     /transcript_id="XM_022819589.1"
                     /db_xref="GeneID:34716280"
     CDS             complement(693057..694832)
                     /locus_tag="KLMA_40293"
                     /codon_start=1
                     /product="leucine-rich repeat-containing protein 6"
                     /protein_id="XP_022676139.1"
                     /db_xref="GeneID:34716280"
                     /translation="MSSMLVCYGEKSDESKLNKSFGLTILSLLEIEGFRIRQLKIWCA
                     DKGIELPEDVWDCCVDGLQQLSLIKFIICLHFSNKQLETHREDIFKQKQLLWADIGIE
                     SLKFDDLYNLDGDLEHNFGDPLSKYALELYTTNLFLRCSMMYHIKDFVQHCCATKTKM
                     ESLENRIETFPELFAKGVESVVKIPWKFPTPFLKKVTKEQTLDSKISICFSKVMLKDA
                     SKLYRNVDPEDVGLGYVKVDLKWLESSNTYVLSKLEDETSQTSLALEEIKQRQIERQR
                     IFEDDLEFMTPKADLEVFRLFQKDEIEVDDTDTHTELKDKAEKPETYIEETTLGEPLI
                     VGREVVAENSDVLEMESCVPQTIQTNQQMNPKRELQLKQQEHQQHQQHQQQQVKSNPI
                     KPVFEPPLSHIKVEHDFQKENFAMNSVETDTLHVNSEFHEKIVTGMDHVSPLRTSNND
                     VMDMVPIDFAMVSSFNHLMFVPKLDDVNEADCIIKIEVRKSASLSSPQEYIPFSQRLS
                     RLCWFLKKNKTEKSTDTFMLNKGQFSNFQDMTLPPLESKVTFRKFLRAKIRQIKEDIL
                     YYKNVAIYCMDDIKNYTPEEQEYTA"
     gene            <695628..>696218
                     /gene="SYM1"
                     /locus_tag="KLMA_40294"
                     /db_xref="GeneID:34716281"
     mRNA            <695628..>696218
                     /gene="SYM1"
                     /locus_tag="KLMA_40294"
                     /product="protein SYM1"
                     /transcript_id="XM_022819590.1"
                     /db_xref="GeneID:34716281"
     CDS             695628..696218
                     /gene="SYM1"
                     /locus_tag="KLMA_40294"
                     /codon_start=1
                     /product="protein SYM1"
                     /protein_id="XP_022676140.1"
                     /db_xref="GeneID:34716281"
                     /translation="MSAFFKWYTTSVKRSPKLTNGIMTGSLFGIGDAVAQVFFPENGK
                     KKYDAARTFRAVFYGSIIFAPIGDKWYKFLNGKIVLKPGEHWINNVARVLCDQLIFAP
                     ACIPVYYGVMTLFEGKSIASAKEKIQNNFSSTLVTNWYVWPWVQLLNFSVVPVHHRLL
                     TVNFVAIFWNTFLSIKNSKVTDDNKKIPVNYPPIPE"
     gene            <696567..>698270
                     /locus_tag="KLMA_40295"
                     /db_xref="GeneID:34716282"
     mRNA            <696567..>698270
                     /locus_tag="KLMA_40295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819591.1"
                     /db_xref="GeneID:34716282"
     CDS             696567..698270
                     /locus_tag="KLMA_40295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676141.1"
                     /db_xref="GeneID:34716282"
                     /translation="MLCRNNPCVRVLLKPRLIKTSYQQRFYSKASSIPKRRLINWKTV
                     TLGVAGTTLVFYNTNDTFYMFSRHMYLTMGRVNVAAQALVRCFYHYKKTLGGKYKDKE
                     DYQRALKDCHKKCAVITLNALERNGGIFIKLGQHIGAMTYLLPPEWTETMVPLQDKCP
                     ESTVEEIDRMFQQDLNCSLDDMFSEFDPNPIGVASLAQVHIATLRDTGEKVAVKCQHP
                     RLKEFVPLDVMLTQTVFNLVDIVFPEYPLTWLGDELQSSIYVELDFVREAQNAKKTAE
                     DFANSLDKTALRVPEVINANKRILILEYVSGERLDNLEYMKDHKISRSEVSSCLSHIF
                     NGMIFTPNVGIHCDPHGGNLAIRAVDRPYGGHNFEIILYDHGLYRMPSTEMRRDYAKL
                     WLALLDQDQEKLHYYAKRFAHIDDEQVPLFAAAITGRSIDTALNYDISKPRSQEEMTV
                     MSKKLTEGDMLIDLMSILSKIPRIVLLILKTNDLTRHLDECLKNPLGPERTFLIMTQY
                     CSKLVYQEAQELINRTYSRWSLKWILFELKAWLEFERRKNQLVLYDLALWWKGKTTGL
                     H"
     gene            complement(<698340..>699362)
                     /locus_tag="KLMA_40296"
                     /db_xref="GeneID:34716283"
     mRNA            complement(<698340..>699362)
                     /locus_tag="KLMA_40296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819592.1"
                     /db_xref="GeneID:34716283"
     CDS             complement(698340..699362)
                     /locus_tag="KLMA_40296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676142.1"
                     /db_xref="GeneID:34716283"
                     /translation="MSLKTLLDPEVKARFLKASHANVVSHLKALENGLTRYSKNPSIV
                     PPRTKALTPSGEAIHLFMPVVDDIYCGVKTLGYNEKSGLGFVGSINVLDPTNGLIRGV
                     VDAKQVTGIRTALSSHIGLSHLSHKFDGIEKLNVTVFGSGLQAFWHSFVCAKLFSAKQ
                     VDLNIVHRSKKLDDRELCNACSNICSVNYVKIDSSDIGQLCRKSHVIFGTIPTSEPSI
                     KEHFFRQVPEEIDSTSFTYISLIGSYQPHMHECDNALVSAFRDQNVKIIVDSAEHTLL
                     ESGELIDAHIKPSNLIEIGKLASTHDSCELEAKIGPKSITLCKIVGLAIMDIVTAKKL
                     IEDDES"
     gene            <700814..>704488
                     /gene="HAP1"
                     /locus_tag="KLMA_40297"
                     /db_xref="GeneID:34716284"
     mRNA            <700814..>704488
                     /gene="HAP1"
                     /locus_tag="KLMA_40297"
                     /product="hap1 transcriptional regulatory prottein"
                     /transcript_id="XM_022819593.1"
                     /db_xref="GeneID:34716284"
     CDS             700814..704488
                     /gene="HAP1"
                     /locus_tag="KLMA_40297"
                     /codon_start=1
                     /product="hap1 transcriptional regulatory prottein"
                     /protein_id="XP_022676143.1"
                     /db_xref="GeneID:34716284"
                     /translation="MEQTWAEEAEKELSKDSELKQLRELVKSLEETLSKVHATSGNNN
                     STAGNSPAAGGGGIGSVGGSGAPDGTPVANSFIGGSKKLLSGPNHQSPVLTGGTIQSS
                     QDKYDNDELDLTRQFDMLHLKNNGTVHLGATHWLAIMKGDPYLKLLWGHIFTLREKLS
                     EWYQQKRKPSASGSISGPAGGGGGCPVIHGSMSQQSKCPVAHVSGYPIEKPNSTEGRC
                     PVIHSNIGGTNNEKSNHGSSNASPVINKCPVAHGNPGFSTGSGTCPVTHATVKEENDS
                     RSGSGCPIDHTKYLSAEGKAKLPALPSFQNLTAKCPVMRDSTPTPTGQEMPPTQMHPT
                     AIPEMTPEQAAEAIGKLLPPKKIIILFLDKFFNHIYPIVPILDEQNFKLQVNQIIQTT
                     NDTTTVKLTKASDACILGILLIILRLTWLSLPPNACKIKLGPECESLKLEPTYSATIT
                     QAKEESMLLKYETPLETVAIVRKFLIRFDEISSFANSNVNITTVQFAIFYKLYLMCCP
                     DKTGDTQLNTFTSTGQDNETHQVLMSSIVQMAFSCGLHRDPDNFPQLNSAVNGSKLNK
                     EAMLNTERLKHTWRKTWFFIVSLDVQQSLSLGTPRLLRNLNDFSDTKLPCASKIDYVN
                     DIKELVVVKNFTLFFQIDLCIISVLNHILNVSLARTVRKFELDQLIRSLGKLRDGKTP
                     TTEVVKELVNKGLLFTTEGTVLLDQITEPTYTLPSLQTVISSPNMNSPEEREKKLNLA
                     HECTTRSLFFSKHITISMLEYLLNYVLFTHYEPLGNEDQGTRVLAKEYAQEALNHAME
                     GYRNCVLFFNSTGSNNMFSYMDVLLSPTCLDVGHRALQFIVCLILRAKCGPLTGMGES
                     PAIGAQSSNTNTSSSEDETDSQHRENAQPIANLLHDVSLDTSENLADILLARMMLFHK
                     LTKQISSKYTYATRMTKSTGFFITLLKKPSTKMKNGMKNKNLPRLSHHPNIANMTSFF
                     KNVPSLVLSAGGDQIKRCPVYQDAVGFLPSKVTSGTFNSFFHSNSQSPTTSAITQQLP
                     PLNIQYHPITFRDTLRRTSDVRGNPENIKRRKIDATQQSFPNANVEIKKETSQVSLPP
                     TPAPIPMATPLEPLISSLDKVSSLPPSKTPYSPTASLVGTQQTVAAVSNNHQINTRSP
                     AAPSDLSSITNSPDFEDFLSEHTQLNGLMINPSSIVEAVGFDGYIGPDSLGLQADFLP
                     IDNNEGLNEMAQLAEFSMWD"
     gene            complement(<704917..>706455)
                     /gene="AIM14"
                     /locus_tag="KLMA_40298"
                     /db_xref="GeneID:34716285"
     mRNA            complement(<704917..>706455)
                     /gene="AIM14"
                     /locus_tag="KLMA_40298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819594.1"
                     /db_xref="GeneID:34716285"
     CDS             complement(704917..706455)
                     /gene="AIM14"
                     /locus_tag="KLMA_40298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676144.1"
                     /db_xref="GeneID:34716285"
                     /translation="MESLDLIKRHGSTHYANIHYGYYVLGVIVFYVLFLMLMRRVIPT
                     RYTKISPWKNKLLQSIRTASPIFHLPLLAVLVFAPFIHHYSFIGNISVYIKRLGRLGY
                     VLVILNVLLTLRPVNPILGFNYLDFIPLHKWLSRFITVLGLCHGIAFIIKWSVNSDVS
                     VKSKVTALYNFIGVIAFLPLFAILFLSIRPYRRHNYNVFYVVHQLAQWSMVFLIPIHA
                     RPKVTVPYFLCLLAIYIWRAFSYCYYANTVNITQRIKQDQSLSYIKVERGNIRDWLPG
                     SHLRISKHKKTNPLYWLTPTKPYTIASLPDENQVDLIVREKAVPYVTVGEYTVVDVYN
                     TVSPSFLYDSQRVAIVVGGSGISFGLGVFKFLQARNLEYLKFIWLVKDKDDLHILNHC
                     NVDVNDIEVYVTRSFPDDDTQTKSHDTNNNNSNSSAFDDIDFELENMDESGALLSNDP
                     KMPPNIHFGKRLDWQVDLAHFIETHALENTWLVCCGPESLLKDGQNYANQNYCNFVKE
                     FYNL"
     gene            complement(<707101..>710640)
                     /gene="TY2B-LR1"
                     /locus_tag="KLMA_40299"
                     /db_xref="GeneID:34716286"
     mRNA            complement(<707101..>710640)
                     /gene="TY2B-LR1"
                     /locus_tag="KLMA_40299"
                     /product="transposon Ty2-LR1 Gag-Pol polyprotein"
                     /transcript_id="XM_022819595.1"
                     /db_xref="GeneID:34716286"
     CDS             complement(707101..710640)
                     /gene="TY2B-LR1"
                     /locus_tag="KLMA_40299"
                     /codon_start=1
                     /product="transposon Ty2-LR1 Gag-Pol polyprotein"
                     /protein_id="XP_022676145.1"
                     /db_xref="GeneID:34716286"
                     /translation="MNLMTFRQELIHVFLVQINQKCFYLENVRDIMLDSGTTVALVPN
                     KKLLYNIKDESNIKLLAAGQNEITVEGEGILKLKLNENISIEMKAMIVPSIKINIIPL
                     ASLYENNLYVDETCDNIKSLNGETITSIFKKDKLLWISGNHIQLPTEEHKVYQTTKSK
                     KYKVTLRELHRRLGHTNVRCVRETVKRGGIEDLSMSDVNWEGIDEFQCESCMKGKASR
                     HPHIKNSRDQYNEKYGPFEYIHTDIFGPIRLSEDSKSYRYMITFTDECTRYTWTIPLY
                     LKTERQVRVAFLTIIKQTRTQYNKRIKVFHMDRGSEYTSEWIRQVLKSRGVKLIYTTV
                     ADSRGNGVAERLNRTLLDRCRTLLDETGLSKEFWYHAIEHVVYDLNHTYKEKLKCSPI
                     EKAGIKPPKLKHIHAFGQLACYRINTNSKLDNRAKLGYLLHPSQESYGYIILDAETNK
                     LVDTTDFRPFYKNGPEGITEKEFYEQVGKWLHKAQTKMSSNNQEENNEPEFTTESHNK
                     RRKLTVHESEKNKSSTNDSDTVRHEENLDTQDVPSCGGGEIHSDPKDDSTKESDSDST
                     KLASAQDSQVSHNPNTESEQTTAEEFTAHKHPNDDFNPLQDAHKQLKRKITETVEDPE
                     EGSEKRFRVNYVKAVTDHDTIPYSEDATLSYSQAITGNKNKLLRDQFTQAFNKEINQM
                     RKMHVWDENKLIDISEVDRNKVINPMLVFSIKRDGTKKCRLVARGDQQDLSTYSKDRQ
                     QDTINNMALMTVLAVALDHNLIIKQLDISSAYLYADLKEEIYIRAPPHIKQKGKVLRL
                     NKSLYGLKQSGANWQKTIKDYLKGKCELEEMRFWPCVFTKGKFLEIIVCLFVDDIVIA
                     GNNINTINQFITDLQNRFDTRIVNDGSPNERDAVRYDILGIDVEYKKGVSMKFGMLES
                     LTKKLPLLGVEFKKESRYNIVPGTPDRSLKQDLDIPCDKDYDAKVNWIQRAIGLCNYV
                     AMKYRFDIAYYTNILAQHQLYPSDEVLYETERLLQYLWTTRGKRLVWKRNEKETSELI
                     GLTDASHAKGLKYKSQAGYFCIWNGKKLFARSTRTSYVCESTAQSETYAASECLAISR
                     SINYLLTTLTGKKPDQMLLTDNKALIDSVKGTKTIKPGARHNDLKLYAIKDKYQEGQL
                     KVEHIPTDQNEADLLTKPLKIKQFKVLTDKWMK"
     gene            712038..712146
                     /locus_tag="KLMA_R418"
                     /db_xref="GeneID:34718716"
     tRNA            join(712038..712072,712108..712146)
                     /locus_tag="KLMA_R418"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718716"
     gene            <712524..>713054
                     /locus_tag="KLMA_40301"
                     /db_xref="GeneID:34716287"
     mRNA            <712524..>713054
                     /locus_tag="KLMA_40301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819597.1"
                     /db_xref="GeneID:34716287"
     CDS             712524..713054
                     /locus_tag="KLMA_40301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676146.1"
                     /db_xref="GeneID:34716287"
                     /translation="MAEGEKHHADYTSFQTSDKKEALEQLVLSYEALSEGQDNWVCNL
                     ANAASLIWHCYISLGINVNWAGFYVTQSQNKHELILGPFQGKVACQLIQFGKGVCGTA
                     ASTKDTQLVPDVEKFPGHIACDGETKSEIVVPIVKDNETVGVIDIDCLDYNGFTELDQ
                     EYLERLATLISKTCTF"
     gene            complement(713173..713248)
                     /locus_tag="KLMA_R419"
                     /db_xref="GeneID:34718717"
     tRNA            complement(713173..713248)
                     /locus_tag="KLMA_R419"
                     /product="tRNA-Val"
                     /db_xref="GeneID:34718717"
     gene            <713845..>716250
                     /gene="ERB1"
                     /locus_tag="KLMA_40302"
                     /db_xref="GeneID:34716288"
     mRNA            <713845..>716250
                     /gene="ERB1"
                     /locus_tag="KLMA_40302"
                     /product="ribosome biogenesis protein ERB1"
                     /transcript_id="XM_022819598.1"
                     /db_xref="GeneID:34716288"
     CDS             713845..716250
                     /gene="ERB1"
                     /locus_tag="KLMA_40302"
                     /codon_start=1
                     /product="ribosome biogenesis protein ERB1"
                     /protein_id="XP_022676147.1"
                     /db_xref="GeneID:34716288"
                     /translation="MARKASSKVAVEPVKSTEKKRVLEENDASDSEDERIEVDGLIAE
                     ESSDEEASAAEESPEDGSDEEEEDSDAEFNKLLAEEEGSDEEEYNTSDFSEADDGHSI
                     TDRLSNVKITTIPESENGNVTVTKYSDGRPRIIKPEINPIYDSDDSDVETKNTIGNIP
                     LSAYDEMPHIGYDINGKRIMRPAKGSALDDLLESIELPEGWTGLLDKESGASLNLTEE
                     ELELINKLQKNEQTDESVNPYEPLIDWFTRHESVMPVTAVPEPKRRFVPSKHEAKRVM
                     KIVRAIREGRIIPPKKLKELRAKEEQENHNYDLWENSEESSDHIMNLRAPKLPPPTNE
                     ESYNPPEEYLLTPEEKEAWEKMEPSERERNFLPQKYGALRKVPGYAESVRERFERSLD
                     LYLAPRVRKNKLNIDPESLIPELPSPKDLRPFPIRCSTVYIGHKGKIRTMSIDPSGLW
                     LATGSDDGTVRVWEILTGREVYQVTIIDTEDNHDDHIDAVEWNPDASTGILAVAAGEN
                     IFLIVPPIFGFEIENNGKSKIEYGFGFDTFGNVKKSNLNVNSDDEDEGAESQGVKKQV
                     AQWNKPTERQATKDICIVITCRKSVKKLSWHRKGDYFVTVQPDSGNTSVLIHQLSKHL
                     TQSPFKKSKGIIMDAKFHPFKPQLFVCSQRYVRIYDLSQQILIKKLLPGARWLSTIDI
                     HPRGDNLIASSFDKRVLWHDLDLASTPYKTLRYHEKAVRSVSFHKKLPLFCSAADDGN
                     IHVFHATVYDDLMKNPMIVPLKKLTGHKLVNSLGVLDTIWHPREAWLFSAGADKTARL
                     WTT"
     gene            complement(<716359..>717168)
                     /gene="CSM3"
                     /locus_tag="KLMA_40303"
                     /db_xref="GeneID:34716289"
     mRNA            complement(<716359..>717168)
                     /gene="CSM3"
                     /locus_tag="KLMA_40303"
                     /product="chromosome segregation in meiosis protein 3"
                     /transcript_id="XM_022819599.1"
                     /db_xref="GeneID:34716289"
     CDS             complement(716359..717168)
                     /gene="CSM3"
                     /locus_tag="KLMA_40303"
                     /codon_start=1
                     /product="chromosome segregation in meiosis protein 3"
                     /protein_id="XP_022676148.1"
                     /db_xref="GeneID:34716289"
                     /translation="MSLTGGMSDPLEFQGNITEDGHVTLDFELDPTINGADPTSTEQD
                     PTLISGTTRKPRVKLTAEKLLSKKGLPYVVQHAPKSCRISKKKSPYDNLTGFLQFYQL
                     WAHELYPKAKFKDFVALCGSLGRTDRDLREYRTNLIRKDMGMLIDEDVDGDTLQGQRE
                     PSPSSPPPPQSSQPPQQNGLFVTEEVDSHNFLQTNQSAPHTDHGDDDDDDDDVLYSSR
                     RKTRTDNTSSQLPSSSTVIPTAEEMEEMERAADGIATASDDEMDLLREMQQ"
     gene            <717994..>718233
                     /locus_tag="KLMA_40304"
                     /db_xref="GeneID:34716290"
     mRNA            <717994..>718233
                     /locus_tag="KLMA_40304"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819600.1"
                     /db_xref="GeneID:34716290"
     CDS             717994..718233
                     /locus_tag="KLMA_40304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676149.1"
                     /db_xref="GeneID:34716290"
                     /translation="MFTDITSKARETQQLTPVVVQCFKNTDTKPRSTPELDNSYYDSD
                     EEEDLIVDLTTGSLKPIKLKSYLIMNEVINGLESL"
     gene            <719059..>722469
                     /gene="NUP116"
                     /locus_tag="KLMA_40305"
                     /db_xref="GeneID:34716291"
     mRNA            <719059..>722469
                     /gene="NUP116"
                     /locus_tag="KLMA_40305"
                     /product="nucleoporin NUP116/NSP116"
                     /transcript_id="XM_022819601.1"
                     /db_xref="GeneID:34716291"
     CDS             719059..722469
                     /gene="NUP116"
                     /locus_tag="KLMA_40305"
                     /codon_start=1
                     /product="nucleoporin NUP116/NSP116"
                     /protein_id="XP_022676150.1"
                     /db_xref="GeneID:34716291"
                     /translation="MFGTSRPAFGQTSSSPFGQAQSTNTFGQQPGGTTSNMFGSTSAN
                     NAQSGFGGFGSGANTNPSQTMNSPFGMSQQQNTTTSPFGGAAAGVSAPGNALSNPPSL
                     FGGSQSSGTTTGALSSGPMSGTGIKPFQPYTEKDVSTGYPSVFQSITCMPEYSNFSFE
                     ELRFQDYQQNRKFSTNTAGGPTNSTIASPFGQQQTNGTNNIFGLGNKNSLGNTGTSPF
                     GQQTTNSAFGQQTTNAFGQSNTSPFGQPQQQSTGLFGQQPQNNSPFGTSNAANNSPFG
                     LNKPATSGGLFGQNQTNSTSAFGQSNTNSLFGQQQQQPQQNQTGAFGQNTVGNAFGSS
                     FGQQNTNNQPGGLFGQNNNTTGAGVSGAFGQQNNTNNAFGQTNNTSGGGLFGSKPAGV
                     SGGGLFGQPQNTTSPFGQANNTNNSPFGQMNNNNQAGNGGLFGQNNNNAGGLFGQNNT
                     STNSGGLFGQQNNTTTTGGLFGQQNNNNINQQSGGLFGSKPPTNGGLFGQNNQTQQTG
                     TGLFGTQNKPLGGGTGLFGQNNQQQQQQQPGGLFGQNTQQPAAGGLFGNQNQSQQPGS
                     NGLFGQQNNSLGSNTGGLFGAKPSGAATGPFGQNNQQQSGTTGLFGQAGQQNTTSTGL
                     FGQNNQQQGTSTGGLFGNKPAVNNNAGTIGGAGSGGLFGNNNNQQQNSTTGGLFGAKP
                     AGSTSSGGLFGNNTSGGLSGNNSGGLFGSKPTGTTSFGNNAGGSSNLTTGGLFGGNKP
                     ATTGSTGLFGSQNNTSGGSNMGGLFNSSSIQQNQQTQNQQQPLQSNTNPYGTDELFSR
                     VISIPNSITQPTKPSAIKVNADLKKKNSLSAAYKLVPKPLFDSKKPEVNMKVKIHLKL
                     ANSSDKEPSSSNALVRKSVDSSVFNDSTDEAIMNSGELLFNPDKKSFKNLIINRKKME
                     KEDSSPSEVKFITFKDNIESPKKTELKENSDILNKNPETPVHKLKEKTFETESTPKID
                     DKPLKSFHKNKIIGEDISFTDNGYYISPSFETLESFTLMELRKVENLVIGHKDFGKIE
                     FLKPVDLSLIPLPSICGKLITFEKRCCTVSFIGEKPEKGQGLNVPAMITLVGCYPKDK
                     STGEPIKDPNHPILKKHIGNLKSMNDAQFESYDPETGSWSFTVEEPVV"
     gene            complement(722682..722753)
                     /locus_tag="KLMA_R420"
                     /db_xref="GeneID:34718718"
     tRNA            complement(722682..722753)
                     /locus_tag="KLMA_R420"
                     /product="tRNA-His"
                     /db_xref="GeneID:34718718"
     gene            complement(<723092..>724474)
                     /gene="IOC4"
                     /locus_tag="KLMA_40306"
                     /db_xref="GeneID:34716292"
     mRNA            complement(<723092..>724474)
                     /gene="IOC4"
                     /locus_tag="KLMA_40306"
                     /product="ISWI one complex protein 4"
                     /transcript_id="XM_022819602.1"
                     /db_xref="GeneID:34716292"
     CDS             complement(723092..724474)
                     /gene="IOC4"
                     /locus_tag="KLMA_40306"
                     /codon_start=1
                     /product="ISWI one complex protein 4"
                     /protein_id="XP_022676151.1"
                     /db_xref="GeneID:34716292"
                     /translation="MLQPTDIVIAKVKGYPPWPAMVIPFEIIPQQVLTKNRSKLPDDS
                     DTDSDGAEYIEYSPMLTFKKFTHELTNYCVKFFHDDSYIWLNPRNLHELTLPQVESFL
                     AKANSKTSKNLVAAYEMAKQGLTTGIDVWEFVEYGSEGKPDDEDYTEGENDDEEEYAE
                     ETNSSWEKAPKRKATRSSTRTSAKKIKVTKRSTRSRSKASSKNDDNEDDNDLDSADNN
                     ELLSDINDEDSSEEPVPTKKSKNSSKNSNKTKAKSNGGSKAKASVTTTSKSKAAVAKP
                     NKPKPKPKPEIYHYEDDIDWKIVGLGPQDLDLDSHPSFVSKLLTKKNLEIHNDLKLEL
                     KDRLSAVNKMLIEYTLDKNDDPDLVQLIIDELSICLSLKGNHDELWTVFLSNSELLLN
                     YRILLNLKRQELEEVDALDKFLETYEEIYDHPFQFDSQKWDRNAQIIKTEEKPKENGE
                     GEVSSVSASV"
     gene            complement(<725878..>726555)
                     /gene="MCM1"
                     /locus_tag="KLMA_40307"
                     /db_xref="GeneID:34716293"
     mRNA            complement(<725878..>726555)
                     /gene="MCM1"
                     /locus_tag="KLMA_40307"
                     /product="pheromone receptor transcription factor"
                     /transcript_id="XM_022819603.1"
                     /db_xref="GeneID:34716293"
     CDS             complement(725878..726555)
                     /gene="MCM1"
                     /locus_tag="KLMA_40307"
                     /codon_start=1
                     /product="pheromone receptor transcription factor"
                     /protein_id="XP_022676152.1"
                     /db_xref="GeneID:34716293"
                     /translation="MSDSEVKDESVPKETKERRKIEIKFIQDKTRRHITFSKRKHGIM
                     KKAYELSVLTGTQVLLLVVSETGLVYTFTTPKFQPIVTQPEGKNLIQACLNAPEEEEE
                     EEEDDDEEEEEDDEHNVQHDHGVNMAGQSHSSVPTSVQVAPGGHPHGHLGQQQSVQHQ
                     QQQQQQQQQQQQPVPVQQQRLGQQQAQGQGSDQTPNFTNASYLNPDHAAAYEQYFNGV
                     NSQHGQF"
     gene            <728262..>728648
                     /locus_tag="KLMA_40308"
                     /db_xref="GeneID:34716294"
     mRNA            <728262..>728648
                     /locus_tag="KLMA_40308"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819604.1"
                     /db_xref="GeneID:34716294"
     CDS             728262..728648
                     /locus_tag="KLMA_40308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676153.1"
                     /db_xref="GeneID:34716294"
                     /translation="MKFRNYINPPSNCSTLYPSSAALTHFSPVLVTLYLIYPTNQPTS
                     QNNQHIIAAMNPTLVRAFHRSSIRMSQAAVDASSHGMPASKWFATMLGVGLLLGSGAI
                     GLQKAYSNSKIDQIFHKERRQGQLHN"
     gene            <728990..>729646
                     /gene="YET1"
                     /locus_tag="KLMA_40309"
                     /db_xref="GeneID:34716295"
     mRNA            <728990..>729646
                     /gene="YET1"
                     /locus_tag="KLMA_40309"
                     /product="endoplasmic reticulum transmembrane protein 1"
                     /transcript_id="XM_022819605.1"
                     /db_xref="GeneID:34716295"
     CDS             728990..729646
                     /gene="YET1"
                     /locus_tag="KLMA_40309"
                     /codon_start=1
                     /product="endoplasmic reticulum transmembrane protein 1"
                     /protein_id="XP_022676154.1"
                     /db_xref="GeneID:34716295"
                     /translation="MSIYFSSLFVLLVAEMSIMFVLVMPLHYQVRKRIVATSDKFLGS
                     SQVRTVIAIVSCLVLLLFVDSWKRASVPVSSQSYSPSHGHGHGLGSASGLASHDPAAT
                     TSTRSLASRAYNQRNVYISGFILYFTLCIPVLLNLLSRLVKYETLLRELNSRPTSEED
                     LIRKQKGDDPELSELKNQLESKKKSLKALQTQVDNLNKHFDSNNEPKQDKPVSEKKDD
                     "
     gene            complement(<729647..>730657)
                     /gene="ARA2"
                     /locus_tag="KLMA_40310"
                     /db_xref="GeneID:34716296"
     mRNA            complement(<729647..>730657)
                     /gene="ARA2"
                     /locus_tag="KLMA_40310"
                     /product="D-arabinose 1-dehydrogenase"
                     /transcript_id="XM_022819606.1"
                     /db_xref="GeneID:34716296"
     CDS             complement(729647..730657)
                     /gene="ARA2"
                     /locus_tag="KLMA_40310"
                     /codon_start=1
                     /product="D-arabinose 1-dehydrogenase"
                     /protein_id="XP_022676155.1"
                     /db_xref="GeneID:34716296"
                     /translation="MVETQGKSKDGPFGGLPPLVLGGATLNTQYNDDPFSIPVVEMLR
                     HAFEHGITAIDTSPYYGPSETIYGQALEQLRNEWPRESYSICTKVGRIRLDEFDYSKE
                     NVRFSVLRSCERLKTTYLDVLYLHDIEFVEEDKIMEALCEMKRLKDEGVVLRIGISGY
                     PVRFLYEIAKKCRDNEQIGALDNVLSYCNLNLQNTILEQYYDKFLQECGVGVVSNGSI
                     LSMSLLAGGETKPFHPCSDELRKRSREAAEYLASNGVAIADLATKYAIHKWLKRGPTV
                     LGCSNVAEVDYALKNYNQVIQNGGDGELDARDQALVSYVQENIFKELMNSTWESGIPG
                     RG"
     gene            <731257..>732018
                     /gene="SUB1"
                     /locus_tag="KLMA_40311"
                     /db_xref="GeneID:34716297"
     mRNA            <731257..>732018
                     /gene="SUB1"
                     /locus_tag="KLMA_40311"
                     /product="RNA polymerase II transcriptional coactivator
                     SUB1"
                     /transcript_id="XM_022819608.1"
                     /db_xref="GeneID:34716297"
     CDS             731257..732018
                     /gene="SUB1"
                     /locus_tag="KLMA_40311"
                     /codon_start=1
                     /product="RNA polymerase II transcriptional coactivator
                     SUB1"
                     /protein_id="XP_022676156.1"
                     /db_xref="GeneID:34716297"
                     /translation="MPFKRRIDSIMSNDRGFELGKNKRVTIRRFKNINLIDIREYYLD
                     QSSGDMRPGKKGISLTEEQYDQLIRHRSEIENCLIDLGSSRSLTDRPEMDSLLEKKQK
                     KEKLKKEKEKEKEKEREKERIKREQELEREKEERANTLGGIVVPTNSGAAVKSEDVDS
                     QSEDAQFETVDTEPKAQSQSKVKKEADAQKVSSSTTTKPPSSNPRLDDHLEKISRSAP
                     EEDDDGDNTMEKDLVKALSQDPHNGNSDEDISEAD"
     gene            <732709..>735612
                     /gene="MNR2"
                     /locus_tag="KLMA_40312"
                     /db_xref="GeneID:34716298"
     mRNA            <732709..>735612
                     /gene="MNR2"
                     /locus_tag="KLMA_40312"
                     /product="manganese resistance protein MNR2"
                     /transcript_id="XM_022819609.1"
                     /db_xref="GeneID:34716298"
     CDS             732709..735612
                     /gene="MNR2"
                     /locus_tag="KLMA_40312"
                     /codon_start=1
                     /product="manganese resistance protein MNR2"
                     /protein_id="XP_022676157.1"
                     /db_xref="GeneID:34716298"
                     /translation="MPDRHSEVPLLGSEKKQTGRRGRRRSVFQNNVEIPSSYQVKSDK
                     SDSMGILHDTDDDDESVGIEGAFNDSNIRRSHASYNDRYAWSYIDHRPSLSALEHSSS
                     SQKRKPRSSSSRASFTDPFAGGDSASRTIKSSSNKSSRGRDPYARRYSNVGPNSVVLG
                     PSTPTAGHNYESINNRNDVVIDMDALMEHVNRKNKSRSSLSSKASTPSKATSQDEYNS
                     QPSSRGTSDSGSLDDVCLPIDDETEEGSKVWPDVQVLEEFSREEIERLRREAMRDTEN
                     FHFQYDDDDYDGELSDEERIVSFGTQKPTNPDAPHQLNQSGRPIITNIDVPELGNTRV
                     NETEQLKNGRLRPTKLTPWHLKRGNLNLPGLSSATVSNQGSATAKQSHGLSNKSGSLT
                     HSSNWNADKSLLDSRTDDLLVGRNIQYPPHIISNNPEIFRFTYFREDLDATIHSPTIS
                     GLLQPGQKFDELFVGSVYANPINNSTPSNAGTREVTPGLAASASATNASLPPKNSAPS
                     TLDFDDVSPFWLDVLNPTEEEMKVLSKAFGIHPLTTEDIFLGEVREKVELFKDYYLVC
                     FRSFDIVAERHIRKKKQQQQQKSDTESTESEDESPKGSWLKNIFRRKQRRASMPRTVS
                     SSNSSVQKKARKEKEEIEKYKRKSGDRKKPRAGELEPLNVYILVFRTGVLTFHFAPTP
                     HPINVRRRARLLKDYLNVTADWIAYALIDDITDAFAPMIELIEDEVYDIEDAILKMHH
                     VEGDSDSGSDSEDSSDEDDISFNQFDRASKRTSFSRLTKSSVSSSTTRSTSSSDSTFN
                     AKNIIGWRKKGDMLRRIGECRKKVMSIVRLLGSKADVIKGFAKRCNEQWEVAPRSEIG
                     MYLGDIQDHIITMVSSLNHYEKLLSRSHSNYLAQINIDMTKVNNDMNDVLGKITILGT
                     VVLPMNIITGLWGMNVLVPGQTADSLTWFISIASFMFIAAYFAYMYTKKRFGF"
     gene            <735964..>736698
                     /gene="CCS1"
                     /locus_tag="KLMA_40313"
                     /db_xref="GeneID:34716299"
     mRNA            <735964..>736698
                     /gene="CCS1"
                     /locus_tag="KLMA_40313"
                     /product="superoxide dismutase 1 copper chaperone"
                     /transcript_id="XM_022819610.1"
                     /db_xref="GeneID:34716299"
     CDS             735964..736698
                     /gene="CCS1"
                     /locus_tag="KLMA_40313"
                     /codon_start=1
                     /product="superoxide dismutase 1 copper chaperone"
                     /protein_id="XP_022676158.1"
                     /db_xref="GeneID:34716299"
                     /translation="MENIDFDSTYAVDMHCESCTKDIENCLKNVDGIKSVSFDLNDKL
                     MNVKGHAAPSAIINALQECGRESIIRGTGKPNSAAVSILEEHDSSNTSGVNPVLGLAR
                     IVEVADKKTFFDININGVKKPGLYYASVRSSGDLTDGVKSSGDALYKLDTPIDCSKPS
                     DSIPNTYSGNAFILAPYHVWEILGRSFVVTSNPEHKVTGADDISVGGVIARSAGAWEN
                     TKQVCACSGKTLWQERKDAIQHNIRF"
     gene            complement(<736767..>737405)
                     /locus_tag="KLMA_40314"
                     /db_xref="GeneID:34716300"
     mRNA            complement(<736767..>737405)
                     /locus_tag="KLMA_40314"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819611.1"
                     /db_xref="GeneID:34716300"
     CDS             complement(736767..737405)
                     /locus_tag="KLMA_40314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676159.1"
                     /db_xref="GeneID:34716300"
                     /translation="MQGGVRRGNDLLPRYNTHGHGRGKGVWLTTPMKKIILYVMLLFT
                     VFVVLQTIGIGKENEHIEYELERAGGSSGINRDALGSQMDVSDAMIEKAGSAAADPVP
                     AAADVAPVAAAAAAAAGAGAGSGSDKALDRVSDKSGDKGNAPAVGVGAGSVDNSKEEK
                     KDLSNSAPIAAKNAQKSRNGVGNDIKADKQGGKGIDKKAQEIKEAAPYKKGD"
     gene            <738062..>740191
                     /gene="MSN2"
                     /locus_tag="KLMA_40315"
                     /db_xref="GeneID:34716301"
     mRNA            <738062..>740191
                     /gene="MSN2"
                     /locus_tag="KLMA_40315"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819612.1"
                     /db_xref="GeneID:34716301"
     CDS             738062..740191
                     /gene="MSN2"
                     /locus_tag="KLMA_40315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676160.1"
                     /db_xref="GeneID:34716301"
                     /translation="MTLGGFTSENSLDIRSDSMSGIYGERSQVEAGGGDIGEGGTPAI
                     KNVKLETLQHNMGSTPTEMNDFLAMLDDKTTYSEVIQLTEPNMSSERPQSMDYNTGSE
                     LSFNGRDMIGAGSPMGSYPNSQRISNRSSRDHTLNYSEPEPGDSGELGETMDPLTAIA
                     SASISSVPGSEQHSRVPQVQRMTQQPQTTENSMQKTTLNSTSIQDFLDNIDNSQSEEQ
                     YINPYLLNKEMNGAGVGPSLFMDSGTDIDNNKTNDDTNPISENPMMLEDLTVSPQPVF
                     SDRRRMSEVASEKVGYPSGPRGSISHQVDFWNLSSAGSSNPPLLNMSPNKSAQLQQEN
                     NSELFDLMSFKKKGRQQSLQQQKMHNPTTQQQKDLQHGDLQQTQQQQQQQQQQQQRQS
                     AFKIDNELTQLLNAYNLSQPNVTARNANNINNNSGTATKMRTGSFNQANIKRSNSSTQ
                     EAHNRVGKQRYSMSLLDGNQDAISKLYGDMARNGMSWENAIISDDEEERDRQDDTQKV
                     RRKSSLNRKNQEVSQSSVDATGGRFISPQLLNNDPLLENQLNAGQNSLGVDRSNLNFE
                     LNLPITNPEALIGATSPNSMTTSSNVSSTGYNSAGAVAGPASGQRRKRLSMSKPKVMT
                     KATSPLDGEEKPFKCDQCSKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLS
                     QHLKTHKKHGDITELPPPRRATNSSSK"
     gene            <740572..>741981
                     /gene="ELM1"
                     /locus_tag="KLMA_40316"
                     /db_xref="GeneID:34716302"
     mRNA            <740572..>741981
                     /gene="ELM1"
                     /locus_tag="KLMA_40316"
                     /product="serine/threonine protein kinase family protein"
                     /transcript_id="XM_022819613.1"
                     /db_xref="GeneID:34716302"
     CDS             740572..741981
                     /gene="ELM1"
                     /locus_tag="KLMA_40316"
                     /codon_start=1
                     /product="serine/threonine protein kinase family protein"
                     /protein_id="XP_022676161.1"
                     /db_xref="GeneID:34716302"
                     /translation="MKKYPTVIQFSDSVRLGPLETDVDAESYFQLVDEQRNKLELGVI
                     SKTKLLDTVQLDSDDDENDDEARLNGQIYINGYRLGEKIGSGQFGTVYKGYSTGKVVA
                     MKQIYKRPINSPFSMSQIMKTMRKYDSVSSNLAIMEMNVSKIRWECFVTNKLIHPNIT
                     SLIECLDSPYSDQIWLVQQLAQLGELQWSRESKFDLIEQWQSFYHGHLTSVEEFVIKI
                     MHDVSSGLNYLEKQGIIHRDIKPQNILLDPVYQNLSISDFGCSLMVPNKLPFKDARLD
                     KFFDAELNKIVGTPLFTAPELCNFEQEDVKVHPHNAFKIDVWSLGITLYSVLYNSLPF
                     WGESEFDTYRLVCHQELKPQIVRNTSDENNNKTWIHDYVVTELLRKDPQHRPSAQSIL
                     HTLELHSKPELSSMNKLKSKVSKWKRTLLTKNKTENLPSKLPNVDAENSHSEVPSSKQ
                     KQPLNRSHRATVNLENYIK"
     gene            <742658..>744205
                     /gene="MIH1"
                     /locus_tag="KLMA_40317"
                     /db_xref="GeneID:34716303"
     mRNA            <742658..>744205
                     /gene="MIH1"
                     /locus_tag="KLMA_40317"
                     /product="m-phase inducer phosphatase"
                     /transcript_id="XM_022819614.1"
                     /db_xref="GeneID:34716303"
     CDS             742658..744205
                     /gene="MIH1"
                     /locus_tag="KLMA_40317"
                     /codon_start=1
                     /product="m-phase inducer phosphatase"
                     /protein_id="XP_022676162.1"
                     /db_xref="GeneID:34716303"
                     /translation="MDGKKPKNLLKHLHFLWPKSGKNTATSHDDITSDSSVNHDLDLH
                     TQRPSQQLPQQRPQLQQASLHSEIIASETDSSVSVCQSPISNLSLTRENSLSVYSPNG
                     SESDQFRYLSGDSNRNNGNASQNTLLCENITPAAPILMRHGSIKRRDRISKSNDQRTK
                     LRRTHSMFANTNEVKTVTPDIVPTYNSCLEESKIPIHYDDNSNDNLPRVSVETLVKIM
                     DKEYKGFYGSIYIIDCRFEYEFLGGHIKDAVNISKQKQLEEEFIHKRHVRCKDTKKPP
                     LIIFHCEFSSYRGPILASHLRTCDRILNHDNYPKLHFPDVVILDGGFKTFYEKYPNKC
                     EGSYVCMQSKNHEEELSEFKRDSKKVMTRANSTQILLLKNNSLRNCAFQTNYYQNDVR
                     NHPYRRENYTAYDNENNNDYEEQNISNFSISIPPKLSLDKYGELSPSHRSSSSKSSSL
                     CSSSKLLFSNEAGTGLKPKFLENDESDFDSDAYSFQFGDDDDDVKLGSVSGKKQLLPD
                     LVNADRH"
     gene            complement(<744300..>744836)
                     /gene="IMP2"
                     /locus_tag="KLMA_40318"
                     /db_xref="GeneID:34716304"
     mRNA            complement(<744300..>744836)
                     /gene="IMP2"
                     /locus_tag="KLMA_40318"
                     /product="mitochondrial inner membrane protease subunit 2"
                     /transcript_id="XM_022819615.1"
                     /db_xref="GeneID:34716304"
     CDS             complement(744300..744836)
                     /gene="IMP2"
                     /locus_tag="KLMA_40318"
                     /codon_start=1
                     /product="mitochondrial inner membrane protease subunit 2"
                     /protein_id="XP_022676163.1"
                     /db_xref="GeneID:34716304"
                     /translation="MLNYGRYALRSAFITITWIPVALTFSEHVCYVAKVEGASMRPTL
                     NPSDPVRNESDWVLLWKFNLKQAKNWKENDVVLFKSPMDPKKVYCKRVKGMQFDQVRT
                     RSPYPKETCLVPRNHLWVEGDNVYHSVDSNNFGPISTGLVLGKAVCIVWPPSRWSNDL
                     NMSNGRGDIKVFPVDPQD"
     gene            <746263..>747675
                     /locus_tag="KLMA_40319"
                     /db_xref="GeneID:34716305"
     mRNA            <746263..>747675
                     /locus_tag="KLMA_40319"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819616.1"
                     /db_xref="GeneID:34716305"
     CDS             746263..747675
                     /locus_tag="KLMA_40319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676164.1"
                     /db_xref="GeneID:34716305"
                     /translation="MVTNITEAAPEAAAPPATVVEVNPEEEGSSEMSLSEEKSSVGEK
                     KKSSTFKRYLSAFYHHKITQFLISQWFFIGLAIFIVIARFAPNFARSGGLIRGQYSIG
                     YGAVIVIFLQSGLSMSTKKLLINMGNWRAHLVVLVISFLVTSSIMYGLCCAIKAAHNE
                     EIDDWVLIGIIVTSTCPTTVSSNVVMTTKANGNALLCLCEVFIGNVLGAFITPALVQM
                     YTSSGPMTFGNPATGSSVSQLYANVMKQIGLSVFVPLFVGQVLQNIWPKQVSWFLTTF
                     KMNKVGSFCLLLIMFSSFSTAFYQHAFTSVSHTTIIFLCFFNVGIYLFFTVVCFVCAR
                     PWFIPKIFDHEPDENSTKTYTICYKIFRPFYYSKKDTIAVMLCGAAKTAALGVSLISS
                     QYGDHNPKLGTLLVPLVLYQSEQVITANFLVNIMKKWASDEDEDGNKIVVKPNDDESR
                     ISQNKEDVSKENTEDVDSRS"
     gene            complement(<748071..>751187)
                     /locus_tag="KLMA_40320"
                     /db_xref="GeneID:34716306"
     mRNA            complement(<748071..>751187)
                     /locus_tag="KLMA_40320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819617.1"
                     /db_xref="GeneID:34716306"
     CDS             complement(748071..751187)
                     /locus_tag="KLMA_40320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676165.1"
                     /db_xref="GeneID:34716306"
                     /translation="MPFQKLVSFEIEYAPQYHLTKYISSHSKLQLVHVNNKSSPLVEG
                     YFAVGTECPSDSGVPHTLEHLIFMGSQKYPYKGLLDTAGNLCMSNTNAWTATDQTVYT
                     LSTAGWKGFKKLLPVYLDHLFYPTLTDEACTTEVYHIDPEDLSDKGVVFSEMSGIESQ
                     SWFLSSLEKQRTMFPPGSGYRSETGGLTANLRILSNNEIREFHKEMYTPDNCCVIVTG
                     NIPEEELISIMEDFDKELPAFSGSERKRPFIDTPASQIPDSLQEIKEKTIEFPEADES
                     QGEISFSWITKPYLNHLEDQAVSILLDYLTDSPLAPFNKELVEIENPYATEAEFWTDD
                     FMKTITNVVLKGVPTERLQEAKEKALELLSTHQVSLDRIRLVTENTKWDYVFKLEKSG
                     DAMISQIAITDFLYGDVNGEVLEESLRTLQDFDTLLSWPQEKWQILLQKTLVSNKPVI
                     IVCKPSVALNEKLENENKLRLQERKDTFDEAKKNEIKDIFSRAQKKNNIPVPQNVLES
                     FEIQKPQNSVTFTETKSITCIPVPSNDNDDALTKKILAQKPKNFPLFIHFEHFPSQFI
                     ELHVALNVDFVDENELLPLYHIITELFTMPMNDDNGKIVPFEEVVTQLKRETVETNIS
                     CGIEGNFSNLIDFKIQCKAKEYSNAIKWFRNVLFESVFDENRVSVLLEKFYNSIVETK
                     REGDQMLYSSMNRNLYDEATLKKSSDELFVEPIIESLLDDIDAGLYKKEILPKLESLR
                     QQLTENLTKAHILIFGDIEKIENIYEPWNRYVLPKIKERESFNVVVPPTPRLTEHLSV
                     LGKDPTNKAFIVSTPASESSYMMALTKLPEGFHYLHKDFAPILLASTYLECVEGPFWK
                     GIRGAGLAYGAYVTKMYESNMVGFNVYRAADAIGCFEAAKKIVNEYANGVEEFDPLLI
                     KAAISSIINSMASREANYFSVAVNKYLNTFCKNRGPRFNSELLEKLEKVTPEQLQNVM
                     RDIFANMFENKKGSVFVACHPSKVETLKSYFESLKYEVDVEEIIDDEDDSEEEDSEED
                     DSEEDDSD"
     gene            complement(<752343..>754184)
                     /gene="AEP3"
                     /locus_tag="KLMA_40321"
                     /db_xref="GeneID:34716307"
     mRNA            complement(<752343..>754184)
                     /gene="AEP3"
                     /locus_tag="KLMA_40321"
                     /product="ATPase expression protein 3"
                     /transcript_id="XM_022819619.1"
                     /db_xref="GeneID:34716307"
     CDS             complement(752343..754184)
                     /gene="AEP3"
                     /locus_tag="KLMA_40321"
                     /codon_start=1
                     /product="ATPase expression protein 3"
                     /protein_id="XP_022676166.1"
                     /db_xref="GeneID:34716307"
                     /translation="MNDTKLSLNAVQYWLNPAEVRDRHSIVMDRLRVVMGYLKKTPIC
                     ISSPTLTLTVSPANFKFPSTQAVKNETTKERETCGIPASNVREEYLKSLDLPYLSRIS
                     KKEGPYDYKRAMEFSKALKRTMDSKSADQTIFSLCSESIAKLISLLLQITPDKLVVPS
                     STRIFPRELFTDIPKLTDEITSDTDKFANYIGLLTHTKFHYKGSSSQGGIIPKLLNSL
                     LHPSNSQTVKLKSTSVFNDVIFYYTTKNNFATCRELFAQMKAEGFNPDTMTYNLLLRS
                     LRKNDALVKQKLPYDEAVFYLTKMKIEGVPADVITWNTCYLLLKDNISRAIFLEKMIE
                     KNVPLTQHIIHAVLGASDVPYQAVINFLVEYDFPIDTNIIKICFSKLIEEENYERSWK
                     LLEHAKRSKFNVSDPFFLETYIRKFADMGRMDLSLITFNTLTTKYMVTPTLHCYDMLF
                     KCLVRQGYHKNFGVVYKYLVQKLKHLTGGKIISNYWIVKSRAILKFNIGSKGDRDISQ
                     AVSDLDHLIKKCVWNEDKGLKIDCWDQYYQYRRLFRTVGAVPHHTSSKKLNKEQYPAE
                     ASRKKKKYIKRMKETSIANKKLKDAQYEKDYYGALKNDLLNRGIMDN"
     gene            complement(<754440..>757985)
                     /gene="NCR1"
                     /locus_tag="KLMA_40322"
                     /db_xref="GeneID:34716308"
     mRNA            complement(<754440..>757985)
                     /gene="NCR1"
                     /locus_tag="KLMA_40322"
                     /product="niemann-Pick type C-related protein 1"
                     /transcript_id="XM_022819620.1"
                     /db_xref="GeneID:34716308"
     CDS             complement(754440..757985)
                     /gene="NCR1"
                     /locus_tag="KLMA_40322"
                     /codon_start=1
                     /product="niemann-Pick type C-related protein 1"
                     /protein_id="XP_022676167.1"
                     /db_xref="GeneID:34716308"
                     /translation="MLFRWCFGVLIILQTVLCLESCAMYGNCGKKSIFGASLPCPVSA
                     DFRPPLVDSKDIQFLVDTCGEEWKQYDRLCCTREQMVALKENLNKAESIIASCPACKK
                     NFETIFCHFTCSPHQRHFVDVIETSESRDGREIVAELDVFVNGSWASEFYDSCKNVKF
                     SATNGYAMDLIGGGATNYSEFMKFMGDEKPALGGSPFQINYKYEAKDSLALFNEDVYR
                     CDDKVYKCACADCTESCPSLDSIRTGRCMVAGIPCASFFFMVTYAVLFVAIGVWHVHI
                     FKEKRKAKQASNITQSPEPLLSEGNTSDTVNDNGLFVEYASDRNMANDSISKLLSKLV
                     SKCIENPISVLSYTSILVSVLLAALILFGELETNPVNLWVNPSSSKFKEKEYFDKNFG
                     PFYRTEQIFIVNEDKPVLEYETLKWWFQVEENITKALKSSENVTYQDLCFRPTEDSTC
                     VIESITQYFDGILPDENSWKDQIKLCTDSPVNCLPSFQQPLKTNLLFSDEDIFNANAL
                     VVTLLISNHSESAVLWEQALENQLLLQKPPKGIRISFNTEMSLEKELNSSNDIVIVSL
                     SYLIMFIYASWALKRRSGGTRYLLGCAGVLIVFASAISSAGVLSILGIKSTLILAEVI
                     PFLILAIGIDNIFLITHEYDRVDESNPSLSLDEKIIKCMRRISPSIVFSFICQGGCFL
                     LATIVEMPAVRNFAICAAVAVFFNVLLQSTIYVCLLHFYEKYYDASNIIEVSNETSDN
                     TEQNNSLLERYFTLIGKKRKILGIFFSWFLISLIFVPYVKFGLDQTMAVPQSSYLVNY
                     FNDVYEYLNVGPPVYFVVKNLDLKSRPGQKSICGKFTECDEYSLSNILEIERSRSTIV
                     EPAANWFDDFMMFLNPELDQCCRLKKGTDSVCPPSFPPRRCETCYKNGEWDYNMDGFP
                     EGEEFMKYFDIWINSPSDACPLAGKAPYSSAVLYNSTDVIASTFRAAHSPLRSQEDYI
                     QAYEDAQRIVNEMKGLDVFAYSPFYIYFVQYSTIVPLTLTLLSASILLIFLVSWWILG
                     SIYTSIILSGTVCMIIVDIGAMMYLFGIRLNAVSLVNLLICVGLAVEFCVHITRAFTI
                     VPVGVKKDNDSRVRYTMTTIGGSVLKGITMTKIIGISVLALTQSKIFQVFYFRMWASL
                     IFVASLHALIFLPVVLSMFGGKCFIEGESSITLEG"
     gene            <758294..>760039
                     /gene="TFC8"
                     /locus_tag="KLMA_40323"
                     /db_xref="GeneID:34716309"
     mRNA            <758294..>760039
                     /gene="TFC8"
                     /locus_tag="KLMA_40323"
                     /product="transcription factor tau 60 kDa subunit"
                     /transcript_id="XM_022819621.1"
                     /db_xref="GeneID:34716309"
     CDS             758294..760039
                     /gene="TFC8"
                     /locus_tag="KLMA_40323"
                     /codon_start=1
                     /product="transcription factor tau 60 kDa subunit"
                     /protein_id="XP_022676168.1"
                     /db_xref="GeneID:34716309"
                     /translation="MSVLQDLKITRKALEHWTDNICWGKDGTLYISTQPQLTVCEPVF
                     NKPMERQLKSLFHSKELDLPKPDNKFENSQFDENQLLLSQPEPVIERCIPSSHPGLIA
                     AITKHGNVILYQGNNLVSQIDNPNAPLPTRAYHSLCWNEKSDLLFTGSETNSVEIFSV
                     SVLAGSLVSASYKASIQLSTADAGNNQTWVTHMRYKDGLIVCANSNNEVYVVNLETES
                     AKKIKNASRCAITDIQFVGNNILISSIGSLVSYNTKQNISSAEKFDICAEFFIIPLPD
                     EESAILLSNKTGVKVQFKDSGFILSSDDIISPTLEKRFLKWNNTFNEYHKYETKLYIR
                     GCTISPDGYTVAVLYDIEKVLLKYSIPSEQVFRLLILPLSNKWEVSDKASGLAWYQSY
                     AIYNELPMNNACLSKSSEFDCSLSFPDYLSSILESKDLLTWRFNNLIEDVPSAKKIHE
                     YIFMYVMKHLDEVENPLDKAYTIWLSQLLERKVDLELDPITFNGPFISEEFDFQKNAN
                     QDIITSELNHKWRRCSVTGFPLLSTFIRICPVSKTRVIDIEQDKLNEYGWLSTTVLKT
                     FGNISIFTGTKMTNV"
     gene            complement(<760117..>762594)
                     /gene="CHL1"
                     /locus_tag="KLMA_40324"
                     /db_xref="GeneID:34716310"
     mRNA            complement(<760117..>762594)
                     /gene="CHL1"
                     /locus_tag="KLMA_40324"
                     /product="ATP-dependent RNA helicase CHL1"
                     /transcript_id="XM_022819622.1"
                     /db_xref="GeneID:34716310"
     CDS             complement(760117..762594)
                     /gene="CHL1"
                     /locus_tag="KLMA_40324"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase CHL1"
                     /protein_id="XP_022676169.1"
                     /db_xref="GeneID:34716310"
                     /translation="MSRDFHHPYRPYDIQVQLMDRIYDLLNSSKKIGIFESPTGTGKT
                     LSLICSTVTWLREHKLEKLGSVRDRHSDESSSDFSSDDDDDNEPEWVNQFYNDKILKD
                     KVQVLQQYEDYLDTLSNGKVQVSLRELGTFGGKNKKRKRAAGSVHVDMKIGNGSSSEN
                     DDGSQFLPEPYEIGGAGEQVTDKKSQLNDEIQELLAKIGDRDDPNADKYDQNLDLHSP
                     LKIFFASRTHSQLTQFASQLTLPSFPPSSTLLDKERIKFLPLASRKQLCIHEKVSRSR
                     PDLINDSCAETVKKKECQFYTNSKDKITSREFRDHTFSQIHDIEDLVQLGKTFHTCPY
                     YSSRDTLDGAEIVTLPYQHLLSLEVRQSLGIDLKDSIVIIDEAHNLIDTIRSIYSCEV
                     SLSEIDSCLKAIKIYFAKFKKRLNSGNRVSLLKLMKLLEVLKSFIEKYFSEGKEVLPQ
                     EIFHNNNIDLLNIHELTNYMKKSKIAYKIDSYTDWVSKPENSDQTTPSQPILFKISQF
                     IMSLSNLSVEGKFYFREGKMIRYMLLEPQEIFKSIVQDSKCVILAGGTMQPVSDITES
                     LFPYIPSDEIVQFSCDHIIPDSNLDTFLVTDGFNFNHENRNKESNMVGLYEFFLEIGK
                     RVPDGVVAFFPSYGYLEQVVNFWKSKGMYQRLNSLKKIFYETKGGNDILPGYTDAISE
                     RNSGALLLSVVGGKLSEGINFQDELARAVVMVGLPYPNTFSSEMIVQRRHHENKVLSN
                     GGSEQDAHRVTKEFYENICMKAVNQSVGRAIRHAKDYACIFLIDNRYLNNSIQQKLSH
                     WVRKRIMHQKKTEDILEETSSFFVQKR"
     gene            <763884..>764849
                     /locus_tag="KLMA_40325"
                     /db_xref="GeneID:34716311"
     mRNA            <763884..>764849
                     /locus_tag="KLMA_40325"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819623.1"
                     /db_xref="GeneID:34716311"
     CDS             763884..764849
                     /locus_tag="KLMA_40325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676170.1"
                     /db_xref="GeneID:34716311"
                     /translation="MASPIFISNKPATLTKDYLYLGATYYGNALARISNGIKTLHPSH
                     MRNWIPILLLSSITYMVLAFLKTQIMKIDCRGCEYLECIIDQHMIGICIIQFCTPSFE
                     KTFWQSLVELDPAYRVVHRQVYPMQGVGKQRTRTLQLQARVVLTQFLLVTAVAWLPRA
                     AVQLILSSLIFRQLSYRFGTDISLFSCFVLFFFPVVKQIKFLSHFYSLHLLIRASLAP
                     YFNKTMLQKSERHTWIQSRSGILYGYMIPFYLLILSSSHLSMLVFYLSHISGLPELIR
                     DITDPFPDPYVPGTLQVSIWNSKQSVWSNNKFKTADDASDLSETE"
     gene            <766721..>768142
                     /locus_tag="KLMA_40326"
                     /db_xref="GeneID:34716312"
     mRNA            <766721..>768142
                     /locus_tag="KLMA_40326"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819624.1"
                     /db_xref="GeneID:34716312"
     CDS             766721..768142
                     /locus_tag="KLMA_40326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676171.1"
                     /db_xref="GeneID:34716312"
                     /translation="MNDHTSINSKGLRTILLEKFHHRFSHSRSHEETAVAESQEQERE
                     REHEHEQAGSKQQQQNRRSSTPSPASEDGDVEMDINNDEYLIDISTEKSSIEYGQCFS
                     ETDERKTGPAPLTLNTDANTWYAPENRVCTPVMTPVNQSGPAQFYSKRHDSMSSLASS
                     VSEFGYANMRPQSAASNCGGGAFNASFTPRFVSLLSEVYVQVCSDPTITPFDSNNPPS
                     GILHRVSKIAVEKADAEHIDIGIERNSWLLTLVRQRLLMEARKDSYLSRNSSIISLPP
                     VPQFGIENISAPFGNSQLQQQQQQQDYFNCSSSGDGSVFTNNNNYYMGINSSLDSRPS
                     SQSYGSSNQQLQQPIQMSQATNQLPPQHPKSLVRSRNNSFLTAASRSRSNSFKVHPQL
                     SNTMGSVQSSSMPKLSRSRSTSNAHFVLTPTNSIPSQPSFLSQSTSAVNTVLSAIPTN
                     NNTTAAGQQVDERNARLPTHVEN"
     gene            complement(<768688..>769050)
                     /locus_tag="KLMA_40327"
                     /db_xref="GeneID:34716313"
     mRNA            complement(<768688..>769050)
                     /locus_tag="KLMA_40327"
                     /product="37S ribosomal protein S16"
                     /transcript_id="XM_022819625.1"
                     /db_xref="GeneID:34716313"
     CDS             complement(768688..769050)
                     /locus_tag="KLMA_40327"
                     /codon_start=1
                     /product="37S ribosomal protein S16"
                     /protein_id="XP_022676172.1"
                     /db_xref="GeneID:34716313"
                     /translation="MTKGLVRIRLARFGRRHTPIYNIVVTNKHKALNRKPIEVLGTYN
                     PIPKPLTKKEVKQGVVPTKDVQLDFNRAKYWIGVGAQPSDTVTRLLKKAGILDANWGK
                     TYTSSRAVVEPKKEVLEE"
     gene            <769700..>773347
                     /gene="RRP12"
                     /locus_tag="KLMA_40328"
                     /db_xref="GeneID:34716314"
     mRNA            <769700..>773347
                     /gene="RRP12"
                     /locus_tag="KLMA_40328"
                     /product="ribosomal RNA-processing protein 12"
                     /transcript_id="XM_022819626.1"
                     /db_xref="GeneID:34716314"
     CDS             769700..773347
                     /gene="RRP12"
                     /locus_tag="KLMA_40328"
                     /codon_start=1
                     /product="ribosomal RNA-processing protein 12"
                     /protein_id="XP_022676173.1"
                     /db_xref="GeneID:34716314"
                     /translation="MDPEQVSKLLELEDKLAKIRAQSSSKLENQKHIAIILAAVEENI
                     NEQDATNKNIVNYLISFMSLLDQTIDPETTAIKDLQLATSTMYLLDIIFQYTPKKMLR
                     SRFADILTKVAPCITDEKANAPLIRSAVGCLESLLIAQDTQSWNNTQNLKVTPKRGLD
                     GLLELSLDPRPKVRKRAQDAIANILKNPPPGPTAEHVAAPSISEFAINALVSILEEAA
                     TISNKKLRAMGGSNELNSRIIHVLKLLSNIIATNQWPTVHVERLCDLLLEVCKTSDQF
                     LVSNSFKCFETLFQSMAESSVSSGLAENKFMRALEVIFSLKPSQNDTHLAGAWIAVVA
                     KGITTYAIHDPLKCFVKLPEIFRTLSYYLSSELPDVYSSAAQCLIAIITDAVKSEILL
                     FPPAVSAEQYETVDDVIQELSEIFVDLLSIKYTHCAKSVLSILAAAFKKLRYRANPDF
                     LKPLEIVGGWRTDERNFLDLRNETEYVIGAAVESMGVETVLGCLPLNLINHSPSKPGR
                     AWLLPILRDSIKNSTLHTFFTEFLPLIKHFESKYEKLGKESVQLKVFQTVVDQIWSLL
                     PPFCDIPTDLSTAFSDEVAAELSGLMYSNIELRTTICNALKTLVESNLAYQNDPTSDP
                     LLIQHFPAEKATESLEYLSTKSSNLLAVLFNLYTQTAPNARGYILETIDAYLKITKEE
                     DLTNTFNNVCGLLSNAFKEEANKNKNEMSATLLDLVISMVKYVPSSSYGSLFSIFNTI
                     VNSEDSLIQKRAYRIIHKLSEIEEGSDAISNYIGDIEQIMLKSASSVQTSSKSARLQA
                     IRTIVQLLPVDQLSFIVQVVAEVILSTKDVNEKSRETAFGILIDMAKKMDNPNGIVKL
                     SQIPGYDPSTPDQPSSVAEFFKIMSAGLIGESQHMVSATITAYSCLVFEFKDRVDTGV
                     LLEIYDTIELYLTSNSREIVKSSIGFAKVCCLGLRDDIMKPKVKELLPKLLRWSHEHT
                     GHFKAKVKHIIERLIRRFGYEYIEANFPEEDMRLLANIRKSRNRSMRKQTEGEEEGPA
                     QAAPSTKSSRFMSALDEALYSSEEESDDEEEGTGSKNDRRKKGSKQFIVESKENPLDL
                     LDSQTLAHISSTRPKTLNTGKRRIVDDEVFSFDAEGKLVVKDDKRKNNAEDPLEEITS
                     GVNAYLDAVKQGPVKGQKNRLKFKKGARAGNYDDFGDDDDEVALPKPKSTDKGRIGKK
                     QNGRFKNKRKL"
     gene            complement(<773568..>774617)
                     /gene="TAF3"
                     /locus_tag="KLMA_40329"
                     /db_xref="GeneID:34716315"
     mRNA            complement(<773568..>774617)
                     /gene="TAF3"
                     /locus_tag="KLMA_40329"
                     /product="transcription initiation factor TFIID subunit 3"
                     /transcript_id="XM_022819627.1"
                     /db_xref="GeneID:34716315"
     CDS             complement(773568..774617)
                     /gene="TAF3"
                     /locus_tag="KLMA_40329"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 3"
                     /protein_id="XP_022676174.1"
                     /db_xref="GeneID:34716315"
                     /translation="MTSDEKFYFSLLRISMIQLLRAHGFDKAKSSTIDLFTDLYIRYL
                     ELAIHEIRKLALDRGDLDEEVALQDITQGLLNIGAFKPTNLLDTYDEHPFAPGDEGMQ
                     KFKRWLLEDPATTEARVICTPTPDLLKMSEKSNKPLTMIPEYINQLNVSEKKPTDGDD
                     EVELIEAMINNGDMDDWISFTVAAQRIELAKRKTGKVPKDTTSLPSIPGFKYSKLGGT
                     RSTGNNSCIPVGVEIPEENEGEEVVHDSAQHELLTKLLSKLPVGNPENKLENITVSYE
                     EDIDEEMELPPVENMDQDAELVDIEKQNFEFDSPGPGGLTLGNIDTKDLDEMEDMQNT
                     FERRTSLDYGHSYDI"
     gene            <775152..>775721
                     /gene="RET3"
                     /locus_tag="KLMA_40330"
                     /db_xref="GeneID:34716316"
     mRNA            <775152..>775721
                     /gene="RET3"
                     /locus_tag="KLMA_40330"
                     /product="coatomer subunit zeta"
                     /transcript_id="XM_022819628.1"
                     /db_xref="GeneID:34716316"
     CDS             775152..775721
                     /gene="RET3"
                     /locus_tag="KLMA_40330"
                     /codon_start=1
                     /product="coatomer subunit zeta"
                     /protein_id="XP_022676175.1"
                     /db_xref="GeneID:34716316"
                     /translation="MVNLSLFTVKAVIILDGEGKRLYSKYFHAPHEPTSPDSLAGSSK
                     KQKEFESNLFNKTHGQNADIMVLNDHLVLYREYVDVSLYLIGGIDENELVLQEAFNGL
                     KDALELILDTGIDKRNIQEHYDMVVLAVDEFIDDGIILETDPATIASRVTKPPSKDIP
                     LNIELSEKGLLSAWGFAKSKLAERLQQGL"
     gene            complement(<775801..>778887)
                     /gene="TAE2"
                     /locus_tag="KLMA_40331"
                     /db_xref="GeneID:34716317"
