GenomeNet

Database: RefSeq
Entry: NC_036029
LinkDB: NC_036029
Original site: NC_036029 
LOCUS       NC_036029            1353011 bp    DNA     linear   CON 23-OCT-2017
DEFINITION  Kluyveromyces marxianus DMKU3-1042 DNA, complete genome, chromosome
            5.
ACCESSION   NC_036029
VERSION     NC_036029.1
DBLINK      BioProject: PRJNA264644
            BioSample: SAMD00067077
            Assembly: GCF_001417885.1
KEYWORDS    RefSeq.
SOURCE      Kluyveromyces marxianus DMKU3-1042
  ORGANISM  Kluyveromyces marxianus DMKU3-1042
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1
  AUTHORS   Lertwattanasakul,N., Kosaka,T., Hosoyama,A., Suzuki,Y.,
            Rodrussamee,N., Matsutani,M., Murata,M., Fujimoto,N., Suprayogi,
            Tsuchikane,K., Limtong,S., Fujita,N. and Yamada,M.
  TITLE     Genetic basis of the highly efficient yeast Kluyveromyces
            marxianus: complete genome sequence and transcriptome analyses
  JOURNAL   Biotechnol Biofuels 8, 47 (2015)
   PUBMED   25834639
  REMARK    DOI:10.1186/s13068-015-0227-x
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1353011)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1353011)
  AUTHORS   Yamada,M. and Kosaka,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2011) Contact:Mamoru Yamada Yamaguchi University;
            1677-1 Yoshida, Yamaguchi, Yamaguchi 753-8515, Japan URL
            :http://ds22.cc.yamaguchi-u.ac.jp/~jo-sei08/index.html
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP012217.
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps and the
            genomic and proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: SPS phrap v. 0.990329
            Assembly Name         :: Kmar_1.0
            Genome Coverage       :: 8.4x
            Sequencing Technology :: Sanger ABI3730
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1353011
                     /organism="Kluyveromyces marxianus DMKU3-1042"
                     /mol_type="genomic DNA"
                     /strain="DMKU3-1042"
                     /db_xref="taxon:1003335"
                     /chromosome="5"
     gene            complement(<2277..>3980)
                     /locus_tag="KLMA_50001"
                     /db_xref="GeneID:34716619"
     mRNA            complement(<2277..>3980)
                     /locus_tag="KLMA_50001"
                     /product="aminotriazole resistance protein"
                     /transcript_id="XM_022819965.1"
                     /db_xref="GeneID:34716619"
     CDS             complement(2277..3980)
                     /locus_tag="KLMA_50001"
                     /codon_start=1
                     /product="aminotriazole resistance protein"
                     /protein_id="XP_022676476.1"
                     /db_xref="GeneID:34716619"
                     /translation="MSQAESSSNSLNEVAEKEGEFPIESIFHPNRLKHFKFLCILTAL
                     ALDFMSLGAMIVLVQDVEKRFNISATKASWSLTSYVITFAGFIAFFGRVGDIVGNGMM
                     MSISIGVFGICSLLCAVIPNFVGFAVFRAFQGMAGAGIVPCSYALVNSMFAGENLQRY
                     FSILSSIGSGTIGVGFVIGGAFAETKIGYKALFYMVFGASILTCMLILLLIGYPEYVR
                     VKSDYSARFKKVTKLDVIGSFTFISGSVLLVVALTDGGDSWKKPSAYVPLVISIILMA
                     AFFAWNLGYQKVLSLLKPHISTGAYKYMESVSVLIPKELLYAHNFAPVLLVSFFAFAA
                     FMVVMYTVVNYSISVEGDAVIVAAVKIMPLIVGLMLANTTIALHQTILKPKNGLIVGT
                     FVCTLGCAFLTALKEVNGNLYWKLLLLSAFLAGVGGAVYFSYMLSMAIGDAPMEYKAL
                     AGGVVQTASQFGNEVALSVIVSLLGNGKTNRKELRRRYQNVGYFAIACAAMAFISAIT
                     TLRDQLEPSGDEEQQNASVHSVKGCESDESTTHQQCQVTVVQVGFEEDEKMKSQPGRI
                     A"
     gene            complement(<4911..>5405)
                     /locus_tag="KLMA_50002"
                     /db_xref="GeneID:34716620"
     mRNA            complement(<4911..>5405)
                     /locus_tag="KLMA_50002"
                     /product="cd304875 domain-containing protein"
                     /transcript_id="XM_022819966.1"
                     /db_xref="GeneID:34716620"
     CDS             complement(4911..5405)
                     /locus_tag="KLMA_50002"
                     /codon_start=1
                     /product="cd304875 domain-containing protein"
                     /protein_id="XP_022676477.1"
                     /db_xref="GeneID:34716620"
                     /translation="MLDLVPTVFDLGKVKTRYPNNGKSWVPLLHPQSTDDIVHKDYVV
                     SEGGFLKTEEPIIEVAPFPYDIKANLQHDEIDTVGRVVSMRTKEFTFIYRLYEPNELY
                     NRIEDLEERHNLIADPTYTSIVDAFEKKMLKFFIESSDHAPFVTDTRIPEVNLPLPGS
                     KQFK"
     gene            <5929..>7221
                     /locus_tag="KLMA_50003"
                     /db_xref="GeneID:34716621"
     mRNA            <5929..>7221
                     /locus_tag="KLMA_50003"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819967.1"
                     /db_xref="GeneID:34716621"
     CDS             5929..7221
                     /locus_tag="KLMA_50003"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676478.1"
                     /db_xref="GeneID:34716621"
                     /translation="MASNDIISTNVPSKVPTTDTEEYPVQHGSAAKTPIVPSDNQASP
                     EESGSIDVEHKANADDEASGSHEGHHENFSKDSTKTGTPQDTLHKEPVDGSPVPNYAQ
                     QSWYYHTQPPPQFYSSPYANYGPGPYTPPWANMNMPIPGANTNPDKTGGHYQTTGPSG
                     DSSQYNPAYYFPYQLEPKPGLQSQTTTECTFGQLHNPRKTFTLSKVNSPHYYDSWVRE
                     MCQAMLEQNLGHLIPTEDNKTPETPEPAEKRYIEEIHIACVPEEKYPKWLKSSYDEGE
                     ALIDCFKEGIRRIKAEEDPEAIVLALAGLTLDYRESIPNFAKRLRKIHQRTVNAKFPM
                     AEKIVISRALKALPERYEKVDINFTKSNDQSFNNFINILLTTEPRMKSSNQYDNQRFY
                     TNSERKQVDRRPNRKTVHHIGSKTVEGDLRPDTEVQEE"
     gene            <7250..>11224
                     /gene="TY2B-GR1"
                     /locus_tag="KLMA_50004"
                     /db_xref="GeneID:34716622"
     mRNA            <7250..>11224
                     /gene="TY2B-GR1"
                     /locus_tag="KLMA_50004"
                     /product="transposon Ty2-F/Ty2-GR2 Gag-Pol polyprotein"
                     /transcript_id="XM_022819968.1"
                     /db_xref="GeneID:34716622"
     CDS             7250..11224
                     /gene="TY2B-GR1"
                     /locus_tag="KLMA_50004"
                     /codon_start=1
                     /product="transposon Ty2-F/Ty2-GR2 Gag-Pol polyprotein"
                     /protein_id="XP_022676479.1"
                     /db_xref="GeneID:34716622"
                     /translation="MLDGGATVSVIYDKRLIHNFTSESNQILVDVQQNEVAVKGEGNL
                     ELKFKGKRISLPAIYAPSTHTNIISVEDLTKSQAYLDLRRNCLLSKNGKTIAPTHKFA
                     GLRWLSRKNAIELPNQTQSVYAITPRSVRSAPDKFSLTSIHNMFGHMNINYIRESFRK
                     GLIQGVKEDDVDWTGVSSFQCQYCMEGKAKRNNHYVNARKDYTKEYLPFEYLHTDVFG
                     PVRVQRTRTTPRYFIAFIDEVTKYIWTFPLLHKTAEEVAPTFKEVVMLIYTQFNTRVK
                     TIQMDKGSEYLNTKVQKFLRERGIVSRETTVADSKANGAIERQHYTLLNDCRTFLRQA
                     NLRPRLWYHAVVYSTVMRNSLLNRSIGTSPRNRAGMSGLSFRDILPFGQPVIVHLPNP
                     KSKLQARGVLGYALHPSTRSYGYIIVVGKKKKIPIDTRNYRVLNYPPGATISEDEVQY
                     MIDRMENNDAESQDDIESNFEPNYTDMEQPIHHTADYFPNTTASNIETDQYNNDSFGL
                     HYGGDSVPPESSSSEDELFPTDESENDSDSSDQSFNDDGDPMSPPYSGGEEQIVPTPA
                     PIRRVPPMEPPSPVEDSPPPLYGTDLDDLFGESNINNYIPEDTDLLALNHESVPEPDT
                     AVPETTNIEQDNVLPSETIENSNPPNDNSDQSGEESGEESCEESGEESVDNRLKSIPI
                     FNGNKHKDSRTAEADLDSLYGGGNNTENNNGPTLEEVFRSIEEDPFMLTQKRPRSRAR
                     YRESNQDSCDSGGDYESDSDSDGSSDESPQKGRKIQRVNYVNAVLKPVNVIPLNMSLN
                     YSQAISRNRNEEEKDAFQKAYQKEIAQLTKMNTWNEELIDASTLPKKKILNSMFIFTT
                     KRDNSKKCRLVARGDQQAADTYDTELKANTVDNLALMTVLALTLDYNLTAFQLDISSA
                     YLYADLKEELYIRAPPHMNAKNKVLRLNKSLYGLKQSGANWYELIRSFLIKKCDLIED
                     RMWKCVFRDKEPLKLIICLFVDDMLVVGNDVKYIKKFISKLSKRFDTKIVNDGSHRPE
                     DGVNEYDILGIELEYKKKEYMKFGMQKSLEDKLPQLGVPLLPNIKIKKVPGEPGEYIL
                     SGKELTLNEKEYKSKVKHLQRIVGLASYVGHKFRFDILYYVNILAQHQLYPSAKVLDR
                     AAQLCQYLWDTRDKKLVWHYSGPKENNVTAVSDAAFAGNQDFKSQSGTLYLRNNKPIA
                     AKSRKIKLTCISSTEAEIYAISESLPILRGLEHLVNKLQDVKATVKVKTDSQPSMAII
                     NGTDDSACLKKHIGSRAMRIRDECDDLGLTLEYIPTKENNADVLTKPLSVKLFKLLTE
                     DWIQ"
     gene            <11933..>12637
                     /gene="GTT1"
                     /locus_tag="KLMA_50005"
                     /db_xref="GeneID:34716623"
     mRNA            <11933..>12637
                     /gene="GTT1"
                     /locus_tag="KLMA_50005"
                     /product="glutathione S-transferase 1"
                     /transcript_id="XM_022819969.1"
                     /db_xref="GeneID:34716623"
     CDS             11933..12637
                     /gene="GTT1"
                     /locus_tag="KLMA_50005"
                     /codon_start=1
                     /product="glutathione S-transferase 1"
                     /protein_id="XP_022676480.1"
                     /db_xref="GeneID:34716623"
                     /translation="MNNCTIKVHWLNKSRAFRVLWLLDHLNITYEIVPYERTPGFRAP
                     ESLKKIHPLGRSPILEVEYKDNGRKDIVAESGYIFQYVLEHFDKEGKLNNSDPQQAEK
                     IKYYLHYAEGSLQPPLFFEFILGLAKNAKLMFPLSYLTNKVATGISEKYSKGEVKNQL
                     DFIEGEIPKNDGYLVGGKLSAADILLSFPLDTALGRGYCDPNDYPAIANWLKKIKSEP
                     SYEKSKSKAKELGSDY"
     gene            complement(<13083..>13505)
                     /gene="PEX22"
                     /locus_tag="KLMA_50006"
                     /db_xref="GeneID:34716624"
     mRNA            complement(<13083..>13505)
                     /gene="PEX22"
                     /locus_tag="KLMA_50006"
                     /product="peroxisome assembly protein 22"
                     /transcript_id="XM_022819970.1"
                     /db_xref="GeneID:34716624"
     CDS             complement(13083..13505)
                     /gene="PEX22"
                     /locus_tag="KLMA_50006"
                     /codon_start=1
                     /product="peroxisome assembly protein 22"
                     /protein_id="XP_022676481.1"
                     /db_xref="GeneID:34716624"
                     /translation="MQSRHQKKIITATAIVCTLATAVGFIYYKYCGSSPTPESPGKQN
                     SKCYVLSKSLYESVKDWETELYNDTVVLVPPECNGIANQLKAIEPNFEHKVIQFKSWE
                     ALWSTVRHMKKTELIISEQYLPHKPPDIERFVKMTIIL"
     gene            <13708..>14829
                     /gene="RAD17"
                     /locus_tag="KLMA_50007"
                     /db_xref="GeneID:34716625"
     mRNA            <13708..>14829
                     /gene="RAD17"
                     /locus_tag="KLMA_50007"
                     /product="DNA damage checkpoint control protein RAD17"
                     /transcript_id="XM_022819971.1"
                     /db_xref="GeneID:34716625"
     CDS             13708..14829
                     /gene="RAD17"
                     /locus_tag="KLMA_50007"
                     /codon_start=1
                     /product="DNA damage checkpoint control protein RAD17"
                     /protein_id="XP_022676482.1"
                     /db_xref="GeneID:34716625"
                     /translation="MTELPIFYATTVHLDHLVTALDCLIPFGIKEEMLVTIDDQGLSF
                     TRENNHVIKIQMVLSRELFQTFHYQPENEGSVTKVSLRLDHLLDSLNINNDHDEIIEC
                     TLSFNGDGYPFTLIFENELITETAEYSTYLLKDFDSTGLILDREQLQFECIMKGDILY
                     NALHDLKEIGCKDCYFYGILNKSTKRPLFALISRSQQGLSKIILPNERSILEKFEIYS
                     NDSTTLLYDQPMITVFDHSTLDKIRKSSRIASKVMIRKDAHGLMTVNMLNDTKDVLRS
                     NDRETKRAKQSSTASLPIHYPGIIIEASMLEKSLPELLDVNEIESMMIEYNNREMYYT
                     LPNGENQSEEPLKRTSTSEVPADDSSEYNPATEELPLYF"
     gene            complement(<15029..>15433)
                     /gene="RPS12"
                     /locus_tag="KLMA_50008"
                     /db_xref="GeneID:34716626"
     mRNA            complement(<15029..>15433)
                     /gene="RPS12"
                     /locus_tag="KLMA_50008"
                     /product="40S ribosomal protein S12"
                     /transcript_id="XM_022819972.1"
                     /db_xref="GeneID:34716626"
     CDS             complement(15029..15433)
                     /gene="RPS12"
                     /locus_tag="KLMA_50008"
                     /codon_start=1
                     /product="40S ribosomal protein S12"
                     /protein_id="XP_022676483.1"
                     /db_xref="GeneID:34716626"
                     /translation="MSDVEEVQQVPVAELTIEDALKVVLRTSLVHDGLARGLRESAKA
                     LTRGEGQLVVLVESVTEEAISKLVQGLATENNVPLIKVADAKQLGEWAGLGKIDRDGN
                     ARKVVGASVVVVKNWGADTQEREILLDHFSQQ"
     gene            complement(<16005..>18386)
                     /gene="GPB1"
                     /locus_tag="KLMA_50009"
                     /db_xref="GeneID:34716627"
     mRNA            complement(<16005..>18386)
                     /gene="GPB1"
                     /locus_tag="KLMA_50009"
                     /product="guanine nucleotide-binding protein subunit beta
                     1"
                     /transcript_id="XM_022819974.1"
                     /db_xref="GeneID:34716627"
     CDS             complement(16005..18386)
                     /gene="GPB1"
                     /locus_tag="KLMA_50009"
                     /codon_start=1
                     /product="guanine nucleotide-binding protein subunit beta
                     1"
                     /protein_id="XP_022676484.1"
                     /db_xref="GeneID:34716627"
                     /translation="MDPLSQVPELSDDYPSGNNPANSPPINYEWNEIPNVYKSVNKDG
                     KYTKYELLSYVTNYYATLNPRSNTEEYLEESRKASLDALKKYYQQTALEALATRKGSC
                     ISETSSFQTGSSYRKSSLFHTFPPWGVDQPPHEEQRSNKSYSIDTNVDFLTSETAKIY
                     SKYLQKCSLNSDPYGSDKEHYENMWVPISKWDPYHNKNEEPHLYTSYKIRLDIPFSDT
                     SPISVTKLYPPIFSETKVPGLVYHSIVKLEGMLFVFGGMSPCYPYSDVAPDLSSFYVD
                     GIKNLPPPLDESIINNPAMIPSKKLYTFSYASTKWRECEVSGQIPPPLVCVQGSLLTD
                     RHIFYYGGFEIKNEVIIDPKTNEYFIKKRAVLNDTAYILDTLCYKFTKVELVPQPTKY
                     VKYPTTVPRFGHLQVSLKTYPNKLSKGPTTGTEFTPSSASISSTEKSTGNGTFEDPIM
                     NFVSSSMTLNSDNIISPTSSNTPGVYSILIMGGYCDGKDGTFEPISDLWKVEITILSR
                     GKRNFIRFAETALTTLISTLPQDTVDETLKSEFYKKWPLPRGFMAYYVTDTDSLVKKK
                     MDEDLLENMMHNFKIIDKNTEIPVKSDSVIPGRNTKVKTVPKLLNKSLIIHGGSANSF
                     IHGDMWCYDLDEGSWTKMTLNSENQETGEIKPVDFPLTGHSFVHHKQMTVVVGGMNQK
                     DIDNSSSWKNLEKAYSHEYETHDTNGTFTLISLPSRIIRNFEVDTLRDGYQNKQVENI
                     ILSALRLSYNPIIYDKDYIWTVGGLIRDTDSSKVFLRGAISLVSLPLIDIPGV"
     gene            complement(<18893..>20566)
                     /gene="NDD1"
                     /locus_tag="KLMA_50010"
                     /db_xref="GeneID:34716628"
     mRNA            complement(<18893..>20566)
                     /gene="NDD1"
                     /locus_tag="KLMA_50010"
                     /product="nuclear division defective protein 1"
                     /transcript_id="XM_022819975.1"
                     /db_xref="GeneID:34716628"
     CDS             complement(18893..20566)
                     /gene="NDD1"
                     /locus_tag="KLMA_50010"
                     /codon_start=1
                     /product="nuclear division defective protein 1"
                     /protein_id="XP_022676485.1"
                     /db_xref="GeneID:34716628"
                     /translation="MNPRSDNNNFLTSPHICRPAIQEQGNTKYEFTSPQMVQNTLPTP
                     YTLNQNKLDHMSSLGREHSDVNDCSLVENSMLNHHNQQRHQRLSNRSIVDPNVSSSIM
                     EANSSQVLNDSDHSINGMFPTSARSSTSSQNIGMILTSNHNTSSSSAIAGATASMVSH
                     TSSTAKTTLTPQDGSAPASTAVGSSSSVPSADPNAHPIASPVLPDINEQPSSVLHFGN
                     FANELLLASPEQFKEFLMESPAGLNFWQQRNTPAKTPLKFVTNNNTILSQQPLNNGFP
                     NTITSPLQNIDVNLMFNSGSASKSSLSPPRKQMSLTPYGRKILNEMGTPFTKMLQPIS
                     SNNSALVDFHRARKHNLQSTPTSKPSLRNDSPGSRIYGSSPTTIQLHSSGVKCSPGRN
                     LNIDDKLFHLQGSPTPKLSVNKSDKLQLDGGLELPRMGSFREGLFVPSLSAPDGKHSL
                     TGSTSRRNSSTITSHETSSFTSEKVRKPKLNRKGNKNKSKTSQIMTKQRFQIIMTDTT
                     SFNSDNGVSSNNSNKLKRCNSVIVSGENKKKKKKKSSSFTSCNTLPHSQ"
     gene            <22305..>25115
                     /gene="NUD1"
                     /locus_tag="KLMA_50011"
                     /db_xref="GeneID:34716629"
     mRNA            <22305..>25115
                     /gene="NUD1"
                     /locus_tag="KLMA_50011"
                     /product="protein NUD1"
                     /transcript_id="XM_022819976.1"
                     /db_xref="GeneID:34716629"
     CDS             22305..25115
                     /gene="NUD1"
                     /locus_tag="KLMA_50011"
                     /note="with LRR_RI super family consearved domain"
                     /codon_start=1
                     /product="protein NUD1"
                     /protein_id="XP_022676486.1"
                     /db_xref="GeneID:34716629"
                     /translation="MNMDLAESLQNFHITSPQKKNQLMSNGVSIDFNNSDDFVVDETQ
                     DDVDDASNQNSESKKYDFKKYRENEIPLPQQFGSFFSKMDEWSVNYGTVKALKNNENK
                     NEGPNDSSKINRKDETSQAQWKNYLLKPRTTKHQSPKDASDLIVTASLSDLSLIPPDT
                     FKKKEKNEYSSVSQETDPAKEAKSVFNNVLRHQRSNYFKDNSDSVAQNTAHFNDTRSN
                     FQEIDRRDSDSDSSSNSVTDSNKFDTTSDLESDTASVLNTSAINSPSPKPRIVTNTRQ
                     LPLITPEDAGLVFDHETGLWDKQRIAVVTDSSAADNTTSSFTIEENQSDHKSTKNTNN
                     NDRSLKHLNENILSTQNKGSQIGSSNNNTIPGENKTEKQVDENHDNNDNNDVSTSVVT
                     DDTPLSTPRFNRQLYQKNNIKATTTRQPSSSLHRELSNSNLNADSSNVDITNISRMDT
                     SYDLTKREIVSRLLEIEPNPIKWKNLFEVDLSNQTIKDSCIGIDELLPALVNLNIANN
                     ELISLQGIPKQIQSLNISNNRLRSQLLQFQDLPHLEELDISNNNLSSLQDLRLVSSLS
                     HLRYLDVSNCGIVSLIGLPAVAKLDTLIARDNRLIGSIDFKQLCEVSPIPWRSLTKLD
                     LSNNKITNLKNLHYLTKLRVLILDGNSIERLHSDIHADETNDKYRAGNPSLRYLSIRN
                     GRVSVNSFSGFPNLRILRVSVPADYGNDDANSNENAHGIGSEQRRHNVKNDQIPESSL
                     SKRYPLPFPLESLEIIGMPPSSPKSQTISLSQPQASQKRIFGVSTNVDPNAVRPNNKD
                     SDVLIDSSPWESVIFPSQLREVTLRCLNLTRVPQTLTNNTALYSLDVSGNKIYSAQML
                     LPSLPQNLLRLNILQNPVLELVAIPTYTSSSTKTNLDTAGKSETENNLAVQDSGSRHR
                     DLQRLLLHWCPALVESDLNVEG"
     gene            <26187..>27752
                     /gene="ALD4"
                     /locus_tag="KLMA_50012"
                     /db_xref="GeneID:34716630"
     mRNA            <26187..>27752
                     /gene="ALD4"
                     /locus_tag="KLMA_50012"
                     /product="potassium-activated aldehyde dehydrogenase"
                     /transcript_id="XM_022819977.1"
                     /db_xref="GeneID:34716630"
     CDS             26187..27752
                     /gene="ALD4"
                     /locus_tag="KLMA_50012"
                     /codon_start=1
                     /product="potassium-activated aldehyde dehydrogenase"
                     /protein_id="XP_022676487.1"
                     /db_xref="GeneID:34716630"
                     /translation="MLRSTAAGSTRAFRSQTAAFSYALRLYSHLPLKVKVDLPNGISY
                     EQPTGLFINNQFVPSKQGKTFEVLSPSTEEEITHVYEGREEDVDAAVEAADKAFKSGV
                     WSRVDPLVRAQCLNKLADYIEKDAETIASIESLDNGKAISSAKGDVALVVNYLRSAAG
                     YADKIDGRLIDTGSTHFSYTRREPLGVCGQIIPWNFPLLMWAWKIAPALATGNTVVLK
                     TAESTPLSALYVSQYIPKAGIPDGVVNIVSGFGKIVGEAITTHPKIKKVAFTGSTATG
                     RHIYQNAGVNLKKVTLELGGKSPNIVFADANIKQAVQNALLGIYYNSGEVCCAGSRLY
                     VEESVYDEFLSEIKAASEALKVGDPFDAETFQGAQTSQTQLDKIMKYVEIGKKEGATL
                     ITGGERIGDKGYFVRPTVFADVEENMRIVKEEIFGPVVTITKFKTIDELVEKANDSEY
                     GLAAGIHTTNINTAIQVSNRLNAGTVWINTYNDFHHSVPFGGFNASGIGREMGAEALD
                     NYTQVKAVRVKLE"
     gene            complement(<28194..>30074)
                     /gene="cal1"
                     /locus_tag="KLMA_50013"
                     /db_xref="GeneID:34716631"
     mRNA            complement(<28194..>30074)
                     /gene="cal1"
                     /locus_tag="KLMA_50013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819978.1"
                     /db_xref="GeneID:34716631"
     CDS             complement(28194..30074)
                     /gene="cal1"
                     /locus_tag="KLMA_50013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676488.1"
                     /db_xref="GeneID:34716631"
                     /translation="MTTLLLLSQLGLLAFANAINPMVKGEYRIEHPKIGDLSEIESAI
                     SPKSFYESFQYGSEAEFRKNWVSSDLTMEHVDETSSKAFPGTWKLQSPFLVPGFSDDL
                     SLVLGSEQTRAAIAHRLKYDLSIKDNEKLVVQYEVKLQKMLECGGAYIKLLKTSATDL
                     SQYDHSSDDYAVIFGPDFCQGYVDEIHLVLKRENPFSGKSEDKFLLNAPKSALNLPIS
                     RLYTLILDSSDQSYEIRLDGDVVSAGSLLSEGAFQPPFISPKEIDDPSAVKPADWDDR
                     TVIPDPTASKPDDWDESEPQLIPDPASKKPDEWDESIPQYIPDKSRSQPEWWNDEEDG
                     KWIAPMILNPSCGTKKGCGKWKPKMVENEKFRGPWKAPLIANPNYKGEWKAPTIPNPH
                     YYEDLTPANIEGINVVSFDIWATASEISFDNLYIGKSVEEAELIGNKTFIPKSKLEKK
                     ELGIDKPETDSEEQEDRSHKDSSSVSGQEQKEKPEEESSDTPLFGASDSGFEFINRIE
                     KYIQSSHVMMKFTKWFLSIDDLYKGMVISLIATVVVAFTVLFVLKFMIWAQGIDINGS
                     TPSTRARAERKQKREMEEQSKKAVGATSTGIKPGSDADLSKRTSKKQSGEDDSSKEES
                     DN"
     gene            complement(<30437..>31045)
                     /gene="ECM1"
                     /locus_tag="KLMA_50014"
                     /db_xref="GeneID:34716632"
     mRNA            complement(<30437..>31045)
                     /gene="ECM1"
                     /locus_tag="KLMA_50014"
                     /product="protein ECM1"
                     /transcript_id="XM_022819979.1"
                     /db_xref="GeneID:34716632"
     CDS             complement(30437..31045)
                     /gene="ECM1"
                     /locus_tag="KLMA_50014"
                     /codon_start=1
                     /product="protein ECM1"
                     /protein_id="XP_022676489.1"
                     /db_xref="GeneID:34716632"
                     /translation="MAKKPISKHSRAARRSEAAEPEAKALETLPRAEKTDFAATLIRT
                     ANKNEALLEAKIQKRGQKNKKKNAGRVSKQLIDDSSLTSRKAIRALNITSRLDGKREK
                     AIHRAKYVQSARKAGWDTTNQSIRKELSTLQNAANTVSDSVNKSTDKEGSANTEDAMI
                     EDDQDHIEIYDSAKSQKVQEKAVSTTFTASNVFTSLEDEIEA"
     gene            complement(<31447..>32802)
                     /gene="BDH1"
                     /locus_tag="KLMA_50016"
                     /db_xref="GeneID:34716633"
     mRNA            complement(<31447..>32802)
                     /gene="BDH1"
                     /locus_tag="KLMA_50016"
                     /product="(2R,3R)-2,3-butanediol dehydrogenase"
                     /transcript_id="XM_022819980.1"
                     /db_xref="GeneID:34716633"
     CDS             complement(31447..32802)
                     /gene="BDH1"
                     /locus_tag="KLMA_50016"
                     /codon_start=1
                     /product="(2R,3R)-2,3-butanediol dehydrogenase"
                     /protein_id="XP_022676490.1"
                     /db_xref="GeneID:34716633"
                     /translation="MELKAWGGGGGIGVMPSIVYKKMYVGNVTKQGTWFLEEYPYVLE
                     LVRTQLHFCVYISIECSSNNLVIMRALAYFGKKDIKFTNDLKEPTIGVDDEVEINVAW
                     CGICGSDLHEYLDGPIFFPEDGKTHDVSGLGLPQAMGHEMSGIVSKVGSKVKNVKPGD
                     RVVVEATGSCLDHYRWEGSAHAKDGNCAACSRGYYNCCAHLGFMGLGVHSGGFAEKVV
                     ISERHIVKIPDSLPLDVAALVEPISVSWHAVRISHLQEGQSALVLGAGPIGLATILAL
                     QGHGASKIVVSEPAEIRRRQAAKLGVETFNPMEHGDDAVEILKKMAPGGEGFDFAYDC
                     SGVKATFDTGVHAVTFRGMYVNIAIWGHKPIDFRPMDVTLQEKFITGSMCYTVEDFKA
                     VVAAFADGRIEVDKARHLITGKQKIEDGFEKGFDELMNHKEKNIKILLTPNNHGELNA
                     N"
     gene            complement(<33545..>34693)
                     /gene="BDH2"
                     /locus_tag="KLMA_50017"
                     /db_xref="GeneID:34716634"
     mRNA            complement(<33545..>34693)
                     /gene="BDH2"
                     /locus_tag="KLMA_50017"
                     /product="(2R,3R)-2,3-butanediol dehydrogenase"
                     /transcript_id="XM_022819981.1"
                     /db_xref="GeneID:34716634"
     CDS             complement(33545..34693)
                     /gene="BDH2"
                     /locus_tag="KLMA_50017"
                     /codon_start=1
                     /product="(2R,3R)-2,3-butanediol dehydrogenase"
                     /protein_id="XP_022676491.1"
                     /db_xref="GeneID:34716634"
                     /translation="MRALAYYGTQTVRFTTDLPEPKIEEPDDVLIDVEWCGICGTDLH
                     EVLDGPNFFPEDGKTHEISGKGLPQAIGHEISGIVTHVGADVKTLKPGDHIVIEPTGT
                     CQDRERYNTKGKTCAPCKKGIYNVCEYLGLCGAGVQSGGCAEKVVIGEKHCFKIPKWI
                     PLDVAALIQPLAVCWHAVKLAKVKAGQTALILGGGPIGLGMILALKNYGCTDIVVSEP
                     AHTRQQLASKMGTRTSNPLDFKNNDENIKYLKSLSADGSGFDFCFDCSGIPDTFEAAI
                     QCLTFRGTAVNVAIWGHRSVKCYPMELTLQEKRYMGAMCYTTEDFADVVDSFCEGRID
                     PKTAECMITSKVVLENGRAGFMKLLHDKEGTIKVLITPKESLVREQNE"
     gene            complement(<35521..>37341)
                     /locus_tag="KLMA_50018"
                     /db_xref="GeneID:34716635"
     mRNA            complement(<35521..>37341)
                     /locus_tag="KLMA_50018"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819982.1"
                     /db_xref="GeneID:34716635"
     CDS             complement(35521..37341)
                     /locus_tag="KLMA_50018"
                     /note="consist of Fungal transcriptional regulatory
                     protein, N-terminal"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676492.1"
                     /db_xref="GeneID:34716635"
                     /translation="MVIRKRSSSGCLLCKKRKKKCDEIKPTCSACRRNFLECAWPDSS
                     KKEKSKNKDTPPTRSESVEFNITLMKLKHRIKYAKNDDLRMEIYVKRGSNKLYQLKNT
                     KLERIKKFPRALPVLPNDIDSPFIKYHDKHIPNDDFWNSTAPLDLELRDFLFVDLPDG
                     LSIPPYELENPTEEQEKRYLEILQKYNNNSIPDDTYFNDVDLESFIFYTSLTGFIPKI
                     GTQHTSPDLTVGATFVPFVSSNPIMKQVFLCCGATYLAWHDFERFQKYSDDYYLASKN
                     LLQEYMETNKQFYKEDWVFASLLLLVIRVKNAFYGTVDDSVGLLAYSYDLISRRYFDY
                     HAINPHERMFVESFIYHYSTSVLYAQDISRLPSPFVIFKELNKALSCPVYNCENVVEW
                     MKNPVLGSCLDTFEIIAKLSYIARMPMPLAKNWLLKVVQLRNLCIQYQHPIPDQRMTD
                     IEWYNFRINSMVGLLTVKVCYLLASKMIDFYTFDPYSSSVRDCVKEILRHFKEIPEKH
                     QIWGILPWTMLVSGCFCTEPEDQHFILQRINQMTEVAHSYAGVKMAKFLHDVWGDTKT
                     DINVIGDVQNNKSIDRKMGNQGVNNINYLFDRKRLLHVDM"
     gene            complement(<37980..>39365)
                     /gene="GDH3"
                     /locus_tag="KLMA_50019"
                     /db_xref="GeneID:34716636"
     mRNA            complement(<37980..>39365)
                     /gene="GDH3"
                     /locus_tag="KLMA_50019"
                     /product="NADP-specific glutamate dehydrogenase 2"
                     /transcript_id="XM_022819983.1"
                     /db_xref="GeneID:34716636"
     CDS             complement(37980..39365)
                     /gene="GDH3"
                     /locus_tag="KLMA_50019"
                     /codon_start=1
                     /product="NADP-specific glutamate dehydrogenase 2"
                     /protein_id="XP_022676493.1"
                     /db_xref="GeneID:34716636"
                     /translation="MSSEPYEPEFQQAYTEVVNSLKDSTLFEKKPEYKKVLPVVSVPE
                     RIIQFRVTWENDKGEQEVATGYRVQFNSAKGPYKGGLRFHPTVNLSVLKFLGFEQIFK
                     NALTGLSLGGAKGGLCFDPKGKSDAEIRRVCYAFMKELSRYIGQDVDVPAGDIQVGGR
                     EIGYLFGAYRHYRNSWEGVLTGKSLNWGGSLIRPEATGYGLIYYTEAMIKYATKGKES
                     FAGKRVVVSGSGNVAQYAALKAIELGATVLSLSDSKGAIVAENGITPEQVYAIQEGRA
                     AWKTLEQIVGEASIFSDSSVKYIAGARPWVHVGHVDVALPCATQNEVSGAEAEHLVAN
                     GVKYVAEGSNMGSTQEAIDIFEGARLKTASATAPAVWYAPGKAANMGGVAVSGLEMAQ
                     NSSRVQWTRETVDAELKKIMTTCFDDCVATAQEYSNESNTAALPSLVKGANLTGFIRV
                     ADAMLDQGDVF"
     gene            <41204..>43120
                     /gene="FRE3"
                     /locus_tag="KLMA_50020"
                     /db_xref="GeneID:34716637"
     mRNA            <41204..>43120
                     /gene="FRE3"
                     /locus_tag="KLMA_50020"
                     /product="ferric reductase transmembrane component 3"
                     /transcript_id="XM_022819985.1"
                     /db_xref="GeneID:34716637"
     CDS             41204..43120
                     /gene="FRE3"
                     /locus_tag="KLMA_50020"
                     /codon_start=1
                     /product="ferric reductase transmembrane component 3"
                     /protein_id="XP_022676494.1"
                     /db_xref="GeneID:34716637"
                     /translation="MNSFRSPQIPDGVVKLITCNLLSGQYNWGYSRALEDGFYDIGCG
                     NYLPCAQTVMQCLVDLSGGDQLAALNEYTTYCNAYSGKNISLESALKQLVNGTQYLIS
                     NPSSNATNYAPLAFSMKNLEENYNFFHFIFMNFYWAFDCSMLINLTVLAVIILLAIEQ
                     KFQFPWLRKIRSRFTSTISNTHHTETKIGGWYVTILPTIGETYILLFLLVICVLSSVV
                     YYPLYESNTGEGKIAFLAKCIANRTGGIAFGLLPLTVLLAGRNNMICWLTGMPYCSMI
                     FYHKWAARLMTLYGSVHGVLWIGYLVWNQRGEFMNYSKDTILILWGFLICIISVILII
                     KSVYMWKSRHYELFLSLHIILAAVFFYGCYKHSEELGWLGWINLSVALWFMDRILRLF
                     KIFKFGGLKLAYCKVLDPDNEIFQITIPNAGSMKFFPGCYAFLYVLNTKLFWHSHPFS
                     LMKQGDKIIIVIKAKTGMTKELYNKLPKDGTNYPIRVCLEGPYGHNAPVDCYDHALLI
                     TSGTAIAGPISYLQRMQKIDDCHFIWIISNERFLDHMRYALEPLMVDNRCSLDIYITR
                     PLGLDISWVPKSTRIHIGRPNIDDVVHEDLSCWKNSAVVSCALPLIDDHVRNSVAREM
                     SLGTVDFYDELQVW"
     gene            <44010..>45158
                     /locus_tag="KLMA_50021"
                     /db_xref="GeneID:34716638"
     mRNA            <44010..>45158
                     /locus_tag="KLMA_50021"
                     /product="zinc-type alcohol dehydrogenase-like protein
                     C2E1P3.01"
                     /transcript_id="XM_022819986.1"
                     /db_xref="GeneID:34716638"
     CDS             44010..45158
                     /locus_tag="KLMA_50021"
                     /codon_start=1
                     /product="zinc-type alcohol dehydrogenase-like protein
                     C2E1P3.01"
                     /protein_id="XP_022676495.1"
                     /db_xref="GeneID:34716638"
                     /translation="MTTLKRPFEQYNIVQETIPGVHEEIKRFKSSRDEEYHNTIEHIP
                     ATQKGLVVTSFSEDLKLETNLPVPQKLQPYEILIKNKFIGLNHVDWKSKKYRFSIYSF
                     PWVNGRESSGIVVKRGEKVDLKKFPLGCEVFIASTTYRDLRTSTFQEYTVFDSRLVWR
                     VPEKVGLDFASGIGVSLVTAGAALPLKNYSQVDSEKKQSIIIWGGSTAVGIFVVQLAK
                     SLGFKTIIAITSKKHEKYLHSLGATHVIHRELTEDMIIKTVKKISPNGVAHGVDLISK
                     KTATVLSSVLLPESTLICAAGCPNQEDLKDKKIIAEPINLKRFHEDLDYGQEFVRYTS
                     ELFEKNRLKPLSNLKLFKGFDNFCQGIRNGLRELEERGASAEKYVVII"
     gene            <46312..>50424
                     /gene="GDE1"
                     /locus_tag="KLMA_50022"
                     /db_xref="GeneID:34716639"
     mRNA            <46312..>50424
                     /gene="GDE1"
                     /locus_tag="KLMA_50022"
                     /product="glycerophosphodiester phosphodiesterase GDE1"
                     /transcript_id="XM_022819987.1"
                     /db_xref="GeneID:34716639"
     CDS             46312..50424
                     /gene="GDE1"
                     /locus_tag="KLMA_50022"
                     /codon_start=1
                     /product="glycerophosphodiester phosphodiesterase GDE1"
                     /protein_id="XP_022676496.1"
                     /db_xref="GeneID:34716639"
                     /translation="MKFGKTFPNHQVPEWSHEYVNYKALKKLIKEIVNVQDRLYKEEH
                     DINGKDGLRSSSSPPMKPMDAFTRTNDYLNHPEVKNLLAKFFFALESDIQKVDSFYNQ
                     QFLEYDRRLRKLLTSAQFTDFNQMLKYDLQKGINNNGIPTSSNGNLYHPRPTSYNQHQ
                     SLTQYGSSLHQMSSNTVDNQILSPSKAADAAEDWAEVLAILIELRSHFRNLKWYGELN
                     KRAFTKILKKLDKKVGTSQQQTITQSRIAPLEFSNDTEINRDLQVINDLLNKVFPKVK
                     SLQKEVSNAPIGPADGSGFENSPVDIFSQLIAKDDGESLMNELISIYRSAVLIPTRTL
                     VGLLNKSALSQSFKCIDEIIAIIPTLGDPTDISGRNFFHHHVIALGKSHKLIRENNEK
                     IDKDDLNGTSNSLNSLMTQTLDIEAALPPEPNDRLVGAYGPDGINSNDSPSSLKHILN
                     KLPVHLRPALLQKDNYKRTPLHYSAQYGLVEVSKILIEALIEWGAWNPNTPIDDIATW
                     GDSEGLTPIHLAVIGTHPLTVKVLTKNLGPNTVLKTPRLLHLATRLNSPALIDALLSV
                     PGFDINYRDPDHLETALYLACKLNLKEATEHLLKRGADMEIGEKLFGWTPIFVTATEG
                     FTDLVKILKEHGAKYDILDESGWSPMEHAALRGHLEIADLLTIEGNDAITHPKFVTDW
                     NVDSEVNAPAEKSETSSGSDFYKQKTTGSSIDILSEGKPNTHPRKLLTHSLNGNKGNN
                     SKEFSIQNPETVKKFGHSYLKRDESIILITLGSNDTRSKKKAVSLNKVPVSKVSSTEL
                     DTALSLVISCPDSISDETFVLDLPLDSNSDSISFKVPYKPDSSHRIFFDIVPTYGYTT
                     GSRSVSPNGTPFHNSSVSSTREHYNHNESSRFDRSRNISPASMLHANPNSSHSNSPLS
                     SQPSRTILGRAVALLDSALTSVGSKMSSLYDTVTVPILAVENLDVLGTINFEFMKVNP
                     FDNPHIGLARSEKYWKSLVSTRVIGHRGLGKNFNTKKSLQLGENTVESFIAAASLGAS
                     YVEFDVQLTKDHIPVVYHDFLVAESGVDIPMHSLTLEQFMDLNNADKHHINLPSGKGR
                     RRSLDDTDAAILRRARLLQQSRISSNTEKNASKETEEDSGNDVCSNSNVSIGSEESIK
                     EEDNDDRIATIFEDRMRLTKTYKKNAFKGNFRGHSIASNFVTLKELFKKIPPGVGFNI
                     ECKYPMLDEAETEDMGTVVVELNHWVDTVLKVVFDNANGRDIIFSSFNPNMCVMLSLK
                     QPSIPILFLTEAGTNQMADIRATSLQNAIRFAKKWNLLGIVSAAQPIVKAPRLAQVVK
                     SSGLVCVTYGVENNDPENARIEMDAGVDAVIVDSVLAVRKGLTKANSEKA"
     gene            complement(<50811..>51215)
                     /locus_tag="KLMA_50023"
                     /db_xref="GeneID:34716640"
     mRNA            complement(<50811..>51215)
                     /locus_tag="KLMA_50023"
                     /product="hypothetical protein"
                     /transcript_id="XM_022819988.1"
                     /db_xref="GeneID:34716640"
     CDS             complement(50811..51215)
                     /locus_tag="KLMA_50023"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676497.1"
                     /db_xref="GeneID:34716640"
                     /translation="MSHSLIVSNVPVHLNNATLQKYLREKGVEGDIVAFPDEYHHIND
                     DAKTKTLQLFTKSAEMKVNAASIFQDVDCLHQLDELAAEDNKKGGDHGYALGSSGQVH
                     DAVTKNQFIVENSNDLPPAGAHSARRISVTMI"
     gene            complement(<52497..>53471)
                     /gene="CAR1"
                     /locus_tag="KLMA_50024"
                     /db_xref="GeneID:34716641"
     mRNA            complement(<52497..>53471)
                     /gene="CAR1"
                     /locus_tag="KLMA_50024"
                     /product="arginase"
                     /transcript_id="XM_022819989.1"
                     /db_xref="GeneID:34716641"
     CDS             complement(52497..53471)
                     /gene="CAR1"
                     /locus_tag="KLMA_50024"
                     /codon_start=1
                     /product="arginase"
                     /protein_id="XP_022676498.1"
                     /db_xref="GeneID:34716641"
                     /translation="MTMTTEITTPHFDFFDEKKVGIVLAPFSGGQPKSGVENGPKYLM
                     KQGLRHDLETLGWTTSVEEPLQDKDFEARKNDASDVHGIVKRPNLVGEASQLVYQSVK
                     KVAQEGKLALTLGGDHSIAIGSVAGVFDQYPNAGLLWIDAHADINTPSSTESGNLHGC
                     PVSFLMGLDAKNTPPSLQWIPKCLDPKKIAYIGLRDVDAGERQILKENGIAAFSMYHV
                     DRFGLNKVIEMALEKVCPNGDEPIMVSYDVDAIDPLYVPATGTPVRGGLTLREGLFLV
                     ERIAETGRLIALDVVECNPELAAHDGHVVDTITTGCAIARCALGETLL"
     gene            <54662..>55855
                     /gene="PEX25"
                     /locus_tag="KLMA_50025"
                     /db_xref="GeneID:34716642"
     mRNA            <54662..>55855
                     /gene="PEX25"
                     /locus_tag="KLMA_50025"
                     /product="peroxisomal membrane protein PEX25"
                     /transcript_id="XM_022819990.1"
                     /db_xref="GeneID:34716642"
     CDS             54662..55855
                     /gene="PEX25"
                     /locus_tag="KLMA_50025"
                     /codon_start=1
                     /product="peroxisomal membrane protein PEX25"
                     /protein_id="XP_022676499.1"
                     /db_xref="GeneID:34716642"
                     /translation="MSDDFYKPSNTMDSSMGSGAFELISEKVEAISIPNVSSPSREII
                     EVETNVETIPKSRISEEKMGRVINRMAILKAVFGTLIGKDRVAKISKYVIDLLLLFIK
                     SSTYNNNISLDIDRYSKLFSNNNILSIVQNPKLAMRIIVSKSSKLFLEKGTLVSSQLS
                     FYRQIMRCGYTPFRLHHWYHKFLDTLHAAQKSKDLHSQSVVWYKEWWNEDTLSDFIDL
                     YYGIMDELMLLHKLRLWSNKRMYSWVSKHEALSWYYDIILGLKKNWEKLQSIKQKEFE
                     LKIQYQVRQRALELSSKLNESSTSSSYIDGSASLVKQNIIESFKQSNLDLEQEMVAKL
                     QSYQHDKRIIKFDLIRLFFDFLADSTDVFGMKTPPGTYAALSLCSGVLGFSKLWVQAE
                     EDLKK"
     gene            complement(<56219..>56920)
                     /gene="TOA1"
                     /locus_tag="KLMA_50026"
                     /db_xref="GeneID:34716643"
     mRNA            complement(<56219..>56920)
                     /gene="TOA1"
                     /locus_tag="KLMA_50026"
                     /product="transcription initiation factor IIA large
                     subunit"
                     /transcript_id="XM_022819991.1"
                     /db_xref="GeneID:34716643"
     CDS             complement(56219..56920)
                     /gene="TOA1"
                     /locus_tag="KLMA_50026"
                     /codon_start=1
                     /product="transcription initiation factor IIA large
                     subunit"
                     /protein_id="XP_022676500.1"
                     /db_xref="GeneID:34716643"
                     /translation="MSNIEASKVYETVLETVINDVRQEFEDSGVDEQTLQDLKRIWQI
                     KLSESKAATFIWDPERTTVTAQPGTTEGTTNVSGSTVPQDEFGSVAINHSDNGTGATG
                     NGDIIGNSSSDMVNNDELTLQDNEMKPKQEMEFSMDDPDGEISKQLKLQAKQAKKSAL
                     LETDEINSDLDDSDDDYVNMDVEEEGTDVNMMLCLYDKVLRVKNKWKCNLKEGVVTID
                     HKDYAFQKAQGESEW"
     gene            <57687..>59600
                     /gene="SLK19"
                     /locus_tag="KLMA_50027"
                     /db_xref="GeneID:34716644"
     mRNA            <57687..>59600
                     /gene="SLK19"
                     /locus_tag="KLMA_50027"
                     /product="kinetochore protein SLK19"
                     /transcript_id="XM_022819992.1"
                     /db_xref="GeneID:34716644"
     CDS             57687..59600
                     /gene="SLK19"
                     /locus_tag="KLMA_50027"
                     /codon_start=1
                     /product="kinetochore protein SLK19"
                     /protein_id="XP_022676501.1"
                     /db_xref="GeneID:34716644"
                     /translation="MDSMPAELGNKPKLSFEGHENQLEQPIRLLADESNKENVHSLES
                     DGENIDRNQPLYKRARMEYSSPEKIEMLNSLSPIKLYTEGEDIADTDAKRNVAVELEE
                     AMKSLQKEDNEEEEEEEAFAKLENSYNRSSAIRSPSQSDKHTNSKETDSAFHETMSPI
                     LVKRQEELYDNTRSNDEWEAKFENLFEEIHKKSEDIRQLTAQTAVLKDKLIREERIVQ
                     EQKLHLIKQERECSNLKEQLRSFHSLETEHENISKKFEACKQKLKEVKIELSMTNQNN
                     QILSEKFEKEYAKFAENENLVNEWKDKYNSVSSELHASANKLTTLKKELQLKEEEFNN
                     KVKQLDDLQIEIADLKNNNDQEKNELKQKLSDKDQILNEMEEKLKYFESKDSDEISSL
                     KQDLEKAQADLCDKNEQIKDLEYSLTTKEAHVQQLNSQVDELSKEKDSVLLDLENTRR
                     DLDSLAGKTANIESEQLAELETLHQNMSQMEKSLKENVSTISSLTAEIREMESKCKSL
                     ELENNDLKKRLKANEDITKEKSTDTESSKVKELMEKIAQMEKTIAASETETNKKLQLL
                     AEDLYIQYSSKHEQKVKMLKKGYETRYQDLIDKLTIENNALHDEVGQLQKTVETERAE
                     KQELIKSLDAQNE"
     gene            <60161..>61336
                     /locus_tag="KLMA_50028"
                     /db_xref="GeneID:34716645"
     mRNA            <60161..>61336
                     /locus_tag="KLMA_50028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022819993.1"
                     /db_xref="GeneID:34716645"
     CDS             60161..61336
                     /locus_tag="KLMA_50028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676502.1"
                     /db_xref="GeneID:34716645"
                     /translation="MCAKPKILIPRRNRNDIVSDSEEFKRISAQVEFIYHDLTTSDAF
                     KKFLPTSDIDALWFTEALMDNMEAPSKYMEYYPKSLKLIMVPWVGTDFYDGKLLKEKY
                     GITLCNGGPVASENVSDLAIFLTLSCFRLTSFWEHAFRFVHRGDISKCREYIGGTHHD
                     TIPGFALVESNTEMHRSTSTEQKFPTKADKDKFLNIAQDYKIAGKLMESPTSKNALIL
                     GFGSIGQAIGRKLNSSFNMKISYTKRNGPVPEADLGYEAQYMPSMEDELFWKDADLIV
                     LALPGTPETEDIINEKTLSLCKNGVRIVNVGRGSCIDEDALLDALDSGKVASAGLDVF
                     KNEFQQINPRFFERWDVTLLPHIGSTVLEILQRQTAATLENIDGFFLKKTGPKYPVN"
     gene            <61937..>65167
                     /gene="BEM3"
                     /locus_tag="KLMA_50030"
                     /db_xref="GeneID:34716646"
     mRNA            <61937..>65167
                     /gene="BEM3"
                     /locus_tag="KLMA_50030"
                     /product="GTPase-activating protein BEM3"
                     /transcript_id="XM_022819994.1"
                     /db_xref="GeneID:34716646"
     CDS             61937..65167
                     /gene="BEM3"
                     /locus_tag="KLMA_50030"
                     /codon_start=1
                     /product="GTPase-activating protein BEM3"
                     /protein_id="XP_022676503.1"
                     /db_xref="GeneID:34716646"
                     /translation="MDENNKLEEGEPVSSTLKLLEQYENHTQQKDKNLDYIEKGDSRF
                     DSNAPSGPSYDELFKENVKLRLKIEEYEAEIKALNEVISGLREGHNTTHVPAQEYVPQ
                     KIIVDSTTDSSPREPSLLLPPRSADRVRHNQNTIVSRIEQESHELVLPRSPATFQLNS
                     RGFRDELKGISEMNESRKEGERGSKLSPTEKDTTYNEVKDSAISSNSGTFNNNNNILG
                     SPATSVTYTTSRISINSSSPKVSTKSNIKGPNSPALLQAGSHQQGGPVSPHRANRVTH
                     LINNEIRSPLKEQFSDTDVSFATDDVSSHHESQQEREFVDDLLHKSPIIERLSKDDEH
                     IVEFSPSSKQNLNKFTEMINKTFGEDDKITNDRSTANTAGPFKSPPKFDPPLPSANHN
                     TLASPVIIQNSSGSQTPSSATNIQRAGISSLDLLKNASQDNISSISSATTSNHQSFSP
                     RSVSSISRIQPPSFPTSTTDTGSPTSVTGARAGVSAQSPMVSEIPLFVQPEDFSTIRV
                     EIRSTLYHNPEDSAKSVLFSVVDKKSSKEMFKFAKSPDQILQLDHLLKVRLIEQYHLP
                     LLPRKQLFQSSVPVKVDARRELLEEYFTSLFEVDTLPPLLSLKLAQFISTDTAITMPM
                     GMSENIKEGVLLVRKNKTLGTGNSWKVRQAIVDEQTLLLLDQGNLVENVRLANSTIEL
                     QANLPDDKYGTKNGFIVNEHRKTGLSNTSKHYFAAETAKQREEWISALISVCGSAPPN
                     VRADNFSSTAMDQNSISDASVDTSYSAKIGPMVNLEALNKPQQSQQQQSESNSSEIDR
                     ETKRNRMRSFFPFKKNQGQLSTSSFDISKESDESTDRIFSNALRNMNLQEECVSNVVF
                     GSDVKHCLSLSSKIYQSSYEVPSVVYRCLEYLYKNRAIEEEGIFRLSGSSALIKMLQE
                     QFDREYDINLSEYNDLHEDGSSNGSYLDVNTVTGLLKLYFRRLPHLIFGDEMYDEFRS
                     IAETNSNDSKEIAVRFRDIVCSGKIEKENYALMYVLFELLMKINENNKVNKMNLRNLC
                     IVFSPTLNIPVNILQPFIEDFHCIFNGKEPVNNEDRQNLNLRVPQM"
     gene            complement(<65483..>66601)
                     /locus_tag="KLMA_50031"
                     /db_xref="GeneID:34716647"
     mRNA            complement(<65483..>66601)
                     /locus_tag="KLMA_50031"
                     /product="lipoyl synthase"
                     /transcript_id="XM_022819996.1"
                     /db_xref="GeneID:34716647"
     CDS             complement(65483..66601)
                     /locus_tag="KLMA_50031"
                     /codon_start=1
                     /product="lipoyl synthase"
                     /protein_id="XP_022676504.1"
                     /db_xref="GeneID:34716647"
                     /translation="MLKSTKAFTPIQRRFITETVVKSTQPSRTRKRRATHFTDKLNKG
                     PSFEDFVNGNAQKFTLDPLEKARQNSEEVKRLPSWLKVPIPKGSNFHKLKEDVKELKL
                     STVCEEAKCPNIGECWGGGDKSKATATIMLLGDTCTRGCRFCSVKTNRKPAAPDPMEP
                     ENTAEAISRWGLGYVVLTTVDRDDLPDGGAYHLSETVQKIKQKAPHILVETLSGDFRG
                     DLEMVKVMAKSGLDVYAHNVETVEALTPHVRDRRATYRQSLNVLECAKKTVPSLVTKT
                     SIMLGLGETDEQVLQTMKDLRAIGCDVVTFGQYMRPTKRHMKVVEYITPEKFEYWKQK
                     ALELGFLYCASGPLVRSSYKAGEAFIENVLRNRKSASA"
     gene            <70452..>72116
                     /gene="HGT1"
                     /locus_tag="KLMA_50032"