     mRNA            complement(<775801..>778887)
                     /gene="TAE2"
                     /locus_tag="KLMA_40331"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819630.1"
                     /db_xref="GeneID:34716317"
     CDS             complement(775801..778887)
                     /gene="TAE2"
                     /locus_tag="KLMA_40331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676176.1"
                     /db_xref="GeneID:34716317"
                     /translation="MKQRLSALDLQIISKELEDKVVGYRLRNIYNIADSNRQFLLKFG
                     KPDSKLNVVIDCGLRVHITDFTRPTPPTPSWFVSKLRQYLKEKRLTGVRQVPNDRIIV
                     FTFADGRYYLVLEFFSAGNVLLLDADQKIILLQRVVDDYEMKVGQVYNMFDPKELVEA
                     PRPVEKREHSEDELVEWINEAELKAKAMAVPVEGQTRKSKATGSIPSIQKLLFLHAPH
                     LSSDLIQNVLKSNGINPSESCLHFKSSDSLSAIVNMLNQLESDVSELLSTSASSTRKG
                     YILTHKNKLYDPARDGPELEYTYSNFHPFKPFIEDSSDVNVIEIEGYYNEVVDKFFST
                     IESNKYANRLQNQDYLAKKKINEAKANNEKIIQSLLDAQKANEEKGNILIENADLVEE
                     AMSAVRSLLEQQMDWKSIDKLIANEQRNKNKIAQLIKLPMDLANNKISLNLPKEPEES
                     EENNNTNTAPNLSSDESASDESDLSESDPSDISDISDSSDDEEEAPRTKKVSKKHNKK
                     VLQKNSYLTVSVDLSLSAFANASNYFNAKKATSEKQKKVEKNAVKALKSIQQKIEKDL
                     QKKVKDSHDVLKAIRNPYFFEKYYWFISSEGFVVVMGKSPIETDQIYSKYVNDDDVLV
                     TNSFDNKAWILNPDKTEVPPNTLMQAGVFVNSASEAWSKKIASSPWWCFAKNVTKFDD
                     IDGGVLPAGSFRMKNPKDKNMLPPAQLVMGLGFIWKVKSEEDEEDEEKSEDNESSADE
                     EEIPSESTPEVTETDNNSVNDLSEKVEQLGFDVNNFDEIPTKEHLSQSQEEVQYSNSS
                     DEQPDDTKTIATTIVENMNTKVRGKKGKLKKIQRKYLDQDEEERLARLEALGTLKGIE
                     KERQKKTEELEKAEKREFKKQIRKRQEESRIHQFNKSEKVKVNIAHILQQLKGTISQE
                     DEVSDVIPVYAPWSALTKYKYKAKVQPGTAKKTKSINDVLHYFITREVDSGESSKELD
                     WPREHEAIKLIKGLDIVPIICSDKLKVTIPGSNDKSSSSGKGKKASQSNKGKKSKK"
     gene            <779473..>782127
                     /gene="PAT1"
                     /locus_tag="KLMA_40332"
                     /db_xref="GeneID:34716318"
     mRNA            <779473..>782127
                     /gene="PAT1"
                     /locus_tag="KLMA_40332"
                     /product="DNA topoisomerase 2-associated protein PAT1"
                     /transcript_id="XM_022819631.1"
                     /db_xref="GeneID:34716318"
     CDS             779473..782127
                     /gene="PAT1"
                     /locus_tag="KLMA_40332"
                     /codon_start=1
                     /product="DNA topoisomerase 2-associated protein PAT1"
                     /protein_id="XP_022676177.1"
                     /db_xref="GeneID:34716318"
                     /translation="MSFFGFDSSGRKPPRERRKQGEEESLDFEETYQGLGDYEEPEDM
                     LNDETFGNAADLGTDFDFGYGKGELDAGTGSARSEAPAPVSYASIANAKMNRAQNSKP
                     GFDQSVDMQPMESLWGNSSSNNPQQQQQQQQQQQQQVPQQVPQPQQLQQPQQPHMQGV
                     PAPGMEGLTMQALERQQQMGMPPQPGFYGMQPPQGPQNPQGPQGPQGPNYGFIPQGYP
                     QGQYQQFPGQNMPPPVMPNQFGNPQFSNPPVNPVNPQEQFQQMPSMMYNQNQANIPPH
                     MQQPPHMAMPPMQHQPQHQVPPPNQQAQPIVHQQMPMQSSPADNQAILQSNRGNQEYQ
                     RVNSPPVQTESEQVPTPPHTPREYRRGPRRFGPQDQLSNEELRRLQIRQAKVDKILRH
                     SGVMTPRDKDFITRYQLSQIVTDDPYNEDFYFQVYKIIQKGVTASESNKDSIAKAYLE
                     HSGHRLGGRYKRTDVALQRMQSQVEKAVTVAKERPQKSKDGLDNAKEGVLGKISATRN
                     SKAPRKQLQIPTHKEDSPAPNSQPGSALDEVTESLQGVDINSKRRRSSYALSSSVDQR
                     SVLTRSGGRKFILTLIEAVYEEVLELEAQLRSGQQPDSTKLWEALHIEEHGYDVSPFI
                     SILSFDKGVKIMPRIMNFLSREEKIKLFNCFFKELSHLNVIVVSSYKTTPLPTKEQLK
                     KVELFQSIFLKIIVSFLSSSAEFLEVMGLLINVIQNNNVSFITTSRIGLNLITVLISR
                     AALMKQDVSRGKLLSSMEVSTWSEVYDRLFTALETKLSAVFPTQEYMQHVISVYEQET
                     TQYDQSYIWQFFASLALSGKLNHQRILIDEVRDEIFDVISKAEELKNTAQQDPKLVYQ
                     RNKYYQDLNLFLNVMGLVARDGEITELK"
     gene            complement(<783516..>783761)
                     /locus_tag="KLMA_40333"
                     /db_xref="GeneID:34716319"
     mRNA            complement(<783516..>783761)
                     /locus_tag="KLMA_40333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819632.1"
                     /db_xref="GeneID:34716319"
     CDS             complement(783516..783761)
                     /locus_tag="KLMA_40333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676178.1"
                     /db_xref="GeneID:34716319"
                     /translation="MSMSLNLAEMVPNAIGMIAFDNDGQIIEAVGIGKERKEDVLQLQ
                     QVELDDEGFGLLEYDNIQVLIYKKEEKTVAVYTHSGK"
     gene            <784017..>785711
                     /locus_tag="KLMA_40334"
                     /db_xref="GeneID:34716320"
     mRNA            <784017..>785711
                     /locus_tag="KLMA_40334"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819633.1"
                     /db_xref="GeneID:34716320"
     CDS             784017..785711
                     /locus_tag="KLMA_40334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676179.1"
                     /db_xref="GeneID:34716320"
                     /translation="MKGLWLIFLASVVIMTVAAFFFVNRVLSFKLYKNGYPMTLFILF
                     VNMFLLLSITYLLPLDVFYAAQSVGKDTPLAPNGTASAIYTRTDIQMQTQGDILSTPT
                     TSPNFHFLWNFLYWSQFVICWFILPVLISYVDLKYLYPRDSSDSWTYIMKRVQTAIYM
                     NLKFYVFCAIALLLGLLYLFMATRHGIKDIKPLIIAMSHLYSLSYTLILLSNGLVKLP
                     KSLLLQEQNEKKMFVKLSQNNEDLNEAKLGLLEVAEKIISLNVENQADLDLQQAVQEC
                     QMEVQRKCNELQLTIPKLSTNSHVHTIELSKLNNYYNTFSKEYYNYTYHQANADEIIH
                     TLVRSQSKAISIPLNLSAKISGFILMLLSILVFLLQVTPVKFGHAWIFMGKTFWNFLL
                     EMSILLHNTICSLYSLLHVKIHNFHLVRNGNSSPKNALYFSLYSSRLLFPLCFNYMTL
                     VPRATDVEHKSGFDKVLYHQLERVPLAKFLNEYLPIFFVLIVPLSQYFDLKDKLLSKV
                     LGEEYYYQLFGSISTDDRPLTTSTTQRTRVDEDYEYSLQDGQYLFERATSNYDMHV"
     gene            complement(<785830..>787368)
                     /locus_tag="KLMA_40335"
                     /db_xref="GeneID:34716321"
     mRNA            complement(<785830..>787368)
                     /locus_tag="KLMA_40335"
                     /product="pyruvate dehydrogenase kinase"
                     /transcript_id="XM_022819634.1"
                     /db_xref="GeneID:34716321"
     CDS             complement(785830..787368)
                     /locus_tag="KLMA_40335"
                     /codon_start=1
                     /product="pyruvate dehydrogenase kinase"
                     /protein_id="XP_022676180.1"
                     /db_xref="GeneID:34716321"
                     /translation="MGVKFPSSLLNKIWHYSEVPQTAVSLRQMCQFGSHPTPGLMFKA
                     SCFLLNELPVRLAHRIKELESLPRELNKVEEVITVRDWYTQSFQELYEFCHDESQNHG
                     AIYQSLFYGSKTANVDSLAKMLFTQEEMETMKQAQNAKNSLYCKHKKFVDDGIVMKIP
                     GPQSHTSSQPINTNGLVPLPQKYFSPLPASTVKEWSKSQDFYQFWPADLLLFNRSFYN
                     VLQRIKERHDATVITLAKGVLKWKKTHQQNVVDDSIQSFLDRFYLSRIGIRMLIGQHL
                     ALLESARQPAQEPMDEDDENWVGIICTKTNITQLAKSAIDNARHICADHYGLYEAPKV
                     QLLTFPLDYRPSTEGTTSCTNEAPDIEFMYVPGHLIHMLFETLKNSLRATVEKVIAKN
                     KSKDRYDLTFPDIKVIITEGTEDLTVKISDEGGGIARSNMPLVWTYLYTTMPEDEQIG
                     LMSEELSQNFRIPMAGYGYGLALSRLYARYFGGDLKLMSMEGFGTDVYLHLNRLSTSS
                     EPLQ"
     gene            <788318..>789061
                     /gene="ERS1"
                     /locus_tag="KLMA_40336"
                     /db_xref="GeneID:34716322"
     mRNA            <788318..>789061
                     /gene="ERS1"
                     /locus_tag="KLMA_40336"
                     /product="cystine transporter"
                     /transcript_id="XM_022819635.1"
                     /db_xref="GeneID:34716322"
     CDS             788318..789061
                     /gene="ERS1"
                     /locus_tag="KLMA_40336"
                     /codon_start=1
                     /product="cystine transporter"
                     /protein_id="XP_022676181.1"
                     /db_xref="GeneID:34716322"
                     /translation="MERLLGIVYVGCWSISVYPVLYKNWKNGNANAVSFDYVVLNTVG
                     YVCLMVSMLLQKLLWINDGDEKVTAPEIAVPDLVYCGHGTFMCFMLLSQFLVGTSIWR
                     FPTTIITHTRMHYIYSRIFKIVMFLVFLMTVVFLRQTLSGNMTNALLLSYCNKLSMVK
                     ILMSLTKHLPQVKHNFERKNMADFPIQSTCIDFLGSVCSLSQLILRLSSKPQGLSLMS
                     FVTNFGKAGVGLVTLLFNIVYISQWVAYT"
     gene            complement(<789358..>791898)
                     /gene="SYG1"
                     /locus_tag="KLMA_40337"
                     /db_xref="GeneID:34716323"
     mRNA            complement(<789358..>791898)
                     /gene="SYG1"
                     /locus_tag="KLMA_40337"
                     /product="protein SYG1"
                     /transcript_id="XM_022819636.1"
                     /db_xref="GeneID:34716323"
     CDS             complement(789358..791898)
                     /gene="SYG1"
                     /locus_tag="KLMA_40337"
                     /codon_start=1
                     /product="protein SYG1"
                     /protein_id="XP_022676182.1"
                     /db_xref="GeneID:34716323"
                     /translation="MKFAEHLQESQVPEWSDKYINYKLGKKKIKQFQKIRRMQDVGSM
                     DNVMVREFIHDWVIRDQLKNCDEFYEWQLSKYQQKYLKLQRQIHMYVLETEKRGRLED
                     ANRVTSEVSLSQLSESYGSIFPGFSPVYLRYTLKQKIWHDLKQWLIVNDLYPSMPVAW
                     KEKAPLLSKRTRRHGSRGQETFQSQPFQLPLSQIRRQLSEAILDFYLYLQLLKNYRDL
                     NVNGFRKIVKKFDKVLHQHQLRGFMEYAKRNSTMFSHYDEYLKLIKDNIEHADVVNAN
                     TFLGEGNNKEDLKKDPLTFFEQQSINWYTMTLTSSSKDKKLNLEQIKSLSLQYSFNEQ
                     TVHRINASMSQMFLGSTLLGVSLTLVILMVVILARHSTDRMKTNILPIWSSFHYVTFM
                     GLLFVIDCFVWYKVKINYRFIMFGEIHSRNGPVLFNNDFAMTHIPLQFFLATTFLCIC
                     SLLAFCSLVMEKLEPWVLVWLLTGFILLFWKFKAVQIWPYWDATWQARKYLIKTFIRL
                     IFSGFFPVHFGDFFLGDIVCSLTYSMSQFATLGCISFASSNEDKCRYENLLWIGILSC
                     LPSYWRFVQCLRRYFDSYDWFPHLLNALKYAFSVIFNASLYWYKSWPQDPKFRNLLII
                     FGCLNSSLTSMWDLIMDWSLLQKKSKHFLLRDDLYLAGKKNWKTGEYDKFRTLIYYYF
                     MLFDVIVRFEWVFYMVKNNTDYVRHPLVSLALATMEIIRRFNWVILRVENEHVANVHL
                     FKVTDDNWQLPFPVTEEGGEIAREDEYSAAAENMDNIALLTAMRSNPESETLPQPRAH
                     SVSRAERRASVFEIIPWAHATDFQRPLEAPIDESAAASDSETDSESLV"
     gene            <792686..>793579
                     /gene="HIS1"
                     /locus_tag="KLMA_40338"
                     /db_xref="GeneID:34716324"
     mRNA            <792686..>793579
                     /gene="HIS1"
                     /locus_tag="KLMA_40338"
                     /product="ATP phosphoribosyltransferase"
                     /transcript_id="XM_022819637.1"
                     /db_xref="GeneID:34716324"
     CDS             792686..793579
                     /gene="HIS1"
                     /locus_tag="KLMA_40338"
                     /codon_start=1
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="XP_022676183.1"
                     /db_xref="GeneID:34716324"
                     /translation="MDLVNHLSDKLLFAIPKKGRLYEKSVSILKGSDIKFHRSARLDI
                     AISTNMPVALIFLPAADIPMFVGEGKCDLGITGVDQVRESEVDVNLPIDLQFGSCKLQ
                     VQVPVTGQYTDPKQLIGKTIVSSFVKLTKKYFADLEGVPESEMTTRVRYVGGSVEASC
                     ALGIADAIVDLVESGETMRAAGLTDIATVLETSAHLIESKNPKGDVELLKTIKSRIEG
                     VMTAQKYVSCSYNAPESKLSELLKITPGRRAPTISQINDEGWVAVSAMIERKSKGDIM
                     DALKKRGAEDIMVFEISNCRV"
     gene            <794373..>796397
                     /gene="MET30"
                     /locus_tag="KLMA_40339"
                     /db_xref="GeneID:34716325"
     mRNA            <794373..>796397
                     /gene="MET30"
                     /locus_tag="KLMA_40339"
                     /product="F-box protein MET30"
                     /transcript_id="XM_022819638.1"
                     /db_xref="GeneID:34716325"
     CDS             794373..796397
                     /gene="MET30"
                     /locus_tag="KLMA_40339"
                     /codon_start=1
                     /product="F-box protein MET30"
                     /protein_id="XP_022676184.1"
                     /db_xref="GeneID:34716325"
                     /translation="MSNTEFDLHQSCKPVLKRGFDEVDAATLVNEGNGNKNKKSTALV
                     RNKALKSTAGLKDDNKSSHNGHNKKEQEHEHEEDGEENVILSNKMPEFNFIKYCYRHN
                     PDVQHSCKDSMVFQDQLRLERWNQKINALEKDSDRDKIRQTLQNFQNSNEKIRKLMLE
                     GILQLCCFPQLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLCTAALVCKRWK
                     VLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARFLPVNEAHVYNQNGTQNNATS
                     NNNTRESTPGATATIVPSTRSACNPVPQTAVEKTRAKNSRYYTRPWKVIYRERFQVES
                     NWRNGRCRIQVFKGHMDGVLSLRYNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDG
                     VKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSGSADK
                     TVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSCSDDKTLRMWDIRTNSCIKVFR
                     GHVGQVQKVIPLTIKDVANLVVDKDLPEERHNAEQDPQALGNQQNQNQENEQDDCTGV
                     LDPNLKYPTHLLSCSLDNTIKLWEVRTGKCVRTQFGHVEGVWDIAADNFRIVSGSHDK
                     NVKIWDLQNGKCIQTFTGHKAPIVCVGIGDSSFASGDELGEVKMWHFDDI"
     gene            complement(<802669..>803517)
                     /gene="AGE2"
                     /locus_tag="KLMA_40340"
                     /db_xref="GeneID:34716326"
     mRNA            complement(<802669..>803517)
                     /gene="AGE2"
                     /locus_tag="KLMA_40340"
                     /product="ADP-ribosylation factor GTPase-activating
                     protein effector protein 2"
                     /transcript_id="XM_022819639.1"
                     /db_xref="GeneID:34716326"
     CDS             complement(802669..803517)
                     /gene="AGE2"
                     /locus_tag="KLMA_40340"
                     /codon_start=1
                     /product="ADP-ribosylation factor GTPase-activating
                     protein effector protein 2"
                     /protein_id="XP_022676185.1"
                     /db_xref="GeneID:34716326"
                     /translation="MTSVEVKKVLSTLLRDPDNAKCGDCKVATHPRWASWSLGVFICI
                     KCAGFHRSMGTHISKVKSVDLDTWTEEHLAAVLKYGNNKKFNEYYENKLGGGTYVPDQ
                     SKLGQFIRTKYELKKWVGDGPIATTNKDATKNPTATKTKPAVQSASPTTFASQKSAAN
                     ISTDLNRDLHLTPVGTGGSSGQKSSTQESSFQRNNVYKPQDRPDLKKSILSLYANQKS
                     SQSPSHSSLHLPNKNNNSSNSSFNSGGVIGGVSSNPWSLSQPAGETRTGSSLSLDDDL
                     FKNVWS"
     gene            <805014..>805550
                     /locus_tag="KLMA_40341"
                     /db_xref="GeneID:34716327"
     mRNA            <805014..>805550
                     /locus_tag="KLMA_40341"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819641.1"
                     /db_xref="GeneID:34716327"
     CDS             805014..805550
                     /locus_tag="KLMA_40341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676186.1"
                     /db_xref="GeneID:34716327"
                     /translation="MKDPLITMDEVSKHTSRDDCWTVIHGKVYDITNFLNKHPGGTQV
                     LLKYAGKDSTLQFDDIGHSLESLAYDLDPGALKGTLYQPKSKSHRIGDNDNDEENNDE
                     VQLPFFLTTIFPAAGIFWLTEACQAIKKFLVLERDTRIRLLSVTIFFCVLTLGLIHYG
                     HDDFAIDYNDYSAPTWLD"
     gene            <806524..>808092
                     /gene="HOM3"
                     /locus_tag="KLMA_40342"
                     /db_xref="GeneID:34716328"
     mRNA            <806524..>808092
                     /gene="HOM3"
                     /locus_tag="KLMA_40342"
                     /product="aspartokinase"
                     /transcript_id="XM_022819642.1"
                     /db_xref="GeneID:34716328"
     CDS             806524..808092
                     /gene="HOM3"
                     /locus_tag="KLMA_40342"
                     /codon_start=1
                     /product="aspartokinase"
                     /protein_id="XP_022676187.1"
                     /db_xref="GeneID:34716328"
                     /translation="MIDTTNWIVQKFGGTSIGKFSEQIVNEIIKVYSQEYDNNVAVVC
                     SARSSYTKAEGTTSRLLLACELASNNNYEYKNVLDLVEKDHLANAKEHIKDITIQETL
                     IEDSQKEINVVRRYLDASQVLGEVSTRTLDLVMSLGEKLSCLYMTALCQDNGVNARYV
                     DMSFIVPSDYECKDGTLDNSFYAFLVSAFKEKLAPLLAEIEKGTKVIPVITGFFGIIP
                     MGLLNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQARLLETVTPDE
                     AAELTYYGSEVIHPFTMEQVIRTHIPIRIKNVQNPKGNGTIIYPSDQAKKGESTPPHP
                     PVALTSSIFESKKKGATAITTKSDIVVVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDL
                     ISTSEVHVSMALPVPDSDSLKALRAAVVELKRLGTVDVIKKMAIVSLVGKQMKQFIGI
                     AGTMFTTLAEQNINIEMISQGANEINISCVIDESNAVRALQSIHAKLLDAPLNETFDS
                     AVNERLEQIKQMAL"
     gene            complement(<808223..>809068)
                     /gene="CBR1"
                     /locus_tag="KLMA_40343"
                     /db_xref="GeneID:34716329"
     mRNA            complement(<808223..>809068)
                     /gene="CBR1"
                     /locus_tag="KLMA_40343"
                     /product="NADH-cytochrome b5 reductase 1"
                     /transcript_id="XM_022819643.1"
                     /db_xref="GeneID:34716329"
     CDS             complement(808223..809068)
                     /gene="CBR1"
                     /locus_tag="KLMA_40343"
                     /codon_start=1
                     /product="NADH-cytochrome b5 reductase 1"
                     /protein_id="XP_022676188.1"
                     /db_xref="GeneID:34716329"
                     /translation="MVNTSFLFCGAVLLVCTIIAVILEIQANQSKTVLNKEKLQEFPL
                     VGKTILTHNTAVYRFGLPKKDQVLGLPIGQHISVQANINGKEIVRSYTPTSLDSDSVG
                     FFELLIKSYEKGNISKHFAELKIGDKIKVRGPKGFYQYVPNMCEEIGMIAGGTGIAPM
                     YQIMKAIFANDADKTKVSLVYGNQTEEDILLKKELDAFVAKKPDQFKIYYMLDKAPES
                     WTGGVGYITADIMKDHLPTPADGVQLLVCGPPPMVSSIKRNAVSIGFQKAKPISKMGD
                     QIFVF"
     gene            complement(<809318..>810751)
                     /gene="JHD1"
                     /locus_tag="KLMA_40344"
                     /db_xref="GeneID:34716330"
     mRNA            complement(<809318..>810751)
                     /gene="JHD1"
                     /locus_tag="KLMA_40344"
                     /product="jmjC domain-containing histone demethylation
                     protein 1"
                     /transcript_id="XM_022819644.1"
                     /db_xref="GeneID:34716330"
     CDS             complement(809318..810751)
                     /gene="JHD1"
                     /locus_tag="KLMA_40344"
                     /codon_start=1
                     /product="jmjC domain-containing histone demethylation
                     protein 1"
                     /protein_id="XP_022676189.1"
                     /db_xref="GeneID:34716330"
                     /translation="MTSDGDDTSAKCQYCGKDDSEDKGKVIWVGCEYCDSWVHLLCLP
                     INCMIPKPDNKEELMDIKENQINSFRCLLHSDDKRPELKLVRISTAKQSRLRKKRAID
                     YVALNEGNDKRLKHEHPHIKAFLACFERWKGLKTITSKQLESDFQSIKEPLRVIDPEN
                     SGMYVSTANELGLVDDKNNTKLNVDFLTQILGDDYPIDVMDVQTQMNERWTLAQWNDY
                     YTNTSVQKRDRIKNVISLEVSHVEQFKNGIRRPKAVDNNDLVDLVWNFGGENDDIERP
                     KVTKYILMSVQNAYTDFHLDFAGTSVYYNVISGAKKFILFPPTEFNLKQYKKWCDDDN
                     QNLVFLGDLLKEGIAMDLTEGNLFMIPCGYIHAVFTPRDSFIVGGNFLTLRDITTQLG
                     VVAIERATKVPKKFTFPQFDIVMGKTCEWLLESNNIEKVKPADVVSLIAYLKSSKTKY
                     RPLKHETKKALILALSNKLDNTSADAL"
     gene            <811115..>814261
                     /gene="ulp2"
                     /locus_tag="KLMA_40345"
                     /db_xref="GeneID:34716331"
     mRNA            <811115..>814261
                     /gene="ulp2"
                     /locus_tag="KLMA_40345"
                     /product="ubiquitin-like-specific protease 2"
                     /transcript_id="XM_022819645.1"
                     /db_xref="GeneID:34716331"
     CDS             811115..814261
                     /gene="ulp2"
                     /locus_tag="KLMA_40345"
                     /codon_start=1
                     /product="ubiquitin-like-specific protease 2"
                     /protein_id="XP_022676190.1"
                     /db_xref="GeneID:34716331"
                     /translation="MARLKHELGLHPRDTLTKSTTSNSNAGNGLKPSTNKKDLSAGTR
                     YDSARYKVKKEHASFELFSIADEDEDNNRTGKSTSTERMIDITEPEENKDLPTKEKRI
                     EGAGIISPMNLSSNNKITIPYYTEGITKIVNSDSKHGEIFRFVAGLKITLTRGPDFLQ
                     KPNLSIQFMRKDNNPIGGFCFGINDGILLFIYDSKGEGFGVIFSPPKHFSVSVPGEKD
                     TRRVTTHCISWTCTSHMAPESNKFLELIKTYKKLLPKSNLVPDNIRKGDKGQIDEMIN
                     EYKKPPSRRSPSTFSNLDKIQKKDLKSLQKSRKGGSGSKIPPPEPTYDLEEKVSRSEA
                     IPQKSFYAEPGKRFSYVSALSRKTRSATNSTTKENYQSFSDDLIEQEQPEEFKPTLSY
                     TFSDGFKISVNNQDFKCLYNHDWINDTILDFFLKYYIEESINSGIVSRTDVYLFSSFF
                     YTKLISTSENRYENVKKWVNNSNLFSKTFVVLPVNMNYHWFGCIITNLNKIKDAMEKC
                     KESHQHIITGPGNENSTIPSNPSAEQNISEKYYTCMENDLPTISLLVFDSLRQTHSKL
                     MDAVKDFIIDYGKDVHQFSIPRNKIKVKTCLVPEQPNMSDCGVHVILNIKKFFEKPKE
                     TLDLWYTRSPSNYSKKVNEFFEKKERLMARKSLRALLQDLQKQQITANGEANCDTKDE
                     SIEENHSDLEIIENFEESLMNDKIQETSDTTNNERQSDPTDTIQRIHNLSDSITSSIE
                     MQQKRPTSEAEQSIYFNRNSHNTALTNSLDGNMSEDVTANIRNESKNNFSSVDNHNKM
                     ISNEDQTPICAPQLSDRDYMEKSDFADDFLSSQPPDTQQRRNRRATQELDNVDDDSSI
                     DEGVPRKDSSPELDVNEKLSPLPDRVLNERFQRLRTTEHTNGTRPSKEEKITNSIYTS
                     AEISSNTNKQYHQSNDSFSKQGSHYNGKEPPEVLNEKISLELEEEIKVSPDWNHKSTN
                     DKIPEDFSSHNSTSSPTDSVEEILNRETIKESEEQPKRRTNKRSFEHIYENGKAIYAS
                     NNPKIPKPNNVFNKSASK"
     gene            complement(<814406..>817177)
                     /gene="SSM4"
                     /locus_tag="KLMA_40346"
                     /db_xref="GeneID:34716332"
     mRNA            complement(<814406..>817177)
                     /gene="SSM4"
                     /locus_tag="KLMA_40346"
                     /product="protein SSM4"
                     /transcript_id="XM_022819646.1"
                     /db_xref="GeneID:34716332"
     CDS             complement(814406..817177)
                     /gene="SSM4"
                     /locus_tag="KLMA_40346"
                     /codon_start=1
                     /product="protein SSM4"
                     /protein_id="XP_022676191.1"
                     /db_xref="GeneID:34716332"
                     /translation="MDRHLAQREFDAQLDAQLRQRQAPNANNQNQDGEDIRPGVVLEN
                     EDGQARAIFNLNLDYKYFPSYFSIVFSVIGGYLFLAYALTTLVGYLLNLVYFKIIAIM
                     VNGVSILGTYMNLPGYHQRIVEMWPIVTKFESALYDAIILPIVNLYFAYTKGTEKHGM
                     LVRMIAPASTYLTFIALCCIVPEILSRGHSKKNRLKTQWKRVVFQVTYTIKCTLKVLT
                     LFTLELAGFPILAGFLIDISLISPLLLPQNSLTFIPKFCSFWPPYFSYIAYWAIGTLY
                     MYRFAQYVGMVRQYIIRPGVLFFIRSPDDPNIKLLQDSLIYPMKLQLSRLLLSMAIYT
                     AFILVGFGFHTRFLFPFILRSELLPMKHSLSTLLTTGTLLSITVLAFTDKVLSKNRII
                     NVYVRQYWIFVFDICCRKIRLSSFILGKDSPTERGHVVYRNFYYKWFNSKKARLSNLQ
                     LYSHPKSENEVKSLFNEIPDVHAYFVPDGTMMRVPASDIISKKYAQLLFVPVTKDDKL
                     LKPLDLKHIKERQKRTAGEFGYLEKQPTEFDEYKVVYVPPHFTLMYSLLIVFIWFFSS
                     LLFIGLLLASNLIGLPVITGLQYLLHLIVPSFIDSGINLYGSINSLNLFSVCCGLVIL
                     SVALTSYHTRKLNALVRNNRIVEVNVDNIENELDDVIQEVQLGENDINNNINNIDVNN
                     NVAAPAAEEFDIWNPINGFISAIHPIFTAYVGTFLFKCNVSYHSNFLFKYFKFHFLEE
                     NLIHLDDNINTIHPAIMFWFLPSDLVSNGYSVETCLTIFLRIEIAIVGYIAFKTYQEE
                     NKTAGRRKLIEKAADVCTIFLALLLLVPILLQYLICLMEYVSNRNSYTSTWAPFIYFT
                     MITPGVSSDHESMSVLQKLFYCTDAVVFSSAFIALKIVTLRGIYESVTQRVRDEVYGR
                     GRILKNFDD"
     gene            complement(<817482..>818405)
                     /gene="SSM4"
                     /locus_tag="KLMA_40347"
                     /db_xref="GeneID:34716333"
     mRNA            complement(<817482..>818405)
                     /gene="SSM4"
                     /locus_tag="KLMA_40347"
                     /product="protein SSM4"
                     /transcript_id="XM_022819647.1"
                     /db_xref="GeneID:34716333"
     CDS             complement(817482..818405)
                     /gene="SSM4"
                     /locus_tag="KLMA_40347"
                     /codon_start=1
                     /product="protein SSM4"
                     /protein_id="XP_022676192.1"
                     /db_xref="GeneID:34716333"
                     /translation="MVSDEDSGYESEKPTTGGAQSNVNGATCRICMLEGSEENPLFHP
                     CKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPIEFQTLYEKDMPDRIPL
                     SLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLSWNVWGKLYTAAVDDFSFPSDNKW
                     YINIIFGFEKSIPEHPSTSDIIYQLLNNYRFSVIQMAVILVVHAIAYLQYDMVVREPI
                     FNKMIIHKIGPKWTKQDLAIQTLRDFPNIDPRDLNRLINTLDRHNQEESNDENSSSDE
                     DEEQQQQQQQQQQLHQNEAAVDSDVASFDSE"
     gene            complement(818765..818840)
                     /locus_tag="KLMA_R421"
                     /db_xref="GeneID:34718719"
     tRNA            complement(818765..818840)
                     /locus_tag="KLMA_R421"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34718719"
     gene            <819133..>819474
                     /locus_tag="KLMA_40348"
                     /db_xref="GeneID:34716334"
     mRNA            <819133..>819474
                     /locus_tag="KLMA_40348"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819648.1"
                     /db_xref="GeneID:34716334"
     CDS             819133..819474
                     /locus_tag="KLMA_40348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676193.1"
                     /db_xref="GeneID:34716334"
                     /translation="MLRRDPTVLSLTADDISELQEHLEEYKLQREIKAQHLNLLRSSS
                     NPNKDAQLKSLNDNNFIPRESMLYSLHKMTPSRQNKPTMPLDRGFDQAPDDSNAQESA
                     NPFYASNSNND"
     gene            complement(<819551..>819961)
                     /gene="EMC5"
                     /locus_tag="KLMA_40349"
                     /db_xref="GeneID:34716335"
     mRNA            complement(<819551..>819961)
                     /gene="EMC5"
                     /locus_tag="KLMA_40349"
                     /product="ER membrane protein complex subunit 5"
                     /transcript_id="XM_022819649.1"
                     /db_xref="GeneID:34716335"
     CDS             complement(819551..819961)
                     /gene="EMC5"
                     /locus_tag="KLMA_40349"
                     /codon_start=1
                     /product="ER membrane protein complex subunit 5"
                     /protein_id="XP_022676194.1"
                     /db_xref="GeneID:34716335"
                     /translation="MSLFSKSLFLLAWLQLIHSGFSSYEFHRVSKQLVLDNPDAVLPK
                     LPLDIKLEAISGLVFFILAEFIGNSVLRFLTIRGEERIIDTHEYLKPVSMNKASNINL
                     LLNSDPYGEINYHPSFVDIQAKRKEMKEFLAAKG"
     gene            complement(<820306..>823644)
                     /gene="IRR1"
                     /locus_tag="KLMA_40350"
                     /db_xref="GeneID:34716336"
     mRNA            complement(<820306..>823644)
                     /gene="IRR1"
                     /locus_tag="KLMA_40350"
                     /product="cohesin subunit SCC3"
                     /transcript_id="XM_022819650.1"
                     /db_xref="GeneID:34716336"
     CDS             complement(820306..823644)
                     /gene="IRR1"
                     /locus_tag="KLMA_40350"
                     /codon_start=1
                     /product="cohesin subunit SCC3"
                     /protein_id="XP_022676195.1"
                     /db_xref="GeneID:34716336"
                     /translation="MSVRRSTRIRSKASYNEDSEPESDVEDEEVSRATGVDVDDQTEQ
                     VGDMDDILESSSSEEEEDANDDDYVAPGSKKRKSTSRAQNSKRAKKGNSRSRDGSKTK
                     TKTNRTSGSGSHTSSKAERETFLAIQNDFEPTELFRILSASADHSVEELASDWLESYN
                     EDRTQALSEILNFLLDCAGCLTHIAEHDVVNNDSSNETIGEIQIMFQQQKIHEFHLRL
                     SDEHSKRAKYKSLSDNFTQLMSNLIDLAVEKEMIYVEKEKEDSEEVIVETHPLIIDLL
                     TWLPSLTVSKIRSLRYVSTKALLVFQTVFAKVSASLETDSLFKLRKQLTLENKKRNPK
                     SKTIETLESSIADAEATKTIIENNMDNIIKLCFVHRFKDVDELIRINSISELEQWMVN
                     NPEYFFKVTFLKYFGWLLSDSSHAVRLQVLKILSELIRFTNKRNKSVTDNAALRQFFE
                     RFKGRLLEIAHRDIDIQVRLTAVRVLSQINDFGYLDDEEIIEITSLIFYDQEVKLTSS
                     SRDVKFLSEVAKFFSSIVTEKSAELSRDYESNYTNIPLIMTKDHFIEIGVLMRVLNSS
                     LSQFLSTVENEDQLEEGSSKKIKLLYQASEFLSPKFGDLVGDIAKLLYKEIDFEKDLE
                     DKSEYSSADLSDIKLLLPDNDNKVLFYLTVFSGLCTGGVFHNKGQERQMVAQLALPEL
                     IHLFKKMNLDSDLIYTLLLDIVCLFNSEEWSSTEQNNDINIINEIILKRFESSPLLLE
                     SQNIVSKAYKKLIPYLTTINRTEIVDSWKSLQVNIMLSLNKFLESFDIKLENAVTTLH
                     VQYLNKLVILGKEIPTEISESTLSMLTEKFLSKLPNLLESLSKDELSILDFKIFTSVI
                     SWNLESWANIIKNSEQPVPVSQSTLSQIKQILDLLFDIALEVNNNEEVRDIVKYHVLY
                     SVLSVLLDSIMAFKMFELNIPERDTNWKRALRQDYHISLTRELSEICLSVFLYLESCH
                     ANMLKVTLDRVDDENVNYNDSVLLDSSKDTERELCIFTMKLKGVSKLGVLPYTNLQSR
                     LELNKDKLGSLFESIITESIFNNDNKNQPQKNTLPKPSEHERAHSSAPEEQLEPIEEF
                     TQDESINSQSHILPSADPIVSSPI"
     gene            complement(<824566..>825276)
                     /locus_tag="KLMA_40351"
                     /db_xref="GeneID:34716337"
     mRNA            complement(<824566..>825276)
                     /locus_tag="KLMA_40351"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819652.1"
                     /db_xref="GeneID:34716337"
     CDS             complement(824566..825276)
                     /locus_tag="KLMA_40351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676196.1"
                     /db_xref="GeneID:34716337"
                     /translation="MVEDCQKLCVTIDPALCGFTRDDHVIITGNFDNWNPGQYVLEFD
                     ADTGCFKVQLPYDGVSETIVCKFVVNNNEWQTLDCFDKHVDNMGHENNIIHCKAWLQP
                     RGANASAGADADADADADIVMEDVELDLHPLSNSVSPSDLPIEQLDLAATISNSDDHD
                     YIHITSRGELSSSEDVELDLRTATGAIDDILNHENGQQGQSAQSAKSSNNTDYQFSHN
                     PIHGLVAKLRHATTYWKR"
     gene            <826592..>827164
                     /locus_tag="KLMA_40352"
                     /db_xref="GeneID:34716338"
     mRNA            <826592..>827164
                     /locus_tag="KLMA_40352"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819653.1"
                     /db_xref="GeneID:34716338"
     CDS             826592..827164
                     /locus_tag="KLMA_40352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676197.1"
                     /db_xref="GeneID:34716338"
                     /translation="MSSDEQFEDFDTSSSPLFEQELVSPKGDILPYIGVLLYIIEQIL
                     LFFNSPAFETIVNTIQQIVQWIIGLFSLISLLGYHGVQSKIVDQYISSTSFFVATTHD
                     ASDLFNNRIHLAILLINLFTKQDDAPKKEIDWKKIILQILLWIIQRLLDDQNNKNGNG
                     NNPKASNANSFLAVIVKALSIIVCLRYLLT"
     gene            complement(<827437..>828189)
                     /gene="WSS1"
                     /locus_tag="KLMA_40353"
                     /db_xref="GeneID:34716339"
     mRNA            complement(<827437..>828189)
                     /gene="WSS1"
                     /locus_tag="KLMA_40353"
                     /product="DNA damage response protein WSS1"
                     /transcript_id="XM_022819654.1"
                     /db_xref="GeneID:34716339"
     CDS             complement(827437..828189)
                     /gene="WSS1"
                     /locus_tag="KLMA_40353"
                     /codon_start=1
                     /product="DNA damage response protein WSS1"
                     /protein_id="XP_022676198.1"
                     /db_xref="GeneID:34716339"
                     /translation="MVQPVQKNPLIGSIAVLQSKPGKEEAFDILKRIAHEVSYLMKEE
                     NFKVKQLVEFYPKDRSLLGMNVNRGMKIMLRLRDPLDEYRFLPFEHILGTMLHELTHN
                     LFGPHDQKFYAKLDELSGRQWTIEQLGLYNSFIGPGHRLGGGTVGNNVRGTKLNLGAN
                     KIAKRGKPRGRKLGGLNSATGRLGPRKSAREMAAMAAEKRASDNKTCGNSQKQEQYIP
                     SQDDLVIEILDDEPESPKDSNVQKPIEIIDLT"
     gene            <828743..>829519
                     /gene="NSG2"
                     /locus_tag="KLMA_40354"
                     /db_xref="GeneID:34716340"
     mRNA            <828743..>829519
                     /gene="NSG2"
                     /locus_tag="KLMA_40354"
                     /product="protein NSG2"
                     /transcript_id="XM_022819655.1"
                     /db_xref="GeneID:34716340"
     CDS             828743..829519
                     /gene="NSG2"
                     /locus_tag="KLMA_40354"
                     /codon_start=1
                     /product="protein NSG2"
                     /protein_id="XP_022676199.1"
                     /db_xref="GeneID:34716340"
                     /translation="MEEKPLKSTGSKFGSSDSFHTLTKPTLFGLYDDDVVKSEDTEIY
                     EEVKKTSNEKGSVAGKEEERLKSLPSVSTVATTWIVLSAAGIAYHELSKNLHDNHELH
                     NDFTSHPLLLAATIAQSLSFGYIPPWVAYAIEGIVFGSIVPILDWLFGIFDTNSISIS
                     SVLRSTNAMLGVSFGIRRIEWSSSLQASGAWFLLNIVLWLFFDGTFTMLISGIAIGLI
                     TCLTCYHHITDNAQLLYFVDFYFLGLLFFTRLGKYMYRRR"
     gene            complement(<829844..>830341)
                     /gene="IGO2"
                     /locus_tag="KLMA_40355"
                     /db_xref="GeneID:34716341"
     mRNA            complement(<829844..>830341)
                     /gene="IGO2"
                     /locus_tag="KLMA_40355"
                     /product="protein IGO2"
                     /transcript_id="XM_022819656.1"
                     /db_xref="GeneID:34716341"
     CDS             complement(829844..830341)
                     /gene="IGO2"
                     /locus_tag="KLMA_40355"
                     /codon_start=1
                     /product="protein IGO2"
                     /protein_id="XP_022676200.1"
                     /db_xref="GeneID:34716341"
                     /translation="MSGNQKESIFRQQSEQSQTFQQQQGLHFGKERPMPSDSDSVDPK
                     APVANPDNVDLSKLTPQELKIYKMYGRLPGKKDLFQHKLQERKYFDSGDYALRRAGVK
                     SDDLQTSPVANNNLPLTNPSGLRESIIKRRMSNSANSISTSDAHRLSRQGSISSGPPP
                     RSPNK"
     gene            <831072..>832430
                     /gene="ECM14"
                     /locus_tag="KLMA_40356"
                     /db_xref="GeneID:34716342"
     mRNA            <831072..>832430
                     /gene="ECM14"
                     /locus_tag="KLMA_40356"
                     /product="protein ECM14"
                     /transcript_id="XM_022819657.1"
                     /db_xref="GeneID:34716342"
     CDS             831072..832430
                     /gene="ECM14"
                     /locus_tag="KLMA_40356"
                     /codon_start=1
                     /product="protein ECM14"
                     /protein_id="XP_022676201.1"
                     /db_xref="GeneID:34716342"
                     /translation="MRTGFVSMWSGFALLALHLSVFVYGRNYSDYSVCRFEDESQFGE
                     VLSQLQDLAMIKQEFEFDVWSQSRSHGFMDVRVHKDILEKFPSCKVIIEDLDSAISES
                     HPKMSDPDVKLTEENIDNLAQVQDFFDATSGKPREIFFDEYRDLDTIYTWLDLLQLSF
                     PDLVTIEWTGQTFEGRDLKALHISTQNRKKNPDKKTIIITGGVHAREWISVSTVCYTI
                     FQLLSRYGESKTETRFLDHLDFLVIPVFNPDGYVYTWTHDRLWRKNRQQTYFPRCFGI
                     DIDHSFNYHWTGSNNFPCSEDYSGRAPFEALEAESWDNYVNKAKSEYNIHGYLDIHSY
                     AQEILYPYGFSCDALPRDLENLLELAYGLSKAIRHESGKNYKVLSSCEDRGSDVQPGL
                     GAGSALDYMYNHRAYWAFQLKLRDTGNHGFLLPSKFIVPVGEETYAAVQYFCEFILDP
                     DL"
     gene            complement(<832504..>833079)
                     /locus_tag="KLMA_40357"
                     /db_xref="GeneID:34716343"
     mRNA            complement(<832504..>833079)
                     /locus_tag="KLMA_40357"
                     /product="protein PGA1"
                     /transcript_id="XM_022819658.1"
                     /db_xref="GeneID:34716343"
     CDS             complement(832504..833079)
                     /locus_tag="KLMA_40357"
                     /codon_start=1
                     /product="protein PGA1"
                     /protein_id="XP_022676202.1"
                     /db_xref="GeneID:34716343"
                     /translation="MNLCLFFWFLLASFANANTETYQFHVPKDFPHLGDAYVPTIPYI
                     SLWNTTFNTLSLNVSPSNTSVVEVVGLHPNEKYAVKVCWTAADPISINSIRHHIIPHD
                     TEFEGTVVDQTRVVLLVETEAFSYPVLSDDVKIDISIASVKLGIPVDLYSIVIYLALV
                     VLGSVFVLSRIDIHKILDMCREDKLTSDKSS"
     gene            <833406..>834107
                     /locus_tag="KLMA_40358"
                     /db_xref="GeneID:34716344"
     mRNA            <833406..>834107
                     /locus_tag="KLMA_40358"
                     /product="protein ASI2"
                     /transcript_id="XM_022819659.1"
                     /db_xref="GeneID:34716344"
     CDS             833406..834107
                     /locus_tag="KLMA_40358"
                     /codon_start=1
                     /product="protein ASI2"
                     /protein_id="XP_022676203.1"
                     /db_xref="GeneID:34716344"
                     /translation="MDDDDVLYEQFQYEMEHGTPHPDVAEAQELEQLLAQLENEQQRL
                     FLQRNVRRRNEPVRWPDFVNRRPYLVFLLRNLLILDHILMILFLPFSVFTLLKTVINK
                     VTFSDADMLNDIVEYVHNRIVVDPKSSVVYLYRGGDGLLGCFHNSVVYHSAPFYKYLM
                     KMYGNSNFLRQLYTITVKWFAVSTFTLYGLVVSMYLSFLTFFFIVCVTLLFIKKFKGV
                     DLMIANILQTCDLIF"
     gene            <834475..>835674
                     /locus_tag="KLMA_40359"
                     /db_xref="GeneID:34716345"
     mRNA            <834475..>835674
                     /locus_tag="KLMA_40359"
                     /product="putative agmatinase 2"
                     /transcript_id="XM_022819660.1"
                     /db_xref="GeneID:34716345"
     CDS             834475..835674
                     /locus_tag="KLMA_40359"
                     /codon_start=1
                     /product="putative agmatinase 2"
                     /protein_id="XP_022676204.1"
                     /db_xref="GeneID:34716345"
                     /translation="MINWSYYALFCLAIVPFAKCEYYNEDIGTNSTLNDMWGEEWPFS
                     GIQTFAHLPHQKCLLDMGTKFDIGVIGMPFDTAVSYRPGARFGPQGIRKASQRQNSMR
                     GFNFRAGINPYNNWASVIDCGDVPVTPMDNNLALQMMTAAYDNLLSHESKAESNELPP
                     RLVTLGGDHSIILPALRSLHKLYGRLAVIHFDSHLDTWSPSKYPSFWHSDTSEFTHGS
                     MLWIAHNEGLITENSNVHAGLRTRLSGTSYEDYDEDDQVGFYRIEADEIMDGGPSAIV
                     EKIKSKIPDNVPVYISVDIDVLDPSAAPGTGTMEAGGWLTRELIRIIRQLDHLNLVGA
                     DVVEVSPPFDPSEITTLAGAQVAYELITNMVKKGPLDPDMVKRNLESKNANHFQMQQN
                     EQNVLHI"
     gene            <835991..>837187
                     /gene="LPE10"
                     /locus_tag="KLMA_40360"
                     /db_xref="GeneID:34716346"
     mRNA            <835991..>837187
                     /gene="LPE10"
                     /locus_tag="KLMA_40360"
                     /product="mitochondrial inner membrane magnesium
                     transporter LPE10"
                     /transcript_id="XM_022819661.1"
                     /db_xref="GeneID:34716346"
     CDS             835991..837187
                     /gene="LPE10"
                     /locus_tag="KLMA_40360"
                     /codon_start=1
                     /product="mitochondrial inner membrane magnesium
                     transporter LPE10"
                     /protein_id="XP_022676205.1"
                     /db_xref="GeneID:34716346"
                     /translation="MVFLRHFLGSTARLPSYQRFFHSGKQIYQKASDPNHLAILLQKN
                     LAQRNSSLYNPELETIRCTIFNSKGIIQKPSIDLRRDELIHTHGLLPRDLRKIEKSRR
                     NDLVPSVLVRENSILISILNIRALVKSDMLILFDSLGIKLDSVSQQNFITDLQLRLQN
                     KSGFDVPELMNKDPLPYEFRAIESIFVSAISNLSAELKVHLNVTNGILQDLEYSITRD
                     KLRYLLIQNKKLSVFYKKSFLMREMIDELLDQDDVLCEMYLTEKKLGKPREEHDHAEI
                     EMLLETYYNHVDEIVQTVGNTMSNVKTTEEIINIILDSNRNQLMLLGLRFSIGLLSLA
                     GSIFIASVYGMNLENFIEEGNFGFPLVSTIGVVLMAYLFIFSIKHLHKLEKVQLMSHG
                     KGSTLK"
     gene            <837466..>838791
                     /gene="FTH1"
                     /locus_tag="KLMA_40361"
                     /db_xref="GeneID:34716347"
     mRNA            <837466..>838791
                     /gene="FTH1"
                     /locus_tag="KLMA_40361"
                     /product="iron transporter FTH1"
                     /transcript_id="XM_022819663.1"
                     /db_xref="GeneID:34716347"
     CDS             837466..838791
                     /gene="FTH1"
                     /locus_tag="KLMA_40361"
                     /codon_start=1
                     /product="iron transporter FTH1"
                     /protein_id="XP_022676206.1"
                     /db_xref="GeneID:34716347"
                     /translation="MAKSSFENYFSFQIFFIFLRESLEIIIIISILLTIVKQALFSHD
                     NTCESSSSSIVNNAEPVTVEEEAASALLMRENEINSSELGIEVDNEQIYKRLKFQIIS
                     GGLLGLLACMLIGGAFIVAFYYIGADLWSLSEHYYEGVLSVIASVIISVMGLFFLRMG
                     KLREKFRVKLASIIYSDKLLSREYGESRAKTFGEKYSLFILPFVTSLREGLEAVVFIG
                     GIGIDSPLTSIPLSMLSATAISAIFGVFFFKYSKSFSLQICLVITTCFLYLIAGGLFS
                     KGVWQFELQRYVDACNGQDMSEVGNGPGSYDISRSVWHVNCCNGERDGFWMVLTAIFG
                     WTNSATYGSVISYIAYWLVVIAVINLMMVEEKYGYIPFLPISLQRGRINKRITIIEKS
                     LSLKSQPASAAVTPSSIQKNTPELPRSSCDTHDSSSHLLSADVTPPSYQ"
     gene            complement(<839003..>844498)
                     /gene="DUR1,2"
                     /locus_tag="KLMA_40362"
                     /db_xref="GeneID:34716348"
     mRNA            complement(<839003..>844498)
                     /gene="DUR1,2"
                     /locus_tag="KLMA_40362"
                     /product="urea amidolyase"
                     /transcript_id="XM_022819664.1"
                     /db_xref="GeneID:34716348"
     CDS             complement(839003..844498)
                     /gene="DUR1,2"
                     /locus_tag="KLMA_40362"
                     /codon_start=1
                     /product="urea amidolyase"
                     /protein_id="XP_022676207.1"
                     /db_xref="GeneID:34716348"
                     /translation="MGETTTLGWSVQDWLKFHFQSTPKKSLEALEDLLRSQKAAPEDP
                     AWISLISIEDLHHQWNILQSKANKEKLPLYGVPIAVKDNIDYKGLPTTAACPAFSFQP
                     ERDAYVVELLRDAGAVILGKTNLDQFATGLVGTRSPYGITSCVFNDKYVSGGSSAGSA
                     SVVGRGIVPLSLGTDTAGSGRVPAALNNLIGLKPTKGVFSCRGVVPACKSLDCVSIFA
                     LNLGDAETAFKVMCKPNVLEDEYSRAFPKNPITHYSKDVTIAIPKEVPWFGEKENPKI
                     YSSAIESLKKTGANITVIDFEPLLELARCLYEGAWVAERYTATKEFFDTNPPEFSLDK
                     TVTQIIKGATKYSAADAFNFEYKRQGILQKVKLMLEDVDVLCVPTCPLNPTIEEVTNE
                     PILVNSRQGTWTNFVNLADLAALAIPGGFRSDGLPNGITLIGKKFSDFALLDLAKRFF
                     STAFPNNTRTFGKFVDRTITIEDELNGPSEEYIEGIKLAVVGAHLKGLPLHWQLEKCN
                     ATYLSSPKTSKNYKLYALPKAGPVLKPGLRRVSDGTGSQIQLEVYSVPPEKFGEFISM
                     VPEPLGIGSVELESGQWVKSFICEEFGYTQKGTVDITKFGGFKAYVEHLAAVESQKKK
                     PFETVLVANRGEIAVRIMKTLKKMGIKSVAVYSDPDKYSQHVNDADFAVALNGRTAAE
                     TYLDIDKIIKAAKDTGSQAIIPGYGFLSENADFSDRCKQEGIVFVGPSGDAIRKLGLK
                     HSAREIAERAGVPLVPGSGLIKDAEEAKAVARKIEYPIMVKSTAGGGGIGLQKVDSEA
                     EIERVFETVKHQGKSYFGDAGVFLERFVSDARHVEIQMMGDGYGKAIAIGERDCSLQR
                     RNQKIIEETPAPNLPEETRAKMRKAAESLGSLLKYKCAGTVEFIYDEKRDEFYFLEVN
                     ARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFDNTKIEVSGASIEARLYAENPVKDF
                     RPSPGQLTSVSFPSWARVDTWVQKGTNVSAEYDPTLAKIIVHGKDRNDAIRKLNQALN
                     ETAVYGCITNIDYLRSIASSSMFKEAKVATKVLDTYDYKPCAFEVLLPGAHTSVQDYP
                     GRTGYWRIGVPPSGPMDSYSFRLANRIVGNNSKAPGIEITLNGPKLLFHTETVVAVTG
                     ATVKCLLNENEVPQNKPINIKRGDILSIGKVTVGCRAYLSIRGGIDVPEYLGSRSTFT
                     MGNMGGYNGRTLKLGDVLFLNQPELSVSSLGAPEYEPAPAPKSLLPEFSTTKDWKIGV
                     TCGPHGSVDLFKEEYIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARADGGEAGLHPSN
                     AHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVVEAELWKVGQLTPGDTIQFVP
                     ISYETAKLLKESQDKAIETFSDGSLIQLREDLFLPKYENPILAVLPKRSDLSPKVTYR
                     QAGDRYILVEYGDLELDLNICYRINRLINEVERHNTVGIVEMSQGVRSVLIEFDGYKI
                     DQKTLLDCLRAYESEIHFDKNWTIKSRVFKLPMAFEDSKTLDCVTRYRETIRSDAPWL
                     PNNVDFIADVNDISRDDVKNMLYSARFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNP
                     SRTYTARGVVGIGGMYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIGHQWLLTPF
                     DQVEFYPVSEEELEVIIEDNDNGKFKINVEESVFDNKEYLAWIDENIESIVKFQEAQG
                     GEKADEFAKLIQVANAELEKNVDDKGPDTEEYPEDAELLYSEYTGRFWKPVVSVGDEV
                     KEGDGVIIIEAMKTEMVVSSTKAGKVYKILHKNGDMVEAGDLVAVII"
     gene            complement(<845742..>847784)
                     /gene="PAN3"
                     /locus_tag="KLMA_40363"
                     /db_xref="GeneID:34716349"
     mRNA            complement(<845742..>847784)
                     /gene="PAN3"
                     /locus_tag="KLMA_40363"
                     /product="PAB-dependent poly(A)-specific ribonuclease
                     subunit PAN3"
                     /transcript_id="XM_022819665.1"
                     /db_xref="GeneID:34716349"
     CDS             complement(845742..847784)
                     /gene="PAN3"
                     /locus_tag="KLMA_40363"
                     /codon_start=1
                     /product="PAB-dependent poly(A)-specific ribonuclease
                     subunit PAN3"
                     /protein_id="XP_022676208.1"
                     /db_xref="GeneID:34716349"
                     /translation="MPEANWNKPTASFKDTPCRNVIIHGYCKFENEGCEFNHGKSKEP
                     EDNGPVQRTVTPLNVRFNAKTSSSFTPGKSPTMRSTGDFSSLPSFQPGQSVIPDQNPV
                     LQDGSMSSSGMLNANAASFAPSFNPYASESFTPSVSAGGGAGGGAGVGGNGGVPHSSE
                     DLNGSIPSPVPSNPYPGSTGMPPVGILGVGHHMGPPLPSQGQSQGQGSVPPPHAHIHP
                     HPHAPPPPPGSLPMNPIPPFPTVYPPTHSVLQYHLYAPDPPPHLKIPLKPNERTPEML
                     FINNNLRERLVKNNQTALQVFPRGSLPDIVGDYFGLVPMDFHNRTPDKKRYNGHKNSL
                     YKVFSNQDGKIYFMRRIHDVKITESAQVSQPFQAWSKLRSANVTILRDAFVTTAFNDS
                     SLCMVFDYYPQSTSLFEAYGLGASAPELSQDYIWSYLIQLTNALQDVHSHGLALKDLD
                     WKKTIITGEPGRIKITDLGVYDTLNYQQEGRVLHDDQQQDFVALSELIMALVHKLTGT
                     TGPIDTLNSYHIDPLFKKCVQYLQDSENKNKNIEEFTKIFSHKLLSVLNSLQYNVEYT
                     EQQLSRELENARLFRLMCKINAIYGRLESRIDINWSESGEKFPIILFFEYVFHQKDET
                     GKNIMDLTHVLRCLNKLDAGITERVMLVTPDEMNCIIISYKELKDLIDSTFRSIIQ"
     gene            <848128..>848889
                     /locus_tag="KLMA_40364"
                     /db_xref="GeneID:34716350"
     mRNA            <848128..>848889
                     /locus_tag="KLMA_40364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819666.1"
                     /db_xref="GeneID:34716350"
     CDS             848128..848889
                     /locus_tag="KLMA_40364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676209.1"
                     /db_xref="GeneID:34716350"
                     /translation="MSKVYLVTGVSRGIGSCIVKKLCSLESTKAVIGIARSQEKLEEL
                     KVFYKGKFDYWCGDVSDETTIENAVIFVKDKYKRLDGIVANAGVLDPVEDVNNIHVSQ
                     WKKLFDINYFSVVCLVGHALPLLKESHGNIVFVSSSASVETYYAWGAYGSSKAALNYF
                     AKTIAFEEKEVSAISVAPGIVRTQMQEDIREKFGPKGMTKDALKQFVDLHENDQLVSP
                     DVPASVYANLVSRGIPSEINGAYFDYNDEKLASFA"
     gene            <850195..>851106
                     /locus_tag="KLMA_40365"
                     /db_xref="GeneID:34716351"
     mRNA            <850195..>851106
                     /locus_tag="KLMA_40365"
                     /product="uridylate kinase"
                     /transcript_id="XM_022819667.1"
                     /db_xref="GeneID:34716351"
     CDS             850195..851106
                     /locus_tag="KLMA_40365"
                     /codon_start=1
                     /product="uridylate kinase"
                     /protein_id="XP_022676210.1"
                     /db_xref="GeneID:34716351"
                     /translation="MLRLGLRSVAHSSRLAVRIPVGGALLRTQAPRALVGRRIQLYSQ
                     KSGSGSSSGSSTNNGKGRGKLLLVLGLLALGSSIFSLSYQKNPPVAFEEAPVEEKQPA
                     KKQPAFSQDDVMVIFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQNREGSQYG
                     ELIKKCIKEGEIVPQEVTVALLKNAITSNYNDGNKKFLVDGFPRKMDQAITFEEEIVP
                     SSMTLFFDCPEKVMLERLLQRGKTSGRIDDNIESIKKRFKTFVETSVPVVEYFEKQGK
                     VVKVSCDQPVDEVYKHVTESIKDKIPK"
     gene            <851588..>852844
                     /locus_tag="KLMA_40366"
                     /db_xref="GeneID:34716352"
     mRNA            <851588..>852844
                     /locus_tag="KLMA_40366"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819668.1"
                     /db_xref="GeneID:34716352"
     CDS             851588..852844
                     /locus_tag="KLMA_40366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676211.1"
                     /db_xref="GeneID:34716352"
                     /translation="MTLLTDSSLLNFLLQDTSSEVSSQNKVPPCLSHLKAYSDDGSKE
                     SSPNSSVEALTRKNKKNKKTKKHNIKKESLDGLENDDIIKLLESSSIFPTAKAKSNRP
                     MSESHNTKKTSSLKDKREKDEQKYTKLRELMGKKKDEDEETNRKKDKKKKKKKKKKEE
                     EKRLSEGKQGKKDRGRNVQLEMDIHQEAVAGSAIGVSFSDATLISDEIYTRHADSLTA
                     LEAEEQLQDTEKLTQKEQELYGNHVEVEELKIHSKKTSVSTSLDDEAIENHTLKKDMV
                     SQNKSRSNDWMKELIRQELEKNKITTSHKSKGKQRDLSSGLSSSKYSDEPQSSRKAHE
                     KPKKEPNAEVDSRNASLERQERKKELKKDSIDKAGEKEDNENQPEMPSTEPSSKAQKR
                     RKRGGKKHRKDTLMKGYSSNSKEVQT"
     gene            complement(<853147..>855327)
                     /gene="CDC16"
                     /locus_tag="KLMA_40367"
                     /db_xref="GeneID:34716353"
     mRNA            complement(<853147..>855327)
                     /gene="CDC16"
                     /locus_tag="KLMA_40367"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819669.1"
                     /db_xref="GeneID:34716353"
     CDS             complement(853147..855327)
                     /gene="CDC16"
                     /locus_tag="KLMA_40367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676212.1"
                     /db_xref="GeneID:34716353"
                     /translation="MSESHSHGTPSHAQSTLAISPLVQRARASRPDAGQNTGTGVQGR
                     SGNVERGSVSHFTQTPHQERSPLVQKIQDVSHLATPAIMRHNGTAGSSLLASMTKNGL
                     FGSTLPNTMRKSSTSMDAAEMRGSANGDCDSEDVNSEQNNMIDVSDLSSVEKLRLWRH
                     DALMQHHYKTAEHIGDVIYTMTKDPNDAFWLAQVYYNQGSYVRAVELIFTDQLDAESI
                     MCRYLAALCLFKLNKYEEALDIIGDSNPFQNEPCTSNSSDGGVKLESSICLLRGKIYV
                     ALSNMERAKECFKEAVQVDVKNYEAFDYLLSKHLLTTAEQWDLFGSLQFQDLDDNEEM
                     IRCLYISRLSKYQNHKELENASNTLQNKYLLKENRIVKLAEIELLNNQSKFTQCMKLC
                     EQVLEVDEYNPEVLPIYVQCLHSFSAKNKLFLLSHKLAENFPKSPVTWFAVATYYLTM
                     GKVAEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPH
                     LYLGMQYNKMDDLSLAEEYFMIAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAH
                     DAIKNMKSESKAWISIVINLGHTYRKLGEDERAVKCFKTVLESSKPTATLWCSLGFLY
                     LRMKKIEKAIDSFHKALALDQGNQASNKLLKTALEINAHMLIDEDHPMVISSNIRTMP
                     KSQSINNEKKRTALGIGSFDPIIEAKRLKQGLSDHEDGDSMDIE"
     gene            <856079..>857197
                     /gene="LYS1"
                     /locus_tag="KLMA_40368"
                     /db_xref="GeneID:34716354"
     mRNA            <856079..>857197
                     /gene="LYS1"
                     /locus_tag="KLMA_40368"
                     /product="NAD-binding saccharopine dehydrogenase"
                     /transcript_id="XM_022819670.1"
                     /db_xref="GeneID:34716354"
     CDS             856079..857197
                     /gene="LYS1"
                     /locus_tag="KLMA_40368"
                     /codon_start=1
                     /product="NAD-binding saccharopine dehydrogenase"
                     /protein_id="XP_022676213.1"
                     /db_xref="GeneID:34716354"
                     /translation="MTVTLHLRAETKPLEARTALTPTTTKKLLEKGFKVYVEESAQSA
                     FDIEDYRKVGAIIVPTGSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAG
                     WEDVLRRFKNGNGVLYDLEFLENDQGRRVAAFGFYAGFAGAAVGIRDWAFKQTHADSE
                     NLGAIEPYENETAMIKDVRRDYQEALKKGARKPKVLIIGALGRCGSGAVDLLRKCGLP
                     EENIIKWDMKETARGGPFQEIADADIFINCIYLSKPIPPFINNKLLNNPNRRLRTVVD
                     VSADTTNPHNPVPIYSINTTFDAPTVVVPTTAGPKLSVCSIDHLPSLLPKEASESFSR
                     DLLPSLEQLPQRDTASVWVKARKLYEKFSAKVGRTSKL"
     gene            complement(<857373..>858608)
                     /gene="MAK11"
                     /locus_tag="KLMA_40369"
                     /db_xref="GeneID:34716355"
     mRNA            complement(<857373..>858608)
                     /gene="MAK11"
                     /locus_tag="KLMA_40369"
                     /product="protein MAK11"
                     /transcript_id="XM_022819671.1"
                     /db_xref="GeneID:34716355"
     CDS             complement(857373..858608)
                     /gene="MAK11"
                     /locus_tag="KLMA_40369"
                     /codon_start=1
                     /product="protein MAK11"
                     /protein_id="XP_022676214.1"
                     /db_xref="GeneID:34716355"
                     /translation="MPDNQFRIIVGSYEHNLLCLSLNLSLSQPLFTPIFHFQAHSLSV
                     KCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLRFSRGKNENGEDIQL
                     NKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRVAVSVSEDHSIRLW
                     NLMTVKKAGVLKLRKYNQNGQFVRWCGENGSHIAVGLLTKLLIFKTETAKVHREIDFG
                     RKTVMHLEREVIDGEEYLVVGLNDGSVQFWKTSKLYEDVPEPEVEEEEEEEEEEEEAN
                     DDKGKKEAKTPSLEPDFTLLGHSNRVKDFQFYKNEHGHYLVTIGSDGRIVVWDMKIKD
                     QIAVYDSGERLNCVAVCDESIEKYDTVKKRTSEDVELGEQSEAEADPEELKKIMMGKT
                     SKSKKKKGSKKRKVDIQLE"
     gene            <859402..>860934
                     /locus_tag="KLMA_40370"
                     /db_xref="GeneID:34716356"
     mRNA            <859402..>860934
                     /locus_tag="KLMA_40370"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819672.1"
                     /db_xref="GeneID:34716356"
     CDS             859402..860934
                     /locus_tag="KLMA_40370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676215.1"
                     /db_xref="GeneID:34716356"
                     /translation="MSINSGETFDRQPVIDLSSHNLGSRLNDSFPNSMNAAYTSGLDQ
                     HISSNELLIRRNYNQSSSHESPPSGVTIPSGERLLLSPYEEELYLRSLRLNKVPSNNA
                     IPTVTMLAEDGKPKSKSAVPLPYMQDFEQFQAEQEKNHLRRKQQSDENDSWLDAFTKW
                     SKYSSGKFKRGIKHSKPLKRTHSSIRRKDFTVNSEYQKYNKQGKFIFHKGFSARNNSN
                     NSIQRKYSVKTHRRMRSRFKNEQELMSYMRYINISELDITEVVNDDYIRMFFLAKNSL
                     KSLVSVHPPINSFRVPLNQYNEILRKVSKRKITSPNLVKRPSISRKLSAKNRRVCRSS
                     TAPIIRKSFAERLNPELYDVWNSYLKAIITKRIELRLSCLLSEDMSSLVSSLDSPPII
                     RVTTAPEMEQGTSTNPIIIDDDNDKDENDEDEDNLYQSSAYQNPTYNQITRTLHQYDV
                     SDNDSEINSRPTTSVFSIRQSMTSADQNRQSFFFPPDDPRMHKIDEEKSIHSITSRNT
                     IN"
     gene            complement(<861052..>863763)
                     /gene="TMA108"
                     /locus_tag="KLMA_40371"
                     /db_xref="GeneID:34716357"
     mRNA            complement(<861052..>863763)
                     /gene="TMA108"
                     /locus_tag="KLMA_40371"
                     /product="protein TMA108"
                     /transcript_id="XM_022819674.1"
                     /db_xref="GeneID:34716357"
     CDS             complement(861052..863763)
                     /gene="TMA108"
                     /locus_tag="KLMA_40371"
                     /codon_start=1
                     /product="protein TMA108"
                     /protein_id="XP_022676216.1"
                     /db_xref="GeneID:34716357"
                     /translation="MPLSLSEPIIPLEYNLDLTVDHVKPNFKGQLTVLLKPRSENQQP
                     FTTFKLHSSQLVISSAVWQGTTKLSISYDQKQQTASFTSEEPLCFDTSSGSARAELSV
                     TFLGRVKTIKTHREPTIGLFKTNFMNDSTGKSDSYVIATHTQPVFARTLFPCFDEPNS
                     KCKYTLTLTTHKRFKVAANTAIVEQKSSDQDDQLQTVKFATSPLMNPSFFGFCIGDLQ
                     FLKSEIKLNSKTIPLQLFAPQGIAHAAYSFDTIIETLPLVEKKIGFDYPLDKLDVVLL
                     PFLSDMAMENWGLLTFQMNHLLLSPQALADPSVTQQVRQLIGHELCHQWMGNYISFDS
                     WEYLWFNESFATWFACDLFNDHDKDNYWGSDNYFLQMENTISTEADESTKSIVQGSSF
                     DPATLNATSDALSQHHYNKGISLLRSLYESIGKEHFSKALSQIFNETNSFHAKSVKPI
                     DIFKRMGEILNSENIPNFFSSWTRTPGIPIVSVSINDEQTTLEQHRFITEKSDIEDVP
                     YHVPIFGLLPSGEKDEKNDLLTDRTLKLPGPELIINSGAKGLYRVSYESEQCYQLIGN
                     AIKTHKLSEIDIFKIFVDLHAIIGTDYQKTSHINGLITLLKYISSDIELDQNILRGLS
                     VGLDTLQTIESALRTYKHASDDSFTTEIYMPLWKILSWNELSLPPYQLQVMSKVMFAL
                     KKQDTTLTVANQLMKKIMSGPNGSVPLELCGSVFSTVSCHQKSVKQWKKLYELVKSSK
                     GIETHINGGTSTDIQNLALENLAFSTNEELIGKTLNFVKTNITSTSVENALFGLNFNF
                     HEPLDGKTNKLVRDVCWDWFSLNFDQWAPKSLREGVESHVRMKKTLVHISFVIFQMWM
                     DQPEKIDEFVVKKTAMYGKIIGLDQVWNSVKSSEKAKMNIYKGILGF"
     gene            <865589..>867031
                     /gene="APJ1"
                     /locus_tag="KLMA_40372"
                     /db_xref="GeneID:34716358"
     mRNA            <865589..>867031
                     /gene="APJ1"
                     /locus_tag="KLMA_40372"
                     /product="J domain-containing protein APJ1"
                     /transcript_id="XM_022819675.1"
                     /db_xref="GeneID:34716358"
     CDS             865589..867031
                     /gene="APJ1"
                     /locus_tag="KLMA_40372"
                     /codon_start=1
                     /product="J domain-containing protein APJ1"
                     /protein_id="XP_022676217.1"
                     /db_xref="GeneID:34716358"
                     /translation="MVKDTKLYDILEVSADATDQEIKKAYRKKALRHHPDKNNHSPES
                     IKLFQELSHAYEILSDESKRELYDQYGTVDETEINEMMSKQRGAASNAAFAHTAGDLF
                     AQFFGGRPGSASGAGANGSGGNSFFQSFSPDFSSYDMDGSQEMASGPGIHHNLKCTLY
                     DLYHGKRAKLALNRTRLCEKCQGYGGKKTSQCKGCQGTGMYTTTKRMGPMVQTWQTTC
                     KDCGGSGKFIRSKDACEECSGNGFVKERKIFDVEIQPGMTDGKEIVLPGEADEVINTE
                     YGKERVHPGDVIITIELTRRDEHNMKYKYMVHGHDLILDNFEVDLKTSLCGGTIVIED
                     HPSGKPFKIDVLAGELLKPGCIKCVENKGMPVDQYGKFGNLYIRFQVKFPEQLKNETI
                     EKLSQALVEDENIIKQPPNDDKNGGIDPSQVMEEQVLSSFTADDLQSKFREAKKNPSN
                     KRKRGEHGAYNKNGTQFDSSYDPSDSCQVN"
     gene            <869336..>871021
                     /gene="OM45"
                     /locus_tag="KLMA_40373"
                     /db_xref="GeneID:34716359"
     mRNA            <869336..>871021
                     /gene="OM45"
                     /locus_tag="KLMA_40373"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819676.1"
                     /db_xref="GeneID:34716359"
     CDS             869336..871021
                     /gene="OM45"
                     /locus_tag="KLMA_40373"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676218.1"
                     /db_xref="GeneID:34716359"
                     /translation="MSNRAIIGTAVAVGAGYYLYQRQVQLKQQQAGQIPVSPIVHDQD
                     TFELKGAKAGAKIDDISDDVKDKVSQYKTDADYKFQNIASQVESKKAGVADWAVDKLD
                     RAKSNLEESRDKYQETTDNLKGNLDEYKNKDKPNAVVQAINNTKEAISTDIGNIKEGF
                     IDDLKSVKSAIVGTTSEVHDHVVENVNELSDKSARKVDEAKEHFSQAASSGKRAVNQA
                     AAEAKDTSNNILNWGFNKAEKVRAQAINEYDEANKKYQGLEKQYNESKKGLFGKGDPE
                     LKKQLDEAKSYVSDAKARVDQATREFTEKTAKNFNDMADQMHANDEELKRKGFLTWLR
                     GKTDSQVEDPDVVANDSVRGFGETAEWLGREELDEKKRNQQAGPSEAQQRLERLRKIK
                     EEGWFNQQAKDGKEAVKDVGKTVEGWGESASNKAKEDYDDLLKWKESARQGYQESAAA
                     ARDSAQQAVDSAKKRLEETRAELNKQTKHWWQFGAEKNEELQKAAKAKYDAAEKEYQS
                     AVGTLNDWTDKASGKFWSSADDALHTARNAAGSVHETTIKGIDKAQDYVQDKK"
     gene            <873086..>875023
                     /gene="MKS1"
                     /locus_tag="KLMA_40374"
                     /db_xref="GeneID:34716360"
     mRNA            <873086..>875023
                     /gene="MKS1"
                     /locus_tag="KLMA_40374"
                     /product="negative regulator of RAS-cAMP pathway"
                     /transcript_id="XM_022819677.1"
                     /db_xref="GeneID:34716360"
     CDS             873086..875023
                     /gene="MKS1"
                     /locus_tag="KLMA_40374"
                     /codon_start=1
                     /product="negative regulator of RAS-cAMP pathway"
                     /protein_id="XP_022676219.1"
                     /db_xref="GeneID:34716360"
                     /translation="MGPKMYTSAESDRFQMLHSSSNVEHERDHTFLKVTPTLFTQDKL
                     PLFDSLDLYTSLIKCSKFMEQGERLHNLSWRIINKSLLKDQNINKSKKRDGVRNLYNV
                     INPIKQTHSFLHLQQKPKSIQNGTALKTNGVSNHSTNDTSNNNPIDDDHNNRTTTTTT
                     TTPNDKTNNNTNNNADPSNARLNALNNSHSHSRATSALSQISISKKLLSTKSVSPEPV
                     MKSMDTPSRSQSTTPHLRKEAVRKKITMSPELVMSATNDIHPSHHGSIPNHSTISESR
                     LDGQSQTSLFSRNPSSKSLFAKNAHSAIGTGNNSNNSSAKGSTENLKTTKADRTLGET
                     KNTSANTTTDHKNMFFSSEDEESDWDSLSDDSDIYDDDEDNDQYYENQWEELMFSKTN
                     TNQAANHVVSKESGEKKSLLSGLFMQEKQVKSQSVSPPGSASVIKPLEGLPAGASKSI
                     KNSTQNSEPILVRSPDSALKFRIDSDRSNFLSQNHPAGVPIQSQPVAPETSDIVAVGS
                     VTPSSSWQNKGLPIPPAFERSRRLGSFSSIVSDTTRERYYHESNAPPAAQTILPTALS
                     THMFLPNNIHQQRMALRGGLNNYSQSSGTGREREREKVASRRQSMDIPSKNRNNSFIK
                     TRMEISEEESFARVYARGAKK"
     gene            <875550..>876401
                     /gene="IMP4"
                     /locus_tag="KLMA_40375"
                     /db_xref="GeneID:34716361"
     mRNA            <875550..>876401
                     /gene="IMP4"
                     /locus_tag="KLMA_40375"
                     /product="U3 small nucleolar ribonucleoprotein protein
                     IMP4"
                     /transcript_id="XM_022819678.1"
                     /db_xref="GeneID:34716361"
     CDS             875550..876401
                     /gene="IMP4"
                     /locus_tag="KLMA_40375"
                     /codon_start=1
                     /product="U3 small nucleolar ribonucleoprotein protein
                     IMP4"
                     /protein_id="XP_022676220.1"
                     /db_xref="GeneID:34716361"
                     /translation="MLRRQARERREYLYRKAQELQESQLQQKRQIIKQALAQGKPLPK
                     ELAEDEQLQKDFQYDESAQEQIDDEYSATSGIAEPKVIVTTSRDPSTRLSQFAKEIKL
                     LFPTSVRLNRGNYVMPNLVDACQKSGTSDLIVLHEHRGVPTSLTVSHFPHGPTAYFTL
                     HNVVLRHDILNSGNQSEVNPHLIFDNFTTPLGKRVETILKHLFPPGPKKDAARVITFA
                     NRGDFISVRQHVYVRTRDGVELAEVGPRFEMKLFELRLGTLENKDADVEWQLRRFVRT
                     ANRKDYL"
     gene            complement(<877138..>878694)
                     /locus_tag="KLMA_40376"
                     /db_xref="GeneID:34716362"
     mRNA            complement(<877138..>878694)
                     /locus_tag="KLMA_40376"
                     /product="viable in a HAL3 SIT4 background protein 2"
                     /transcript_id="XM_022819679.1"
                     /db_xref="GeneID:34716362"
     CDS             complement(877138..878694)
                     /locus_tag="KLMA_40376"
                     /codon_start=1
                     /product="viable in a HAL3 SIT4 background protein 2"
                     /protein_id="XP_022676221.1"
                     /db_xref="GeneID:34716362"
                     /translation="MSHQELSLSGDDKGLDSRADTLTLSNSNLDLNLNMSPGVSGYDD
                     AGSIHSESSMIFERNVEDPYSQVFSNPRLASLSRSGSHANLGFDSPQQDGSGGSAGLP
                     AGSYNGYPVPLSRKQSNAGSFVSHHTLENLVAPALDEGVTIVNDDSTDLEAVEMIYSR
                     RPSTIGLDMALGRTRTSSFSETATLNAQAQGAGANPRLMRTNSASQSSGPETRPRVLR
                     FYSYADMLSDENSQNPRRPSITQSLSSTLLRQQQQQQQPGGPGLPHDPYQSTSPSFSN
                     PFLSSQALASSAAPGNGVQPPTSPLDAQRKYSNVSIPPLSVTTRHYSNNMLSRSPNTT
                     AAPAAHRLSSWPLMIPHNTNSALLRKSHFQIESSGSECSDEETDRDHHRSNSNNSNAS
                     NNSNSKAKTIPNSTNINSPNYTQYRHSDRDLPSAGTLNTSPPNQQQGLRLSRTSTQGS
                     GFGKKLSPPAYKARAYSNASSNSPYHTNLSRSSFSSANTQRLDDILFDEQLQSNTVSE
                     VLKKKLTNDI"
     gene            complement(<879366..>879722)
                     /locus_tag="KLMA_40377"
                     /db_xref="GeneID:34716363"
     mRNA            complement(<879366..>879722)
                     /locus_tag="KLMA_40377"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819680.1"
                     /db_xref="GeneID:34716363"
     CDS             complement(879366..879722)
                     /locus_tag="KLMA_40377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676222.1"
                     /db_xref="GeneID:34716363"
                     /translation="MITCQSEGNRETPCPLGDSVPKGQQTGDRVPRAKGQTQRKNGTA
                     TATGTVQCLPKPAAASDKRSSGISNARQPKASRLVSSPSVHCTPPAQRICAQGFPATV
                     PHYLAVFSLTDSRFPL"
     gene            <880056..>881561
                     /gene="FMS1"
                     /locus_tag="KLMA_40378"
                     /db_xref="GeneID:34716364"
     mRNA            <880056..>881561
                     /gene="FMS1"
                     /locus_tag="KLMA_40378"
                     /product="polyamine oxidase FMS1"
                     /transcript_id="XM_022819681.1"
                     /db_xref="GeneID:34716364"
     CDS             880056..881561
                     /gene="FMS1"
                     /locus_tag="KLMA_40378"
                     /codon_start=1
                     /product="polyamine oxidase FMS1"
                     /protein_id="XP_022676223.1"
                     /db_xref="GeneID:34716364"
                     /translation="MSTPTHYTALVIGAGIAGLKACNELHANGIDSVICIESRDRIGG
                     RLHAEQGRNGKYEVGAAWHHDTLSNGLFLEELSLPAEERADFVFDDEDATCLVDKNSG
                     IVNVDQLDTLRHEFERWVEMKYYQSLGVKDLPYFDLCIEFCYQKRDLLTNDQLFHLPQ
                     LLRYMELWHGVDWYGLSGKFSGIEHNGRNALVFSYDKIVSRIAKPIKDKIHLNESVSL
                     VKKLPNGGFQVQSDKGNYTCDYCIVTVPQSVLTFSCKDPEPSAKTAARIQFDPPLNSA
                     ITEALTEKSSFGSLGKVIFEFDKVKWSTKCGRFLTAHEQPQDFVETVRNSDDLHHLLS
                     TMREKLPRSNDDSWKNPTYIVNLAKRTGIPTFVALTQQPLTEYLETLSKEEVEQFYRP
                     VINKLLHSLDAQDYICDLQDKIPDSDSEAPVLKNIITTKWSSDPFALGAYSACKPGDD
                     PMDLVIALSAGQGNLRFAGEHTIMDGAGCAYGAWESGKREAKYILDKVFTR"
     gene            complement(<881619..>883112)
                     /gene="MAC1"
                     /locus_tag="KLMA_40379"
                     /db_xref="GeneID:34716365"
     mRNA            complement(<881619..>883112)
                     /gene="MAC1"
                     /locus_tag="KLMA_40379"
                     /product="metal-binding activator 1"
                     /transcript_id="XM_022819682.1"
                     /db_xref="GeneID:34716365"
     CDS             complement(881619..883112)
                     /gene="MAC1"
                     /locus_tag="KLMA_40379"
                     /codon_start=1
                     /product="metal-binding activator 1"
                     /protein_id="XP_022676224.1"
                     /db_xref="GeneID:34716365"
                     /translation="MIIFNGEKYSCVSCIRGHRSSSCKHSDRMLVKVRTRGRPSPLDV
                     RKVILVDKNSRVDVPDGQSQNQGQNPGQVQGQSESAMEDDTEPLCTGMNKQPVLFLRA
                     IATKKALLVDGNLKILVASESSTPDSEVTRELQMKEDEKKFVSEHEFLLQHSTRPTAA
                     ACSSCSGKNKQLLSRGDDEFSAGTVSKRLKVENDNSSMDLSIAADGSTIPSSNSNSNS
                     NDNHKSQNPHMFQDSVVQLFTQKGAYLSTTCSCDDNCGCNNCLIHREEEELEKYLHGL
                     QQPLINLGSAHLFTTTNNNKSDHISIQNQDPSETDLLNPINIGANAQGYSEICLCDHN
                     LCECPNCLFHPEEHITLSDILIHGVLHYKWKKKTVIHYKNKAIRSKYWWDFLTSQVPS
                     LSTEGLRSLDLIKWFDNLVLSNIVELPDVNDYGYFSKHIDGAKHINNVTESANPHLKM
                     HNNHNGRGDEDAGTHCMNNSGKNIEKENLSFANDPRAANASTSYMIL"
     gene            <883688..>884185
                     /gene="UBC7"
                     /locus_tag="KLMA_40380"
                     /db_xref="GeneID:34716366"
     mRNA            <883688..>884185
                     /gene="UBC7"
                     /locus_tag="KLMA_40380"
                     /product="ubiquitin-conjugating enzyme E2-18 kDa"
                     /transcript_id="XM_022819683.1"
                     /db_xref="GeneID:34716366"
     CDS             883688..884185
                     /gene="UBC7"
                     /locus_tag="KLMA_40380"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2-18 kDa"
                     /protein_id="XP_022676225.1"
                     /db_xref="GeneID:34716366"
                     /translation="MSKTAQKRLLKELQKLTKDSPEGILASPVDDSNLFQWDCLIMGP
                     PDSCYEGGVFNARLDFPKDYPLNPPKLTFQPSILHPNIYPNGEVCISILHSPGSDPNM
                     YEHECERWSPVQSVEKILLSVMSILSEPNIESGANIDACILWRDNRPEFERQVKLNLL
                     KSLGF"
     gene            <884651..>886009
                     /gene="DCW1"
                     /locus_tag="KLMA_40381"
                     /db_xref="GeneID:34716367"
     mRNA            <884651..>886009
                     /gene="DCW1"
                     /locus_tag="KLMA_40381"
                     /product="mannan endo-1"
                     /transcript_id="XM_022819685.1"
                     /db_xref="GeneID:34716367"
     CDS             884651..886009
                     /gene="DCW1"
                     /locus_tag="KLMA_40381"
                     /codon_start=1
                     /product="mannan endo-1"
                     /protein_id="XP_022676226.1"
                     /db_xref="GeneID:34716367"
                     /translation="MKCWKLMLTTLTAFLTVASGIDLDVDDLNSLQKATSLVSSGLMD
                     YYTGLQKGQTIGMFASPSYWWQAGGAWGSILDYWYYMQNDTYNSILTQALLYQTGDNN
                     DYMPLNQTVTEGNDDQAFWGFVVMAAAERNYPNPPKDQPQWLYLAQAVFNTMASRWDS
                     DTCGGGLRWQIFTWNSGYDYKNSVSNAALFHMASRLARYTGNSTYADWATKVYDWMQD
                     VGMLTDKDENSSFVYDGASIENNCTKIVKYQWTYNQGLILSGSAYMYNHTGSELWHKR
                     TKDFLNSASVFFNSTNNIMYEAACQGSGYCNNDQRSFKAYFSRFLGLTAQLVPETRDD
                     IMKLLKASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKYGLGEQMAALEVMQNLRCLDR
                     PAPLTANTGGTSVGNPAAGTEQSPSNLSPLTITHGDKAGAGIITAVIGITIIGSVVWL
                     VL"
     gene            complement(<886266..>887414)
                     /locus_tag="KLMA_40382"
                     /db_xref="GeneID:34716368"
     mRNA            complement(<886266..>887414)
                     /locus_tag="KLMA_40382"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819686.1"
                     /db_xref="GeneID:34716368"
     CDS             complement(886266..887414)
                     /locus_tag="KLMA_40382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676227.1"
                     /db_xref="GeneID:34716368"
                     /translation="MVVFIHEFDVLKGNTLSWTNGNAEALEGLEFTVLPSGIHLRERD
                     TIYFQFNGKSGLAVFRQNSLDLDASQHHIDRSQVKMFSFGTLFDEKMDYEQLSLYEKG
                     MKTALEEWWEDHDYNVLEKWDAKRNHDEISSFNFNDTCVEVGPIVLQLWRCALLHNRV
                     LVLNKGVEVKKCNMLCHLITTMGKLEQSVYDNEMTITMLNTEKYKSSESWCATTSDEI
                     LMYETDLYDKLVIWDATGIHLRDHDHEVKCNEVDFSIYKSLTSDDLSKFNYQYESSII
                     WSKLIIDGLFLIFTGNMYKPWYHVEIEPVENPDFYRYFVERTRRIYSQSKTIIENNPD
                     QDTIYQGASILTTFQLDYFHDAEFLRQLTQQWFGKPIIPNYIDLSFLF"
     gene            <887655..>887960
                     /gene="BLI1"
                     /locus_tag="KLMA_40383"
                     /db_xref="GeneID:34716369"
     mRNA            <887655..>887960
                     /gene="BLI1"
                     /locus_tag="KLMA_40383"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819687.1"
                     /db_xref="GeneID:34716369"
     CDS             887655..887960
                     /gene="BLI1"
                     /locus_tag="KLMA_40383"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676228.1"
                     /db_xref="GeneID:34716369"
                     /translation="MKEKALRTKIDELVATLQQRIDIVTATAVSQFEQETENNYAKLD
                     YLKAHFKKDDSINDWLNDKQEFTEKLDKLESQITELSDLADEWEIFIKELLLTDAKL"
     gene            complement(<887937..>889418)
                     /gene="MSS1"
                     /locus_tag="KLMA_40384"
                     /db_xref="GeneID:34716370"
     mRNA            complement(<887937..>889418)
                     /gene="MSS1"
                     /locus_tag="KLMA_40384"
                     /product="tRNA modification GTPase MSS1"
                     /transcript_id="XM_022819688.1"
                     /db_xref="GeneID:34716370"
     CDS             complement(887937..889418)
                     /gene="MSS1"
                     /locus_tag="KLMA_40384"
                     /codon_start=1
                     /product="tRNA modification GTPase MSS1"
                     /protein_id="XP_022676229.1"
                     /db_xref="GeneID:34716370"
                     /translation="MGCCRLLSKPVCMPLWRRQYSVPATYFHPTVYALSTPSNQHSAI
                     AILRISGTHSKYILEQLAPGKHVLPRKPMLRTLSDPKTSTFIDEALVLYFPQPKTFTG
                     EELVELHLHGGKAIIKAALKSIQELRSEERDIRMAMPGEFSRRAFQNGKMDLLKLESI
                     NKMIHSDTEIQRLSALHSDEILLKFQRWRQEIIDQMAKLTAIIDFGEDIESEDIEAII
                     KAVNDKLLTLHTQITRFVTKLDRMSVLNDGIKLTLLGEPNSGKSSLINEISHDEVAIV
                     SNIPGTTRDSIDVVMDINGFKCILTDTAGIRQGTSDAIEIKGIDRSKKKSLESNLVVL
                     VIDASKPNIDEQFFDFINNQLAEKPLVVVLNKSDLITSDQLAQLKANFEAKLNALKVH
                     TVSCLTKQGLDSLVETLTDNFKHISATEDEDPIAVSDRVKEILQTDLLYGLDQFFEHK
                     DQDILIACEALRIASDGIGKITGENIDVEEVLDVVFSKFCIGK"
     gene            <889820..>890776
                     /gene="MRPL3"
                     /locus_tag="KLMA_40385"
                     /db_xref="GeneID:34716371"
     mRNA            <889820..>890776
                     /gene="MRPL3"
                     /locus_tag="KLMA_40385"
                     /product="54S ribosomal protein L3"
                     /transcript_id="XM_022819689.1"
                     /db_xref="GeneID:34716371"
     CDS             889820..890776
                     /gene="MRPL3"
                     /locus_tag="KLMA_40385"
                     /codon_start=1
                     /product="54S ribosomal protein L3"
                     /protein_id="XP_022676230.1"
                     /db_xref="GeneID:34716371"
                     /translation="MSVLRSLLNPVRVRGFASCTRVYQAEVSELSSLKQYKNTISSLL
                     RGSEQLTSPNLVALHARLNLPKEFSYSLLSKCLTCRTAGEKNFDNVSMNIFGKNLLTL
                     TVTSELMKQYPRLPAAVLNAAVDAYINDSVLSHVGRSWGIEVENTSLVDRYAKNENAN
                     VTLGKLRFFENSRNELHNFTEANAMAVAVRSIVAGVYSVDSDLNRTRKFISDYILSRK
                     LDVKKLFAFEQPTRELAALCRREGLERPVSKLIAENGRLSKSPLFIVGVFSGEEKLGE
                     GFGSSLKEAKARAATDALLKWYCYQPVESQQQVIIDQGEVLV"
     gene            <891031..>891642
                     /locus_tag="KLMA_40386"
                     /db_xref="GeneID:34716372"
     mRNA            <891031..>891642
                     /locus_tag="KLMA_40386"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819690.1"
                     /db_xref="GeneID:34716372"
     CDS             891031..891642
                     /locus_tag="KLMA_40386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676231.1"
                     /db_xref="GeneID:34716372"
                     /translation="MDLKEEVLLQVNSVLNSNKDNGPLLFILTLENGVASHCFLNDNT
                     EFLPKRLQLFNWKESDPIGVLLVDPEIYDYEDAVQLLESTNYNILSVFEYFPESCRLN
                     QVHQGVRYPYKIIECGVEIQSYEPDLGLLKRDLKDRLDRMIQYLEKSDKSSDEVLREM
                     WLLTLKYKNTIATDLEDEISRLEYEITVMQTMFNQLETSIALS"
     gene            complement(<891703..>892710)
                     /locus_tag="KLMA_40387"
                     /db_xref="GeneID:34716373"
     mRNA            complement(<891703..>892710)
                     /locus_tag="KLMA_40387"
                     /product="peroxisome assembly protein 12"
                     /transcript_id="XM_022819691.1"
                     /db_xref="GeneID:34716373"
     CDS             complement(891703..892710)
                     /locus_tag="KLMA_40387"
                     /codon_start=1
                     /product="peroxisome assembly protein 12"
                     /protein_id="XP_022676232.1"
                     /db_xref="GeneID:34716373"
                     /translation="MDFYSNLPVNLQQPTLFEILSVNEVKKLIKPTLRYIFSLYLQHR
                     GTGRWLLKIFNKFDLLILLLKSLLEYRHCKATGATILDKFYGLKRVSRFDHLTFLGVW
                     INDCLSEYINDICEQYHEKLQSMKLTNLKLNNWQQWFDLYFPKVQQAIKVINFCFKLK
                     YLRDSKHSDLVQFATQTRYERYSEPDEVESKVPAVSDIVQRRRKRTNMPRILEIVKKS
                     VDKTFSMFLDKLFPSFLVMIRILQIINQRPELFKQDVRIKKPKPPVLPSKKGSDKDVD
                     KANATTENCPLCGEKIKDPAMISSGYIADLKCAEEWVRTETTCFITGIEINKTIRKLL
                     I"
     gene            complement(<893107..>894192)
                     /gene="FBA1"
                     /locus_tag="KLMA_40388"
                     /db_xref="GeneID:34716374"
     mRNA            complement(<893107..>894192)
                     /gene="FBA1"
                     /locus_tag="KLMA_40388"
                     /product="fructose-bisphosphate aldolase"
                     /transcript_id="XM_022819692.1"
                     /db_xref="GeneID:34716374"
     CDS             complement(893107..894192)
                     /gene="FBA1"
                     /locus_tag="KLMA_40388"
                     /codon_start=1
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="XP_022676233.1"
                     /db_xref="GeneID:34716374"
                     /translation="MPASDVLSRKTGVIVGDDVRHLFEYAKAHKFAIPAINVTSSSTV
                     VAALEAARDNNSPIILQTSNGGAAYFAGKGVSNKDQNASIRGAIAAAHYIRSIAPAYG
                     IPVVLHSDHCAKKLLPWFDGMLAADEEYFAKHGEPLFSSHMLDLSEETDEENIGTCVK
                     YFKRMAKMGQWLEMEIGITGGEEDGVNNEGTSNDKLYTTPETVFSVYEALAPISPNFS
                     IASAFGNVHGVYKAAAALKPELLGTFQEYASKQLKEKKDDKPLFLVFHGGSGSSTKDF
                     HTAIDFGVVKVNLDTDCQFAYLKGIRDYVLNKKDYIMTPVGNPEDPDGPNKKHYDPRV
                     WVREGEKTMSERIASALEIFRTKGTLN"
     gene            complement(<894232..>894561)
                     /locus_tag="KLMA_40389"
                     /db_xref="GeneID:34716375"
     mRNA            complement(<894232..>894561)
                     /locus_tag="KLMA_40389"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022819693.1"
                     /db_xref="GeneID:34716375"
     CDS             complement(894232..894561)
                     /locus_tag="KLMA_40389"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022676234.1"
                     /db_xref="GeneID:34716375"
                     /translation="MCVYVCACVDRFLALLVLLVMIDGGFSVQELAQAFFFSHRFQFG
                     LSLCIHYIVIALSFGNFSYSSKSYIISYNVSYSLLPGCWCKHHLTSPFFLKLFNIYFY
                     FVPNTKK"
     gene            complement(<895386..>896672)
                     /gene="TRM13"
                     /locus_tag="KLMA_40390"
                     /db_xref="GeneID:34716376"
     mRNA            complement(<895386..>896672)
                     /gene="TRM13"
                     /locus_tag="KLMA_40390"
                     /product="tRNA guanosine-2'-O-methyltransferase TRM13"
                     /transcript_id="XM_022819694.1"
                     /db_xref="GeneID:34716376"
     CDS             complement(895386..896672)
                     /gene="TRM13"
                     /locus_tag="KLMA_40390"
                     /codon_start=1
                     /product="tRNA guanosine-2'-O-methyltransferase TRM13"
                     /protein_id="XP_022676235.1"
                     /db_xref="GeneID:34716376"
                     /translation="MTSAVVDKERLQCEFYLVKKKRQCGMTRRAGSRFCSEHSDDSDR
                     VPCPLDPSHTVSVDKLRVHMRKCNKFRHDVSYQAKSRDIPWFQEGLNSIANGASADAK
                     PKDETVVASIAIIERIFEQEFQDLPTLPLIEKKNELLEQTERYKTLINKKHARQQSSL
                     IEHLKEASLWPSNDKHMQFIELGCGRAEFSRYVNIAVHLDQTQHESESESEEGPKEGT
                     KNVPSFCLIDRASQRLRFDNKFSADVDSEVTLRREKIDIKDLKLDAVLNPDAHEYAAI
                     SKHLCGVATDLSLRCLLNSEKCNKGLKGILIAMCCRHVCQSSEYVNRDYISDLLAKHG
                     PDMTYTDFFQCLKKFCSYYTCGLRPDMDPNGGAEEHFTKLTHNERKRIGYMARRIVDE
                     GRQRFLQSRGFKTVLFRYVDNSVTLEDTALLALKDA"
     gene            <898246..>899370
                     /gene="MDH2"
                     /locus_tag="KLMA_40391"
                     /db_xref="GeneID:34716377"
     mRNA            <898246..>899370
                     /gene="MDH2"
                     /locus_tag="KLMA_40391"
                     /product="malate dehydrogenase"
                     /transcript_id="XM_022819697.1"
                     /db_xref="GeneID:34716377"
     CDS             898246..899370
                     /gene="MDH2"
                     /locus_tag="KLMA_40391"
                     /codon_start=1
                     /product="malate dehydrogenase"
                     /protein_id="XP_022676236.1"
                     /db_xref="GeneID:34716377"
                     /translation="MPAVSYDVQQRDILKIAVLGAAGGIGQSLSLLLKSNASFLLPRD
                     SSRHISLALYDVNKDAIVGTAADLSHIDTPITTTPHYPNDGNGGIARCLQDADMVIIP
                     AGVPRKPGMSRDDLIGVNAKIIKSLGNDIAEYCDLSKVHVLVISNPVNSLVPLMVSTL
                     ANSPHSANTNIEARVYGITHLDLVRASTFVQQLNSFKSNNAPDIPVIGGHSGDTIIPV
                     FSVLNHRASNSGYANLLDNGVRQKLVHRVQYGGDEIVQAKNGNGSATLSMAYAGFKIA
                     AQFIDLLVGNIRTIENICMYVPLTNRYNTEIAPGSDELRSKYINGTLYFSIPLSIGIN
                     GIERVHYEIMEHLDSYERETLLPICLETLKGNIDKGLSLV"
     gene            <899976..>900737
                     /gene="BXI1"
                     /locus_tag="KLMA_40392"
                     /db_xref="GeneID:34716378"
     mRNA            <899976..>900737
                     /gene="BXI1"
                     /locus_tag="KLMA_40392"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819698.1"
                     /db_xref="GeneID:34716378"
     CDS             899976..900737
                     /gene="BXI1"
                     /locus_tag="KLMA_40392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676237.1"
                     /db_xref="GeneID:34716378"
                     /translation="MTEPSVSTPFIPDDFKYSTKVSSCENEIKLRFLRNVYSILLFQL
                     TLTFAFGLYVYNSPKLQYFIVTKLWVDILAIVIGLVTCIWLSFAPSSTDEENEPWYVL
                     SFPQQLALLFVFTLAEAYSLSIVVVVYRPEVILNAVMMTLFVVIGITTTLMSTNYFKI
                     YDFQKWYYWLNMLLWVMIGFSLSSIFFSFNTNLDLLISWVGVILFTGYIFVDTQLILR
                     KVLIGEEIKCAMMLYLDIINLFLYILRILSRNEDD"
     gene            complement(<900983..>901931)
                     /gene="RPL25"
                     /locus_tag="KLMA_40393"
                     /db_xref="GeneID:34716379"
     mRNA            complement(join(<900983..901398,901919..>901931))
                     /gene="RPL25"
                     /locus_tag="KLMA_40393"
                     /product="ribosomal protein L23"
                     /transcript_id="XM_022819699.1"
                     /db_xref="GeneID:34716379"
     CDS             complement(join(900983..901398,901919..901931))
                     /gene="RPL25"
                     /locus_tag="KLMA_40393"
                     /codon_start=1
                     /product="ribosomal protein L23"
                     /protein_id="XP_022676238.1"
                     /db_xref="GeneID:34716379"
                     /translation="MAPSTKATAAKKAVVKGTNGKKALKVRTSASFRLPKTLKLARSP
                     KYATKAVPHYNRLDSYKVIEQPITSETAMKKVEDGNTLVFQVSLKANKYQIKKAVKEL
                     YEVDVLNVNTLVRPNGTKKAYVRLTADYDALDIANRIGYI"
     gene            complement(<902694..>903311)
                     /gene="MRPS18"
                     /locus_tag="KLMA_40394"
                     /db_xref="GeneID:34716380"
     mRNA            complement(<902694..>903311)
                     /gene="MRPS18"
                     /locus_tag="KLMA_40394"
                     /product="37S ribosomal protein S18"
                     /transcript_id="XM_022819700.1"
                     /db_xref="GeneID:34716380"
     CDS             complement(902694..903311)
                     /gene="MRPS18"
                     /locus_tag="KLMA_40394"
                     /codon_start=1
                     /product="37S ribosomal protein S18"
                     /protein_id="XP_022676239.1"
                     /db_xref="GeneID:34716380"
                     /translation="MLKTIVRPFSSTARVSQDVASFLFASTKGPESAQANEDANIVQP
                     KNLQGGNKKGRVDESVVKYILNCRFTKNNTHFTYSAVMEDKNFLTNNEQLSYNEKYLY
                     YLKLPQKVKFHMSTGHLGFRKAARGEYEASFQTAAKLFETLQQKKLLDKNIEIVMRDF
                     GKGRDAFISALNGKEGNLIRRHISRISDATELKFGGVKAPRPRRL"
     gene            <904488..>905585
                     /gene="MCK1"
                     /locus_tag="KLMA_40395"
                     /db_xref="GeneID:34716381"
     mRNA            <904488..>905585
                     /gene="MCK1"
                     /locus_tag="KLMA_40395"
                     /product="protein kinase MCK1"
                     /transcript_id="XM_022819701.1"
                     /db_xref="GeneID:34716381"
     CDS             904488..905585
                     /gene="MCK1"
                     /locus_tag="KLMA_40395"
                     /codon_start=1
                     /product="protein kinase MCK1"
                     /protein_id="XP_022676240.1"
                     /db_xref="GeneID:34716381"
                     /translation="MSMQRLDEYVANDVISNKSNIKREMLVKEYKKIGQGAFGTVVQA
                     YLTPDNQKWLGPFAIKKVPAQTEYKSRELEILRIADHPNVVKLEYFYTHVSPTDHKVY
                     QHLAMECLPEMLQNEILRYKKNNLELPLKHVKLYTYQIARGMLYLHALGICHRDIKPS
                     NVLVDPQTGILKICDFGSAKKLESNQPSISYICSRYYRAPELIVGCTQYTTKIDIWGL
                     GCVLGEMLLGKAVFQGHQPLLQLHEITKLLGPPDKRFIFFSNPSYNGPLFSKPLFEGP
                     PRARFEKYFGYAGPDGVDLLMSVLVYEPEKRASPRRILAHPFFDDLRNERYFFPSGNS
                     QPKRLPPLYDFSDFELQVIGDLLPQIQPKQD"
     gene            complement(<906177..>906707)
                     /gene="VPS68"
                     /locus_tag="KLMA_40396"
                     /db_xref="GeneID:34716382"
     mRNA            complement(<906177..>906707)
                     /gene="VPS68"
                     /locus_tag="KLMA_40396"
                     /product="vacuolar protein sorting-associated protein 68"
                     /transcript_id="XM_022819702.1"
                     /db_xref="GeneID:34716382"
     CDS             complement(906177..906707)
                     /gene="VPS68"
                     /locus_tag="KLMA_40396"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 68"
                     /protein_id="XP_022676241.1"
                     /db_xref="GeneID:34716382"
                     /translation="MEASEERLFRLPFTLPKSLSAKKICVYIAGALYGAGIWSFLDCV
                     LYSKHGNASDMHVSFIDWVPMICSVLGMAIVSSIEKNRLLQDALSSGNFNGSQATAWQ
                     ARIVLFLGFSLLASGISGSLVVLIVKFLLKDYTSYPTLGMGVNNVLANFFILMSCTFL
                     WIGQNVEDEYNYSLTL"
     gene            <907315..>909054
                     /gene="KRI1"
                     /locus_tag="KLMA_40397"
                     /db_xref="GeneID:34716383"
     mRNA            <907315..>909054
                     /gene="KRI1"
                     /locus_tag="KLMA_40397"
                     /product="protein KRI1"
                     /transcript_id="XM_022819703.1"
                     /db_xref="GeneID:34716383"
     CDS             907315..909054
                     /gene="KRI1"
                     /locus_tag="KLMA_40397"
                     /codon_start=1
                     /product="protein KRI1"
                     /protein_id="XP_022676242.1"
                     /db_xref="GeneID:34716383"
                     /translation="MPRKKSAAKKAREAAKKQEQKVEPVSAQTKVDTANSKGDEKSKL
                     VSDSKKETVDEVDEEEEEESSSEDEDDFGELITEEVEEGIQKVMNAIKNNETDKLLNP
                     EVKFFEEPEKAVEKLEKTEKHKPIYLKDYHRMNLLNGGVEGEDEDMEFQTVDGKQSFV
                     SQQKEEKAQLLNEIKDAFKVDDEENEEDGDDDGDFLKKKETKREREPASRLPDPEVDD
                     EKFLEEFVNQQAWIPKKGDKMIDLDRAPDMEEDDEEFEDAVEEFEKAYNFRYEDPNAA
                     EIVSYARTQATLRRAATSSRRRKRDEERALKAKEEEEKQKAVQKKKKEKINQLTDVLE
                     QVKKEYGADIKEEHVKALTDTLLNGSFEDGKWDEVIGTIFNDEFYNQEEKPTWNEDDE
                     IMGEFYSEQGANQEDEGEEISDSEEHKRKKSKKEKIEEKKGKKKEKKQLQEMVEKAVD
                     ERKLDIIDQVEEERGRSKEKDSEIKFRYREVSPESFGLTTREIFTADDADLNEFIGLK
                     KFAPYRPKELRSKDKRKVMKSRRLREWRKKVFKTEEGLTGDELAIPLSENASHQTSKE
                     KERLKNKKRKRKD"
     gene            <909390..>910312
                     /gene="RFA2"
                     /locus_tag="KLMA_40398"
                     /db_xref="GeneID:34716384"
     mRNA            join(<909390..909396,909498..>910312)
                     /gene="RFA2"
                     /locus_tag="KLMA_40398"
                     /product="replication factor A protein 2"
                     /transcript_id="XM_022819704.1"
                     /db_xref="GeneID:34716384"
     CDS             join(909390..909396,909498..910312)
                     /gene="RFA2"
                     /locus_tag="KLMA_40398"
                     /codon_start=1
                     /product="replication factor A protein 2"
                     /protein_id="XP_022676243.1"
                     /db_xref="GeneID:34716384"
                     /translation="MTTYQPYNEYSNVNAGGFDTSESQSSRPNTAGGQNVNTLTPVTI
                     KQMQSAKQHVQDGPYVFMNQELHHVSFVGVIRNVADNTSNVTLTVEDGTGQIEFRKWT
                     NDSNDMSHASQGEPNDEYNSQVAQDYSVGKYIKVYASLREFSGKMNVQYAVVKKIETF
                     NEVLAHHLEVMKAFATVNGTLSTGGAESSNTINADGNGLFVQDNEPPKSATEKVLDFI
                     RAQCAGKDSNSFSVQTKLIAQSLNMLEDDVRMYCQTLTEQGYIYPTFDEFTFFIL"
     gene            <910671..>912086
                     /gene="GAS4"
                     /locus_tag="KLMA_40399"
                     /db_xref="GeneID:34716385"
     mRNA            <910671..>912086
                     /gene="GAS4"
                     /locus_tag="KLMA_40399"
                     /product="glycolipid-anchored surface protein 4 precursor"
                     /transcript_id="XM_022819705.1"
                     /db_xref="GeneID:34716385"
     CDS             910671..912086
                     /gene="GAS4"
                     /locus_tag="KLMA_40399"
                     /codon_start=1
                     /product="glycolipid-anchored surface protein 4 precursor"
                     /protein_id="XP_022676244.1"
                     /db_xref="GeneID:34716385"
                     /translation="MYSVILLLMTIGVVNVLADIHPIEIRGKHFYDTVTNEPFFIRGI
                     DYQPGGSSDVAEDRDPLSDVSVCSRDIPLFQDLGINAVRVYSLNPDLNHDKCMTMLAS
                     AGIYLILDVNSPLTNQHLNRYEPWTTYNPTYLEHVFKLMGQFMTYNNTFGFIAGNEIV
                     NDKRSAERSPPYIRQLVSDMKGFIAAHSPRTIPVGYSAADDLKYRVSLSKYLECEDKD
                     AHDSSVDFYGVNSYQWCGDQDFQSSGYDKLVEAYKDYSKPVFFSEFGCNEVTPRKFGE
                     IPTLYSDKMYHTFSGGLVYEFTQEINNYGLVSVNEETDDVYLLEDFEALKEQYKQTPH
                     PRAADLKLVQDQVKSRIMSNSPSCANKYTNLDITAKVVPKLATEFIRRGVKCNKGKYV
                     DLEKSDLVSNSKYFDAKGNQLSKVPKMSVVNDINSVKLKEPEKKASNSATGIKASKSN
                     IIIGCIMVFGVVLDMFSIVFV"
     gene            complement(<912070..>914082)
                     /gene="SKP2"
                     /locus_tag="KLMA_40400"
                     /db_xref="GeneID:34716386"
     mRNA            complement(<912070..>914082)
                     /gene="SKP2"
                     /locus_tag="KLMA_40400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819706.1"
                     /db_xref="GeneID:34716386"
     CDS             complement(912070..914082)
                     /gene="SKP2"
                     /locus_tag="KLMA_40400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676245.1"
                     /db_xref="GeneID:34716386"
                     /translation="MRGLQLFGVGKKNVSEENGLYSRGRSEKDQYTKLQGPHLLGLPD
                     KILERVLENLDLQTYLSLIRVNKKFYQFICERFLFKNVVLTNKMSLLQFNALIQCQSL
                     TLRNDISYLVRSVEFVDPECHDSLFKYSKYYRTDSSGTMIGGTYSFAERQGRSNDIML
                     NSSRSTSLSSVRSRTKQNSTEIHQRLAKLESKFNNYTYIELMLNIIDYLPNLSHIILS
                     QVEQNFKVPLWYSVLNDGSKEFMKKIIKGQGSMTVEDLRSFKVSNEWIRQYEETFQSL
                     SRFKRLSIKAKTNLALRPNHLCCFGVFEELMLENVTITTESLDTPLEYLPLYLRIGRD
                     KRLDLHLPVLSLELKSCTIKPGNGLMRLIYSYFFPVRKLSLYNLQSKFDLLLINCFPS
                     LSHLTLDCNSKCFVDVVPVDESYYFPDEPAQDVLDDVQTLINSSKRTKLTTPPPTTPV
                     VVVMNKGKLVNNEPSVHRKPALLTTTQANYFQSASISPFHCYFHHFKRLWERIPNSGV
                     HLTIVNIPFTNVFPLVPELVWERFLTNDSDTLYGDSDSENEEERDEFWWDSSIRDYLE
                     ETIGVSNNLDDSHEELEPQKWNDLHRINSFKDIPNVNVWFFLKLISKFQSVEIHMLRQ
                     WLFCTPRTRYDWELLLKPVLNGKVPVTVKDNAGYLLYSYGSTIQKR"
     gene            complement(<914487..>915056)
                     /gene="ZIM17"
                     /locus_tag="KLMA_40401"
                     /db_xref="GeneID:34716387"
     mRNA            complement(<914487..>915056)
                     /gene="ZIM17"
                     /locus_tag="KLMA_40401"
                     /product="DNL zinc finger domain-containing protein"
                     /transcript_id="XM_022819708.1"
                     /db_xref="GeneID:34716387"
     CDS             complement(914487..915056)
                     /gene="ZIM17"
                     /locus_tag="KLMA_40401"
                     /codon_start=1
                     /product="DNL zinc finger domain-containing protein"
                     /protein_id="XP_022676246.1"
                     /db_xref="GeneID:34716387"
                     /translation="MNRLSVFSNPALKRGLRAVGLAARPLAARSSILFYRSNVPLNRH
                     FHASLCRNEESDKTDNKSQHLGSFKVDKPMLLIAFTCKKCDTRSSHTMSKQAYTKGTV
                     LITCPGCKNRHLIADHLKIFNDNHITIEDIMKAQGQSVSLTTDDLAFEDVPDSLKNVI
                     GHYAKDAPDELKKKLDNEKVHELPEGTEK"
     gene            <915497..>916519
                     /locus_tag="KLMA_40402"
                     /db_xref="GeneID:34716388"
     mRNA            <915497..>916519
                     /locus_tag="KLMA_40402"
                     /product="protein STB1"
                     /transcript_id="XM_022819709.1"
                     /db_xref="GeneID:34716388"
     CDS             915497..916519
                     /locus_tag="KLMA_40402"
                     /codon_start=1
                     /product="protein STB1"
                     /protein_id="XP_022676247.1"
                     /db_xref="GeneID:34716388"
                     /translation="MSSMSPEKQQELADRILERAELAQMARKLKLGLSKVASPKKNGG
                     GSALPLGAKNKNRYSSEPDSLGIPTSAGRSRARSVSITKPSHVSESPTRRSTMKSPSR
                     TVSSSGTGTGTGNSNAMMATTASRRTSIGRESHMPAIPSTPKAKSGHQSVSDPKGASE
                     EGADLLMYLATSPYASSSAGNLGAGRRPSFGHSSIHHGIPTTPSSNMYAPPATAGSES
                     HLNDITRLSHIKDRASSSSPQSTFKQPVMIPSSTMHELMQSPSVAMFTSPRRKLAADD
                     QQLLVPGTPSRIGLSAASMTSDQLNDSQSKIGSLLKTPNFNMGDYVHTLFSPSPRIDT
                     THQSRD"
     gene            <917436..>917816
                     /gene="VTC1"
                     /locus_tag="KLMA_40403"
                     /db_xref="GeneID:34716389"
     mRNA            <917436..>917816
                     /gene="VTC1"
                     /locus_tag="KLMA_40403"
                     /product="vacuolar transporter chaperone 1"
                     /transcript_id="XM_022819710.1"
                     /db_xref="GeneID:34716389"
     CDS             917436..917816
                     /gene="VTC1"
                     /locus_tag="KLMA_40403"
                     /codon_start=1
                     /product="vacuolar transporter chaperone 1"
                     /protein_id="XP_022676248.1"
                     /db_xref="GeneID:34716389"
                     /translation="MSTPLLQKAPGKRIALPTRVEPKVFFANERTFLSWLNFTVMLGG
                     LGVGLLNFGDKVGQISAGLFTLVAMGTMIYALVAYHWRAAAIRRRGSGPYDDRFGPTL
                     LCFFLLVAVVVNFFLKMKYQNNDA"
     gene            <919176..>920720
                     /gene="ALD5"
                     /locus_tag="KLMA_40404"
                     /db_xref="GeneID:34716390"
     mRNA            <919176..>920720
                     /gene="ALD5"
                     /locus_tag="KLMA_40404"
                     /product="aldehyde dehydrogenase 5"
                     /transcript_id="XM_022819711.1"
                     /db_xref="GeneID:34716390"
     CDS             919176..920720
                     /gene="ALD5"
                     /locus_tag="KLMA_40404"
                     /codon_start=1
                     /product="aldehyde dehydrogenase 5"
                     /protein_id="XP_022676249.1"
                     /db_xref="GeneID:34716390"
                     /translation="MLARTQINTVRRFIRLYSQLPLKVSVQLPNGTTYEQPTGLFING
                     EFVPSRQHKTFEVLNPSTEEEITHIYEAREDDVDIAVAAAKKAFDNGWSTAEPEERAK
                     CLLKLADLVDEHAETLAAIESLDNGKSLFCSRGDVALVAKYLRSCAGWADKIYGKVID
                     TGADHFSYSKREPLGVCGQIIPWNFPLLMWSWKIGPALATGNTTVLKPAEATPLSALY
                     ACQLVQQAGVPKGVVNIIPGFGKIVGERICTHPDIKKVAFTGSTATGRHIMKTCADSV
                     KKVTLELGGKSPNIVFADADLDKAIKNIAFGIFYNSGEVCCAGSRIYVQDTVYEEVLE
                     KFKQYAESLKVGNPFEEGVFQGAQTSQMQIDKILSYVDIGLSEGARVVTGGERIGNKG
                     YFVKPTIFADVAEDMQIVKDEIFGPVVTVSKFTTVDEVVAKANDSQYGLAAGIHTKDV
                     NKAIDVSNRIKAGTIWINTYNNFHQNVPFGGFGQSGIGREMGAEALDNYTQTKAVRMA
                     IDHPNY"
     gene            <921800..>922744
                     /gene="RPS24B"
                     /locus_tag="KLMA_40405"
                     /db_xref="GeneID:34716391"
     mRNA            join(<921800..921802,922340..>922744)
                     /gene="RPS24B"
                     /locus_tag="KLMA_40405"
                     /product="40S ribosomal protein S24"
                     /transcript_id="XM_022819712.1"
                     /db_xref="GeneID:34716391"
     CDS             join(921800..921802,922340..922744)
                     /gene="RPS24B"
                     /locus_tag="KLMA_40405"
                     /codon_start=1
                     /product="40S ribosomal protein S24"
                     /protein_id="XP_022676250.1"
                     /db_xref="GeneID:34716391"
                     /translation="MSDAITIRTRKVISNPLLARKQFVIDVLHPNRANVSKDELREKL
                     AEVYKAEKDAVSVFGFRTQFGGGKSVGFGLVYNSVADAKKFEPAYRLVRYGLAEKVEK
                     ASRQQRKQRKNRGKKVFGTGKSLAKKAARRNAD"
     gene            complement(<923995..>927141)
                     /gene="PTP3"
                     /locus_tag="KLMA_40406"
                     /db_xref="GeneID:34716392"
     mRNA            complement(<923995..>927141)
                     /gene="PTP3"
                     /locus_tag="KLMA_40406"
                     /product="tyrosine-protein phosphatase 3"
                     /transcript_id="XM_022819713.1"
                     /db_xref="GeneID:34716392"
     CDS             complement(923995..927141)
                     /gene="PTP3"
                     /locus_tag="KLMA_40406"
                     /codon_start=1
                     /product="tyrosine-protein phosphatase 3"
                     /protein_id="XP_022676251.1"
                     /db_xref="GeneID:34716392"
                     /translation="MESADSIHLGGQMHSPKYIQESPTFSKPVPKPFSLTMPAVLKER
                     QSSANNSFNSETSSVLSSSSTLVDEKIMQQQHLHLPDKRYSVDAITESSCAFQPVSSS
                     PTVATSAAAAAAAVSAGTADTAVTTPKSSMVSTPNPLSTHRSSASCTFANPRRIAMKC
                     NSSPVIPIIRSKEMRFRNHKDCSLISSEEFHTLFNKIDNENEILIIFDTRPYVDYAKS
                     HIASALHLSLPSTLLKRKNFNLERLIGNLPAPAKETLAEYLLGSSPDQKFNSTVVIYD
                     NVPNQTDTSVSLACFGISSKILDHESQNHQKPSVYVLADGFDEFNKQFPQDVEIGPGD
                     LLDPTCSSTDSIDSPQPLSATSPVQPHTKLFGRSQSHSASPLHQPPQLTSSRTFSGSP
                     VSASSPLSSLFGFTLPTNLSNQQQPTFKLSQIEQDISDLDSYVKAVEINERSQRNSFL
                     ESERTLRSFKFPTTDSSSANTTTDNGDSRSINSPPPKRLFDTHSHKKSLSPSSSVDLT
                     SSAYDTSKLTFQVKFDSLFNKFDSTEISKVIPPWFCKLMTTPKLQFISKFQRLEMLER
                     KRLHRLLGSFSSATLLNGNGSSSSISSSTMSHANQTSCEEDDDSDENLQSITISSGVE
                     FGTKNRYKDIFPYEHTRVKLSHYNLNSGKYGNSPGHSPTNSHDGSSSDVPQKNQEEEQ
                     EDIWNTYINANYLVNPYDEIKKTTAEPSPFKSVRYIATQAPLKDTISDFYTCILNNNV
                     PLILTLTDEYENGVEKCCKFWADGTYDGIKVELLDEYSTLQCGKPVGKEMNPEEDMFA
                     SKFLKHLNLNQDSHKSSNSDIIIRRIQLTYNNGESKFQLLQLQIRDWPDLGTLLKPNE
                     ILQLINLKNFIIDKLFVQEVFNPDYITTVLVHCSAGCGRTGTLCAVDSVLSNLAKFKD
                     NDSMDLSGNLSGSITPEVSPTTSKCSPLSSNKTSNNIQCNNHSIASNKLNFNSVFDPI
                     ATTVNQFRRQRISMVQNINQYLFIYDCLLFYFTLNLETSMVGGKRVSNWNRMTKENSK
                     LDILSSFIEDKVNESRTF"
     gene            <929010..>929795
                     /gene="MAM33"
                     /locus_tag="KLMA_40407"
                     /db_xref="GeneID:34716393"
     mRNA            <929010..>929795
                     /gene="MAM33"
                     /locus_tag="KLMA_40407"
                     /product="mitochondrial acidic protein MAM33"
                     /transcript_id="XM_022819714.1"
                     /db_xref="GeneID:34716393"
     CDS             929010..929795
                     /gene="MAM33"
                     /locus_tag="KLMA_40407"
                     /codon_start=1
                     /product="mitochondrial acidic protein MAM33"
                     /protein_id="XP_022676252.1"
                     /db_xref="GeneID:34716393"
                     /translation="MSFSLRLLSRTASKVATRPASVQIAKNVVARPTFVNFPRYFSSR
                     AVAFNQHTTKVVQILNSEVELETSQQIKELPEEVASFLETYKFETVENKGNNLAHIKR
                     ESATETVNVFFDVAQVANLPVDPAALDQAEESMEEDFDSMADNFFNVNVVVVKKADNT
                     AVAFELLMNMQEGNFFVDSVTPYESADAALNESAEAEVKRELRYHGPPFSNLDESLQE
                     SLESYLESRGITNQLVSFISNYSEFKENNEYIQWLNNMKKFFD"
     gene            complement(<930058..>932001)
                     /locus_tag="KLMA_40408"
                     /db_xref="GeneID:34716394"
     mRNA            complement(<930058..>932001)
                     /locus_tag="KLMA_40408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819715.1"
                     /db_xref="GeneID:34716394"
     CDS             complement(930058..932001)
                     /locus_tag="KLMA_40408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676253.1"
                     /db_xref="GeneID:34716394"
                     /translation="MHCIKSCARVRPFSRSFHTGFVGLGSQLKLKLNILQQKEKLVKQ
                     TEKELKKRVEEKRLKGLSAGKYGYSKQKANDILKKKYHIQDAEKFAKIGPLSDADTSL
                     LAITKDKRLMYTMLGITRPQLKDSVLVQKDVQKFCKRDQLQKALFLIKLAGPNGAAGM
                     NALMEHYLTVEKDGKSAVDLYTWRKKWQIPPNEYTESILFQGLAKLPEPISVKLAERV
                     VKIVVKMIEDERLNNINFNAALSALSNCNDTSYLFTCFDLRPKGIKKDAITYTQLLIG
                     CSKIEDPVEAIQRADAVMNMADPRLIDSQMFFHYANVWHSRKDIRFARCVLPLIETFY
                     SYNVKDTTYKYTVPEFVTLPTMENWRLQRKLKMSPYTAHLILENCLKTGEYEYGIAFF
                     EQYCKDHSESLTSKNILAYMELIIKAYPLECGYKCREMYRRLEENGSMREPLHALLKT
                     YKAFERQASKKINNSDPEKASNLVQSCVSFIKENESSVLRSEKGQNESYIKWKAWMFL
                     WNVVSPCKETLPLVQKKAIMDEFIRTMLYDNAMLIRHKGITLSNMRFIYLEAVRFVKI
                     IETSLTLSDEQLKKVQLEPEEQSASIEKKKFLFKRHVMRLRKRLLEIVENLENGKDST
                     GNEIEKAFKQYCSLILSTSVNGF"
     gene            <932345..>933511
                     /gene="PCI8"
                     /locus_tag="KLMA_40409"
                     /db_xref="GeneID:34716395"
     mRNA            <932345..>933511
                     /gene="PCI8"
                     /locus_tag="KLMA_40409"
                     /product="COP9 signalosome complex subunit 11"
                     /transcript_id="XM_022819716.1"
                     /db_xref="GeneID:34716395"
     CDS             932345..933511
                     /gene="PCI8"
                     /locus_tag="KLMA_40409"
                     /codon_start=1
                     /product="COP9 signalosome complex subunit 11"
                     /protein_id="XP_022676254.1"
                     /db_xref="GeneID:34716395"
                     /translation="MTARSLNLPVAVLQDRYLRTENPNYRGYSDAKDYNLALSKLPGW
                     EQRLNSLLLENRYAEAILFINTDPLMVSIGFYKKIKLLMRIHILNTHYKALLDFEPRL
                     NVQAITSDSSEFSDFIECKLLLILNWYLRGEFHQCLQRFIQLLIDIPNLVDIMENLPT
                     NDVFVTTETILYIVTMCALITIPLDNLDTFIHLAELEQFNEKFNTLMVKARLIIGSKF
                     RRFFKWWHNDMNDICSNNYFLSKKWELVSSTMRQKIYAFYLRISNKLKISYLSEKLEI
                     PLDVVNQEVNQLIREACLNFRVQDGFVYFLPYDARDALVHNIIKEDILLNKKLTRLRH
                     QNSNLKLVIAENLSVRRNRQQHKTKCPNEKPMDQEEIFANSDSEMSNDNTDSFG"
     gene            complement(<933590..>935116)
                     /gene="ICP55"
                     /locus_tag="KLMA_40410"
                     /db_xref="GeneID:34716396"
     mRNA            complement(<933590..>935116)
                     /gene="ICP55"
                     /locus_tag="KLMA_40410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819717.1"
                     /db_xref="GeneID:34716396"
     CDS             complement(933590..935116)
                     /gene="ICP55"
                     /locus_tag="KLMA_40410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676255.1"
                     /db_xref="GeneID:34716396"
                     /translation="MLFNPNFLRVISRRNFGTKPELKQFVNRQRLPINCGQPIHETRP
                     YLLKQGELTPGITALEYFKRRVKLASKLVPRSCAIIAGSQMKYASGPVFYPFQQNNDL
                     FYLTGWNEPDSVMILEKPDNDPENVVLHMIVPPKDSFAEKWEGFRTGVEGAQEIFNAD
                     EATSNENLEKYVDKIIKRCDNIYFDTNNTAKNSGAFFSEFFSLKNESQKQNTILNMIK
                     NTSGVKNLMPLKKIIANLRSIKSPAELRVMRRAGQISGRAYNQAYAKRFRNERTLGAF
                     LEYKFIEGGCDRSAYVPVIGTGENALCIHYTRNDDVMFDDEMVLVDASGAIGGYCSDI
                     SRTWPVSGKFTDAQRDLYEVVLTVQRKCIELCCAHNVISLHQIHEKSLQFFKEELKNI
                     GLSSLSTWDINEIYPHYIGHNLGLDVHDVPEISRHQPLQENQVITIEPGLYIPDDPKY
                     PAYFRNIGIRIEDDIAIGMDTYTNLTMEAVKEIADLENIMQNGISTKIEHDVVSPLDF
                     "
     gene            complement(<935380..>937122)
                     /gene="HOP1"
                     /locus_tag="KLMA_40411"
                     /db_xref="GeneID:34716397"
     mRNA            complement(<935380..>937122)
                     /gene="HOP1"
                     /locus_tag="KLMA_40411"
                     /product="meiosis-specific protein HOP1"
                     /transcript_id="XM_022819719.1"
                     /db_xref="GeneID:34716397"
     CDS             complement(935380..937122)
                     /gene="HOP1"
                     /locus_tag="KLMA_40411"
                     /codon_start=1
                     /product="meiosis-specific protein HOP1"
                     /protein_id="XP_022676256.1"
                     /db_xref="GeneID:34716397"
                     /translation="MSTIQKVRQREEVAIKNAISQDQSQKLVQTMITMCFGCLAFLRG
                     LFPDDNFVDQKFVPEKCNKDYDKFSASSIRIKTLVRDKSEEADLFLDWLENGVFQSLK
                     KGYLKAISLGIFIDENNPNDLIETYLFSFKYSQDSISISINDQTDTISLLDSRKMVQQ
                     LMRRFIIITQSLDPLPEKRFLTMRLMFNENAPSEYQPKLFKDATKEPPTLITLPKGNE
                     LETFSVGSLNTSVHKVGLKVLSLADNAIQQQLTTGPTTQLDPFDMLEENIELPQETPE
                     NSQMTMQSQTTKMLQNYLKSSPAKCQPTQAMQSEEKTTVTEAVTKQRQLRCMSCKKFL
                     LAICYGNESRRFIPECVECLTDGKLDTNSRNFQRFMTTRKIYRYMAKKPDFPHSFSDL
                     VSVISGPSASASDKSIVSDSLSVLLMDEVFLVEEDVRVSYSGTQLRSSGFIEVDTDEI
                     VSPSGPLKRGKYAWTFMLHSAKAHSFYTEHYAKTEAQLQQLLKECSDTFQKMRETLVN
                     NESSNSLALHKLNINDTEKTSLGNDSVVKKRSYNDDIDDETQGESDLDTQDNQHQGKV