                     /db_xref="GeneID:34716648"
     mRNA            <70452..>72116
                     /gene="HGT1"
                     /locus_tag="KLMA_50032"
                     /product="high-affinity glucose transporter"
                     /transcript_id="XM_022819997.1"
                     /db_xref="GeneID:34716648"
     CDS             70452..72116
                     /gene="HGT1"
                     /locus_tag="KLMA_50032"
                     /codon_start=1
                     /product="high-affinity glucose transporter"
                     /protein_id="XP_022676505.1"
                     /db_xref="GeneID:34716648"
                     /translation="MTLLDKLLLRNIEYKGTFYSKFPQLTNIYAIGTIACISGLMFGF
                     DISSMSSMIGTKKYKEYFNHPNATAQGGITGAMAAGSFLGSLLSPNFSDTFGRKLSLH
                     ICSILWIVGSIIQSAAQDEAMLIVGRVIAGMGVGFGSSVAPVYCSEISPPKIRGLISG
                     LFQFSITVGIMLLFYIGYACHFIKGTASFRLTWGLQMIPGFVLIVGTLFLPESPRWLA
                     NHDRWEETIQIVANVVSKGDVEDEQVKFQLEEIKEQVIIDAQAKNFGFKDLWRPKTRR
                     KIIVGICAQMWQQLCGMNVMMYYIVYIFNMAGYTGNSNLVASSIQYVLFVLVTFPALF
                     LIDKIGRRPVLVAGGVFMFSWLFAVAGLLATYSEPAPQGVDGDTTVTIRIPEKHKSAA
                     KGVIACSYLFVCSFAPTWGIGIWIYCSEIFNNMERAKGSAVTTATNWAFNFALAMFVP
                     SAFKNISWKTYIIFGVFSVALTVQCFFMFPETRGKTLEEIDQMWVDNIPAWKTGSYIP
                     QLPIIEDEEGNKLGLLGNVEYVERVNSKEEGLILQSSVTDSNSQSN"
     gene            complement(<73062..>75227)
                     /gene="HOS3"
                     /locus_tag="KLMA_50033"
                     /db_xref="GeneID:34716649"
     mRNA            complement(<73062..>75227)
                     /gene="HOS3"
                     /locus_tag="KLMA_50033"
                     /product="histone deacetylase HOS3"
                     /transcript_id="XM_022819998.1"
                     /db_xref="GeneID:34716649"
     CDS             complement(73062..75227)
                     /gene="HOS3"
                     /locus_tag="KLMA_50033"
                     /codon_start=1
                     /product="histone deacetylase HOS3"
                     /protein_id="XP_022676506.1"
                     /db_xref="GeneID:34716649"
                     /translation="MSQDPLYEFKQQFEKFVASNPNVSSVTSAASRIPESSKAVVVLS
                     PYSLSHQFPRYWVSKSYKKTIVERPERLLACCIGVAAAITMYPALFTVKTSNRHKTSL
                     LAPHVLKVHGKDWPKKLLKLCKESERKLERQEIEVPEDWNVGDIYLSRQTIAALEGSI
                     GALEVGIDSIFEGASIEQTSNRAFVAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEK
                     YDVTHAVILDFDLHHGDGTQDICWKRAGFRPDEFASEAGSDSGSAELENEDDDEYDEF
                     GKTFAKFPKVGYFSMHDINSFPTELGYATKENIRNASTCIMDAHDLNIWNVHLQPYKD
                     EEEFVKLYQTKYRSIFAKADEFFKNAKAEMKNGGFRFKGLVLISAGFDASEYEQQSMQ
                     RHNVNVPTSFYNMFTKDALKLAQMHSSGKILSIMEGGYSDGAISSGVFSHLIGFQNQN
                     WINEWGSEQVVKEITRGCKPRWKPYKTKKARDVIRIWAEEVIMLGRSMIPEFKSVLFE
                     PEPPIVHPEVRLTRSKYHETLVKKEQDIPRAETPTPPPTRSEQVTAKTEEIPFVEQVL
                     PSDDENDDDEDYQYDEELNKTFNRTVEDITIDDISRHLETLDILQLSDEDEVESTRLR
                     NNGDPKVVTNHRTSPVNNSHTLDPASGTRHLSGNGNVSGVPSGNYKIPSSTTTRHLRS
                     NRHSRLLNFDDSDISMISHASPPRSKTRSSGKSNGHSNW"
     gene            <76068..>77348
                     /gene="MCA1"
                     /locus_tag="KLMA_50034"
                     /db_xref="GeneID:34716650"
     mRNA            <76068..>77348
                     /gene="MCA1"
                     /locus_tag="KLMA_50034"
                     /product="metacaspase-1"
                     /transcript_id="XM_022819999.1"
                     /db_xref="GeneID:34716650"
     CDS             76068..77348
                     /gene="MCA1"
                     /locus_tag="KLMA_50034"
                     /codon_start=1
                     /product="metacaspase-1"
                     /protein_id="XP_022676507.1"
                     /db_xref="GeneID:34716650"
                     /translation="MYPGRTNATYNNQQQQQQQQYYSRPPNPPPNVASQPMPFEGQFY
                     PRPGGPPPNSGNDYSGQYSRPPVPPPGAAPSQQYNRSDIAQNHNTGLVNGPSGYEQPQ
                     NLYRPPTQVQYAGPGNEVAYQYSQMTGRRKALLIGINYFGSQNQLRGCINDSHNMFNF
                     LTQRYGYRPEDIVMLNDDTTDPVRVPTRANMLRAMQWLVKDAQPNDALFFHYSGHGGQ
                     TKDLDGDEEDGMDDVIYPVDFQVAGPIIDDEMHAIMVTPLQPGVRLTALFDSCHSGTV
                     LDLPYTYSTKGVVKEPNVWKDVGSNALQGAMAYATGNTGALMKSLGSVFTTIKNSNNN
                     VDRERIKQIKFSPADIIMFSGSKDNQTSADATENGQNTGAMSWAFLTVLSKQPQQTYL
                     SLLQNMRAELRGKYSQKPQLSSSHEIDVNLQFLL"
     gene            complement(<77711..>79090)
                     /gene="BFR1"
                     /locus_tag="KLMA_50035"
                     /db_xref="GeneID:34716651"
     mRNA            complement(<77711..>79090)
                     /gene="BFR1"
                     /locus_tag="KLMA_50035"
                     /product="nuclear segregation protein BFR1"
                     /transcript_id="XM_022820000.1"
                     /db_xref="GeneID:34716651"
     CDS             complement(77711..79090)
                     /gene="BFR1"
                     /locus_tag="KLMA_50035"
                     /codon_start=1
                     /product="nuclear segregation protein BFR1"
                     /protein_id="XP_022676508.1"
                     /db_xref="GeneID:34716651"
                     /translation="MSGGRPRQHIKKPDVGARDKKLEPLNVQLKKIDQDIALIRQQID
                     NTDFSESAKSSKEKLQTELKEIIKTQSDLKNKRQQIHDQIKFLDGQIKRKSGEINDLV
                     GKNKRFQNVGQIKQRLAEIDDEIASGDLSLVEERLRVKEMQNLHKLSKDFQVVEPIRK
                     SIEEERAQIDELKKQLNELNPRDVATKFETVQAQINELNSKNQVVYDKRKTLMAKRSA
                     LYNKREEIYAQIRKIRGDFDNEFKNFKKKMDEERLKREEDEKLSKILEEKDEKVGKLK
                     ENLNNAKKPAFTFELEAIENALTVLDPTYVKPSHSIFENDSSASQTATPAKAVNSEGL
                     VPIVKKKEEFFSGSAVSKSKKHKKKNQSTKFSLEPSMIALLAELDIKVPLSKEDVPAT
                     VEQLKAKHEELTAKQPEATEKNIAEAEEKLKKLELEYEAKEQKVKDEIEAKKIKEQQE
                     KEAAAAAAA"
     gene            <79915..>80751
                     /gene="IDI1"
                     /locus_tag="KLMA_50036"
                     /db_xref="GeneID:34716652"
     mRNA            <79915..>80751
                     /gene="IDI1"
                     /locus_tag="KLMA_50036"
                     /product="isopentenyl-diphosphate Delta-isomerase"
                     /transcript_id="XM_022820001.1"
                     /db_xref="GeneID:34716652"
     CDS             79915..80751
                     /gene="IDI1"
                     /locus_tag="KLMA_50036"
                     /codon_start=1
                     /product="isopentenyl-diphosphate Delta-isomerase"
                     /protein_id="XP_022676509.1"
                     /db_xref="GeneID:34716652"
                     /translation="MSTETSTYAELVKSLDQDYILEKFPDVIPLNNRPNTRSTESSET
                     SDNLLNGYDEEQIRLMNENCIVLDWDDNAIGAGTKKLCHLMENIKQGLLHRAFSVFIF
                     DDEGRVLLQQRATEKITFADLWTNTCCSHPLCVDDELGANGSLKAKVAGARTAAVRKL
                     EHELGIPPQEVETKGEFHFLNRIHYVAPSNGAWGEHEIDYIFIYKLRKGEKLTVLPND
                     NEVRDIAWVSQDELKNMFNEGKLKFTPWFKLICDNYLFDWWNQLDDLQKVENDTEIHR
                     ML"
     gene            complement(<81203..>82402)
                     /gene="MRM1"
                     /locus_tag="KLMA_50037"
                     /db_xref="GeneID:34716653"
     mRNA            complement(<81203..>82402)
                     /gene="MRM1"
                     /locus_tag="KLMA_50037"
                     /product="rRNA methyltransferase"
                     /transcript_id="XM_022820002.1"
                     /db_xref="GeneID:34716653"
     CDS             complement(81203..82402)
                     /gene="MRM1"
                     /locus_tag="KLMA_50037"
                     /codon_start=1
                     /product="rRNA methyltransferase"
                     /protein_id="XP_022676510.1"
                     /db_xref="GeneID:34716653"
                     /translation="MKAVYRGFATRIRPAVKIPNESFIKDKKVTFGRNFPIQKRTKAW
                     EKDGMDKDEWFKKKYSHVHAKQKTERALNGDVDPFGKRQKFYDNLKQQEVSKREQYRK
                     HKSGYAKTHPLQGLRPNPLVDYIYGTNSVISALRAKKREYFIKLYHYGDLNTEINSLC
                     SKADIRIEEVDKHRLNLLSDYGIHNNVILECKPLHTPELMNLGSINPEAGTFDMKEID
                     YDQPVTIRNKYLTNEYKKYPLGIYLDEVVDPHNVGAIMRSAYFLGADFLILSHRNCAP
                     LSPVVSKVSSGTMELLPIYKCDKPLQFFEKSKEEGGWTFVTSHVQNSPKENHLELNDL
                     SGMVKELPVILVVGNEGNGARTNILNRSDFTVEIPFGRAESKVHNTIDSLNVSVAAAL
                     LINKILN"
     gene            <82747..>83412
                     /gene="HIS3"
                     /locus_tag="KLMA_50038"
                     /db_xref="GeneID:34716654"
     mRNA            <82747..>83412
                     /gene="HIS3"
                     /locus_tag="KLMA_50038"
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /transcript_id="XM_022820003.1"
                     /db_xref="GeneID:34716654"
     CDS             82747..83412
                     /gene="HIS3"
                     /locus_tag="KLMA_50038"
                     /codon_start=1
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="XP_022676511.1"
                     /db_xref="GeneID:34716654"
                     /translation="MTYPERKAFVSRITNETKIQIAISLHGGHISIPNSILDRPESDV
                     AKQATGSQIIDIQTGIGFLDHMIHALAKHSGWSLIVECIGDLHIDDHHTTEDCGIALG
                     QAFKEALGHVRGVRRFGTGFAPLDEALSRAVVDLSNRPFAVIDLGLKREKIGDLSCEM
                     IPHFLESFAEAARVTLHVDCLRGFNDHHRSESAFKALAVAIREAISSNGTNDVPSTKG
                     VLM"
     gene            complement(<83617..>84678)
                     /locus_tag="KLMA_50039"
                     /db_xref="GeneID:34716655"
     mRNA            complement(<83617..>84678)
                     /locus_tag="KLMA_50039"
                     /product="uncharacterized protein in HIS3 3'region"
                     /transcript_id="XM_022820004.1"
                     /db_xref="GeneID:34716655"
     CDS             complement(83617..84678)
                     /locus_tag="KLMA_50039"
                     /note="fragment"
                     /codon_start=1
                     /product="uncharacterized protein in HIS3 3'region"
                     /protein_id="XP_022676512.1"
                     /db_xref="GeneID:34716655"
                     /translation="MSHISNLLRNSRIAQVPKTEKALFQVGNPTRPTHQVIETKPSTL
                     QRQEWGLKASIPSKIKSRYLVFNDLDTQERLTSFEPIGQYQWNRIRFQEMGLAPRYVE
                     EEKNPLFEGHTKKSGRLAPFSNAVHITPTTPRSEKSRKLRDINVHRAEFKQWILENHP
                     ESLAGIKNENTKSLKTLASEFLHQKLGKLDINTASKTDWNVVGTGGLTYNLRGRLRQS
                     PNGVKQKTVVPGRILSLQGPDRAVAVGGFVAEAKSIGRNPRALQFDMGDFVRQQVLPF
                     VIEDPKVESGTVTLAASLIEPKNDFNFAQKIGLGQRRTQFSRTSPHNAFPKKTIRSIS
                     AEESRNQSEEFLNLLKTNA"
     gene            complement(<85283..>87028)
                     /gene="AGP1"
                     /locus_tag="KLMA_50040"
                     /db_xref="GeneID:34716656"
     mRNA            complement(<85283..>87028)
                     /gene="AGP1"
                     /locus_tag="KLMA_50040"
                     /product="high-affinity glutamine permease"
                     /transcript_id="XM_022820005.1"
                     /db_xref="GeneID:34716656"
     CDS             complement(85283..87028)
                     /gene="AGP1"
                     /locus_tag="KLMA_50040"
                     /codon_start=1
                     /product="high-affinity glutamine permease"
                     /protein_id="XP_022676513.1"
                     /db_xref="GeneID:34716656"
                     /translation="MIYNRNSFSLSDMSSAKASVSLDGDNDTNISKDFEPATCSGIVS
                     NASDGEMAVCENTPNELKQTIKPFHVLMMSTATGIGTGLLVGNGRSIAIAGVGGTLVG
                     YLIIGIMLTCCMQTVGELVVAFPSMPGGFNSYGKRFIDPSVGFTTSWLFFLNWTVVLP
                     LEICVASMTIKFWNERIYPWLFVSLCFAMVCCVNFFGARCYADADCIFNCLKVLMIAG
                     FIILGVLINTGVAGTSGYIGLKYFHNPGFFRNEGNLFKSIATTLVTACFSTGGTEFVA
                     LSCAEQNKDDMPRSIRRASIQVLLRIAVIFCVSLFIIGLLIPYNSPFLMGSGSELTHA
                     SPYVVALTTNGVKVVPHIVNAIILLSIISVANNAMYSSSRTLHSLADQGFAPKYFCKL
                     DISGKPFRCLCVSAVTGMFSFIAEYKDQETVFVWLLSISGLSTVFTWSMICISHLRFR
                     SAMKEQDQSLDQLGYKSPCGVYGSYISLVICGILLIVQFWVSLFPIGSNGKPDVASFF
                     QNYMAVPVGLLLYLGHKCYTRNTQLFISADKIDINTNRDIYWVDDVIGKKTIFKELDE
                     DTMEQSSALSEPRNK"
     gene            <87951..>89834
                     /gene="DED1"
                     /locus_tag="KLMA_50041"
                     /db_xref="GeneID:34716657"
     mRNA            <87951..>89834
                     /gene="DED1"
                     /locus_tag="KLMA_50041"
                     /product="ATP-dependent RNA helicase DED1"
                     /transcript_id="XM_022820007.1"
                     /db_xref="GeneID:34716657"
     CDS             87951..89834
                     /gene="DED1"
                     /locus_tag="KLMA_50041"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DED1"
                     /protein_id="XP_022676514.1"
                     /db_xref="GeneID:34716657"
                     /translation="MSDIAENMSNLSVQDDNARSGSNTGGRRSYVPPHVRGQQRSGSG
                     NYRGRSDNFGGSERGSYFGGDDRRGGGYGRGGGRGSFNWGGSNWGGRGDSRNGGGYGG
                     NNSSGRWIDGKHVPAQRNANLELELFGAAEDKSFQSSGINFDNYDDIPVEASGTDVPE
                     PITEFTSPPLDPVLLENINLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFL
                     FPVLSSSFSSGPAPTPENAGNSYIKKVYPTAVILAPTRELATQIYDEAKKFTYRSWVK
                     PMVVYGGASIDQQIKQMRYGCNLLVATPGRLTDLLERRYISLANVKYLVLDEADRMLD
                     MGFEPQIRRIVEGSDMPSVENRQTLMFSATFPSEIQHLASDFLKDYIFLSVGRVGSTS
                     ENITQKILYVEDFDKNDTLLDLLSADADGLTLIFVETKRAADSLTDFLIMEGFKATAI
                     HGDRTQGERERALSAFKTGRATILVATAVAARGLDIPNVTHVINFDLPNDIDDYVHRI
                     GRTGRAGNTGVATAFFNRGNKNVAKDLVNLLSEANQEVPSFLTTIMREASSGRGGGRG
                     GSRGGYSRGSGTRDFRRGGASNGGGFSNGGGFGNSSGGGWGNSSSNWGSSNNSSSSNS
                     GWW"
     gene            complement(<90865..>92355)
                     /gene="TFB2"
                     /locus_tag="KLMA_50042"
                     /db_xref="GeneID:34716658"
     mRNA            complement(<90865..>92355)
                     /gene="TFB2"
                     /locus_tag="KLMA_50042"
                     /product="RNA polymerase II transcription factor B subunit
                     2"
                     /transcript_id="XM_022820008.1"
                     /db_xref="GeneID:34716658"
     CDS             complement(90865..92355)
                     /gene="TFB2"
                     /locus_tag="KLMA_50042"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor B subunit
                     2"
                     /protein_id="XP_022676515.1"
                     /db_xref="GeneID:34716658"
                     /translation="MSLNLFKTTVNDYLEGLPEQVQSRLYESPATCLAIYRLLSPMAK
                     FFMMSMLFQDHDVSLRDLDKWVKHDAKFQLQYSIKSMKSLNLIIEGESKQPFMIQLNP
                     IFKKSFKNVLTGGEINNSFGDVTDDDNNVSIVMLDEYSAEKWENILHYMVGTPNTNAP
                     GGKVLDLLQHSGLMEEANYGELKITNQGFQFLLQDVNAQIWTLLLQYLKMAETLQMDP
                     VDVLNFIFMLGALQLGKAYKVDMLSNTQRIMLQDMRDYGLIYQNQSDFKKFYPTRLAT
                     LLTSDTKAFRSASVALDSVLHKANDGAAATEGEGLPDESAEQTQDGALIIETNFKLYS
                     YSNSPLQIAILSLFAHLKSRFANMVTGQLTRESVRNALLNGITADQIIAYLETHAHPK
                     MRRLAEENLNKKLELDSSTNETLQVLPPTVVDQIRLWQLELDRIMSYEGYLYTDFDSY
                     QEYQTVVDYAKDIGVLLWQNDKKKMFFVSNEGNSQVLDFHRRNFKK"
     gene            <92905..>96333
                     /gene="RET1"
                     /locus_tag="KLMA_50043"
                     /db_xref="GeneID:34716659"
     mRNA            <92905..>96333
                     /gene="RET1"
                     /locus_tag="KLMA_50043"
                     /product="DNA-directed RNA polymerase III subunit RPC2"
                     /transcript_id="XM_022820009.1"
                     /db_xref="GeneID:34716659"
     CDS             92905..96333
                     /gene="RET1"
                     /locus_tag="KLMA_50043"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC2"
                     /protein_id="XP_022676516.1"
                     /db_xref="GeneID:34716659"
                     /translation="MVKAEVHDHTNYEKDEAFDALLQPVFRGKKLTDEINTAEDKWNL
                     LPAFLKVKGLVKQHLDSFNYFVDVDLKKIIEANEVILSDVDPEFYLKYVDIRVGHKYN
                     GNKVAMIPPHECRLRDMTYSTPIYVDIEYTRGRSIVLHRDVEIGRMPIMLRSNKCILD
                     GAADNDMARLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKAIVQASVTS
                     STHERKSKTYVVTKNDKIYLKHNSIAEEIPIVIVLKACGVVSDLEIMQLVCGNDSSYQ
                     DIFAVNFEEAAELNIYTQLQALEFIGAKVKTVRRQKLSILQEGIEAIATTVIAHLTVE
                     ALDFREKALYIAMMTRRVVMAIKDPKMVDDRDYVGNKRLELAGQLMSLLFEDLFKKFN
                     NDFKANIDKVLKKPNRAEMYDALLTINVHSNNITTGMNRAISTGNWSLKRFKMERAGV
                     THVLSRLSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTPEGEACGLVK
                     NLALMTHITTDDEEGPIKKICFLLGVENISLVDSASLHLNFGVYLNGTIIGTTRFPTK
                     FVTQFRSLRRTGKVSEFISIYTNTHQKAVHIATDGGRICRPLIIVQDGKSSVTADHIR
                     DLLAGKLQFDDFLKLGLVEYLDVNEENDSFIALYERDLSEQITHLEIEPFTVLGAVAG
                     LIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIELI
                     DYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCETRRKNTTILKRYPNHT
                     QDIIGGMRVDEKGEPIWQHQALGPDGLGEVGMKVESGQIYVNKSIPTNASDSILAQTQ
                     AQYKETPVVYRAPEPSHIDQVMMSVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKGV
                     CGIIVQQEDLPFNDQGVVPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGSLEYGTCF
                     GGSKLEDMSKILVDNGFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHA
                     RARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVC
                     EKCGLMGYSGWCTSCKTTEHVVKMTIPYAAKLLFQELLAMNIAPRLKLGDEFET"
     gene            complement(<96474..>97130)
                     /gene="MEI5"
                     /locus_tag="KLMA_50044"
                     /db_xref="GeneID:34716660"
     mRNA            complement(<96474..>97130)
                     /gene="MEI5"
                     /locus_tag="KLMA_50044"
                     /product="meiosis protein 5"
                     /transcript_id="XM_022820010.1"
                     /db_xref="GeneID:34716660"
     CDS             complement(96474..97130)
                     /gene="MEI5"
                     /locus_tag="KLMA_50044"
                     /codon_start=1
                     /product="meiosis protein 5"
                     /protein_id="XP_022676517.1"
                     /db_xref="GeneID:34716660"
                     /translation="MNSEFDSDRTLVPESDVSDLNIKCSPQTQRNKQLSNDEESNLKI
                     LKEIRKVENEIDRDIRELAKKEVLLKRAVKVLETYSKEVKTLELIEKWRAICQCGMSY
                     LHNSILMKIDRMGGYQEYRKKEMDAAKRQLEYYYDDGIQQQMEDILESPDFFHLPEEE
                     KNEIRDRIDEKVKEAEEEKQKQLKKIESNFQAQDANEMTLEELASKIKVDFSMVYPTQ
                     "
     gene            complement(<97391..>99520)
                     /gene="NOC2"
                     /locus_tag="KLMA_50045"
                     /db_xref="GeneID:34716661"
     mRNA            complement(<97391..>99520)
                     /gene="NOC2"
                     /locus_tag="KLMA_50045"
                     /product="nucleolar complex protein 2"
                     /transcript_id="XM_022820011.1"
                     /db_xref="GeneID:34716661"
     CDS             complement(97391..99520)
                     /gene="NOC2"
                     /locus_tag="KLMA_50045"
                     /codon_start=1
                     /product="nucleolar complex protein 2"
                     /protein_id="XP_022676518.1"
                     /db_xref="GeneID:34716661"
                     /translation="MGKVSKATKKFQSKHLKHTLDHRKKLKDHAKRTAGRRGNKTEEE
                     KQAAALTKEDQKLKQSAKEEVFKDMKVEEFFDNTIDIPKMSKNLTKDTQNKNAENNSE
                     SDQQSSAEDEEDVNMDMHDLAEKDPDFYKYLAENEPDLLSFKASNPLDDISDEGEEEG
                     DEDVAEKPVKSSSDAKVEVDMKLVTKWKKDLKKSPSFKTIRSVVAAFKAAVNMNKEEN
                     VEDYKFSVLDEKAFHELMFIALVDMPKAVQKLTPYKVGKNETRNLPSSKNVSKLSSVL
                     KAHLPSLILLLSDINNTDVASMILHSTFELLPYFISFRRLLKELITQIVEVWSTTRDV
                     ETQIAAFAFLNNASREYKKALLEIVLKATYSTFIKSCRKTNIRNMPLINFQKNSAAEL
                     FGIDEVISYQSGFEYIRQLAIHLRNSINATTKRTSKVDPTTAYKIIYNWQFCHSLDFW
                     SRVIAIQCNPEKENGHESPLRQLIYPLVQVTIGVIRLIPTAQFFPLRFYLIRSLIRIS
                     QNTGVFIPIYPLLSEILSSTAFTKKPKKSTLPAFDFDHNIKCTQAYLGTRIYQEGLAE
                     QFVDLLGEYFVLYCKSVSFPELTTLAVISLRRYIKHSENAKFNKMLQNVVDKINQNTQ
                     FILKKRGDVDFGPNNRSEVERFLNDITWKETPLGSWVAVQREVKEEKARLLRESLESD
                     DEQGDEEELSDGAQDIEMDDDNSETEK"
     gene            <99858..>101525
                     /gene="GEP3"
                     /locus_tag="KLMA_50046"
                     /db_xref="GeneID:34716662"
     mRNA            <99858..>101525
                     /gene="GEP3"
                     /locus_tag="KLMA_50046"
                     /product="mitochondrial protein FMP38"
                     /transcript_id="XM_022820012.1"
                     /db_xref="GeneID:34716662"
     CDS             99858..101525
                     /gene="GEP3"
                     /locus_tag="KLMA_50046"
                     /codon_start=1
                     /product="mitochondrial protein FMP38"
                     /protein_id="XP_022676519.1"
                     /db_xref="GeneID:34716662"
                     /translation="MSFLRLSSCAFRRSCRFISCKSCGIELQSNNPDGLGYCKKPKPF
                     VKTHDSKDSIEKLKYLMFTQELQQKKSEIGVLDPDVDDDYQLSTPKRLTCKRCIEALS
                     HNKYNTESFPVHYFENIKGALPHIANVYHIVSLADFPFTLNKAAFMKKENINYLLLSK
                     ADQITYKSAILPHKGSAFFAEFCKRHIGVPVKKVVLFSSVRKWNIPSILNSLAKRCFL
                     LGNPNVGKTSLINSLLKERLDSFQAQVDKQGNVIGPHKGIQNIKTIRDRINFNKGGVS
                     HIPNFTQAIQTYVIDDKIVNDLPGYTIGPSETVDLSKIIEKENLDDIRKTSKFKIDKL
                     IKQRYVSLKGSKNGKCLSFGGIFHLVPPESTINQVVNYIPVMEHEFSNVEKAISVSEE
                     VLKNANHPLKKYFCLKHPYTDIKMFDRHVIPPFQGTVEIVIKDIGYFQVKPTGKYSFN
                     GLYEIWVPKGIKVCIREPLAKLISTSYDKYIESKVPTDLCPDRPLVSDTYIMDHNEPD