                     RKISVSKKTLKSAW"
     gene            <938047..>938724
                     /locus_tag="KLMA_40412"
                     /db_xref="GeneID:34716398"
     mRNA            <938047..>938724
                     /locus_tag="KLMA_40412"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819720.1"
                     /db_xref="GeneID:34716398"
     CDS             938047..938724
                     /locus_tag="KLMA_40412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676257.1"
                     /db_xref="GeneID:34716398"
                     /translation="MPESLSSHGSRDIYSSISLNDQSMDNSSMKAIYETDMMDSSEAG
                     DQDGDNEPLSATISRPLSRSSVTSGLSMTATKDGVEGRRVQRYGIPQYSLNILNSMSQ
                     SHWKPKKNGLEDVDSPIGPPMSLRDRIKLLSTDTLSRTTINDSRQDSNSIESSSRDSP
                     LYSRQYQQQPRELEEHLLDSFNTTLTPRANSELDSNLSTMGDDMSYLHDMKSIPSVLV
                     AVDSDND"
     gene            <939607..>941475
                     /gene="AIM9"
                     /locus_tag="KLMA_40413"
                     /db_xref="GeneID:34716399"
     mRNA            <939607..>941475
                     /gene="AIM9"
                     /locus_tag="KLMA_40413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819721.1"
                     /db_xref="GeneID:34716399"
     CDS             939607..941475
                     /gene="AIM9"
                     /locus_tag="KLMA_40413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676258.1"
                     /db_xref="GeneID:34716399"
                     /translation="MLRVGSKYLRNVSKVSKTPFVINSSRMNRVFTRSISDKADEVFT
                     KLSDENDPQRDAFFQYSWGSWLKNDKQEKEKRVTRFSLEGLNSVLDELYKQSIDNAKT
                     LTKDSIPPPSYLPNLTVSLPHNVTVKEIGTVNPNEKVRILSMASIHEGKHHRIYKVDT
                     NAGKSFVLRIPYALDDENTLAYRLKSEVATMDFAALKLGLKVPKVYSFGVNALNPVRQ
                     PFILEEYIEGKLLMRDWTPLESDAEDGESHKVKLNAVIQPLSKFQAKLAEVEFTAFGS
                     LYFAKDCKDSNSPAYENETNNDLKDRWRIGPSVERCLWRKKSALNFKDRKQFLGPWSI
                     TSPLDIVKCTGQIEAENARARLALVQAQASPEVIEEGILKEQIKTFDNLAKIAPSLIN
                     TETTSIPKMKNLLKPRLYHPDLDPMNVLIKEGDNVPYLLDFEGACIKPYILQNSPQFV
                     AYDGPKIYDLERDIEGYKDLPENEKAKYEFMYKRTRNQYLWEFALNENLPELISSVAP
                     PIKVLRSPYVTAIERKADQEYLLVEESLMQLAEVWPIFAKNKLVNADEYPLAYSEEDV
                     KKHTEALNAYHEKLISEPFAATQGWMPQDMFDSLVQSGVLVKDKSGDYGIAKAPDA"
     gene            <941818..>943008
                     /gene="PNT1"
                     /locus_tag="KLMA_40414"
                     /db_xref="GeneID:34716400"
     mRNA            <941818..>943008
                     /gene="PNT1"
                     /locus_tag="KLMA_40414"
                     /product="pentamidine resistance factor"
                     /transcript_id="XM_022819722.1"
                     /db_xref="GeneID:34716400"
     CDS             941818..943008
                     /gene="PNT1"
                     /locus_tag="KLMA_40414"
                     /codon_start=1
                     /product="pentamidine resistance factor"
                     /protein_id="XP_022676259.1"
                     /db_xref="GeneID:34716400"
                     /translation="MLSANRATLITKRAYNSRVIPIDITSKDGWRNSLKNNTLLNKLH
                     QLNQNKKILIKPHTDETTSNEINSNGTLPITCMPIQTIAESIKNDNSIGNWRKPLVKW
                     IRVGKFLLSTYRSGLKFTWSTYFETKSFKYTPKELIKLIEFKETESRILKKNKMNELA
                     ISRREYLQWLRRAEFWKIPKFALTLLVFEELTPLLCYLFPHLAPWNCLTPGLYKKITA
                     SRNKRPTQDFDINKKYISPYEVDKKMLSEYLVSQCIVPAWKMRLYRITNEYRIPLLSL
                     VEVNHKTIIDDWLLLREFLKSENEVATVISDKEIVDAVFRRQLYTSDEDLNKMVQDMR
                     GQEVLKLRLLIYLAFKYDCTLSAHDINGQLLAEKWGVDNMATFNYRGSNRLLTADVLD
                     NLEA"
     gene            complement(<943488..>945575)
                     /gene="HRK1"
                     /locus_tag="KLMA_40415"
                     /db_xref="GeneID:34716401"
     mRNA            complement(<943488..>945575)
                     /gene="HRK1"
                     /locus_tag="KLMA_40415"
                     /product="serine/threonine-protein kinase HRK1"
                     /transcript_id="XM_022819723.1"
                     /db_xref="GeneID:34716401"
     CDS             complement(943488..945575)
                     /gene="HRK1"
                     /locus_tag="KLMA_40415"
                     /codon_start=1
                     /product="serine/threonine-protein kinase HRK1"
                     /protein_id="XP_022676260.1"
                     /db_xref="GeneID:34716401"
                     /translation="MPSLLGLSFHKKKTNSSSQLSLSLEKEDSGKSDHQSHGHGHSYR
                     NAHGHPETTAVTAAGPVQTNSHVSQLLHHHSQSSHSRNSSSNNLNNFFHNISTNNNHH
                     NNNVNGTFAPNSSNNNTNNNNNYNDNIISNFTNNTAHHHHHDPHQQSQQHKLTRFFRP
                     SMKKKLSSGSGMSSTKLSELMSIEQQNLDHHSHTMSAIPPSTDSTLSLSNKTNIYHDD
                     SILAQKYGKLGKVLGSGAGGSVKVLVRPSDGAMFAVKEFRARKPNEPVRDYARKCTSE
                     FCVGSMLHHPNIIETLDIFSDAKQTQYYQVMEYCPVDFFAVVMSGEMSRGEINCCFRQ
                     LVEAVNYLHSKGYAHRDLKLDNCVMTKDGILKLIDFGSAFVYRYNFENDTKLAHGIVG
                     SDPYLAPEVLSGRSGGYDAPKVDIWSLGIIFCCMMLKRFPWKVPKDSDVNFSLYCMPD
                     DMEHDYEKSAREHEALMKAKKEERQRNKVAKGQGSSSATTEEKDSPKAAAAENTEQEN
                     NEHSSTPAGSSEQHQQATQKDDQNDQKQDQNQNQNQNQNQNQNQNDDHDQDQNREEPK
                     QEKSSPPPAASASDHHQEQQQQQQQGEVLDPKKDPTSSEYQVPQRKQKKVIHGPYRLL
                     RLLPHASRPILAKILTVDPNKRATMEDIYKDAWFSGISYCTLDNKRNVIRGTGHSHTI
                     VTEENAHLEKYKV"
     gene            <947564..>948892
                     /gene="PAC1"
                     /locus_tag="KLMA_40416"
                     /db_xref="GeneID:34716402"
     mRNA            <947564..>948892
                     /gene="PAC1"
                     /locus_tag="KLMA_40416"
                     /product="nuclear distribution protein PAC1"
                     /transcript_id="XM_022819724.1"
                     /db_xref="GeneID:34716402"
     CDS             947564..948892
                     /gene="PAC1"
                     /locus_tag="KLMA_40416"
                     /codon_start=1
                     /product="nuclear distribution protein PAC1"
                     /protein_id="XP_022676261.1"
                     /db_xref="GeneID:34716402"
                     /translation="MLSEIQRQSLNRAVCDYVRQNGGSPQLLSQLESLLPGPDASHKQ
                     DTQLLERKWNSIVRLQSRIMELEKQCSSSNSTTNDSQQTIDNANANWIPKEKPSFQIT
                     LEAPVTALCLHPTLPIIYVGLESGKLLRYDILNVELPLQSTMAHLDAITSISVSLPNT
                     NNNNSSSSSRPAYLATTSKDLNCKIWELDRDSSLTHIRTLVGHEHTVSECQFFEKDSD
                     LYLATCSRDLSVKIWDTSNGWCIKSFQPHTQWVRTLHVRGEYILTGSNDSALRLTHWP
                     SGNGLSMGIGHEFPVETVRILAQNANDILPQYQPLGFQYVSSASRDGTIRIWKVSLPK
                     FIPHRPPRPNPMDTNFRLMAVLKGHKSWVRHLCQFNNKLYSCSDDGSIKCWELNWPDI
                     SSTTCTKTWDLSENGFQNCLALDNIDFTNYPSRKLLFSGSNNGTLTCFMR"
     gene            complement(<949158..>951677)
                     /gene="VPH1"
                     /locus_tag="KLMA_40417"
                     /db_xref="GeneID:34716403"
     mRNA            complement(<949158..>951677)
                     /gene="VPH1"
                     /locus_tag="KLMA_40417"
                     /product="v-type proton ATPase subunit a"
                     /transcript_id="XM_022819725.1"
                     /db_xref="GeneID:34716403"
     CDS             complement(949158..951677)
                     /gene="VPH1"
                     /locus_tag="KLMA_40417"
                     /codon_start=1
                     /product="v-type proton ATPase subunit a"
                     /protein_id="XP_022676262.1"
                     /db_xref="GeneID:34716403"
                     /translation="MSEGVEKQEAVFRSADMSLVEMYIPQEIAREAVYSLGHTGLVQF
                     RDLNRKIKSFQRTFVGDIRRLDNVERQYRYLVSLLQKFDIPLYQENGLDENEESVGLG
                     SGSASLRVAPSTSVISDHVDNAAILETRMQQLVESSDGLEVKKSDLEQFRAVLLAADH
                     FFSVESDLSSLHNVTSQEEGLESGTSHASPLKACFVAGVIPRTKVGTLEQILWRAVRG
                     NLYFKHMELAEPFYDPKTKESVHKNAFIVFSHGDMIIQRIQKIAESLDASIYEVNESS
                     ELRSNQLKDVNSRLQDLYTVLNSTNMTLESELFAISKELDSWYRDISEEKAVYEVLNM
                     FAYDSSRKILTAEGWCPSDELTVLQNTLQDTCVRLGIASPAIVNVVETTRTPPTFHRT
                     NKFTQAFQDICDCYGIAAYQEANPGLATIVTFPFMFAIMFGDMGHGTLMAMAAAVLVL
                     NEKKIGNMKRGEIFDMAFSGRYIVLFMGLFSIYTGFIYNDMFSKSLTLFKSGWEWPES
                     WEVGESITARQVGVYAFGIDSAWHGTENALLFANSLKMKLSIIMGFIHMFYSYMYSLA
                     NDFYFNDMVDIFCNFIPGLLFLSSIFGYLVICIIYKWSKDWVGDGKPAPGLLNMLINM
                     FLSPGTIEDELYPGQAKVQVFLLLLALVCVPWLLLAKPLHFKYNQDKHEHQKLALSED
                     AEIVSNDQLQEYSGIDDEDDDDEAGHGHGENLGDVVIHQVIHTIEWCLNCVSHTASYL
                     RLWALSLAHAQLSTVLWTMTIQIAFSMTGVTGVVMTVVLFAMWFVLTCLILVVMEGTS
                     AMLHSLRLHWVESMSKFFKGEGIPYEPFKFVYVELEPESSS"
     gene            <952499..>953758
                     /gene="ERG12"
                     /locus_tag="KLMA_40418"
                     /db_xref="GeneID:34716404"
     mRNA            <952499..>953758
                     /gene="ERG12"
                     /locus_tag="KLMA_40418"
                     /product="mevalonate kinase"
                     /transcript_id="XM_022819726.1"
                     /db_xref="GeneID:34716404"
     CDS             952499..953758
                     /gene="ERG12"
                     /locus_tag="KLMA_40418"
                     /codon_start=1
                     /product="mevalonate kinase"
                     /protein_id="XP_022676263.1"
                     /db_xref="GeneID:34716404"
                     /translation="MTVLSAVPTPFIVSAPGKVIIFGEHSAVFNKNAIAASVSSLRTY
                     MLVEQLQEGDGVELNFPDINFDYRWSSEELKKIDISGVDEALTLDKLSSSLKAQLQEF
                     LTDLKGSLNYFAAFSFLYMYLCLCREVNGLKFTVKSTLPIGAGLGSSASISVCLALAM
                     ARMGGHISCENAISEQEKEFINRWSFIGECCIHGTPSGIDNAVATYGNAVKFQRQSDG
                     STKFDKIDNFPQLPMILINTKIKRSTKILVGGVGELVSRKPLVAEPILEAMDQVAIRG
                     SELLADVSKDIHYDELLELIRVNHGLLVAIGVSHPGLEVIKQLSDELKIGQTKLTGAG
                     GGGCAFTLLNKDVDHTSVREFHETLHEKYNYQIFETGLGGVGCCYVNVPKEKQKLLLS
                     IFANPVSTQEISLALLPSPDSELKWIS"
     gene            complement(<954061..>955044)
                     /gene="FSF1"
                     /locus_tag="KLMA_40419"
                     /db_xref="GeneID:34716405"
     mRNA            complement(<954061..>955044)
                     /gene="FSF1"
                     /locus_tag="KLMA_40419"
                     /product="probable mitochondrial transport protein FSF1"
                     /transcript_id="XM_022819727.1"
                     /db_xref="GeneID:34716405"
     CDS             complement(954061..955044)
                     /gene="FSF1"
                     /locus_tag="KLMA_40419"
                     /codon_start=1
                     /product="probable mitochondrial transport protein FSF1"
                     /protein_id="XP_022676264.1"
                     /db_xref="GeneID:34716405"
                     /translation="MASSVPGPIPLPESRYDLSSYWGRVRHCAEISDPSMLLTTNDDL
                     AQARKVISAYRHGELKETTPEFWRAKKQLDSTVHPDTGETVLLPFRMSCCVLSNLVVT
                     AGMLTPNLGTVGTMFWQWANQSLNVAVNSANANKSHPMSTSQLITNYTMAVTASCGVA
                     VGLNKLVPRLKNLTANTRMILGRLVPFAAVVSAGIVNVFLMRGSEIRKGISVYDSNGD
                     EVGKSKRAALFAVGETAFSRITNATPIMVIPPLILVRLQKTVLKGKSVAVQTAANLGV
                     ILVTSFIALPFALAVFPQYQSISVSKLEPELANKLDSNKKLIETVYFNRGI"
     gene            complement(<956548..>960429)
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_40420"
                     /db_xref="GeneID:34716406"
     mRNA            complement(<956548..>960429)
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_40420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819728.1"
                     /db_xref="GeneID:34716406"
     CDS             complement(956548..960429)
                     /gene="TY1B-DR6"
                     /locus_tag="KLMA_40420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676265.1"
                     /db_xref="GeneID:34716406"
                     /translation="MLDTGAQISVVTDLKLLHNYTSNITRNITAANMGTLNTMGEGIL
                     ILRLSNNVVVQFPAVYSEETPSNILSVMQLTAKQKITVDFYQRKMLVQDHNINIDIIH
                     RNGFYWLSSEYLVLNETNIHSPADDDSPVSISLCHIRENTVPKKKWSLEFIHNLLAHV
                     NIKQIRKSISNGDIRFIKLEDIDWSDMNSFTCQYCNIGKGKFHDHFTDSRDVYMKKFK
                     KFEYLHTDIMGPFREDNTIPPNYLITFSDEVTKYRWIFPMSLASEHQVSAIMRKLISN
                     IRTQQGVRVKEILMDQGSQYTGRMVRDLLDEFGIEGKYTSTGDKRSNGVAERLNRTLL
                     DDARTLLASANLPEFLWYDAAEFAVIVRNSMHMRKLDGSPNMAAGLGGIAINKILPFG
                     QPVVVYYNTGKKTLPRGKIVYALHPAKQSYGYTFYDPSSKQTMETTNYKIINTIQGDY
                     LNSEENLDTLNQVDDIVRQRSNDPSTDSQRHITHRNQREQDYISQERDPTDEPQQPES
                     DSTETHGNYLRTHKNEFQKGIATHTLGKDSRYPVRNSSDVPSQSPQEVQETLPVALSP
                     ASPPNNIFISQERLMEEEARSVKHPTKHVPAENGKRPAQRDELGVSTKRPNTKASPEQ
                     CSPIPEHLSHNDDTTDTSSLNEEERRSLYDKLSAKYRDSSIELQSTDSLYGGGGSDIG
                     DLSNPDKQIMGIISCTKTELKINDSKSDQNHEHQIDAIVNMLIQENPVQTYDNIKHEN
                     RVKIPLVNSLKMVRSLPNTKIDRSLSYSQAITKNSNHQEREAFKEAYDSEIAQLMRRG
                     TWDTTEVDIKSIEPHKLLNTMFIFTTKRDGRKKCRLVVRGDLQHWSTYEKHLESNTIH
                     HYALMTILSVALEENMIVKQLDITAAYLYADLKEELYIRTPPHMKMPNKAFRLRKSLY
                     GLKQSGANWYGTITSFLKERCGLKEDKIWSCVFTKEPPLSIIVCIFVDDIIVTGKDTQ
                     EIERFLEQLRSTYETKLVHDGKMGEDGTARYDILGLDLEYKRNGYMKFGMLDILSHKL
                     PLLNLPLREGSRYNQAPVSSSSEPPKVDKNLYVTEKDYKSNVKKLQQVVGLLSYVAHK
                     FRFEALYHVNVLAQYQLYPTDEVMKWANESVQYFWNTKEKRLVWTKNKTPVDYEFTII
                     SDASDRCEPEGKSRLGWFYEIYGHKISARSTKSSYVCDSSTGAEICAMKEATKFDFAI
                     SALLFTLTGKRPRVRLLSDNKPALGRITNPNSTVSPFKPTFTRTMELREKHNEGLCDF
                     TYIPTEQNVADILTKVLSAKRFNRLTNGWLI"
     gene            complement(<960488..>961414)
                     /locus_tag="KLMA_40421"
                     /db_xref="GeneID:34716407"
     mRNA            complement(<960488..>961414)
                     /locus_tag="KLMA_40421"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819730.1"
                     /db_xref="GeneID:34716407"
     CDS             complement(960488..961414)
                     /locus_tag="KLMA_40421"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676266.1"
                     /db_xref="GeneID:34716407"
                     /translation="MTQIQHGSAAFYDPEEYRKMFINSKGMFQTVNIKEVLPDEEPEG
                     MIKGKYMIIRGIPDSSAEHQIAITIVENEEMYQSWLIDLYRYLHRHNVDNAMTPKELK
                     LPKSLTANQRFWLRDVNEQCVHISKMPTWLEHELEGLYTSDDRLLNVLTYTRVKYDPE
                     RLYEEICGFRLQKYYKLENVERILQNFNERLELARLPSLEPLLVERAIEGMMVTKDRN
                     GRFHNFAHLEPRLTHIIAEIREKIADEKFYLHRNESMRTNDVGKKVHKPYNKFSNKPN
                     NNKNFTKKSNVKQSTPKVDDKNESKTVANLRH"
     gene            <961906..>963240
                     /gene="YTM1"
                     /locus_tag="KLMA_40422"
                     /db_xref="GeneID:34716408"
     mRNA            <961906..>963240
                     /gene="YTM1"
                     /locus_tag="KLMA_40422"
                     /product="ribosome biogenesis protein YTM1"
                     /transcript_id="XM_022819731.1"
                     /db_xref="GeneID:34716408"
     CDS             961906..963240
                     /gene="YTM1"
                     /locus_tag="KLMA_40422"
                     /codon_start=1
                     /product="ribosome biogenesis protein YTM1"
                     /protein_id="XP_022676267.1"
                     /db_xref="GeneID:34716408"
                     /translation="MSNDKSQVKLRFFTREEDETLHVNDTPIYAPVSLKRYGLSEIVN
                     HLLELPKSVPFDFLIDGELLRTSLQEYLTKKGLSSENFLNVEYTRAVLPPSYLSSFDN
                     EDWVSALDVGSNYIYSGSYDGIVRTYNLSGKVEKQYSGHSGPIRAVRYISNTRLVSAG
                     NDRTLRLWKTKNDDLKAIDEEEVEDGKTLAILEGHKAPIVSIDVSKDRILSASYDNAV
                     GLWSTNYKEMTVIDPMEDLGNNVSSAAKKRRKLTLKDGSIRRRAPLSLLESHSAPVEA
                     VLFDNLDQTVGYSVSQDHTIKTWDLITSKCVDTKTTSYSLLSIAQLPKLNLLACGSSA
                     RHITLHDPRVDSSSKITQQQLIGHKNFVVALDTCPENEYMLCSASHDGTVKVWDVRSN
                     SAMYTITREDKSVVKGVNDKVFDVKWAQGVGIISGGQDKKIQINKGDNIFSN"
     gene            complement(<963378..>964661)
                     /locus_tag="KLMA_40423"
                     /db_xref="GeneID:34716409"
     mRNA            complement(<963378..>964661)
                     /locus_tag="KLMA_40423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819732.1"
                     /db_xref="GeneID:34716409"
     CDS             complement(963378..964661)
                     /locus_tag="KLMA_40423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676268.1"
                     /db_xref="GeneID:34716409"
                     /translation="MESYSTLIVIIISLGMASLTRNKVFKNWLVSKIEKSINNLQIYP
                     SVSANFKLTESKYFTKQQSLKEIASSLVSLNEFKIRAVRQNAVIYHRATKLPNDLIEQ
                     LYAINYFHKISEVDKSIVLNYNTLSKVVEFTLKQLIINNEFNSTIESILKDTGYTWDN
                     DTKTLKHDSINSIQISKNSNQSRVNEAMCHIVRDWSDKFDIERKPLIDYIQKSLNNCQ
                     VDKDTLIIVPGSGCGRIAYEISLKFPQASVDSIEYSPLMYLCNEFVLGGTEEIDISPF
                     YQYYSGQQETKNQTRKYHINLNTFKKPDNLTVHFGDFCCYKPDKKYKNIVICSAFFID
                     TAENLFEYFSSIENLSKFSNMPLHWINIGPLKYGTKPLVQLTFGELTKLRNIRGWKDH
                     SNEVNIKDLNGYLTDYESLYQGFYGLVKFHSELKK"
     gene            complement(<965268..>967094)
                     /gene="TPO4"
                     /locus_tag="KLMA_40424"
                     /db_xref="GeneID:34716410"
     mRNA            complement(<965268..>967094)
                     /gene="TPO4"
                     /locus_tag="KLMA_40424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819733.1"
                     /db_xref="GeneID:34716410"
     CDS             complement(965268..967094)
                     /gene="TPO4"
                     /locus_tag="KLMA_40424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676269.1"
                     /db_xref="GeneID:34716410"
                     /translation="MSSSGSVADTKETKNDVLIDPKDLDWDGPDDLDNPHNWPAWKKW
                     YTTMTAAILCLVVTMGSSLFVTGVPDLVVRYGISQTLALSGLTFYLLGLSTVIGAPLS
                     EVFGRKPVYLFSLPLSMLFTMGVGLSNGHMRMILPLRFLSGVFGSPALSIASGTIVDI
                     FDIDEISVAMAFFCTAPFLGPVISPIIGGFATEKETWRWAVWIQLFAGGLIMPFIILM
                     PETNKTVLLIKRAKKRNLNIKKPSKEELRAFLKMTMTITVFRPIKMLFVEPIVLVFSI
                     YVAFIFAVLFGFFEAYPVIFRGVYRMSIGVSGLPFIGIGIGLWIGAVFYVWYDRRYFF
                     PKAPASIPDSPHPDSMRTSPTRGHRDEDGNLKPLTPEVFLNITKIGSIALPIGLFWLG
                     WTARESVHWMAPTAAGVPFGFGLILIFFSVIIYFSTSYPPLVVASAMAANNMLRYVVS
                     CVFPLFTVQMYNNLGIDWASSLFGFICIAMIPIPWLFERFGPKMRSISQFGFSVEDME
                     AQAEEDNEAQHSAIINRVVSNEEVITHKVRYEQEGKLAKDNNINNNSTEDAAEALTRV
                     TTYETTVSNESAERDNDQSNTHSNSLLIQPINENRDENSDKV"
     gene            <968590..>970002
                     /gene="DML1"
                     /locus_tag="KLMA_40425"
                     /db_xref="GeneID:34716411"
     mRNA            <968590..>970002
                     /gene="DML1"
                     /locus_tag="KLMA_40425"
                     /product="protein DML1"
                     /transcript_id="XM_022819734.1"
                     /db_xref="GeneID:34716411"
     CDS             968590..970002
                     /gene="DML1"
                     /locus_tag="KLMA_40425"
                     /codon_start=1
                     /product="protein DML1"
                     /protein_id="XP_022676270.1"
                     /db_xref="GeneID:34716411"
                     /translation="MQEIINVSLSHRSNHLISQFYNCLEPLLYDADHENDVFLNQSVD
                     KVNKTVSYTPRALLWDAKLGNGSLGTYQYVSENDHVDSLKREDDKNVLNTAQTVQTHD
                     RIRKSPYQLALDQGNAQLPKLNDDIAQYWSDYSKLIYDPSSFNLLQDWYHDSEHQSNA
                     PNFQNLHQVYFDKYEVGLEQFKERYSNDFFDNNLHLQLEKCDNLQGFNIVTEVDDAWG
                     GFAASLLMELKDELPKVSYFTYAWNKDDVVSLKEPIHSTKTKFQALCNKIRATISLVQ
                     ESDLFFPIYADSKKSFWQSTGETVLLFDSINSIFHGSRKHSSTDINVRKMSHLTDVLT
                     LGESKRNIVSKLNVDHYTSYSFYERLPYYKNSKGQSSFTFTECEIDRVCHDKATKFHF
                     NTYPWTNSDTVPESHRVCTEAILGVTEKSRDVFKTWEDLVSRYFRYDSDREELKDNLA
                     TISQEYEHGFYDDEDSGLDM"
     gene            <970252..>971529
                     /gene="miaA"
                     /locus_tag="KLMA_40426"
                     /db_xref="GeneID:34716412"
     mRNA            <970252..>971529
                     /gene="miaA"
                     /locus_tag="KLMA_40426"
                     /product="tRNA isopentenyltransferase"
                     /transcript_id="XM_022819735.1"
                     /db_xref="GeneID:34716412"
     CDS             970252..971529
                     /gene="miaA"
                     /locus_tag="KLMA_40426"
                     /codon_start=1
                     /product="tRNA isopentenyltransferase"
                     /protein_id="XP_022676271.1"
                     /db_xref="GeneID:34716412"
                     /translation="MIKKIIKDWIMPRPKVIVIAGTTGVGKSDLSIQIATKYNGEVIN
                     SDSMQMYKGIPVITNKHPIEERNGVKHHLMNHVSWDEEYYIHRFEQECTEAIQDIHSR
                     GKMPIIVGGTHYYLQTLFNKRVNERIRNPNAEETKILDSNDAKLVYDTLKSVDPTIAS
                     KFHINDIRRVKRMLEIYYTTGEKPSEAFEKQDTSLKYDTLFFWIYSKPEILDKRLDLR
                     VDKMMDLGALEEIKELYAYYKEHKFTAEKCENGVWQVIGFKEFLPWLNNPENCDFNAC
                     VEKMKIRTRQYAKRQVKWIKKMLMPDIDGKIYILDATDLEQWNVNVSQRASSIIEDFT
                     QGRSTKLPYAPEMLSSLLIHDSQNSPKLNADWKQYTCDICKDKDNKNLIAIGTKNWEI
                     HLKSRRHKANINKQHKKLNFEKWQKRKIEEVDH"
     gene            complement(<971531..>973483)
                     /gene="RIM20"
                     /locus_tag="KLMA_40427"
                     /db_xref="GeneID:34716413"
     mRNA            complement(<971531..>973483)
                     /gene="RIM20"
                     /locus_tag="KLMA_40427"
                     /product="pH-response regulator protein palA/RIM20"
                     /transcript_id="XM_022819736.1"
                     /db_xref="GeneID:34716413"
     CDS             complement(971531..973483)
                     /gene="RIM20"
                     /locus_tag="KLMA_40427"
                     /codon_start=1
                     /product="pH-response regulator protein palA/RIM20"
                     /protein_id="XP_022676272.1"
                     /db_xref="GeneID:34716413"
                     /translation="MADLFSIPFKRTLQFSLKDAISQVIDSKFYQTAASVTNDLILLE
                     KYRDILSHLDVSNEDLQELIKYYLSLKAISVKLPDDQIEFTWFNTLGLKSSGLTRNSL
                     KFEILNVLYNIGAMYSLLSVSNNLSSNDGLKESCRLFKLAAGCFQRIYDEEVKTGFTF
                     FDENTLQSLIHLMLAEAQEMVWKKAYFDDKERHSILSRLALQVSIFYEDASRYANRSP
                     LIRTDWIKGMSFKSKYYTAVSYYRSALLQLEKQNFAQAICDLTYALSILKKMTLNDSL
                     VEWKIDMQNLLETTERDNDLIYLQASVQKVSPIKPAVIVQPEFFKEIDMKDNEMFKNL
                     LPVDVIESCSAFSERVENYVNENITNPLKAMNKILLENISFSGVFESMYITEQEWDSY
                     EASLKDLNEIRNYITSKLKSLRNTINHEIDENEEMIRKHGQIRWKVESIDDGIRGYLS
                     DLERIENYALDGQRIDTETEHLFGTLDHDLVTNVTKAPESNNPVLKEVFSLLKQRKEH
                     IRVAERKIIENKLLPKIISYYKKTGSIDFEPVYQDYIRVFDEDLNTVQKEKAKNIEIL
                     SQISNGVQQQAKVSRVDPLTLYMEELKHSTRILSDVKQNITSGKKFYDDLVKAIQAKE
                     ERINDYIIKRKNERETMNRVLEEKMG"
     gene            complement(<973686..>975899)
                     /gene="EFR3"
                     /locus_tag="KLMA_40428"
                     /db_xref="GeneID:34716414"
     mRNA            complement(<973686..>975899)
                     /gene="EFR3"
                     /locus_tag="KLMA_40428"
                     /product="protein EFR3"
                     /transcript_id="XM_022819737.1"
                     /db_xref="GeneID:34716414"
     CDS             complement(973686..975899)
                     /gene="EFR3"
                     /locus_tag="KLMA_40428"
                     /codon_start=1
                     /product="protein EFR3"
                     /protein_id="XP_022676273.1"
                     /db_xref="GeneID:34716414"
                     /translation="MGFLFTPKHQKLVNQCYPPGRTPDKKPKSSETSYLLYYVNSRRP
                     KLEKVSTYLVKKSNTDLNRKRSGNVSVTLELLAKIVDNCSENMNIFIKDFINIMIKVL
                     NNNNFNNDPTIVGLIERVLFAICSNLDGSLVSGDSEFLELFKNFVTLYFNVASSRVND
                     TDLVLKGCLDFSKISNLGTIHQWSATAKNCVTIALEQFQQRHPAYAGATIDSVQSEPE
                     TQSLTKKPTITQTKSLGLDDVTDTSDYSILVLNAFFNTTETDKLTLSMHSLIESLLKT
                     PNKELLQFICNGIPVQLRYIVILLFVRQLSSNSEENMIVILKLISSLLTSGVSIIGLS
                     VIDILRKLLTVQLAKADSPLIVKQISVSIKDLNRKTYYKQQSYDMLSELSFKFIENQK
                     AHHEDILKLDLDALFSTTGEECLDLDLYVDILPFVTNKEKLCSLLSQDTPHQVSFIRF
                     FEKLSSLSKSDIELAISSCFKKYKGACLLSGLVYYLNHSQSSADYYIYHRYAAQFLEL
                     ADYQSQVDYKQSHREVFTKEDLLNYYSDSGSNVYSEKGRDILLLDDHSNSNDVSPVNG
                     KTSELSPIALPQINFPSSNMNGTVFRKQSPAHDIHSIRSLKRNATPKVKYLKTLVDNQ
                     KKNETATKSLRGSQSVKSKVTNITFLLDELNNDTHDIKITDPDDEDVIGMEKEDLVRS
                     YSLRMSTIQSATSRNSRSFIPSAEVQKTEAPVDDFKDAQEDIEVSSSTRGRLFMA"
     gene            <976563..>978179
                     /gene="CEF1"
                     /locus_tag="KLMA_40429"
                     /db_xref="GeneID:34716415"
     mRNA            <976563..>978179
                     /gene="CEF1"
                     /locus_tag="KLMA_40429"
                     /product="pre-mRNA-splicing factor CEF1"
                     /transcript_id="XM_022819738.1"
                     /db_xref="GeneID:34716415"
     CDS             976563..978179
                     /gene="CEF1"
                     /locus_tag="KLMA_40429"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CEF1"
                     /protein_id="XP_022676274.1"
                     /db_xref="GeneID:34716415"
                     /translation="MAPVPIYVKGGIWTNLEDQILKAAVQKYGTHAWSKVASLLQKKN
                     ARQCQSRWNEFLNPALNFTPFDVKEDEKLLDLAKRIPNQWRTIAEIMGRPAQTCIDRY
                     NILLSVDKNKDGLETQMQVGEINPNNESLPAKEDKKELEDEEREMLAEARARLLNTQG
                     KKATRKIRERMLEESKRIAFLQKRRELKQAGVDSKIKAPKKKYESQLDYNEDIAYEQR
                     PLPGIYDTSKEDERTELLLRKFENLVEQKGVFDRKNNERPKELHKRKQEKQLTPVSIK
                     VSESTNSVLTNEYKKPKLQLSAPKVKLQSKSISKKKSIIYLFESLPPPKNDFEIELDD
                     STVEDGDEDEKNNEYVNNINSESEVQTENKLQPAPSDKDHQQIVPKISSITEQAREDN
                     TDNNFDGRITGNVVKSPHQNRKSIHEYLESILSSTSAVEVPESLHPKLEEHLQSTSID
                     TENEIIRMQNRITELRLTLEESVKPERDSISRLSLQLQNTLKPAVSGLAYQYYIDYMK
                     YTRDYHLMAEEKERLEDNLELTKISGDVSV"
     gene            <978425..>979732
                     /gene="DBP8"
                     /locus_tag="KLMA_40430"
                     /db_xref="GeneID:34716416"
     mRNA            <978425..>979732
                     /gene="DBP8"
                     /locus_tag="KLMA_40430"
                     /product="ATP-dependent RNA helicase DBP8"
                     /transcript_id="XM_022819739.1"
                     /db_xref="GeneID:34716416"
     CDS             978425..979732
                     /gene="DBP8"
                     /locus_tag="KLMA_40430"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DBP8"
                     /protein_id="XP_022676275.1"
                     /db_xref="GeneID:34716416"
                     /translation="MSNPEFRSLGCSKWLAEALNAMKIIQPTAIQKACIPEILKGRDC
                     IGGAKTGSGKTIAFAAPMLTKWSEDPQGMFGIVLTPTRELAMQIAEQFTALGSAMNIR
                     VALVVGGESIVQQAIELQKRPHFIIATPGRLAHHILNSGEDTVGGLKRVKYLVLDEAD
                     ILLTETFSKDLAKCVGILPPKSKRQTLLFTATMTDQVKALAEAPQIEGKLPVFSFQVE
                     SVDDVAIPKTLKTTYLLVPEHVKESYLYQILTSENYVNSSCIIFVNRTVTAEILRRTL
                     KALDIRVTSLHSQMPQQERTNSLHRFRAQAARVLIATDVASRGLDIPVVELVVNYDIP
                     GNPDTFIHRAGRTARAGRQGESLCLVTEKDIQRIEAIEDRINKKMEEFTDVGDTAVIR
                     KSLSKVTTAKRESLMAMDKEGFGERRKMQKRKEENKGKSHRRS"
     gene            <980002..>980586
                     /gene="NOP19"
                     /locus_tag="KLMA_40431"
                     /db_xref="GeneID:34716417"
     mRNA            <980002..>980586
                     /gene="NOP19"
                     /locus_tag="KLMA_40431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819741.1"
                     /db_xref="GeneID:34716417"
     CDS             980002..980586
                     /gene="NOP19"
                     /locus_tag="KLMA_40431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676276.1"
                     /db_xref="GeneID:34716417"
                     /translation="MSRSQEIKEKQALLAKFQHGFGNSTSKVLEWIDGSSSVQEQENK
                     SKDDFFQLPVIQIGSGLSFNDTQDINDTDIHTIGEFIKGDKKVSSLAKKKRTNKDIQE
                     RNSVHRVRKDDSQAMVSLKNKIRNQQRQKIRNELPKDKKGSNNVNDKKQSQMQLQPSV
                     DAESSSDDEADIKEQKHSKKKTGLLLFTGKKSKR"
     gene            <980824..>982371
                     /gene="NMD3"
                     /locus_tag="KLMA_40432"
                     /db_xref="GeneID:34716418"
     mRNA            <980824..>982371
                     /gene="NMD3"
                     /locus_tag="KLMA_40432"
                     /product="60S ribosomal export protein NMD3"
                     /transcript_id="XM_022819742.1"
                     /db_xref="GeneID:34716418"
     CDS             980824..982371
                     /gene="NMD3"
                     /locus_tag="KLMA_40432"
                     /codon_start=1
                     /product="60S ribosomal export protein NMD3"
                     /protein_id="XP_022676277.1"
                     /db_xref="GeneID:34716418"
                     /translation="MNYTPLDQNHMQHQHATVLCCSCGVPMDGSSGLVMCYDCIKMNV
                     DITEGIPREANVSFCRNCERFLQPPSQWIRASLESRELLALCLRRLKGLNKVRLVDAS
                     FIWTEPHSRRIRVKLTVQGEAMANTIIQQTFEVEYVVVAMQCPDCARSYTTNTWRANV
                     QIRQKVPHKRTFLYLEQLILKHNAHVDTISISEAKDGLDFFYSQKNHAVKMIDFLNAV
                     VPIKCRKSEELISQDIHTGSSTYKFTFSVEIVPICRDDLVVLPKKLAKSLGNICQFVL
                     CSKVTNSIQFLDPTTLQTCDLSASVYWREPFSALAEVSQLTEFIVLDVEPTGQVRNKW
                     VLADVTVARASDLGQNDQTYYVRTHLGGIIHPGDSVMGYFIANSNYNSELFDALNNDY
                     VPDVVLVKKLYQRKTKKNRKWKLKRMAREHKDIEASQDYTSRQQKQEMERAERDYEVF
                     LQELEEDEEMRQTINLYKSKTTAEHEAEMDEDEDEDAPQIDIDELLDELDEMTLEDQQ
                     QENEAGI"
     gene            <982689..>984509
                     /gene="ATG7"
                     /locus_tag="KLMA_40433"
                     /db_xref="GeneID:34716419"
     mRNA            <982689..>984509
                     /gene="ATG7"
                     /locus_tag="KLMA_40433"
                     /product="autophagy-related protein 7"
                     /transcript_id="XM_022819743.1"
                     /db_xref="GeneID:34716419"
     CDS             982689..984509
                     /gene="ATG7"
                     /locus_tag="KLMA_40433"
                     /codon_start=1
                     /product="autophagy-related protein 7"
                     /protein_id="XP_022676278.1"
                     /db_xref="GeneID:34716419"
                     /translation="MVSDLKFAPSFQSFVDSSFFHELSRLKLDIFKLDSDEKALYTQL
                     DLNQFTSNVLAISLRDDSFQKPDNDEHNIILKGYLLNFNTIELFKNCNKIQFIKEKGQ
                     ELLQRGLENDLNEIISFYMISFADLKKYKFYYWICMPSFQSDGATYQIISSKVIASDS
                     DISVSFIKQNVIIACVISGVIQKATPDNLKVCEKVVFKDFSHLKDIPSAVTKNILTVW
                     SKLSPRETYTICFLRSDESSFEAEIIINNGNNPSLKVSGWEKNGLGKLAPKSIDLSSL
                     MDPVKIADQAVDLNLKLMKWRIAPKIDLDGIRNTKALLLGSGTLGCYVSRVLLAWGVR
                     HISFVDNSTVSFSNPVRQSLYNFEDCGKPKAQIASEALKRIFPSVESSGYQLEIPMIG
                     HPVTNEKKQRQDYEALEDLIKSHDVIFLLMDARETRWLPSVLGRLHNKIVINAALGFD
                     SYLVMRHGNDDDKLGCYFCNDILAPSDSLTDRTLDQMCTVTRPGVALLAASQAVELLV
                     TYLQPTPNVLGTSPHQIRGFLNEFKTVSQSTPEYEHCCAGNKSVISALQENGWNFVRQ
                     ALDDYKCVEKLSGLSKVQEEAELALEEDFDFSEDDEFVTG"
     gene            <984903..>986441
                     /gene="GCN5"
                     /locus_tag="KLMA_40434"
                     /db_xref="GeneID:34716420"
     mRNA            <984903..>986441
                     /gene="GCN5"
                     /locus_tag="KLMA_40434"
                     /product="histone acetyltransferase GCN5"
                     /transcript_id="XM_022819744.1"
                     /db_xref="GeneID:34716420"
     CDS             984903..986441
                     /gene="GCN5"
                     /locus_tag="KLMA_40434"
                     /codon_start=1
                     /product="histone acetyltransferase GCN5"
                     /protein_id="XP_022676279.1"
                     /db_xref="GeneID:34716420"
                     /translation="MPVKRRYTGQGRSQTKRGKNGKIKDTIKPKVEQEETPEIEESPS
                     VLDPADDTSKAADANDEEQEAKEPPENNEDVESVKEGSDSVNENDSEKADVKEEENTG
                     SSVTNDNKEKEESKLEEKQLEKEADEKADAQPIAENEVVDEEAGITKFDFDGQEYSYK
                     DRPSVMEEKEGKIEFRVVNNDNSKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSH
                     LSMAVVRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRAT
                     SPIKYFLTYADNYAIGYFKKQGFTKEITLDKNIWMGYIKDYEGGTLMQCSMLPRIRYL
                     DAAKILLLQEAAIQRKIRSISKSHIVRPGLKQFEDLTNIKPIDPMTIPGLKEAGWTPE
                     MDELAQRPKRGPHYAAMQNLLTELQNHAAAWPFLQPVNKEQVPDYYEFIKEPMDLSSM
                     EMKLNGNRYEKMENFIYDARLIFKNCRAYNGENTSYYKYANRLEKFFNSKVKEIPEYA
                     HLVD"
     gene            complement(<986802..>987605)
                     /gene="PUP2"
                     /locus_tag="KLMA_40435"
                     /db_xref="GeneID:34716421"
     mRNA            complement(<986802..>987605)
                     /gene="PUP2"
                     /locus_tag="KLMA_40435"
                     /product="proteasome component PUP2"
                     /transcript_id="XM_022819745.1"
                     /db_xref="GeneID:34716421"
     CDS             complement(986802..987605)
                     /gene="PUP2"
                     /locus_tag="KLMA_40435"
                     /codon_start=1
                     /product="proteasome component PUP2"
                     /protein_id="XP_022676280.1"
                     /db_xref="GeneID:34716421"
                     /translation="MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNE
                     GIVLGVEKRVTSALLESDSIEKIVEVDTHIGCAMSGLTADARSMLEHARVNAVTHELY
                     YDEKITVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIGGYDDEQGFQLYHAEP
                     SGTFYRYNAKAIGSGSEGAQSELQNEWHSSLTLKEAESLVLKILKQVMEEKLDENNAQ
                     LSSITKEGFKIYSDEQTAEIIKEVKEKEAAEAQEAARANTQGSDVEMEG"
     gene            <988443..>989822
                     /gene="ERG4"
                     /locus_tag="KLMA_40436"
                     /db_xref="GeneID:34716422"
     mRNA            <988443..>989822
                     /gene="ERG4"
                     /locus_tag="KLMA_40436"
                     /product="delta(24(24(1)))-sterol reductase"
                     /transcript_id="XM_022819746.1"
                     /db_xref="GeneID:34716422"
     CDS             988443..989822
                     /gene="ERG4"
                     /locus_tag="KLMA_40436"
                     /codon_start=1
                     /product="delta(24(24(1)))-sterol reductase"
                     /protein_id="XP_022676281.1"
                     /db_xref="GeneID:34716422"
                     /translation="MSSKPQRKSHLPQGKYLKPEEIEYEFGGVPGVFGMLIGFPALMY
                     YMWISAKFYNGAAAWPAEGESWGQFLCHLGQLIRDNATPSCYAWKIFLTFWVAQMVFY
                     YTLPGVWTKGQPLDHLNGKQLPYYCNAMWTFYVSNIIVLALHYSGVFKLYTILEMFGE
                     IMTCAIISGFSFSIFLYLFTLFVTKDYHRMTGSHIYDFFMGAPLNPRIGYLDLKMFFE
                     VRIPWYTLYFLTLGACLKQYEDYGYVSPQLGLVFLAHWLYANACSKGEELIVPTWDMA
                     YEKFGFMLIFWNIAGVPYTYCHCTLFLYYHDPSEYQWSTAYNVSLYITLLIAYYFFDT
                     TNGQKNSFRKQMAGDLTVRKTFPFLPRQVLKNPKYMVTENGSYLLIDGWYKLARKIHY
                     TADWTQSLVWGLACGFESPFPWFFPVFFFVVLLHRALRDDAKCKKKYGKDWEKYCKEC
                     PYLFIPYVF"
     gene            <990272..>990778
                     /locus_tag="KLMA_40437"
                     /db_xref="GeneID:34716423"
     mRNA            <990272..>990778
                     /locus_tag="KLMA_40437"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819747.1"
                     /db_xref="GeneID:34716423"
     CDS             990272..990778
                     /locus_tag="KLMA_40437"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676282.1"
                     /db_xref="GeneID:34716423"
                     /translation="MVNQLLKEFFGPKRLYFVCGKVYQDMHYANRIVHWYTQHRLPVI
                     PVNPKGGEIDLSVDSVSRRVAGDTRLPIARTIKEGLDNYKGKKDIDGISVSFVTPPPV
                     TLSILKELKDVGTPVISVWFQPGSWNTECVDYATADLKIPEGNVINDCILINGHSNYV
                     KSELVADL"
     gene            complement(<990944..>991561)
                     /locus_tag="KLMA_40438"
                     /db_xref="GeneID:34716424"
     mRNA            complement(<990944..>991561)
                     /locus_tag="KLMA_40438"
                     /product="membrane-associated progesterone receptor"
                     /transcript_id="XM_022819748.1"
                     /db_xref="GeneID:34716424"
     CDS             complement(990944..991561)
                     /locus_tag="KLMA_40438"
                     /codon_start=1
                     /product="membrane-associated progesterone receptor"
                     /protein_id="XP_022676283.1"
                     /db_xref="GeneID:34716424"
                     /translation="MQQDSKRRARDGEEYYDEEVDGRFGVVDWLRVGFGVVLASQIVA
                     KCVFGHWWSLSGVTPFGGGRHEATIKPLPAPYWGLHGYSLPHVFSLEELARFSGEKYV
                     DGEGEKLSPIVLSINGTVFDVTSSPRFYGPWGPYRKFTGTDCSNNFQFGMFDYHHAYN
                     TPCHWNITDFTEDQLAKVRGWYEFFTTKYPIVGTIQFPPAENAAG"
     gene            <993212..>996550
                     /gene="Fbxl7"
                     /locus_tag="KLMA_40439"
                     /db_xref="GeneID:34716425"
     mRNA            join(<993212..995858,996048..>996550)
                     /gene="Fbxl7"
                     /locus_tag="KLMA_40439"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819749.1"
                     /db_xref="GeneID:34716425"
     CDS             join(993212..995858,996048..996550)
                     /gene="Fbxl7"
                     /locus_tag="KLMA_40439"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676284.1"
                     /db_xref="GeneID:34716425"
                     /translation="MFKTRVPKRRSNLSNVVKSQRSSRVKVGERFSEKKSKHEQSEGA
                     QKIDSAVSGSVNSTDKGPISSHPEESRPGSHSNSASDSDSDSDSEPSSNSSSDSDSDY
                     DDSSLSQNQIKDGIPAAFLERLMSFSLFNNAPELFYIAIARKLKLLVYHPHEFVVKAG
                     EPALAMYWILRGSVNVTSPDGEIVHAELVEGSYFGEIGILFNRPRTATVISKTKVLLG
                     VLTAETFNQVLLHFPQIERQIRDEAQERLATQEKQRKAGVSKIIHDNDFIVRQRSPTC
                     ITNDQSIQPIYSSPGSYSDTAISSVTNSTVIFPLQQESSDKLLEERILPPQLPERNDS
                     SSPTNQSLGNPIYTETIDDTISTRQFLKSLPLFTALPANAIHELALSVEIKQVPPFEY
                     VFKKNDIGEDIYFIISGEVEVLGPSTSKIFPGKNVPMPSHKIIDVVLARLGPGQYFGE
                     MGFLSSITDDVKQKSKCKRSAGIRTVSNCTLLVLTGDTLRDFCAKFPETETQIKQTAE
                     ERMKKNVEMRKNNDTEYQTNSSHPDSAALISPISQKGYINLLNDQTRKIQSQPLVTVD
                     SLLSQTSESSLDLYNEPNNKSLFKSNFSFDNQSQKETSMQQIRKPASPTFTPVSGIGA
                     SLSAASSGSLLGENSIKSDEVLQQQPLELHVPPLNGALKRRASAFATRSPSPMQYMGH
                     LKRARLSNIGGGPSRRRSSVLSVGPLPDRLLLRCFQYIPLPELMKLRLVCRRWRQLLY
                     VAPGLFDKLDLTPWSTSIDDKALHKITDFVGSRSKYIDISNCFHVTDEGFSYMVNEIG
                     IGGCIKSLKMTSCWEISAMAIMDIAVPSIGKFLEEINLSNCRKVRDDVIQRLLGWDVA
                     EVAPSSVASSHNNQIGSLYPLDEPIPDVGFSYWSYQMFPKLKTLIISECIFLTDNSIR
                     SILNSCPNLAYLNVSFCCSLTDTAIELICVGGQNLEQLDISFCGRAVSDISLLNISMH
                     LRKLEQISLKGCLRVTRSGVDSLLGGYAPLKRIDISQCKNAHIYQGGVQATLFKTSSG
                     SKSVFLTMEDSSRCVEVII"
     gene            complement(<996733..>997776)
                     /gene="VMA6"
                     /locus_tag="KLMA_40440"
                     /db_xref="GeneID:34716426"
     mRNA            complement(<996733..>997776)
                     /gene="VMA6"
                     /locus_tag="KLMA_40440"
                     /product="v-type proton ATPase subunit d"
                     /transcript_id="XM_022819750.1"
                     /db_xref="GeneID:34716426"
     CDS             complement(996733..997776)
                     /gene="VMA6"
                     /locus_tag="KLMA_40440"
                     /codon_start=1
                     /product="v-type proton ATPase subunit d"
                     /protein_id="XP_022676285.1"
                     /db_xref="GeneID:34716426"
                     /translation="MEGVFFNVDNGFIEGVVRGYRNGLLTGSQYINLTQCDTLEDLKL
                     QLASTDYGNFLSNVSSDALTTTVIQERAADKLYQEFQYVRDQSSGVTKKFMDFITYGY
                     MIDNVALMITGTIHDRDKAEILGRCHPLGWFETLPTLTVATDLESLYDTVLVDTPLAT
                     YFRDCFDDADELDDLNIEIIRNKLYCAYLQDFYDFVSTEIDEPARENLKELLEFEADR
                     RAINISLNSLQSSDIINSDLKRDLLPKLGKLYPVASEQLATHGQDFESVRQIVDTVHT
                     YRGIFENGNLEDHFYKLEMELCRDAFTQQFTVSTIWAWMKSREQEVRNITWIAECIAQ
                     NQKSKINNYISVY"
     gene            <998412..>999668
                     /gene="COG8"
                     /locus_tag="KLMA_40441"
                     /db_xref="GeneID:34716427"
     mRNA            <998412..>999668
                     /gene="COG8"
                     /locus_tag="KLMA_40441"
                     /product="conserved oligomeric Golgi complex component"
                     /transcript_id="XM_022819752.1"
                     /db_xref="GeneID:34716427"
     CDS             998412..999668
                     /gene="COG8"
                     /locus_tag="KLMA_40441"
                     /codon_start=1
                     /product="conserved oligomeric Golgi complex component"
                     /protein_id="XP_022676286.1"
                     /db_xref="GeneID:34716427"
                     /translation="MDSLVGEVIGTNDKEAIEFAIGILRERDSYDDYFTSEPLPGSII
                     EDIAEYNAEISKLERTLKSELTKEKGNLLDILLSSNWNSTLAEISTQIDQLWELHRDE
                     EDEDGGDINEPSNDKTPNSSTESDDAFHEALDKLRHLHLTERDTSLVQVLNNIDKIND
                     ILELPTLISTCIRTGHYQEALMLYSYSKNLEKKFPNVELIRIVVKRIQEVISTRMLNG
                     LVKLLSTNLTLSSMKKILSYLEALDPLDTNPTALQQLLLTMRYKFVTEEIDSYHIADD
                     TGKSVKEMLIKRKIECVREHVYGTIAVFNSLFQSETKAIYIPLLIVDQQDEPSTTDSA
                     VETSLPLLKFINECSNFLIQHLSLHKQYLTESVCLQLVYCSFRLCDANQNFHHLFINK
                     LLESSLFTKEALNLAIAKRLELAARY"
     gene            <1000282..>1004751
                     /gene="TCB3"
                     /locus_tag="KLMA_40442"
                     /db_xref="GeneID:34716428"
     mRNA            <1000282..>1004751
                     /gene="TCB3"
                     /locus_tag="KLMA_40442"
                     /product="tricalbin-3"
                     /transcript_id="XM_022819753.1"
                     /db_xref="GeneID:34716428"
     CDS             1000282..1004751
                     /gene="TCB3"
                     /locus_tag="KLMA_40442"
                     /codon_start=1
                     /product="tricalbin-3"
                     /protein_id="XP_022676287.1"
                     /db_xref="GeneID:34716428"
                     /translation="MGQVDPRTDKPLPVGTSSPGTAASPEKNPLLQAKEEAKTKASKD
                     EKPSQLKEHETNETENKVPDVIPATAAQENVDLPPPNEEGAVGTVPVEKINPEKLKRA
                     PPRKQNKLETSIDTAKYQADQQKIGSLEKEFEKENPDYLFPWYSVGGFDANKSSSKQL
                     KNTRVVKSYVVENYYNDWYCNTVGVVGTCFFAWLLSYLNFSWWSLGFVFFCTASVYRS
                     EFRRFNRNLRDDFKRVVVHETLSEKTESSLWLNSFLSKFWVIYMPMLSKQVKAAVNPQ
                     LAGAAPGYGIDALSLDEFTLGSKAPAIDAIKSYTKKGDKTVEMDWTFSFTPNDESNMT
                     SNQVKSKINPKISLGVTVGKGIVSKTLPILVEDINVAGTARITLKFGDVFPNIKTVSV
                     SMLEPPLIDFALKPVGGDTLGLDIMSFLPGLKTFVKSMINSNAGPMLYAPNHFDVDVE
                     EIMAAQSNDAIGVVAVTIDSAADLKTTDFLSTSVDPYIKFEAEKGIIGNDSNIRTAIK
                     SDNKNPRWNETKYLLVNTLDQKLTFNCFDFNDVRKDALIGSFDFDLSDLYQKPAQEHL
                     TRDLLSKGKSRGVLNYSINWFPVIKNEDDDDVSEEKSDIDTKELDSEDDDKEKEASDS
                     DVGIFKFTLHNVKYLNKASALTGFLSPFAELYLDGKKVKTYRTLRRINEPSWEESIEV
                     LVPSVSKSEIALKVFDQQLTGDMLLAEYSAPMEDVISLSEQAQTYVKASPQGEIYISS
                     SWKPVAMTGAFNVSDKIREPLGALRLHLKEAVIHESDLSGVGDIDPFVTVTSNKSMFY
                     RTNYFSDTKTPIFNSVVYVPITSENQSITINLVDYQKMSKDRHLGSYHFSASKLIKKD
                     PKTQRFIASFNGEEQIKCSLLNRKGRVMRSYINVGCSVVSTIPVYYPHELPEVEKLEE
                     NLKKKREEFEAEQAELKKQMDSNPKEYEMIEVEDKFEKDMQRINRKEKMSFEELIKTN
                     SGTCSFQIIDSSFTRPSVYLQILYDDVSYPALTSQKSKSGKIPVEFGSFFVRDLKNSI
                     MTFRLSKKPIVKEKDDIISEQTVSTFDLLKKGLTEASTVSIKDGSKIKVRFYFNPSVS
                     KLPPSETVTDTGILQTTFVSAENVLASDRNGKSDPMIIVKIDGGKVFQSSVVKKTLNP
                     VWNEKAKILVPSRSRSDVLVQVYDWDRAVSNDLLGEVKWDVQDLVPNKETTLSFNLKP
                     QGTLHVKATFVPKYIPPTVEVTEGNLAKKTVGNVANLGVGAVSGVAQVGSGVAGAGVG
                     AVSGGLSKGGRLLKGISGIKSRSADSKDVNEDEHSVTSDVTNFGFDPSVPNTSYAPVR
                     PQTAPTASTKEASSIQGPPGAIHKRNVSGTSNHSRATIPGSHSGKVTIVGAENLGKSV
                     QVRVSITQGGRMKHLHRTHERKSDDKGTCHFDETVNFKATGDAVIVFGAVAHHTFSKD
                     TELGVSQISLSDPQLHQDGQIGLRLGNGHIIFKIKYPLDGEVPPTPQIPEKYK"
     gene            <1006109..>1006720
                     /gene="RPL6B"
                     /locus_tag="KLMA_40443"
                     /db_xref="GeneID:34716429"
     mRNA            <1006109..>1006720
                     /gene="RPL6B"
                     /locus_tag="KLMA_40443"
                     /product="60S ribosomal protein L6-B"
                     /transcript_id="XM_022819754.1"
                     /db_xref="GeneID:34716429"
     CDS             1006109..1006720
                     /gene="RPL6B"
                     /locus_tag="KLMA_40443"
                     /codon_start=1
                     /product="60S ribosomal protein L6-B"
                     /protein_id="XP_022676288.1"
                     /db_xref="GeneID:34716429"
                     /translation="MLLFSDFLTHLEFFLLTSFDNFVLKLCLFVQAQKWYPAEEVPAP
                     KQTRKAARPQKLRASLVPGTVLILLAGRFRGKRVVYLKHLEDNTLLVSGPFKVNGVPL
                     RRVNARYVIATSTRISLEGVNVEKFNVAYFAREKLSRKQRAEANFFNEDQPKKEIKAE
                     RIEDQKNIDKALLAEIKKTPLLKQYLAATFSLKSGDKPHLLKF"
     gene            <1007216..>1008469
                     /gene="FPR3"
                     /locus_tag="KLMA_40444"
                     /db_xref="GeneID:34716430"
     mRNA            <1007216..>1008469
                     /gene="FPR3"
                     /locus_tag="KLMA_40444"
                     /product="FK506-binding protein 3"
                     /transcript_id="XM_022819755.1"
                     /db_xref="GeneID:34716430"
     CDS             1007216..1008469
                     /gene="FPR3"
                     /locus_tag="KLMA_40444"
                     /codon_start=1
                     /product="FK506-binding protein 3"
                     /protein_id="XP_022676289.1"
                     /db_xref="GeneID:34716430"
                     /translation="MSDLLPLAAYNLNIEPYTPTPAIDVTTPVTVRITMAAIDPEALD
                     DEANPSTLRIIKRNPDFDDEDDADALLGDYDEDELDVSEEEEEEEEEEEKPKDKKSKS
                     KSKSKSKKEESEDELEDESDEDDEEGDEDDEFQEFVLATLSPKTQYQQSLDLVIAPEE
                     EVQFIVTGSYRVSLTGNFVKHPFDTPDYDEDDSEEGEESYDEDEDDYLTPDEDADLEE
                     LEEASDIEAKIQELVEKEQSKSKKNNKRKQPEPEEEEEEEEQEAPAPVEETKKAKKAK
                     KEKKVEFKKDLEEGPTPAKKEEKKEKKEKPKTKVLEGGIIVEDRVVGTGKACKKGSKV
                     GMRYIGKLKNGKVFDKNTSGKPFVFNLGRGEVIKGWDIGVAGMAVGGERRIVIPAPYA
                     YGKQALPGIPANSELTFDVKLVSLK"
     gene            <1009886..>1013107
                     /gene="HMG1"
                     /locus_tag="KLMA_40445"
                     /db_xref="GeneID:34716431"
     mRNA            <1009886..>1013107
                     /gene="HMG1"
                     /locus_tag="KLMA_40445"
                     /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase
                     1"
                     /transcript_id="XM_022819756.1"
                     /db_xref="GeneID:34716431"
     CDS             1009886..1013107
                     /gene="HMG1"
                     /locus_tag="KLMA_40445"
                     /codon_start=1
                     /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase
                     1"
                     /protein_id="XP_022676290.1"
                     /db_xref="GeneID:34716431"
                     /translation="MPVLFKQFKHMAKPFAYVARFSAKHPIHVILVTLLFAATTYLSV
                     IEYYFNGWTIENKTVSYHGSNSANSLKHDSLHFHYTPKDSQWSALSEEDFEKMKYQST
                     PLAHYYLLGFEFHSDNESLVLPEIEGNVYEEGSIKYLLTDEPVISKTLKSKDDTTWTL
                     RAHRHKLLDVKAGVLALYKELEERINSAEPFDIFIVGSAYVAMVYTLISLFLDMRVTG
                     SKFWIALAAIINSGSAFFMALYTSQKIYHRPVTALSLIEGLPFVIVVVGFKDKIKLAK
                     YVVDQFKRFDVSQKVTTYQVVYDAMIQEGGRLVQDHLLCVIAFGGCSIYASSLSALSN
                     FCFFCGLLLAYDLILTSSFFAAVLALKLEISIIHKATTIKQTLEEDGVVPSTAGIISK
                     SETLKKNRVLKSSSSLLVGKLLFVTGFIGFNLYNFGTRWTYETFSSLYSKSHTNELPA
                     FVTSIIAKENSEAVVSLVPPQFYEPAKTYFQVEDGVLSLIRYISVAIRDRFVSKVLIF
                     ALIMSASINVYLLNAARIHTELTANDIQKKRAAKLVPKPYSNHNEKQSPSSSASNETK
                     VETVTERMPVVASIQHEIDTESDSDNGSSEVRPVEELVDVLKSGDVKSLSNREVVSLV
                     VANKLPLYALEKQLGDTTRAVVVRRKALAILADAPVLATERLPYKNYDYNRVFGACCE
                     NVIGYMPLPVGVIGPLMIDGVYYHIPMATTEGCLVASAMRGCKAINSGGGVTTVLTKD
                     GMTRGPCVRFPSLKRAGACKIWLDSEEGQNKIKKAFNSTSRFARLQHVQTALAGDLLF
                     IRFRTTTGDAMGMNMISKGVEFSLHQMVEEYGWKDMEIVSVSGNYCMDKKPAAINWIE
                     GRGKSVVAEANIPGDVVRKVLKSDVKALVDLNISKNLIGSAMAGSIGGFNAHASNLVT
                     AVYLALGQDPAQNVESSNCMTLMKEVDGDLRISVSMPSIEVGTIGGGTILEPQSAMLD
                     LLGVRGPHPTEPGKNARQLAKIVASAVMAGELSLCSALAAGHLVQSHMVHNRAKQPVA
                     TGAGAPVSGPGPVSTPAIATNGKELSAEQLKTLKEGSVICIKS"
     gene            <1014815..>1015300
                     /locus_tag="KLMA_40446"
                     /db_xref="GeneID:34716432"
     mRNA            <1014815..>1015300
                     /locus_tag="KLMA_40446"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022819757.1"
                     /db_xref="GeneID:34716432"
     CDS             1014815..1015300
                     /locus_tag="KLMA_40446"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022676291.1"
                     /db_xref="GeneID:34716432"
                     /translation="MFDSAVVLPSLALPGFGFGFGFGFGFGFGFGFGFGFGFARPCDA
                     GQTQAQRSDCVAPSRALSPSAARLRLPVCSSEPPHTKKKKIIPKTKRKTKTHTHTHTQ
                     PKPNSGPPYLFTKPVRCNYALLAILASGVAGNHSLLPAPYCRITRLSEFNYLLQTVYL
                     K"
     gene            <1015968..>1019006
                     /gene="WAR1"
                     /locus_tag="KLMA_40447"
                     /db_xref="GeneID:34716433"
     mRNA            <1015968..>1019006
                     /gene="WAR1"
                     /locus_tag="KLMA_40447"
                     /product="weak acid resistance protein 1"
                     /transcript_id="XM_022819758.1"
                     /db_xref="GeneID:34716433"
     CDS             1015968..1019006
                     /gene="WAR1"
                     /locus_tag="KLMA_40447"
                     /note="intron"
                     /codon_start=1
                     /product="weak acid resistance protein 1"
                     /protein_id="XP_022676292.1"
                     /db_xref="GeneID:34716433"
                     /translation="MAEVRQQSLPQTQQQPCASSPASDSTASTCGGGGGSGSGTSFAQ
                     MSLVDQQRHHPQVFLLGISADDPRHFKPMSKERKADGKTKRNTFACITCHSMKQKCNP
                     GNPNDIYRHPCVRCAKLNKLCQFDLSKRRRKKKKKKRLENDGDDVSGIRADPGASNMK
                     LASDGAPVIARTTTDVGTKDIAEKDADHHSPGSVLSPQQHNGPGAASAAAAAAAAAVS
                     LVGSISAPLPFHGAQQNYHHQTATAGSDSMAGGFVHGYPHTRHNAYANMDAHKTPGMD
                     HSLKMKQVFGAHSSTLNGQLSAPAGWQFASPVINQRQRLLPKPWLEADLKRLEHNSAN
                     NGNNNTTNNHNHNHNHNNSHVQAHNQFQHNIDVPHNSIHHRDSNSNAPITLGQHFSTT
                     NHALGADQYHNSQIQNRYNNTLSPVSTGNGINVHPDINNLPKDQTLKFISPTIPSIHD
                     YMGENGENKSLAQDLRNASPVDLKSPALPLKSSQINDYELEITNLLSWQKGALELISE
                     KLSSQAAAWDDIVQTSSSVPLYTDPLALGLISEQDALYHLKLYRETMSKKFHLPLVKI
                     PDDVTIDQLRKNQPILFSTILSVVSLIIPASHKSKCDRLKLDNFALSLICHHGMRLGS
                     KRPELIRSLLVLCLWYNFSEWNNQTRYHFFNYICCSAIREFDLNGNSRLMGMMDSSQQ
                     VPVSDKREPEHDDDFYRMVLVIYVSGLNISIFLRQPIQLRWSPKFDSFCEGLLKGQYP
                     SKVYGFDSDQIFVVFSRINYCLELIHTHIQLTSGLMENTYITFDTEKFIDKMKITLDG
                     LAPQIAPDRHRMWTFFHSVYVYLYESILIEFFQSRTMEDKFEMTEIPKDVEDAFIKCT
                     ERCLITFQHFFELTPHLIASMPLFHVTRIIYVLGVLLLKVRFGVMTISAIHHLKPMTD
                     SCGDIVRKMCELLEETSALYPHNTFVVKLRYMCALFSQTYATNLRKYLERQNRNSDIE
                     RNNLFQSGDVSSFFVDSMILENSINSLNEQFWTDMLTNLL"
     gene            complement(<1019001..>1019557)
                     /gene="BET5"
                     /locus_tag="KLMA_40448"
                     /db_xref="GeneID:34716434"
     mRNA            complement(join(<1019001..1019404,1019524..>1019557))
                     /gene="BET5"
                     /locus_tag="KLMA_40448"
                     /product="transport protein particle 18 kDa subunit"
                     /transcript_id="XM_022819759.1"
                     /db_xref="GeneID:34716434"
     CDS             complement(join(1019001..1019404,1019524..1019557))
                     /gene="BET5"
                     /locus_tag="KLMA_40448"
                     /codon_start=1
                     /product="transport protein particle 18 kDa subunit"
                     /protein_id="XP_022676293.1"
                     /db_xref="GeneID:34716434"
                     /translation="MIYSLWIFDRHCNCIFDKEYTLNHSTPIVNSKTQQSRGKLIYGM