                     TLSKMKEMYMEKTKSDNLARRLHQTDASELLKEIHNPPLNLYWYYKW"
     gene            <101825..>103225
                     /gene="VPS30"
                     /locus_tag="KLMA_50047"
                     /db_xref="GeneID:34716663"
     mRNA            <101825..>103225
                     /gene="VPS30"
                     /locus_tag="KLMA_50047"
                     /product="vacuolar protein sorting-associated protein 30"
                     /transcript_id="XM_022820013.1"
                     /db_xref="GeneID:34716663"
     CDS             101825..103225
                     /gene="VPS30"
                     /locus_tag="KLMA_50047"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 30"
                     /protein_id="XP_022676520.1"
                     /db_xref="GeneID:34716663"
                     /translation="MGDLTLRCMNCRSLLDIDSSLVDLSMAQRDLLLNSETNTDNSDN
                     NKHNGENDRNIIPQEKLKIINQVKSPSQLRIGQAKNVTAESYVFLTDTEFSLTKFKNN
                     GDEFVDDEDYDERNKTLSSRISALSNIFNILSCKSNIDYPVCQGCCDTLLEKLKEEYN
                     QELKKRDTYHEFMKRIQEQNNSVEIYSDGNKGPKELKNLKREKEELLRQLQELEGEND
                     LLQNDIQTLQSQLKEKQEQQLEQLREKNVQQMEHLSFIKDIQSLKNQRVVTLNHIDSL
                     RKLNIYNETFRISHKGPFGTINELRLGSVPKIQVPWTEINAALGQVVLLLSLIVEKTS
                     LPLPDYNLKPMGSTSVIEKRDLQTDQWFVLKAYGGSEFSLSSLFHKENPIDKALLAIL
                     EIIKKLSENVSSNTSEPASIELPYDISDDKINGLSILLKSSSPSLEWTTACKFLLTNI
                     KWLLAFSTSRINKAKP"
     gene            <103657..>106221
                     /gene="RNR1"
                     /locus_tag="KLMA_50048"
                     /db_xref="GeneID:34716664"
     mRNA            <103657..>106221
                     /gene="RNR1"
                     /locus_tag="KLMA_50048"
                     /product="ribonucleoside-diphosphate reductase large chain
                     1"
                     /transcript_id="XM_022820014.1"
                     /db_xref="GeneID:34716664"
     CDS             103657..106221
                     /gene="RNR1"
                     /locus_tag="KLMA_50048"
                     /codon_start=1
                     /product="ribonucleoside-diphosphate reductase large chain
                     1"
                     /protein_id="XP_022676521.1"
                     /db_xref="GeneID:34716664"
                     /translation="MTDTVELWDAKSSQKKSFNKDKLIEFLGSLTFGLNKDYLDITLV
                     VDKILLGAPNELTDKAKFVSYVAETVAAMSSTHPDYSTLAARVEIRELHELIGKSTFT
                     ENLAKLRKIVDAPEDQSKRRKLSSRSLSKNLISEEFYQYALKHRDQIDKAIDMSRDYY
                     FTYFGWKTLCKSYLMKRNNEETYETPQFMFMRVALAIHGPFNDIDAVLETYQLMSQKY
                     FIHASPTLFNSGTVNQYLSSCFLVAMEEDSIDGIYKTLHKTALISKASGGIGIHVSNI
                     RANGAYISGSNGTSNGLVPMLRVFNNTARYVDQGGNKRPGAFCIYLEPWHGDIIDFLQ
                     LRKNHGKEEMRARDLFYALWIPDLFMQRVENNEDWSIFSPDEATGLSDCYGTEFKTLY
                     EKYERELIPMKKMKAQQIWSEILQSQTETGVPFMLYKDSCNEKSNQKNLGVIKSSNLC
                     CEIVEYSSPEEVAVCNLASVALPTYVKITSDDSPVFDFVTLHRVVKVLVRNLDRTIDV
                     GAYPIPEAKRGNLRHRPLAIGVQGLADAFMLCRTPFESEDAATLNKQIFETIYHAAIE
                     ASIELAEKYGHYESFPGSPAQKGELQFDMWGLNKENYHFLFDDWDTLKQQITNGPGLR
                     NSLLVGPMPTASTSQILGFTESFEPMTSNIYSRRVLSGEFTIVNQYMVDDFCKMKVWN
                     EKLKNRILKDNGSIQTIDGVPEEMKSLYKTVWEISQKKLIDLSRDRAPFIDQSQSLNL
                     YLREPTMGKLTSMHFYAWKKGLKTGMYYLRTQAASRAIQFTLNDENTLLDKLSTHASD
                     TTKVLPKKFLGQYPDHANDENHKSDNSSQGDIYGIHDTTPLICNIIEGATCESCSG"
     gene            complement(<106411..>108207)
                     /gene="THI72"
                     /locus_tag="KLMA_50049"
                     /db_xref="GeneID:34716665"
     mRNA            complement(<106411..>108207)
                     /gene="THI72"
                     /locus_tag="KLMA_50049"
                     /product="thiamine transporter THI72"
                     /transcript_id="XM_022820015.1"
                     /db_xref="GeneID:34716665"
     CDS             complement(106411..108207)
                     /gene="THI72"
                     /locus_tag="KLMA_50049"
                     /codon_start=1
                     /product="thiamine transporter THI72"
                     /protein_id="XP_022676522.1"
                     /db_xref="GeneID:34716665"
                     /translation="MSAKLGGITSVMSNEEIEIIHEQKKIESESEPQGKWARFFKKLE
                     VPHTGKPLSVLRNPDLEPISVEDRTWGFWSFFAYWGLPNFAVATFSTGSALLDLNLNI
                     QQSIGALVIANVLIAVVTIMNSNPGIRCRIGYTLDQRMIFGIRGSFIGIIFRVGLSVV
                     QYGYLAWLGGLCTNMIFSSFSLNYLNMKNTFPSSVPMAKRDCISFLIFQIIQMPLAFV
                     KPRKVNIPSIISCFMTLFAIIGIMAYLISKNGGPGPLFYKKVDLSTSERSWMWLYAIA
                     IWYSGVSAGVANQSDYSRFSSNSRASYLGLFLGIVIPGTFVSLAGMLCASACLKLYGT
                     AYWTPDEIVAQWLNDNYSSKARAAAFFIGISFTSSQVFLNMTQNGYACGFDLTGLAPK
                     YINVTRGTLFCQLISWVVQPWTFFNTASSFLNVMSSFGIFTSPIITINVIDFYIIRKQ
                     KVSLLDFFTLSPLGTYWYWKGINLRAVAALICGVTLGLPGLAYSANTHIKVNQPMMNY
                     YYGYFFFIPLVTGCVYYGLNLIFPHKHNRQGENDPIDYFNCFTEQERLERNMVAFDNS
                     KGDVYQYLDAEESSMNDLNEVNEVINSDKAEK"
     gene            <109036..>110529
                     /gene="SHM1"
                     /locus_tag="KLMA_50050"
                     /db_xref="GeneID:34716666"
     mRNA            <109036..>110529
                     /gene="SHM1"
                     /locus_tag="KLMA_50050"
                     /product="serine hydroxymethyltransferase"
                     /transcript_id="XM_022820016.1"
                     /db_xref="GeneID:34716666"
     CDS             109036..110529
                     /gene="SHM1"
                     /locus_tag="KLMA_50050"
                     /codon_start=1
                     /product="serine hydroxymethyltransferase"
                     /protein_id="XP_022676523.1"
                     /db_xref="GeneID:34716666"
                     /translation="MLSRSVRCSRNVLIGVRRYASSKAAAAGVSGNQLLVSKHVQDID
                     PEMFDILTKERQRQKHSVTLIPSENFTSKSVMDLLGSEMQNKYSEGYPGERYYGGNQF
                     IDMAESLCQKRALELYNLDPELWGVNVQPLSGAPANLYAYSAVMETNDRLMGLDLPHG
                     GHLSHGYQLPSGTKISYISKYFQTMPYHVDAQTGIIDYDTLSKTSKLFRPKVIVAGAS
                     AYSRVLDYKRFREIADACGAYLMVDMAHISGLIAAGVTASPFDYADIVTTTTHKSLRG
                     PRGAMIFYRKGVRKVTKKGKEIMYDLEKRINFSVFPGHQGGPHNHTISALAVALKQAS
                     TPEFKEYQTAVVENARVFSEELIKKGFKLVSDGTDTHLILINLSNLGIDGARLEALLE
                     KINIAANKNTIPGDKSALFPSGLRVGTPAMTTRGFGPQEFAQVASYIDRAVKLAIGIK
                     SQESPDAKDARSKLANFKELCNESEQVKELAAEVYQWAGEFPVPGEL"
     gene            complement(<110630..>111262)
                     /gene="VPS21"
                     /locus_tag="KLMA_50051"
                     /db_xref="GeneID:34716667"
     mRNA            complement(<110630..>111262)
                     /gene="VPS21"
                     /locus_tag="KLMA_50051"
                     /product="vacuolar protein sorting-associated protein 21"
                     /transcript_id="XM_022820018.1"
                     /db_xref="GeneID:34716667"
     CDS             complement(110630..111262)
                     /gene="VPS21"
                     /locus_tag="KLMA_50051"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 21"
                     /protein_id="XP_022676524.1"
                     /db_xref="GeneID:34716667"
                     /translation="MGNSAYIATIKVVLLGESSVGKTAIVTRFTTGEFQTNNATIGAA
                     FTTKELEWVGEEDDISRKVRFEIWDTAGQERYRSLAPMYYRNTDVAVVVFDVTQPESR
                     DKAKSWIDELHCYVEDYKKDDIVVQVVANKSDLIVRGESEDVWNGVKLVSAKTGDGIE
                     QLFKDIAENMPLDKFKLVGGNNELANVDENTSRIELDSVHRAINNASCNC"
     gene            <111647..>116011
                     /gene="RIF1"
                     /locus_tag="KLMA_50052"
                     /db_xref="GeneID:34716668"
     mRNA            <111647..>116011
                     /gene="RIF1"
                     /locus_tag="KLMA_50052"
                     /product="telomere length regulator protein RIF1"
                     /transcript_id="XM_022820019.1"
                     /db_xref="GeneID:34716668"
     CDS             111647..116011
                     /gene="RIF1"
                     /locus_tag="KLMA_50052"
                     /codon_start=1
                     /product="telomere length regulator protein RIF1"
                     /protein_id="XP_022676525.1"
                     /db_xref="GeneID:34716668"
                     /translation="MTEPSKKTRSEGKIKALDVLDKHITQRSALKKTLTMNGQNVLAL
                     NENMTLNPAPALVPTTDNVYQRSPTPRNRRDIAIKRDRDTMDASPSPLSSPIRKGVSF
                     SDQIESSPIEHQIASSPMRPSSMTKPPSKSILKQYSLKVERSSLRGSPRKPTHLSIDP
                     FSPTFWPEGEILRMINPNNVAEFRKIIEGGIHVLNSGKARDFEIFASFNNIVPSMNGV
                     ILNDVVHHKIEVIIENLEPLLNISLTILKNLQNSLLLQLKKDPFKSRCYIQVVRFLTV
                     IFSNFKVIKHLDGNLNLQLKFTEVLKKCEETLTHKNTSKVMVIYPLTLLKEEKFGQFY
                     LPDAQIKHLVHSVFQMRYIDSSNVQCERLMVLKQFLQKYNKIMIKSLPEWFPVEIAGR
                     YLAEEKLSSPKIRSCCNLLLLDLLRKSITSDKMVHDIHDLLSIPFNKIKTLPQFSEDA
                     NWGSMDANPCNLTLLEALCKKLKLLIDERDEYKLSMDYWLGIVGLLFNTPETMPLLLQ
                     PVGSMCLEVNSSLLQSQNKVACGTAIKSRRIINFMIVTNLTLDMGSTMLNGLLKIILE
                     PFNPDNSEGLYEYLTFLFNGLMYLVCCDNRTMSPKKFEFLYKHILVPLFSDISDSQLR
                     STLGYQAQHIFSRILRSCSDDEGSSPRRSTGFQPLKALSTNGVDLTDFEPMDNAILEN
                     NWSSIVNLLKSIIDWSGFAPQNSLTSLQHLIRRAPSTIPMSQTCCTLLDLLSLILNKG
                     KIDRNGDAFKTTIRTFAEKFELHLFDDDSIFLTHIFPMNGISEEEQFNLFKEILQQVK
                     PFVKPLLLFGCFHSIENSLISNYTANIVGSMLLPTNMSDLEYKTLLKIVNKTPIPEII
                     DNLFTWLRKTGKWKSLANELNLSSWDDHLFANFIQKWLQEQKNTWSEETINMISESLW
                     RRPEAFKQLSSILINSGQIQLIKDTLTKNPDIIDDISLLGDLPLLEVLPKPLVISSFT
                     HINQYDDVIKTKLFLCACAQEEYEVIRANLKLLHQLLVPTDDDVSLNNDRNVIIDLLI
                     KYSISNKFYDLVSMVIEVCLLRKDVDRIIEIFSHHQITFSVLEAKIIAMMVNNIGKLN
                     SELIEYLRNVFISGESSYGIAIIEELLKETKYQVFNVLREDVLKFSFNNDHKLTENEK
                     ERLKKIFPLIVDYYVEDNSKSLIDIMKIILNIMKTSKDKQYGTSLVVMFLNHSEFKIQ
                     GNKTLMKKLNVYKANAKRLATIRKYQFISPNETRDSPAQKPDVIEPKTTSTTTPITNN
                     IHSNTTNDLNILSVQRESEAQQKPPSKVEAPEIDCESASAICKVTMPETKVRSSEPTL
                     NAKKCDGPNAQKIFIKKEMSPSDISVSLNGTEENESSNLPVKIPIFNPFGSDIVKLED
                     EIRSGVPVPLKRSRDFSERDTQKMKKNKENEYPPLKIQKLVDNLSQVSKDDVNALKEE
                     DRRILRKAICSFMLELEK"
     gene            complement(<116070..>117635)
                     /gene="CHK1"
                     /locus_tag="KLMA_50053"
                     /db_xref="GeneID:34716669"
     mRNA            complement(<116070..>117635)
                     /gene="CHK1"
                     /locus_tag="KLMA_50053"
                     /product="serine/threonine-protein kinase CHK1"
                     /transcript_id="XM_022820020.1"
                     /db_xref="GeneID:34716669"
     CDS             complement(116070..117635)
                     /gene="CHK1"
                     /locus_tag="KLMA_50053"
                     /codon_start=1
                     /product="serine/threonine-protein kinase CHK1"
                     /protein_id="XP_022676526.1"
                     /db_xref="GeneID:34716669"
                     /translation="MNFSQIAQLPEIEGVRLGSTVGKGSFAFVKEASLVVDPTTLIAV
                     KFVHLPTCEKQGMSQNDVLKEVKMHSRCSAHENVLKVIDCSISEPFLWIAMELAEGGD
                     LFDKIEPDIGVASEVAQFYYKQLVNAITYLHETCGVAHRDIKPENILLDRYGNLKLAD
                     FGLASLFKRKDGTKRISRDQRGSLPYMAPEIIYCDGYYADITDVWSIGILLFVLLTGE
                     TPWELPHEDDLTFRSFIKGQGKISQGSWLKIDLVQLNLLRKILQPDPEKRASLSTLRN
                     HVWYQTKSRFADENGLCKNPSLLAEKLISRLQVSLSEHEYISSTNDMPSKDKQRIAST
                     QPLDNDFAYIDIISTDIHNGLSATQKIISNDSNSSTRERFSTTQNTFLTQNIQDDLAS
                     LQFNISTSKPIPNFSSNKLTKFFSTDDIEVILAELENALVAHGVRVSQNLYENLLELQ
                     RANNKTSLYPIFIQVKTFDRNRLPLTGALAIMQLDDNLKSITFERKRGDPLEWRRFFK
                     KITIFCRDIVYVN"
     gene            <117968..>119200
                     /gene="UBX7"
                     /locus_tag="KLMA_50054"
                     /db_xref="GeneID:34716670"
     mRNA            <117968..>119200
                     /gene="UBX7"
                     /locus_tag="KLMA_50054"
                     /product="UBX domain-containing protein 7"
                     /transcript_id="XM_022820021.1"
                     /db_xref="GeneID:34716670"
     CDS             117968..119200
                     /gene="UBX7"
                     /locus_tag="KLMA_50054"
                     /codon_start=1
                     /product="UBX domain-containing protein 7"
                     /protein_id="XP_022676527.1"
                     /db_xref="GeneID:34716670"
                     /translation="MYIDNMDNLDTHFVSSVENAVQKSLRENKALLVYTSDGDNVWFE
                     SWFTPLVAEQLKDKCVWLRLLAQSREMSYFEEIFPGVKVPSVYCISKGQIVEMISYDQ
                     VDMDKFSTRLIRAVTHGKLVDISSEDSSEGSGTSRGTDLGSSGSPVGSSSSGPASTTT
                     KLTEYQIRAKKHQLTEQQERERIMRLMKADREEMKHRRHSSCSSPGLISQDQEIPIVP
                     EVASEPIHDNIKNRDIINSTVCTLLIRLTDGKTLKHDFSSTETLNDVRKWVDANRTDK
                     DLPYQFHRNIPRETFTESQEMSTLLDLELTPRSALILKPLENQGHSQKIADVEGPGLL
                     GKIYQNVTSWWYKGSSTSGNTKRSQLPQENRDAVQSEASSRYVSPLSSPNITHTDPSR
                     GVSPSPINYAHHSDDNNS"
     gene            complement(<119385..>120728)
                     /locus_tag="KLMA_50055"
                     /db_xref="GeneID:34716671"
     mRNA            complement(<119385..>120728)
                     /locus_tag="KLMA_50055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820022.1"
                     /db_xref="GeneID:34716671"
     CDS             complement(119385..120728)
                     /locus_tag="KLMA_50055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676528.1"
                     /db_xref="GeneID:34716671"
                     /translation="MLPESRLRSLYSDFRELKLVNIDGYEANIRQWKEYLIKEYWQNS
                     VIINGDDIISDLTIPQYGAPKSIDVVLDEMVKDGTIVPMERYLKRNESVLISMLKWTI
                     NKVVVDLSWKSRSNEGTRYLKPVKYVNVFWLKHNSETIQKLLQENIYECSIKPTDYIF
                     TKEHFYKKSGIDTIVKDWDSYNIILDYLCDQNNIVMASDDESDVIKVISPLSLNITGI
                     SQEIADSDIYVAKINHYVFIAESEITSAQKVVELTGKRLSNAISSGLSLEIKRTLLRL
                     KKRAEKNLEQAYISLESLKKLQEEISNATQTVSMVKIMSQGSSALKSINKQLIDEESI
                     ADMLDEFQENNEKQERISKLLAGESITDETAIEKELSSLENELREDESQKPKIQETQH
                     DSPSLEESEKHSSSTEDLIKRLETLKVSSGDIIEAKRRKEKDEEEDTEMKQPELA"
     gene            <120994..>122406
                     /gene="HSM3"
                     /locus_tag="KLMA_50056"
                     /db_xref="GeneID:34716672"
     mRNA            <120994..>122406
                     /gene="HSM3"
                     /locus_tag="KLMA_50056"
                     /product="DNA mismatch repair protein HSM3"
                     /transcript_id="XM_022820023.1"
                     /db_xref="GeneID:34716672"
     CDS             120994..122406
                     /gene="HSM3"
                     /locus_tag="KLMA_50056"
                     /codon_start=1
                     /product="DNA mismatch repair protein HSM3"
                     /protein_id="XP_022676529.1"
                     /db_xref="GeneID:34716672"
                     /translation="MGSIESDIDKLTLKLGNEEISPDINQLMEKLTLNLTSSSNLDKD
                     VKPLLHSIKNFLLHSDIEFFDYDLLIELLDAIVALCPFEDVLAVFSVDDLVAALESGS
                     RSLITTVCKVISAAYPRDIFAGTPLIDELLKLYFDDSAVVSIISELEKTFDTLSTNQL
                     NRRRILENNLPTIMNAKNSNNSTTFCRLLDLLKMLAANVSFEEFRKDTFSVDEKTIRE
                     AMENDVLVFIHICQYVCELLNLVIKGHGKEWIVRYIDKTFDIFGEAYARRDELYDVSH
                     FANSYLLRIFSKISYLDEKSYIKNLELRHFPLSVDKPYCVDFLTVLNPSYIVKSHKEL
                     LQELNLRPRNVHMFVNLIKDEECFNIIKDEINSKSLEAMPYLEQMFLLVGLTSELYGI
                     HHLTHNIPAIMNNLIDSGNNVTEQVCFDLRQKVFENLLDADPQELSIWLIPLQSEYSN
                     ILNGRSKRLSEKHKVADEYI"
     gene            complement(<122465..>125674)
                     /gene="MTR4"
                     /locus_tag="KLMA_50057"
                     /db_xref="GeneID:34716673"
     mRNA            complement(<122465..>125674)
                     /gene="MTR4"
                     /locus_tag="KLMA_50057"
                     /product="ATP-dependent RNA helicase DOB1"
                     /transcript_id="XM_022820024.1"
                     /db_xref="GeneID:34716673"
     CDS             complement(122465..125674)
                     /gene="MTR4"
                     /locus_tag="KLMA_50057"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DOB1"
                     /protein_id="XP_022676530.1"
                     /db_xref="GeneID:34716673"
                     /translation="MSDSLFDVFGETPAEDLIPPEELATLHDEIPAEDKSAAKRSNEE
                     NEASDNEERSKKVKKGMALIDDKKNKEVVVPVVADAFEKEASREVEASTGLGSAQTVQ
                     LESDGKVKLRHQVRHQVALPPNFDYKPIGDHIRTNEARTYPFTLDPFQDTAISCIDRS
                     ESVLVSAHTSAGKTVVAEYAIAQSLREKQRVIYTSPIKALSNQKYRELLAEFGDVGLM
                     TGDITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETI
                     ILLPDKVHYVFLSATIPNAMEFAEWICRIHSQPCHIVYTDFRPTPLQHYLFPAHGDGI
                     HLVVDEKGTFREENFQKAMASISNQNGDDVHTIGGRGKKGQSYKGGAAKGEAKGDIYK
                     IVRMIWKKKYNPVIVFSFSKRDCEELALKMSKLDFNTEEEKDALTKIFKNAIELLPET
                     DRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMP
                     AKTVVFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKMEPQVAKG
                     MVKGQADRLDSAFHLGYNMILNLMRVEGISPEFMLEHSFFQFQNATSVPVMEKKVAEL
                     SNELQSIQIDDEATIKEYYEIRKTLDGYNEDIRTIITHPANSLAFLQPGRLIKVKIDG
                     KHDYGWAAVVDFVKRTNKRNPTAVYSDHESYIVNVVVNTMYADSPINLLKPFNPTFPE
                     GIRPAEEGEKTISTIIPITLSSIHSIGNIRLFMPNDIKAESQQTAVGKTLREAVRRFP
                     DGVPVVDPVKNMKIQDDDFLKLLKKVEVLEGRLYSNPLTNTLRLKELYEKYTKKVAIE
                     ADIKNLKHKINEAQAVVQLDDLRRRKRVLRRLGFCTQSDIIELKGRVACEISSGDELL
                     LTELIFNGNFNELSPAQAAALLSCFAFQERCKEAPRLKPELAEPLKAMREVAGKIAKI
                     IKDSKIELVEKEYVESFRHELMEVVFEWCKGASFTQICKMTDVYEGSLIRMFKRLEEM
                     IKELIDVSKTIGNTTLKEKMEAALNLIHRDIVSAGSLYL"
     gene            complement(<126493..>128340)
                     /locus_tag="KLMA_50058"
                     /db_xref="GeneID:34716674"
     mRNA            complement(<126493..>128340)
                     /locus_tag="KLMA_50058"
                     /product="uncharacterized protein IRC8"
                     /transcript_id="XM_022820025.1"
                     /db_xref="GeneID:34716674"
     CDS             complement(126493..128340)
                     /locus_tag="KLMA_50058"
                     /codon_start=1
                     /product="uncharacterized protein IRC8"
                     /protein_id="XP_022676531.1"
                     /db_xref="GeneID:34716674"
                     /translation="MLMNGMQLNSRILNLYNQQRHGTESLKPLNEDLEKGSIPLEQDD
                     EKYVALKASAQTLTPELEAVLEKNWMNEYPHSGSDTTSTPSVIKHKLAYQMNGELSNK
                     SSISKLRNTSFPNDTSPIARSQHVFEKLQRKFSIKSPTNKDKHLKTGSSASEPRNSFQ
                     PEINAKYVTRLSTIPDMSKSYLNILKQTNEVNSATSVCLKDSDDIDRSLLKMEKDALD
                     LYDSVLLPSILHNSKMIEKSASQSASSLINEDNIKKKDYVKNDEDDDDDDELEKILEE
                     DLQIRPLQVPHIFKGSVSQPNLRTDMKSNTITLNNWNENKSSLLEKEKQNQKQSDHMY
                     LPYDFDTNFSFPSKKNSSHLAFVGSDAEEEIMTFVDEAIKPHDNQLMEEGLKQDSPSV
                     NPLLYSQSIHSPTKSVSSVATATKTPVKFNSGAFSTEDTRDDSQISLYLNSNNSRQVF
                     SAQSSPTRLSKRLSQRFSRVNLRYDDESHNNMHSHSKSLTLSGFHYRHHSETNSYTQI
                     DLSYIHSLQQKHSPQRSVCTQNSRRRSSIYQSVSEIPKIETTNDELHPVSDSESLDIE
                     EEEEEDNDIDSALSFGAGREFVGVDTGLSEYDREKLSILVSRQQTLNKY"
     gene            <129818..>130696
                     /gene="RTK1"
                     /locus_tag="KLMA_50059"
                     /db_xref="GeneID:34716675"
     mRNA            <129818..>130696
                     /gene="RTK1"
                     /locus_tag="KLMA_50059"
                     /product="probable serine/threonine-protein kinase"
                     /transcript_id="XM_022820026.1"
                     /db_xref="GeneID:34716675"
     CDS             129818..130696
                     /gene="RTK1"
                     /locus_tag="KLMA_50059"
                     /codon_start=1
                     /product="probable serine/threonine-protein kinase"
                     /protein_id="XP_022676532.1"
                     /db_xref="GeneID:34716675"
                     /translation="MAFLGRLLSRDKSKSFAEKPNQVVRGTTCEVEIVHRKDDSKIAI
                     KRFISWDRHSHHKQVCNNEYALLKKLQHENIVEALDFDQKKYTITFPYYDYTMLLLMK
                     MKLLPTIQERGLWFCQICEGVAYLHSQNIVHRDLKLENIMVDQSLCNIKIIDFGSAVD
                     IGANRVDCHGICGSEPFIAPEVFQRLSYEGPPVDIWSLGIIMFELFNNSNKLLYPWKL
                     AKIDDPAFKQYKEDPESLDIELPLCSKLLSIDPKERLQIEDILQDKFYKDNSSCVDEH
                     LVHARTKRILNRSQTI"
     gene            complement(<130689..>131603)
                     /gene="PEP8"
                     /locus_tag="KLMA_50060"
                     /db_xref="GeneID:34716676"
     mRNA            complement(<130689..>131603)
                     /gene="PEP8"
                     /locus_tag="KLMA_50060"
                     /product="vacuolar protein sorting-associated protein 26"
                     /transcript_id="XM_022820027.1"
                     /db_xref="GeneID:34716676"
     CDS             complement(130689..131603)
                     /gene="PEP8"
                     /locus_tag="KLMA_50060"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 26"
                     /protein_id="XP_022676533.1"
                     /db_xref="GeneID:34716676"
                     /translation="MSLFYKTPVDIEILFDGEDSRKHIEVPTSSHAAKSLFDKYPLFE
                     DGESVSGIVTLRVREGKKLEHSGIKVSLIGSIDTTSHNNEVKNKTLDTFLTLSMDLCP
                     PGELVHSINYKFNFKDVEKRFESYLGKNVSVLYYVKVTMIRKSTDIVKLKKFWCYRYS
                     NEMAVNTTDNKPIKLDIGIENCLHIEFEYSKSKYSLKDVIVGRIYFLLTRLKVKHMEL
                     SLIKRETCGTEPNQLSDSTSIRYEIMDGSPVKGETIPIRLFLGGYDLTPNMSCNYFNV
                     KNYLSLVIIDEDGRRYFKQTEIILYRTI"
     gene            complement(<131871..>133271)
                     /gene="TIM54"
                     /locus_tag="KLMA_50061"
                     /db_xref="GeneID:34716677"
     mRNA            complement(<131871..>133271)
                     /gene="TIM54"
                     /locus_tag="KLMA_50061"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM54"
                     /transcript_id="XM_022820031.1"
                     /db_xref="GeneID:34716677"
     CDS             complement(131871..133271)
                     /gene="TIM54"
                     /locus_tag="KLMA_50061"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM54"
                     /protein_id="XP_022676534.1"
                     /db_xref="GeneID:34716677"
                     /translation="MWKKIPSPKWIAVGLVVTAGGSGIAYDKYEQSQIRSKYMDYVSE
                     GSHAPLDTNLRPRKLLVIVAPPPNDYLDTSLKLWRRWVKPILYSSGLDYEVVTGTKQG
                     EIRTEIAQRVRDIRSRLIEQRKEELKQEEEKKNKKWWFNWRSSTKTAAKDEIAEADES
                     AVKNPPKFDTRSVLGIFYHNEPKQVVTEDSLVDPSVAGGVICIGRGAYKEYIDGVHEG
                     VLGPLEAPVEKPSEETVPAESVPTTVEQHTNVSDDAPIVKPLESEIPKSLEENSSKED
                     DQAVKPEAEEEATSDSNSNSDSNSNAEKTAENKDSQPLIVKPFIKPSEYENATIPQEL
                     TSKLVIDPGTGAPAFFQQPLLVLAVPNLSGFTTIPSRISRFYQKRFNCEQVSHATLAM
                     VESKSRPFTETDLDLAAYEELDWPKNWVEEGKKRGSEWVQPLKGDPRIMEKLRVIEPA
                     MVSPISQQIESEPESS"
     gene            complement(<136169..>136669)
                     /gene="ABF2"
                     /locus_tag="KLMA_50062"
                     /db_xref="GeneID:34716678"
     mRNA            complement(<136169..>136669)
                     /gene="ABF2"
                     /locus_tag="KLMA_50062"
                     /product="putative high mobility group protein B3-like
                     protein"
                     /transcript_id="XM_022820032.1"
                     /db_xref="GeneID:34716678"
     CDS             complement(136169..136669)
                     /gene="ABF2"
                     /locus_tag="KLMA_50062"
                     /codon_start=1
                     /product="putative high mobility group protein B3-like
                     protein"
                     /protein_id="XP_022676535.1"
                     /db_xref="GeneID:34716678"
                     /translation="MLFKRFLSITPITSQAAATAIKPKRPPTAFSYYFKQNVKQICEA
                     NNVKTVDAMKIAGEKWRSFSESEKQKYFDEVKPLLENYQAQLKEFEKNLPPKRPATSF
                     GLYLKEVSPDRRAQNPGLNQVEIMKLVSNEWKNMDESLKNKYREQFAEQLAVYNKAVE
                     KFKKSA"
     gene            <137536..>138981
                     /gene="IKS1"
                     /locus_tag="KLMA_50063"
                     /db_xref="GeneID:34716679"
     mRNA            <137536..>138981
                     /gene="IKS1"
                     /locus_tag="KLMA_50063"
                     /product="probable serine/threonine-protein kinase IKS1"
                     /transcript_id="XM_022820033.1"
                     /db_xref="GeneID:34716679"
     CDS             137536..138981
                     /gene="IKS1"
                     /locus_tag="KLMA_50063"
                     /codon_start=1
                     /product="probable serine/threonine-protein kinase IKS1"
                     /protein_id="XP_022676536.1"
                     /db_xref="GeneID:34716679"
                     /translation="MSLVVYSHDRDVEPGEGQIVVYNQAYFEYLQAEEGSSRGSYEDH
                     ARERPRRSSIPDDFFVQGYYQRFFKQVGVVGTGSRAVVYKVKHMLLENDLGTFALKKI
                     CIGDDMHWLYRCLKEVKLLNRLTEESSHLITYNHVWLERCPVESLILTQDDGSPANLD
                     IPTTMPYMFILQQFCCGGNLDDVIQYQVFNKISGKETRLERKKKLMNAKKLRKGLTTY
                     QIVSIAKDINTGLRQLHSLRIIHRDLKPSNCLLLEQFDPADTKNFPKCVIGDFGESQL
                     YGQLRDATGSTGTLEFVAPELTTGAQFSFKSDIYAFGMILYFVIFGQLPFGSKDMSVI
                     KREINQLSLNPDSMRELHESLDLVPVHPALFDLVCEMLNHTPSLRPDLASISYRLDTI
                     LESVTTSINNENTPTNSENKHKVGFASLYALQIAVTLTVLNHSDWHWWKYTVIFITGL
                     AYNHNRNDSAGNRNLLIILIASVLISAISIW"
     gene            <139164..>139883
                     /gene="BIT61"
                     /locus_tag="KLMA_50064"
                     /db_xref="GeneID:34716680"
     mRNA            <139164..>139883
                     /gene="BIT61"
                     /locus_tag="KLMA_50064"
                     /product="HbrB domain family protein"
                     /transcript_id="XM_022820034.1"
                     /db_xref="GeneID:34716680"
     CDS             139164..139883
                     /gene="BIT61"
                     /locus_tag="KLMA_50064"
                     /codon_start=1
                     /product="HbrB domain family protein"
                     /protein_id="XP_022676537.1"
                     /db_xref="GeneID:34716680"
                     /translation="MKRARHKIFRKDDSPAAPPINIDSLLKNVHSLELNYQGFQPAEK
                     KALLRTISALCKEVIENAMCHGLDGSIKLEDLNLLFRFYVDLEKEFKLDCNKDIKKMI
                     MDGLSKFENEFILNSNEEVINVALKRLCAIWGRFYSRVYPDCLICLIQIPTDMEQLLL
                     VCFRDAIVLPYYKNFMNAVEGISMSFAKYINSEEENGVKQEHKLILLQCFGVLSSIHG
                     KDMNQRLIEDLLSGVRMSIGV"
     gene            complement(<139915..>141099)
                     /gene="BTN1"
                     /locus_tag="KLMA_50065"
                     /db_xref="GeneID:34716681"
     mRNA            complement(<139915..>141099)
                     /gene="BTN1"
                     /locus_tag="KLMA_50065"
                     /product="protein BTN1"
                     /transcript_id="XM_022820035.1"
                     /db_xref="GeneID:34716681"
     CDS             complement(139915..141099)
                     /gene="BTN1"
                     /locus_tag="KLMA_50065"
                     /codon_start=1
                     /product="protein BTN1"
                     /protein_id="XP_022676538.1"
                     /db_xref="GeneID:34716681"
                     /translation="MNFEWSREKRTFLYFWLFGLINNILYVVILSAASDIIGPSLPKS
                     IVLLFDIMPSFLIKLSAPFFIHKIHYDKRIPVLIILSVFGIMLVSTRKLWLCLPGIVL
                     ASLSSGFGEITFLQLTHFFGSRSLTGWSSGTGGAGIVGSFSYLLLTTFLRLNIQVSLM
                     LYALLPFFFLLYFNVNDEIYASQDYQSLEVPIEEDGIASSEDPIQILKPDHWHHTLKR
                     LSQLVVPYMIPLSTVYLFEYLINQGVAPTLLFPIDKTPFVKYRDIYVTYGTLYQLGVF
                     VSRTWGHLLPVKNLYVFSILQFINLAVTICQSYFYFTHSMWLLMIIIFYEGLIGGSSY
                     VNCFMNILKNVDPKEREFSLGSVSISDSSGTLIAAFLGIYLEPTLCKHQIDTGRPWCR
                     ME"
     gene            <141444..>142229
                     /locus_tag="KLMA_50066"
                     /db_xref="GeneID:34716682"
     mRNA            <141444..>142229
                     /locus_tag="KLMA_50066"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820036.1"
                     /db_xref="GeneID:34716682"
     CDS             141444..142229
                     /locus_tag="KLMA_50066"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676539.1"
                     /db_xref="GeneID:34716682"
                     /translation="MVSTGSKSAAINPKITEEEADVGIWYDAIHWQDEEETASGNSLL
                     LYCLVSTDSGVYELRKRASSVSQSKALESTKILSVRKWDPLWALNKKNGRISVDNGYS
                     KYTYDLKGKNLCRLTKNKTRDDNEEYTVSWSSRFYNVLCKNVIGSEVTYVHVSPADIN
                     LTGKSSSLKLTDTKVLQIVPASQNRFVLFGTKVLVIQVIPALDFKINILESSIAPHLP
                     LAVGGYLECNHLVIQCPYASKSRDTTVRIPLPSCLTENVLSCT"
     gene            complement(<145857..>147161)
                     /gene="BNA3"
                     /locus_tag="KLMA_50067"
                     /db_xref="GeneID:34716683"
     mRNA            complement(<145857..>147161)
                     /gene="BNA3"
                     /locus_tag="KLMA_50067"
                     /product="probable kynurenine--oxoglutarate transaminase
                     BNA3"
                     /transcript_id="XM_022820037.1"
                     /db_xref="GeneID:34716683"
     CDS             complement(145857..147161)
                     /gene="BNA3"
                     /locus_tag="KLMA_50067"
                     /codon_start=1
                     /product="probable kynurenine--oxoglutarate transaminase
                     BNA3"
                     /protein_id="XP_022676540.1"
                     /db_xref="GeneID:34716683"
                     /translation="MTQQSKVAGIRANRAFMGNVPKDVWTLTNEAAHVASENEKNRGR
                     AILNLGQGFFSYSPPKFAIDQVVEALKVPLNNQYSPTRGRPALLTALSNFYSPIYGEP
                     LNANNVTITTGANEGILSCLVGLLNPGDEVIVFEPFFDQYISNIEIPGGKVRYVPLVA
                     PKELSERVTTGDDWKIDWDILNNTINEKTKAVILNTPHNPIGKVFTREELTQLGEICV
                     KNNIYIISDEVYEHLYFGKEFVRIATLSKEIGDLTLTVGSAGKSFAATGWRIGWVVSR
                     NAELLSYASKAHTRICFSSPSPFQEACAHSIEIGLKNGYFKAMREEYKEKFAILTSVF
                     DELGLPYTKPDGTYFVCVDFSKVKIPADYPFPQELNNRAKDFRLSYWLVNELGVVAIP
                     PTEFYIKEHEKAAENLLRFAVCKDNDYLRKSVERLRLLKDYL"
     gene            <148090..>148488
                     /gene="FMP21"
                     /locus_tag="KLMA_50068"
                     /db_xref="GeneID:34716684"
     mRNA            <148090..>148488
                     /gene="FMP21"
                     /locus_tag="KLMA_50068"
                     /product="protein FMP21"
                     /transcript_id="XM_022820038.1"
                     /db_xref="GeneID:34716684"
     CDS             148090..148488
                     /gene="FMP21"
                     /locus_tag="KLMA_50068"
                     /codon_start=1
                     /product="protein FMP21"
                     /protein_id="XP_022676541.1"
                     /db_xref="GeneID:34716684"
                     /translation="MLPTVRIPNVFRTVRFRPALSSISQVRTFQERRAGPPPLPKEEQ
                     EEFERLQKLASSQEAIDAYNAQFETDHTMESVKSPILKNDVGGFSPEFMKTIPEFEGD
                     KNPETGEIGGPKQDPLRHGDYSFNGRVTDF"
     gene            complement(<148568..>150628)
                     /gene="NUP82"
                     /locus_tag="KLMA_50069"
                     /db_xref="GeneID:34716685"
     mRNA            complement(<148568..>150628)
                     /gene="NUP82"
                     /locus_tag="KLMA_50069"
                     /product="nucleoporin NUP82"
                     /transcript_id="XM_022820039.1"
                     /db_xref="GeneID:34716685"
     CDS             complement(148568..150628)
                     /gene="NUP82"
                     /locus_tag="KLMA_50069"
                     /codon_start=1
                     /product="nucleoporin NUP82"
                     /protein_id="XP_022676542.1"
                     /db_xref="GeneID:34716685"
                     /translation="MSLLNVGDLEGIFQPVSVNPSSRLVCYNSSRVYVWQNGILRVQS
                     EVGNTYKSYDLEVPFTPEAMVLDISGDLIAFHSKSEFYVVEVRQNTRLKRHHKPEAGI
                     KRLLWHPLATYGLSVVILHEDSSIQIYDLNELDVPKPTIFNLKTKSFGLSDHVEGVCD
                     ITFDTTGLVLYLLSSYNFCDVYAIYPFLPDNFTLDGFENNKDDNDNSSLADYMYHKSL
                     SQFNNVQKELNQSTMTADVQQSDMLPLSHDLLKQIQFFKSFAKKNESLPFSNKALTKA
                     TPQGPFRIKGFSKSLYEKDVIGITNIPISKYLGLLALQFEDGSNVILFPDSEPIMSWT
                     PRNINPFNSFTVITSFQAQGSCTLLNGTKPKLAYVGPNAAIFVELPWLSPLSECIKLN
                     DFSSIVGVDFDVNITTISGSFSGVIPTITADVLYDNQHIKVIESEDKKESTLRTPKNL
                     DVKYTYKPALPTSSQEIGMLVMKYKSQAKHFVGGVPDELASVPFKNDNNEDQLEIVSK
                     LYKNTMGRVKMGQMIAYRMFNKLQEQQNEIHRQLRKTNRLNELKVKLEGNLSELEERH
                     AASKEKSKQLNERLDKLKETFTKIENSQKLKTASISDAEVAWFKTIRTQVLKFNEYVH
                     MTNNLREELEFLDKKLKAIHTDKTDLFSDAEFNELQQMLLNDKKVINACVSELTASVQ
                     TLEM"
     gene            complement(<150907..>151203)
                     /gene="MRPL37"
                     /locus_tag="KLMA_50070"
                     /db_xref="GeneID:34716686"
     mRNA            complement(<150907..>151203)
                     /gene="MRPL37"
                     /locus_tag="KLMA_50070"
                     /product="54S ribosomal protein L37"
                     /transcript_id="XM_022820040.1"
                     /db_xref="GeneID:34716686"
     CDS             complement(150907..151203)
                     /gene="MRPL37"
                     /locus_tag="KLMA_50070"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="54S ribosomal protein L37"
                     /protein_id="XP_022676543.1"
                     /db_xref="GeneID:34716686"
                     /translation="MFRVTRVLFSQAKNEASAQATKIVSSCPAGTPLKLQIKKSGKEP
                     VALEDHEYPAWLWSVLDEKAQAEKLAADPIKLRKKQLRVANRERIKQNNFLSQM"
     gene            complement(<151365..>153734)
                     /gene="LAS21"
                     /locus_tag="KLMA_50071"
                     /db_xref="GeneID:34716687"
     mRNA            complement(<151365..>153734)
                     /gene="LAS21"
                     /locus_tag="KLMA_50071"
                     /product="GPI ethanolamine phosphate transferase 2"
                     /transcript_id="XM_022820042.1"
                     /db_xref="GeneID:34716687"
     CDS             complement(151365..153734)
                     /gene="LAS21"
                     /locus_tag="KLMA_50071"
                     /codon_start=1
                     /product="GPI ethanolamine phosphate transferase 2"
                     /protein_id="XP_022676544.1"
                     /db_xref="GeneID:34716687"
                     /translation="MSKLTYYILAALQLIAAFLFCAGFFPQKVVLKNDSEFIVEPKLQ
                     LESKPVFDKLIVVVIDALRSDFLFQKDSSGFDFVHELLNSGEAWGYTAYSNPPTVTLP
                     RLKGITTGSAPNFLDAILNVAEDDTSSNLKEQDSLLKQFHTNNYKVNFFGDDTWLKLF
                     PLEYFGEYEGTNSFFVSDFTEVDLNVTRHVPYQMDHQKEWDVLILHYLGLDHIGHKGG
                     ARSHFMAPKHKEMDSVIKQIYGKMSENTLMVVLGDHGMNDLGNHGGSSSGETSAAMAF
                     LSKKLKKHDPPTGQKESILPITDIDPNYKYLQEIEQIDIVPTLSVLFNLPIPKNSMGV
                     IIPEFLPFLPKSMAEIKLQDNYLQLTKLKPGYKASLAGKSPLELLVEMKDIQSSLAMA
                     ATNYNYTLLISGIGIMTLGTIYVVALCFGKTQEFIESTAVSILLGLSMFASSFVEEEH
                     QIWWWVTVTVLFLMDISMKSKLSFLVGLRLIRGWNNSGQKYIYEHVIYSLLKSHTTVQ
                     WCLNVLTILSVGFPFLKNSDDVEKLISMITVSFLALSCMTYKACYAVVNRDNVPDALH
                     KFVLKSCSTYLNDKNMVDIESEVSECLVPMARMFFLICAASAVIVTFSKYALSKGTNA
                     QQKLLSIVKFILILQTTSANIPMFLILEILTTIIPQTSPVLSLCLQNLTFFQFGGTNS
                     IATINLTNAYNGVNSNYNIYVVGVLMFLSNYAPSIYMALSFIPISDSKKLLKLKHYYI
                     TGVFLLIACTALRYHLFVWSVFSPKLCYYTAWSLFNFVTDLAVTLLQNI"
     gene            complement(<154154..>155404)
                     /gene="REI1"
                     /locus_tag="KLMA_50072"
                     /db_xref="GeneID:34716688"
     mRNA            complement(<154154..>155404)
                     /gene="REI1"
                     /locus_tag="KLMA_50072"
                     /product="pre-60S factor REI1"
                     /transcript_id="XM_022820043.1"
                     /db_xref="GeneID:34716688"
     CDS             complement(154154..155404)
                     /gene="REI1"
                     /locus_tag="KLMA_50072"
                     /codon_start=1
                     /product="pre-60S factor REI1"
                     /protein_id="XP_022676545.1"
                     /db_xref="GeneID:34716688"
                     /translation="MAGYTCNTCGVVFDTAAGQRDHMKSDWHRYNLKRRVADLPSITE
                     ATFNEKVSNANAEKEELDKSKKTKVKQLTKKEMRRLEKEKLLAKKQELLELAKQSMLK
                     NMQEEAAKNEMKDTPEEEQPQETPEEKTSEENVLEENIPEENKPEEELSPEELAEKLM
                     AEKLQNRVEIDKTECLFTGKKFKTFEENLDQMFKNHGFYIPEQKYLIDKEGLFQYFSE
                     KIGLGNMCLVCSYQGRSLEAVRAHMLAKKHCRIPYESEAEKLEISEFYDFSSTYEELD
                     KAANEDESQWEDIEEEVDAASGKVGGSQDGNEEEEEEEELPEYALYNDGVELHLPTGV
                     KVGHRTLQRYYRQNLKPERELSEGQGTIIAADTRHFATIYDRQQQQLQKKVWQTEVKD
                     KKRDDKRAAKFVNNQPHYRDQLLQ"
     gene            complement(<155731..>156675)
                     /gene="TSC10"
                     /locus_tag="KLMA_50073"
                     /db_xref="GeneID:34716689"
     mRNA            complement(<155731..>156675)
                     /gene="TSC10"
                     /locus_tag="KLMA_50073"
                     /product="3-ketodihydrosphingosine reductase TSC10"
                     /transcript_id="XM_022820044.1"
                     /db_xref="GeneID:34716689"
     CDS             complement(155731..156675)
                     /gene="TSC10"
                     /locus_tag="KLMA_50073"
                     /codon_start=1
                     /product="3-ketodihydrosphingosine reductase TSC10"
                     /protein_id="XP_022676546.1"
                     /db_xref="GeneID:34716689"
                     /translation="MTRYSTEKQVVLISGGSQGLGESFAKRFVQENNKVIIVSRSDEK
                     LRQACQRIGVDGITLGEYQGKGVSEDKSWKCPQLLYHACDISDYESVDSMFKLLVKNE
                     LVPTQVYMCAGGSIPKLFVELSASELQNGITTNYATAVNLAHVSLRFKVPHILFFSSE
                     VAFFPFIGYAQYAPLKQSIRSLVAILRQEHADTRITCVYPGNFQSEGFDLENMTKPSI
                     TRDIEGPSHPVTAAQCRDKIISSLKYGLDDITTDSIGWLLMACDQGFNKHTSNQFMFL
                     FSWILGAILNITIVPIYMLICKFQIYQWRNKRAKSDKT"
     gene            complement(<157008..>157274)
                     /locus_tag="KLMA_50074"
                     /db_xref="GeneID:34716690"
     mRNA            complement(<157008..>157274)
                     /locus_tag="KLMA_50074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820045.1"
                     /db_xref="GeneID:34716690"
     CDS             complement(157008..157274)
                     /locus_tag="KLMA_50074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676547.1"
                     /db_xref="GeneID:34716690"
                     /translation="MLEPSPYQDPRTWKMTPAMIRARAPFFKKNMMGLLLLVGVTGTI
                     YTYTYRMLNKDTSFADVPIPPIDEKELEQLKKEYELEKAKRAQK"
     gene            <162127..>162846
                     /gene="MRPL8"
                     /locus_tag="KLMA_50075"
                     /db_xref="GeneID:34716691"
     mRNA            <162127..>162846
                     /gene="MRPL8"
                     /locus_tag="KLMA_50075"
                     /product="54S ribosomal protein L8"
                     /transcript_id="XM_022820046.1"
                     /db_xref="GeneID:34716691"
     CDS             162127..162846
                     /gene="MRPL8"
                     /locus_tag="KLMA_50075"
                     /codon_start=1
                     /product="54S ribosomal protein L8"
                     /protein_id="XP_022676548.1"
                     /db_xref="GeneID:34716691"
                     /translation="MTRGLGRHLSRTKAHRDALLRNMATQLLQHGTIMSTTPKLKETQ
                     KYVERIITIAKHGVQNGTPQKSIPELQSRLYLSGDNSNLLKKLFEEIVPRYISRDGGY
                     TRVMKVEPRLSDRAPQGILELVDAPVQSSDGQLLKGNMKLWLLTKNCMQQIEEEGQKL
                     TPNTVKNLKKMTHNKSVDELMTDIGVVRKYLIEAAEPEGEFNEEKHKAFLETVKNEIL
                     NFSAPKQEQLGYKFVERPTQQ"
     gene            <163163..>164230
                     /gene="cysB"
                     /locus_tag="KLMA_50076"
                     /db_xref="GeneID:34716692"
     mRNA            <163163..>164230
                     /gene="cysB"
                     /locus_tag="KLMA_50076"
                     /product="cysteine synthase"
                     /transcript_id="XM_022820047.1"
                     /db_xref="GeneID:34716692"
     CDS             163163..164230
                     /gene="cysB"
                     /locus_tag="KLMA_50076"
                     /codon_start=1
                     /product="cysteine synthase"
                     /protein_id="XP_022676549.1"
                     /db_xref="GeneID:34716692"
                     /translation="MSQFIRHLHVPPLATKGFTDAVGSTPLIKLQKLSKELGRNIYGK
                     SELQNPGGSVKDRAALYLINDAEKRGLIDPSKPVTVVEGSAGNTAIGLAHICKAKGYK
                     AVFYMPDTQSQAKINLLKWLGAEVYPVPVCPITDPLNFNNRARDHAKRLDNAVWTDQF
                     DNQANWRAHYYTTGPEILKQIEDEGLKLDAFTCSTGTGGTYTGIAKYLEEATKGNCKL
                     VVADPPGSVIYSYIKTGELNREGGSFTEGIGQGRITGNMKESVSITDDAVFIPDEESI
                     IMLFRLLDEEGLFVGGTSALNVVAAAKVGSTLPEGSNVVTILCDSGHKYADRVFSKSW
                     LQSKNLYDVLPDHLKKYASLP"
     gene            complement(<164428..>166755)
                     /gene="PPS1"
                     /locus_tag="KLMA_50077"
                     /db_xref="GeneID:34716693"
     mRNA            complement(<164428..>166755)
                     /gene="PPS1"
                     /locus_tag="KLMA_50077"
                     /product="dual specificity protein phosphatase PPS1"
                     /transcript_id="XM_022820048.1"
                     /db_xref="GeneID:34716693"
     CDS             complement(164428..166755)
                     /gene="PPS1"
                     /locus_tag="KLMA_50077"
                     /codon_start=1
                     /product="dual specificity protein phosphatase PPS1"
                     /protein_id="XP_022676550.1"
                     /db_xref="GeneID:34716693"
                     /translation="MMPEATFKRQNDGVSPAPLKRARDTITSEEVWQLLSNEWRSPLP
                     DTSVMFPWLHGDMQEVLPESYMDETKSHDFDRFNVSIVRSNIKESKYIENSGLLKSSL
                     EIFDILLPYTKEHSIDSVIRDVLKPFTSVTESEIAQLIDDCVLFETLPLLKTDPFHSV
                     YNSQSNSVKNNYQKWKQPNTFRRFDLQPALHFHLSKLCVVYCISNSCSCERLVNILRW
                     SRKLAKLPECQFKILRGEIQDKLWGTPPILLSSLQNKKGLCSEFDLATFKNWDRDMYY
                     TERLEVSKMSSASKVENIWCGNSTDAEIWKMGRFSNEVSDENGDPNNNCNNSDDNINN
                     NVDENIKGLTSSQDNATSNKIRPAYYEPSNSIVKETDLRDSVLFSIPPKSNDWRLFIN
                     CFESAQLPPLDKVVELIRIPENSPIWLTFPSSGSIGLGNLNLESIQTILNICHLLHSY
                     PQNSLLFSPDGYTETSFLLVAYLIFKLDKSLDDVIFALHTDYKRPFFLFMVDIQVLAH
                     LETLLRQYSPLRNKDRDPNIPLTIDSDTFSKIFFIKPPTNSPFLKCKGPLPSRILPHL
                     YLGSLKHAQCPEMLKKLGIKNIVSVGESVSWCRPRAHTFNEEVKVPLAQDMERRRSNS
                     LQAVPTTTNSTPNNQSTSAINITEHDGFRVCHIDNLGDNGMDPMLHQLDMVLNFIDDC
                     YKRDEKVFVHCMVGVSRSATVCIAECMKRLDCGLLKAYLYVRVRRLNIIIQPSLMFVY
                     ELLKWQELLNPSDPDIIWDWNMACRCIAQLNSNYI"
     gene            <167631..>168119
                     /gene="DPB3"
                     /locus_tag="KLMA_50078"
                     /db_xref="GeneID:34716694"
     mRNA            <167631..>168119
                     /gene="DPB3"
                     /locus_tag="KLMA_50078"
                     /product="DNA polymerase epsilon subunit C"
                     /transcript_id="XM_022820049.1"
                     /db_xref="GeneID:34716694"
     CDS             167631..168119
                     /gene="DPB3"