                     IHSLRSMSVKMAPGNTLRTISTGKYRIHALFTASNLWIVIFSDLTHHELHERLDKIYE
                     LYLKYVVHNMLKPIDFKKAEEDGETAKITNTSFIKAVDQVLCL"
     gene            complement(<1019881..>1021107)
                     /gene="ENT3"
                     /locus_tag="KLMA_40449"
                     /db_xref="GeneID:34716435"
     mRNA            complement(<1019881..>1021107)
                     /gene="ENT3"
                     /locus_tag="KLMA_40449"
                     /product="epsin-3"
                     /transcript_id="XM_022819760.1"
                     /db_xref="GeneID:34716435"
     CDS             complement(1019881..1021107)
                     /gene="ENT3"
                     /locus_tag="KLMA_40449"
                     /codon_start=1
                     /product="epsin-3"
                     /protein_id="XP_022676294.1"
                     /db_xref="GeneID:34716435"
                     /translation="MSLEDSITKLSLYDAKKYFRKAQNVVFNYTEMEAKVREATNNEP
                     WGASSTLMEKIAQGTYNYREREEILGMIFRRFTEKTASEWRQIYKALQLLEYLIKHGS
                     ERFIDDVRNNLNLVKMLESFHYIDSQGRDQGINVRNRASQLVKLLESDEMIRQERKKA
                     RETMKKYKGVAGGIVPGMGANVNSRAGYTRSTNQGISVSADFDSDDDDGYQKPQPYGL
                     DNGNSKSSYNPNEEYEPRQSEGSSDLLDIQENEGAKNKKQDQQTNSQAAAAAADIDDD
                     DDEDFAEFQSATPSAPVSNRLDDLVFSNDNSFATPSHPHAPATAVTPAIAEAAKASDP
                     FGSLFSSAKKEPFKTTVTASTTGKTETASNPVAHSDDADLFGDLQPAPNSQKSNGNHQ
                     QPATQNHSEEIDLLSF"
     gene            complement(<1021577..>1022278)
                     /locus_tag="KLMA_40450"
                     /db_xref="GeneID:34716436"
     mRNA            complement(<1021577..>1022278)
                     /locus_tag="KLMA_40450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819761.1"
                     /db_xref="GeneID:34716436"
     CDS             complement(1021577..1022278)
                     /locus_tag="KLMA_40450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676295.1"
                     /db_xref="GeneID:34716436"
                     /translation="MSRDSMTPVPRLRSRSSASAGSSGSLSLKRSVKNFMGKIVRTVK
                     NVAHEALNDSDTECEQITVNNMFLEPECVGNLLHADDEDANHDNRLSSNSETLADGFS
                     TENNVETSGEGEENSQDFLSFDPVQEVAKLRQEDQLKKADSVDTFSRGPEVWEKRRKL
                     WLTVTPSNTLESAKKARESFADISPKKYGVIYKRLVMEDAHLKKNLNLQDVVKVINAG
                     WVETSKWERAAQGIA"
     gene            complement(<1022852..>1023718)
                     /gene="RXT3"
                     /locus_tag="KLMA_40451"
                     /db_xref="GeneID:34716437"
     mRNA            complement(<1022852..>1023718)
                     /gene="RXT3"
                     /locus_tag="KLMA_40451"
                     /product="transcriptional regulatory protein RXT3"
                     /transcript_id="XM_022819763.1"
                     /db_xref="GeneID:34716437"
     CDS             complement(1022852..1023718)
                     /gene="RXT3"
                     /locus_tag="KLMA_40451"
                     /codon_start=1
                     /product="transcriptional regulatory protein RXT3"
                     /protein_id="XP_022676296.1"
                     /db_xref="GeneID:34716437"
                     /translation="MSDELYRQTQNRIYSMQETLLNSSRESRTAVAAVTAADETENTT
                     SPEVSTLSAVSGRKGAEGQKGGHSGVEVSSKSVLEYTAKNYAQQRCNLGTLEYDPMRV
                     GRFAQGKPSTESLPFPYNFKSISSPRPFIPRLSHDQINSICTIMIDYTYLRQVERGEN
                     IRYQNREIWGTDIYTDDSDIILALQHCGVLSGQHPPGSRRTPANLSNPDSVKGAIPER
                     DIPFAIKVDILLLPPLQSYASTTRYDITSREWSAQVHDGLSFGIFHIEILVMDDTLNN
                     IDHAARARHLQW"
     gene            <1024701..>1025473
                     /gene="RPL31"
                     /locus_tag="KLMA_40452"
                     /db_xref="GeneID:34716438"
     mRNA            join(<1024701..1024757,1025186..>1025473)
                     /gene="RPL31"
                     /locus_tag="KLMA_40452"
                     /product="60S ribosomal protein L31-A"
                     /transcript_id="XM_022819764.1"
                     /db_xref="GeneID:34716438"
     CDS             join(1024701..1024757,1025186..1025473)
                     /gene="RPL31"
                     /locus_tag="KLMA_40452"
                     /codon_start=1
                     /product="60S ribosomal protein L31-A"
                     /protein_id="XP_022676297.1"
                     /db_xref="GeneID:34716438"
                     /translation="MAGLKDVVTREYTINMHKRLHGVSFKKRAPKAVKEIKKFAKLHM
                     GTDDVRLDPKLNQEIWKRGIKGVPFRLRLRISRRRNEEEDAKNPLFSYVEPVVVASAK
                     GLQTVVVDEDEA"
     gene            complement(<1026537..>1027598)
                     /gene="DUS4"
                     /locus_tag="KLMA_40453"
                     /db_xref="GeneID:34716439"
     mRNA            complement(<1026537..>1027598)
                     /gene="DUS4"
                     /locus_tag="KLMA_40453"
                     /product="tRNA-dihydrouridine synthase 4"
                     /transcript_id="XM_022819765.1"
                     /db_xref="GeneID:34716439"
     CDS             complement(1026537..1027598)
                     /gene="DUS4"
                     /locus_tag="KLMA_40453"
                     /codon_start=1
                     /product="tRNA-dihydrouridine synthase 4"
                     /protein_id="XP_022676298.1"
                     /db_xref="GeneID:34716439"
                     /translation="MMSSCSVRIPPPKELSKSNDPLHIIKSRLETHNRPATIAGPMVR
                     YSKLAFRQTCRHYDVDIVYTPMILAREFVRNGHARMADFTTCRDDTPLIVQVGVNNVA
                     DLLKFTEMVYPYCDGIGINCGCPIREQVREGIGSALIYNGELLCNMVKAVKEKYGDKV
                     RLETKIRIHDNIAETVTLCNNLCEAGVDWITVHGRTRTTRSSVPVNLDAIKYIKENIK
                     NKEVPLVANGDCFSLEDFQHIHEYTNVEGVMAVRGLLANPALFAGHEKCPWGTIELFF
                     HYAMEFGGLPYQLLQHHLYTMMENMGIEKPMLKELMEIKNLAHLVDWLDDNFDFKRKG
                     DPGFAEAVDIPFRSSQPKI"
     gene            complement(<1028120..>1030144)
                     /gene="BRE1"
                     /locus_tag="KLMA_40454"
                     /db_xref="GeneID:34716440"
     mRNA            complement(<1028120..>1030144)
                     /gene="BRE1"
                     /locus_tag="KLMA_40454"
                     /product="E3 ubiquitin-protein ligase BRE1"
                     /transcript_id="XM_022819766.1"
                     /db_xref="GeneID:34716440"
     CDS             complement(1028120..1030144)
                     /gene="BRE1"
                     /locus_tag="KLMA_40454"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase BRE1"
                     /protein_id="XP_022676299.1"
                     /db_xref="GeneID:34716440"
                     /translation="MDEHIAKKPKLELSDASEPLTQRDVIAFQKEALFRCLNQWRSKA
                     NCLAEENEVLQGKIEEAMESAAGCGSTLVAVAQALLDSCSDDEDRQLLQRIISESEGD
                     SRAFVHTAAENSSRICQLILKSAGGSGGTASGAASERLQELEKLKLKLQGLLSASESK
                     LKKTTEYYEGLLSKYDRQDSETVSRVFNSADDDNGSVKKEKNQSENAAGSSGGVDQKK
                     GSAANEEQRTVSEVEHEMQINDLKSQIAVLEATVKDLKEWKEQNLKELSQLRQSAAAL
                     RPDSAQSNAQEAASANAAAATAASGGNEKISSLMKQNEDLQRINEAYMTKFQQLSSDR
                     EIFTNKLTSEFHAAQDALKKHNSSLEKDLVRIRTIRDELLAKVSLLEAQKGKSEMIDD
                     LEKLLKIQEEQLTRVESRSNESTSQDALMKELQDLEKAFKEVSRISNKKYATYLNQES
                     VLSKLTVEKTKASEKYFAAMRSKDAIMIENKNLSKNLNKSNELIVQLKELEKTLQQKI
                     ESLHKQLNVSQENEKRLKDSNKETSMKIAELTSDNNKLKKSAERLESENKQLIGAKTE
                     LESVVKDKDIENKQLRIKVSNAEAKSKKLYKTLLSNGGDSGALAEELENFRTIIYCSL
                     CSKNWKNTSLKTCGHVFCESCCKERLAARMRKCPTCNKPFSSNDLLTIHL"
     gene            <1031493..>1034600
                     /locus_tag="KLMA_40455"
                     /db_xref="GeneID:34716441"
     mRNA            <1031493..>1034600
                     /locus_tag="KLMA_40455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819767.1"
                     /db_xref="GeneID:34716441"
     CDS             1031493..1034600
                     /locus_tag="KLMA_40455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676300.1"
                     /db_xref="GeneID:34716441"
                     /translation="MDTGRRGVQLLNSLNKFISLTASSATIGHGPDHGFSVSQLKAVA
                     NFIRLNVLSPLRRLEPDISIPISREDEQHHLGELSNDVLVQWWLTLLNFLNSGLISDT
                     TSNTSLAMDAVSVSLECISRIITITVPKVNSPDREREIYSYHLLLTVRWVTNRLVLNS
                     RRKSELESRNFQQQQQQQQQQQQQQQQKQNAMLALQFAKQYTAVLIPLIGKIIAFAFC
                     FLDDELHYDVEVVKTLSKNRFDIVDISSETLLPWRTKQVVVIEDDAQQQSQYTRELIN
                     KFNNVELNEPMSQETKKVFPIMISYLQNSQVQTIFLFHYWFNVLNAHSELGLKHLEIE
                     KFPGFALILHFCCNTLKQDLDKLSKFIKIEDKQGKHEAALLKTTPNSNPNQINVSHEK
                     IINFIFTKFQGVRIIECYRSLMGYFYNTRIEKTLLIELFNLQEKTFLASSSSISAYDS
                     WMANIIFNVLFQFQVFHFDTLPEILESFSWNSWINGIFGTLKTYNVDSQLVGLLCLFN
                     TWQSIPLVYRKRIAGALIGEFWDMLSIDTDFHIVNILFHKLLIFKVLADENISKIYHE
                     AIKTKLFSINKEVLCIINAFDYDYTQLVDEKTVLFFHTNNRLILERQEPLYEDDLLLM
                     SNLKHTEGNMGNANNTLLFTNMSRMSNIRPGVVICKGKHPFDISDELVSRAALMVAQK
                     NKTKRENERNRSSISSSTSSLNSDTSETDDSKKEGGLKFGFGALLSSFNNNIKSKPDT
                     PPKPTQRNSNRNSIASTSTTDTYETHEMLSMYSTVSSVASNSSRSESSEDLLYKLSQQ
                     TRSHIMNNNDSPASKKHKLLAPVETKYTRDIVTKPPIRFIFKTVSVNSQLTQKKNMLD
                     KIQGFNKKWGVKVVNRYDKPLPDPLGMASDTLIDGFDFDSLSPTIEELQQLNLVENSV
                     SNIYEHDSSQERRQQGGAMEPPQIDISQLFPDDTFMNLTDVLNSTSYDIEKNKPISKV
                     ERMKLITKLTKLIKVIHTFNLTMKEYTEFKKVNGNNLVYMELDPGFHQNHSLNKGLIA
                     IASYK"
     gene            complement(<1034878..>1035582)
                     /locus_tag="KLMA_40456"
                     /db_xref="GeneID:34716442"
     mRNA            complement(<1034878..>1035582)
                     /locus_tag="KLMA_40456"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819768.1"
                     /db_xref="GeneID:34716442"
     CDS             complement(1034878..1035582)
                     /locus_tag="KLMA_40456"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676301.1"
                     /db_xref="GeneID:34716442"
                     /translation="MKINLSIPLQAARWFSYLLFLISVEVILVFPLANLLWIDFINRL
                     IPNSTMHLIPLSNMLNSWTIPFDFSVIANSTSIIESDTMVRSDIPLEITINLGIYCTS
                     QKPIESAVLTIDNKSQRLALTCFQNVDFLSTRFTGFDSVSKTIKKDMINEFKFEFPVN
                     PDKKKIHIQLSDYTENHLLDHINAQFSVKYTGFRKFLLKWRITCHIFGTLIFASLISA
                     CFLLSFTVAFGYIYVS"
     gene            complement(<1036448..>1038550)
                     /gene="SFP1"
                     /locus_tag="KLMA_40457"
                     /db_xref="GeneID:34716443"
     mRNA            complement(<1036448..>1038550)
                     /gene="SFP1"
                     /locus_tag="KLMA_40457"
                     /product="zinc finger protein SFP1"
                     /transcript_id="XM_022819769.1"
                     /db_xref="GeneID:34716443"
     CDS             complement(1036448..1038550)
                     /gene="SFP1"
                     /locus_tag="KLMA_40457"
                     /codon_start=1
                     /product="zinc finger protein SFP1"
                     /protein_id="XP_022676302.1"
                     /db_xref="GeneID:34716443"
                     /translation="MEITATTTTTTAAMPASTSAGNSRSNSGVIGGSVSHPGSVPGIF
                     ISDGQGQAQTQAQAQAQAQNQGQGQQGLAPQQMAKLRRDSIAHSQGIGGVSWGSLTIS
                     SWLRDEVMIHSQTYAKDHALSGSHNSKSFPINVGKHGSGAAAAGINVPNTAGTKSPLD
                     LTKFASPPGSSGAYLPNLEKQYCKDYSCCGQLLPSLHDLLRHYEEAHIATSPGGHGHG
                     HGHVIGNAHHHHNNNNNNNNSINSHMHGQHQHQNQQHQQNHHSQQNHHQSGMVGVNMN
                     FSLQTATNHSTSAGASPSNSTNSHSNSNSAAAAANSGNQHSNLHSHLHQHNATMSPHS
                     SHGNMRSEGKHDQFDPNSVSYQQQRIQQQQLGGADSQNHGMGSRRLDPRSQQINNNLS
                     QSKVPQRSQLNNSSSNASLSTLSQTVQASASTGQIHLNGGFVDAVSTNEVFLQSKHNQ
                     PSSTRNISNFNSYSTKSHQTMSQPAAKRSLPLGTGLDLDYMETGVMGGLHENSLGGVM
                     GFGSMDSISHTVPLTNANQHGLQKKSKKLANAHLKSKGLGRQDSGSGLLVDHGSGVVV
                     DDDVDDAVDDDDDDDDDDDNVSSNRKQQGYIDDPARRLYVMDHEEHKPFKCPVIGCDK
                     TYKNQNGLKYHKLHGHQNQKLHENPDGTFSIIDPESNEPYPDGMGMENDKPYRCEVCG
                     KRYKNLNGLKYHRGHSTH"
     gene            <1039942..>1041999
                     /gene="DUS3"
                     /locus_tag="KLMA_40458"
                     /db_xref="GeneID:34716444"
     mRNA            <1039942..>1041999
                     /gene="DUS3"
                     /locus_tag="KLMA_40458"
                     /product="tRNA-dihydrouridine synthase 3"
                     /transcript_id="XM_022819770.1"
                     /db_xref="GeneID:34716444"
     CDS             1039942..1041999
                     /gene="DUS3"
                     /locus_tag="KLMA_40458"
                     /codon_start=1
                     /product="tRNA-dihydrouridine synthase 3"
                     /protein_id="XP_022676303.1"
                     /db_xref="GeneID:34716444"
                     /translation="MSAAKRPASDADASSASSSAPKKIDSKGVAQLKPEYIVLNDQPS
                     TVQYDDEESSSSRLDLDAQQNGNGKGKKNKKSKQRGQNKNRDNRQAREQNALCSKFVC
                     NVNATCPFGDKCRYVHDVKQYLEHKAPEIKSEYFPVCPVWQSLGYCPMGYKCCFLSSH
                     CNLETLELNEVQDPDTKQKLYDANHEINHIDGERKYDLIKKRFPFTKSEHILEIIDAM
                     QQENRDSMAEAEAGAKARAKARSAAQQDAETPAPTEAGEAPAAEAPAAEASQPQLSPQ
                     ALEQKSKADRKRERQRELYLQYRDTRYFAQEKRKLDLHHKKIVSPLTTVGNLPYRRLM
                     RKLGADVTYSEMALAVPLIQGTNSEWALPKAHCTEFPGFGVQIACSKTWQAAKAAEAI
                     AANISGVSEINLNSGCPIDLLYRQGSGSALLDNPARMIRCLNGMNYVSNDIPVTVKIR
                     TGTREGHPIALSITKRLVMETDVAAITLHGRTRQQRYTKLADWDYVGEVANAVRTYEA
                     EKQENKELRDGQKLQFVGNGDCNNWEDWYKHLENENIDSVMVARGALIKPWIFEEVDA
                     KQYLDKSSTERLEILKDYAQFAMDHWGTDQFGISQCRRFFCEFMSFFHRYVPMGICER
                     YPVLLNERPPNWKGRDDLETLLGSADSNDWIKLSELFFGKVNDEFVFTPKHKSNSFAP
                     TTN"
     gene            complement(<1042152..>1042781)
                     /gene="YET3"
                     /locus_tag="KLMA_40459"
                     /db_xref="GeneID:34716445"
     mRNA            complement(<1042152..>1042781)
                     /gene="YET3"
                     /locus_tag="KLMA_40459"
                     /product="endoplasmic reticulum transmembrane protein 3"
                     /transcript_id="XM_022819771.1"
                     /db_xref="GeneID:34716445"
     CDS             complement(1042152..1042781)
                     /gene="YET3"
                     /locus_tag="KLMA_40459"
                     /codon_start=1
                     /product="endoplasmic reticulum transmembrane protein 3"
                     /protein_id="XP_022676304.1"
                     /db_xref="GeneID:34716445"
                     /translation="MFNHFKCSFQVYIYDQESNRDLKVLSTPESMSLYHGLVYAILVV
                     ELITLTLLGLPLPLVLKKPVIKALSKPLLSSTVQITIKCVLGFILLLFVDSMNRVYGI
                     ESELDRMKESGVGTYPHGKTEILSRKFFWQRNMYLTGITLFLTFLLTRVATLVWELFD
                     MKDAYETTLKTKQDELPPKQKSLAKEIADIDEEIARLKEQSTALQEQMK"
     gene            <1044657..>1046762
                     /gene="BDF1"
                     /locus_tag="KLMA_40460"
                     /db_xref="GeneID:34716446"
     mRNA            <1044657..>1046762
                     /gene="BDF1"
                     /locus_tag="KLMA_40460"
                     /product="bromodomain-containing factor 1"
                     /transcript_id="XM_022819772.1"
                     /db_xref="GeneID:34716446"
     CDS             1044657..1046762
                     /gene="BDF1"
                     /locus_tag="KLMA_40460"
                     /codon_start=1
                     /product="bromodomain-containing factor 1"
                     /protein_id="XP_022676305.1"
                     /db_xref="GeneID:34716446"
                     /translation="MQMAETRDLKEVPSEHATVVDMKPSGGNVAVNGNSAGGVGDMKA
                     EGGATAVGAAVVATPAATPEAVPEETVPEEQPVSTEAEPTAAAAAEPVAGIETPADAP
                     VDTPAEATAEEARTEAPTEPKPEENMVPAPAPPQEPDMNNLPQNPMPAHQKKHALTAI
                     KAVKRLKDAKPFLKPVDIVALNIPLYYNYIPRPMDLSTIERKLNVDAYETPEQVTDDF
                     NLMVNNCIKFNGDKSVIAQMARNIQASFEKHMLNMPSKDAPPQQQKRTKANPDQPVVI
                     RRAPSQSGRPKREIHPPKTKDIYPYESNKPKSKKHQMEMKFCQQVLKELLSKKYSSFN
                     YPFLEPVDPVALNCPTYFDFVKEPMDLGTIQKKLNNWEYQTAEEFEHDVRLVFKNCYA
                     FNPEGTIVNMMGHRLEDVFNSRWADRPVIPDEESADEGGESDDGYESEEASEEEQIDE
                     TQITNPAIQYLEQQLERMKIELQQLKKQELERIRKERRAARGASKSKRRGKTGTKRKA
                     AGNGKSAASSASSGGKRRKKNPLKAVVTYDMKRTISERIGDLPESKLEKAVDIIRKSM
                     PEIGADDEVELDIEQLDENTILTLYNTFFRKYDSANNGYAGVDDGVLSVSSETDLRHS
                     SLSPNSTKSKGKRRRSKALSEEEQNNQIQQIKNKLASFNANSPMSPNTLNALAHQHHQ
                     QHSNESSSEDDMSSESEEE"
     gene            <1047414..>1048802
                     /gene="GNT1-A"
                     /locus_tag="KLMA_40461"
                     /db_xref="GeneID:34716447"
     mRNA            <1047414..>1048802
                     /gene="GNT1-A"
                     /locus_tag="KLMA_40461"
                     /product="glucose N-acetyltransferase 1-A"
                     /transcript_id="XM_022819774.1"
                     /db_xref="GeneID:34716447"
     CDS             1047414..1048802
                     /gene="GNT1-A"
                     /locus_tag="KLMA_40461"
                     /codon_start=1
                     /product="glucose N-acetyltransferase 1-A"
                     /protein_id="XP_022676306.1"
                     /db_xref="GeneID:34716447"
                     /translation="MGFGSKRKLKLLLGALFATCLISVFTTYGSDSLPESIKFPIDTS
                     WASEQLKGLKSSFGKKTSTTYDPSNIKQIPYSAIEKLYDYELNSVSNIDWSHYAYVNY
                     AADENYLCSSIIHFNRLLETATQAKLVLLVAKELTELSPDHPVSKMLAGFKALSENCI
                     VEPVDTITITDDSSEWSKSLTKLHVFGLTEFERVVYFDSDALITNNLDELFFLPDYVQ
                     FAAPATYWFLKDSEIPALVEETKKVSASLNVTSDLYLIEQKLSEKIANGEEIYNDLPN
                     LPKSLYPKSENADFESEDNTYFKFSSTLMVIKPEQSQYESLVNEIIPKYTNGTKKYDM
                     DLINIEFYDFNKTVEDQINLSKQIMQGFKPTMLVLPYDKYTVITRTLQDENYQQLLHN
                     GILGYETSDKSKGPVSAKYYHFSDHPTKKPWNYKKISDVSCAKKAPEDSCKVWLNLFA
                     NYFDERAKYCVT"
     gene            <1049346..>1050341
                     /gene="YEA4"
                     /locus_tag="KLMA_40462"
                     /db_xref="GeneID:34716448"
     mRNA            <1049346..>1050341
                     /gene="YEA4"
                     /locus_tag="KLMA_40462"
                     /product="UDP-N-acetylglucosamine transporter YEA4"
                     /transcript_id="XM_022819775.1"
                     /db_xref="GeneID:34716448"
     CDS             1049346..1050341
                     /gene="YEA4"
                     /locus_tag="KLMA_40462"
                     /codon_start=1
                     /product="UDP-N-acetylglucosamine transporter YEA4"
                     /protein_id="XP_022676307.1"
                     /db_xref="GeneID:34716448"
                     /translation="MSVVLALVLVLGGCCSNVISFEHILQGSSINLGNVVTFSQFLSV
                     TVMQLPSVFTVVSQPPFLIIRRRKIPLKIHCLAVLLFFMSSVANNSVFKFDISVPLHI
                     TIRCSGTALTMLIGWAVCNKRFSKLEVFSAIIMTLGAIVTLLYRDKEFSLDTLNSASK
                     NSGLTKKSAIGVLLMLFATALMALLSLLNEWTYKRYGKHWRETLFYSHSLALLLFIPG
                     IPRLKEEFKDLTVFSNVIQVPFLKQPISTKLGMLFVNNMTQFVCVNGVNMLASQTDAL
                     TLSVALLTRKFISILLSAYIYKSVMSKTAYLSTTLVLFGASLYSYASKKRSAPLT"
     gene            <1050724..>1054521
                     /gene="SKI2"
                     /locus_tag="KLMA_40463"
                     /db_xref="GeneID:34716449"
     mRNA            <1050724..>1054521
                     /gene="SKI2"
                     /locus_tag="KLMA_40463"
                     /product="antiviral helicase SKI2"
                     /transcript_id="XM_022819776.1"
                     /db_xref="GeneID:34716449"
     CDS             1050724..1054521
                     /gene="SKI2"
                     /locus_tag="KLMA_40463"
                     /codon_start=1
                     /product="antiviral helicase SKI2"
                     /protein_id="XP_022676308.1"
                     /db_xref="GeneID:34716449"
                     /translation="MTTSSFSTATDLFESLNGLDISDIHEFEDKIITPKGYSQAIEEV
                     EISNRFLHTSNVLDWNLLDLLQPMPNSNTLQVPSDLNEKNQERNDFIPLSMISCPEPV
                     SRTQYHFHRVGIEGEISTYEEKVNIEDVLNANSANSLSLTRKINPNGDLIRGTTNQLP
                     FTPGGLDKDVVETGSDSVVANNEAGTKLLSRDEFGLFNIPPGLERGITPNIETNNQTT
                     QKELEEIDRLSKLENDEQNKQEIQKLRDLEHDKISSSAVVDESLGTSEIDELLPVDLN
                     FGRHIRKLNKSSDRVEWAHMVDLNSNMDNFNDLVPNPARTWPFELDTFQKEAVYHLEQ
                     GDSVFVAAHTSAGKTVVAEYAIAMSKRNMTKTIYTSPIKALSNQKFRDFKEDFDDIDV
                     GLITGDVQINPEADCLIMTTEILRSMLYRGADLIRDVEFVIFDEVHYVNDQMRGVVWE
                     EVIIMLPQHVKFILLSATVPNTFEFANWIGRTKQKNIYVISTPKRPVPLEINIWTKKK
                     LIPVINDKREFLPRGFREHKDLLTDSVVSGSDPRSQQKNGKPSGNQKTITKGSKGVGA
                     KGSNKSSFFKYDGPTKATWYNLLKHLKANDLLPAVVFVFSKKRCEEYADAVEGADLLN
                     AKERSAIHIFIEKSISRLRKDDRELPQILKIRSLLSRGIAVHHGGLLPIVKELIEILF
                     AKGFVKLLFATETFAMGLNLPTRTVVFSEISKHDGEKKRNLLPGEFTQMAGRAGRRGK
                     DKTGTVIVMSYSRPLDEASFKEVTLGIPTRLQSQFRLTYNMILNLLRIEALRVEEMIK
                     FSFSENSKETLKPEQENMIKELQAKVDLIDISKYSEEDIKEYESAYNLISGYSQTCVD
                     IMTEIDETRTIGKRLSVGRFIIFRDKNGNPVAGFVFKSNPPKGTCVVLKLTRPMLLGS
                     ESVNHLPSLFFFANYCSSHLSTWNSIKGCLDLEIQEISIFDIEVISKFIFSDVNGKFI
                     NSTSEEQRKLACEFLFSVSRRVQKTKDLTLASTPSLKVQQSVLQIQKIVADLHRLRVV
                     EDETFGKKFEPFYKRFELQKEIKNIYHMMSEQNLSLLPDYESRLSVLKETGFIDYNNN
                     VLLKGRVACEINTGYELVLTELILDNFLGDFEPEEIVALLSAFVYEGRTREEEPPVIT
                     PRLAKGKEKIKEIYSKMQEVSERYQIPATQEEAEFLEKKRFALLNVIYEWARGLSFKE
                     IMEMSVEAEGTIVRVISRLDEVCREVRNAAVIIGNSVLHQKMTQAQELIKRDIVFAAS
                     LYL"
     gene            complement(<1054567..>1055181)
                     /locus_tag="KLMA_40464"
                     /db_xref="GeneID:34716450"
     mRNA            complement(<1054567..>1055181)
                     /locus_tag="KLMA_40464"
                     /product="beta tubulin"
                     /transcript_id="XM_022819777.1"
                     /db_xref="GeneID:34716450"
     CDS             complement(1054567..1055181)
                     /locus_tag="KLMA_40464"
                     /note="autoregulation binding site"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_022676309.1"
                     /db_xref="GeneID:34716450"
                     /translation="MRDIVMLRNTVLSATPCIRTLANIARTRGSLPKRNQQEDDERIS
                     CILNVLNATKYELILPPISQLRKCLYVSKSSRFKIDSRFYGFARLELEGSTLLKSEFI
                     ATKSQLNVMNMRKNMTSLQKAFMTNHRTREVLSRFLRTKGVKKLARFPLPHYELSSNA
                     ITRMDLSVFYTVVACLAHCNEKMVMSELIQNEITKPAIRKLFRL"
     gene            <1055442..>1057778
                     /gene="AFG2"
                     /locus_tag="KLMA_40465"
                     /db_xref="GeneID:34716451"
     mRNA            <1055442..>1057778
                     /gene="AFG2"
                     /locus_tag="KLMA_40465"
                     /product="ATPase family protein"
                     /transcript_id="XM_022819778.1"
                     /db_xref="GeneID:34716451"
     CDS             1055442..1057778
                     /gene="AFG2"
                     /locus_tag="KLMA_40465"
                     /codon_start=1
                     /product="ATPase family protein"
                     /protein_id="XP_022676310.1"
                     /db_xref="GeneID:34716451"
                     /translation="MAVKGSSSGSKKKSSSSSGSAEESSKSKFKLPKEYIVRPCTNEV
                     ANNAEAIVEIDTEVMEALELKNDSFCIVSKPGENGIVAICKASKDESVLNNVIKVSKP
                     LRSVGSLLLGDRLEIRKLQKQPVYLESVTVGSLQGIELPSDGLIAQTLDKCGLLMPGM
                     IFRSVELDKDTIVDLIINDINDNSSDLPDMSKLNISDKPTSMDNVSNCYLSPPGLFNK
                     KSTKIITTTEREVVSKYGLPQPVLYNAVGGLTKEISTLKSTVELPLHQPQLFTDFGIT
                     PPRGILLHGPPGTGKTMLLRCVANETDAHVLTINGPSIVSKYLGETEAALREIFNEAK
                     RYQPSIIFIDEIDSLAPSRASDDSGEVESRVVATLLTLMDGMDGSGRLAVVAATNRPN
                     AIDPALRRPGRFDQEIEISIPDVEARHDILRKQFSRMSNKRQLLTADDVFQIASKTHG
                     YVGADLIALCRESVMKTIQRGLHSKIERSELKVTFDDVLDAMVDIRPSAMREIFLETP
                     KVYWDDIGGQEELKLKMKEMIQLPLEAAETFNKLGVSAPKGVLLYGPPGCSKTLTAKA
                     LATESGINFLAVKGPEIFNKYVGESEKAIREIFRKARAASPSIIFFDEIDALSPDRES
                     GSGTSAANHVLTSLLNEIDGIEELKGVIIVAATNRPDEIDPALLRPGRLDRHIYVGPP
                     DFDARLQILKKCTKNFNIDPLEVDLNALAESTDGCSGAEVVLLCQEAGLAAIMEDVNT
                     SKVEQRHFTKALAGIARGITPEMLEYYSAFASRSGISA"
     gene            <1058006..>1059877
                     /gene="VPS33"
                     /locus_tag="KLMA_40466"
                     /db_xref="GeneID:34716452"
     mRNA            <1058006..>1059877
                     /gene="VPS33"
                     /locus_tag="KLMA_40466"
                     /product="vacuolar protein sorting-associated protein 33"
                     /transcript_id="XM_022819779.1"
                     /db_xref="GeneID:34716452"
     CDS             1058006..1059877
                     /gene="VPS33"
                     /locus_tag="KLMA_40466"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 33"
                     /protein_id="XP_022676311.1"
                     /db_xref="GeneID:34716452"
                     /translation="MVTKLNTKRYVRANRDSFIHAVEAFQGHLKPITLVVDNNALQTL
                     DSIFTFSKLKQETQVENVVKCDEEASSVLHALIDDTTVVFLVDVRSDLVLNKEMEKLL
                     RELRSSSVNIITTTNNGRDTEQGLIRDYLREIIPLELVLVKWHILPMESLDDNVLDCN
                     ILMNSEGNNLYYPKNPYYRNATVNILVNNLSDSVVSILEKENITLIKSVALGENSKRL
                     IDIIQQRLELSDTTEKKFIRDAKFGKLKSGERNDLIVFERSLDTLTPMMTDLTYSGIL
                     SETKRMDFTPNDDDIWDQLKFLNFGAVGSNLNTLAKDLQMKYESRHEANTISEIKNFV
                     DNLGDLQSRQEVLKKHTVQSSELMDFLKEIDFKDTIDFEHNLYENSLDSSTVINKIVE
                     MMCFETEESNILRLCCLFSQIKQGLREKDFTALRQELVDTFGNEMIFKLKALEDYKLL
                     SKKHLENSKDYQSIIKVFDTMPDVDIEPLKPRDMNYAFSGAVPIMSRLLQSMFDRSVF
                     VKNNNSILQSFIHSKEPTLTRLETLLADMKIPVDERNWINKDGKIIGDVKNEPDLTLL
                     VFIGGITRGEISTIKFLQERLRSMDIPKEFVIVTDGIITGNEIFAKDISAPMKAAVN"
     gene            complement(<1060433..>1060949)
                     /gene="COX9"
                     /locus_tag="KLMA_40467"
                     /db_xref="GeneID:34716453"
     mRNA            complement(join(<1060433..1060681,1060920..>1060949))
                     /gene="COX9"
                     /locus_tag="KLMA_40467"
                     /product="cytochrome c oxidase subunit 7A"
                     /transcript_id="XM_022819780.1"
                     /db_xref="GeneID:34716453"
     CDS             complement(join(1060433..1060681,1060920..1060949))
                     /gene="COX9"
                     /locus_tag="KLMA_40467"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 7A"
                     /protein_id="XP_022676312.1"
                     /db_xref="GeneID:34716453"
                     /translation="MGVSGPMNCLVLLFYRIVFLDYRITYSHTQSTMSAIAPITGTLR
                     KRILADITIGFTIGGAMASYWWWGFHKGIINKREAYYAKLAEQKAAEN"
     gene            <1061659..>1061877
                     /gene="COX8"
                     /locus_tag="KLMA_40468"
                     /db_xref="GeneID:34716454"
     mRNA            <1061659..>1061877
                     /gene="COX8"
                     /locus_tag="KLMA_40468"
                     /product="cytochrome c oxidase polypeptide VIII"
                     /transcript_id="XM_022819781.1"
                     /db_xref="GeneID:34716454"
     CDS             1061659..1061877
                     /gene="COX8"
                     /locus_tag="KLMA_40468"
                     /codon_start=1
                     /product="cytochrome c oxidase polypeptide VIII"
                     /protein_id="XP_022676313.1"
                     /db_xref="GeneID:34716454"
                     /translation="MFNQVTRLATRRAFSATVKQSSHFQEGVYSNIPVKIHNRKIPYA
                     FVHFGFFALGFAVPFISCYVQLKKFGAF"
     gene            complement(<1062386..>1063360)
                     /gene="CST9"
                     /locus_tag="KLMA_40469"
                     /db_xref="GeneID:34716455"
     mRNA            complement(<1062386..>1063360)
                     /gene="CST9"
                     /locus_tag="KLMA_40469"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819782.1"
                     /db_xref="GeneID:34716455"
     CDS             complement(1062386..1063360)
                     /gene="CST9"
                     /locus_tag="KLMA_40469"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676314.1"
                     /db_xref="GeneID:34716455"
                     /translation="MPSRPVDLNQVWVNCSKCHKPYSSNSETENGKFWLTSCAHIVCS
                     KHCNGSTTVCPVCGIERVSVLPLDDDSSKLPTEVQSFFKPFTSQLEPLYTVANFQWDS
                     MVQVCGYYRQMCVKLQEKCNRQRELLVQAKEELDKYTALKNELRMGKSATVAPFSGSQ
                     TVSRNIFNARNDVSSENHESFVSKLQNSHRLSKPSRSLVNGQEPTSSSSSSSSSITNI
                     LAESTSINKIHQIEDPIVPTTPQTTVMNTSSKSTNSYSKPLSKQGAVSKPLPNALERL
                     KLRRSSTSTISSRGILSYMRINSSQTSTGINSRSNINSSIYSRNQFKK"
     gene            <1064175..>1065464
                     /gene="IDP1"
                     /locus_tag="KLMA_40470"
                     /db_xref="GeneID:34716456"
     mRNA            <1064175..>1065464
                     /gene="IDP1"
                     /locus_tag="KLMA_40470"
                     /product="isocitrate dehydrogenase [NADP]"
                     /transcript_id="XM_022819783.1"
                     /db_xref="GeneID:34716456"
     CDS             1064175..1065464
                     /gene="IDP1"
                     /locus_tag="KLMA_40470"
                     /codon_start=1
                     /product="isocitrate dehydrogenase [NADP]"
                     /protein_id="XP_022676315.1"
                     /db_xref="GeneID:34716456"
                     /translation="MKTTVINVHRQFSSSAMAGLRKIKVQTPIVELDGDEMTRIIWDK
                     IKQKLILPYLDVDLKYYDLSVTNRDATDDKVTVDSANAIKKYGVGVKCATITPDEARV
                     KEFNLKKMWKSPNGTIRNILGGTVFREPIVIPRIPRLVPGWEKPIVIGRHAHGDQYKA
                     TDLIVPGPGKLELVYKPGDGSETKTLEVYDYKGPGVALAMYNTDESIRGFAHSSFKLA
                     IAKKLNLYLSTKNTILKQYDGRFKDIFQEVYDSDYKAEFEKLNIWYEHRLIDDMVAQM
                     IKSKGGFILAFKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHY
                     RQYQQGKETSTNSIASIFAWTRGLAKRGELDNTPEVVKFANLLESSTLNTVQEDGIMT
                     KDLALACGKSDRSSYVTTDEFLDAVEARFKNDIKSLQ"
     gene            <1066013..>1066810
                     /gene="DPM1"
                     /locus_tag="KLMA_40471"
                     /db_xref="GeneID:34716457"
     mRNA            <1066013..>1066810
                     /gene="DPM1"
                     /locus_tag="KLMA_40471"
                     /product="dolichol-phosphate mannosyltransferase"
                     /transcript_id="XM_022819785.1"
                     /db_xref="GeneID:34716457"
     CDS             1066013..1066810
                     /gene="DPM1"
                     /locus_tag="KLMA_40471"
                     /codon_start=1
                     /product="dolichol-phosphate mannosyltransferase"
                     /protein_id="XP_022676316.1"
                     /db_xref="GeneID:34716457"
                     /translation="MSIENSVIVPAYHERLNIKPLTTRLFQALGKEGSNITELIFVDD
                     NSQDGSVEEVDALKKQGYNVRIIVRTDERGLSSAVLKGFHEAKGEYLVCMDADLQHPP
                     ETVPQLLDSLRKHPFVLGTRYAPGVGIDKDWPLYRRIISSGARSMAKPLTSASDPMSG
                     FFGLQKKYLLHKDAKNINPKGFKIALDLLVKLPLPADQPIGEVPFFFGVRTEGESKLS
                     GKVIIQYLQQLKELYNYKFGSNNLLLFFLFWTILALYILYQAYHLVF"
     gene            <1067523..>1072091
                     /gene="GDB1"
                     /locus_tag="KLMA_40472"
                     /db_xref="GeneID:34716458"
     mRNA            <1067523..>1072091
                     /gene="GDB1"
                     /locus_tag="KLMA_40472"
                     /product="glycogen debranching enzyme"
                     /transcript_id="XM_022819786.1"
                     /db_xref="GeneID:34716458"
     CDS             1067523..1072091
                     /gene="GDB1"
                     /locus_tag="KLMA_40472"
                     /codon_start=1
                     /product="glycogen debranching enzyme"
                     /protein_id="XP_022676317.1"
                     /db_xref="GeneID:34716458"
                     /translation="MRVVLLRLSDNGEPRVSCSYNHGVLTLPSLPIPPGRKPEEPLYT
                     VRLVVAAGCPVARDGLIWTNCPESHEVEFDRNRFHKKYIRASFHKDDEIDLEVYSPGS
                     YCFYISYRNESNELETTRKFYFVVPPSLYLNGTFLPLNSIALQSVVSKWMGKNWDPIF
                     KKIESKGYNMIHFTPLQPRGDSDSPYSIYDQLAYDPAFFDSPDDVKKMVEVLHKKHNI
                     LALTDVVYNHTANNSQWLLEHPESGYNQETAPHLLPAIELDKSLLDFSNKMKRLGYTT
                     EITSVEDLIGIMDGIKIHVLGSLKLWEFYVVDIEQTLKDLATGWESAPIDSLKVPDDV
                     KNDLVKLAAFVRIACVNDGFGTLSKRFSNTLNTNRFAQVLKQVYGEKWNDTVESQAHK
                     ILDELNLPLYREYDDDVRVILDQLYNRIKYLRIDDNGPKMGPITTESPLTEPYFTRFT
                     GNDGKSYALANNGWIWNSNPLVDFASKDSKAYLRREVIVWGDCVKLRYGAKPEDSPYL
                     WQRMSEYTRLQATIFDGFRIDNCHSTPIHVGEYFLDLARKHNPNLYVVAELFSGSEQM
                     DCIFVEKLAISSLIREAMQAWSEQELSSLIHRHGGRPTGSYRYMPLDDFAYNPELELD
                     EDFVTFKNSSANEFKCISEIKIPKFLSATPPHALFMDCTHDNETPYEKRTVEDTLPNA
                     ALVSLSSSAVGSVYGYDEIFPHLLDVVKENRQYSVVPGDGISIVKKKFNAIRAEIAKQ
                     SDDIDDSEMHVHHDGQFISYHRTHARTGHGYYLIARTKFNEYQGDQPSPSIKLAGSSV
                     ELLFSYSLVKTGGLPEDDDKEIKGISTKLVELTGFNIQYDEEKGDSSVDLPSNFPAGS
                     IAVFKTKQNGVSKDLDEFIRTGAIKATEKLNLHSLNAVLYRCGQEEADTSANRSGVYT
                     IPEYGPLVYCGLQGWVSVLRDVIFRNDLAHPLSKNLRLGHWALDYVVDRLDYYRDIPG
                     VTDLQQWLKDRFDRIKKVPYYLVPRFFALVIGIAYESCRFRAICQMSKNIGLSNLFVQ
                     SLAMTSIQMTSVMTSTSLLPDKNVSCMAAGLPHFSTQYMRCWGRDVFISIRGLLLTTG
                     RFDEAENHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFVQAVQDYIKIVPNGED
                     ILKKKVKRRFPLDDRYIPWTDPEAFSYETSIEDIIYEIISRHAKGIKYREANAGPNLD
                     RVMKDEGFNVEVHVDWSNGLIFGGSQFNCGTWMDKMGESELAGSVGIPGTPRDGAAIE
                     INGLLKSCLRFLIELQDKGLFQYTDVEKADGSRISLQEWDALLLENFEKKFYVPESPE
                     DDAKYDIDRSLVNRRGIYKDLYRSGKAYEDYQLRPNFAIAMTVAPELFTSEYAYKALN
                     IADKVIRGPVGMRTLDPSDYNYRPYYRNSEDSTDFLTAKGRNYHQGPEWVWCYGYFLR
                     AFNYFHFITNPLAYNAARNTPSSYLYQQLYKRLDGQRKWISDSEWAGLTELTNKDGEF
                     CADSSPTQAWSTGCLLDFFYDLWNGFEE"
     gene            <1072694..>1074832
                     /gene="ATG13"
                     /locus_tag="KLMA_40473"
                     /db_xref="GeneID:34716459"
     mRNA            <1072694..>1074832
                     /gene="ATG13"
                     /locus_tag="KLMA_40473"
                     /product="autophagy-related protein 13"
                     /transcript_id="XM_022819787.1"
                     /db_xref="GeneID:34716459"
     CDS             1072694..1074832
                     /gene="ATG13"
                     /locus_tag="KLMA_40473"
                     /codon_start=1
                     /product="autophagy-related protein 13"
                     /protein_id="XP_022676318.1"
                     /db_xref="GeneID:34716459"
                     /translation="MSDSDREIIGLINNFFLKAALLLEQCKVVARGGGFDGEEPLRDG
                     NHLFNIETRGDPTLEAQIQPWTTFDGEKSMPPLVLETFLDLRGLHSNQTVYLHDSDGN
                     PWMVCKGGKKSEIVLERWLIELDRQFSSTTGSTDAAEDDEYNEFNDPENLHKQLVLLF
                     RYLYTLTQLLPANDIITKLQASQQGTAQATTTTGTLKPLHIHTRLLDGSKPILSKGRV
                     GLSKPIIASYSNTMNETNIASHLEQRKITPIKTKFGSLRITVSYRKDVDFYVIDQEDP
                     YKRTTNVSALQDTVTATDRRISSNSNISISVSPKTTNMLNANHIPVDSSGGGFARRQS
                     ISSKLQPFKVGSVGSGSFVQSGSLQSVTNPNPSLSRNVSSSSVAAALKVQRGSAGSTV
                     LNSDLPPELSSVGSGSKYSSSFGRIRRHSSVRRSESIDRTAKPRKSNETPPEDLLEFV
                     KLLEDKKELNMKPSTILPQQDISSSLIKFQSMKPNNDTLSDNLSMSMSIDQPNMRMGS
                     NSHSPIPSFSPNYGSIPSRLSQGSRNNSNVELITSRKSSLDRHRLSLLNRTGSNVDIR
                     RGSVGTMETTNEDSKEDEDSHVHGLRFNSGTVNDKTEDNNEDDDEEEILIKRSSNAVA
                     SSTEHFSVSPRSARSISVSSYTRSQLPLKHPNFSYPTTSATTAHAKFHKSEVIPDQLH
                     REGSHHHNSSHKNDEDDDLLFVMSDMNLTN"
     gene            complement(<1075135..>1076415)
                     /gene="PZF1"
                     /locus_tag="KLMA_40474"
                     /db_xref="GeneID:34716460"
     mRNA            complement(<1075135..>1076415)
                     /gene="PZF1"
                     /locus_tag="KLMA_40474"
                     /product="transcription factor IIIA"
                     /transcript_id="XM_022819788.1"
                     /db_xref="GeneID:34716460"
     CDS             complement(1075135..1076415)
                     /gene="PZF1"
                     /locus_tag="KLMA_40474"
                     /codon_start=1
                     /product="transcription factor IIIA"
                     /protein_id="XP_022676319.1"
                     /db_xref="GeneID:34716460"
                     /translation="MSDKSTVGGGGPEELELNKVGCNGALPFARSDSTDSVMSVTSTG
                     SIGSISSTTSTTSTSSQRAKVYFCEYEGCDKSFTRPGLLTEHQMSVHHGVKPHKCDLC
                     DKAFAKKSHLNRHMFSHSEEKPFQCSVCGKGVTTRQQLKRHEIVHTKSFHCPYDGCEE
                     SFYKHPQLRSHILSIHENKLTCPHCNKTFQRPYRLKNHIDKHHNPESAGKYQCDFISC
                     TEVFSTWSALQQHIKETHPKLPCPVCKKPCVGKTGLKNHMIIHNDALVTKNWKCTVCS
                     QVSFAKKSQLLQHYADDHKELDPLLLPTPSETVTSLAIDTENVEIAKKPKTIDDYYSS
                     KKRKADELASVESEVKIQKYIESGKSAMSLLLNTIGQRRKCPYTNCNRSFKTKEKFDK
                     HIEKHKIHDLKMKILEDENNKEKETHNTESAEAA"
     gene            <1076966..>1077442
                     /gene="RPO26"
                     /locus_tag="KLMA_40475"
                     /db_xref="GeneID:34716461"
     mRNA            <1076966..>1077442
                     /gene="RPO26"
                     /locus_tag="KLMA_40475"
                     /product="DNA-directed RNA polymerases I"
                     /transcript_id="XM_022819789.1"
                     /db_xref="GeneID:34716461"
     CDS             1076966..1077442
                     /gene="RPO26"
                     /locus_tag="KLMA_40475"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases I"
                     /protein_id="XP_022676320.1"
                     /db_xref="GeneID:34716461"
                     /translation="MSDNEEAFNDGPENYEDFDQEHFSDYEGFDESEGKFGAGNGLGT
                     DENGNTIVAGGFGPEEFQQQEARRKRTLKEKAIPKEERTTTPYMTKYERARILGTRAL
                     QISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL"
     gene            complement(<1077619..>1078083)
                     /locus_tag="KLMA_40476"
                     /db_xref="GeneID:34716462"
     mRNA            complement(<1077619..>1078083)
                     /locus_tag="KLMA_40476"
                     /product="myosin light chain 2"
                     /transcript_id="XM_022819790.1"
                     /db_xref="GeneID:34716462"
     CDS             complement(1077619..1078083)
                     /locus_tag="KLMA_40476"
                     /codon_start=1
                     /product="myosin light chain 2"
                     /protein_id="XP_022676321.1"
                     /db_xref="GeneID:34716462"
                     /translation="MEKSTSVSFSQFTQEQIKKLKEAFQLIDDDGDGVISETDLSKIL
                     KGLGMPSDEDKIKEMINVAPDETVTFPGYLSLMSETIGEMPDTAEIREAMKAFSDEEE
                     LLCDASELERCLKDVGFDDSTKLDRVLRHFSTKQVSGERVFKGAKFIQAISE"
     gene            <1078396..>1082598
                     /gene="SKI3"
                     /locus_tag="KLMA_40477"
                     /db_xref="GeneID:34716463"
     mRNA            <1078396..>1082598
                     /gene="SKI3"
                     /locus_tag="KLMA_40477"
                     /product="superkiller protein 3"
                     /transcript_id="XM_022819791.1"
                     /db_xref="GeneID:34716463"
     CDS             1078396..1082598
                     /gene="SKI3"
                     /locus_tag="KLMA_40477"
                     /codon_start=1
                     /product="superkiller protein 3"
                     /protein_id="XP_022676322.1"
                     /db_xref="GeneID:34716463"
                     /translation="MSQVKSLLKNARAALAEADWEYAIESSKDVLKIDKENYFAYVFL
                     GKANEGLENFKKSKESYLKAISLDSTNPVAWKGLFVLFKTVKNLKDIVEWKEYFKYCN
                     DYAQALAQQQQSLIDLINDIRNVRRKYPDAEEPFLESIRPGTEFGELVGREIMTPRDV
                     LRKLLTLKQNSEQQRASKLISAARMKISVNDPDYHFKVNSSAWTVYKDSDVDLLFRQL
                     VNITEDDEKRRNLELQWLEYRIKLLKTMPKEMKPSFYPVVKEMIDDMIVVKHDSLLPW
                     TLYFDWQDYLNVESLDVTVCSEFIKKFPSEPLAMVIYAWISSSLSSYDSKKLSTDVLN
                     SSSPASDPTVNEEDVETESEGISPIVDIEEEASSGLSEATVLEMLQDNIVKCKQSILA
                     NRIIAHYYVTQKEFQLALPYIRAGTSAVATSIRDLGASLKNSKFDFTLLYATTYTYFE
                     APKNHNIALSLFDKVLLEDPKNAEAKMGKGLIFIEMKNWEGASQYLADATAEFPQNWE
                     IISAYGWCLLHVGETQKAIEKFNAVLENTPSSDPKSIDFRALNYWRIAKCYLYEAENN
                     SDKDLINKAYKTLVHALKVSDIYAPAYSLLGYIYQKYYSDESRAFKCFFKALSLDSSD
                     LEAAYYICEKYCAKGNWASAASVAERLIKTEHIKNALQSINWPYRVLGMSHLERQQYA
                     ESIEYFQSAIRISASDVESWVGLGQAYLNCGRVEASIKVFQKVIKMKADHKFAQYLLA
                     NALASLGEYEKSLELFEKLVMEGQPEECFLVSEISVLVDYAVELYHQGYLLKAVDTAV
                     KSIKKIEIVLCSVSSELYTVWTSLSKALRIFVTIESQIDKLPVDTLVNIFNQIALIEE
                     DTVFEIDNVSLDTILSDDTADNMSIALKFVILSAKYPILAKNFQDSSRTLKASLLYNL
                     GCAELLCYMTINGQNYCDAAIKAFKDAISYQSNNAEAWIGMGIATMDKNYKVSQHCFI
                     KAIVTSPKEIAGWHCLALLALKNNDTEMTHSILLKAQSIAPQDWYSWLGLALMYEKEG
                     KANDSARMFTHAYVLANGKSKITQLLYAKNVLSRRLGKGDNEKDILAQQELSSVAAGL
                     SQYLKKSQNDIFAMQLYILTLERLHEYTTASGLAQYLSTLVEERFEKSQDERELLNFA
                     LIKTQLSRLYMGNEDYDNAIEAATFALGILEDDENQTDIVKTAIVSNHVTIGLSSFFI
                     SDIDQSLDHSNTLISLSPASSSVAILIFKILYAMQSEEASDIALQELMNYIDKNGNDY
                     NVTLTLTAFFILKDRPDELRELAKQLKMLPNSLLLKDQHKDIPFLIQEINKRIGEERD
                     TVDIWQKASFMFPNNPNVWDRLSTEISCRISASGQNRVSPLHLSNKLAKRGTLTKAQK
                     AMYLCPWNAQAVNALKECFKAI"
     gene            complement(<1082680..>1084695)
                     /gene="RPC82"
                     /locus_tag="KLMA_40478"
                     /db_xref="GeneID:34716464"
     mRNA            complement(<1082680..>1084695)
                     /gene="RPC82"
                     /locus_tag="KLMA_40478"
                     /product="DNA-directed RNA polymerase III subunit RPC3"
                     /transcript_id="XM_022819792.1"
                     /db_xref="GeneID:34716464"
     CDS             complement(1082680..1084695)
                     /gene="RPC82"
                     /locus_tag="KLMA_40478"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC3"
                     /protein_id="XP_022676323.1"
                     /db_xref="GeneID:34716464"
                     /translation="MSAAQAALIPDAGANSVVNSAECSSSGNGHVNGLSNDSTSGKSA
                     STEPVDISSLEQRTLNPDWFLYTELARSNLGERASAVLSVLINKGRLSTREIQSYVPD
                     LSLSSIRTVLVSLIQLRCVQYLEETSLSGRKTIYYYFNEDGLILMLYSGDISYRVTKY
                     FNEHTEQHLISIAQEIIHNVLALGSLQVKDYLQSLSSGETAEEDLFNVHQTFVRLAEL
                     QFLIPLQGIHYTPIEDLWNLLYLREYKKLPKNTTQSDLKKRNEAKAKAKAEFNRVITM
                     PTNGESTKNLFVTDSKTGFKKINESISLTFNLDRYMKARRSTQLIHFAKNRIGTTTSK
                     IYAAALSLTEQLSNDLSHPLAKTGLFQDLDERTALYEDLKIDEENVKGVTFTATDLSR
                     RLPKDLDLRGTLTYANQSTKRKQNRHQSNQMEKRIKTEDGFVVPPLPTVPEESEEDDL
                     EDANLDMNSEDNDPHSVNLIDGHLRLLLSSGIPFIKESKPGQFFVPYSELIPTLKMHV
                     YDSLIASTLGASSHRVLRCIRDNGLCTEKTITTTSLMREKDVRTVIGTLIRYNAIEIQ
                     ELPRTADRAASRAVFLFRIKERHAFNTMKQNLTWNLARLIAKLEALKEENATLLKKAN
                     RDDVKGRELELLLASEINQLKLVNDREMNGLVRRHRLLSLWEVFKLF"
     gene            <1085636..>1086718
                     /gene="QCR2"
                     /locus_tag="KLMA_40479"
                     /db_xref="GeneID:34716465"
     mRNA            <1085636..>1086718
                     /gene="QCR2"
                     /locus_tag="KLMA_40479"
                     /product="cytochrome b-c1 complex subunit 2"
                     /transcript_id="XM_022819793.1"
                     /db_xref="GeneID:34716465"
     CDS             1085636..1086718
                     /gene="QCR2"
                     /locus_tag="KLMA_40479"
                     /codon_start=1
                     /product="cytochrome b-c1 complex subunit 2"
                     /protein_id="XP_022676324.1"
                     /db_xref="GeneID:34716465"
                     /translation="MLSNRLQFVQQAARRLSISAKDGSGKVSTLAVKVHGGARYADKE
                     GVAHLLSRFNFHNTGNKSALRLVRESELLGGKFESTVDREYITLKATFLKEDLPYFVN
                     ALGNVLYKTSFRPHELPESVLPAAKYDVALAEANPVNKAEELLYDVVFRKDLGKPVLY
                     NGVENVTLEDIKAYADKVYTKENIEIIGEGVNEADLKRFVNDSLINSLPTGSKLASQA
                     QPKFFSGEARVRAPGASVAAIAVPVTKEELATYEVLAKYVTSSLFELAPLVDSAKLDK
                     YANAGLFALYVKGEDAAVVGENIKKVVAALKKDVDLSVAKEYAALQLALENASADVSN
                     VKSVKLGKFSYAAVGNVAKLPFADEL"
     gene            complement(<1087797..>1090073)
                     /gene="SCH9"
                     /locus_tag="KLMA_40480"
                     /db_xref="GeneID:34716466"
     mRNA            complement(<1087797..>1090073)
                     /gene="SCH9"
                     /locus_tag="KLMA_40480"
                     /product="serine/threonine-protein kinase SCH9"
                     /transcript_id="XM_022819794.1"
                     /db_xref="GeneID:34716466"
     CDS             complement(1087797..1090073)
                     /gene="SCH9"
                     /locus_tag="KLMA_40480"
                     /codon_start=1
                     /product="serine/threonine-protein kinase SCH9"
                     /protein_id="XP_022676325.1"
                     /db_xref="GeneID:34716466"
                     /translation="MMNFFKSQNEGGNASAARAKNGGTPGAGFFPTIGSHSATATPTT
                     ALSEHSYAIGTTGLNQSRQHQENILNHMKATMDPDIYANQQQHQQQQQHQQQQHQQQQ
                     QQQQQQQQQQQQQQQQHQQQQHVPTITTSVASAGLSEEKAQSSASSETLSSTSSNANG
                     QLPRGKLRIVIAEALNLSIRSPTASQPYVVCTFESSEFISNGPESLDNKHPSHSTSNA
                     NSNWVKALPDIKEKQKRPLYTRQSSSQLDKLGKNKLNLKRDAINPVWEHEATFDVLGT
                     HSELDISVYDAAQDDMFLGQVRLHPDMKNVAPGVHSEWHKLKSRTLGEHVTGDILIHW
                     EYTSTKKKQYGPQDFEVLRLLGKGTFGQVYQVRKKDTLRIYAMKVLSKKVIVKKNEIA
                     HTIGERNILVRTASKSCPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFPED
                     RAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKDRTNTF
                     CGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCGWSPFFASDNQKMYQKIAFGKV
                     KFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFSDVDWEAVRQKKIPPP
                     FKPHLVSETDTSNFDPEFTQTSTSFMNKQPIAATPLSPAMQAKFAGFTFVDESAMDEH
                     YTNAYNSRKYLQNSYFMEPGSFIPGNPNLPPDEDVIDDEEESADRLAAVKEGNGLSVD
                     YDGDHQMDDEFVNGRFEI"
     gene            complement(<1090827..>1093169)
                     /gene="MNL1"
                     /locus_tag="KLMA_40481"
                     /db_xref="GeneID:34716467"
     mRNA            complement(<1090827..>1093169)
                     /gene="MNL1"
                     /locus_tag="KLMA_40481"
                     /product="ER degradation-enhancing alpha-mannosidase-like
                     protein 1"
                     /transcript_id="XM_022819796.1"
                     /db_xref="GeneID:34716467"
     CDS             complement(1090827..1093169)
                     /gene="MNL1"
                     /locus_tag="KLMA_40481"
                     /codon_start=1
                     /product="ER degradation-enhancing alpha-mannosidase-like
                     protein 1"
                     /protein_id="XP_022676326.1"
                     /db_xref="GeneID:34716467"
                     /translation="MLTGFIFVCFCILTWLTNTCLGFKAEPYSFTKPELHKYREQVRE
                     LFYHGFDSYLKYGYPFDEVRPISCKPKKRKFDNPQDTITNDVLGNFTTTLVDSLTTLA
                     VLGDKERFTESLELFRNTVPDSFDLDSTVQLFETTIRLLGGMMSAHIYATDPRTKVYL
                     GKKKYDGFLLKRCIILADKLLMAYLSPTGLPVPRINLRYGTSIDPGLLDENNAAATAS
                     PMFEFRLLSMLTLNDTYRQVTEFAFNRTWDLRSDLNLLPMSFSPYDTMVFNDISGTGA
                     SIDSFYETALKGSILFDDPWLYNVWETSIHALDAYSKTDWFYSNVGTSHGKTVMLWID
                     SLSAFFPGLLTLDGRIENAAKKHMMFSKLWSTYGGIPERWNFDIGVSSAEGGVQSAGK
                     TKSVMDKYAAIPSPLDLEWYPLRPEFIESTYYLYRATKDVYYLNVAVRILDDITNRFK
                     AKCGFTGFQNVLTGEKQDRMESFVLGETLKYLYLIFDEENELHNKLWNHVFSTEAHPF
                     WINDKLKNQYELHKRKTRGRLHVSEMYKFHLMKAAYTMMGSKGKKNSKSSSSSVIPEL
                     PLQLEGQCDFVGQMNTAFQESNILSRDDLFEIDFRYWPSLQQPKWNKGYVSLELTPQL
                     YNLWKGRGKLGNQHKCAVPKTRVFEGIISERTLRSRLINTHRLWGPSDSPAVYRFDSI
                     TGLRMRFYEQNLSIHTKRNDPLVYDVVNWKSCLPDTSNNVPPVLYTAIFIDGTELTDN
                     DVVLVNRSALLTAQSVKYLSMNANHQLLINCIPVSNIYLE"
     gene            <1094102..>1095331
                     /gene="RPS4B"
                     /locus_tag="KLMA_40482"
                     /db_xref="GeneID:34716468"
     mRNA            join(<1094102..1094115,1094560..>1095331)
                     /gene="RPS4B"
                     /locus_tag="KLMA_40482"
                     /product="40S ribosomal protein S4"
                     /transcript_id="XM_022819797.1"
                     /db_xref="GeneID:34716468"
     CDS             join(1094102..1094115,1094560..1095331)
                     /gene="RPS4B"
                     /locus_tag="KLMA_40482"
                     /codon_start=1
                     /product="40S ribosomal protein S4"
                     /protein_id="XP_022676327.1"
                     /db_xref="GeneID:34716468"
                     /translation="MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPL
                     IVFLRNRLKYALNGREVKAILMQRHVKVDGKVRTDTTFPAGFMDVVTLDATNENFRLV
                     YDVKGRFAVHRITDEEASYKLGKVRKVQLGKKGIPYVVTHDGRTIRYPDPNIKVNDTV
                     KIDLATGKISDFIKFDTGKLVYVTGGRNLGRVGTIVHRERHEGGFDLVHIKDSLENTF
                     VTRLNNVFVIGEPGRPWISLPKGKGIKLTIAEERDRRRAQHGL"
     gene            complement(<1095486..>1097288)
                     /locus_tag="KLMA_40483"
                     /db_xref="GeneID:34716469"
     mRNA            complement(<1095486..>1097288)
                     /locus_tag="KLMA_40483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819798.1"
                     /db_xref="GeneID:34716469"
     CDS             complement(1095486..1097288)
                     /locus_tag="KLMA_40483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676328.1"
                     /db_xref="GeneID:34716469"
                     /translation="MRHLLNINHLALYALYIPTLLCAVLPFEPIQKFMSSEQQAVKKY
                     RDLQIGELNFIHTTDTHGWLGSHLNEENYDATWGDLISFVDKLRQNVIKENDLLLIDT
                     GDKHDGNGLSDATIPNGLNSTQIFNEMNYDLLTLGNHELYVEDNTVLEFYETASNPKF
                     KGKYVSSNVEFIKEDGSKVPFGSKYRYFTTKNKGLRILAFSFLFNFERANQRATVTPV
                     ANALKQEWFKEVTKIYSRDDVDVIIVFGHLPVSDPENREINHLHSKLRHNYPNTFIHY
                     FGGHTHIRDFVSLDNKAYGIQSGRFCETVGFSSVDDVKKESPVVSRRYIDFNLDSFMH
                     HAKVKNIDDFDTELGLAVNEHIKQLREDLNLTTVFGYVPSTYYMYNKPLSSPHNIYNL
                     LTTKVLPRLVSDRSDVIAESGGRIIMINSGSIRFDLHEGPFTTDTEYTISPFSNTWNY
                     IKLPLELAMQIESYLNGMGPILTLNVPGENRRHCPFVNDKSLPKGYTTSDDLGCEGDD
                     TLHRSEHEYRIPNVVQSIDIVNEDAETIDFVYYSFIQPYVLEALNDLNEDQNIVDHEF
                     SEQDCKIYGGASTKDLLREYIISLGDKSGNSINT"
     gene            complement(1097549..1097624)
                     /locus_tag="KLMA_R422"
                     /db_xref="GeneID:34718720"
     tRNA            complement(1097549..1097624)
                     /locus_tag="KLMA_R422"
                     /product="tRNA-Val"
                     /db_xref="GeneID:34718720"
     gene            <1098497..>1099375
                     /locus_tag="KLMA_40484"
                     /db_xref="GeneID:34716470"
     mRNA            <1098497..>1099375
                     /locus_tag="KLMA_40484"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819799.1"
                     /db_xref="GeneID:34716470"
     CDS             1098497..1099375
                     /locus_tag="KLMA_40484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676329.1"
                     /db_xref="GeneID:34716470"
                     /translation="MNILTCVVSFVTQVVTLWMPLVLTLSTIFEINIIYRRTIKGYYE
                     TQHFRYQGQKLMDSQDSLAKFHKDMHTVLQNNVLLHRFGLKRIHLCEFWCIYWMLTFV
                     INEQIIPMLQRSGIPITILHVLKVFTPMTLYVYIHERPSHKNCDSLRPWRFPKLFAEL
                     YKYQILPLIKAVIGVVKSDITIEKVHSCIKHINGTIGASDFNLFGVESRQIFYFQSNF
                     EATEEPTTLAMANMEVYPDSIIDSTRSSLLSHISPAESIYKGPVVEKHSSKPPQTKRK
                     FATRLNDLFRHKNQCQ"
     gene            complement(<1099605..>1100402)
                     /gene="MGM101"
                     /locus_tag="KLMA_40485"
                     /db_xref="GeneID:34716471"
     mRNA            complement(<1099605..>1100402)
                     /gene="MGM101"
                     /locus_tag="KLMA_40485"
                     /product="mitochondrial genome maintenance protein MGM101"
                     /transcript_id="XM_022819800.1"
                     /db_xref="GeneID:34716471"
     CDS             complement(1099605..1100402)
                     /gene="MGM101"
                     /locus_tag="KLMA_40485"
                     /codon_start=1
                     /product="mitochondrial genome maintenance protein MGM101"
                     /protein_id="XP_022676330.1"