                     /locus_tag="KLMA_50078"
                     /codon_start=1
                     /product="DNA polymerase epsilon subunit C"
                     /protein_id="XP_022676551.1"
                     /db_xref="GeneID:34716694"
                     /translation="MDLEEYKQNLPRLPISKCKKIARTDPEYMLTSQTAFAATAFSTE
                     LFVQMLAEETCSLAQIHNKTKTLRLNYEDLSTTIRNLDKFQFLSDVVPQTENLASLVR
                     ENKVRYTIVNPSPEVDIVSEDEEDESIPDTEDQGPPAPVPAAAAAAAAESVPTQPEEV
                     QP"
     gene            <168450..>169154
                     /gene="MPM1"
                     /locus_tag="KLMA_50079"
                     /db_xref="GeneID:34716695"
     mRNA            <168450..>169154
                     /gene="MPM1"
                     /locus_tag="KLMA_50079"
                     /product="mitochondrial peculiar membrane protein 1"
                     /transcript_id="XM_022820050.1"
                     /db_xref="GeneID:34716695"
     CDS             168450..169154
                     /gene="MPM1"
                     /locus_tag="KLMA_50079"
                     /codon_start=1
                     /product="mitochondrial peculiar membrane protein 1"
                     /protein_id="XP_022676552.1"
                     /db_xref="GeneID:34716695"
                     /translation="MGLYRNSDDKDFNDGNQSDSVAFPGEVWEGLVSNGVVHDVLQGL
                     GLPGGWAFNIDKLVDDVNTGISGRTRMPTVEQFSKCNELNGLSVWDTRGLWRCLFPKS
                     VVKDNGLSREAVESDTEHKKGLFFPDYNGYLSWKSHMVKLAMEKRKRERDLYALSTPE
                     DVMLNQVDSLGKKVVGTSSYSTYKATPEGKERIKEEKTFYEDGSVLVKTDKKIYPHEG
                     QPRNESSEKLLKPGEN"
     gene            <169753..>171504
                     /gene="CPS1"
                     /locus_tag="KLMA_50080"
                     /db_xref="GeneID:34716696"
     mRNA            <169753..>171504
                     /gene="CPS1"
                     /locus_tag="KLMA_50080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820051.1"
                     /db_xref="GeneID:34716696"
     CDS             169753..171504
                     /gene="CPS1"
                     /locus_tag="KLMA_50080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676553.1"
                     /db_xref="GeneID:34716696"
                     /translation="MLKGLEKARLPNRWMHWATLLIVVLGSTNLCMYLARNHAAEKNL
                     NRFIPYCRDDYKSIAPVVSDKFIDKIAKILNDADFKEDVAKKLSGAVKVPTVIGDVFP
                     EPSSDIEYYSEFLKFHDYLESTFPLIHKHLRREKVNEIGLLYTWEGSDENLKPVLFMA
                     HQDEVLVNPETTDEWKYPPFSGYYDGENVWGRGSSDCKTTLIGELVAIEELLRDGFQP
                     QRTIILLFGFDEESGGELGTLRLSQFLQDRYGPDSIFSIMDEGMGVMEIEPGLYAAAP
                     ITQERGFGNIELSISGPGGHSSVPPKHTNVGVLSEIVYKLENTPFKYVVEDTHPFLSY
                     YQCVADFSTTVDPGFRHIIKRAATSNKYRKEFVKALEVFNPTAALTFKTTEAIDMFHS
                     GVKVNALPETGSVQINYRVGIHSNIEEVLERTTNIVNKVAQAHGYNLTVGEDNNNVIY
                     SDPSNTGSLTMKLYTTKNPSPRSPSYQDNDKVWDLFAGTIKDYFENRVFLKEKESGKP
                     PKLFITTSTMTPNTDTRHMWNLTSHIYRFQGAIFPPDLLKGVHSVNEHSSVSSVVQIA
                     GFVYEYVLNADQANLGY"
     gene            <171894..>173117
                     /gene="PAF1"
                     /locus_tag="KLMA_50081"
                     /db_xref="GeneID:34716697"
     mRNA            <171894..>173117
                     /gene="PAF1"
                     /locus_tag="KLMA_50081"
                     /product="RNA polymerase II-associated protein 1"
                     /transcript_id="XM_022820053.1"
                     /db_xref="GeneID:34716697"
     CDS             171894..173117
                     /gene="PAF1"
                     /locus_tag="KLMA_50081"
                     /codon_start=1
                     /product="RNA polymerase II-associated protein 1"
                     /protein_id="XP_022676554.1"
                     /db_xref="GeneID:34716697"
                     /translation="MSKQELIAKIRYENELPAPLLPPKIIKYENTADEDVSSSKLVTS
                     LYTKTNVTSLISVDHDLGMPLDLLTIPGVLNQQNTSGLFGYDNIKLKQEDRVLLRDPR
                     MDKVAKTDLSKVTFLRRTEYVSSATTSKADKTKRIYSELEKEETLTPEQVLEKIDSTF
                     SHTTDDIEKLHHPIKKKVKAVKTWNLLPDTVAMDQGYFAVKFVGSAALDSKEKEKYDM
                     RTALLRPVELEEDEWISVYSADKESSNKMGENLEQQIDEITHDDTVYKFKRFRDFDMK
                     QVQPENPLSDLVLRYDNEKGIVYYKPLRTKLELRRRRVNDVIRPLVREHNWDQINVVL
                     RAPTTKETKMRDAIRMRYDPIDFPALDDDENDEEEEPSNVEGNNATKVEENAAEEAEK
                     PVQSETVEAKTEESV"
     gene            <173497..>174384
                     /locus_tag="KLMA_50082"
                     /db_xref="GeneID:34716698"
     mRNA            <173497..>174384
                     /locus_tag="KLMA_50082"
                     /product="S-formylglutathione hydrolase"
                     /transcript_id="XM_022820054.1"
                     /db_xref="GeneID:34716698"
     CDS             173497..174384
                     /locus_tag="KLMA_50082"
                     /codon_start=1
                     /product="S-formylglutathione hydrolase"
                     /protein_id="XP_022676555.1"
                     /db_xref="GeneID:34716698"
                     /translation="MSLKINSTIGVCGGKLLKLSHKSQCTGTNMDVNLYLPKQYYSSK
                     EGSKLIPSILYLSGLTCTPQNASEKAFWQIQADKYGFAVIFPDTSPRGDDVDTDPEES
                     WDFGLGAGFYLNATEKPYSTHYHMYDYVHKELPEVLSKEFGSKVDFFDNISITGHSMG
                     GYGALSGFLKNINRYKSCSAFAPIVNPSVVPWGQKAFKGYLGAENKDAWAQYDPAELV
                     KKVENTSGKKILIHVGSNDPFLEKQLKPELLLDAAKNTSWEEKIELNIVDGFDHSYYF
                     ISTFVPTHAEFHAKYLGLT"
     gene            complement(<174523..>176334)
                     /gene="SAF1"
                     /locus_tag="KLMA_50083"
                     /db_xref="GeneID:34716699"
     mRNA            complement(<174523..>176334)
                     /gene="SAF1"
                     /locus_tag="KLMA_50083"
                     /product="SCF-associated factor 1"
                     /transcript_id="XM_022820055.1"
                     /db_xref="GeneID:34716699"
     CDS             complement(174523..176334)
                     /gene="SAF1"
                     /locus_tag="KLMA_50083"
                     /codon_start=1
                     /product="SCF-associated factor 1"
                     /protein_id="XP_022676556.1"
                     /db_xref="GeneID:34716699"
                     /translation="MELKNDLVSGIRECLPPDIVQLLLPYLTPKDIKNLSLTNRYFNE
                     LLDYRTSSILWHELFRKSFGDPYTNDEPFISKGSNEFHTCGETILLKTHPGQTWDKLY
                     NLRKYRSSVFTWGCVKHGRLGYTMSSNSRLSQDAINQLDRRLTFGVCKPTEIPWMLHS
                     IPISGRANSWTGAEEEEDARGSLLDDYDRSIVQISGGGFSFQILTQSGKLYSTGATYH
                     GGHNGPGPLAGERDFQPIDETIRELERSLPLIQGGPFRVLGSIGDPVRVRNPAHTTNL
                     TGAFNQHEDIYESLMRLNEISSKCLPGNEQVRRMFPKFIFNVRDPKDFQESLIESIRF
                     VAVSSGRSHFLALDSQNELYSWDGREVNHGVKLLFEGLPPRTTNPILKISCGWNCNCV
                     FIYDIGLVVWKSRDATKGIEGSAKAHYKVIPGTASVNGDSKVVDFACGSDNAVFYITN
                     EGEKLWLYSNDIEKYVDLPIEGRMVKIQASNTTLAIFTSETCYTVEIKDGEIIHSSLA
                     KIEIDANVKIISLSFGDYHVIALSDDGSVYTWGLESEMCGCLGLGNPDSIVSSGIGSF
                     ERSRSVRVKKPTKVEIDGTCVAVTAGGWQSGAIVIKD"
     gene            complement(<176715..>179324)
                     /gene="DUG2"
                     /locus_tag="KLMA_50084"
                     /db_xref="GeneID:34716700"
     mRNA            complement(<176715..>179324)
                     /gene="DUG2"
                     /locus_tag="KLMA_50084"
                     /product="probable di- and tripeptidase DUG2"
                     /transcript_id="XM_022820056.1"
                     /db_xref="GeneID:34716700"
     CDS             complement(176715..179324)
                     /gene="DUG2"
                     /locus_tag="KLMA_50084"
                     /codon_start=1
                     /product="probable di- and tripeptidase DUG2"
                     /protein_id="XP_022676557.1"
                     /db_xref="GeneID:34716700"
                     /translation="MSPPQLHKWSHDFCILSTVIFPKKKLLFAGTQDSKILCIDLSTY
                     NLIHTIYLGVSEETNTRSSVLCLTKSVDEEYLFSGGADSLVRVWSVRGGPEDYRLSVK
                     EMITIYSLMDIGDIFSLTYIDELDLVVFGSQNASLLYVANVSKHKHAQEDYAMLPHLR
                     FDKFFDSKGPQQQLIMSDKSSESLNTMKSRTLSMSNGEDESQGQILQVPSSNILPFAH
                     NGFIYSIVKLESRRDTLPVYLNVKEKTQYIISGGGDGISKVWSLQTDSNSETDHSASL
                     YLISELDNEEPVLSQYIEFPFLYVGLTDGIVKIWDLNTNQLVSTLQSDDYSDISSLAV
                     CRDHIFASQKHGITKFFQDDIYHWRGHQGSILSSQILCKGCTKNPYTRLITGGNDGSL
                     VLWNITDLVNSSQESIHSHENWETDRRNSWSATTFLDNDHMLHSLSSLVQFQTVSRKA
                     DTRQLLEGRRCATFFQQLLFKLGAKHCDLLPVKNGGNPIIYSVFSGNSKSTVERKRIV
                     WYGHYDVVAADMEDWKTDPFKLTCEDGFLKGRGVSDNKAPLLAAMYAVAQLVHNGELD
                     HDIVFIIEGQEENGSAGFKEALEENRHRFNEKIDWVILSNSYWLDENIPCLNYGLRGM
                     VNLKVSVTSDEPNRHSGFDGGVHREPTADLINIISKLQKDDGSILIPGYYDNIKSLSD
                     KELSQLNEIVERAHLHESVTVESLIAKWTRPSLSVTTMTVSGPGEPTVIPQSASVDIS
                     IRLVPGQDVDKIKESLQNYLHSCFSKLKTKNHLSIKILNEAEAWLGDPSNTAYQVIRE
                     EVAKEWGVEPLMVREGGSIPSVRYLEKTLEAPVIQIPCGQSSDKAHLPNEQLRMKNWY
                     RLRSILVRTFNRL"
     gene            <180158..>181873
                     /gene="UTP18"
                     /locus_tag="KLMA_50085"
                     /db_xref="GeneID:34716701"
     mRNA            <180158..>181873
                     /gene="UTP18"
                     /locus_tag="KLMA_50085"
                     /product="U3 small nucleolar RNA-associated protein 18"
                     /transcript_id="XM_022820057.1"
                     /db_xref="GeneID:34716701"
     CDS             180158..181873
                     /gene="UTP18"
                     /locus_tag="KLMA_50085"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 18"
                     /protein_id="XP_022676558.1"
                     /db_xref="GeneID:34716701"
                     /translation="MDHPIPPPDEEELLLSKLVFGDNTDFYNELQNVDLNVNSDEDAA
                     EYEQNSDSEASENGAENDDIGKIMDDQLFFVDDGAEAGQDADAMDIDSEDEHEDEAGY
                     DDSDEYSDEEQDAWVDSDDERLQINITETNRSKKLRTSYVESQINGRDYVQRLRSQFE
                     KIYPKPTWVEDEDDSEINDDSESDSDEYENVLNGDVNALSKILQSTYNYTEKSSKLLP
                     PKTLDITRLKDANATHPSRSAIQSLSFHPTKPILLTGGYDRTLRIYHIDGKSNHLVTS
                     VHIKGTPVQTCCFYSSQDGKEQKVFTGGRRRYMHSWDLSNNNTSVAKIDKISRLYGHQ
                     DTQRSFEKFKLAHFQDAYGNRHGLICLQGNNGWINILHASTGVWLQGCKIEGVISDFC
                     IDYKTAQHGKFITVLIAVNTYGEVWEFDLNNSGKTIRRWKDDGGVGITKIQVGGGTSI
                     YSPKQRIIQNRWIAIGSESGFVNVYDRQSDSQRPVCTLDQLTTTISSLEFSPDGQMLC
                     MASRATKDALRLVHLATGTVFSNWPTSGTPLGKVTSVMFSPQGTMLAVGNEQGKVRLW
                     RLNHY"
     gene            <182252..>182689
                     /gene="MRPL27"
                     /locus_tag="KLMA_50086"
                     /db_xref="GeneID:34716702"
     mRNA            <182252..>182689
                     /gene="MRPL27"
                     /locus_tag="KLMA_50086"
                     /product="54S ribosomal protein L27"
                     /transcript_id="XM_022820058.1"
                     /db_xref="GeneID:34716702"
     CDS             182252..182689
                     /gene="MRPL27"
                     /locus_tag="KLMA_50086"
                     /codon_start=1
                     /product="54S ribosomal protein L27"
                     /protein_id="XP_022676559.1"
                     /db_xref="GeneID:34716702"
                     /translation="MRATSPSFFQQTPLTQLTRPWKKYRDGTLFYGQSKVGNKRLPLT
                     TKDGNKSMYKGTRSSGIGRHTKFGDYKINWNRVRTYVVPKNFNTDLKPLLSHNLPELK
                     HQFTGYQKGYTDPKLYFEKLEKYVKEGKTQSEATNVDCYVERG"
     gene            complement(<183105..>184723)
                     /gene="SSH1"
                     /locus_tag="KLMA_50087"
                     /db_xref="GeneID:34716703"
     mRNA            complement(join(<183105..184549,184714..>184723))
                     /gene="SSH1"
                     /locus_tag="KLMA_50087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820059.1"
                     /db_xref="GeneID:34716703"
     CDS             complement(join(183105..184549,184714..184723))
                     /gene="SSH1"
                     /locus_tag="KLMA_50087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676560.1"
                     /db_xref="GeneID:34716703"
                     /translation="MAGFCLIDLAKPFMAFLPEIEIPYENLPFDEKVVFTLTTALIYL
                     FSQFPLAGISKESVAVKDPIFFLRGVFAAEPKTLLEFGIFPPVATALILQLLAGFKTI
                     KVNFNQRTDRELFQTLTKVISIATYAILANIFIASGYYGENLSLMAKLLINAQLIGAG
                     FFITLLVEVVDKGHGFASGSMSIVAISLSTSLVDDLFGIQQFPVDQEGHTEPRGAIIN
                     LLQGLRAKHKTFTGAIVNAFQRDYLPNLTSGLLVIVIGAAICYLQNVRNELSIRSTKA
                     RGMTNIYPIKLLYTGGLSVLFSYSLLFYIHILAFAVIQLIGGNKDGSIINKLFGGYQA
                     TEFFYVPRFPLSLLAPPTSLAALITQPLSLITFPAFLIVTGVWFATNWQDISGSSARD
                     VGKQFKEQDVALAGHRDASKELIRIIPVASATGAAALAALVSVGELLGLKGKAAGIVV
                     AVTSVFAILEIVTVEFQQNGSQSTIAQMLGGRVA"
     gene            <185394..>185678
                     /gene="AIM5"
                     /locus_tag="KLMA_50088"
                     /db_xref="GeneID:34716704"
     mRNA            <185394..>185678
                     /gene="AIM5"
                     /locus_tag="KLMA_50088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820060.1"
                     /db_xref="GeneID:34716704"
     CDS             185394..185678
                     /gene="AIM5"
                     /locus_tag="KLMA_50088"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676561.1"
                     /db_xref="GeneID:34716704"
                     /translation="MSKILKLTGFTTLSTLLGVSYYYYVIDRPIYQNTGLYKTSKQVE
                     RVIDNKAEFVYERMGLEPQLVVQRPFTETVKDIWNKEVRNTANWLYSWGR"
     gene            <186034..>186723
                     /gene="TAE1"
                     /locus_tag="KLMA_50089"
                     /db_xref="GeneID:34716705"
     mRNA            <186034..>186723
                     /gene="TAE1"
                     /locus_tag="KLMA_50089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820061.1"
                     /db_xref="GeneID:34716705"
     CDS             186034..186723
                     /gene="TAE1"
                     /locus_tag="KLMA_50089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676562.1"
                     /db_xref="GeneID:34716705"
                     /translation="MTTPDAHINYKDAIDYWTSVPATVDGVLGGYGDETPLPNMDVHG
                     SMHFVRKLKSRMIADPGAKYSCDIGAGIGRVTKNFLSKISDKVDLVEPVVPFVEQAHK
                     ELEPLKKEGKIGEIFQIGMQDWVPEENKYWLIWCQWCVGHLPDDQLVQFFERCKKGLQ
                     KNGTIVVKENNTVGEDDFDPVDSSVTRSDEKFQKLFKEAGLKMIATEKQKGLPEGLYP
                     VRMYALKPITE"
     gene            <187813..>189966
                     /gene="RGD1"
                     /locus_tag="KLMA_50090"
                     /db_xref="GeneID:34716706"
     mRNA            <187813..>189966
                     /gene="RGD1"
                     /locus_tag="KLMA_50090"
                     /product="RHO GTPase-activating protein RGD1"
                     /transcript_id="XM_022820062.1"
                     /db_xref="GeneID:34716706"
     CDS             187813..189966
                     /gene="RGD1"
                     /locus_tag="KLMA_50090"
                     /codon_start=1
                     /product="RHO GTPase-activating protein RGD1"
                     /protein_id="XP_022676563.1"
                     /db_xref="GeneID:34716706"
                     /translation="MSAVNSGEPKPENPGASSSSGSELLQREEVKKVLSSDIAINALL
                     SRLKSSLLTCEEFTKFVRKKYLYEEEHAQEMTKTTKHFFQQSGHSGLSRSIHQLLEFD
                     NKLSQVKVSYVRALQKIYDELTALLLTVTKTRKSVKERSRRLEKDVSDAIHSAEKAKS
                     RYISLCQDWEKLRLADPTKTKLTLRGSKTTKEQEEDLQRKIDNADIEYKQKVDHSNSL
                     RNTFLSRERPQIVSELTDLILEMDTAMSIQLQKYTIWTENMILNSGVSINPVDGNSKS
                     MRNAATSMNNELDLYNSLNKYNTSKSASMVNKNLIPVEYKKHPSMAKSYTSSAMGGSS
                     TFGKISGPSNFVVNTSKNSLPKRVMSTQNESPFVASSASTGLGGTVSPQNHNVQPSSA
                     SSGHSQMSSNGNSITPSSSRPLKSMVDIAIPSSAPATGYGSNTNGSSGPAPNSAPSQV
                     NNSNGSGNGISNGIGNDSNQDFPTLDPGANARQTSIAHSIATTTDTMNRPTSTVQTIG
                     SLPPGTTKDFKTFGMPLENLLDYDQDLVPAIVRQCIYVVDKYGLDLEGIYRKSANVLD
                     VSRLKSEIDKDPSNIFMILPSKNYTDSDIYLVGSLLKTFFANLPDTLMPREMTDEIKT
                     CLSIDDPTTRRNYMHGIIYKLPDGQYWTIRALIFHLKRVLEHEAQNRMGLKALCIIWG
                     PTIISPNNEDLNDVNYQISAMRLLFDVADQAFEPE"
     gene            complement(<190024..>192135)
                     /locus_tag="KLMA_50091"
                     /db_xref="GeneID:34716707"
     mRNA            complement(<190024..>192135)
                     /locus_tag="KLMA_50091"
                     /product="cullin"
                     /transcript_id="XM_022820064.1"
                     /db_xref="GeneID:34716707"
     CDS             complement(190024..192135)
                     /locus_tag="KLMA_50091"
                     /note="a subunit of E3 ubiquitin ligase) conserved domain"
                     /codon_start=1
                     /product="cullin"
                     /protein_id="XP_022676564.1"
                     /db_xref="GeneID:34716707"
                     /translation="MPPLVPEKIKSSKNKYDSLLEELKVLLSEYSAPAVNIKHDKEIY
                     ILLQKLIRYNVPKLSRTQSNTKQYVVVFKDSFISDLWDIIKKLIDELLTRDQILASIK
                     SKQLSDINMVYVTFNHNVHSLEYYTKAFLPKIFNNIESKSFSSLEEYGTIRFFQKVSE
                     IFNSNTTSIFKDFMVEAFEFPKDQQFLILKNLVAYDLPLEQTSGKLLLTDIVHANIKQ
                     FVYDRTHFEKVDTLQIHITFYCEKYPILLQSLISNTIDNLLLRFECFETFFDTCMNDP
                     MTIFCILQELGNMIKYYYPWRIEEYKSLVTKTVVKMITEQYFTSFVSFYSSSLSLSDN
                     NLANSLKDFVLVTLNSDIKNIERIAKWICKISEDYDGNSLNKLIKEFCTFLNDVFGSH
                     SKYDKLLWNIYKRKFFLRSVIKTVSLSDYTAKLNQRFDQQVIESKFLDSVHTFEIRQL
                     NEEIVYSLNIKRAPYIVPIILKHDSILDSLDSSDINGLIIPEILNDLLKVQIRFYMEL
                     DKNSHKTLSIQNHMNIIELKSPFTFGVSSTPLILLVNLLQASIFCLFNYDVHLSLSDI
                     KAKLTEDKHEIPLIDRNMEMFLEMNVFRKDENDKFYLNKRYKPKKEALNDEKLILYHL
                     PKISSTAIENDKADNKWYKELVGACIIRTLKQRKKCTKTKLFEFVAAEFPGISHGEFK
                     DALEGCKNYYTSENGNIQYIL"
     gene            complement(<192345..>194240)
                     /locus_tag="KLMA_50092"
                     /db_xref="GeneID:34716708"
     mRNA            complement(<192345..>194240)
                     /locus_tag="KLMA_50092"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820065.1"
                     /db_xref="GeneID:34716708"
     CDS             complement(192345..194240)
                     /locus_tag="KLMA_50092"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676565.1"
                     /db_xref="GeneID:34716708"
                     /translation="MGSRNKEILHWFDYRLLVNKSDSELNEKTIALRKWTNKRLKSDR
                     STFSEALLGITRNFLRNFLHYLEKDSNELDTKLDINSFNGFILRIKMRLSKLQKLFVV
                     LEQLYDKENIHIQHHSIGIQLMISFLGHKYYRHLYEIISCQLKKTIDTVQTPDNRLIT
                     LCQYFSDIGFDANYRNMVDASWIPKENPPPSRFILEILKKLVMSFDISKSILEPPVYP
                     EERLYLYMEHLNNLVISIYPEECFSICRMAYLETFANLSFYKSLVLASLSAVNITKKY
                     DKKSERIIQEEPFSSSQLANANLEITTRWLHKLMKENKNQHDLILRMLFLLTQEKDYQ
                     YQIMKNYQFVLRNSDVPRFMKLLVRHILLFHPTLKLTVVSEQDSSQVTNSILHEKEWI
                     ERISCFLQNYHLMQPFVNTFFEQYILKNLIKGTITLESIKSALTNNSFSTTQLQRFYS
                     ILKHNHSTLNKTKKLIINSATTVTQYTSGVSLNSCISLPEYLFPSISMKESVDLPFSI
                     PSKWLVSPSHDMSLLGVPVKFQNQPHLQRVLVKPWNLEKTDVLLDLNLFHAIILDTFF
                     NERPEWLLSDMIKGLEVKNVSVFRHYLSSLVNHGILIQSNDSCYSLNLKFEPNAKLLK
                     KGIIIVP"
     gene            <194493..>194876
                     /locus_tag="KLMA_50093"
                     /db_xref="GeneID:34716709"
     mRNA            <194493..>194876
                     /locus_tag="KLMA_50093"
                     /product="COMPASS component SHG1"
                     /transcript_id="XM_022820066.1"
                     /db_xref="GeneID:34716709"
     CDS             194493..194876
                     /locus_tag="KLMA_50093"
                     /codon_start=1
                     /product="COMPASS component SHG1"
                     /protein_id="XP_022676566.1"
                     /db_xref="GeneID:34716709"
                     /translation="MSNLEKSQNESLDPAKDLADAFKKEGHLDKMKNEILSQNLKDDM
                     NLEQFIREQVKKLVRSKVQEDESLVFKNRGTTTALLEGQLFKDGFKSLNTAEVDIENL
                     LDVSLNSNVLEKQIRDILEAKIDNK"
     gene            complement(<194878..>195708)
                     /gene="POP4"
                     /locus_tag="KLMA_50094"
                     /db_xref="GeneID:34716710"
     mRNA            complement(<194878..>195708)
                     /gene="POP4"
                     /locus_tag="KLMA_50094"
                     /product="RNases MRP/P 32.9 kDa subunit"
                     /transcript_id="XM_022820067.1"
                     /db_xref="GeneID:34716710"
     CDS             complement(194878..195708)
                     /gene="POP4"
                     /locus_tag="KLMA_50094"
                     /codon_start=1
                     /product="RNases MRP/P 32.9 kDa subunit"
                     /protein_id="XP_022676567.1"
                     /db_xref="GeneID:34716710"
                     /translation="MDRVQPFIEECLFTKCFDNPNKPIDENRLTQTLFLMPTDGGVAT
                     KLRKKNKLQLIPSTSGGGAPEFKQDNYRSVNKNSRVILKEYFNKCNHASRKAKNIAHS
                     LKITNRDQISKILQEKHSDIWSNLPQYDTFQAMFEDIWCPYIRELLNIPQNHKVGNAL
                     NINAQQTLLKLSMADYNGCKIRVSKSKNHCLIGIEGIVIWDAQKSFIIVTKGKITDEL
                     KSIPKKGTTFEFEIPVNEEEALSYTILGDRFKYRSVDRAGRKFKSRRCDDLLFYVNGK
                     "
     gene            <195976..>197169
                     /gene="AIM22"
                     /locus_tag="KLMA_50095"
                     /db_xref="GeneID:34716711"
     mRNA            <195976..>197169
                     /gene="AIM22"
                     /locus_tag="KLMA_50095"
                     /product="putative lipoate-protein ligase A"
                     /transcript_id="XM_022820068.1"
                     /db_xref="GeneID:34716711"
     CDS             195976..197169
                     /gene="AIM22"
                     /locus_tag="KLMA_50095"
                     /codon_start=1
                     /product="putative lipoate-protein ligase A"
                     /protein_id="XP_022676568.1"
                     /db_xref="GeneID:34716711"
                     /translation="MIKLILRPLNIASGKLFLGRARFYSSPSGQIPFEIDETDDKYKE
                     LNNYYTELFTNPNPSKQINDSNTSKSELDELNEELRSLYSVDVLTPAELETKVKSDGR
                     FLIRSTSTNPYFNLALEDYVFRHTPVNERKSGNQRLLFYTNDKCVVIGKNQNPWKELY
                     LRNVKDRGYHFLRRHSGGGAVVHDLGNVNYSYLTTRESFRREFFNQQLVKWLNNDDIN
                     LNERGDLTYKGFKISGSAFKIGRGKAYHHGTMLINSNLDEFRGLLKPDAIANVEWSCN
                     SVESVRSKVSNIGGKVVSSIDHFCSIVTNEFRVLHEDPEIPMFYCDENSSLPEIEEAM
                     DVLKSEKWQFLSGPKFSVTCNDITIKVDKGVIIESDIPQLVGQPFYKFYDEINENDEI
                     FHQLL"
     gene            complement(<197192..>199129)
                     /gene="PTR3"
                     /locus_tag="KLMA_50096"
                     /db_xref="GeneID:34716712"
     mRNA            complement(<197192..>199129)
                     /gene="PTR3"
                     /locus_tag="KLMA_50096"
                     /product="SPS-sensor component PTR3"
                     /transcript_id="XM_022820069.1"
                     /db_xref="GeneID:34716712"
     CDS             complement(197192..199129)
                     /gene="PTR3"
                     /locus_tag="KLMA_50096"
                     /codon_start=1
                     /product="SPS-sensor component PTR3"
                     /protein_id="XP_022676569.1"
                     /db_xref="GeneID:34716712"
                     /translation="MSLEQILNDIGQNLFLPSEILRSGSKLTVKYKYVGDAYMQSCGC
                     IVSEQLAKEVENLSEDCPVCHATGVRGIGPIQPLRHLYDQLRFYQSNTLSNDDIIIEQ
                     NATPMGVQRTRRPSDKSHSLLSLFLQVATKVATDDESLEKKPSSFSKESSDAQASSRI
                     SMDEQALVDSMSLDNISNSKTLPIQDNSGSVMEPPQFPISTSTLSSEYNEEKEFYFAK
                     CFPMYRKRSQFSTHSKFLRTKSKLFINNSISPDCTKFALITPNKWEVFSIPYANSGSK
                     SKEPALLFCGNSAGEYGPNFESLSMPTNLMSLKPIYNESWDASTMRTTRKKTRDNSAE
                     TALAQWEHIYCKLSNRLLVVAGTRGIFRVFDLEKGGEPIYTYCSSFPIRSVDINPITS
                     TISCGITGRDRTTGAEQALLLLHRIEFDKTSQNWLFPQPITITLPYRDPIHTLQFSSD
                     GKYLSCSTALESRFLVISLRKINEPRLVMKSLRLLDTSLESEGITDTKLFPGNPNLMC
                     VTSVAFNAPPIVINTKIESMNGVQSVAQPTMLLRLNELGSKIHKCEVSPRNDSIAFLD
                     RNGTVYMLFAPTMMDNEKRRILTVDMVSNAYRMREAASMRFSSDGHTLYILDRKGILY
                     VEDFAYALPQHPEVTKCKQIN"
     gene            <199979..>200839
                     /locus_tag="KLMA_50097"
                     /db_xref="GeneID:34716713"
     mRNA            <199979..>200839
                     /locus_tag="KLMA_50097"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820070.1"
                     /db_xref="GeneID:34716713"
     CDS             199979..200839
                     /locus_tag="KLMA_50097"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676570.1"
                     /db_xref="GeneID:34716713"
                     /translation="MQPIGLLSLLFSIVQLMCTLHAAPTTITGTSLKEKAPQHTHLVE
                     ISKMQRVVDVIGLLQALPTFDDIGKIVSKMVTFSVEQDMEAEQKRNAAPEQKGTILDC
                     LERINRTLPQHTYDVKSRLANTIELVAGLTVAETQRFGRLPTMLLRYLQFQTDKIEKS
                     TNNAKQLEYTSATIALVEAYVSVLRDPAFLDRMVEKGRSLGVNAPIGSSDELLKLLQD
                     EGIEDVPSVTLVLHLLFLFSATGILTPVVCFGSSFFKGGASVCEAFVSSITWQEFTVI
                     VEMARRLRQA"
     gene            <202326..>205058
                     /locus_tag="KLMA_50098"
                     /db_xref="GeneID:34716714"
     mRNA            <202326..>205058
                     /locus_tag="KLMA_50098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820071.1"
                     /db_xref="GeneID:34716714"
     CDS             202326..205058
                     /locus_tag="KLMA_50098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676571.1"
                     /db_xref="GeneID:34716714"
                     /translation="MRCVLACSRCRHQKIRCVNDGSAPCKYCVHKGCADQCVLTFPEA
                     WMKTVEKKAEKKAEKKAVKKARGAADKKVQKGGLPAKKKNKKMLASDIVKLEQDTGHA
                     QQLQAVHLPQGAHSNYGTPPHAQPQTFSVPSSASNGMAPPIHGTATPTSAAATSSNTT
                     TNPHAPPPMDAIFIPGVLPRINNEMLQYQSLKNNARAPVFSSIQELVASTPKTHIILA
                     VKRVETCFPECHFFHIPSIDTRLADVNPILLGALLGVCSFFTPFKYSDAKTEFNADDK
                     WLGVNSFQVKNSLYEKLALDAIFSNMLFLKKPDIEICQALILLSCVKWGHNDYFSAWM
                     LHGCGSRLVQALQFDERFQQKCKQSPLLNELRNRTFWSAFCLDRIISTGENRCFMINN
                     YEDVELPLPDSYFFGLQFDNIGTPSSNLSANRNNYNEGPFSADVHTKPSFLESQARIA
                     AANDLQLKSRVTIASFNSFYRENPLLIFQNERSVFLKSYSLWGLINEYMMQGGRAKKP
                     NEVPWDLENSTVGRITKEVEEFWSVLPNEWKWPNIDYANQRKQQTKRIFIIATINCLY
                     CLTIIFCVREYFPFLPSKEQGICGPTEPPYLPKPPYPEYWVDMSRKCFSALRELCEIL
                     EVIFETESKITRNRTGLDSNTIGDDINLTESSPFFSFCAFVCAIQCNYGTNFPFMDPD
                     SSYYNRKSGKSLSHCFKVMLKILKSREHTCPVTKNWLYMVYRVQEMYRSVANNKVTVS
                     KTQKDTVSQTNSNVENGHVQTHNYAPTQHIQSSSGLQRQDNYQLQGQAQVQAQNSQNY
                     GSSMQQNHHIPPELVTNSINHGTVDSSALNKNNTNSTIINSDSDTIFNTNIDMPRNSN
                     HFPAPYGNTSDITSGTSSNPNSTPRNPIDLEPDTDKLSLLFSDQEFEMLMQFSS"
     gene            <205573..>206439
                     /gene="RPA43"
                     /locus_tag="KLMA_50099"
                     /db_xref="GeneID:34716715"
     mRNA            <205573..>206439
                     /gene="RPA43"
                     /locus_tag="KLMA_50099"
                     /product="DNA-directed RNA polymerase I subunit RPA43"
                     /transcript_id="XM_022820072.1"
                     /db_xref="GeneID:34716715"
     CDS             205573..206439
                     /gene="RPA43"
                     /locus_tag="KLMA_50099"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I subunit RPA43"
                     /protein_id="XP_022676572.1"
                     /db_xref="GeneID:34716715"
                     /translation="MKRSAEEVKALRLIKRFKQPNRNPIDEEDGCSKCIVKVPVSMYV
                     SLAPIYQQLPKDGIMRQHLNGMVMKYNADIGGVILGFENLRIVGEEVNEEDEKLMKLT
                     PDTPFAFTWCHADFIVWQPQVGDIIEGWIFIQSASHIGLLVHDAFNASIKKNSIPNDW
                     TFIHNEETTGNDGEDSIEDKKFQSLGHWIDGNGQQLGGKLKFKVKNVYTAGRMVSLEG
                     TLLADSARASHSDVENLPVVSNKKIVFDDEVSKENTDSHKELELSVVKEDNGDEIVYE
                     KDSSESDSSDSD"
     gene            <206902..>207771
                     /gene="MTW1"
                     /locus_tag="KLMA_50100"
                     /db_xref="GeneID:34716716"
     mRNA            <206902..>207771
                     /gene="MTW1"
                     /locus_tag="KLMA_50100"
                     /product="kinetochore-associated protein MTW1"
                     /transcript_id="XM_022820073.1"
                     /db_xref="GeneID:34716716"
     CDS             206902..207771
                     /gene="MTW1"
                     /locus_tag="KLMA_50100"
                     /codon_start=1
                     /product="kinetochore-associated protein MTW1"
                     /protein_id="XP_022676573.1"
                     /db_xref="GeneID:34716716"
                     /translation="MTTPTMERTSILTEHLGYPPISLVDDIINAVNEIMYKCTNAMEK
                     YLIQRGNIDGKDFSDEIKVGTAKLESLLENSVDKNFDKLELYVLRNILSIPSDLVEEG
                     KFRLLHQENIILANVASRKQTDDSVRMKLDEISRQYELNQLLNERINNTKALLKEIVQ
                     FKTRILRLLQCEDPLTSHLHDIWNDLKPLDSAIKLITSRLKQIYLENEEFCSIDQIQR
                     LVKRYNELRNTSIVRSGYIQKKSQHILNELNISVEPVNQSNSDPNSEAVPSEYEDVPV
                     VDHPDWSSIQKAI"
     gene            complement(<208295..>209638)
                     /locus_tag="KLMA_50101"
                     /db_xref="GeneID:34716717"
     mRNA            complement(<208295..>209638)
                     /locus_tag="KLMA_50101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820075.1"
                     /db_xref="GeneID:34716717"
     CDS             complement(208295..209638)
                     /locus_tag="KLMA_50101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676574.1"
                     /db_xref="GeneID:34716717"
                     /translation="MEFNSPRPEHAQLQGPGTVVHPKGTSAILSTLNNRILASSTNRN
                     STDTTAGTNSNNNGSNIDIINTSVDHANTNRTGNNGNQNKNNNHLPENTASRDVILGD
                     GFTLVAPRPVNGRDASLYEPIDEYLIPSPPLSPMEGDAQTYTQHVPRCSSTNDGSIVG
                     RSTDVEQAVTEDQPRTIAIKDNKNNNGIVVKGVWDNYASNGGSKRYQLHINAFLSQYK
                     VLKPMFSRSNRSGSSGSASTRYTRRTRTSNKTYASNSDFEKVYRTRRATSGTASAKQG
                     ESSDESPAVPYVSRSVTPVPRKKVVQHHPSPLSHSSISHHHPTNHHHHTVSMSWEKLP
                     DYSPPLDTLPNNNKCLKVDWKGSSMDLSNDPLKHKLHPAELVLAQILRLPCDLYLDSK
                     RRFFMEKVHRLKQGMPFRRTDAQKACRIDVNKASRLFAAYEKIGWLQDSHFKKFL"
     gene            complement(<211048..>213192)
                     /gene="TEA1"
                     /locus_tag="KLMA_50102"
                     /db_xref="GeneID:34716718"
     mRNA            complement(<211048..>213192)
                     /gene="TEA1"
                     /locus_tag="KLMA_50102"
                     /product="TY1 enhancer activator"
                     /transcript_id="XM_022820076.1"
                     /db_xref="GeneID:34716718"
     CDS             complement(211048..213192)
                     /gene="TEA1"
                     /locus_tag="KLMA_50102"
                     /codon_start=1
                     /product="TY1 enhancer activator"
                     /protein_id="XP_022676575.1"
                     /db_xref="GeneID:34716718"
                     /translation="MVKPQKGTFINHDIKSNENKPASKPPVKRLACANCRRRRRKCDL
                     NYPCGRCVEFKLECNINDVDLRKKRYNLTYVKNLEDHVAQMELRLRQFAKRAEELLPD
                     DAGGAKKLMVNDILSCVSPMPSEDINGTTNEVSNSINNKDSYVFSRMQSPSTDADIEN
                     SVNIKEEKSVTMSKGSSSSLSNDSSLSNNNHDVLRNKKFVKGSIYPEGPTSYKKRNRE
                     KSTKAQPSQRIGDLKSTVIVRNHSDPNSGRLNSDPEIIQSLSNFYKWLYPGNFIFVHR
                     ESFLYGFFNHNEETYDNSQYCSEELIYSVAAIGSRLSKDLHHLSEQYYEIAKSRLLKI
                     VFDEQSIAKITTVQALLCLAFYELGNGENQLAWYFSGLAIRVGYDMGFQLDPKVWITD
                     DSIHDNQELSDSELEIRSRIYWGCYIADHFICLILGRAPSLTVSNSTVPESDELPEIE
                     GTEDFRYESQTVLQVSQPLKNLMILSRIIQIFTSKIFIEPNTTAKRIEYLKKFNLKVA
                     NWRQSLPEFLKWSKVLVQSVELSTDPTVSYFWYHYYIVLITFNKPFMEDCEEAKTVIL
                     DLLQDLKTLLNNLKLKFNNSLERATLYHLYTCLLSISCFQKLMSMGPDPAVKATFPNL
                     KFELHWFKSVFHEFSNIYDLPNKIEEEDLELEHQQDPSLQTHLGYHGFQGFQGFHQMN
                     NTHDFSLSDEIDDLIKQVFGFDHWNINPSYQV"
     gene            complement(<213669..>217421)
                     /gene="KRE5"
                     /locus_tag="KLMA_50103"
                     /db_xref="GeneID:34716719"
     mRNA            complement(<213669..>217421)
                     /gene="KRE5"
                     /locus_tag="KLMA_50103"
                     /product="killer toxin-resistance protein 5"
                     /transcript_id="XM_022820077.1"
                     /db_xref="GeneID:34716719"
     CDS             complement(213669..217421)
                     /gene="KRE5"
                     /locus_tag="KLMA_50103"
                     /codon_start=1
                     /product="killer toxin-resistance protein 5"
                     /protein_id="XP_022676576.1"
                     /db_xref="GeneID:34716719"
                     /translation="MRQFCSQVVVIILFLLHATRGLEIGVSKLWLSTSIVGRETLSDT
                     QWMNLYHDLIFGEEDADEEYDFIDDGDENKSTDLDSSNQVQSIRDLLYVIAEHEDFAP
                     YDEKYNETCLILNHKKYSKSDDSFYFKTSELEAQAAMGDFELLAENEITIGTNSSAPI
                     VILYGCETDLEFDDFNRNLFNEAKFGKIRMVWRPTCAIGEKSTYAYSETIPEALWGKE
                     VKLENKIDIAGKKLPTVAKLEFLNQQQLEKLDIKFTALLLQKYEELNDFEKFFEYFKT
                     LVSNFPAIAPIIASKSDIDTASAEALYNKFKERQISHELLGLYVNGQQWRLTELDEVT
                     LPKIIAEEYTKTNDLKEKLQNFGDVNLEKFLRYLTVGYSFTSFFDKNRYDFYRVPGFS
                     EAVIFFNDFEKDKMYEKLPDQNDAFLGPSDFEPIPNIRQNWNELIFIINLDDPQSFEE
                     HGAVNAFLEALEQMKTGYPVRLGLIPFSAQRSNHAVNQLYELKSKPGSLKKVKTYLKK
                     LVRKPEIITKTTDEKSDQCNDFLERFKISNTVVVMNGVILPFQQKAWKIHTSRILFDD
                     IEYLKREVRSMAKRNDLSVRQILHHRSLTIRNTKYLPNRMLDESFTRINNAALGELGE
                     RMIFYAGSKKPSPIHTVTIVDDFNAEGAIQKLEALLKNNHKGVAIRLVHMGALTKQWK
                     IIRTEFSSGRLPNRKSYNKNCAFQSESYLNDLKSWLPDVPIDALRKPFVVINGKFFNT
                     DQDLSSVELWHNILVQHSSKTLDTLNTLYRIGNLGSSEVDTSHIEELTASVIKYVYHS
                     VLVFDNGIPYTTEASLPRVSLFELGDQMIKKAVEYPVVNITLLLDPAEERTQRLLYLT
                     SLIKDLPFVKTEFALIPTSNLTMNPIYRFYNTSVETKKGRFESEIEHPHNFKADSDSI
                     ILEAHVFDENDEVSVNSVEGVPNVCIKLVDSEGNVIDKAISMTSFGYTQLSIPHFMRG
                     MTIQSCDSEYTVTSFSTAGTSNYIESKQIDVTNTLPTKVYVKVKKTTNESAVLDDSKV
                     NIMMVIHDGQESLAVAKIAKIKKESQDKMKFYILAKNPKLLAKMIPKSTDYELLNYAW
                     PLWLRPQRFSEQELEAKSILLLDTILPKSIQKLVFISLKDDSLDNISLNDLSKYSEGV
                     FYLREAKTEHDSYWKSGYWKTYLEKYDLPFYNLSASYVVNMQQLRRLDAASTLRLHYH
                     LLSKSFTSLMNFKSDLLNSIQLKIPIISLNSVSKQGNAQGLEHDEL"
     gene            <217983..>220853
                     /gene="ALA1"
                     /locus_tag="KLMA_50104"
                     /db_xref="GeneID:34716720"
     mRNA            <217983..>220853
                     /gene="ALA1"
                     /locus_tag="KLMA_50104"
                     /product="alanyl-tRNA synthetase"
                     /transcript_id="XM_022820078.1"
                     /db_xref="GeneID:34716720"
     CDS             217983..220853
                     /gene="ALA1"
                     /locus_tag="KLMA_50104"
                     /codon_start=1
                     /product="alanyl-tRNA synthetase"
                     /protein_id="XP_022676577.1"
                     /db_xref="GeneID:34716720"
                     /translation="MTIGDKAKWTATNVRSTFLDYFKSKGHTFVPSSPVIPYDDPTLL
                     FANAGMNQYKPIFLGTVDPSSDFYKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFF
                     EMLGNWSFGDYFKKEAIEYSWELLTKVYGIPGDRLYVTYFEGDEKLGLEPDFEARDLW
                     KAVGVADDHILPGNAKDNFWEMGEQGPCGPCSEVHYDRIGGRNASSLVNQDDPDVLEI
                     WNNVFIQFNREQDGSLRPLPAKHVDTGMGFERLVSVLHDVRSNYDTDVFEPLFKRIQE
                     ITGVRPYSGKFGAEDVDGIDTAYRVLADHVRTLTFALADGGVPNNEGRGYVLRRILRR
                     GARYARKYMNYPIGNFFSQLSVTLIEQVKDMFPEVAKDPSYLFEILDEEEASFAKTLD
                     RGEKLFEKYAEETMKKSDKTLDGKQVWRLYDTYGFPVDLTELMAEEQGLKIDTEGFEK
                     AKKESYEASKQGGKKGTSNLIKLNVHELSQLNESNVPKTDDSFKYGTENIEATILRIH
                     DGEAFVDSMTEVGKQYGIVLDKTCFYAEQGGQEYDTGKIVIDGQAEFNVENVQVYNGY
                     VFHTGILGDGELSTGDKIIASYEELRRHPLRNNHTGTHILNFALKEVLGNDVDQKGSL
                     VAPEKLRFDFSHKRALSYEELVDVEKITNEKIKENLTVYYKDVALDLAKTISSVRAVF
                     GETYPDPVRVVSVGKPVDEILENPSSEEWSKYSVEFCGGTHVSKTGDIKEFVIVEESG
                     IAKGIRRIVAVSGPEAYEVQRVAVEFDGELDAVDKLPFSALKAQKVKELGVRLGQLNI
                     SVISKTDLKEKFNKIEKEVKDEMKVRAKKEIKQTVDDVKQYFEENKDASFYVKHIDIP
                     TNAKAITEAINHIKTNLKDKSIYLFTGNDANGKVAHGCYISDAAISKGVDGSSLAKKV
                     SANIGGKAGGKGNVFQGMGDKPSSIDSAISEVSDLLKEKLTI"
     gene            <221308..>221796
                     /gene="POP5"
                     /locus_tag="KLMA_50105"
                     /db_xref="GeneID:34716721"
     mRNA            <221308..>221796
                     /gene="POP5"
                     /locus_tag="KLMA_50105"
                     /product="ribonucleases P/MRP protein subunit POP5"
                     /transcript_id="XM_022820079.1"
                     /db_xref="GeneID:34716721"
     CDS             221308..221796
                     /gene="POP5"
                     /locus_tag="KLMA_50105"
                     /codon_start=1
                     /product="ribonucleases P/MRP protein subunit POP5"
                     /protein_id="XP_022676578.1"
                     /db_xref="GeneID:34716721"
                     /translation="MVRLKSRYILFEILYPTTGEKFESVPNTQKKTILMNHHRISPNT
                     INAKIILQELRKQLQINFGDYGAGKATSLLQIKYFSNKTSTGIIRCSHEDHQLVIVAL
                     TLMNQLDSVEDIIVNPIKVSGTIKKIELYAINRSRRLNRILSTTDRNDEFSTIIEDDI
                     DD"
     gene            complement(<221837..>223162)
                     /gene="PRP45"
                     /locus_tag="KLMA_50106"
                     /db_xref="GeneID:34716722"
     mRNA            complement(<221837..>223162)
                     /gene="PRP45"
                     /locus_tag="KLMA_50106"
                     /product="pre-mRNA-processing protein 45"
                     /transcript_id="XM_022820080.1"
                     /db_xref="GeneID:34716722"
     CDS             complement(221837..223162)
                     /gene="PRP45"
                     /locus_tag="KLMA_50106"
                     /codon_start=1
                     /product="pre-mRNA-processing protein 45"
                     /protein_id="XP_022676579.1"
                     /db_xref="GeneID:34716722"
                     /translation="MNVPRSQDMLSKPFSSLLPPPKHVDTEKKSLTVNGSNKSKKDTV
                     ILDSLRPENLPVASISDFVPLRQRDLSLEIPLPTVDEIKRTYNRTKVVLDKLIRKKLN
                     PQLVKTTASHNNSREEVISSLNSSSGKREVKIIEHRKDPLQPVTHRKRKVVAPNEEIQ
                     APILHKTDDSTTKPTKEDVDKWRIPSAISNWKNPKGFAISLENRVTIESKGDEQASTA
                     NEKLLQLSEALDEAEKQARENINLKQEAKKELEEQELLRKEQLLQNLAERARQSHRED
                     HRRQYENEDHYIRERERSERIRAKRDEERSSRMSTAEKLRRLAHQQGRDVSEKVVLNA
                     AKATKVSDVQYDSRLFTKAATSSVSSTHQTYDSPLFSATQIDNIYRPPAGSNEETSDI
                     VDRITNKRGRTGPVEFSSADDSKAPEAEADDEEQIKEYGLHLRKKPHNN"
     gene            complement(<223385..>225664)
                     /gene="GIP4"
                     /locus_tag="KLMA_50107"
                     /db_xref="GeneID:34716723"
     mRNA            complement(<223385..>225664)
                     /gene="GIP4"
                     /locus_tag="KLMA_50107"
                     /product="GLC7-interacting protein 4"
                     /transcript_id="XM_022820081.1"
                     /db_xref="GeneID:34716723"
     CDS             complement(223385..225664)
                     /gene="GIP4"
                     /locus_tag="KLMA_50107"
                     /codon_start=1
                     /product="GLC7-interacting protein 4"
                     /protein_id="XP_022676580.1"
                     /db_xref="GeneID:34716723"
                     /translation="MLAKAAASASSPMVQGGVSLDFTDIKCLQHSTSIWKLKQLIHVC
                     KMLNRTLELKKSENLVPLTNIVIALATGFHFNVSAVIEKRIEILSQFKQCKQGTVSAP
                     LVPSALKIDVRLAPVEEDIGVYVGKVYDKELQSQLLLSLQHVAENALQIYQSKVKQLI
                     VERNSNRPTDISGRVVSLDENAFDDLLFPHELMFGLDLLANLRDKSKDTTSAAFFSLA
                     LSILDKFKSNLNEKCLPPIRLYYTTMMKFTKTKGLYSTNVLIRLPYWQFTMHRIYTAS
                     LRNKSLIDVIRAVLRQIYLPNKSHFHDEFVKLHSQNLHEYLELLEQLDEFCTSQTLEK
                     ELVENFKQYSNQNSVYHVHFSNIQNAYQSLLLKSVQILRRATKLVDTFTSQWKAISNS
                     MKNIDFDNLSGAELTKMVSEKLEVDKLAYSEKQSNLNNNNINNHLGIDSNSEQRSGFS
                     SSSSSSSINASPSVLSPVTLSRTPSMSKSDISKSPSSPIPFVDASESPQEIKQTPVRR
                     RNRSSSLQSENQSNGRASTATSLRNNMRSNSLQTGSANTQRLVQNAYSKALSSLNDKR
                     SPLLTPAKSLAAKPKPSSPIITRQNSVKARNKMNSSKLNEVNESMNNLRLDEETLIIS
                     QESLSSDTNDGIKNPDIIVSGADENDSMLSSSETPSESTIKKVRFTGVPPMTPDEDPE
                     PKRRGWYKKPAVLHYPTPPAQFSLQKSRLSQEGLAFRTSLIARDQAAERKFGYETAYP
                     SHQGTGTKMVNKIKDKLIR"
     gene            complement(<226036..>227376)
                     /gene="MRS2"
                     /locus_tag="KLMA_50108"
                     /db_xref="GeneID:34716724"
     mRNA            complement(<226036..>227376)
                     /gene="MRS2"
                     /locus_tag="KLMA_50108"
                     /product="mitochondrial inner membrane magnesium
                     transporter mrs2"
                     /transcript_id="XM_022820082.1"
                     /db_xref="GeneID:34716724"
     CDS             complement(226036..227376)
                     /gene="MRS2"
                     /locus_tag="KLMA_50108"
                     /codon_start=1
                     /product="mitochondrial inner membrane magnesium
                     transporter mrs2"
                     /protein_id="XP_022676581.1"
                     /db_xref="GeneID:34716724"
                     /translation="MSSVLGRLTRDVQSHLRYTSKTLRHHLRWNSSQTTPFKPIAAAQ
                     HPFLVKPVTPHESYVSCTIFNERGDVTAVSHKFPKWEFLQKYGLYPRDLRKIDSSSID
                     VIPSFVIKPKCILVNLLHIKAMIQKDKVFVFDTANPDAATKLGVLMYDLESKLSQRNA
                     THQGKSISYQENYEHRALESILINVMTCLETEYKYHHSVCGMILNDLENQIDRDKLRD
                     LLIKSKNLTAFAQKSVLLRDLLDELLESDEDLAGMYLSEKKLPDADDHSDLEMLLETY
                     YKQCDEYVQQSEALIQDIKSTEEIVNIILDANRNSLLLFELKVTVYTLGFTVATLVPA
                     FYGMNLKNFIEESNWGFASVVGVSTLAALLVTISNMRALRSVTRLTLLNNHTGAHNTK
                     HLANAKMALDKEIPTFWSRWKTSAKVLWSGREVLYKDGSKRDMIWKWLVDDDKK"
     gene            complement(<227761..>228450)
                     /gene="VMA4"
                     /locus_tag="KLMA_50109"
                     /db_xref="GeneID:34716725"
     mRNA            complement(<227761..>228450)
                     /gene="VMA4"
                     /locus_tag="KLMA_50109"
                     /product="v-type proton ATPase subunit E"
                     /transcript_id="XM_022820083.1"
                     /db_xref="GeneID:34716725"
     CDS             complement(227761..228450)
                     /gene="VMA4"
                     /locus_tag="KLMA_50109"
                     /codon_start=1
                     /product="v-type proton ATPase subunit E"
                     /protein_id="XP_022676582.1"
                     /db_xref="GeneID:34716725"
                     /translation="MSTITALSPNQVNDELQKMQAFIKKEAEEKAREIELKAQQEYEI
                     EKTGLVRNETSAIDTNIAARMKKAALKQQIVKSTIANKMRLKVLGTREEVLDEIFEKA
                     KAELKKISSNKKEYKPVLHALVLESLLKLLEPKAVVKVREADVEVVNSLLEEVTKEYE
                     ERTGKQVSLTVSEDYLNKDIAGGVIVSNGNGKIEVNNTLEERLKLLSEESLPAIRLEL
                     FGPSKTRKFFD"
     gene            <229328..>232927
                     /gene="MIP1"
                     /locus_tag="KLMA_50110"
                     /db_xref="GeneID:34716726"
     mRNA            <229328..>232927