                     /db_xref="GeneID:34716471"
                     /translation="MLSFNRIVRVNGARFATSGTAMVRKSVASSASTVSASRAASSSP
                     SVNSTTAENGTGRTSAMKRVPGYTKTLEETLNGSVLEPPAQVQTSSSSEEINWYSSFH
                     GIGSKPFPKETQDALSGALVPEDIEIKPDGLIYLPEIKYRRILNKAFGAGGWGLVPRS
                     ETIVTAKLVTREYALICHGQLVSIARGEQDYFSETGIPTATEGCKSNALMRCCKDLGI
                     GSELWDPVFIKKFKKSHCTEKFVEHVTTKKKKKIWLRKDREVEYPYK"
     gene            <1101052..>1103358
                     /gene="PMT4"
                     /locus_tag="KLMA_40486"
                     /db_xref="GeneID:34716472"
     mRNA            <1101052..>1103358
                     /gene="PMT4"
                     /locus_tag="KLMA_40486"
                     /product="dolichyl-phosphate-mannose--protein
                     mannosyltransferase 4"
                     /transcript_id="XM_022819801.1"
                     /db_xref="GeneID:34716472"
     CDS             1101052..1103358
                     /gene="PMT4"
                     /locus_tag="KLMA_40486"
                     /codon_start=1
                     /product="dolichyl-phosphate-mannose--protein
                     mannosyltransferase 4"
                     /protein_id="XP_022676331.1"
                     /db_xref="GeneID:34716472"
                     /translation="MAVNKRNKTPGLGEKGKKAPVATPESDEEDKYTKKRTIEYVAEK
                     WLLQDAPDSAQLYKTLGYIVTAIALVLRFWRISEPREVVFDEVHFGKFASYYLERTYF
                     FDVHPPLAKMMIAAVGWLVGYDGRFKFDDIGYSYDKYYAPFVAYRSLSAVLGTATVAV
                     VFQTMKELNFRAATCFIASFLIAVDNAHVTQTRLILLDAMLVFSIALTFYSYVKFYKL
                     QLTSPFSSQWYLWLYLTGFSLSLVMSTKYVGILTYCAIGIAVAVNLWQMLDIRSGLSV
                     RTISKHVSTRLNGLIIFPFIVYLFWFWCHFAILNKSGPGDTFMSVDFQDTLYDAPGAT
                     EVKDVHYYDIVTIKHDLTEAFLHSHPARYPLRYEDGRISSNGQQVTAYVHEDANNEWE
                     ILPPRDSPIKKGAPVKLDENIRLRHIGTNTYLLAHDVASPYYPTNEEITTVTEEEANG
                     ERYDSTIFRFQPVLAKNSGRVTKTKNSAFRLFHVETAVALWTHDDKLLPDWGFEQQEV
                     NGNKKVQDPENSWYVDSIVNMAENDLRRIYKPRVPRPMSFLSKWYELQILMFDHNNKL
                     SSEHPFASEPQTWPVALNGVSFWTKEEGRKQIFFTGNIIGYWFEVISIALYAGLVIAD
                     LVTRQRAVYSLNKMAREKLYGPLAFFLISWAAHYFPFFLMGRQKFLHHYLPAHMILAM
                     FAASLWETVFTDNQSLNLDLDEENPENPHEDKPKFYTVLFYFFCVTVVINVGGFFVYF
                     APLVYGLPMTVEQIQARQWLDIRLQYAK"
     gene            complement(<1103522..>1104550)
                     /locus_tag="KLMA_40487"
                     /db_xref="GeneID:34716473"
     mRNA            complement(<1103522..>1104550)
                     /locus_tag="KLMA_40487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819802.1"
                     /db_xref="GeneID:34716473"
     CDS             complement(1103522..1104550)
                     /locus_tag="KLMA_40487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676332.1"
                     /db_xref="GeneID:34716473"
                     /translation="MTQVVECNGKEILVRSKEDEVTNFSYLDVIEKVDVFPVNYNTSE
                     HFRANVYMLQSHTGIEIGFVLKLVLGEIRKYGDKVVSELFDIDDGSHVIRIKPESFNT
                     RTELMDQLCRALKVKSSLNCIKTWREEKYAVYVDHAPYILIERGLSGAFGIITYGVHV
                     NGFFKDSATGHLRIWIPRRSASKSTWPSMLDNIVAGGIGYPCGIYETVLKECMEEASL
                     SKDDVERNIKPVGSVSYFHHQVTFGEQKYLDEEAFIAGEVEYLYDLELPPTVKPIPND
                     GEVEEFGLYSLQETINAIKRNEFKPNCALVMVEFLIRHGYITPENEPNYTAILSRMHR
                     RLPFPLMR"
     gene            <1104688..>1105872
                     /gene="PPX1"
                     /locus_tag="KLMA_40488"
                     /db_xref="GeneID:34716474"
     mRNA            <1104688..>1105872
                     /gene="PPX1"
                     /locus_tag="KLMA_40488"
                     /product="exopolyphosphatase"
                     /transcript_id="XM_022819803.1"
                     /db_xref="GeneID:34716474"
     CDS             1104688..1105872
                     /gene="PPX1"
                     /locus_tag="KLMA_40488"
                     /codon_start=1
                     /product="exopolyphosphatase"
                     /protein_id="XP_022676333.1"
                     /db_xref="GeneID:34716474"
                     /translation="MMIYRKKVSMSSTSHFQIMPENLVRVLKQLKTFQASNTSQKLLN
                     IVCGNESADLDSIVSTLAYAYFSYIHDPSKYILPVVNIPREDLKLRKDVTFLLGSHSI
                     SSDLLNFREDLVNWQKQSLYDINYVLVDHNDVPAITNDGPTNIAGIIDHHKDLGLHAE
                     SITKLSGPRIIQTAGSCSTLVFQYWNGILKHDSNSTEMIKEIVPLLLGALLLDTDNMK
                     NKVEPVDQAVFEQYKRILGSSFNTDSFYQQLRTAKDDINGLSINDILRKDYKEFRFAS
                     NVRCGIASVVKSLEWINEQYGEESIENACEKFMTEHSLDIFIIMNSFTRDGTFSKQIA
                     FISENDNLLNELFKDLIPKLQLESIRDVSKRKLKCYRQGNVKASRKQVAPYVQESLEK
                     YQ"
     gene            complement(<1105904..>1106974)
                     /locus_tag="KLMA_40489"
                     /db_xref="GeneID:34716475"
     mRNA            complement(<1105904..>1106974)
                     /locus_tag="KLMA_40489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819804.1"
                     /db_xref="GeneID:34716475"
     CDS             complement(1105904..1106974)
                     /locus_tag="KLMA_40489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676334.1"
                     /db_xref="GeneID:34716475"
                     /translation="MLEYFVEHHQWIGTVYIWIYYKNTGLQVGKIGQNGRSLELIGTE
                     EENNQFVIELPCAVEPTRAKLNYKGDLYNLRLTAVKNEQRFDRSSNHIMEEVVSKWMR
                     KDLVKGPFTFYCSCCNDQLICSKDYTKVRDMPSEFWAEFMDYWHCHKPHSDTNSTLSN
                     GFDNKFTKSVVPTVGEICLSDSFIYIHKDSLNSKIVYDYNNVFCNSCKQVLGSVNRDG
                     SIGFKKWCLKAEINKEIETIDISNYVLNQIFNELKAHSTRLFHIRDNSIAMEVQVWVF
                     GFGSTISFSNSHLLTNCMKILYQRGGPPNGPQNSQNIELIEVDEPNALSAFISRLDDV
                     NSNLPHDLQRMNEWKVGYISCD"
     gene            <1107151..>1112109
                     /gene="HIR3"
                     /locus_tag="KLMA_40490"
                     /db_xref="GeneID:34716476"
     mRNA            <1107151..>1112109
                     /gene="HIR3"
                     /locus_tag="KLMA_40490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819805.1"
                     /db_xref="GeneID:34716476"
     CDS             1107151..1112109
                     /gene="HIR3"
                     /locus_tag="KLMA_40490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676335.1"
                     /db_xref="GeneID:34716476"
                     /translation="MSSFEALNLSTTDTVDESKDHSRELQVEESSKIFQLALIQLKAK
                     RYDDAKDTFDKLFEIDVIKPNKWGLYEYSSPTLDSLRYLAFRNRGILYYQYVKDNLAE
                     MESGDVVDYVLKALECLLESLQHGDADSTVTHLLLNIFWSFNSAKLSRSILEFELTRS
                     PEEFRLLSSLAAMFKGQKRIVKKYSELLKKLHDAGSRENIPSAINDVLNYIEHCDVEM
                     KERDLLLKQIKTMKMEDDELIKNLDATSLPLYELSWEEIGSKLRSLIPRTKVTNILGR
                     KSDTYSDLEAPLEYVYFSIDEAMEKTARSPADSVENLSDHYEDAISTLPETNASNTAT
                     PNNSDTSDTKQISSRRAESNDRPTAQRSSKRFKEREKVQEPDVEELVEFHNRILANID
                     GVLKSYGIAEDLSVEAIDPNNISKQQELCMSDFYDCLSSWTNKHTEFLKQGQESFSLK
                     SSTDDFTQLTILLRSSMFSGDVEPSDSLSEVEADDVTAFIKTVNEQKLHFHAVRFLLI
                     EQLLSLRTDGRCMITDFFWSPSLYEAVEFFTIGMEFNLYEMISPSTDEKLLSIGISFF
                     EIMINLMGSICNDISTKKTQGQKINELESQRNKLERKISRWHEMLSSKNLTQRLLYRF
                     KWSNFCFLQSTTDVTNNNLITTMEEIEKGLSAIPDFGTIAYSNYNNISSLSLKTVQSQ
                     FSKIKMLRRFTTVDVENEEDDTTHRDYVQHLYCILNQIPGSGSDFDSMYEFVTTSPFL
                     MKLKLWKMLINYYANKNDQMRFQTCYFSSMKFLFERLNSQEYQLQSQLQRQKTLLSTF
                     NHIGDFSKRFYQVLSQSWQSALKQPTSDQLKTLVSIFRLLYPLVFYETMAEKDSSLKS
                     FFKKAVKSSITLQDIFLTIASLMTICIKSLSDEKDSLDENSCHVIDLISALHTLAGKY
                     GFCDKFDGNFLRVQEHILCGFSNTQAFVELKRVLWCQYHISIGLDNPDDQHQTQPQTM
                     TKKNAIVLSNYLIKFQYPDRNILVLNSGRSNFKQFFEIVMELIGDIDYESNHVLSRNE
                     YFFNQFFTAPISLKTVMDAFAGELEIEFTSPNDELQSGVDGGLFYVSAVHALNQYQSR
                     KKSMQARPSELDAIMSTLTTDILYNTKRFESWYLLGKCYSFVVEDDLTWTSDKLASRD
                     KKQATAFAEKKAILCYLMALNLYLSTSSQVNSELMKNDNKIVFRGLLEALGKEMLQAY
                     VKPMSSMSYTWKPKPVLIMKEDGTLENLQVVDKPSISETNIRKCILTILAKADALYET
                     DKERSWTNPFYISKVHLKTDKTLFKNRGIHLLQEACKLSLLQSSVSGNDTILEAHYAL
                     VSACYKCFKEKVFSLEEALEQLKLDDGFFGLSDEEWEIKEEKEFYTLIIKLLKFILSK
                     DKHKWQHRPVYRIAQIKYTDFKDIEGAMEEMNKLLGLKSVNKNVVNIWKPENELPGKH
                     FVYAYQYVMFYMELLDEKHDFMAIGGMVKKLRRFGSGMINSQDAINKAVELFVNGAKS
                     ELSLNEKEHGELLMQRIPFPEFVQNSEELHQSFKKEDYPTKVLDVFLLAYNLKKGTNS
                     IQFDGVCITIYFKYFYTPFVEKKKELTPTVPPTIEITNGEQKEKSPTQQQQQSNSPSP
                     NLNGAKDKVTKMPNKVSSSVRKRVSKRDVFDRVLKLIEKKLS"
     gene            <1112441..>1113597
                     /gene="HOM6"
                     /locus_tag="KLMA_40491"
                     /db_xref="GeneID:34716477"
     mRNA            join(<1112441..1112474,1112549..>1113597)
                     /gene="HOM6"
                     /locus_tag="KLMA_40491"
                     /product="homoserine dehydrogenase"
                     /transcript_id="XM_022819808.1"
                     /db_xref="GeneID:34716477"
     CDS             join(1112441..1112474,1112549..1113597)
                     /gene="HOM6"
                     /locus_tag="KLMA_40491"
                     /codon_start=1
                     /product="homoserine dehydrogenase"
                     /protein_id="XP_022676336.1"
                     /db_xref="GeneID:34716477"
                     /translation="MSSKAVNVAVIGTGVVGSAFLEQLLSMKSQITYNVILIAKYSKS
                     LASKDYSPLALEASSWNKTVDAQGSAPFSVSEIHDFLKKSPLPTILVDNTSSEEIANY
                     YPKFIESGISIATPNKKAFSSNLELWNSIFSLKPSNGLVYHEATVGAGLPIIGTLRDL
                     IQTGDKVVKIEGIFSGTLSYIFNEFSTPTANDVSFSEVVKVAKSLGYTEPDPRDDLNG
                     LDVARKVTILARIAGFEVQSPTSFPVQSLIPSALESVASSDEFMQKLPNYDDELKQLK
                     LEAAKENKVLRFVGKVDFPSNVVSVGIEKYDYSHPFASLKGSDNVISIQTERYTNPLV
                     IQGAGAGAAVTAAGVLADVIKIAQRL"
     gene            complement(<1113627..>1118282)
                     /gene="IML1"
                     /locus_tag="KLMA_40492"
                     /db_xref="GeneID:34716478"
     mRNA            complement(<1113627..>1118282)
                     /gene="IML1"
                     /locus_tag="KLMA_40492"
                     /product="vacuolar membrane-associated protein IML1"
                     /transcript_id="XM_022819809.1"
                     /db_xref="GeneID:34716478"
     CDS             complement(1113627..1118282)
                     /gene="IML1"
                     /locus_tag="KLMA_40492"
                     /codon_start=1
                     /product="vacuolar membrane-associated protein IML1"
                     /protein_id="XP_022676337.1"
                     /db_xref="GeneID:34716478"
                     /translation="MPQGDLIFSSLRSGSRPVPKNTDTLSSVKSDVVSIDSNLRRYGT
                     HTESVETGSGKNVTIRNNTLTIGVSSEVSRSAFHGPRMKLSTTGLKPPSSKVARSQNI
                     EVINDKKNESNEQDLYNKTTKSSVELELTFHESRFSTDQVMLDITAIKGAREGDLAEL
                     KTYKKTPGSKDKKVYFIIKDFDSETKRRAKSSQVSVLSGQLQQVLDLPSRSKVWVKLK
                     DKESLTVDLIELHVKDCHVNRGDMWKFSTTLQDTCVFLGQKVSLIEAVRATVKGIYRN
                     GKKVFSGYINDNTKIVYRSESAKILFLIQITDEMWHFEEKGEETFHKVVNSLFPEIFK
                     KWKSIGTHHSISIMFCASVDRSESSFNEVTSGERLKSTDDYYRVVVDQVNIVHWVEIM
                     KTLRKEFLRIAQDLRNVKLNDDVSVIRGSLPSVIKSNLLETINVATSLITDPFKQNDL
                     RHTTTHAIIVTAGSGLYDVDYDLLKITTKKLMSLEITMDLICLTRPPLHIVPLLRYRD
                     YKNELHYCTPTWLSISFWNDSSRGNVEWRPRCKIYDVLMMGLTETELKDEIALQSLNM
                     NDKCKSVSEFMEDYDSGVFGSQNKKINVSGTIVPESKGDKAQNNNWRKNNVSKENDST
                     NVMESIKWMNPTSTDAILQPTFKEEVFAQLSSTSSAETENNHAKNDYASTAKDSLALN
                     TLKRLRDNKSGVTQRLFSKLFPELSIKKSTESLNSPQDSLTGTPTITSTTTEPLPISK
                     THSRLSFKETNLSNRNKKGDSEDYSVSSSESVNANVQERRPLLSDTSQNSSRANNSTK
                     KKMKGDSWIEIDNPSVPVDSAVASYLIPNRWRDVFPKYVAKKYTKWRSFTTPAELPLT
                     TSLFPTPYDFENQFMLRNHTVSLTIEQEGYQQSVFDLLQNMLYVRLLAGFQFCLGKDV
                     KKVEMILNKDTSGSRVTNIVTADNYTDVTIYMRIDDEIHRIVCSDQTVYVQRYVKHED
                     LKLLQNFAKYTPNVKTRYETEYRELDSDPIKAQRESYNWNHMDQVLAGYGDNVIDSTA
                     QKKFRCKFVILPAEIPPNTFQSTINGRKETLTAEEIRLEGLRKIISSISRSRLRTESE
                     KKDKKNHKEEILPEVLFYTGYLFDFIEEHNDFLKNSGTEVKNSIFMEDAETLSKDADL
                     SKIAFELQYGLDPIKLVNRKWHFKRHDNCFIGLELVNWLIEHFSDIHTREEAVIYGQG
                     LMNKGLFHHVESRHGFLDGHYFYQLKPEFTTENKPLYKTSTKHSNESNLQRKISTSNK
                     SESTKSMDPIVATESNQISEDQINIPEEHNVTVMLSNAVTINLDPNKKSYKLETCVAH
                     YDRVHNPDHCFHIRLEWLTATPKLIDDLISNWSRLVERYGMKLVEIPWDELCNIPKIN
                     PFHSFMNIRLAINPWEEEEFKDESIFKEQKFFYHIYLLEKSGFLLDNRASKFFQSEKS
                     SNYQIVYSWGKPMFKYAQYIHYSGSCMAEIRENGDLFLAPNNLHISRVNIGSIIGKSN
                     SYPKFTLDARKIMLDFKKTCETYESLRVIFLEAKEKHLENAADFEEYSPFQSFNLYM"
     gene            complement(<1118659..>1119405)
                     /gene="RPN10"
                     /locus_tag="KLMA_40493"
                     /db_xref="GeneID:34716479"
     mRNA            complement(<1118659..>1119405)
                     /gene="RPN10"
                     /locus_tag="KLMA_40493"
                     /product="26S proteasome regulatory subunit RPN10"
                     /transcript_id="XM_022819810.1"
                     /db_xref="GeneID:34716479"
     CDS             complement(1118659..1119405)
                     /gene="RPN10"
                     /locus_tag="KLMA_40493"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN10"
                     /protein_id="XP_022676338.1"
                     /db_xref="GeneID:34716479"
                     /translation="MVLEATVLVVDNSEYARNGDFPRTRFVAQIDAVEYIFQAKRNSN
                     PENTVGLVSAAESNPKVLSTFTNEFGKILSGLHETNIGGSIHFSTAIQIAALTLKHRQ
                     NRVQRQRIIIFVCSPITEDRQDLVKMAKRLKKNSIAVDVINFGETDSNTALLEEFVET
                     VNSGQEDSKSTLLNVNPGPKLLYEHIAASPIILEGSNAEAGFTMGGNEDFMDFGVDPS
                     LDPELAMALRLSMQEEQERQERLRQQSTEQ"
     gene            <1121089..>1125375
                     /gene="MET5"
                     /locus_tag="KLMA_40494"
                     /db_xref="GeneID:34716480"
     mRNA            <1121089..>1125375
                     /gene="MET5"
                     /locus_tag="KLMA_40494"
                     /product="sulfite reductase [NADPH] subunit beta"
                     /transcript_id="XM_022819811.1"
                     /db_xref="GeneID:34716480"
     CDS             1121089..1125375
                     /gene="MET5"
                     /locus_tag="KLMA_40494"
                     /codon_start=1
                     /product="sulfite reductase [NADPH] subunit beta"
                     /protein_id="XP_022676339.1"
                     /db_xref="GeneID:34716480"
                     /translation="MTSYTLAQILAQASSSVASKNNIFYTTPSKAATSSIASELAGSG
                     AVRLLSGNDPFATVSETASKDQFTTVFTDDSTLLKALPYLFQLKSLPVVINVELTLQD
                     FSVIPALKDLGFVSLVSNNFVDAKAAAEVSYNIAGKLLQPVLHYISIPYQSEGSAELS
                     LPNVEIVQEVEDKIEDLLTVNKFEFYSHDKEPTTAIVNLSPYAQEFFKVLPKDTAVLD
                     LKVYRPFDLSSLFAELPASVKDIVIVQKSNRKPENTNGFEPIQLDFFSDFNLLVEKKI
                     NQIIVTNVGDVSDFEKTLQQIVSNVKSSSPDLSLYLGTPSESESNRDLSVSIAGALSL
                     ESAYEKVLKELFKSNLEVLNEYDHETINVSSPEYGFGKFLKLKEERQRLIALAEKSLD
                     ASSYTSADGQKIVELLDQWINYNKTSLDEASIENGNKVAEELYELLRSNDHSTTALSL
                     LKRIDDVEKLKFRSSWLVGSDAWSYDLGQSGVHHVLASNENINVLIIDSDPYDKIREL
                     APKSRKKDVGLYAMNFGNAYVASVAVYSSYTQLLTAFVEAAKFVGPSIVLAYLPYNSE
                     NDTPLEVLKETKIGVESGYWPLYRFNPKDEKEEEVFKLDSSVIRKQLQDFLDRENKLT
                     LLAKKSPEFARNLEQSSSTVIQQKQERRAKAAFDQLLEGLSGPPLHVYYASDGGNAAN
                     LAKRLATRAASRGLKSTVLSMEDIVLEELPGEENVIFITSTAGQGEFPQDGKAFWDSL
                     KSSTDIDLASLNFSVFGLGDSQYWPRKEDAHYYNKPAKDLFKRLELLSGNALVPLGLG
                     DDQDADGYQTGYSAWESQLWEKLGVSNAVVPDEPKPITNEDIKIASNFLRGTIVEGLQ
                     DDSTGAISASDQQLTKFHGIYMQDDRDIRETRKSQGLEPYYIFMSRVRLPGGKASPDQ
                     WLVLDHLADKTGNGTVKITTRATFQLHGVVKRNLKHTIRAMNSTLMDTLAACGDVNRN
                     VMISALPANAKVHKQIAEVGSAISQRFLPETTAYHEIWLEGPDKDDEDPSWPEVFEKR
                     PDGPKKKKTLVAGNALVDAEPVYGPTYLPRKFKINIAVPPFNDVDVWSSDVGLVAIVN
                     ESDILTGFNLYVGGGMGSTHNNKKTYPRTGSCFGFVSVADVGDAIEKVMIVQRDHGDR
                     SNRKHARLKYTIDDLTVEVYKQKVEELWGKKFDPAAPFEIKSNIDYFGWVKDETGLNH
                     FTAFIENGRVEDSVELPQKTGFKKIAELMKKDGFGHFRLTGNQHVLICDVDDGHLEEV
                     KKIMNKYKLDNTNFSGLRLSSAACVALPTCGLAMAESERYLPVLITKLENALEEYGLR
                     HDSIVMRMTGCPNGCARPWLAEVALVGKAPGTYNLLLGGGYYGQRLNKLYRASIKEEE
                     ILATLKPLFKRWSLERNEGEHFGDFVIRVGIIKPTLEGKYFHDDIPEEAL"
     gene            <1125682..>1126632
                     /gene="AIM18"
                     /locus_tag="KLMA_40495"
                     /db_xref="GeneID:34716481"
     mRNA            <1125682..>1126632
                     /gene="AIM18"
                     /locus_tag="KLMA_40495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819812.1"
                     /db_xref="GeneID:34716481"
     CDS             1125682..1126632
                     /gene="AIM18"
                     /locus_tag="KLMA_40495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676340.1"
                     /db_xref="GeneID:34716481"
                     /translation="MIRLSQHLLNTGKRGFVYSVGRSSFRSFGSFNKPRVAVSTIAKK
                     HKKPNGFPGLLALFFGIGTIAVSGISSNLHNDQNVKENPWKSVTVDKGLDPFPTELKA
                     PDYPLSTEYIMLGYGTRAVTFLSFKVYGLGIYAAVKDLDLIPKVLDSKFLSTAFIDFD
                     PSKSHKENLKVALEDPKTSRILINNLLDSGIRLVAKITPIRNTDFNHLKDGLVKSILG
                     HPDSRKDEETLNIGLQQLREAFVRKGSVPKNSDLLIELQGNGDLQLYYFNKKTNGSEV
                     LGKVSEPLIGKLLFSQYLSGPKPLSPNTRDSVVSKLVTMA"
     gene            complement(<1126764..>1128983)
                     /locus_tag="KLMA_40496"
                     /db_xref="GeneID:34716482"
     mRNA            complement(<1126764..>1128983)
                     /locus_tag="KLMA_40496"
                     /product="pseudouridine-metabolizing bifunctional protein"
                     /transcript_id="XM_022819813.1"
                     /db_xref="GeneID:34716482"
     CDS             complement(1126764..1128983)
                     /locus_tag="KLMA_40496"
                     /codon_start=1
                     /product="pseudouridine-metabolizing bifunctional protein"
                     /protein_id="XP_022676341.1"
                     /db_xref="GeneID:34716482"
                     /translation="MLRSNMRLCSKRVGFRRYHLKISDEVKDALHNKRPIVSLESTII
                     SHGLPYPQNIEMALAVEREIRRNGAVPATIAFIKGVPKVGLDATEIEQLAEYAQKGAI
                     NKVSRRDIAYTMANKLYGGTTISSTMILSEKAGISVFATGGLGGVHKGGELTLDVSAD
                     LEELGRTPVAVVCAGPKAILDIPRTMEYLETKGCMVATMGPKGTNVPGFYTRDSGVKS
                     PYNFQSYAEAAQIIHSGNSFGLRSGYLLCCPPPKEVALDEHIINGIIEDACREAEYRG
                     VAGKELTPFLLKEIALKTGGASVSCNISFVLNNASIASKIALELSRLQNTGQAAIDNE
                     PLHLKSSQNDLASNKEEIKKKTYSAVIGSVALDTQCKLNSPKVYKFDSNPGKASNSIG
                     GVGHNVALSANLSNRSSNHETVLISSVGDDYAAKAILSDFGMSKEGIYVDKTQSTAQY
                     ISLLTQDGELFIAGSDMDIATKIPLDHINEKIKSLNPNVVLVDANISVPVLQYLVTLR
                     KELGFKLIFEPTSSAKASKIANIKNLGVYPNHDFDIITPTENELKAIHQAMDNAGKFD
                     LDNWFPVLDSLKIDKNISIKNRANNKHLKYLLDVGIFQTASLLLPYFPRIIVKNGARG
                     VYIFSIEKVNSPSKLQLLSQNSDFCMFAKGDVINGDQYGVLVENHAVPVRVDVSNVSG
                     AGDTLVGVLLNELSINPSCLDIDDISRRKNCLDRAQLGAKLSIEDTETISKKLRHLP"
     gene            <1129253..>1130527
                     /gene="TTI2"
                     /locus_tag="KLMA_40497"
                     /db_xref="GeneID:34716483"
     mRNA            <1129253..>1130527
                     /gene="TTI2"
                     /locus_tag="KLMA_40497"
                     /product="TEL2-interacting protein 2"
                     /transcript_id="XM_022819814.1"
                     /db_xref="GeneID:34716483"
     CDS             1129253..1130527
                     /gene="TTI2"
                     /locus_tag="KLMA_40497"
                     /codon_start=1
                     /product="TEL2-interacting protein 2"
                     /protein_id="XP_022676342.1"
                     /db_xref="GeneID:34716483"
                     /translation="MNKTILAFSQALENDKLKVPEDELLQEVIDQYRNYTNLNKEEWF
                     VDGLVGLCYFALQKREIINVVDAYLQQNGDELIPILISKLKPMLVKADGVSSGNLTAS
                     GRRKIESSSTKYGLQPRLGFEETFGESKWEEWRLNGGIRGIGLFYMIVRNLKKRDIST
                     NLPWISPGILNIIDDTTVGADNVRLYGILLLQELLRSILKSDENNKYTFSFKDTGLHQ
                     IYEPILTGLLYHLPPSSTAEETLRIWEVTYPTLQLLLEVEAFGNTDEYRTKLGQMFSE
                     TILQLTIPRIGLEHVALAQWILSYCERIISILEQDSTIYLQRILYVLGEYYFRNPFIT
                     LNMEVLEQSLHIVETLCHQALPESIRNQQYDILACILLTYEKCSTEGALTPNISSKCK
                     KLLKLLESLGCDFQNDIAHLRKRKSLIDLFQQ"
     gene            complement(<1130625..>1130888)
                     /gene="TIM8"
                     /locus_tag="KLMA_40498"
                     /db_xref="GeneID:34716484"
     mRNA            complement(<1130625..>1130888)
                     /gene="TIM8"
                     /locus_tag="KLMA_40498"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM8"
                     /transcript_id="XM_022819815.1"
                     /db_xref="GeneID:34716484"
     CDS             complement(1130625..1130888)
                     /gene="TIM8"
                     /locus_tag="KLMA_40498"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM8"
                     /protein_id="XP_022676343.1"
                     /db_xref="GeneID:34716484"
                     /translation="MSSISQTDLANLDDGSKKEIMNFLESENSKQKVQMSIHQFTNLC
                     FKNCITNVHNADLSSQEEQCLNNCVNRFLDTNIRIVKGLQSIQ"
     gene            <1131266..>1131940
                     /locus_tag="KLMA_40499"
                     /db_xref="GeneID:34716485"
     mRNA            <1131266..>1131940
                     /locus_tag="KLMA_40499"
                     /product="central kinetochore subunit MCM22"
                     /transcript_id="XM_022819816.1"
                     /db_xref="GeneID:34716485"
     CDS             1131266..1131940
                     /locus_tag="KLMA_40499"
                     /codon_start=1
                     /product="central kinetochore subunit MCM22"
                     /protein_id="XP_022676344.1"
                     /db_xref="GeneID:34716485"
                     /translation="MEQEQPNVYRQALQKEIIAKQELLKEAREACTRLTESQNINSVS
                     GKVWEQLTYRQMYTPNRSDPIGIAYLNQNLRMENEQSLLNDTEMKLKAMVDRQKSFNE
                     DLKSVIAKLEGKYQKGINSETRNDNDTKAADVNMRINEVRTKIYALIKNNMAVDISGP
                     DFPVEQATEKLTGLLNRLLEGDETLSVRDFEPHCMHFFRLLDKAYLLEKKEVDGDVYL
                     RLEEFF"
     gene            complement(<1131959..>1134280)
                     /gene="RIX1"
                     /locus_tag="KLMA_40500"
                     /db_xref="GeneID:34716486"
     mRNA            complement(<1131959..>1134280)
                     /gene="RIX1"
                     /locus_tag="KLMA_40500"
                     /product="pre-rRNA-processing protein RIX1"
                     /transcript_id="XM_022819817.1"
                     /db_xref="GeneID:34716486"
     CDS             complement(1131959..1134280)
                     /gene="RIX1"
                     /locus_tag="KLMA_40500"
                     /codon_start=1
                     /product="pre-rRNA-processing protein RIX1"
                     /protein_id="XP_022676345.1"
                     /db_xref="GeneID:34716486"
                     /translation="MSSNDVPLSLLAKAIEEAEGAQFRSILHTLRSPNYVDQSLLKGD
                     LSVFVAKLLKLLRSSEPYQIWKGCHAVSVLCTYNPVVLCSQANQLLTVLYTRLESFVE
                     YYKETSQSKARLATLKTLTKTVDIMMDLIRGKPTLTREALTPKLNSIIPLLITLSQYE
                     TALCLPILKKLLLQNTTTFKPFANKYRVILTNLITKEFQLHDDETQRMICDNFALLHL
                     IKQTAQKVDENQEHHKSSPDEHWRSGLYSILCQFKPLILLCGEMLDFSVDKELLRLVE
                     SLPTQKNETDSKNQLFGPLAIDMNESFTLWEILYRVEVLSKLLISFISLPTPFPLRIP
                     LHGIISVCEALLMLTTNYLPLKRGLRRESELTAVIASVLRSLQYQGILVLQTVVKCYG
                     TDILYYYSSILSSLELFIPIKSKGNTIDYDKVELMKHEFFGLLSLMNLLSKRLGHKVS
                     EMDLFTKLTDITLRLTEDKSTLGRFYASVNDSKTIKQTTKQKKDFNKMAGAMSDVYSH
                     PKQFINKTELTWYDEANNFLSMVIKNWKLPSTQQVSIIKYAVITSMTLKEHIGYIPQS
                     FEDLLTTLVLQPGNERISILPIAVGLLKGTDNKVLDILCNPRLPFVSILNLNASALNK
                     DARTQLKMPQEDDSEDVSDNESNTNADQEVVENAEIPVSNPITAEETETTTSYKPQSI
                     VSDPSQLLKKRSVEETVTENEDQETKRSRIEPTVQVEPTPAVEPVPIAEPAPIVQPTV
                     SKNNEGPSSDSDSDSEIEIPALNVSDDEDEDDE"
     gene            1134578..1134652
                     /locus_tag="KLMA_R423"
                     /db_xref="GeneID:34718721"
     tRNA            1134578..1134652
                     /locus_tag="KLMA_R423"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34718721"
     gene            <1134963..>1136915
                     /gene="SGM1"
                     /locus_tag="KLMA_40501"
                     /db_xref="GeneID:34716487"
     mRNA            <1134963..>1136915
                     /gene="SGM1"
                     /locus_tag="KLMA_40501"
                     /product="protein SGM1"
                     /transcript_id="XM_022819819.1"
                     /db_xref="GeneID:34716487"
     CDS             1134963..1136915
                     /gene="SGM1"
                     /locus_tag="KLMA_40501"
                     /codon_start=1
                     /product="protein SGM1"
                     /protein_id="XP_022676346.1"
                     /db_xref="GeneID:34716487"
                     /translation="MEKLSVQERLNLAAKAKSKNRKKNKRVTSPGVAEPTPEIDKVDS
                     HDAEGLQNNETEYKKTEEDSDDALREFYGKLLHMETDSLLELDSITLLRKLYPIIKEP
                     ELPSSENPSDSSLIKLIKEKDEKIEALTKEGESLSKKELVQSDKIKKLNKTIKELESD
                     FGIKLDELQDVKTQVNVLENTNQSLMTSLKDTESQLDSLNKKYENLKKEYDDHMDNEY
                     ATKKAELKKLGEENTVLKEKLAAMVNNEAKLQKSFDTKYKALEEVSAEEVNRLEIRLE
                     QLRIDLENATTTSNATGLKSSGPDFNSYEKLQSQYKSAVQELEERNKSFASIEYALTE
                     QCESLKRDKAEAEGTIESLNNELSNLKESHSSFISQVAQLTKKNHELTNSLAKVQDEL
                     SNNQKKLEDLTDDYETLKKQHEIQKTQLERALSMKPTIPTEAQSKESENLKRDSNNNF
                     NFLQEDPMTKWNLNHEGLDSIDPLDGEDIDNNSAASFSFEKDLDIPEEAADLELMKKG
                     STDLSLNLNSTQLRTNTGRDSHSYANNTNLQMVTKLGGEIRRLETELLSMKDAYNKLM
                     EEKEEANEEISRLLESNEEVETLKVNNSKLSQQIEQLENKQSTLLQLLGEKSERVEEL
                     ENDVADLKDLMRTQVQQIVQLQEQLG"
     gene            complement(<1137010..>1137654)
                     /gene="XPT1"
                     /locus_tag="KLMA_40502"
                     /db_xref="GeneID:34716488"
     mRNA            complement(<1137010..>1137654)
                     /gene="XPT1"
                     /locus_tag="KLMA_40502"
                     /product="xanthine phosphoribosyltransferase 1"
                     /transcript_id="XM_022819820.1"
                     /db_xref="GeneID:34716488"
     CDS             complement(1137010..1137654)
                     /gene="XPT1"
                     /locus_tag="KLMA_40502"
                     /codon_start=1
                     /product="xanthine phosphoribosyltransferase 1"
                     /protein_id="XP_022676347.1"
                     /db_xref="GeneID:34716488"
                     /translation="MSQEDSAASNKMYISYNNIHKLCQQVAKTIMERGERPDVIIAIT
                     GGGMIPARIIRSFLKSKGQKNIPIQAIGLSLYEDLGLDNQIETIGKEVIRTQWLDFGA
                     LDKHFDSLIGKRILIVDEVDDTRTTLHYALTELQKEVREQQVKLNRLNEDTTFSIFVL
                     HNKDKPKKVELPQDLFDHGRYLAAVTVPDKWLCYPWEAIDIEEHTQLAIEQGNN"
     gene            complement(<1138027..>1139664)
                     /gene="UTP9"
                     /locus_tag="KLMA_40503"
                     /db_xref="GeneID:34716489"
     mRNA            complement(<1138027..>1139664)
                     /gene="UTP9"
                     /locus_tag="KLMA_40503"
                     /product="U3 small nucleolar RNA-associated protein 9"
                     /transcript_id="XM_022819821.1"
                     /db_xref="GeneID:34716489"
     CDS             complement(1138027..1139664)
                     /gene="UTP9"
                     /locus_tag="KLMA_40503"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 9"
                     /protein_id="XP_022676348.1"
                     /db_xref="GeneID:34716489"
                     /translation="MVESGYSGGDFITSFSPGANFFAFQSNRSQKNSIELYPLQDINN
                     LQITSSQVHQIDYENYDLLVSEVKLLTWCNNNIPTENNAKTRSVKRRGNEEIQSERTE
                     QYFVNVFPKGKIVVYSSNGKEIINIIQNKKDILGIDSNEDVIWILDDEKTVKRFNYTT
                     SKPLQTFHLTDGKNDDIINFQLLRFPNKLLLAITTEEVIYIIDPSKKRPSTFAKIENF
                     GSISCTVYDEDHVVIADVSKVILYSLSEKKSIMEWNIECEKVKVHDDTIVVLDVSGNI
                     KVLSAKSEEPLASVKVENSEILDFELKEDSIVLAWIDVNEPKFEVISKSQLEEKKEFA
                     FNSTSPIDTVSEITEETVNKDKPESNRKVSKKEQNETAQMLISALVDSDSNPVHILDL
                     LLQPAWTDHNIHLFVRDDVNADIVNKLFDVLAKHISANPASTGQASTWLKWLLTLRRS
                     QIKSINSNTNKLTKRLRSSLRTSAESLPTLLSIQGKLEMLAGQSLLRKQFASMDVNQE
                     TSSDVQNGEQDDDAEAGFLFENGEADELDDQSQELQN"
     gene            complement(<1139973..>1143131)
                     /gene="NMD5"
                     /locus_tag="KLMA_40504"
                     /db_xref="GeneID:34716490"
     mRNA            complement(<1139973..>1143131)
                     /gene="NMD5"
                     /locus_tag="KLMA_40504"
                     /product="nonsense-mediated mRNA decay protein 5"
                     /transcript_id="XM_022819822.1"
                     /db_xref="GeneID:34716490"
     CDS             complement(1139973..1143131)
                     /gene="NMD5"
                     /locus_tag="KLMA_40504"
                     /codon_start=1
                     /product="nonsense-mediated mRNA decay protein 5"
                     /protein_id="XP_022676349.1"
                     /db_xref="GeneID:34716490"
                     /translation="MDVHLLFQCFEGTLNQSGQIRHEAEQKLKELSKTPGFLGACLDI
                     LSNGEVPESIKISASLYLKNKIYYGWSKRSGSSNELLNIEVDADEKPVVKDMLINTLV
                     QCAHTSPNCVRMLQPALTTIVGEEFPAGRWNNLLEESFKLLASNDIDSAFIGLLALSE
                     IFRTFRWSTNDERQNLERLIAQHFDDLLAYANQLIYHPGAVDDNKIGNMVKLIVKIYK
                     FITYHDFPFTLQAPERFIPWANFHVAIIELPFSQNFLDSVDKDSRKNYQWVKAKKWAY
                     SNMLRIFQRYASESLTRKFSYDDFKQMYLKDFMPNLLQLYFHQIEEWGTNKLWLSDEC
                     VYNILNYIEHSLTQKASWLLVKPHYNVILQHIVFPILCPDSETLETFENDPREYIHRH
                     LETWNDDYSPDVAAVSLLVTAVQKRSKTTLEPTLTFVTESLNAIKAASSGFQSLPLEQ
                     AVKVESCLRIVTNIIDRLTSPKSPYSKAMEEFLHAFVFPLFNSNYGFLRARVCEICSK
                     LSEYEFTKESSIPIIYEGVMHCFNDESGFLPVKLLAAFALQSFVQNTTFQESLSTIVV
                     PTMQSLLQLSNEFESDVISGVIREFVEQFSKELQPFSVELTNNLVQQFLKLAIELNDA
                     SRADVNAFSGGDLPDESDKEMAALGILSTIISILLSFENSTDIIESLEHSFYPAAEFI
                     LKNDMEDFYHEVCEFIENSTFLLRRVSSISWKVLELIGECNRKEGSMVAFYLEDFMMA
                     ISNYLIYGKDELKQNQFYTNILFEIFQTATANGNEDNDLDEMCVIFEFAQKMILAFGD
                     KIPENYLSTFLETTCKGIEVEKESLKTHLNYGVNSFNVLLASIVYYPSQTLQYLHHKN
                     LLTTFLEIWIQTFLPKFTRVIDIKLSIMAILSLLTQVPTQEFHALQIEPVYSKLGPML
                     VELFQKFPAALKALQDKRQEFSSDAFSKFDGFDDEWNDYEDDDEDAVDEAEEYLKFLN
                     GQADGLKLVRESGEFLDQDDMDELEEDPLSGSVIDDINVYELFQHTFTRLQQNESEKY
                     QHFLSSMSPEEQQTFFNTLNAQ"
     gene            complement(<1144772..>1146616)
                     /gene="MDM31"
                     /locus_tag="KLMA_40505"
                     /db_xref="GeneID:34716491"
     mRNA            complement(<1144772..>1146616)
                     /gene="MDM31"
                     /locus_tag="KLMA_40505"
                     /product="mitochondrial distribution and morphology
                     protein 31"
                     /transcript_id="XM_022819823.1"
                     /db_xref="GeneID:34716491"
     CDS             complement(1144772..1146616)
                     /gene="MDM31"
                     /locus_tag="KLMA_40505"
                     /codon_start=1
                     /product="mitochondrial distribution and morphology
                     protein 31"
                     /protein_id="XP_022676350.1"
                     /db_xref="GeneID:34716491"
                     /translation="MFRASRLGSAAANVTSGLTLNHFACRPRLFNWCTVGCISYQYRP
                     YARIHLRHYSNSKDPDSRERGHHQQQQQQQQQQQQLEQGKKKQPLHPPFRFITERDRL
                     LAQATSILQRLRINLKWTLTRSMRPFNTDDISAVVSWVLVSNVLLIFLFTTTFLSLAI
                     YLLNTVFAQEYLATKVGNFLTKNSALSVVFESAIVPDWSSGKISFNRVFVSRRPKLPY
                     GVTKGSQQEAVERAKLALSERLLVSREDFDDGNYTQFDLTIDQVEISVSLSKWINGKG
                     FLDEVTINGLRGVVDRTHVFWKENDDARNYLNVHQPGDFEISKFVMNDVLFTLYQPNG
                     FRPFLVSIFNCELPQLRKHWLFFDFLNADNISGSYDNSMFTIHKKYKERDVNTKAESD
                     NASGSGSTGSTSHHSPWHKVTQMRVDNLNIDHLNAGIEGPFGWITSGQVDMIGDLLLP
                     ENDIDASQISEILTVVRDTILKEARRHSDIIPVDIPEPKDIDVKQYFIMDFFLKLHNV
                     KAEVPLFSTDLSYINNALIRPIVGYINSRRTYIPIRCRVVKNLNDFSGAWTIYDSRLM
                     DDLSAEVYDAFADYVADDERINLRMKRVGFWTLQLIIQVVLMSLGAIA"
     gene            1147131..1147204
                     /locus_tag="KLMA_R424"
                     /db_xref="GeneID:34718722"
     tRNA            1147131..1147204
                     /locus_tag="KLMA_R424"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:34718722"
     gene            <1147583..>1148104
                     /gene="EGD2"
                     /locus_tag="KLMA_40506"
                     /db_xref="GeneID:34716492"
     mRNA            <1147583..>1148104
                     /gene="EGD2"
                     /locus_tag="KLMA_40506"
                     /product="nascent polypeptide-associated complex subunit
                     alpha"
                     /transcript_id="XM_022819824.1"
                     /db_xref="GeneID:34716492"
     CDS             1147583..1148104
                     /gene="EGD2"
                     /locus_tag="KLMA_40506"
                     /codon_start=1
                     /product="nascent polypeptide-associated complex subunit
                     alpha"
                     /protein_id="XP_022676351.1"
                     /db_xref="GeneID:34716492"
                     /translation="MSEIPQGSNVSIFSKNEKKAKEQILKLGLKPVPGISRVTFKKKD
                     NQIFAIDRPEVYKSQGGNYVVFGEAKIDDFPQRLAKAQEAAQAEGVLPAGQDAVSKDP
                     QSIQADMQAAADNAGKEAPADDDDEEVDESDLKADDIEIVMQQANVTRAKAAKALKAH
                     NGDIVNAIMSLSD"
     gene            complement(<1148250..>1149071)
                     /locus_tag="KLMA_40507"
                     /db_xref="GeneID:34716493"
     mRNA            complement(<1148250..>1149071)
                     /locus_tag="KLMA_40507"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819825.1"
                     /db_xref="GeneID:34716493"
     CDS             complement(1148250..1149071)
                     /locus_tag="KLMA_40507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676352.1"
                     /db_xref="GeneID:34716493"
                     /translation="MLRAVRKIIGGDNDVKSVVQKYNKDLSSITNKIHDYEASLKGVD
                     TKRKRVSSAVTYYYLTVLTVVVAYVYVKSSTAAAVLSVIIGLLVLIGIRLVIKRVYQM
                     LSNKYESRIAALRSLHQEKMEELKQKTNFYYTNSLIQRFSSGESGSDDLMLLIDDEVK
                     SKQEQLEKLKAELDRLREDEQLKSQSEDVEAREKWFDKALGLLAGGDDVKNLQSSISL
                     IVCPQCKESRGCYSAVGVPFTYICTNCGYKQDNSTNNSKEPQETDSLTTTETSTN"
     gene            <1149366..>1149767
                     /gene="CTF8"
                     /locus_tag="KLMA_40508"
                     /db_xref="GeneID:34716494"
     mRNA            <1149366..>1149767
                     /gene="CTF8"
                     /locus_tag="KLMA_40508"
                     /product="chromosome transmission fidelity protein 8"
                     /transcript_id="XM_022819826.1"
                     /db_xref="GeneID:34716494"
     CDS             1149366..1149767
                     /gene="CTF8"
                     /locus_tag="KLMA_40508"
                     /codon_start=1
                     /product="chromosome transmission fidelity protein 8"
                     /protein_id="XP_022676353.1"
                     /db_xref="GeneID:34716494"
                     /translation="MPSVDISINKLIDIFSKDADASTTINTPLGHVMIEIQGDLLYPS
                     KRIDPENDVDCRFIRQDGEDMVRFGILSYDLQTRKATLFIGSKQRMLGQIVKIDPPLG
                     VLKFDKEDGTVSLRDVIRYKILFKDRPLPIM"
     gene            complement(<1149809..>1151455)
                     /gene="MNS1"
                     /locus_tag="KLMA_40509"
                     /db_xref="GeneID:34716495"
     mRNA            complement(<1149809..>1151455)
                     /gene="MNS1"
                     /locus_tag="KLMA_40509"
                     /product="endoplasmic reticulum mannosyl-oligosaccharide
                     1"
                     /transcript_id="XM_022819827.1"
                     /db_xref="GeneID:34716495"
     CDS             complement(1149809..1151455)
                     /gene="MNS1"
                     /locus_tag="KLMA_40509"
                     /codon_start=1
                     /product="endoplasmic reticulum mannosyl-oligosaccharide
                     1"
                     /protein_id="XP_022676354.1"
                     /db_xref="GeneID:34716495"
                     /translation="MKWTVTPIICAVLAITVYQYGARFLQETYKSKDVKFEIESVFLE
                     SWTDYRENGWGYDVYGPVSKKGKNMGRSGDPLGWIIVDSIDTMMIMYNKSSDEDHRKQ
                     FAAEIQLAEEWVDNTLNYDIDSEVNVFETTIRMLGGLLSAYHCSETYKVGNSTVYLNK
                     AIDLGDRLASSFTQSATGIPYSSINLGSGKAIKNHVDNGASSTAEFTTLQMEMKYLSY
                     ITGNSSYWTLSEAVYEPIYKNNNVLGRHYQGLVPIYTNPDTGMFQGSTIRFGSRGDSF
                     YEYLLKQNLLTGESLYRKLYNFSMKGMKRHLLDKSRGNLALTYIGEKEYGLAGPTSSK
                     FDHLVCFMGGLLAMGATDGKPYTEAISSPDWDPTKQSDWDLAQQITKSCYEMYRQIPS
                     GLSPEIVVFNSNYPVYEDNWWVSETKDYFVKPLDRHNIQRPETVESLMFLYHLSGEEK
                     YRHWGYEIFKSFVKHTKVVDEDTETSAYTSLHDVISIPTNKADNMESFWLAETLKYLY
                     LLFDDEVDLTKIVFNTEAHPFPVFDQKRLDELNLTTGWKP"
     gene            <1151870..>1153948
                     /gene="STR2"
                     /locus_tag="KLMA_40510"
                     /db_xref="GeneID:34716496"
     mRNA            <1151870..>1153948
                     /gene="STR2"
                     /locus_tag="KLMA_40510"
                     /product="cystathionine gamma-synthase"
                     /transcript_id="XM_022819828.1"
                     /db_xref="GeneID:34716496"
     CDS             1151870..1153948
                     /gene="STR2"
                     /locus_tag="KLMA_40510"
                     /codon_start=1
                     /product="cystathionine gamma-synthase"
                     /protein_id="XP_022676355.1"
                     /db_xref="GeneID:34716496"
                     /translation="MKIATEVGDSIPPNTKHAVSVSLPTWEATVGYEEGEKWVVERMT
                     TGYPRFFIHKSIQRLCNVLKDKYAKEEETCLVFPSYQVAKRCREFCKVKSKVTLRNKI
                     RILQLATSKPLNKEEESWKRECKIAVVFAQKDLYPLLKQYWQHTGEIISSRLAEYVLA
                     ELFELEHSDGKQNEEFVENRFGRSLDFSFAGRAKLLIKRRIARKVVDVDEDDDETAQQ
                     QQEQQEQQQQQQQQTNNRSDSGSDDEASTATGNGEDNETSFTHSPGIPRDDVIRVEFS
                     DVDDDEDDGNFAHMDHNSAIPAELIDEVEFEQINISPPSPQNTDCASSGILTDNLEAT
                     SIHLNPERDVFLFPSGMASIFTAHRLLLELDSKRVRRNAVTSDPIGYGGAYKKTVMFG
                     FPYTDTLSILRKFNHTHFLGHGDAQSMAELKEILHSGEQILAVFLESPSNPLLKMADL
                     VELKRLSNIYGFYIVIDETVGGFLNIDVLPYADIVCSSLTKIFSGDSNVMAGSIVLNP
                     KSGLYEFATKMLHLTEKWYEDLLWCEDAICLERNSRDFISRSIIVNENTEALLEKVIL
                     PNVGEGKLFKRLYYPKYTSVETKANYDTVKAKSVGSGYGGLFSVTFHNIEQAKMFFNS
                     LELCKGPSLGTNFTLACPYTILAHYQEMEEVAKYGLDVSLVRVSVGLENKSELQAVFE
                     KSIAHALGKE"
     gene            complement(<1154281..>1154457)
                     /locus_tag="KLMA_40511"
                     /db_xref="GeneID:34716497"
     mRNA            complement(<1154281..>1154457)
                     /locus_tag="KLMA_40511"
                     /product="ATP synthase subunit J"
                     /transcript_id="XM_022819830.1"
                     /db_xref="GeneID:34716497"
     CDS             complement(1154281..1154457)
                     /locus_tag="KLMA_40511"
                     /codon_start=1
                     /product="ATP synthase subunit J"
                     /protein_id="XP_022676356.1"
                     /db_xref="GeneID:34716497"
                     /translation="MVKRFPTPVLKPYWPFFAGGAIMLYAISKAADLSANSKEFINDP
                     RNPRFARGEKPVEL"
     gene            <1155671..>1156714
                     /gene="DAL2"
                     /locus_tag="KLMA_40512"
                     /db_xref="GeneID:34716498"
     mRNA            <1155671..>1156714
                     /gene="DAL2"
                     /locus_tag="KLMA_40512"
                     /product="allantoicase"
                     /transcript_id="XM_022819831.1"
                     /db_xref="GeneID:34716498"
     CDS             1155671..1156714
                     /gene="DAL2"
                     /locus_tag="KLMA_40512"
                     /codon_start=1
                     /product="allantoicase"
                     /protein_id="XP_022676357.1"
                     /db_xref="GeneID:34716498"
                     /translation="MLQFKENQAKEFENVVSQTHQSVEILSDRVLGQVVSYSDQWFAD
                     ATNLLKPTAPVRDATRFTHAGAWYDGWETRRHNTEEYDWVIFKAGVHAARIIGCEVDT
                     AFFNGNHAPAISVQALRHEDAASAPSDISEKDVRWTDVIEKVECGPSQRHFFLREALT
                     DDHYNYFKLKMYPDGGIARFRLYGKVVAPEQAAASAKPIDLCSIANGAVAIAVSDQHF
                     GSANNLIMPGRGHDMSDGWETSRSRTPGHVDWAIIRLGKLTSYIDRIIVDTAHFRGNF
                     PQFIKVEGIAVDGTTAAPHHDDPKWTTLVDKSKAGPDKEHEYKIDKVLQITHVKLTII
                     PDGGVKRIRVFAT"
     gene            <1156972..>1157913
                     /locus_tag="KLMA_40513"
                     /db_xref="GeneID:34716499"
     mRNA            <1156972..>1157913
                     /locus_tag="KLMA_40513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819832.1"
                     /db_xref="GeneID:34716499"
     CDS             1156972..1157913
                     /locus_tag="KLMA_40513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676358.1"
                     /db_xref="GeneID:34716499"
                     /translation="MDVYDRIHAREPVKDVLQYISDNNVELEPTQFLNQLEVVQERNS
                     YYAKQFLKLLIPYLEKIGSELSETVYEPYINLLAVNAPDPQSSDIIQYRFGSYKLLIK
                     ETPSLICAQGTTGFRTWEAALFLCHFMTQNPHLFATDDGGSSMLELGCGTGIISILYT
                     LMQKEKEKENKGSLENHIFVTDGDSSLLQQVKDNFLLNDITAVPELRFQRLRWNEDEL
                     LQAERDKKVGLILGADITYDTSVIPDLVGCLKQFAGADAYISCTERNMATLEAFENEL
                     TRNCLDFEIVATISPESFKQISVRNITTSIRIYRVRT"
     gene            <1158000..>1158902
                     /locus_tag="KLMA_40514"
                     /db_xref="GeneID:34716500"
     mRNA            <1158000..>1158902
                     /locus_tag="KLMA_40514"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819833.1"
                     /db_xref="GeneID:34716500"
     CDS             1158000..1158902
                     /locus_tag="KLMA_40514"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676359.1"
                     /db_xref="GeneID:34716500"
                     /translation="MNGNESDSALLRKYKNQVKLLTEEIAHHENEQSVRDWQIDELKV
                     KLRSVTEELKNVKQDLEFETQRSQTLEEANSELQLRLRESKSQHTAILQELEQLKSEK
                     RVISERIRQSYVELGTRRKISTNLIPDNNSDDEYEYKDGNGNGKDHDVLEGTVANRRI
                     SSRKFSSKTTTSEEQELSSFDEWSDDEVDELHEIEQDGDALEPKHEPAASQTLLQQYE
                     TLIDDLQHENEKLVAQLRIQALRTANISVSPPLRKFLHETYPVMAKRPTYILLWQPWF
                     SSSSSCPGGKFKPVSMGVLLDIDM"
     gene            <1161874..>1165947
                     /gene="TDA9"
                     /locus_tag="KLMA_40515"
                     /db_xref="GeneID:34716501"
     mRNA            <1161874..>1165947
                     /gene="TDA9"
                     /locus_tag="KLMA_40515"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819834.1"
                     /db_xref="GeneID:34716501"
     CDS             1161874..1165947
                     /gene="TDA9"
                     /locus_tag="KLMA_40515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676360.1"
                     /db_xref="GeneID:34716501"
                     /translation="MDSVADSTLVSKAVAQPSPHHAVIKREHEQERERQIEAEAEAEA
                     EAEAEAETEIEPGASTGLSSSSSNRSEGNDSRNTPCNSSSNSNTPGIVPIPRKSRIIK
                     TDRPRPYLCPTCTRGFARQEHLKRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLH
                     ASLMDQDKNPDIIMASKEVKVNYSARHIIKKPGNKETVLPTPAMSVPQLEHSMSMGSA
                     RKTSSKQLQVPLLPHLLLPLQQQQQQQQQQQQQQEQQQQQQQSPDEQQHSPVHSEDPN
                     LHAPKKRKRHASFSASTNISYTQRKDVPQLFDTEQNNVPHQVGFSTPQLTAQELTDKA
                     LESGLNIDFLEPPEFMLSDPSVQPDLKPKQPGVNDITFNRNSQIPPGESSSKIHNASQ
                     RNDGMQLDLGQVSKDLHNKHQFPAGLTPLISDMLTMRSATAGVGGFVDLNAEQNLDYF
                     NYKDNNDEPHHGQHLSAGANRMNIQEPDNYKQKETPTTATTTSTVSGFHSQNGNADGS
                     GVSMPNMSTSHKQTSELIHEFISNMGPQNPEVQHDNKTSSNINTQQHFMKGQDSQRQD
                     QVLDLSGKRSSSQQQQQQHLYNPEDEHWLSEFINTQIDGNFKVNMTSFNEIGFPATTS
                     SHRNSFSISSNTQHSSPSKNAGPLNAQQMANTQLPQALPNSKFTIGSPKFMRDAPTSA
                     PLSKTPSQSFSPDISTLFKSRQVDLFKKIMDKNGIATPGLSPNSISNGAKPKKGTRLV
                     FFDEVLRQKILLENNLLSTQFPTLEELNTYANLYQDEFHMYFPFIHLHSIKPSMRIYP
                     LLLSICVIGALYGFHSSHAMLLFNISRFHIREYLERTKDHHHETPLWVIQSMVLLIFL
                     GIFNNDMSITQTMNTQIMSLIELVKLKQLNLPLENIMPLPIESDHILEYQDYPELQEQ
                     IRKQYRTKEQMEKNFQYFIKAQSRIRTCHTILLISNLFTSLVGLDCCFHSIDLKCGIP
                     CYNEQLYFCENSVEWTELLKNDNIELDSKFSLIQLSNGDETYKNCLIYLTNGHQFFYD
                     NKKVSFKTLLSLLISIHEKIFLERYHLKRETNIQIIEMKWRMHSRPIIESLIKFWEAL
                     YLKNGGILQPNENNIELINNNPALRLIIPLHSFAKMRKCISLTSVMNKIWLKDWQAMN
                     IDLENSFSDWDSLREATDYGLNIVKFWIDTVSIVKNAEKTSIRTPIFSITCIFSAILT
                     IAEFLKRMERKALTWKHNQLQPTSNTSNSTSFMNYVDRTIWLKSEMILKKVETHLLPK
                     GYNMQSYAEFLRIQANGALDVEVLDDELAKRAMDPNTDIHETMQVVQRARLSSRSLYL
                     GVRILGDAPIWPIALLFAHALQARAIYNVSHPSQYQT"
     gene            <1166371..>1167621
                     /gene="DUS1"
                     /locus_tag="KLMA_40516"
                     /db_xref="GeneID:34716502"
     mRNA            <1166371..>1167621
                     /gene="DUS1"
                     /locus_tag="KLMA_40516"
                     /product="tRNA-dihydrouridine synthase 1"
                     /transcript_id="XM_022819835.1"
                     /db_xref="GeneID:34716502"
     CDS             1166371..1167621
                     /gene="DUS1"
                     /locus_tag="KLMA_40516"
                     /codon_start=1
                     /product="tRNA-dihydrouridine synthase 1"
                     /protein_id="XP_022676361.1"
                     /db_xref="GeneID:34716502"
                     /translation="MTSDKLNGRQLFEKIGKPTKIVAPMVDQSELAWRILSRKYGATL
                     AYTPMFHAKLFATSEKYRKDMWCELDGDEKIDRPLVVQFCANDPDYLLQAAKLVEDKC
                     DAVDLNLGCPQGIARKGKYGAFLMEDWDLISKLIRTLHENLKVPVTAKIRVFPEREKT
                     LEYAKMVLNSGAQFLTVHGRLREQKGQKTGLADWEIIKYLRDNLPSDTVFFANGNILY
                     PEDIARCMNEIHCDGVMSAEGNLYNPGVFNTSHTEDKEKIFPRVDKLLREYFEIVKSC
                     NGSHASKIAMKSHFFKVLRPFLPHNVDIRANIASMTANTSFEEWEEKVVKLVEDRVQK
                     LFEEPDIAEKDIITVGEPQPWGGAYRTVPYWRCQPYFRPVNGVTADKRVTDALKSKQS
                     LDAESLKRKPECELEHGKEKEIKV"
     gene            <1167976..>1168614
                     /locus_tag="KLMA_40517"
                     /db_xref="GeneID:34716503"
     mRNA            <1167976..>1168614
                     /locus_tag="KLMA_40517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819836.1"
                     /db_xref="GeneID:34716503"
     CDS             1167976..1168614
                     /locus_tag="KLMA_40517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676362.1"
                     /db_xref="GeneID:34716503"
                     /translation="MEFEMRPDALTSRTLDRVTEDPIVLPYFVEFPALNPSDLLKKFI
                     AKEGLIRHGTGPYFKETDRSPLQVKITDTNNGSDDTGAAVTNRDAFSLITVLYTPDAP
                     VGSFLKLKNTSIHIVQKGKGKVVLVYPDGHVKSFTVGLDYESGESSQWVVPGGVFKAC
                     FTIPNEELDNSLLISEVVVPGFDIQDCITMSGKEELVALVGQEKAETLKYLM"
     gene            <1168905..>1171229
                     /gene="VPS70"
                     /locus_tag="KLMA_40518"
                     /db_xref="GeneID:34716504"
     mRNA            <1168905..>1171229
                     /gene="VPS70"
                     /locus_tag="KLMA_40518"
                     /product="vacuolar protein sorting-associated protein 70"
                     /transcript_id="XM_022819837.1"
                     /db_xref="GeneID:34716504"
     CDS             1168905..1171229
                     /gene="VPS70"
                     /locus_tag="KLMA_40518"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 70"
                     /protein_id="XP_022676363.1"
                     /db_xref="GeneID:34716504"
                     /translation="MNTTFDEESQPLVTRPVTRRRDNSVASFLARGRSNTINSLRSGY
                     ETVKKHKNEFWLLIIGSLMLYLGFTLAFLPRTSLSRDFRRLYFGKLTKSEAFRIYIES
                     LMKENKCSTHVEQYTSHKHWAGDRFVLDYTVSELSKLGFTPRLEKYHVWLNEPVYTEV
                     TLWDNGNLKYNASMVEDDISISDENTLTEKVMAFHGYSANGTAQSQYIYSNYGTLEDY
                     EQLRLNNIDTRGKIHIIRYGSGVRGIAVKNAEDNGALGVILFTDSFDDGLITEKNGYK
                     PFPHGPARHESSIERGSVLIFSDSPGDPSTPGYASKKGSGRKNTSDAVPSIPSVPMSE
                     REIAPILHRLNGKGFEWKNKGNVKGFDYFSGPSEPGIECKVSNHQNYLIKEISNVIVE
                     IPGILKQQEVIIGNHRDAWTTGGAGQPGSGSAILLEIARGFSALHEKGWKPLRTIKLI
                     SWDGEEQGMLGSTEYGEDHRDSLQRGTIAYFNLDGGVTGSKLNVKANPLLNELLVLSS
                     KRTLFKEDPETTVYDYWKQSSNVSLEILGAGSDFTVFQNNLGIPSIDFSFERDPKTDA
                     VLPFHSSYDSYEWMQKFVDPDFSLHSTMAAFVGMSILSLTENELVGFKTHEYMVEISK
                     YFKTMYNDISVVFPHDTLIDTLRKNLADLLELLTTHTSIDFDAMVDNIKQQTEQDYPW
                     WKWNKKLEILTRLISANSKLRKLDRYFITERGIKGRPFMKHSIFAPNRVTGYQGDVLP
                     GLHEAILSKDRQECIFWLETLITQLDKVVSLLTI"
     gene            <1171565..>1172143
                     /gene="CPR3"
                     /locus_tag="KLMA_40519"
                     /db_xref="GeneID:34716505"
     mRNA            <1171565..>1172143
                     /gene="CPR3"
                     /locus_tag="KLMA_40519"
                     /product="peptidyl-prolyl cis-trans isomerase C"
                     /transcript_id="XM_022819838.1"
                     /db_xref="GeneID:34716505"
     CDS             1171565..1172143
                     /gene="CPR3"
                     /locus_tag="KLMA_40519"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase C"
                     /protein_id="XP_022676364.1"
                     /db_xref="GeneID:34716505"
                     /translation="MFATALKTGKVASFAPAQRLFSSSSLLMRTKVFFDTSINGTKMD
                     RIEFELYDDIVPKTAENFRALCTGEKGFGYKGVPFHRIIPNFMLQGGDTDLTNGYGGR
                     SIYGNKFADENFQERHTKPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTD
                     GMSTVKTIESCGTVSGQPRAKVVIEDCGELKE"
     gene            complement(<1172247..>1172570)
                     /gene="BLS1"
                     /locus_tag="KLMA_40520"
                     /db_xref="GeneID:34716506"
     mRNA            complement(<1172247..>1172570)
                     /gene="BLS1"
                     /locus_tag="KLMA_40520"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819839.1"
                     /db_xref="GeneID:34716506"
     CDS             complement(1172247..1172570)
                     /gene="BLS1"
                     /locus_tag="KLMA_40520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676365.1"
                     /db_xref="GeneID:34716506"
                     /translation="MSNERILLNQLIKSKTDTVGSELLKEIERNDEYIKEVQLKKLKE
                     LHDKQFKEKHVLPLIKLYERYNSSAINDGDLQNWAELIDRDIRILEGTINILEEEHRS
                     ENQKD"
     gene            <1172798..>1175785
                     /gene="VAM6"
                     /locus_tag="KLMA_40521"
                     /db_xref="GeneID:34716507"
     mRNA            <1172798..>1175785
                     /gene="VAM6"
                     /locus_tag="KLMA_40521"
                     /product="vacuolar morphogenesis protein 6"
                     /transcript_id="XM_022819841.1"
                     /db_xref="GeneID:34716507"
     CDS             1172798..1175785
                     /gene="VAM6"
                     /locus_tag="KLMA_40521"
                     /codon_start=1
                     /product="vacuolar morphogenesis protein 6"
                     /protein_id="XP_022676366.1"
                     /db_xref="GeneID:34716507"
                     /translation="MFTARRISSTEVEDVQCLNRLHAWDKTLVIKNNGDFDIFSSEGL
                     HTYRQLWSEKIFDTGYSEALSTLFVQCERSLVLFNVGNMEQYDKIVDKRGILGFWCLE
                     NHCENEVDQRTVVVILLNTRVPKIKVLTWVSKSFLRMVEIPLSSKNEHIASVNLVDQG
                     TIIATNKGVFLCKFGGSELISIDKAVTPKLPTCLPDLLQNLYEVIDHSSSNDNESVAD
                     SFAWSSISGLWLSEKRKRRAMSSKNVRYMFNIDHVTCFLLDGNSQMLLQFNATDDGLF
                     YLKALPHENFFQRNIDFDRCLYLGSNFMALYNTSSLRIVDYEQGFVFLDIDIPNGIKK
                     VYHQNEAEIIIWTTKGVIETYRIDIDESLDMAVSSKNGSMFDLNFDTLEKRTVFYRNI
                     LKSEHLPLIKMSDDNNELIISCVMKLRDFCIVYALQAFDRAQKLYYKSNQQQFRNSKI
                     ADLYDTIIKRISQLLLQFLAPPVLTISYCFPEIAETMSDLFPQKNLFLRETSGEIPIN
                     LVKKGFIPYLTEVRRHLKNIRNGNETVWSYDQIDLKLTLSFFQNHNQEELSVNELLTI
                     VDTTLFEIYVKCNKTMVGSLVRVENSCDFTIVEHLLKKEKMIHELIDFYFYNGQHKKA
                     LMLLTEMLDHAGNLENALKTLIIDYLKKLVLTDLKLVFQYSDLLLNRYPDELFEILTL
                     IFLQPLPISKELSHNEIYEYIDSKRPELSLSYLEFVVGELQYSDSKIFCTLVKRYLTN
                     ISDQMTIRKLHAVLKSSKDYDPRSVLRILKNSISEHEQGHSSEVKALKYLSIYPLRLM
                     GDHEVALSLLWDDLNDYQQSSEYCESLYKTDKVSGSKLLMLFLDKILEFDDENRKAQL
                     LKIFLTEHGFKLNSDQVLLKLPMDISIADVSTFFNTELKDKTSKQNDLNLLKGILTSE
                     MIKANYDLANVLSEFFVLSEERKCPMCNRPLKNTPTEYLAIMSYKNKPYVMCLNCARK
                     LQAKLQQENTMSSKEIPTLAQLI"
     gene            complement(<1175817..>1178642)
                     /gene="UTP21"
                     /locus_tag="KLMA_40522"
                     /db_xref="GeneID:34716508"
     mRNA            complement(<1175817..>1178642)
                     /gene="UTP21"
                     /locus_tag="KLMA_40522"
                     /product="U3 small nucleolar RNA-associated protein 21"
                     /transcript_id="XM_022819842.1"
                     /db_xref="GeneID:34716508"
     CDS             complement(1175817..1178642)
                     /gene="UTP21"
                     /locus_tag="KLMA_40522"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 21"
                     /protein_id="XP_022676367.1"
                     /db_xref="GeneID:34716508"
                     /translation="MTIDTTLKKRKFVSDGAKRPASRIFSPYRVVGNVSTHVPFAVGT
                     LGTTFYIVTSVGRSFQIFDANNLHLLFVSERQTEGDITCLAAHYHFVYAGFKNKVGIY
                     KRGKLEHLIELPDTDCTVTKLSVFGDYLIASTNKNVVYVCKKRSASDKFATELYTSFT
                     IGKLQGGDVVELVHLPTYVNKLLVVTKSNFILYNVRTGKQLYTSNEFPDEITTAEPAP
                     ALDIMALGTATGEVILFNVRKGKKIRTIKTPMRISSISFRTDGASHMSVASTSGDLIF
                     YDLDHRSRIQVLKGIHKEFSGGVAKASFLNGQPIVVTSGGDNHLKEYVFDPSLSQGDS
                     EVVIQPARLLRSRGGHSQPPSSIVFADDQSHFILSASSDRSFWGFSLRKDAQSQELSQ
                     RLHKNKDGNRIAGSTIGEKFSEITAIAIENNRQGQWENILTVHKGEKFARTWNSKTKR
                     VGRWTLNTIDDGIAKSVAISQCGNFGLVGSSNGSIGVYNLQSGIKRKAYRLHKKAVTG
                     IAIDGMNRKMVSCGLDGIVGFYDFSKSAFLGKLQLDAPITDMVYHRGSDLFALALDDL
                     SIVVIDSVTQKVVRQLWGHSNRISSFDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGV
                     KVENVITNIKFSPNGDLLATTSVTGNGISLWTNRAQFFTVSTRQINEEDFNSITSPNN
                     SADGGSNLLDGAFNENEVDLDDTIGKYDSLEQISKDLLTLSLGPRNTMNILLNLDTIN
                     QRSKPKEAPKKPEKAPFFLQLAGEKVGDDASGREGAQSTDLELLKSEKEKAAAKADAA
                     SELNKFKSSVKLRAHFESEFTRLLREGSENNDYTKFLEKIVSMTPSNIDLEIRSLNSF
                     DPYDEICWFIEALSQGLSTNKNFDLYEAYIAMLFRVHGDVIHPNNKNENIRNALQQWE
                     NNHKKGESLDKLVKFCGNALNFVANTN"
     gene            <1179172..>1182594
                     /gene="VIP1"
                     /locus_tag="KLMA_40523"
                     /db_xref="GeneID:34716509"
     mRNA            <1179172..>1182594
                     /gene="VIP1"
                     /locus_tag="KLMA_40523"
                     /product="inositol hexakisphosphate and
                     diphosphoinositol-pentakisphosphate kinase"
                     /transcript_id="XM_022819843.1"
                     /db_xref="GeneID:34716509"
     CDS             1179172..1182594
                     /gene="VIP1"
                     /locus_tag="KLMA_40523"
                     /codon_start=1
                     /product="inositol hexakisphosphate and
                     diphosphoinositol-pentakisphosphate kinase"
                     /protein_id="XP_022676368.1"
                     /db_xref="GeneID:34716509"
                     /translation="MASIGPTERDESEEAGNSQSNNMPPLFLDSNTKKAMESIAPILE
                     GFTPKTSSSENKSLKLPPAGFTSDDDDETNKLVRTLSISSTGSASRHVNPLALGTSYD
                     GSGGAGTKLQRLKSNQSGAGSVNTIVENSPSPSPMLEEPHAFPFIPQAATSNDANSSS
                     ADTLTSPSSSTSSRKASTSLPKPQLPKIGKIGVCAMDAKVLSKPCRHILNRLIEHGEF
                     ETIIFGDKVILDESIENWPTCDFLISFFSSGFPLEKAIKYVKLRKPFIINDLIMQKVL
                     WDRRLCLQLLAASNVPTPPRLEITRDGGPKVDDELKAMLADRGVTISHVKEPKWRMID
                     DDTLEVDGQIMVKPFVEKPVDGEDHNIYIYYHSKNGGGGRRLFRKVGNKSSEFDPSLV
                     YPRTEGSYIYEKFMDTDNFEDVKAYTVGENFCHAETRKSPVVDGIVRRNTHGKEVRYI
                     TELTAEEKEMARRVSKTFAQTICGFDLLRVGGKSYVIDVNGFSFVKDNVQYYDSCAKI
                     LRDTFYNAKKKMSLDKRNLPAIQEEKTQKWVFKGLVTVIRHADRTPKQKFKHSFTSPI
                     FISLLKGHKEEVVIRHINDLKIVLQALKIAQEENAEDPVKLDVLANALEKKLSFPGTK
                     IQLKPVLNKDNEVEKVQFILKWGGEPTHSAHFQAEELGEQMRQDFDLLNKNILQNIKI
                     FSSSERRVLVSAQIWATALFGADEIGSDEISIRKDLLDDSNAAKDLMDKVKKKLKPLL
                     RMGKEAPPQFAWPPKMPEPYLVIKRVVDLMNYHKKIMDHNFATKNVDEMQQNWCCAED
                     SMLFKERWDKLFKEFVTVEKVDPSKISELYDTMKYDALHNRQFLEHIFMPDDGTEEEN
                     EEVRHHSLVDRYPINILARNNFKIPDSSNVQMVNQATTTGSKSSSSVGSLGWVLESVE
                     SGTKSPGRSNSTFDDPKFMQLRELFKLSKVLFDFICPQEYGIEDTEKLDIGLLTSLPL
                     AKQILNDIDDMKEKDTPACVAYFTKESHIYTLLNIIYEAGLPMRIARNALPELDYLSQ
                     INFELYESTDASGRKSHAVRLKMSPGCHTQDPLDVQLDDRHYISCIPKISLTRHLDVD
                     YVSQKFRNKFSRVILPQKFTPVNITSPNLSFKRKGITETLESSTEENENLDK"
     gene            complement(<1183493..>1184746)
                     /gene="PRS1"
                     /locus_tag="KLMA_40524"
                     /db_xref="GeneID:34716510"
     mRNA            complement(<1183493..>1184746)
                     /gene="PRS1"
                     /locus_tag="KLMA_40524"
                     /product="ribose-phosphate pyrophosphokinase 1"
                     /transcript_id="XM_022819844.1"
                     /db_xref="GeneID:34716510"
     CDS             complement(1183493..1184746)
                     /gene="PRS1"
                     /locus_tag="KLMA_40524"
                     /codon_start=1
                     /product="ribose-phosphate pyrophosphokinase 1"
                     /protein_id="XP_022676369.1"
                     /db_xref="GeneID:34716510"
                     /translation="MRKCKVFVGNSHPELGNLVCERLGIEPAPCTLKKFANGETSVQI
                     GVSVRDEDVYVIQSGSPEINDHIMELLILVSACRGGSAKKITAVIPQFPYSKQCKMKK
                     HRGAITARMLANLLIMAGADHVVSMDLHASQMQGFFTKPVDNLYGGPSLGKWIRENVE
                     DYREAVVVSKNPGGTKRVTALADSLKINFAMIHTDRRRSKDLYAQNKDKTQLRQRKQS
                     MLRKNKPIIRPGDFENEEENIILTNGIQTARVIKGHVVDDEYVDDADAVESEAEGSIG
                     TIGSFDAVDSEDDEEPEEQPEKLITLVGNVQGRTAIILDDMIDRPGSFISAAEHMVKN
                     CGAKEVYVVATHGIFTGDCLEQLENSDDIHKIVVTNTYPISPESIAKSKKLVVIDVSS
                     IFAECIRRDHYGESISVLFDSLASL"
     gene            <1185433..>1186236
                     /gene="BER1"
                     /locus_tag="KLMA_40525"
                     /db_xref="GeneID:34716511"
     mRNA            <1185433..>1186236
                     /gene="BER1"
                     /locus_tag="KLMA_40525"
                     /product="SRR1-like protein BER1"
                     /transcript_id="XM_022819845.1"
                     /db_xref="GeneID:34716511"
     CDS             1185433..1186236
                     /gene="BER1"
                     /locus_tag="KLMA_40525"
                     /codon_start=1
                     /product="SRR1-like protein BER1"
                     /protein_id="XP_022676370.1"
                     /db_xref="GeneID:34716511"
                     /translation="MAEKDFQTSTKSKRSVNRLKLRSFDELLEDARNVIRESEFLESL
                     CKSLEGQHVDRVRCLALGSFHQDSPARFQLALLLELLSSLNVTRCSLYDPAFDEEDLA
                     YIKGQDHWSVDAESPFAGDKPDSILFFLPHAPLDLTEKIISKESPRIWLANHLVQHTD
                     RYTKTQLHDKYPLISKLVNYIDLKTLNKTKTGNEIDEEGFQQFTSSRKRNAKARKNKF
                     KQPSIDYKSVDSYFTDCSIINDFRNGSLLTNKPWLNSFSDLTLHMIESN"
     gene            complement(<1186756..>1192902)
                     /gene="FAS1"
                     /locus_tag="KLMA_40526"
                     /db_xref="GeneID:34716512"
     mRNA            complement(<1186756..>1192902)
                     /gene="FAS1"
                     /locus_tag="KLMA_40526"
                     /product="fatty acid synthase subunit beta"
                     /transcript_id="XM_022819846.1"
                     /db_xref="GeneID:34716512"
     CDS             complement(1186756..1192902)
                     /gene="FAS1"
                     /locus_tag="KLMA_40526"
                     /codon_start=1
                     /product="fatty acid synthase subunit beta"
                     /protein_id="XP_022676371.1"
                     /db_xref="GeneID:34716512"
                     /translation="MSSSARPLSLSHGSIEHVLSIPTTSFFTASQLQDQFHRQLPEVT
                     EGFASDDEPTSPAELLAKFLGYVSSLVDVTTKGQFDDVLEIALSDFETNYLQGNDIHT
                     LASRLLQSEDSTTTLEKVKELIKNYYNARVTAKKPFSKTDSALFKAVASGDAKLVSIF
                     GGQGNTDDYFEELRELYQTYNCLISDVIKAAANTLGELVTRTDDTEKLYTQGFDILTW
                     LEQPQKTPETEYLLSIPISCPLIGVIQFVHYALTARILNFTPGQLRDSLVGATGHSQG
                     LATAVAIAEADSWESYFKAMEKTIKLLFFIGVRCYQVYPKTSLPPSMLEDSVENGEGV
                     PTPMLSISNLTKDQVQDYVDQTNAHLPESKHIVISLVNGARNLVVSGPPQSLYGLNLT
                     LRKAKAPAGLDQARIPFSERKLKFSNRFLPIVSPFHSHLLEPANALIEHDLAAAGVEF
                     KASDLKIPVYDTFNGKDLRESKESIAQRVTYCITSLPVNWEETTKFQATHILDFGPGG
                     ASGLGVLTHRNKDGTGVRVIIAGALDTNPDDEYGFKQELFDITNNGLKFSVNWLEQFH
                     PKLVKTKAGKVYVDTSFSRLLGRAPLLVPGMTPTTASTDFVAATINAGYHIELAGGGY
                     FTAEGMTKAIEDVVSKIKKGYGLGINMLYVNPRMLQWGIPMIRELRERGYPIQALTIG
                     AGVPSLEVAAEYIETLGLTHLGLKPGSIDAISQVIAIAKAHPNFPIVMQWTGGRGGGH
                     HSFEDFHAPILQMYSKIRRHPNIYLIAGSGFGSAEDTYPYLTGEWSKKFNYPPMPFDG
                     FLFGSRVMIAKETKTSPAAKQTIAACTGVPDSQWEQTYKKPTGGIVTVRSEMGEPIHK
                     IATRGVMLWKELDDQFFTLPKNKLQAALDAKRDYIIARLNADSQKPWFATVNGEARDL
                     ADMTYEEVAKRMVELMYIKSVNRWIDVSLRNFTGEFLRRVEERFTKQKTVSIIQSFAI
                     LDEPEKALVKVFDAYPAAKEQFLNAQDIDYFLTLCQRPTQKPVPFVPVLDSRFEFFFK
                     KDSLWQSENLEAVVDQDVQRTCILHGPVAAQFTNEVDQPIKTILDNIHEGHVNMLLKD
                     YYGSDDSKIPVVEYFGGEEPEAVAYDSLESGNKVTYQASASTDVSTWFKLLAGTEKSW
                     RSAFFSTPRVVQDSFLIENPAKKVFHPSDNMVVQIENADTPAKTVVTLLEPVQGEIKA
                     TATLRLVKDKLIQLDLIENRTMDGTPVALPLLFNYNIEDGFAPISEVTEGRNNRIKEM
                     YWKLWLDEPFNLDFNPRETIKGGEFTISAKDISEFVHAIGNNCEDFVARSGRKMLAPM
                     DFAIVVGWRVIIKAIFPNAVDGDLLKLVHLSNGYRMIPGASPLKEGDVISTSAVIKSV
                     VNQANGKVVEVVGTLTRDGKPVMEVSSSFFYRGTYNDFEYTFEKIVEPLYKIDITSAK
                     DSAVLRSKEWFQLDDEDTNLLGKTLYFKTETEVTYKNATVFSSVKCHGKILMELPTKE
                     TVEIGVVDYEAGESHGNPVIDYLNRNGSTLEQKVNLENAIPIAVRETQSPSTNEPYAR
                     VSGDLNPIHVSRHFAAYANLPGTITHGMYSSATVRALVETWAADNVSSRVRAYNCQFV
                     GMVLPNTPLKTSIQHVGMINGRKLIKFETKNDADETVMTGEAEVEQPVSTFVFTGQGS
                     QEQGMGMDLYAKSEVAKQVWDRADLHFKSTYGFSILDIVRNNPTELTIYFGGEKGRKI
                     KENYTQMIFETIVDGEIKSEKIFKDITEETTSFTFRSPTGLLSATQFTQPALTLMEKA
                     SFEDLKSKGLIPAEAAFAGHSLGEYAALASLADVMSIESLVEVVFYRGMTMQVAVPRD
                     ELGRSNYGMVAVNPSRVSATFSQEALEFVVKAVSKKTEWLLEIVNYNVENQQYVAAGD
                     LRALDTLTNVLNFVKIQKIDIAKLQETLSLEEVEGHLNEIVEEISKKSVAKPQPIELE
                     RGFACIPLRGISVPFHSSYLRNGVKPFKNFLMKNVTKENVKADRLVGKYIPNLTAKPF
                     EITKEYFQDVYELTGSEKIKDILDNWEKIVNQ"
     gene            complement(<1195447..>1196355)
                     /gene="LOT5"
                     /locus_tag="KLMA_40527"
                     /db_xref="GeneID:34716513"
     mRNA            complement(<1195447..>1196355)
                     /gene="LOT5"
                     /locus_tag="KLMA_40527"
                     /product="protein LOT5"
                     /transcript_id="XM_022819847.1"
                     /db_xref="GeneID:34716513"
     CDS             complement(1195447..1196355)
                     /gene="LOT5"
                     /locus_tag="KLMA_40527"
                     /codon_start=1
                     /product="protein LOT5"
                     /protein_id="XP_022676372.1"
                     /db_xref="GeneID:34716513"
                     /translation="MMGEKQFCQLILTKPTIENITTVGQYELTQPRLKGVDLLHQSEI
                     PILFGGGRDFLLGELGSVTEAVNALNAGLSPNPQSLILSDLFVLNSCVLIWFKEWERS
                     LQIPYRNIVYHAVHKTDDSSQVDGHRLELLITVERDPIINELFPIPNRSIGQMHRLQA
                     DENVISTVELVLRPKYANFDRHYNEEVEDLFTFKEFGLNRGDTMVKNSYNAILTCMDF
                     YPDEESLAEQQQQQQMQMYTQSQAQAQAQAQAQVQTQNVYVNSGVADDLDDDSTMDIY
                     AQDGYDASMALQFYADQPVAGAKRRL"
     gene            complement(<1196776..>1198308)
                     /gene="SPE1"
                     /locus_tag="KLMA_40528"
                     /db_xref="GeneID:34716514"
     mRNA            complement(<1196776..>1198308)
                     /gene="SPE1"
                     /locus_tag="KLMA_40528"
                     /product="ornithine decarboxylase"
                     /transcript_id="XM_022819848.1"
                     /db_xref="GeneID:34716514"
     CDS             complement(1196776..1198308)
                     /gene="SPE1"
                     /locus_tag="KLMA_40528"
                     /codon_start=1
                     /product="ornithine decarboxylase"
                     /protein_id="XP_022676373.1"
                     /db_xref="GeneID:34716514"
                     /translation="MSNLPFFAYSVIFLFSIFFSFHDFLTYMKMKMCNMLHAINKTLF
                     EMSICYSSLFFVKMFLKPYETMTLQSVEHAEHCVPTDISHGVSYRPVVGLPRDNGKNV
                     KLLHEQKHNMIFDTLKEKIEAINHETCEPGDENSFFVCDLGEITRLRKLWSELLPRVT
                     PFYAVKCNPNTEVLRRLASMDTNFDCASKCEIEKVLSLGVSPERIIYANPCKASSFIR
                     FAAKNGVKKSTFDNIDELYKIKKYHPDSELLLRIVTDDSTAQCRLSTKYGCELDDVPA
                     LLDTVKELNLNLVGVSFHVGSGASDFSTITQAVRDARKVFDMAECMGLAPLKVLDVGG
                     GYQFESIVKVADVINAALEHFFPSQTHSHVQFIAEPGRYFVATAFTLAATVIGKRISG
                     PNESMLYINDGVYGNMNCILFDHQEPVPRILYHRKEFHYLDFESSSRIQSGGHPYKIS
                     MWGPTCDGLDCVTQEYYMKHDLEVGDWVYFANQGAYTCSAATPFNGFEQTVDIIFIDS
                     VL"
     gene            complement(<1198670..>1200031)
                     /locus_tag="KLMA_40529"
                     /db_xref="GeneID:34716515"
     mRNA            complement(<1198670..>1200031)
                     /locus_tag="KLMA_40529"
                     /product="transcriptional regulatory protein ASH1"
                     /transcript_id="XM_022819849.1"
                     /db_xref="GeneID:34716515"
     CDS             complement(1198670..1200031)
                     /locus_tag="KLMA_40529"
                     /codon_start=1
                     /product="transcriptional regulatory protein ASH1"
                     /protein_id="XP_022676374.1"
                     /db_xref="GeneID:34716515"
                     /translation="MSAVSKSLSLSDHSSENKYYIRRKRSFDDLLLPSLTHTAHTPRA
                     VEESPYFFDARKKSKTAPASPSGLVQITPTTSPVCSSSNSLAWKQTTLGENGTSAQLS
                     FSPYNANVKQAMTQSNTPLPQLKHLKLLPNPKVQEYSYRYPDTCSYTPLWKQNLTEWC
                     KETNYSQYQSIIEQVSQVNPRSGNLTHGLNLLADAARISSIISSPDEFYELSNTSNKS
                     KVLVTPPSSPSAQFTSMISGSLVKAVKKNRTRMHKKTNSFKARKLKKLLDERMNLDHN
                     DKFESQKTVFRAAPAMPTTPPHKKITLSSTPKSLQSPQQKYHPIILNSPEKFTTNKPI
                     SNSNSEDETDQDIMQASPKSSPSQRRNSNRFCVSCHCTDSPCWRPSWSKSKQDQLCNS
                     CGLRYKKTHTRCTNQNCRKIPSKGELTLMKSNKPITFTKPDGTHTYGMACLFCGHTVA
                     TDE"
     gene            <1201508..>1202035
                     /gene="MTR2"
                     /locus_tag="KLMA_40530"
                     /db_xref="GeneID:34716516"
     mRNA            <1201508..>1202035
                     /gene="MTR2"
                     /locus_tag="KLMA_40530"
                     /product="mRNA transport regulator MTR2"
                     /transcript_id="XM_022819850.1"
                     /db_xref="GeneID:34716516"
     CDS             1201508..1202035
                     /gene="MTR2"
                     /locus_tag="KLMA_40530"
                     /codon_start=1
                     /product="mRNA transport regulator MTR2"
                     /protein_id="XP_022676375.1"
                     /db_xref="GeneID:34716516"
                     /translation="MNHQSQIVETFVKKVLAHLDEPDPAKLQQFLQLFNPQQCKIIFN
                     SQPFGQAVQFLQAWQTQVVLTQHLVTAVDFHVIPGTGTLVCNVNCKVRFDESGKDKSG
                     QDSTIPDAQGSTARPGSGSVNSATRARPIWGTYYGVSLQLVLEDRMFNNDMNGVISSM
                     NYTIVFKPSDSLMNI"
     gene            <1204012..>1206069
                     /locus_tag="KLMA_40531"
                     /db_xref="GeneID:34716517"
     mRNA            <1204012..>1206069
                     /locus_tag="KLMA_40531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819852.1"
                     /db_xref="GeneID:34716517"
     CDS             1204012..1206069
                     /locus_tag="KLMA_40531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676376.1"
                     /db_xref="GeneID:34716517"
                     /translation="MILPSKLSLALCTLFTLATLILIVVSTSGSTSNYNPLNKIYIGE
                     VDISHIRVDKLLPKASPMVAVLAAAMKAPNASYAQIFAALKAISTTEALDPLMGVLTP
                     SNNVSETLDALTVLAPAAINGTNSSTAELNAIYNLVADSKDTNTTLKSLSSFVALASD
                     LQKQNATVVMQMQQQLQQAFGLLEGSKNVSATVASLSSLNSMKQEEKQQLTPVFALFA
                     DSRNLNGTLSAVSTFMTTAVSGEQAQQLFGALSKSDNVPQTLQQLQQAASNEEKVIIG
                     ALATLLNSSSDATKDLTILQSLLQNNVTSSQSAKEAFSDLTTLIASSNDTATTLTTVA
                     AMANTTSETTTKSLTILEEMLNASKNQTNVMLTIGGLQSTLSKSDASKQKQVEALFAL
                     LNSSSNPTETFKALNELTAIAQSKPAVFTPILDLLREATASNQVITLADINEIMPDII
                     SNLNIASHFRLGIFTYCRVNNDKKVLSCTSPKAVQGLDMKQILYDELEHSDFRPYLQA
                     LNIHREDLVLVGKLPDKEHQYKPAIRAILALNLLAIILSFFLLISIVLTFFNKLTGRV
                     SRWVPSGLALFVVIFSLLGAIISVVVTEIIKEGTAKDHYNVVHKGGSSYYGMVWTAFV
                     LSLITAVLLLLSRSPRRDQNTLGQVEEETSSSVVPSDKLESETSPEKKQTDIERDVVA
                     EDE"
     gene            complement(<1206591..>1207403)
                     /gene="PUN1"
                     /locus_tag="KLMA_40532"
                     /db_xref="GeneID:34716518"
     mRNA            complement(<1206591..>1207403)
                     /gene="PUN1"
                     /locus_tag="KLMA_40532"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819853.1"
                     /db_xref="GeneID:34716518"
     CDS             complement(1206591..1207403)
                     /gene="PUN1"
                     /locus_tag="KLMA_40532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676377.1"
                     /db_xref="GeneID:34716518"
                     /translation="MNVLTLFGSFFITLFSFILAILVCFGSTTNDSPLNRIYAAQLDI
                     SNINFSTLLNIDIPKSGIPSLDNLDVPSYFNLGIWSYCMANSEKKIYQCTKPAGIRDF
                     NLQRLLEDNFDNNEVTQLVGSIIQMAIPKDLKDDMDLYNSLMRCMAVTLVIGIALMGL
                     AVIVNVIRWLVHRPFINLVGRVLALLSFLSMGISAGTSTGTYVLIKNILKDNYKEYGI
                     KLTLGRNFYALLWASVVGCLANFVFWIFTRQNNNRPFLMRQLPTAPIVEEKY"
     gene            <1208896..>1211349
                     /gene="PXA2"
                     /locus_tag="KLMA_40533"
                     /db_xref="GeneID:34716519"
     mRNA            <1208896..>1211349
                     /gene="PXA2"
                     /locus_tag="KLMA_40533"
                     /product="peroxisomal long-chain fatty acid import protein
                     1"
                     /transcript_id="XM_022819854.1"
                     /db_xref="GeneID:34716519"
     CDS             1208896..1211349
                     /gene="PXA2"
                     /locus_tag="KLMA_40533"
                     /codon_start=1
                     /product="peroxisomal long-chain fatty acid import protein
                     1"
                     /protein_id="XP_022676378.1"
                     /db_xref="GeneID:34716519"
                     /translation="MEFYKRQRLRILKGSYLVLLVITVKSLATGKDKSNRGEKKDVNG
                     RTGQQERKVRKYKIAPRLSHMSLNQLSTRGVTEVDSVPSSSSGDDDSSSDDGNCTLDN
                     DANGITHRRTHVNESKFKKQQRRRLGEKKNFLVKLILTDKKCLLIFLIQTVLLVIRTV
                     LSLKVAKLDGVLVSKLVKSEYSNFVKVLLGQWMTLGIPASIVNSLLRYMTRISAIAIN
                     RKVSEALLDKYMSSHQIFYAINNQPSSQVAGLSSGSLDNVISSTSTSEGKNADDNDLS
                     DSPVQYLTRDVGAMSYNSSVLLNQLLKPSLDLILCSFTLLSNANSTFMGEGTLALGIV
                     VHLSNIGLKLIQPNFTKMQMKKTQLEGLFRSLHSKIHSNCEEIALLKGQKTELWNLDY
                     AFYRLYTYMSHEIRSRALYDFATTFIIKYIWGAAGLLLCSIPIFLQDTITKDKTAEFI
                     TNRRLLLTASSSIGRFVQLRRNIQQLQGVSLRLNKFNDELDEIISAPQLREDAVPIEY
                     NENVIEFQNVPLVTPTGQVLVSELSFKLERFNHMLIIGPNGCGKSSLFRLLGGLWPIS
                     KSLNPDHETKLIMPPRKGTLNESTIYYLPQKPYMSSQGTLREQLIYPDTMDEYMERFD
                     GSIEVGDQLLLDILQVLDLNDMINENLSIVMARDNKKECTFKDALELVRPWSAELTMG
                     IQQRLAMARMYYHKPIFAVLDECTSAVSPEMEQKMYRHAQDLGITLISVCHRTTLWHF
                     HTHLLSFDGKGNYKFGKFDPEQRLKDEEKLMELNKLLDQEVPIMQKRLKELTIARSSN
                     LLKNSQSNLNLSTPAPVKA"
     gene            <1211621..>1213204
                     /gene="VPS36"
                     /locus_tag="KLMA_40534"
                     /db_xref="GeneID:34716520"
     mRNA            <1211621..>1213204
                     /gene="VPS36"
                     /locus_tag="KLMA_40534"
                     /product="vacuolar protein-sorting-associated protein 36"
                     /transcript_id="XM_022819855.1"
                     /db_xref="GeneID:34716520"
     CDS             1211621..1213204
                     /gene="VPS36"
                     /locus_tag="KLMA_40534"
                     /codon_start=1
                     /product="vacuolar protein-sorting-associated protein 36"
                     /protein_id="XP_022676379.1"
                     /db_xref="GeneID:34716520"
                     /translation="MSPGFSYWHPVEIAGSGQPLLRENERDIYVEQCVGLYHGKSKIL
                     NKQKGRLYLTSQRIIYVDELDAKKESVCIENYDIENIEYSSKFLKRSAKIILFFKDTP
                     YSEDLGNEGGTQQSSTSVTEWLCPICTSKNTYNGTLDSTQSTLPACQTCGVPADKDMA
                     KDSITVKAEEISKGSGKLENTCPVCTFINHPQLRSCEMCGARLKQLDRITAKNTYNSK
                     DNKYGDGVRIVLEEKSSATEAQKQFGQLSFRKTDGTVFYEALAKQLQIIARNESQHLF
                     NQNVVAINGVPKDPVIDPDLVLLNNDMSLIGITALEKNKEHQLLKNNIVMSNALSDLN
                     NLMALAEEIEKMYQEGSNEKKNNSPILFVDREKYLNKEVFLEEIAREIYGFVESELRG
                     DNGIIVTLVDLYALYNKSVRIGTGLISPDEMRQACEKFKSLGLNDLNLIKINGRVLCL
                     AFQDSFDHIRTKISQIAAMKPGVDILQITTELNEYEKNSWSMGVISEVLQYCVTEGDL
                     VIDEQISGTNYYFNTYWKT"
     gene            complement(<1213308..>1214402)
                     /gene="HYM1"
                     /locus_tag="KLMA_40535"
                     /db_xref="GeneID:34716521"
     mRNA            complement(<1213308..>1214402)
                     /gene="HYM1"
                     /locus_tag="KLMA_40535"
                     /product="protein HYM1"
                     /transcript_id="XM_022819856.1"
                     /db_xref="GeneID:34716521"
     CDS             complement(1213308..1214402)
                     /gene="HYM1"
                     /locus_tag="KLMA_40535"
                     /codon_start=1
                     /product="protein HYM1"
                     /protein_id="XP_022676380.1"
                     /db_xref="GeneID:34716521"
                     /translation="MAFWWKKSPKTPSDYVKHLNEQLDKLESASAGSDLRKKAQDECG
                     KYIAGTKHFLLKETDPVPTQEALDELYYWIYQSDLFFTLLHSFPNLDFEARKDVAMIY
                     CICLSRSKDNKFPTVDYLLTKPKFVSMLLKTSEVCITRPGGSDIFLTASGMILETIKQ
                     EQLCRLIIRDQQIWKFFDFTRLGSFEISSSSLQVLTELFTTHPKLVSVEFFSNEDNMN
                     QFIDRINKLMAHGNYVTKRQSVKLLGTLIFNRVNKNLMTTYINNSDNVKLVMILLSDR
                     SKNLQLESFNIFKVVVANPRKSKPVLDVLVKNRDKLLNFLEQFGTDNKDSTFLDEKEF
                     IVEQIEALPRIVPASGEYTLGTSPQKNMVL"
     gene            <1214991..>1216157
                     /gene="NPY1"
                     /locus_tag="KLMA_40536"
                     /db_xref="GeneID:34716522"
     mRNA            <1214991..>1216157
                     /gene="NPY1"
                     /locus_tag="KLMA_40536"
                     /product="NADH pyrophosphatase"
                     /transcript_id="XM_022819857.1"
                     /db_xref="GeneID:34716522"
     CDS             1214991..1216157
                     /gene="NPY1"
                     /locus_tag="KLMA_40536"
                     /codon_start=1
                     /product="NADH pyrophosphatase"
                     /protein_id="XP_022676381.1"
                     /db_xref="GeneID:34716522"
                     /translation="MGLMVLVSNTTKWTHKGSCLWSTVRHPPRSNMIPLQYSSRLLKR
                     YSFLKRDPTFIYEAVNSERAQFLPYHDFYPFCSSRDRSKLWKLHRSIPSNGAMLKPFI
                     QSHKPGELVFMGLIPPTKGESSSQGPSFTYKKYKGDPLFAIDITRHEYMLPQADGKDS
                     VIKCQDFRHFNDLTVDESSLLSLGKMMLHWLYTHKYCSMCGYKNDVIACGSQLKCTNH
                     ECESNGRITNVSFPRTDPVVIVGITNQTRDAVLLCKHKAPSARDPKRNMYACVSGFMD
                     PSETIESAVLREVFEETGLDVLNVEYVTTQPWPFTNNIMIGCLATVDDKQPVDLGHDE
                     ELVDASWFPTSQVKQMLNSDMDSYGLLRDPVSGIGLPNDKTIANRLIKAVCQVR"
     gene            <1216523..>1217491
                     /gene="PGC1"
                     /locus_tag="KLMA_40537"
                     /db_xref="GeneID:34716523"
     mRNA            <1216523..>1217491
                     /gene="PGC1"
                     /locus_tag="KLMA_40537"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819858.1"
                     /db_xref="GeneID:34716523"
     CDS             1216523..1217491
                     /gene="PGC1"
                     /locus_tag="KLMA_40537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676382.1"
                     /db_xref="GeneID:34716523"
                     /translation="MSGPKLEIVGHRGFKAKYPENTLLCYDKAYEAGSDVIETDLQLT
                     MDGKIVINHDVDTGRMWDQNLVIAESNLEDLMVLRNKMDPAISITTFKEALQWLKEHP
                     KMKFMLDIKPTNSKVILVKTILEMREVVDDLDYWRERLIFGIWNVDWYKCGYITGTLK
                     KFKIVAILPFSKMASRFIEYSNSLNDSDYKLYGVSLNFLNSWKPGFKEHLLPYFKENN
                     LSVYLWTVNSELDIQHVISSVPVYGIVVDDPINYVSIRDSYAKKSDPLAQPVLNGAQR
                     LKVYLRLQLFELFEIIFSSKYATVPIVRGITLIQLTVILLRRLHCL"
     gene            <1218063..>1219667
                     /gene="SGF73"
                     /locus_tag="KLMA_40538"
                     /db_xref="GeneID:34716524"
     mRNA            <1218063..>1219667
                     /gene="SGF73"
                     /locus_tag="KLMA_40538"
                     /product="SAGA-associated factor 73"
                     /transcript_id="XM_022819859.1"
                     /db_xref="GeneID:34716524"
     CDS             1218063..1219667
                     /gene="SGF73"
                     /locus_tag="KLMA_40538"
                     /codon_start=1
                     /product="SAGA-associated factor 73"
                     /protein_id="XP_022676383.1"
                     /db_xref="GeneID:34716524"
                     /translation="MSSVNIEIKGLRPDIRLEEFDSGKNGWKELVANLKSKSDQEYRD
                     IRSKYLSRPSEILPSVLKEDIRYRECIACHQPVLVSGIVEHLEKYCIAKMPINSAAET
                     PDVMSSPAKSKGNARRSSSIDPEGFDSPSKKQKTSTPSGSGSGSGSTRKQRKIKQRNP
                     TEPHLVNFDKQCGVPLPEGGVCGRSLTCKSHSMGAKRAVEGRSQPFDILLADYQKRNQ
                     LKSSASKTRIQKAQQNQQDPQTTSKHKGKEKGNNKTNSGNSNNNSNSNNADNDSMSKI
                     SPEEETTLVLNGVSRSYPLPLESTVLTSTRTRTKYIRMREMFASAFNIKPGFKSPGVG
                     AFRSRVGLIDIDRTTDYTFRIRTPQPMNAVPQKLTPEQLQALQAQRLKQQQQQQQQLS
                     PQQSSQQLSQQQQQRQQATQQQQQLLAQQQQRQHQANTTGSLSQMQVQMQQAGQSNKV
                     GVQQSMMGQSITPRDIQTQQLIMQQQQQKLLQKKRMEDASAQLDTASKLMQHSIGSPV
                     NVQVRNNSNQQGVQFGANNGYGGRVN"
     gene            complement(<1219819..>1221348)
                     /gene="ALG2"
                     /locus_tag="KLMA_40539"
                     /db_xref="GeneID:34716525"
     mRNA            complement(<1219819..>1221348)
                     /gene="ALG2"
                     /locus_tag="KLMA_40539"
                     /product="alpha-1,3-mannosyltransferase ALG2"
                     /transcript_id="XM_022819860.1"
                     /db_xref="GeneID:34716525"
     CDS             complement(1219819..1221348)
                     /gene="ALG2"
                     /locus_tag="KLMA_40539"
                     /codon_start=1
                     /product="alpha-1,3-mannosyltransferase ALG2"
                     /protein_id="XP_022676384.1"
                     /db_xref="GeneID:34716525"
                     /translation="MSQPSAPPPVYHRKVAFIHPDLGIGGAERLVVDAAVGLQNKGYE
                     VTIYTSHCDKSHCFEEVKDGTLKVEVFGDKLPTSIMGKCSILCSNLRQLYLTMCLVAT
                     KRIGKFDVFIVDQLSSCVPLLGLNARDAKILFYCHFPDQLLATRDSFLKKVYRLPFDW
                     LEQYTMSLSDQIVVNSNFTKGIFARTFPTLNFIPKVIYPCVNFDNEKPSALDKNLKNL
                     ILSKDDKYYLSINRFERKKNIELAIFAFSECKQKETYKLIITGGYDPKVSENMLYLNE
                     LEGLCQDLTLTYKRVSYPHFSTTEHTYNAKDFEDAQIIFITSISSSFKELLLKNAELL
                     MYTPSNEHFGIVPLEAMKFGVPVLAVDNGGPVETVVDYNESPQHINATGWLRYSDSTA
                     WAKVLDESVEALAKHRSIFQESGPKRVRYYFSREAMAENFDNIIDRTIWEKKDSSGFT
                     TFTPGILMLITQYLVITLFGDATVPYFFLALISFYILRSIKASFYWIIVFLYMTYTGK
                     T"
     gene            <1221729..>1223021
                     /locus_tag="KLMA_40540"
                     /db_xref="GeneID:34716526"
     mRNA            <1221729..>1223021
                     /locus_tag="KLMA_40540"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819861.1"
                     /db_xref="GeneID:34716526"
     CDS             1221729..1223021
                     /locus_tag="KLMA_40540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676385.1"
                     /db_xref="GeneID:34716526"
                     /translation="MRRIGCDLALRSINGISIGIGNQPFYSHGYCRSCLRRYSSDNGE
                     AGYMKKRLQELSETNTVDKDDPLMKIIHGGSIVDESEPLRKIHGKLQDVTFQEKHREQ
                     LSITKGSVNTNKHARDIASSKSWSGDEHVLDTALRMVLDSAPKAIPMPNGSVNNRFKN
                     TSRRKLSVQDRLEQVQDKTMRYKQDLSTDEIEKREAAAFRALYTEKFTPIGSFEKLRS
                     VADARIEESIKRGEFNSTKKLHGKKVDVSNENAHLDRTTYHLNNILVNQNIVPPWIEK
                     QGSVSSDIAAFRKQLVGKLEAELLNQMRKRKLFSHAYATVQDALDSINTDRDTFLDTC
                     FRSWCKSVQPFLNSNIPRLNSGLRSYNLQAPLHTQKLYLVADRELERTRKSVNMDNLF
                     AQEYARIKDLNPPGSSAKENLGSKDHSRFSLFNIFKSY"
     gene            complement(<1223220..>1223612)
                     /locus_tag="KLMA_40541"
                     /db_xref="GeneID:34716527"
     mRNA            complement(<1223220..>1223612)
                     /locus_tag="KLMA_40541"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819863.1"
                     /db_xref="GeneID:34716527"
     CDS             complement(1223220..1223612)
                     /locus_tag="KLMA_40541"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676386.1"
                     /db_xref="GeneID:34716527"
                     /translation="MMSISTQSTSGFLDKVPSSLVVYTAVMFYLLSGGRISVSLAVVV
                     GFFILRKHNEEVSSAKVEEVEPPKKKGCCGGKNGGCSGHKVDDNGLPIKKKSCCGGAC
                     KSKKVEDPAPAVEISYDNEIDFTDSFKR"
     gene            complement(<1224045..>1225814)
                     /gene="RKM1"
                     /locus_tag="KLMA_40542"
                     /db_xref="GeneID:34716528"
     mRNA            complement(<1224045..>1225814)
                     /gene="RKM1"
                     /locus_tag="KLMA_40542"
                     /product="ribosomal N-lysine methyltransferase 1"
                     /transcript_id="XM_022819864.1"
                     /db_xref="GeneID:34716528"
     CDS             complement(1224045..1225814)
                     /gene="RKM1"
                     /locus_tag="KLMA_40542"
                     /codon_start=1
                     /product="ribosomal N-lysine methyltransferase 1"
                     /protein_id="XP_022676387.1"
                     /db_xref="GeneID:34716528"
                     /translation="MDHLEYLLKFANEIGVVIPQNVEFRDTKEKGICCIATTDIDGAL
                     FKLPREFIITKDLSNTHFKDFIGSSKHHNTWFKLFLSKLKFSDEAIVIDGVDVTQRFR
                     PYINALPKQVDSPLIWNPSELLLLNGTNIYRSLNEKLQSIYDEWWNVIKDSGFKTETY
                     DISQLSIDEIYREITSKVSSDVQLNFDSFPAFLWAHLICTSRAFPERVINPSCEEHNI
                     ILLPVLDLLNHENRSKIQWSYSAEKEFVFEKLDVVKKGNEICNNYGAKGNEELLWGYG
                     FVIEQNQFDNLALKLKLPIPVVERLLHEQEIRLPTFKDYTTYAFDVSNKAQIPTEENQ
                     LSNASDYEDGILYFINSEIVSLKPLIELFAQLNKNAQEDPKTLRCQLTSLQSLKNALQ
                     HKLLLITNPQAETTRDLENHHEVNSYRRYCAEVYKTSQIDILRQSINNVKRLQKQILS
                     EYKPSVASIKNIIKRDKTFYDDLAQLYGNKEPIALTDEFDLSIAWLMVRNYIPFSSEE
                     PKKYEWVIQMFKNYMETHNSSCELTEAGTTLHSSFFPSGNDDVSPKVLEHISNFVNYE
                     TFLMESGDDAVPVFTQPATLEYD"
     gene            <1227136..>1228293
                     /gene="IPL1"
                     /locus_tag="KLMA_40543"
                     /db_xref="GeneID:34716529"
     mRNA            <1227136..>1228293
                     /gene="IPL1"
                     /locus_tag="KLMA_40543"
                     /product="spindle assembly checkpoint kinase"
                     /transcript_id="XM_022819865.1"
                     /db_xref="GeneID:34716529"
     CDS             1227136..1228293
                     /gene="IPL1"
                     /locus_tag="KLMA_40543"
                     /codon_start=1
                     /product="spindle assembly checkpoint kinase"
                     /protein_id="XP_022676388.1"
                     /db_xref="GeneID:34716529"
                     /translation="MLPTDAKDVGRRSSLEQQSKLLSIRLNNAGKRTSLARGYSRAKK
                     SIGSSYQRVSITPRNGYDHPNTSTLLRNSSPKGSDSVSGLTSGSLAVKKPNAGIGNRS
                     SILAGKEVDKFKNMSLQDFEIGKILGKGKFGKVYCVKHKETGLICALKAMEKKEIVQY
                     TIQKQFRREVEIQGSFKHKNLTQLYGFFYDEKRVYLLMEYVYHGELYKFLKNNGPLNE
                     SLASYFVYQMANALDYMHSKKILHRDIKPENILIGFNNTIKLTDFGWSVLNEKGQKRK
                     TLCGTIDYLSPELIKSREYDDKVDVWALGVLTYELLVGSPPFEENTKEMTYRRILRCD
                     IRFPPHVSPQARDLIGKLLQFEPTNRIPLSEVKSHTWITSHKPSWSSLQSD"
     gene            complement(<1228369..>1230063)
                     /gene="MRH4"
                     /locus_tag="KLMA_40544"
                     /db_xref="GeneID:34716530"
     mRNA            complement(<1228369..>1230063)
                     /gene="MRH4"
                     /locus_tag="KLMA_40544"
                     /product="ATP-dependent RNA helicase MRH4"
                     /transcript_id="XM_022819866.1"
                     /db_xref="GeneID:34716530"
     CDS             complement(1228369..1230063)
                     /gene="MRH4"
                     /locus_tag="KLMA_40544"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase MRH4"
                     /protein_id="XP_022676389.1"
                     /db_xref="GeneID:34716530"
                     /translation="MNNPYARIFNVSRSFGRVLITRSYVASKSSTSGTKWSPVHNRKD
                     KKNTPKKNAVHGQPKNEKKQRFEFGEYGKLSDGDANVLERSQKLVSKITDFDSLKLLP
                     DVREKMIDIISSESLLNKNIQNIGYNPEDKSVQEFKKTVKPSPIQTTAIYQLSKTLMK
                     PELQVRLIAAETGSGKTMAYLIPLVDYLKRTELENPTVWESMKNKAIVRSIILLPTHE
                     LVEQVYQTVSKLEPALGMNTYKWDAGSSYKGFVDALKGRIDIMVTTPGKILSLFKISM
                     VSRPDRILSQVKFLVMDEADTLLDKSWVEDSYSTIKHMQNLNHVLFCSATIPKEFQKT
                     ITRLFPDVGVIASPNLHKINHKNDIKLINADMAPYKGSKIKALAQILYSINRDNIDPG
                     FEKRAVVFVNEKTSVPIVAAKLANQYGHDVVALTGSDTVEERLEKIKPFMDPAKKINK
                     SPSKPVADSNKVLRKIPNSNIVIEEAPDKAEEATAESTLKVLVTTDVLARGINFRSCR
                     YVVLYDIPNTSVDLVHRIGRTGRMKQKGSVFIITGKRVKNWVKAIPSIVSKKVTIS"
     gene            <1230631..>1232544
                     /gene="SRP72"
                     /locus_tag="KLMA_40545"
                     /db_xref="GeneID:34716531"
     mRNA            <1230631..>1232544
                     /gene="SRP72"
                     /locus_tag="KLMA_40545"
                     /product="signal recognition particle subunit SRP72"
                     /transcript_id="XM_022819867.1"
                     /db_xref="GeneID:34716531"
     CDS             1230631..1232544
                     /gene="SRP72"
                     /locus_tag="KLMA_40545"
                     /codon_start=1
                     /product="signal recognition particle subunit SRP72"
                     /protein_id="XP_022676390.1"
                     /db_xref="GeneID:34716531"
                     /translation="MVQEDLTELIRKFDFKEKNPKLQSTITACYKKLLAEGNDPHKAR
                     QIIFGDLVKEEKYDLLCYVFQKLFNDSKESATVEPDIIMFVLYAVYKSKKLGSDPETT
                     KVVDFDKYLSVADNYASKDSISELERQVLHIVAQDAWKQKNPEKAFGIYKKLLEIPND
                     LDNTFELLCNKYAALSAIPYFSEVKEDISTVGENDTYDILYNKALGLCQLRDYNAALA
                     VSTNALELAQKEEADLDDQRSIKLQLSYIHQLIGQYEEAKTLLKDVLDSSIDKSDMLY
                     HIAKLNLKSFTDFSKFKDNMPLILREIEANHLVGSYNELSKQQFDVVSNNIESLKLFS
                     NGTINRSTLPHSIANKFYSKNVNNVVLEPYEDQAEALSKKLDKYLVSGTKDSKTLLIY
                     SLVCIQLLVKAKNLDKAISRAEKIWNHFPRDELSKEKRVISYILLKLYDEQNRSHSTS
                     KHIEKLHKLFTEESLKEDPLFWEFIGFKLLEQGRIPDAERMFRGYAEINPNSASAKYM
                     KELASADILNTDIDKIIGDVDVETIISSGISVFEKSKSKTTAIRPTPKKKRRVHKNKK
                     LPKSYDENKKPDPERWLPLKERSTYRVSKKNIGKNTQGSKTSKASEAKLDITKKAAKK
                     TNKSSKSKSNRRH"
     gene            complement(<1232769..>1233314)
                     /gene="NIP7"
                     /locus_tag="KLMA_40546"
                     /db_xref="GeneID:34716532"
     mRNA            complement(<1232769..>1233314)
                     /gene="NIP7"
                     /locus_tag="KLMA_40546"
                     /product="60S ribosome subunit biogenesis protein NIP7"
                     /transcript_id="XM_022819868.1"
                     /db_xref="GeneID:34716532"
     CDS             complement(1232769..1233314)
                     /gene="NIP7"
                     /locus_tag="KLMA_40546"
                     /codon_start=1
                     /product="60S ribosome subunit biogenesis protein NIP7"
                     /protein_id="XP_022676391.1"
                     /db_xref="GeneID:34716532"
                     /translation="MRQLTEEETKVVFEKLAGYIGRNIVYLVDNQDQPHVFRLQKDRV
                     YYVPEHIAKLATSVARPNLMSLGLCMGKFTKTGKFRLHITSLSVLAQYAKYKVWIKPN
                     GEMPFLYGNHVLKAHVGKMSDDIPEHAGVIVFSMHDVPLGFGVSAKSTSEARDLQPTS
                     IVAFRQADIGEYLRDEDTLFT"
     gene            <1233851..>1235470
                     /gene="PUS1"
                     /locus_tag="KLMA_40547"
                     /db_xref="GeneID:34716533"
     mRNA            <1233851..>1235470
                     /gene="PUS1"
                     /locus_tag="KLMA_40547"
                     /product="tRNA pseudouridine synthase 1"
                     /transcript_id="XM_022819869.1"
                     /db_xref="GeneID:34716533"
     CDS             1233851..1235470
                     /gene="PUS1"
                     /locus_tag="KLMA_40547"
                     /codon_start=1
                     /product="tRNA pseudouridine synthase 1"
                     /protein_id="XP_022676392.1"
                     /db_xref="GeneID:34716533"
                     /translation="MSEEQNLRPVYDDDQPGEEAYKRGAAYKQTRARKADYEDKLGSE
                     KRQRTNDNGSTDKKETRSANSDESVALAVDSNGNPIPTEPRLPKRKVAVMIGYCGTGY
                     HGMQYNPPNDTIEKELFEAFVRAGAISKANSTDLKKNGFQRAARTDKGVHAGGNVISL
                     KLIIEDPDIKEKINKELPEQIRVWDISRVNKAFDCRKMCSSRWYEYLLPTYSLIGPKP
                     SSYLYKEIAASKEEIPGVIEDDVESAEFWDLFHKEVDSKFTKEELEEISSFVMPKENF
                     DENNPTYQKCKAYKKLETKHKRAYRISKERLERFRSALKQYEGTYNFHNFTLGKDFND
                     PSAKRFMKELTVSEPFVIGEEKTEWVSIKIHGQSFMLHQIRKMISMATLITRCFCPLE
                     RISQAYGAEKINIPKAPALGLLLEAPVYDGYNTRLQEFGYTPIDFSKFQSEMDAFKMK
                     HIYDKIYQEEVNENVFNAFFSYIDTFNPSANQNQQEPLEAEIDEKKDLEDSKETENDT
                     TDTINAAANKGKKPQRPIFDFLTARGITQAP"
     gene            <1235843..>1237150
                     /gene="RSM23"
                     /locus_tag="KLMA_40548"
                     /db_xref="GeneID:34716534"
     mRNA            <1235843..>1237150
                     /gene="RSM23"
                     /locus_tag="KLMA_40548"
                     /product="37S ribosomal protein S23"
                     /transcript_id="XM_022819870.1"
                     /db_xref="GeneID:34716534"
     CDS             1235843..1237150
                     /gene="RSM23"
                     /locus_tag="KLMA_40548"
                     /codon_start=1
                     /product="37S ribosomal protein S23"
                     /protein_id="XP_022676393.1"
                     /db_xref="GeneID:34716534"
                     /translation="MLRIQARNFSNGAAMQAAAKKKAPGFSKAQSGGKKTTKRVTAGS
                     MYKRWQPAVATANLHKNATFVDLPIFNPQKMKGVEVNSFSEHQLQFLYRLGSFRQNQF
                     NELFTRPVSLVRDSTTKKLFDTLEKSASKRIVITGEPGVGKTTLLAQLHAQALEKKAL
                     VFSISNSEILTNGRTDFFAEGEKYIQPMLVKKLLTKFAKSNSKELLQSITLSDNYKLV
                     HSEGKDLSVKRNVNLTKGKSTLSDLLNIKAPSRNRGAVFDALIKELTTQTKIPVYFTV
                     DNFSHLLTTPFTAYKDTSNKNIHLLKFQIGQSIFDLVSGDLKFAAKNSCVVLATSGSD
                     RTNRTLPIGLNKLPHDPYLTRYHYEPLLAEKLLKGKCEEFEVAKLSKIEVAKLIEFYQ
                     KAGILLEKDLQNKSLEQLTEEKYFLSGNGNPRELLKSIALYPF"
     gene            complement(<1237300..>1238721)
                     /gene="CEG1"
                     /locus_tag="KLMA_40549"
                     /db_xref="GeneID:34716535"
     mRNA            complement(<1237300..>1238721)
                     /gene="CEG1"
                     /locus_tag="KLMA_40549"
                     /product="mRNA-capping enzyme subunit alpha"
                     /transcript_id="XM_022819871.1"
                     /db_xref="GeneID:34716535"
     CDS             complement(1237300..1238721)
                     /gene="CEG1"
                     /locus_tag="KLMA_40549"
                     /codon_start=1
                     /product="mRNA-capping enzyme subunit alpha"
                     /protein_id="XP_022676394.1"
                     /db_xref="GeneID:34716535"
                     /translation="MDSNRVAPEIPGIRQPGQVTNDIRMLVCKLLNSPKPSNTFPGSQ
                     PVSFHLGDIEEKLLSEDYYVCEKTDGLRALMLIMVNPVTKEQGCFMIDRENNYYMVNG
                     FRFPCLPRSNKKELLETLQDGTLIDGELVVQKNPVTKMQELRYLMFDCLAVNGRSLIQ
                     SPTSSRLAHLGKEFFKPYYDLRSFYPDRCATFPFKISMKHMNFSYDLVKVANSLDSLP
                     HVSDGLIFTPVQRAYHIGGKDSYLLKWKPEVENTVDFKLILEPPLVEDKTLRKEDKNR
                     FYYNFDVKPFFYLYVWQGGNDINNRLHDYDQPFSKKELELLGRTYKKFAEIEIDDKQW
                     NELKAIQEPLNGRIVECSKDQESGAWKLLRFRDDKLNGNHVSVVQKVLESISDSVSLE
                     DLEEVAAEMKIRWKQREEERKRAQHNQQTMSRSSNHHSSFSDRSTSHRPSLSERPSDQ
                     PKYVDDDDEDWSDEEPESKKQKI"
     gene            <1239155..>1243696
                     /gene="SNT2"
                     /locus_tag="KLMA_40550"
                     /db_xref="GeneID:34716536"
     mRNA            <1239155..>1243696
                     /gene="SNT2"
                     /locus_tag="KLMA_40550"
                     /product="SANT domain-containing protein 2"
                     /transcript_id="XM_022819872.1"
                     /db_xref="GeneID:34716536"
     CDS             1239155..1243696
                     /gene="SNT2"
                     /locus_tag="KLMA_40550"
                     /codon_start=1
                     /product="SANT domain-containing protein 2"
                     /protein_id="XP_022676395.1"
                     /db_xref="GeneID:34716536"
                     /translation="MTTPSKRSPSDESKVLDTVDTTAAGSRKRSATKNVNYNEKEADN
                     ALARKIKQLEKFKVVKSKADKNNNSKKNGLNKKIINGKANFKYQSFLQDKNLSWNFIP
                     SLPTSFRKYARFSTLLDIDGMTVDVSKQILISEGNTVLKQNSHIYMVSEPPGEPYYIG
                     RIVEFVPKKEYRELISNSLHVTSVFPAVYFQLRMNWFYRPRDIQDRTNGSSSRLLYAS
                     LHNDLCPIYSFRGKCNVKFQKEFASNEELIEYVSKPNNFYFNQLFDRFTLKYYQMEQT
                     AKLRQDVDPESHYLKVLAQLYPYVFYEDKYPLHEVIKKYICGHKMDDQSWDNSCMECR
                     DWCHSASSIHCDECKVSIHLWCMDPPLEKKPAKGIVWICSACVAKQENSEPTSSNIPQ
                     ELGKLACLPVGDDVLQIDKTTTNKENWYYQYLGEDMCNHLIEPLFDDYIAPFPWKRSR
                     VSTNKGQWTKCNQNWIPEPYSNIEGERGSDDGIERLWTMNVNKISEKELDAYINKCKS
                     SIPKRLDVQPESCNFIDICLKLLMDNDYNPTSAYEAAIENITRDSLREPTLSPEEIKK
                     FEEGVSLYGSELHPVCKHVGTQPMSMIVRYYYYWKKTPNGRAIWGNFKGRSKNKKKNI
                     SEGGNTNQEHSLDKSDREFKRVTKNKSPKHSDKVWRHVDDSSFDSDKISDVKKEFQCM
                     FCSLDYSPLWYRVTGGSDDDHVQQRITLGMKTPDEDMSASLPEVKRKGKKENDAKLNA
                     LCIRCARIWRRYGVRWRTPIEVLKQLYGSSTSSIQTAVSELIEENDNQLKSYPNQQAF
                     SKCLDWELVVDAESITKQRYSASDNPEKLLKMKRNALSSQSQLNKATKKLIDVEGIKP
                     NNMENNLHTYINNIEMQIKKKEEKRLKKLKERELQEKLLLEAYSTNKNKGVKKEIKKE
                     PKNEDIPIEPVVNKVGKLHPEIKPQTPNEQKKVPPMLYNNSALIKKLLPSGEYLLNME
                     SNLGKADSLSAVTVDAEFLEIKLSDTIINQLKRERESIDIMRSMPISPKQKIAKTNNS
                     STNQSLSTTSKNHIPILKADEMSRSAILQMYNSISPKYGSVMKSCKREEKKSSKPKAA
                     FQAAKGVVDSDDKAMTIGTLIPREGSPADKVKDKCSVCFGICDSEFINSISCLNCKVK
                     VHFQCYGVTTNCKRNINSKEKSWLCDPCSNDRNPIFSTNYQCSLCNGEKKTLESADKS
                     SPGLFPEAFKRTMDGKWCHILCAAYCSDAKFASGETLQPILNVESVLFKQNTSKCELC
                     KESCGVIVKCECCDDCFHISCCANIEGFKLGFKKELNSNCSRENFMTFCDGALEYTVF
                     PTLTCTKHQNNPEILPLNYTPYGQSVSLFELFLKRAKIDPQAENLSTIQLRTYDKSCL
                     RMCDKSMNQLNMGTKQCLEKTFNEKAVLREQLLTILKAGFEKYPCPEIEKEEALELPK
                     QPERKRAFALISSIATGYASETSSKPSRKTKTKKGVKTEWKNVATAENNVTQPVEIYY
                     DNSGSDGNSIIAKDNSIDN"
     gene            complement(<1243758..>1244480)
                     /gene="LEA1"
                     /locus_tag="KLMA_40551"
                     /db_xref="GeneID:34716537"
     mRNA            complement(<1243758..>1244480)
                     /gene="LEA1"
                     /locus_tag="KLMA_40551"
                     /product="U2 small nuclear ribonucleoprotein A'"
                     /transcript_id="XM_022819874.1"
                     /db_xref="GeneID:34716537"
     CDS             complement(1243758..1244480)
                     /gene="LEA1"
                     /locus_tag="KLMA_40551"
                     /codon_start=1
                     /product="U2 small nuclear ribonucleoprotein A'"
                     /protein_id="XP_022676396.1"
                     /db_xref="GeneID:34716537"
                     /translation="MPKLSINQVLDAPTYFVDHFNGKYDTDKTIILRDESIVSDTDIM
                     RQSLSRLPEDCKVLDMTNNDLVTIPPLETHKGIHTLLLGRNRIRTVDGKAFPRQIKNL
                     SLVQNELKEFSDLEGLKFAPKTLENICLRGNDVCYLSGYRQYILKLCPQIRVLDFEKV
                     MDKERSAEFPDEVLESEIKDSQTLVHKTDRRMRDKHMELLGTVVKKMDEETRNKIKRQ
                     LAEATTLDEIERLEGLLAGNIE"
     gene            <1244861..>1246417
                     /gene="THI6"
                     /locus_tag="KLMA_40552"
                     /db_xref="GeneID:34716538"
     mRNA            <1244861..>1246417
                     /gene="THI6"
                     /locus_tag="KLMA_40552"
                     /product="thiamine biosynthetic bifunctional enzyme"
                     /transcript_id="XM_022819875.1"
                     /db_xref="GeneID:34716538"
     CDS             1244861..1246417
                     /gene="THI6"
                     /locus_tag="KLMA_40552"
                     /codon_start=1
                     /product="thiamine biosynthetic bifunctional enzyme"
                     /protein_id="XP_022676397.1"
                     /db_xref="GeneID:34716538"
                     /translation="MIDYTLYLVTDSTMLPEGTTLLSQVEAALKNGVTIVQLREKDTD
                     TKTLIHKALELKQLCDRYEVPLIIDDRVDVAMAIDASGVHVGQSDMPIPMVRKLVGPE
                     KIVGWSVGKVEEVDMIAQWGPEMVNYIGVGTVFDTQTKKDIKKIPFGPEGVSKILTRL
                     EEKKCHWCRTVAIGGLHPDNIARTIYQAQSQTGSRSVDGICVVSEIMASKDAAEATKN
                     LRNILKQERFNFLNTTSIESEEDHIKKEIQWTKKVKNISPLIHHITNRVHQNFGANVA
                     LAIGCSPIMSEVASEFADLSAIPNAVLLLNTGSVADIDTLTHAVKTYNAQKRPIVFDP
                     VGFSASATRLNTNLKLLSAGQYSCIKGNAGEIMGIAGVGGKMKGVDSSGSYNLETLIE
                     ATQIVAFKYRTIAVCSGKVDIVVDGTASLVSPLSKGLSVTPKKLPYTLIETTDIPLFD
                     KITASGCSLGTVIAGYVSAAPENKLYDAVTAAVRLYKEAGTKANTTANGSGSFQVHLI
                     DNLYKAVFDE"
     gene            complement(<1246624..>1247592)
                     /gene="CBP3"
                     /locus_tag="KLMA_40553"
                     /db_xref="GeneID:34716539"
     mRNA            complement(<1246624..>1247592)
                     /gene="CBP3"
                     /locus_tag="KLMA_40553"
                     /product="protein CBP3"
                     /transcript_id="XM_022819876.1"
                     /db_xref="GeneID:34716539"
     CDS             complement(1246624..1247592)
                     /gene="CBP3"
                     /locus_tag="KLMA_40553"
                     /codon_start=1
                     /product="protein CBP3"
                     /protein_id="XP_022676398.1"
                     /db_xref="GeneID:34716539"
                     /translation="MFRTSKSGSSLINLAGRQSALLNGSKLSVAPLNIRCYSAKKDDS
                     KVLQNGFVPEEVKAKRRELSDSKYESATYQLPKWKEALGEFVISTLNLDMDKVRSGPI
                     AGSYYYSICKEQGLQYADEPLSPTAKFFYEDLKLPKTFSQWFQITILHEWILFVRMRA
                     MPFKYGKAYQQKLVDRTFADIEKRLFDEMNVRSGRITDQYMKDFNSQLRGAVFAYDEG
                     FFGSDAVLAAAIWRNLFGGRKNIDMVHLEAMVRYVRAQLYVLSKLSDREFALGEFKFA
                     APDELVETLTPQQEKSIKEKVIAKYQEIDANPNTLPSQRSKLSYTN"
     gene            complement(<1247978..>1251628)
                     /gene="ITC1"
                     /locus_tag="KLMA_40554"
                     /db_xref="GeneID:34716540"
     mRNA            complement(<1247978..>1251628)
                     /gene="ITC1"
                     /locus_tag="KLMA_40554"
                     /product="imitation switch two complex protein 1"
                     /transcript_id="XM_022819877.1"
                     /db_xref="GeneID:34716540"
     CDS             complement(1247978..1251628)
                     /gene="ITC1"
                     /locus_tag="KLMA_40554"
                     /codon_start=1
                     /product="imitation switch two complex protein 1"
                     /protein_id="XP_022676399.1"
                     /db_xref="GeneID:34716540"
                     /translation="MVLYKRKSITLPEARPLPSNINRKIWYIKETGEWFLTYAEFLER
                     LDFYMRHYFTCEITGASCLTFFEALNSEEEQFQYVEKMFPLKLREPVAKFIHFNEIRR
                     LDMLVEQVYSNFKNNFFPGETVYLRKAKQEVASGDEDPEKQLRLQLQQMQQQPTSPQN
                     SSQSNVYIIKEKAQFNAVIDRNTGQELVPAHTKYMLQEAYGSASIIADEDQIYRDRST
                     FTKHLIKCFCKITLRRASSKMGAPWCVKDEYLPIYNLSPEWPPHMLKYREDYVDMQYL
                     QQQQQQQQQQQATDSNNRSGYTTADSADLKRELDAARTATPDHKRLKTEDSVMEYSPS
                     VDHGNLESNNNVQNDHQTITEITEDLKIPFSAPRPASISNKLFSYSKEYVALPAASND
                     KSFSDSVGKLLHCYQFLMGFHTTLQLSKFSWDNFVNSMRFTDRRNLMDEFVDISLEDG
                     TKNKVERFNAWNSLVYDYIDSLNSDKMRITVELDEDINEDYLDEIKITGASLTVECFC
                     SLLRLFMDTDGNWTTLVTSEWLEGEDLDEELEEDKEDGVDEDSNGNDKDDGVNPNEDD
                     SESGKNENKSANDDNDDDNDDESKLETALEKCLNYRKMEWTDRLAKRQFSNGHWLIIL
                     LGVLQDCMHLPMYTTTIKNFMKKLIPFENSTSNIALNKQLWRQFCKNISIKEKIDIMW
                     ILVEVLSNYSSIIRSAMDDSMELSNQIRSERFRLSRDLKACANTVSELKESIYLMSVE
                     NGGVNGNEKEEEKEEEGEKEKEKEKEKELAERQEKLRKANTELERLQKRKHFLDVKLI
                     ESDIQRLKPLGSDRYGNKIYWLEYSGVPRPDSFSTEKHILSNRLWIQGPVKEVALLYF
                     NLSEDQYENWISISRTSGKAEATKQIFNVYRDDSGSYYHHDEQGDVMLINDEGVVNSY
                     IELSPLQRKIIDETPENLLLSPNDWVFLQDTNELTNYMEWLDSWGKREHETLKQLEYV
                     IEPLKENLLDYQKLVNQKLEQERNSIVAEINAINITEEEFSAGSSVANTTGTHIDDEL
                     EDIANQIMALDDASKTRKVLLQIQDLEAKRDKLLEKKKTAVETADSSEGSGSGSKISA
                     VERKKILASREKKIGNLKDALDKLINLQRESERISITEWSNEMAIDVWSNELFKCNGN
                     VKSAKDPPVITVSEKIAKILEQASIIEDQPSISSTESEEQTQTQDEHKTQDVTPHDQS
                     DKSDVSRKNTQA"
     gene            <1252205..>1255723
                     /gene="BMS1"
                     /locus_tag="KLMA_40555"
                     /db_xref="GeneID:34716541"
     mRNA            <1252205..>1255723
                     /gene="BMS1"
                     /locus_tag="KLMA_40555"
                     /product="ribosome biogenesis protein BMS1"
                     /transcript_id="XM_022819878.1"
                     /db_xref="GeneID:34716541"
     CDS             1252205..1255723
                     /gene="BMS1"
                     /locus_tag="KLMA_40555"
                     /codon_start=1
                     /product="ribosome biogenesis protein BMS1"
                     /protein_id="XP_022676400.1"
                     /db_xref="GeneID:34716541"
                     /translation="MEQSNKEHRKRKEKAGAKKKLHTQGHNAKAFAVSAPGKMAKQMQ
                     RTGDKNEKKLHVPMVDRTPEDDPPPIIIAVVGPPGTGKTTLIKSLVRRLTKTTLTEIN
                     GPITVVSGKRRRLTFIECPADDLNSMIDISKVADLVLLMIDGNFGFEMETMEFLNLAQ
                     HHGMPRVLGVATHLDLFKSQSTLRASKKTLKHRFWTEVYQGAKLFYLSGVINGRYPDR
                     EILNLSRFISVMKFRPLKWRNEHPYLLADRIADLTHPELLQSKGKHIDRKVAIYGYLH
                     GTPLPTTSGYKVHIAGVGDYAIDHVEKLPDPCPTPYFQQKLDEYERERAKEEGASAAA
                     IPKRRKRLDDKQKLIYAPMSDVGGLLMDKDAVYIDVGGKTGPSTMTNEEKGESDQLVS
                     QLQGTNQSIDEKFQNVGLQLFSNSTELHAVEDQEEFSEEEEEDDADNGDTGRSSLRKA
                     KVYGKSIRESNEDDDGLSSDNEEFEDADEDEGEEHRTKLVEIDFDEDGNEKMAFETDS
                     ELDASDSEDWERTAAGKLNGTNRRRRWDIGKLIYMDNISPEDALKRWRGELEDDEAEE
                     DIEAEEDEGDFFKQKTSATINKTQTYEDDLERFIPYFDTFNSLVEKWSTVDSIKDRFI
                     GKPLLSDKEKANSNSDDDDEDEVYGDFEDLEANPENPEEGDKENASDEGEEDKEEESD
                     SNDSFADFDEEEKKELTQEEERELNASKKEKLRLQFEMEEGDKFGEDPENEYDTWYEL
                     QKAKIAKQLEINKVELESMTPEQREKIEGMKAGSYVRIVIDNIPMEFIENFNPKFPII
                     MGGLLPTELKFGIINARIRRHRWHKKILKTNDPLVLSLGWRRFQTLPIYTTSDSRTRT
                     RMLKYTPEHAYCTASFYGPLCSPNTTFCGVQVVANSDTTGSFRISATGIVEEIDASVE
                     IVKKLKLVGYPYKIFKNTAFIKDMFSSAMEVARFEGAQIKTVSGIRGEIKRALSKPEG
                     HFRATFEDKILLSDIIILRSWYPIQVKKFYNPVTSLLLKDKTEWKGLRLTGKIRADLG
                     IETPTNNDSTYKKVERVERNFNGLKVPKSIAKDLPFKSQIHQMKPQKKKTYMAKRAVV
                     LGGEEKKARSFMQKVMTISNAKEEKRKSKKAEERKERLKKLAKLEEAKKEKEKQKKKD
                     FFSKNGKKRQFNDSEMSDVMSSKKRK"
     gene            complement(<1255858..>1256430)
                     /gene="SAR1"
                     /locus_tag="KLMA_40556"
                     /db_xref="GeneID:34716542"
     mRNA            complement(<1255858..>1256430)
                     /gene="SAR1"
                     /locus_tag="KLMA_40556"
                     /product="small COPII coat GTPase SAR1"
                     /transcript_id="XM_022819879.1"
                     /db_xref="GeneID:34716542"
     CDS             complement(1255858..1256430)
                     /gene="SAR1"
                     /locus_tag="KLMA_40556"
                     /codon_start=1
                     /product="small COPII coat GTPase SAR1"
                     /protein_id="XP_022676401.1"
                     /db_xref="GeneID:34716542"
                     /translation="MAGWDLFGWFRDILSSLGLWNKHGKLLFLGLDNAGKTTLLHMLK
                     NDRLATLQPTWHPTSEELAIGNIKFTTFDLGGHLQARRLWKDYFPEVNGIVFLVDAAD
                     PERFDEARVELDALFQIKELDNVPFAVLGNKIDSPSAVSETELRAALGLMNTTGHTRI
                     EGQRPIELFMCSVVMKSGYSEAFKWLSEYI"
     gene            complement(<1256896..>1258383)
                     /locus_tag="KLMA_40557"
                     /db_xref="GeneID:34716543"
     mRNA            complement(<1256896..>1258383)
                     /locus_tag="KLMA_40557"
                     /product="PHO85 cyclin-8"
                     /transcript_id="XM_022819880.1"
                     /db_xref="GeneID:34716543"
     CDS             complement(1256896..1258383)
                     /locus_tag="KLMA_40557"
                     /codon_start=1
                     /product="PHO85 cyclin-8"
                     /protein_id="XP_022676402.1"
                     /db_xref="GeneID:34716543"
                     /translation="MPGSVSPGAFIGDKRDWLKVNGDVNHEEDCDQSDYDVDDVSFGL
                     PLKSRHLEGNFDDILHISDAKKVRFVEGKSAMTVEQLLENTSNLNLFVEKNMERINGL
                     RSGLDVQEWYRSSTPDTPTGTNISAKATASASAGSTSNFQLSEAGDRDSSTIGGIDSD
                     QDSNQESNMLDSRLSNLLASTSAADYSLQKMDSSTYNESASNSHPNLDRTDDQRDNTL
                     LIHSLLRTNSEETGLSGLHMTSKEASHVFIDILQLALRLSLQKEQNEHNNSDIENNND
                     DDNTTINNNNNNNNNSNNNNNNNNNNDDDDNDDNNNIDNNIIKDTSITTDNKEDTDIT
                     HITQNAEHPSDESLDSGLSPKLESIFQMKSTPTLSASDYIDRIESKCSFAPVIYLTAS
                     FLLITYCNLQFDDQNGFHIEQGITESMMHRLTIACIRVAAKLLEDTVHSHHYFSKVCG
                     VSKKLLSKLELQLLLSLQSKPGGLIVTEQSIQTVMNIHSHIEKNC"
     gene            complement(<1259129..>1259782)
                     /gene="RPL10A"
                     /locus_tag="KLMA_40558"
                     /db_xref="GeneID:34716544"
     mRNA            complement(<1259129..>1259782)
                     /gene="RPL10A"
                     /locus_tag="KLMA_40558"
                     /product="60S ribosomal protein L10a"
                     /transcript_id="XM_022819881.1"
                     /db_xref="GeneID:34716544"
     CDS             complement(1259129..1259782)
                     /gene="RPL10A"
                     /locus_tag="KLMA_40558"
                     /codon_start=1
                     /product="60S ribosomal protein L10a"
                     /protein_id="XP_022676403.1"
                     /db_xref="GeneID:34716544"
                     /translation="MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQ
                     RDKRFSGTLKLPVCPRPNLSICIFGDAFDVDRAKSCGVDAMSVEDLKKLNKNKKLIKK
                     LAKKYSAFVASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYAKVNDVKSTIKFQLK
                     KVLCLAVAVGNVEMDEDTLVNQILMAVNFLVSLLKKNWQNVGSLVIKSTMGPAYRLY"
     gene            <1260394..>1261266
                     /gene="MRM2"
                     /locus_tag="KLMA_40559"
                     /db_xref="GeneID:34716545"
     mRNA            <1260394..>1261266
                     /gene="MRM2"
                     /locus_tag="KLMA_40559"
                     /product="ribosomal RNA methyltransferase MRM2"
                     /transcript_id="XM_022819882.1"
                     /db_xref="GeneID:34716545"
     CDS             1260394..1261266
                     /gene="MRM2"
                     /locus_tag="KLMA_40559"
                     /codon_start=1
                     /product="ribosomal RNA methyltransferase MRM2"
                     /protein_id="XP_022676404.1"
                     /db_xref="GeneID:34716545"
                     /translation="MLSSLVVPRVPNYRPFVSLTLRLVRHNSNSQNRWLARQKNDHFT
                     KAAKEQQFRSRAAFKLMDIDDKYKLMKKKHKVLDLGFAPGAWSQVARKRVGPEGMIMG
                     VDLLRCPPPKGVFSIQANILSKKTHELIRFCFARHIQLNKHDELHKDHGYFQHMLEEE
                     LNHVRESEEYKELFSQADVSNSVERYPVDVVLSDMMANTTGVSIKDHYMSMDLCDAAL
                     IAAIDLLKPGGSFVCKLYAGSEDSLLESRLRKVFRKVDRFKPHASRNESKELYFIGRE
                     KLAKVDKLKVFLEE"
     gene            complement(<1261467..>1264335)
                     /gene="SEC27"
                     /locus_tag="KLMA_40560"
                     /db_xref="GeneID:34716546"
     mRNA            complement(join(<1261467..1264112,1264318..>1264335))
                     /gene="SEC27"
                     /locus_tag="KLMA_40560"
                     /product="coatomer subunit beta'"
                     /transcript_id="XM_022819883.1"
                     /db_xref="GeneID:34716546"
     CDS             complement(join(1261467..1264112,1264318..1264335))
                     /gene="SEC27"
                     /locus_tag="KLMA_40560"
                     /codon_start=1
                     /product="coatomer subunit beta'"
                     /protein_id="XP_022676405.1"
                     /db_xref="GeneID:34716546"
                     /translation="MKLDIRKTFSTRTDRVKGIDFHPEEPWVLITLYSGKIEIWNYET
                     QTQVRSIPLCDAPVRAGRFIARKNWVVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRS
                     IAVHPTRPFVLTGSDDLTVKLWNWEKNWACEQTFTGHEHFVMSVAFNPKDPNQFASGC
                     LDHTVKVWSIGQDVPNFTLKAHETKGVNYVDYYPLQDKPYLITTSDDGTIKIWDYQTK
                     SEVATLQGHMANVSYAVFHPTLPIIISGSEDGTLKIWNANTYRLEKTLNIGLERSWCI
                     ATHPSGKCNYIASGFDDGFTVLSLGDDQPKLSLDPVGKLVYTGGKGFVTDVFSAIIRG
                     NEEVEEGGALPLQSKELGYIDVFPQSLKHSPNGRFVAVVGDDQFIIYTALSWRNKGFG
                     KCHDFVWGPDSNSFAIIEESGSVAYFKNNNKVTSWSIPLEYGIEKLFPGSLLGVKADG
                     FTYFFDWESGSLVKRIDVDAKDVVWSENGELVMIINKDRDADSNEEASAYALLFNKDA
                     YDEALASGNIDEDGVEDSFDVLYEVSEGITSGKWVGDVFIFTTPTNRLNYFVGGKIYN
                     LAHFDKQMYLLGYLPRDDKVYLADKDIHVYGYEISIDVLEFETLVLRGELAEAKSTVL
                     PNVQGKENLLRISRFLEGQDLFEDALEISPDAEQKFDLALKLGKLSLAEEILSEQESE
                     NRWIQLGDAALKKFNFTLALQCYKRANDLESLFLLYSSFNNKQELISLGKNAETSGKF
                     NLAFNAYWVAGDVTGAKNLLLKSGRVPEAALLSLTYGEPDAGVNEVVDIWKQTLLKDG
                     KAGIAQRIGIIGETEGFPSREPQTLVDLDTPKDGKEEIEAEEKTNEEEQVETEKVVEE
                     TKEAEAEQEEKEEKEEKDTDEVPEKFTDAEE"
     gene            <1264743..>1265978
                     /locus_tag="KLMA_40561"
                     /db_xref="GeneID:34716547"
     mRNA            <1264743..>1265978
                     /locus_tag="KLMA_40561"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819885.1"
                     /db_xref="GeneID:34716547"
     CDS             1264743..1265978
                     /locus_tag="KLMA_40561"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676406.1"
                     /db_xref="GeneID:34716547"
                     /translation="MNCIRCWRIILVTVIYVSSIVTGLSILPVYTIDKACFAGSDSMN
                     VNVKKTFEMWSGSEIPISQLPGDTKLFTGFKFHRVFSFHQLFRGNGKALKITYCKEGK
                     EVFQTEKDIAHDGDDWERPWCFFEDGNESVENIESFHCLKIARRKKYAIRPFDIFIPY
                     TWIGGLFYCNISENEKISILTKKGKEEPFKSYSGSPICTLDNSIPIEPLYASLTTSSY
                     NEIVSKKLVPFITLLSKRKTKTYIPYLQSPNLCSKDLNITSASFEESTKGPKSLNRGY
                     KVDTKDLVLEWYSFGQNSTSSNTQAKWFREIEVDEKYKYNQEDHFMLTLATNKLRSII
                     TPFVEPSAQDIEELSFPWKTINRIIETKIWKTFGITDKLLTLNAQDILDKCEAFLKFW
                     DNLHLDDEEFTYKYSDIQK"
     gene            complement(<1266089..>1268464)
                     /gene="FLC1"
                     /locus_tag="KLMA_40562"
                     /db_xref="GeneID:34716548"
     mRNA            complement(<1266089..>1268464)
                     /gene="FLC1"
                     /locus_tag="KLMA_40562"
                     /product="flavin carrier protein 1"
                     /transcript_id="XM_022819886.1"
                     /db_xref="GeneID:34716548"
     CDS             complement(1266089..1268464)
                     /gene="FLC1"
                     /locus_tag="KLMA_40562"
                     /codon_start=1
                     /product="flavin carrier protein 1"
                     /protein_id="XP_022676407.1"
                     /db_xref="GeneID:34716548"
                     /translation="MIMKDFLAKCWILLCFLIASASAKRNLVATSLVTCMDNSQLTAN
                     SFDVVFNPDDSSLHYTLDITTEVNGYVVAQAEVYAYGFRVINKVIDPCDSNWKQFCPL
                     YPGVIEIDSIQYISKHYKDMIPGIAYQVPDIDAYLKMNVMHRGSSEVIGCIQAFFTNG
                     KTVSQPGVKWVTAVIAGLGLLTSALLSAFGNSNAASHVAANTMSLFLYFQSVAVFAMQ
                     HVETLPPIAAAWSENLMWSMGLIRVSFMQKIFRWYVQSTGGTPTLYLTSKTISVLVQR
                     SLEFVENSWLYKRSHDVLKGNSNVLIFRGIKRLGYSAHIEVTSIVPTGLTFFVLCGYV
                     LFGLIICTKYAIELSIRAGWIKNSRFIDFRKNWKAILKGALMRYIYIGFIQITILCFW
                     EFVQRDSAAVITLSCLFLVMVYGIIAYASYRTIFFAKRSIAKHNNPAAILYGDQRVLH
                     KYGFFYTMFSADYYYWSCVIMGYNFIRGLFIAFAQSSGKTQALAIFIFDLAYFIALIK
                     YKPYLDRATNIMNILISTVTLINSFLFLFFSGLFNQPYPVGSIMAWVFFILNAAFSLI
                     LLMMILVYVGFVLFSKNPDVRFKPANDDRTSFQRQTATVGALDKSVAEELMALGTVAK
                     DHDGDWQELLATQGNRTTESSSGSVDDEKFLSLKNEQSVSRKHSLKDKLFRKMSIRRN
                     KSTSSKISNGKSISNAGTLSPGSSSNSTEPMSKSYPRVTSRGSGAENRLIDNSSDFDF
                     TLDPGQVTPTRSPRRTASINNESVNLDGNADVNATSSTDIFQHNNGSYYKL"
     gene            complement(<1269285..>1272299)
                     /locus_tag="KLMA_40563"
                     /db_xref="GeneID:34716549"
     mRNA            complement(<1269285..>1272299)
                     /locus_tag="KLMA_40563"
                     /product="ATP-dependent protease La"
                     /transcript_id="XM_022819887.1"
                     /db_xref="GeneID:34716549"
     CDS             complement(1269285..1272299)
                     /locus_tag="KLMA_40563"
                     /codon_start=1
                     /product="ATP-dependent protease La"
                     /protein_id="XP_022676408.1"
                     /db_xref="GeneID:34716549"
                     /translation="MGLFFDSSKPTLYLPCFTLVDAPKLVPLPGISYKVSFEKVSITP
                     VLSEYKRNDAFRRNPCLREIKPNIAQNEVVVDSSVVKSCIEFHRKYGSRKGKDSDDDV
                     PMYIVLLPCEATNISVGVACKIVSVEVEDDVVTITFKSVVRVENTQPILNMKQKLWKS
                     IVVELDDRVELLSWDQKETDGFISTFLKLFDDTNRILKEFKIKYSLASKKSSDERSRM
                     LYLSPLANTLYLQLNRSHFNRSWNLLKIYLAEVKTEENIHDTCFELSSMMDLMMSILP
                     MTLKQRLDFLATKKLKERSALFFNSIQELQQLFQKLDDGIEYINQHFSDSPNIEKSIL
                     ISSQLRALRFYIDDIKRSNSSPTLKPTPKNGIPTGRKASSNSPESKPDDFDSGSDAKD
                     EIEQIKGFINSLDKKGVHPDGIKLLRKDFMRFSKMTAQNADYQVLRNYFDIVMDIPFG
                     KTLSRETIDLMQSKAKLNSDHYGLQSVKYRLIEYLSVLKLSELTEAVSKEQLQNSRKL
                     RKSPILLLVGPPGVGKTSIAKSVADVLGRKFQRISLGGIHNEAEIRGHRRTYVGSMCG
                     LIVNALRKAGTMNPLILLDEIDKVTSGGVGGYGNRINGDPGSALLEVLDPEQNSSFTD
                     HYVGFPIDLSQILFFCTANELEGISEPLLNRMEVIEIPGYTPEEKIMIGSKFLLPKQI
                     KANGLDAVKGIPKLCLSSDAWNSVVLEYTREPGVRGLERKLSAIVRGKVMEYFTNKEI
                     KGEVKKEDLYRYLGLARHPISEDILAPTEHSESFGIVNGLSYNSDGTGSVLVFEVIKT
                     NSDDIANGSNASGPHINTTGNLGSILEESIRLATSFVRHILLRGLIPILDQKQIQEFL
                     SSEYHLHVPMGAVSKDGPSAGVAITLAILSCALQRPVSPKICMTGEMTLRGKVLPIGG
                     VKEKLLGAQLYNMQHVLIPAGNRSDIVQALATENEQQYKLYMDTTYPELRILHEKTNL
                     QVHYCSDFFDVIKHTWPDIFKRSSLNVSSARM"
     gene            complement(<1272662..>1273759)
                     /locus_tag="KLMA_40564"
                     /db_xref="GeneID:34716550"
     mRNA            complement(<1272662..>1273759)
                     /locus_tag="KLMA_40564"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819888.1"
                     /db_xref="GeneID:34716550"
     CDS             complement(1272662..1273759)
                     /locus_tag="KLMA_40564"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676409.1"
                     /db_xref="GeneID:34716550"
                     /translation="MLLKQAKKTQKRKVETFESIAFPLMELDQLPLPFYETKTEVFSL
                     DQVEFSEVSDSFSKEFESIIEEVFSDKYEQYTYDQTSSVYEQATLDEKNNRDINEQEM
                     EEHIPIENLPQSPLFNCELEENSFLADYYREDSLPTEQTDIGSFSREHSTNDYKKIAT
                     PEVVTKRVLKGDLTKEPVLEIADDNNNIGENEEKNEDKSTKVSKSWKRYINLLEKYPI
                     YTKDDILKQELALQKLKERIYSEKISKGTRVAKNSFLTLVVGPYYLGKFGYKLCLRNL
                     AKFSIAHLEEFKDVDYQELLKYAKLQSLNLKEDDLSLHDKHYKKWLETDGSVTQIPSI
                     CYRNLGNDTGSLFPASTNYPKTYSTHSRKTY"
     gene            complement(<1274094..>1276106)
                     /gene="FMP40"
                     /locus_tag="KLMA_40565"
                     /db_xref="GeneID:34716551"
     mRNA            complement(<1274094..>1276106)
                     /gene="FMP40"
                     /locus_tag="KLMA_40565"
                     /product="UPF0061 protein FMP40"
                     /transcript_id="XM_022819889.1"
                     /db_xref="GeneID:34716551"
     CDS             complement(1274094..1276106)
                     /gene="FMP40"
                     /locus_tag="KLMA_40565"
                     /codon_start=1
                     /product="UPF0061 protein FMP40"
                     /protein_id="XP_022676410.1"
                     /db_xref="GeneID:34716551"
                     /translation="MGEARNIILALKECGSSRVVRHLDPERYLQTVGAAADLYRATDD
                     ESLKRQRLVFHTPRQVSTETNGTPHFSFGAPEKRVHYKPMIQSKKALEDLNLVSDEKL
                     TNLCQGSEIYFDESRNIFPYSLSYAGFQFGQFAGQLGDGRVHNLFEIKDKNAQYQTIQ
                     LKGSGLTPYSRFADGKAVLRSSIREFVISESLHAIGIPSSRALQISSLPKTRAKRSYF
                     EPCAVITRFAPSWIRIGNFDLFRWKKDDKGLLKLADYCIDEVFDGLKVEKNLVSLNSF
                     KTNFFEGTSTMINSSEEHSKKLTDDVMTKYDLLFRKIAKLNAEGVAYWQAYGFCNGVL
                     NTDNTSILGLSIDFGPFGFMDKFDPDYTPNHDDVNGRYSFSNQPSVIWWNLIKLAEAL
                     VIPLGVGKELLPKLPVTERKDWTEEEVNKISERATAIINLTGLEYEYRFTVKYADLMA
                     KRLGYDLEIPAELTEENLSSIADKVKCFTVDVIEPMLKILQVTGVDYNGFFLALQNYN
                     GPFLNDKEPHGLDKDLLRVFFNEEQILKITKYYEDHAENDSGETRKLLEVSKTLNNWA
                     KDFLQLAPSFQNRVQVAQKVNPLFIPRNYILEYVADQYTEEQREKLNDPDAELDNQSL
                     EKLLLMSTNPYDSSAWNNSLLPELEVEWSTVTDDPDLLMTQCGCSS"
     gene            <1276951..>1279719
                     /gene="SRC1"
                     /locus_tag="KLMA_40566"
                     /db_xref="GeneID:34716552"
     mRNA            join(<1276951..1278882,1279120..>1279719)
                     /gene="SRC1"
                     /locus_tag="KLMA_40566"
                     /product="src1p"
                     /transcript_id="XM_022819890.1"
                     /db_xref="GeneID:34716552"
     CDS             join(1276951..1278882,1279120..1279719)
                     /gene="SRC1"
                     /locus_tag="KLMA_40566"
                     /codon_start=1
                     /product="src1p"
                     /protein_id="XP_022676411.1"
                     /db_xref="GeneID:34716552"
                     /translation="MSKEEGNSSFNESLLKEDFDPASLKIAELKTVLTSNEIGFKAHD
                     KKAALVKLVEENLDTIKKNVEKDGITTSSHGKVKVTKKRESSKKKRKSATPDALEKSL
                     EKAVHHVKSTPISTPVKEEKEEEEGNTSKVVAKKRKKKSKGNELDKEESRSKTSKKRT
                     KGDESDVEEGEKPDKKARKTKKKKNVSKEGSHDIKSATGSPITKKITKKSPIKSPHRS
                     LIIDKFESSDDASDDSGKDDSFVNFSIKRTSKSNSAIHSSPKSGTASADISADASGRT
                     VTRSNESTKIMETPQESTPIKLNSKSPRANNALRELENQVEQEELENPQRRIPTPTFP
                     TIEEVQKLQDQVTRSINTDNTEASENVSTSEQQIATDREETSREEESISGDKTKDEVE
                     EPIDEELLEGEEEVDENSSVLKGEGKEEEEEEEEEEEGKETTDTKMAKKQCIKKSAKS
                     LFTSLGHFLIKLNIFLLIMLPIIFGLWYREQRIAVGFCGSEIDIPLLGKEYTNPYVKE
                     FESKLSPLKPDCLPCPENAICFPYMNLKCKPGYIIEKSIFSLHGLVPIHDRCIKDSKK
                     QKLVQEVVKKTLELLRTKNAQESCGECEDDIKSGVSNEELYEIFYESKKPWINDEEFN
                     ALWEQVEVDLKEEPEIIWRQLPTKSGNHKSSGSSSDGHPPEGSLEVDGQTGHFQETGF
                     QKGYFRSTSKKYIGLKCQFERQVHSTWNRYQWLVVSTFSILVALQILKRYISKKLQER
                     EMIEKISEQVIKRLQQVVIKKIQPSYMSSVQLRDLILKDVNDLNEKNRIWTATTKRLD
                     SNTNVKSTLMEIHGEIMKCWEWIGVLPINDDDNKTEQTENANVAA"
     gene            complement(<1281186..>1290914)
                     /gene="TOM1"
                     /locus_tag="KLMA_40567"
                     /db_xref="GeneID:34716553"
     mRNA            complement(<1281186..>1290914)
                     /gene="TOM1"
                     /locus_tag="KLMA_40567"
                     /product="probable E3 ubiquitin-protein ligase TOM1"
                     /transcript_id="XM_022819891.1"
                     /db_xref="GeneID:34716553"
     CDS             complement(1281186..1290914)
                     /gene="TOM1"
                     /locus_tag="KLMA_40567"
                     /codon_start=1
                     /product="probable E3 ubiquitin-protein ligase TOM1"
                     /protein_id="XP_022676412.1"
                     /db_xref="GeneID:34716553"
                     /translation="MVTLTRAEKLRKEENAKSYKPLIDDLTECSESDFIEKLKNIKEW
                     DRSRDDLYVWIPVLNRIDEILTKIVENYNYTSTDWKKLPCKLELMSKKDENDVWEYLS
                     FSIRLLNNTMNRSIYNSLDVMNSLLNCPNFKIKLGAARILATIGERNVVSRNGYDSKG
                     IMSSDEMKEKSLELALCLPSSTTDDNMEHFSLVDLYFDKKLYPSKLGRIEYKYFTKDS
                     KRNKDNSKPPSKNLQVNANKMRTFILSKDDLTSLTLQQIFDKGMQELPREEWFKFSLR
                     ATVAKAFSDNSFENIQLRNHIIQTKFNAIAIINVTFYPAQVSSKFFEVDPYAFNSLSE
                     FLSLSETKVPRDLRMDALFALECISLKHIWCSDIVRNLGGNMSHGLLFQILKYISKII
                     RENNTEEVDEEYNVRFFYLISNLADVRVLQESLLNAGLISSILDIISIKTNGFKRTKT
                     SATHLLDALMSNECVDDFINNNGLNILIESLTEEVTFALEHPEYGAPPKYSVTHYSIS
                     FRQISFIRSLLKLVLKLLSCDSGNRTRNLIDSPILGALNNILKNKSVFGYTLLSHVLD
                     IIQTVINIEPTIYQVLIECDTIPFIIENFEQFVCPSTELLKILPEVISALCLHTDGLK
                     QVKEKHLINYIFQISTDVDFSKVMCADDEVIDLGSSLDELSRHYPDLKEDIVDQFVEL
                     VHKLPEILDFDHPHLYKSQNGQNNFYLSPDEEVVENEEGADEIAAWEVQKYSVILDTF
                     SGMFFGMMENVSWVPLLSKKIDAASLLAVLVPKKPTYDYIDSQCFLNFTDALKTFDDE
                     DSKYALPTLLDLLKSTLEDLSDFINYDQNKSFVLTMDSDTVEQTLKQVNVLQVILSTI
                     TSVYIDLFSLFPERVIQIIEYFEQHGFSLVHLLRSTFERCALEEYYIRESLPVDVSDK
                     TRPATSPGTPSLLLYKVKGEKEVKTNFTSTKFKNTLQCRFLFHTTQSCISIIFRALLR
                     LSHARKMSLTSTDLATELRIFNEVTQSFVNMLSNKSLEKKLGYLVVLLNLTSFSFTYV
                     VANNRSLDTFNTIPILMFYQLGGFQAYKHWCMVLTKKCLEIPDVTAVEKINYLKDEQD
                     VIASHGLVATLSFMNKAIQLQTMEMIRSTKDYYPHDDITYNITSGVIVTIKILALGLV
                     KEIFDLDEMFSSDRRRFPYPVFKQLLTMIKNIYASSDEVEDPEFSLYELRWDLIPPSY
                     CKIEMLKSCGISEDVARGYLEEQNDDLPVHVKPDVFSNAEWENYKKLKASGEWKTDLQ
                     LLPPQYDNLTTKADLTDFRANFYRNGFEQKILCIVQNYPKLINAVSKMFLEIYDELQF
                     PHISMLEDLLSIMNSSKLENADQLAPIVHLFGIFLNEEKIYNQSKTVIHKFITFLLEN
                     LSPQYVNHPWFFKALYVYEIILARSMFPDSTELPDDFKIPEIITVDVKHLFSVDKDLI
                     FNVLIRVPEITDFYSSLAISRILILYAAEEKYSNEIVQSGIIPKLLKVIGTHQKSEKI
                     NYLESSLLLLCRRCFETKNVVSSLIKYELNRAFTTRAIGDTKEKSRDLTLLIGEKANV
                     IMRDPEIFVTELCKNGRFVDFSSKNVLESFVMKRFVDEEPKNLEADEGGKEAAFTKRT
                     GIVDLLLSQLMAAYKMDWLSEPPNPAEQEEKKVKKKPRNQVKASRNPICAYMIFLLKT
                     LTELLSSYNHSKYEFMTFNKRGAYSESPAPRTTALNFFIHQLLDYKTQDVDIYVTKRR
                     ETIGKLATCALIGFVSSVQDDKLVKSDPKSLDPNMTFIRKFTLESLSKAMKDLKGTRS
                     LENNLGKYHGWFNLVHRLLITDPLMNNLLDKMKIETDKYEICKLMLEIKIPETITECL
                     STLDLNVPFSKKIYNAAIDPLNSITETRNIFSEYFKSENNEDDEDVDEDSDKEEVPDM
                     FKNSALGMYDIEDIEDDDDDDSLMGDEDVAFVNDDEDIEIVFSDEDGAEESVSESDSD
                     SDESSATSDSVESSEDEEMEVEINEQSSDEDMSGDDEEDISADESYYSGSPPLVVEVS
                     EEGFGSDLEIDLDDSELSSDWESGLSELDDTDYESDDSQREEANYNSSNLRNGANNRW
                     YTSDGVEIYDDSDGEGRGIYRGVQHVPNEELIFRIENSSLSNNRRGRHHHNRMAIAPS
                     IISIDSDSHRSRNMLMNPLGPHGMEEVEDIISNEDNPARRFGPGITGFWLADSLLDNK
                     SIDGIIVKNTTERWGDIFEMFYENKGFLINILPEIVCKVIERSAELWYKQIAEHKAKE
                     LQEKTGTERPKKRSLDEMTMDDSDTENLSSREGSEAVAEVEEEHPTNTASHEPVYVII
                     DGNEVDIGGTDIDPEFINALPEDMRAEVLAQHISERRAEARQHEIDSREINDEFLESV
                     PATIREEIIAGENVSRRFSNLLSNRRVGEFDGESVSGSDYDGNSDNENTTSQSNQNKS
                     KRVHFDPLVDRSGIAAIVKSLFIPQPYFSRESYHELFFKLCSSKQNRSDIMNFLLLIL
                     TEGISDQHSLEKIFNLISNKANSSNDSKTMSYQLPPDCTPLIVANQCIEVLQSMIESD
                     ARLRYFFVTEHDNLIINKSYVKTKKDIFSKNMKWPINALFALLNQKLVTDETVLMDLL
                     TNILKQCTKPILSLVKKKNENTFKRNFEIPVIEKKHLELIVSVIKLDSCNTKIFQQTL
                     NIMTNLFSIKDAQEIFTSELRNLAVSTISQLIKDLNELCVQLPSVKSGTEINSEIIQK
                     FTSPSSEQSKLLKVVTAVDYIYSHQKQGDTESARKLVALFNEMKLGPVWVALSKCLTA
                     FEENSAVSTSATILLPTIESLMVVCKNSKVREVSGGQLKYTEKSYDFETISVEDLFFE
                     FTDLHKKLLNEMIRANPQLMSGPFQLLVKNPKILDFDNKRHFFMAKIRHNPAQRQKLS
                     ITVRRDQVFLDSYRALFFKSNEEIKNCKLDITFKGEAGVDEGGVTREWYQVLSRQMFN
                     PDYALFIPVGSDNTKFRPNRTSGINPEHLSFFKFVGMIIGKAISDNCFLDCHFSREVY
                     KNILGKPVSLKDMESLDLEYYKSLNWMLENDITYVIEETFSIDTDDYGEHKTIDLIPN
                     GRNIAVTEENKKEYVQKVVEYKLQESVKEHMANLLQGFYTIIDKDLISIFDEQELELL
                     ISGLPDIDVDDWKNNTTYVNYTPTCKQINYFWRAVRSFDKEERAKLLQFVTGTSKLPL
                     NGFKDLSGINGDSKFSIHRDYGSTDRLPSSHTCFNQLDLPAYDSYEQLRGSLLLAINE
                     GHEGFGLA"
     gene            complement(<1291477..>1292814)
                     /gene="RAD52"
                     /locus_tag="KLMA_40568"
                     /db_xref="GeneID:34716554"
     mRNA            complement(<1291477..>1292814)
                     /gene="RAD52"
                     /locus_tag="KLMA_40568"
                     /product="DNA repair and recombination protein RAD52"
                     /transcript_id="XM_022819892.1"
                     /db_xref="GeneID:34716554"
     CDS             complement(1291477..1292814)
                     /gene="RAD52"
                     /locus_tag="KLMA_40568"
                     /codon_start=1
                     /product="DNA repair and recombination protein RAD52"
                     /protein_id="XP_022676413.1"
                     /db_xref="GeneID:34716554"
                     /translation="MDDGQGNSGAKSAQDDIQSKLDKKLGPEYISKRIGFGSSRVAYI
                     EGWKAINLANQIFGYNGWSTEVKNVTVDFLDERQGKFCIGCTAIVRVSLADGTFREDI
                     GYGTVENERRKASAFERAKKSAVTDALKRSLRGFGNALGNCLYDKDFLAKIDKVKFDP
                     PDFDEGNLFRPADELSEITRSNTISDSHTEGPSLKKRILNHDPKNQSHVSIQKPGAPV
                     VSSTASINQNRPTASGTIEAPFATNSTTAVAPVTTTAAVNPVSNEEAAQDPDDLLDDS
                     FMFSDEIQEEDLINMNAKSNSGSTEEPRTTSPLTFVTAKAAESLQNKSPISSDAIFDP
                     KFQAQSIRHTVDQSVSIPVRATVLKEKGIDTNKSKIYSSFAPKGKELSTNTTNEAQAA
                     TSQSSTETNKTTPTRYPAQLAPNTASNARPAAQRTQLGRPRMLQQPNIRKNIS"
     gene            <1293793..>1295622
                     /gene="NDC1"
                     /locus_tag="KLMA_40569"
                     /db_xref="GeneID:34716555"
     mRNA            <1293793..>1295622
                     /gene="NDC1"
                     /locus_tag="KLMA_40569"
                     /product="nucleoporin NDC1"
                     /transcript_id="XM_022819893.1"
                     /db_xref="GeneID:34716555"
     CDS             1293793..1295622
                     /gene="NDC1"
                     /locus_tag="KLMA_40569"
                     /codon_start=1
                     /product="nucleoporin NDC1"
                     /protein_id="XP_022676414.1"
                     /db_xref="GeneID:34716555"
                     /translation="MSAYENKGRSASFTPQRPAPRYTYHHIFSDVCKTRFNQYSRGFL
                     FKISILLITLMVFISKSSSPWTEILLEYFKVIPLMAAMLQVVITRKNYLHVDYLGYTS
                     WISTIYGQLLSKKWAIYTFIYGIAAREIAYVFKGLFFRKFCCYSDTQNLYYSIFLYYI
                     VPIVYSAQHVLLDLDRLTFNYGTQHQHPQKYMASKALDSFLKSLVLAGITSIITPILF
                     KFNFGTFTAGFFFHLKTSSLAFVILQIYDFTNIGFDAYLSIGCLHKGNPISSLSSTPI
                     ETLLTGLRSEKKIVKLTSFQELAYRATHPKTELRKPIYYSSDKNDILWPCILMECTLV
                     IQETNNNVSDFLVSLKNEVDPKPPKQPMSTTNSSSDYLFGTNHTIRTQSDDGSSRLPG
                     APPSEHRFADPPSTSSHRIVLEDANVFKNHSQKDFNTPRFTEAYKQSIFNRQPTIFSL
                     LNELWNYLVKKVTQYLFTIDSGDSNKKKLSLFELYHISKLRESEKLCPVPVCYAECVN
                     ALMGLLVNSLDENPKGAVVSSVGDVLKLLERSIGVLGSFAELELDGKKDKNPDDIISI
                     LYDQCINAFLAIVLKYDTLLNDVYLDEDVVKLTQWLLRLSQDL"
     gene            complement(<1295933..>1297756)
                     /gene="NHX1"
                     /locus_tag="KLMA_40570"
                     /db_xref="GeneID:34716556"
     mRNA            complement(<1295933..>1297756)
                     /gene="NHX1"
                     /locus_tag="KLMA_40570"
                     /product="endosomal/prevacuolar sodium/hydrogen exchanger"
                     /transcript_id="XM_022819894.1"
                     /db_xref="GeneID:34716556"
     CDS             complement(1295933..1297756)
                     /gene="NHX1"
                     /locus_tag="KLMA_40570"
                     /codon_start=1
                     /product="endosomal/prevacuolar sodium/hydrogen exchanger"
                     /protein_id="XP_022676415.1"
                     /db_xref="GeneID:34716556"
                     /translation="MKKTALYIALWLIKARMGYASGEDDEGGDNDGEVPIPDDPDDVN
                     PITEEMFSSWALFILLFLLIAALWSSYMLTRKRVRAVHETVLSIFYGMLVGLIIRLSP
                     GHYIQDTVTFNSSYFFNVLLPPIILNSGYELNQVNFFNNIVSILTFAIPGTLISAIVL
                     GTILFIWTSLGLEGINISFVDALSVGATLSATDPVTILSIFNAYKVDPKLYTIIFGES
                     LLNDAISIVMFETCQKFHGKKLQFSSFFEGIGMFLMTFTVSLLIGCMIGMLVALLLKH
                     TYIRRYPEIESCIILLVAYQSYFFSNGCHMSGIVSLLFCGITLKHYAYFNMSRRTQVT
                     LKYIFQLLARLSENFIFIYLGLALFTEVELVYKPMLIIITAISICVARWCAVLPLSNF
                     VNWFYRIRTLRSMGLNSSSESEYSIPDEIPYQYQMMVFWAGLRGAVGVALAMGIQGEF
                     KFTLLATVLVVVVLTVIIFGGTTASMLEILNIKTGCEDENDLSDDEFDIEAPRPISLP
                     SGNLDSTADFRSDFPPLATSANGGLGASPNEQPATNSRFSFDRSQIRSSVDKIFNQDK
                     WFANFDEQVLKPVFLDNPSDAPSRADNHSSDSPNFMSSRRT"
     gene            <1298378..>1298941
                     /gene="GUK1"
                     /locus_tag="KLMA_40571"
                     /db_xref="GeneID:34716557"
     mRNA            <1298378..>1298941
                     /gene="GUK1"
                     /locus_tag="KLMA_40571"
                     /product="guanylate kinase"
                     /transcript_id="XM_022819896.1"
                     /db_xref="GeneID:34716557"
     CDS             1298378..1298941
                     /gene="GUK1"
                     /locus_tag="KLMA_40571"
                     /codon_start=1
                     /product="guanylate kinase"
                     /protein_id="XP_022676416.1"
                     /db_xref="GeneID:34716557"
                     /translation="MSRPIVISGPSGTGKSTLLKKLFSEFPDKFGFSVSSTTRKPREG
                     EVDGKDYNFVSVDEFKSMIEANKFIEWAQFSGNYYGTTVESVNKVTKSGKTCILDIDM
                     QGVKSVKKTDLNARFLFVAPPSVDALRERLTGRGTETPESLEKRLSAATAELEYAKTG
                     AHDLTIVNDDLEKAYAKMKEFIFEEGN"
     gene            <1299282..>1299761
                     /gene="RCF1"
                     /locus_tag="KLMA_40572"
                     /db_xref="GeneID:34716558"
     mRNA            <1299282..>1299761
                     /gene="RCF1"
                     /locus_tag="KLMA_40572"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819897.1"
                     /db_xref="GeneID:34716558"
     CDS             1299282..1299761
                     /gene="RCF1"
                     /locus_tag="KLMA_40572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676417.1"
                     /db_xref="GeneID:34716558"
                     /translation="MSYLPSSFDADLEDVDEMPFWDKMVFHCKQQPLVPLGTLATTGA
                     VTLAVLNVKNGNKQKAQIWFRWRVGLQAFTLAALVAGSYLYGKNSKERATHEEQMRKK
                     AKLREELWIKELERRDEETKMRKQRAELARQKAKEMEEETTRLQQELKELEAKLKNK"
     gene            <1300138..>1302684
                     /gene="USA1"
                     /locus_tag="KLMA_40573"
                     /db_xref="GeneID:34716559"
     mRNA            <1300138..>1302684
                     /gene="USA1"
                     /locus_tag="KLMA_40573"
                     /product="U1 SNP1-associating protein 1"
                     /transcript_id="XM_022819898.1"
                     /db_xref="GeneID:34716559"
     CDS             1300138..1302684
                     /gene="USA1"
                     /locus_tag="KLMA_40573"
                     /codon_start=1
                     /product="U1 SNP1-associating protein 1"
                     /protein_id="XP_022676418.1"
                     /db_xref="GeneID:34716559"
                     /translation="MEYLASKAYHFSVWSSDPQLLTGTNLTIRAHAKCSVLRLKQYIH
                     HLLVQQQGVGIKFSVNDLTLSYKTGDLDGELQCQQIEPNYPGVIRLRLEKSNKAVSLQ
                     PTYYNPDSFTRTMVQSQCNILSVEKIFKARLQDVSLHSTISHLAKLTIEELNQYERQN
                     EDEQMCSVKEHTLEDVIALDIAGRSHPINLSETTEDLTLSDLLGIDFVPTANGYCSLL
                     CKVRHSQMEEGVTIEFVSEAKFTIQQMIVNSKTTVLDVKNFICSVYAHALRLQPSDIK
                     LIYKGCIIHELNGASNEPNKILKFITEPNGAKLHVHISHEYSEPGPGFWSELLFAPDR
                     FDFMPTRTQSQDSSNSNSNSNSNGDSVTAALSGSLTGSAPMRATDSTDTYSQRHTAPV
                     SYSNTRSVTPSPTPTRTVDAIPETHQQPVQVVTSEGLPVSRSYETYERVTVNNKDYIV
                     PRSQLETQYFELQIGDRIIKLCPDEVHFQGGYVQLTASARASIENAIGERITNGEYLG
                     NIAEDEGLLPDTPATPNNGGDQQEADGQRRRGGVGRLPNMFNFLRRMNMGRFFRRETL
                     VLIIEMITGRNGLLMSLGFGLYLRLPLWAFCLLVTGLTIRSVWIKFKLSKKVRKLVVG
                     SADSLTTQEQEQIRTLIKSEKFNTAFFMSLARMRTILPLLCSRMDANQDLANELLHEV
                     KRNPKVNQQLAENDRLASHSSYVLKQFLLSLPSQERAKPIFYELFRDLLEKCEPLLSQ
                     EMHTLEPWAAAMVHEMRKYNWRVNRSHMTASDYIKLWLDIYEPWNFFSNTQFMRYAVP
                     DPRTDNILVGIVKNCLLFVLLFIPSFERQFEEIIEERLIQQSQDEDLIAL"
     gene            <1303433..>1304026
                     /gene="TSA1"
                     /locus_tag="KLMA_40574"
                     /db_xref="GeneID:34716560"
     mRNA            <1303433..>1304026
                     /gene="TSA1"
                     /locus_tag="KLMA_40574"
                     /product="peroxiredoxin TSA1"
                     /transcript_id="XM_022819899.1"
                     /db_xref="GeneID:34716560"
     CDS             1303433..1304026
                     /gene="TSA1"
                     /locus_tag="KLMA_40574"
                     /codon_start=1
                     /product="peroxiredoxin TSA1"
                     /protein_id="XP_022676419.1"
                     /db_xref="GeneID:34716560"
                     /translation="MVAQVQKPAPEFKKTAVIDGVFDEVSLEKYKGKYVVLAFIPLAF
                     TFVCPTEIIAFSEAAKKFEEIGAQVLFASTDSEYSLLAWTNVARKDGGLGPVNIPLIA
                     DTNHSLSRDYGVLIEEEGIALRGLFLIDPKGIVRHITINDLPVGRNVEEALRLVEGFQ
                     WTDKNGTVLPCNWTPGSATIKPDVEASKEYFAAANKE"
     gene            complement(<1304370..>1306451)
                     /gene="PPN1"
                     /locus_tag="KLMA_40575"
                     /db_xref="GeneID:34716561"
     mRNA            complement(<1304370..>1306451)
                     /gene="PPN1"
                     /locus_tag="KLMA_40575"
                     /product="endopolyphosphatase"
                     /transcript_id="XM_022819900.1"
                     /db_xref="GeneID:34716561"
     CDS             complement(1304370..1306451)
                     /gene="PPN1"
                     /locus_tag="KLMA_40575"
                     /codon_start=1
                     /product="endopolyphosphatase"
                     /protein_id="XP_022676420.1"
                     /db_xref="GeneID:34716561"
                     /translation="MHGSISMDEPRLREKEEKPDRLEVGGKPQGPQEREGSYFRVWKQ
                     VIHVVLLLGTIVTYFYFFRRENLTRPLEELNGEVRGFTTSLSDDRNVSSADILSMLNL
                     SPNQPVKITDLSGKRARHLKGRFLHITDMHPDLYYKEGSSTRKTCHRGKPQDDKDRAA
                     RFGNAMMGCDAPPALMDYTLKWIEDNLKDEIDFIIWTGDNVRHDNDRMIPRTEQQIFD
                     MNRHVSELFSKKFRDPSSQDPREFTVKIIPSLGNNDVFPHNMFSTGPTLQTRELFDIW
                     RNFIPQEQQNTFDRYTSFFVEVIPGQLAVISLNTLYLFKGNPLVDNCSSKNQPGYKLL
                     LWLGYTLQELRSRGMKVWLSGHVPPIAKNADSSCSDKLALWLHEYNDIIIGGVYGHMN
                     MDHFIPIDGKKAWDNLAEDYSALEFEARDFVEDASAGRRITIEGAKPVKKVSYMNRVR
                     DQYYSKVAAKYDRVSRKDPLFERYSLVHVGTSIIPTFNPGFRVWEYNITALQTQEVHV
                     HSYQPWDTFFEELEEKIESELLRPTLEEEEEREHEQEEDENDDDISIAKKKKKGRKGK
                     KGKKGKKRRKDWWKDDKTIPRKKPKDIEPGPSYENQLFSPLRFVQYYADLKQIDKDYR
                     KLVAEGKSEDEAASIAFQYQVEYTSDQKPYPMKTLLVKDYMKLASMLALDDKVWDKYL
                     ERAFCSSGYEE"
     gene            <1307882..>1309291
                     /gene="YOX1"
                     /locus_tag="KLMA_40576"
                     /db_xref="GeneID:34716562"
     mRNA            <1307882..>1309291
                     /gene="YOX1"
                     /locus_tag="KLMA_40576"
                     /product="homeobox protein YOX1"
                     /transcript_id="XM_022819901.1"
                     /db_xref="GeneID:34716562"
     CDS             1307882..1309291
                     /gene="YOX1"
                     /locus_tag="KLMA_40576"
                     /codon_start=1
                     /product="homeobox protein YOX1"
                     /protein_id="XP_022676421.1"
                     /db_xref="GeneID:34716562"
                     /translation="MSKPMLPSFSTIIDAASSATSSPLPRPASMSFRLDIQGNIKLPP
                     LSSNEPQTPVLRTNLLSITPTTSMLRMGNVSISGSSNIHSESNFRSCDVSHVTGSEPV
                     IASAPLLQQQQQQQQQLHPISRTSNTTPSAGASLSLNLKLAETSSLHHTPSKKPRANK
                     RSSSANTSLILADPEPVENSSVSGKKKSTKTKSFAFITHSQETFPSNEPSIDNAQLAR
                     RKRRRTSKNESETLKREFEVNPAPSKERRAELAAICNMSEKAIQVWFQNRRQNFRKKL
                     RTDSKQLNSPLTDSEGSKSNCSTSPTVDKPQHSISTESITLVNDDKTDDSFSSAPKQS
                     DTENTPSMTVTSNRRNSANATIVTPVDEQKFQKKLKLDVPRYTTATTLTEKESSPSEK
                     GKVLTFRLKQDNELARVYTSPNNRVNKLINGSAIQSMHSTPIKGNTENNKINESIASG
                     KLNFNSNRGILKELNVNAV"
     gene            complement(<1309716..>1310620)
                     /gene="rps13"
                     /locus_tag="KLMA_40577"
                     /db_xref="GeneID:34716563"
     mRNA            complement(join(<1309716..1310109,1310574..>1310620))
                     /gene="rps13"
                     /locus_tag="KLMA_40577"
                     /product="40S ribosomal protein S18"
                     /transcript_id="XM_022819902.1"
                     /db_xref="GeneID:34716563"
     CDS             complement(join(1309716..1310109,1310574..1310620))
                     /gene="rps13"
                     /locus_tag="KLMA_40577"
                     /codon_start=1
                     /product="40S ribosomal protein S18"
                     /protein_id="XP_022676422.1"
                     /db_xref="GeneID:34716563"
                     /translation="MSLVVQEQGSFQHILRLLNTNVDGNIKVVYALTTIRGVGRRYAN
                     LVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPTWFLNRQKDVNDGKDYHSLA
                     NNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA"
     gene            complement(<1311374..>1312168)
                     /gene="YML6"
                     /locus_tag="KLMA_40578"
                     /db_xref="GeneID:34716564"
     mRNA            complement(<1311374..>1312168)
                     /gene="YML6"
                     /locus_tag="KLMA_40578"
                     /product="54S ribosomal protein YmL6"
                     /transcript_id="XM_022819903.1"
                     /db_xref="GeneID:34716564"
     CDS             complement(1311374..1312168)
                     /gene="YML6"
                     /locus_tag="KLMA_40578"
                     /codon_start=1
                     /product="54S ribosomal protein YmL6"
                     /protein_id="XP_022676423.1"
                     /db_xref="GeneID:34716564"
                     /translation="MFATKQASSLCKNVRFLSKSQRPLPNACPPPKYTLATVRAFPSL
                     EPLTFAPVPTSVLDAPLRRDLIWRAVVYENDNKRVGASNPPGRSDVGYSRRKILPQKG
                     SGMARAGDANSPIRHNGGRSLARTAPNDYTTDLPKKIYSLAFNNALSYQYRNGNVFVV
                     GSGDSVSPTNALDLNDLEVLPTSQDSQDGEIVFEKFLEYHNLNGKKLLFVINEPRVGL
                     FEFSEKFKDKVNIVQKEFVNVNDILKAQRIFIELEALEFLAISNNI"
     gene            <1312786..>1314138
                     /gene="UTP6"
                     /locus_tag="KLMA_40579"
                     /db_xref="GeneID:34716565"
     mRNA            <1312786..>1314138
                     /gene="UTP6"
                     /locus_tag="KLMA_40579"
                     /product="U3 small nucleolar RNA-associated protein 6"
                     /transcript_id="XM_022819904.1"
                     /db_xref="GeneID:34716565"
     CDS             1312786..1314138
                     /gene="UTP6"
                     /locus_tag="KLMA_40579"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 6"
                     /protein_id="XP_022676424.1"
                     /db_xref="GeneID:34716565"
                     /translation="MSSRTRYYLEQCIPEVDDLVQKNLFTKNEVNKIMRKRTDFEHRL
                     SSRGSSISDYIRYIEYEKNVNALRLKRVKRILQSNKSNSISDYTIQQRILYIFQRGCN
                     KFPKELKFWSLYLNHLKSKGTNASYKKIQNVYNQLLKLHPTNVDVWISCAKYEYEVHA
                     NFKSCRNVFQNGLRFNPDVPKLWYEYIKFELNFVTKLLNRRKVMNLINEREQELDMLK
                     QQEEARNLNSAETEGEDTYYDQDGIQLPSTGDKMKDKLNELPEADLNMLGSEDTNPAL
                     RGDVALAIFDVAMKNLGTSFIKKHQGYYSITNSQVDQELSRNVLEYLYDRCIEYIQLF
                     SEFQDLKREYLLNHIIQWLKKEHYNVSIEKDLPEHYVELLLYDITLNIRFMPADNLDI
                     DNLQISFKKFIAYKTKLDDVHAQKLTTLYADYLTQNYLANIDKSDPKYTILNAIIKKL
                     "
     gene            complement(<1314220..>1315527)
                     /gene="ADA2"
                     /locus_tag="KLMA_40580"
                     /db_xref="GeneID:34716566"
     mRNA            complement(<1314220..>1315527)
                     /gene="ADA2"
                     /locus_tag="KLMA_40580"
                     /product="transcriptional adapter 2"
                     /transcript_id="XM_022819905.1"
                     /db_xref="GeneID:34716566"
     CDS             complement(1314220..1315527)
                     /gene="ADA2"
                     /locus_tag="KLMA_40580"
                     /codon_start=1
                     /product="transcriptional adapter 2"
                     /protein_id="XP_022676425.1"
                     /db_xref="GeneID:34716566"
                     /translation="MSNKFHCDVCSADCTNRVRITCAICPEYDLCVPCFAKGSYNGNH
                     RPSHDYRVIETNSYPILCEDWGADEELLLVKGAQTLGLGNWQDIADNIGSRDKEEVYD
                     HYLKYYLNSEHYPIPDITKNIDVPQDKFLEERKKRIEKFRERPLEPPRKPMASQPSCH
                     EVQGFMPGRLEFETEFENEAEGPVKDMVFDADDQPLDIEVKLTILDIYNSRLTTRAEK
                     KRLLFENHLMDYRRLQSIDKKRTKETKDLYNKIKAFARIMTPQDFEEFSKDILEELRC
                     RTRIHQLQEWRSNGITTLEAGLKYERDKQARIMTLERFGNQVYSSSNNTNSARYRASS
                     AHRSQADYAQNYNESSGRKKLMTISDIQHGADFQLLSPEEQQLCVSLKILPKPYIVIK
                     EILFRELIRTAGQLTKKQCRDLLNIEAAKANRIYDFFVSQNWV"
     gene            <1316608..>1317195
                     /gene="RPS17A"
                     /locus_tag="KLMA_40581"
                     /db_xref="GeneID:34716567"
     mRNA            join(<1316608..1316621,1316799..>1317195)
                     /gene="RPS17A"
                     /locus_tag="KLMA_40581"
                     /product="40S ribosomal protein S17-B"
                     /transcript_id="XM_022819907.1"
                     /db_xref="GeneID:34716567"
     CDS             join(1316608..1316621,1316799..1317195)
                     /gene="RPS17A"
                     /locus_tag="KLMA_40581"
                     /codon_start=1
                     /product="40S ribosomal protein S17-B"
                     /protein_id="XP_022676426.1"
                     /db_xref="GeneID:34716567"
                     /translation="MSYIQTKTVKRASKALIEKYYPKLTMDFQTNKRLCDEIATIQSK
                     RLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEVSALDLSHSNDVLNV
                     DTQTAELVNSLGLKLPLSVSSVSAVRDRRFRRRN"
     gene            complement(<1317372..>1318325)
                     /locus_tag="KLMA_40582"
                     /db_xref="GeneID:34716568"
     mRNA            complement(<1317372..>1318325)
                     /locus_tag="KLMA_40582"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819908.1"
                     /db_xref="GeneID:34716568"
     CDS             complement(1317372..1318325)
                     /locus_tag="KLMA_40582"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676427.1"
                     /db_xref="GeneID:34716568"
                     /translation="MIKKEPGISNAVSSWLEKPSQQVNQPKSENSRPPLKQKAENIQT
                     DPVLSKGTDAKNQLLSQFMMITGNNANNAPQVKKEPGSYAPNESSPKSSSTIMHPAKH
                     KIGKPIHTERIANSNKPKTTENSAAIVASAIQDSTQSNSPLAKFKIEEGAANKSVITN
                     TPVHNKQETKSVNKSVGKSTEKPSNKVQNKLATKSVTNPPQNPGKYEKLIKRLNEKED
                     EENPDYYEEVFTHAEWKKECIDLAKCDMTEWIDKGQELLKEQQAIMSRMVLARIKLSH
                     RFQVVTNIINERAELLAKQGNLMDAKLKKVQVLGKEILELL"
     gene            1318602..1318676
                     /locus_tag="KLMA_R425"
                     /db_xref="GeneID:34718723"
     tRNA            1318602..1318676
                     /locus_tag="KLMA_R425"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34718723"
     gene            <1319416..>1321116
                     /gene="DLD1"
                     /locus_tag="KLMA_40583"
                     /db_xref="GeneID:34716569"
     mRNA            <1319416..>1321116
                     /gene="DLD1"
                     /locus_tag="KLMA_40583"
                     /product="D-lactate dehydrogenase [cytochrome] 1"
                     /transcript_id="XM_022819909.1"
                     /db_xref="GeneID:34716569"
     CDS             1319416..1321116
                     /gene="DLD1"
                     /locus_tag="KLMA_40583"
                     /codon_start=1
                     /product="D-lactate dehydrogenase [cytochrome] 1"
                     /protein_id="XP_022676428.1"
                     /db_xref="GeneID:34716569"
                     /translation="MYRSKLVSVLAKRPSVSKSFIRLSTRRLSQKSSKRIESYGFVGT
                     LLFGIGSGLVASDYVLGDSRKQVFPLKSTTPLQSLEPPKYGSEEDLQHCIREITAVIG
                     NDNVKNSDVEIKHHTDNGFNPTKPLPHQKPKWVVYASSTEDVSAIMKIVNKYNIPVVP
                     FSGGTSLEGHTYSTRPGIMLNTSKMNKILSVHDKDLDAVLQGGVGWQQLNEYLSSVPE
                     YKNLMLGCDCGPGAHVCGMVNTNASGIGATRYGSMGSNIISITVVLADGTVIKTKKRP
                     RKSSAGYNLTGLFVGSEGTLGIVTEVTVKLQVKPPYETVAVVQFPTLKDSTNTVAALF
                     QKGIQLNAVELLDSSMMKCINYSNLVRKKYDNVPTLFFKIAGLNKTVVNEYVKEVKKV
                     SYDNHCTKFEFAKDEKEAEDLFSTRKNALYLMLDYAYNEIHEDAKMWITDCAVPLSNL
                     AATLEELDAITATYPLSHMTLGHVGDGNIHYDIFYKPDQYEICKQLVSKINEVTLKYE
                     GTCSGEHGIGSGKRAFLQQELGVDAIDLMRKLKLALDPKRLLNPDKVFKIDPLDPSNE
                     "
     gene            complement(<1321238..>1323148)
                     /locus_tag="KLMA_40584"
                     /db_xref="GeneID:34716570"
     mRNA            complement(<1321238..>1323148)
                     /locus_tag="KLMA_40584"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819910.1"
                     /db_xref="GeneID:34716570"
     CDS             complement(1321238..1323148)
                     /locus_tag="KLMA_40584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676429.1"
                     /db_xref="GeneID:34716570"
                     /translation="MSVEEIEVSPAAKSDSGILLLREGGSLGIGDVNRFKILIDKEKL
                     TTSGVEVIDDTVYLRIKNLESGFLRPVWMTGPYSIYVDVVPHNFDERKSFEGEKIQFL
                     ADLKPDETFKAVLNLNNNSKIGSTSQYCWTIDLVAQFTVVTNANLPYSLVIATTYDTC
                     KRELKHHQNDSITDFNGFSYTKIDAEALWNLPPRFPQKPVHLVIITHGIFSSVGGDML
                     CLKDTIERAAKEAPENDENNIIVRGFTGNVGGSYKGVRKLGFKLGKFVIETIDKLKKE
                     YELTRISFIGHSLGGLVQSMAIHYISVERPDIFDEINGLIPTNFIAAASPFLGVIGDL
                     PKYVSIALDIGALGQTGRDLTLQRTYFLPSRGIVNSHESHDRIKGKPLLELLPKEPAL
                     KIFQRFKRRTLYANAAFDGIVPLRTAAMLYLDWKGLSEVQNIRNKHDSNIHHNISNDS
                     YNQSTGEIPEVAADKSSIIQWLLPQSVIKKEKYKPYLRTQTFNLSDSEGKESSNESFV
                     DFKPPKKPNTIRAAASTIIAPLPTELYITNPDSRKDRIVHDKVYSPRELPDIHYKHGK
                     FVKKIVYPNYSIHMKEERIARLWQDTMEWRKVLVELQPDSHNNIIVRRRFVNSFGWVA
                     INHLADEHFGQV"
     gene            <1323457..>1327647
                     /gene="SSN2"
                     /locus_tag="KLMA_40585"
                     /db_xref="GeneID:34716571"
     mRNA            <1323457..>1327647
                     /gene="SSN2"
                     /locus_tag="KLMA_40585"
                     /product="mediator of RNA polymerase II transcription
                     subunit 13"
                     /transcript_id="XM_022819911.1"
                     /db_xref="GeneID:34716571"
     CDS             1323457..1327647
                     /gene="SSN2"
                     /locus_tag="KLMA_40585"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 13"
                     /protein_id="XP_022676430.1"
                     /db_xref="GeneID:34716571"
                     /translation="MKETVGEACRLEDIITNIYRLERVSQINYQQYVPSKTDNQWSIQ
                     AELYLRRKNPRVLAALFSRELWCFSINDDPLPELDFKVGNESDVPQPERKGHFTPEFS
                     KPNLPTPYAIFMKALRRTVYVNLTLSSNKGIIPFGNSCIFQEDYTSATKLLHFDPHLF
                     ENGDLTVAICSKDLGLAKLKPETLSTDSAVYLAPSGIRVYLPSCDLKKCYVPPPKNAT
                     MFLKTLYISHGINLTNEEDLKWVKLIPNASHLNGFTPTISHYLDQPKGTNYVVWPASL
                     CFVQKASDSKSSPYSLVSNSPKFELDDCFDMVDGFIQLKLTSAYRTPGASAGMGTVTG
                     HNPMSTGGVFTDQFQGFNKHSENVGNNVPSTGDNSKGSPDLSNDPNKTPGKEMKSQRQ
                     PFSADGYGSAGFITTPIINENITPTVDDLIMETPSVKPQNDLWNEKKDIVNVNTSQES
                     RDPYPPSANAAKVEENNETLHNPNYGNQNTDDVELPPDNDDFDKDLFGEDSDEDVSEK
                     SNNESLASVKEITDEMFDMADNDMDVEVSSTFSATSENQHPSIDSSETTDKKTRTKRT
                     YLDIPVDDITIETTPSLYEDPGAPLPIETPKDRKKSIYAPLNFNPIFESNVDNKYKNG
                     GKFSFNPNSNDEPLQFGISTSNVSSSEDEDSDFSPSENNNGFSASRILPYDSRDNEIP
                     ILEPPSYEPLSKDTLPDLINPPSASKDESVVSSYNMMGPVLDKSMKSNLEAIWKPSSL
                     NKVEKPQLSNVQNNENNIEENSPITSNPTVFYEGTPFPRQDSPYSNLKQKNISSNTVP
                     SGDVEQKADQILQNSEQDHTESSRILPYLLRHMPLFSLPDIFLSQNPTLPSGKDLDDV
                     LDILTDQIVFNNRLFFDDHKDDFKYKGIKECSGGIISDTMKSLFSNFSKLHGNEIIEE
                     IFYMPEPSVFVKKADNTIKIRSSSSYFSEYLSLKPNRGVKNFRALVLTTEAKNDCMSF
                     VSQMSQTYSNHELGFCELTKLTNEDDKGLVYLKNFNQDTLLLLSAQIVSFCSTTLSNV
                     KNVPLLIFLPINKLSLSECISMILKFHVIRKEVKSKLPKADILLNLVDFDFLKNPLTP
                     SGAYTSLCMSIYNCLPPKGTKVTTLTNDLPKDIKFRTLNNTSLSIHYDNYIHLAYLRS
                     IDREWLSAAWSDTEGVESFVRTWYVGNSRTRFEEVCNEMWKITLQLASKKFGNVCLVL
                     TRLDSVLPDDELIHWRRLSVATKDLHLAVVCVGDNTKLSLFDEDKTYPTFKNLFRSNG
                     NNDLETTGNIDNYEIVNIDEEVHGVMFSNPLQLANSQHRCAIKSGALIRFAKSEGDSF
                     IDKFEVNLLNCPHADSSTLLKEILKQYRNLAGLNSWFGVSRGKDNYIPWHVVAVKNVM
                     DSIVHVKSSFEKETYIID"
     gene            complement(<1327655..>1329184)
                     /gene="NSE5"
                     /locus_tag="KLMA_40586"
                     /db_xref="GeneID:34716572"
     mRNA            complement(<1327655..>1329184)
                     /gene="NSE5"
                     /locus_tag="KLMA_40586"
                     /product="non-structural maintenance of chromosome element
                     5"
                     /transcript_id="XM_022819912.1"
                     /db_xref="GeneID:34716572"
     CDS             complement(1327655..1329184)
                     /gene="NSE5"
                     /locus_tag="KLMA_40586"
                     /codon_start=1
                     /product="non-structural maintenance of chromosome element
                     5"
                     /protein_id="XP_022676431.1"
                     /db_xref="GeneID:34716572"
                     /translation="MASTSREYVVEDKEAKRPAYYVEVTDKQISDFEIWNSLCANEGY
                     EVVIYICEQYLNSGQIPVISSEIISVLFTLASVDEDVNRPLLRKADPLDHGRESLPAR
                     SLRLLDTLISHLVSFDHEKFDLYNLELLRCQFFYFIDGLIPNKGRSWICSPPEYNKSN
                     KIIWPFTDSAFMSQSNVPLYASYINLIDDNRVVFKSMMINRLLSQNGSFWNTLSWTLS
                     CFSTEENFVIRSFNERWLSIFDLLFDVYSLRQDYYMRYESSNLRTSPLFKVFWAVDHK
                     YISKGLLEYLFVGCNEKESLYPIPPPPNEAVSGVEHVNHFTYNRSFKLSMSMKLRKKI
                     IGLFLDLFPTLKNDINVDLPRKEDILDTLADTMYNDLKIEPFKHFMLSCYSNRKDNDD
                     DRMFLPQLVERIINKAFINVNRQKQFAIVDNLHDIAKITSELVQLLKATNKYAAFNRS
                     RSMKRREKIDFCIITVAKLMTTTHSIKKFQDYSSFLSTIKTFAHSSAGLNDLELFFYF
                     K"
     gene            <1329551..>1330093
                     /gene="APT1"
                     /locus_tag="KLMA_40587"
                     /db_xref="GeneID:34716573"
     mRNA            <1329551..>1330093
                     /gene="APT1"
                     /locus_tag="KLMA_40587"
                     /product="adenine phosphoribosyltransferase"
                     /transcript_id="XM_022819913.1"
                     /db_xref="GeneID:34716573"
     CDS             1329551..1330093
                     /gene="APT1"
                     /locus_tag="KLMA_40587"
                     /codon_start=1
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="XP_022676432.1"
                     /db_xref="GeneID:34716573"
                     /translation="MELRGALHQYPNFPQEGILFEDFLPIFREPQLFRKLVEAFKMHL
                     QEKFPNKKIDYIIGLESRGFLFGPSLALAIDAGFVPVRKQGKLPGKIASATYVKEYGE
                     DVFEIQEESIPEGSNVVIVDDIIATGGSAKAAGELALRLKANLLEFLFVMELDFLKGT
                     SKLQAPSFTLLKGQEEALSK"
     gene            complement(<1330307..>1332040)
                     /gene="DOT1"
                     /locus_tag="KLMA_40588"
                     /db_xref="GeneID:34716574"
     mRNA            complement(<1330307..>1332040)
                     /gene="DOT1"
                     /locus_tag="KLMA_40588"
                     /product="histone-lysine N-methyltransferase"
                     /transcript_id="XM_022819914.1"
                     /db_xref="GeneID:34716574"
     CDS             complement(1330307..1332040)
                     /gene="DOT1"
                     /locus_tag="KLMA_40588"
                     /codon_start=1
                     /product="histone-lysine N-methyltransferase"
                     /protein_id="XP_022676433.1"
                     /db_xref="GeneID:34716574"
                     /translation="MSVECNSTGSDTSVFSSAQSMENTPESTPIHCNEQTAEPSAKRI
                     KKSTMSLIEEAMKYDMRSEYHLPTTFLRERRKPVKVETDDEDEQVNQKPKRKYTRKTS
                     SSSRRVGRPRKDVTSNNTIKPIKPERKAKTKTDTKPIAVINKSKLKSKTTTKPKTKSK
                     SKPKTNSKSVSNTYKDQTSEDNNSDMFLTDLDNCIENTSFFNLPLIRNRSGFVKNITS
                     PKIFVENPDENNFVPLKSVVFPDCEERFPVHANIQKFGYDALLEIGQNIESAVRVYFP
                     KRYKPRGEKLLEELNDTFEKADTPAFESVMHRFNMLVSEIPHELLIQELEVCPKIPVS
                     FIHSLLHVCYTRSIYPNARKLKKYTSFSNFVYGELMPDFLTSVYRRCGLSSDSVFMDL
                     GSGVGNCVIQAALEFGCKLSFGCEIMDSASDMTELQLKELENRCNYWGINLPKIEFSL
                     RESFVNNYRVNELIPKCDVILINNFIFDAPLNKQVEKIIQNLKPGAKIISLKSIRPPG
                     YSINYDDMDNIFNRLKVESFKLPENSVSWTYRSVGDYYISTVQDTIDESIFCPPIIGR
                     IRKKESIHYTK"
     gene            complement(<1332272..>1333318)
                     /gene="UNG1"
                     /locus_tag="KLMA_40589"
                     /db_xref="GeneID:34716575"
     mRNA            complement(<1332272..>1333318)
                     /gene="UNG1"
                     /locus_tag="KLMA_40589"
                     /product="uracil-DNA glycosylase"
                     /transcript_id="XM_022819915.1"
                     /db_xref="GeneID:34716575"
     CDS             complement(1332272..1333318)
                     /gene="UNG1"
                     /locus_tag="KLMA_40589"
                     /codon_start=1
                     /product="uracil-DNA glycosylase"
                     /protein_id="XP_022676434.1"
                     /db_xref="GeneID:34716575"
                     /translation="MLKRSNDDAHQLQGKSPGKKRKVLVTDFFQKKTSSEEQTKATGH
                     VDKAFKSIEKAESKSNIESITTVSSPAANVTAYDNSLLSLELQTIDASWLERLRPEIN
                     KPYFLKLKQFVIDEQKRYTVFPPEQDIYSWTRLTRFADTKVVIIGQDPYHNFNQAHGL
                     AFSVKAPTPAPPSLKNIYKELQMNNYSDFKVNYAYGDLTSWSKQGVLLLNTSLTVRAH
                     NANSHSKRGWEQFTKKAIDLLIEDREKSGKPIVFLLWGSNAIKLLQDKVNRMPKNFLV
                     LKSVHPSPLSASRGFFGNKHFRMINDFLYENKLPMIDWSVVPESSLQEVTEANKKLLK
                     SKSSSDIENAQNSS"
     gene            <1333765..>1335690
                     /locus_tag="KLMA_40590"
                     /db_xref="GeneID:34716576"
     mRNA            <1333765..>1335690
                     /locus_tag="KLMA_40590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819916.1"
                     /db_xref="GeneID:34716576"
     CDS             1333765..1335690
                     /locus_tag="KLMA_40590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676435.1"
                     /db_xref="GeneID:34716576"
                     /translation="MSTRSSLKKHTTLTAKGDKKEKDSVPSNNDETVASAA