                     /gene="MIP1"
                     /locus_tag="KLMA_50110"
                     /product="DNA polymerase gamma"
                     /transcript_id="XM_022820084.1"
                     /db_xref="GeneID:34716726"
     CDS             229328..232927
                     /gene="MIP1"
                     /locus_tag="KLMA_50110"
                     /codon_start=1
                     /product="DNA polymerase gamma"
                     /protein_id="XP_022676583.1"
                     /db_xref="GeneID:34716726"
                     /translation="MKARNYYGSRLRGCNVRTIRYFYRSVSLKAEEPRINPVGIQYLS
                     KSLHEQIFPSKDKYNKFFDNEEKQELVKLSKSFLKNHDLLGKPTNITEPISFQLPKLQ
                     GEVLDEHFQKLGHFASEPYRSMCDKKFKKILPKPKTWLRKPGWYRYEPGKAPESVPYP
                     QEDTLVFDVEVLYKISDFPTLAVALSDKAWYLWCSPFICDTADSDNVKHLIPMNTLER
                     PKLIIGHNIGYDRSKVLEEYNFVPSKAFFIDTMSLHVASSGMCSRQRPVYVKKQKRDE
                     EIAELNAENSSLPPISDVDEDSPWLHKSATNSLKEVARFHCNIKMSKEARDTFATLDK
                     YEIINKFQDMVEYCVSDVEITSKVFDSVFPKFIQKCPHPVSFGALRFLSSSILPTRVE
                     KWQQYLKSSESLFQDNKTKIEEKIIEIVEEVAALKDKPEVFENDPWLKQLDWTIKPIR
                     YNKKGELVKNQKLPGLPEWYRSLFPSKSSTKPNITIRTRQVPLFFKLTWEDCPVVWTA
                     SQGWCFRCDNSRIAEIETKNYDKAKEVDDYQEENTTLFRIPHPNGPDFNCSTLLSKPF
                     IHFFEKGILKSQSKLAHDALQINAAGAYWMSARERIMSQHVVSAKDFKSEFKTSASTS
                     EKDEDIGIILPKLVPMGTVTRRSVENTWLTASNAKKNRIGSELKCNVVAPPGYVFVGA
                     DVDSEELWIASLVGDSIFDVHGGTAIGWMCLEGTKSLGTDLHSKTAQILGCSRDEAKI
                     FNYGRIYGAGVKFAAQLLKKFNPSISEQEARKTAEKLYASTKGKKQRSSIFKTFWYGG
                     SESILFNKLESIAEQDEPKTPVLGAGITFSLMKKYLGKDTFLPSRINWVIQSSGVDYL
                     HILCCSMNYLIEKYSIDARLMISIHDEIRYLVSEKDKYRLALALQISNLWTRAYFSEQ
                     MCINDLPQNCAFFSAVDVDKVMRKEVNMDCVTPSNPNPIPHGESLEIHDILKITGGEL
                     GKSNDEIDVSKFPYTFRESVFRQYNRKYSKEFLKYSLQMQVQMKKYRVEQIETDYIRS
                     LEESRLSKLNADDEVKSVADYVQGLKLQNNKNKPSIMSDSVMYGGKDPVSTLEEDKNS
                     ERETSTLKKIISSNSTGSIRYRQRTEKTTANSPPQKMDSEMISTIVAEALMETPPEVK
                     IKSGKAKTAKKKKINSKTEKILKERSVSTKTQMASSILTNRSSKYGNTNRSVG"
     gene            <233315..>235468
                     /gene="SCD5"
                     /locus_tag="KLMA_50111"
                     /db_xref="GeneID:34716727"
     mRNA            <233315..>235468
                     /gene="SCD5"
                     /locus_tag="KLMA_50111"
                     /product="protein SCD5"
                     /transcript_id="XM_022820086.1"
                     /db_xref="GeneID:34716727"
     CDS             233315..235468
                     /gene="SCD5"
                     /locus_tag="KLMA_50111"
                     /codon_start=1
                     /product="protein SCD5"
                     /protein_id="XP_022676584.1"
                     /db_xref="GeneID:34716727"
                     /translation="MSFDWLNVPGLNISNDAQTSVQGSSPPPTVSFSFDTSDHSEETQ
                     QAKKTSVNQLRKVSHDDSLTVSGSTGNFQDTSSLKVAKTDATLHSQSESDIASTYVEP
                     PQELQVPLAIPKYQLTPEERKAYLRWFNDLHTRIRSKQITLDDVFNFLANFKLDETIK
                     ERISRIFRTCRYALNEEQFFAVVRLAAHALQQRLLPTRSMILEKAPVLKPKSILSATA
                     GQEVYEEVEEDPNNDADKKVDFDGFASLLLTGKTVRKNIRRRIMKRRDQIKKVRFSQN
                     LVTFEDEPTTISDGTGTNSQQQGVTSQSDESTAPGANSSDDSSLDLSLPMEQLLLKLS
                     SRNRNNSALVKELPSDSQPETQEEREVLEDMKDSLSHFRQIQKVDNVTQLPDEIPNSI
                     KFSSPGNENQPLEPLKPTATGSANHLFRQTVPPTQQNIGAGSSILGNSNGLQPLKPTA
                     TGSANEIFKNIFMQNNNTSPQNQQAKPLEPLKPTSTGSANYLMKQQFQDFQEFQPFQS
                     AVPSRRQSQPLPQQHQLQQLQSQSLQPPQSQSNQPYLSPQQTAQQAQQAQPPQPPQQP
                     QLQNHQQYLSPQPSNSAFQLQPQGSFMQPSSGALVSSPQPQLSSDGYFRSLMAGSPSL
                     MQGSSPQPQNISNQSGMQPRYPQQPAEFHTTPYHPQQHRLSLPSQMPMGSNQPLTNIS
                     PQNTITNSDNILNDLKALQQQVDQLHQTYNYDVRR"
     gene            <235989..>236463
                     /gene="SNC2"
                     /locus_tag="KLMA_50112"
                     /db_xref="GeneID:34716728"
     mRNA            join(<235989..236072,236215..>236463)
                     /gene="SNC2"
                     /locus_tag="KLMA_50112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820087.1"
                     /db_xref="GeneID:34716728"
     CDS             join(235989..236072,236215..236463)
                     /gene="SNC2"
                     /locus_tag="KLMA_50112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676585.1"
                     /db_xref="GeneID:34716728"
                     /translation="MSSSVPYDPYVPANEEREADSKTAALKSEIDDTVDIMRDNINKV
                     AERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRMCLALVIIILLIVII
                     VPIAVHFS"
     gene            complement(<237158..>241816)
                     /gene="MYO2"
                     /locus_tag="KLMA_50113"
                     /db_xref="GeneID:34716729"
     mRNA            complement(<237158..>241816)
                     /gene="MYO2"
                     /locus_tag="KLMA_50113"
                     /product="myosin-2"
                     /transcript_id="XM_022820088.1"
                     /db_xref="GeneID:34716729"
     CDS             complement(237158..241816)
                     /gene="MYO2"
                     /locus_tag="KLMA_50113"
                     /codon_start=1
                     /product="myosin-2"
                     /protein_id="XP_022676586.1"
                     /db_xref="GeneID:34716729"
                     /translation="MPYEVGTRCWYPSKEQGWTGAEISKHEVQGDKFRLELTLENGEK
                     VDLLVSSLDEAKEPSLPLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTY
                     SGIVLIATNPFDRVDQLYSQEMIQAYAGKRRGELDPHLFAIAEEAYRLMKTTNENQTI
                     IVSGESGAGKTVSAKYIMRYFASVEENNEENAHHNPEMSETEKRILATNPIMEAFGNA
                     KTTRNDNSSRFGKYLEILFDDETSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILS
                     GLSDEEKSQLKLTKVEDYHYMNQGGDYHIQGIDDAEEYRSTVDALTMVGIEKETQFQL
                     FKILAALLHIGNIEIKKVRNDASLTSDEPNLQIAAELLGIDASEFSRWVTKKQIITRS
                     EKIVSNLSYHQAIVSRDSVAKFIYSALFDWLVDNINKVLCNPEVVNEINTFIGVLDIY
                     GFEHFKKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEQIEWSFIEFNDNQPCID
                     LIENKLGILSLLDEESRLPAGTDEGWTHKLYETLDKPPTNKVFSKPRFGETQFVVSHY
                     ALDVTYDVEGFIEKNRDTVSDGHMEVLKSSKNETLLSILETIDKNAEKLAKQQAEKQE
                     SQKKPGPVARKIIRKPTLGSMFKQSLIELMETINSTNVHYIRCIKPNEDKEAWKFDNL
                     MVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHILIPSEYWSNILQSDPSEDDVK
                     NLCKEILKRTMDDVSKYQTGNTKIFFKAGMLAHLEKLRSDKLYVSSVLIQKKIKGVHY
                     RRRYLETVSAIRSLQSASRGLLIRQSVDHEFKTNCSLLIQSTYRGISVRKNVSSTILG
                     IIRIQSLARRKITKDALLERRKNDAAIFIQKKLRSFQPRKQYIHERKSSVTIQSFIRK
                     HYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLAAKVRENKDLASRLEELQQS
                     LNESENIKKLLETEKETHSRVLNDQKSLHQEEFGKVNTELLAAKEEITSAKLEIEELQ
                     KKQKELKDEVASTLEQLNATRLELSTSQTENVDLKKEISSLKEKIARLQSSGRAGGIN
                     VGANAMNSTPVKNRRFSSHSALNDASSPKQLNVVSINNSFNTDDVSNLMSKINDELYK
                     MFEDSRSLNTEIIEGLLKGGKVPPTGVSIDLTRKEVLYPARVLIIILSDMWRLGLTKQ
                     SETFLAEVLETIQKIISSLKPEVMIEHGAFWFTNVRELHSFVVFAYESITTDETYNSG
                     MNEEEYNEYVNLVKELKDDFEALSFNVYNLWMKKLRKYLEKIAVPAVVVSQALPGFVV
                     PEPSQFLQKFLQSSSVYKMDDVLTFFNNIYWAMKSYDIEMEVFDEVITNLLRLLDALC
                     FNDLILRKGFLSWKRGLQLNYNVTRIEEWCKSHHIPEASVCLQHILQAAKLLQLKKRV
                     IADIDIIWDVCNSLKPIQIKQLITQYSVADYEEPIAPEILQYVAEKVRNDSSKADGGN
                     NDVFLPVDVGPFDDPYQKIEVRAFGQIEAYIPAWLNLPNTRRIVELVTQYVAVQEQAE
                     "
     gene            <242968..>244371
                     /locus_tag="KLMA_50114"
                     /db_xref="GeneID:34716730"
     mRNA            <242968..>244371
                     /locus_tag="KLMA_50114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820089.1"
                     /db_xref="GeneID:34716730"
     CDS             242968..244371
                     /locus_tag="KLMA_50114"
                     /note="Ras-like GTPase superfamily conserved domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676587.1"
                     /db_xref="GeneID:34716730"
                     /translation="MYVRSREYPDKLGSQPNALFNGLLTRQQELDSLRNPRDAKYRRR
                     SELTGLTSVTGQHPLKMKGDLDQDGGYYTHQPQPQHQQHQHQQPQNRLSVNMDADSGP
                     EYDNRMNIVVTNSDDDSITCGSSRFSEALLGGSHLLSSEYESNRNSYSMGPVSTSVSR
                     PRSSNSSLGHLKNPSFSNISVSSLPSHKRMHSNMLHLAPLRQEQASSSESLHSKGNQL
                     AKQFLETATKTAHNKEPTVPASAASTNGYSDSSGMAEFVSTGFIEKLFPMGKTSNTAG
                     PREGKEDLDRKKPTEHMSVDFMKHIEMNLTAVESRLKHFLKDSIRSQELEMNQKVSQL
                     QTLSGVVQKLHTDIKGIRTSSKTQLNELKAKFDSSDPDSFITSLTKLVENHVSRLETM
                     EKRTTDIQSELEAKKQQLRKLENLIKVNDMINDFKRNMKLSEKLKESCGTLGDIFVLG
                     FTFLLIVYLFKRWFASE"
     gene            <244617..>245578
                     /gene="SAW1"
                     /locus_tag="KLMA_50115"
                     /db_xref="GeneID:34716731"
     mRNA            join(<244617..244627,244708..>245578)
                     /gene="SAW1"
                     /locus_tag="KLMA_50115"
                     /product="single-strand annealing weakened protein 1"
                     /transcript_id="XM_022820090.1"
                     /db_xref="GeneID:34716731"
     CDS             join(244617..244627,244708..245578)
                     /gene="SAW1"
                     /locus_tag="KLMA_50115"
                     /codon_start=1
                     /product="single-strand annealing weakened protein 1"
                     /protein_id="XP_022676588.1"
                     /db_xref="GeneID:34716731"
                     /translation="MAPTSALIQINSRCVLSVRIFINRNKILKGITNSDTIFEAPILS
                     NNSIVRLKSPSIRLLLSNEDMKSLTYEIRDSLLFILYELCSPLLEEQVLNKLKVGTFM
                     DFSDVLQILRKGSKLSSNSTDLNNCIDGIDVHIVSIERTGKKRYKLHFSSKWKLDIII
                     EDIDKLSHWRKLLVLLDSIQSVPSSTQNIPLFIPFKSTNVLVRSRQQLSHTTEKNEGK
                     TTDSRILVESDEEAPLPPFQEEEQNDIHSSQDSEIGGKKDNKKPIFDYQYKGMRLFDK
                     CISIHVLQRPKRIKKNR"
     gene            <246017..>247360
                     /gene="PRO2"
                     /locus_tag="KLMA_50117"
                     /db_xref="GeneID:34716732"
     mRNA            <246017..>247360
                     /gene="PRO2"
                     /locus_tag="KLMA_50117"
                     /product="gamma-glutamyl phosphate reductase"
                     /transcript_id="XM_022820091.1"
                     /db_xref="GeneID:34716732"
     CDS             246017..247360
                     /gene="PRO2"
                     /locus_tag="KLMA_50117"
                     /codon_start=1
                     /product="gamma-glutamyl phosphate reductase"
                     /protein_id="XP_022676589.1"
                     /db_xref="GeneID:34716732"
                     /translation="MSVSENIAKTARAAGNILKTLSDEDRSAILYKIHDGLKANASSI
                     EKANKLDLEHAKAVNLSDSLVKRLDLFKGDKFDTMLQGIIDVAKLQDPVGKVNFAREL
                     DENLTLYQVTAPVGVLLVIFESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSR
                     IINSVISNNVETCHVPEGAIQLIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSST
                     KIPVLGHADGICSIYVDESADLEKAKRILVDAKTNYPAGCNAVETLLINPKLQNWWEV
                     LDALIENGVTLHLSDEVKKSYSEHHDISEHVVNLDESVDFDKEFLSLDIAVTFINSVK
                     EAVSHINSHSSKHTDAIVTENSENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVG
                     ISTSKIHARGPVGLDGLVTYQYQLRGNGQVASDYLGAGGKKAFIHKNLDVKGITI"
     gene            complement(<247436..>251416)
                     /gene="DRS2"
                     /locus_tag="KLMA_50118"
                     /db_xref="GeneID:34716733"
     mRNA            complement(<247436..>251416)
                     /gene="DRS2"
                     /locus_tag="KLMA_50118"
                     /product="probable phospholipid-transporting ATPase DRS2"
                     /transcript_id="XM_022820092.1"
                     /db_xref="GeneID:34716733"
     CDS             complement(247436..251416)
                     /gene="DRS2"
                     /locus_tag="KLMA_50118"
                     /codon_start=1
                     /product="probable phospholipid-transporting ATPase DRS2"
                     /protein_id="XP_022676590.1"
                     /db_xref="GeneID:34716733"
                     /translation="MTEPRRHDNDNTLFDVDFLDDDYTPDLSGNPGRSNSAAVIDSDM
                     DGHANFQLGSIPQETIDLNDSDRIENDIDNPFNDRYSSTFLSSNPRGSVLPQPSGFSR
                     FMNSVKGSIGMNNANKGGFQSFEMDDYHETNNNRYEESKSKFDIKVLFNKYILRKRVS
                     SLKPDEPRTIILNDRVTNSNYGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFT
                     SIIQQVPNVTPTNRYTTIGTLLVVLVVSAVKESVEDLKRSNADKELNHSLCDVLDETT
                     GKFVRTKWINIAVGDIIRVKSEEAIPADLILLSSSEPEGLCYIETANLDGETNLKIKQ
                     ARQETAGILDENALSHLHGKILSEHPNSSLYTYEGTMTLNGSTFPLSPEQMILRGATL
                     RNTAWIFGLVVFTGHETKLMRNATATPIKRTAVERVINMQSLALFGVLVVLSFVSSLG
                     NVIMMTKDSNHLGYLYIEGTNKIGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAY
                     MIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGSC
                     YIETIPEDRRATVEDGIEVGFRTFESLKEKMSSFDDDEAGIAIEFMTLLATCHTVIPE
                     TQSDGTIKYQAASPDEGALVQGAADLGYKFIIRRPNSVTISTPSGEELQYQLLNICEF
                     NSTRKRMSAIFRMPDGSIKLFCKGADTVILERLDNDYNPYVQATLRHLEDYAAEGLRT
                     LCIASRTIPEDEYAEWSKIYEAASTTLHDRSAELDKAAELIEHDLFFLGATAIEDKLQ
                     EGVPETIHHLQEAGLKIWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEETRAN
                     LISKLNAIESHQISQQDMNSLALVIDGKSLGFALEADLEDYLLTIGTLCKAVICCRVS
                     PLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIG
                     QFRFLKKLLVVHGSWSYQRISLAILYSFYKNMALYMTQFWFVFANAFSGQSIMESWTL
                     TFYNVFFTVMPPFVIGIFDQFVTSRLLERYPQLYKLGQKGQFFSVTIFWGWVLNGFYH
                     SVVIFIGSILFYRYGNCLNMHGETADHWTWGVAIYTTSIIIVLGKAALITSQWTKFTL
                     VAIPGSLVFWLVFFPIYSAIFPRVNVSPEYYGITGHVYGSATFWLMCIVLPVFALFRD
                     FIWKYYKRTYSPEAYHVVQEMQKYNISDYRPRMEQFQKAIRKVRQVQRMKKQRGFAFS
                     QSEEGGQDKIMRMYDTTLKRGAHGELVDAQKNPFSDTPIDNHQEQNFDVAESLDPTNP
                     FKDPLI"
     gene            complement(<251787..>252692)
                     /gene="MAK16"
                     /locus_tag="KLMA_50119"
                     /db_xref="GeneID:34716734"
     mRNA            complement(<251787..>252692)
                     /gene="MAK16"
                     /locus_tag="KLMA_50119"
                     /product="protein MAK16"
                     /transcript_id="XM_022820093.1"
                     /db_xref="GeneID:34716734"
     CDS             complement(251787..252692)
                     /gene="MAK16"
                     /locus_tag="KLMA_50119"
                     /codon_start=1
                     /product="protein MAK16"
                     /protein_id="XP_022676591.1"
                     /db_xref="GeneID:34716734"
                     /translation="MSDEIIWQVINQHFCAFKVKTDKGQNFCRNEYNVTGLCSRQACP
                     LANSKYATVKNVDGQLYLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNK
                     FLIHKCKQRMTKLTQVMITERRLALREEERHYVGIAPKVKRREENRERKALAAAKIEK
                     AIEKELLERLKSGVYGDKPLNVDEKIWKKVMGRVEEDEVSEDENDWEEEEESDEGEVE
                     FVEDDDAEDEMVDMEDLQKWLGGSDESDYSSDEDSEDDDSDASDEEENPSKRQKKSAT
                     SKRRRPKVEIEYEQELQPNQHELAQ"
     gene            complement(<253129..>257277)
                     /gene="LTE1"
                     /locus_tag="KLMA_50120"
                     /db_xref="GeneID:34716735"
     mRNA            complement(<253129..>257277)
                     /gene="LTE1"
                     /locus_tag="KLMA_50120"
                     /product="guanine nucleotide exchange factor LTE1"
                     /transcript_id="XM_022820094.1"
                     /db_xref="GeneID:34716735"
     CDS             complement(253129..257277)
                     /gene="LTE1"
                     /locus_tag="KLMA_50120"
                     /codon_start=1
                     /product="guanine nucleotide exchange factor LTE1"
                     /protein_id="XP_022676592.1"
                     /db_xref="GeneID:34716735"
                     /translation="MSSAAKTGGEHDEETESVALFSQSDLFPVPSEKVLTVDIRDGSV
                     RILKCTLPALLVKLSSPLDNVDYSMLTDFFLVYRSFISSESLLELILERFQWALTLRQ
                     SESRQKSLSEIILVRMFVLIRHWLSNYFAQDFVLNASLRSTMLLFINSFSPSDKFLDN
                     IILSLKKLWVQNVQLMWEDVGDLASQNNISTREQWLNWKISDVSSVIPNNHNGDTSNQ
                     SSQTTLSKQRRLSSIALQNINDPAHRNESLLSLLHTKEKIPLPQQSEGDTKKQSMRIK
                     QRTGSMLLFPENASNGYTAKQNHSYNNTHLQESSTNQKNVTITTLKSLHTQNITQLSK
                     DTDVSTIMKELEYPITPSVDAVIPPTPAKKIEFILQTSYVDADPTEIEKKTQQKNLRE
                     SVHHKGIIGLLSKWKLNHQTKANPQRVQNPPRVEKLIKYVFSISSLETHSNPQPDSIG
                     SKFDILSARTIEEVEYLISVEKDLLEKVEENRISAKTSKIESSEDDSNDYSVIDNLNL
                     YKTVSSIANSVISLSKTLNNKGNKSATHLLSPSMTALERRKIRNSAPMLHSYNSSRYS
                     ISNALIGVPKSDERSSPKRLVFLDSKRNSPTKKAILANSLGNIGEYNGQRNSITSVVT
                     YDSAFSSTSASEVAPNKNNANSNIFMDAAPTLKRKVNVNDLRRFNFEEPDSTEINNNK
                     SNENVDQRDSVSIHTAHNEIDATKPDSELENADISSLITAYEESTSELGNARNSVAEV
                     KRPTSGRISISRNQNAAISASMSSAVPKSPLILRNEFFIERDQALAYNQDIISELEET
                     TSHFLKDDINLRSPSKHESLCNDSDSQSVATNLLFTSAKASPQKAGMRNSVSFPEEEE
                     YEYNSQPASHSSVPKLSQTPSIKSITSHDSEHSLEHSSDSSAHKSSKYTSIREQLQLA
                     KQPTSDIFDEDIDNINTEQNKYLFSPDIDNGDYASPEKNLDDLKQQFIDAPDEETSLE
                     EEEDDIDNPTTNPNVVENEEIDEKKLEDIINGIDDTMDSNMDPVNLALMKLEGTYVKD
                     KNGEDDKSSPVSESLAMEVEKFQMIQSTTLPESARKRQSMFIQRRRNTMIDLGVRNST
                     DESESAEDNSENTDEQIRRLLSEYQITDPRLGIKNLNQHIPFILMYDSKSVATQLTLI
                     EKDILSEIDWKDLLELNMKDQLPQFTSWLQLLVYNDHLSGIDLAIGRFNLTVDWIISE
                     IVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTMMQIILALSSIVVQRFTETWRLVEPG
                     DLLTWENLKVIPSIEKNYGQIRQLLDNMNPLSGCIPFIVVYLSDLSLNTEKHTWIVPN
                     ELLNYNKFQIKVQIVKNFVQRMQWSKFYRIDIDNELLSKCVYLTSLSHDEINTISAQH
                     LAPR"
     gene            <258906..>260486
                     /locus_tag="KLMA_50121"
                     /db_xref="GeneID:34716736"
     mRNA            <258906..>260486
                     /locus_tag="KLMA_50121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820095.1"
                     /db_xref="GeneID:34716736"
     CDS             258906..260486
                     /locus_tag="KLMA_50121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676593.1"
                     /db_xref="GeneID:34716736"
                     /translation="MSSKELEKETYEVNVQAESDAVSTESPIDNLHHVKSVELEVDHA
                     VGADLFQEVLEQELKYDDKEYAKIRRKIDKWLLPVLCITYLLQFLDKLSLNYASAYSM
                     NADLKLKGNDYGDIAAIFNVGYLIGSIPGNWLIQKFPVAKFTGVSLIIWAIILICHLG
                     AKSYSGMMAIRFFLGVMEASISPSNMMMCSMFYNKREQPFRMCTFLSMNGVATMVGSL
                     LAYGLGHATSVSLKPWKLIFLVFGVLNLVWSAFFLYLAPDSPATARFLTHEERLKVID
                     HVSKNQMGIKDTKFKPVQFKEAMIDPNNWIMALIGLACGVINGAVTNFISSLIKGFGF
                     SGLNATLLQLPTGAIELVVVFSVGMVALFTQKNVRVILLFLTCIPTLAALIGIKLIPL
                     SHKWSLVGCCWLLYIVGGPVIMCWVLMNVTIAGSSKIVSAKMMWFIFYTGGNIGGSKI
                     MYAKEAPRYNSGMKGLIVCYCGVMFLCIVYYAMMYYRNKKRDEKYGVPTEEDQRKGVI
                     NGFMDYTDFENKYFRYVY"
     gene            <261107..>263512
                     /gene="LDB19"
                     /locus_tag="KLMA_50122"
                     /db_xref="GeneID:34716737"
     mRNA            <261107..>263512
                     /gene="LDB19"
                     /locus_tag="KLMA_50122"
                     /product="protein LDB19"
                     /transcript_id="XM_022820097.1"
                     /db_xref="GeneID:34716737"
     CDS             261107..263512
                     /gene="LDB19"
                     /locus_tag="KLMA_50122"
                     /codon_start=1
                     /product="protein LDB19"
                     /protein_id="XP_022676594.1"
                     /db_xref="GeneID:34716737"
                     /translation="MVLPLFGISKQSSNSSSAPSLQALDYTNHDDHPVELSINIESPP
                     CVLYGSATESSGALLGGLLTVTINDGLEIEAPRSTPLTPVNSNQRKQLTNSLTTSLSH
                     LSFSHNHGSNHSKSGDSLKRLGSMSNIVPSAKTVTTIKINSVELSLIQKVHYEKPFRP
                     AQATFNSCTNCKTKMTEFHRWTIIDKPTEVKVGKHSFPFSHLIPGNLPATTHLGSNSH
                     TTIKYELIAVVTYRHPFRGKGESSKRVLQLNLPIPITRSILRGSDKTSLRVFPPTELT
                     ANAVLPNVVYPKSTFSMELKLDGVCSENRRWRMRKLNWRIEEKVKVRAHGCQAHMSKL
                     KQLEEKVKHDEERDRQLRKNTKPIKRSLDMGPQVKMTVNSSHDLVAQQLSRLNAQSSD
                     SGNAASSNDILAPTASADGNLDEDHDTIPDTSNDFIHPNDDAMRQEILQQQQRLRQQQ
                     LEAELKHESALYTEEIRTIAHGDVKSGWKSDFSNGGTIELVTDIDCMKLNSGVTNPVN
                     HTSTRKPFILPNQDNVNISCDIEDNSLGVYVSHVLFVEIIVAEEQLQTSQGTGTGSES
                     GSRRGSVVSSSSKASVKPKNNADQRLAELSPMFADRENKPVPVIEPHNNDAGPRIVGV
                     PTGAARVLRMQFRLTMTERSGLGISWDDEVPPAYQDIKALTPPSYDDADSSVHRMRGY
                     NYYSDGPAASSSAAQTMDGAGAPSEVGSARNSTSTSLHQDDNTRNSSGGTGEYIRPPP
                     ALHHSASTSSNSANFPFTDLDHVMSIQGAEPGFNSALTPQTTRTINVPTISELLDTDR
                     ITQ"
     gene            <265651..>267462
                     /locus_tag="KLMA_50123"
                     /db_xref="GeneID:34716738"
     mRNA            <265651..>267462
                     /locus_tag="KLMA_50123"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820098.1"
                     /db_xref="GeneID:34716738"
     CDS             265651..267462
                     /locus_tag="KLMA_50123"
                     /note="Haloacid dehalogenase-like hydrolases conserved
                     domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676595.1"
                     /db_xref="GeneID:34716738"
                     /translation="MSTATAKTDKLTEKLKQFTFDEKDNSLIDSKNPAPFPGSEPDSK
                     EKPKSAATTTATSTSTSTSAGSDADALKASKPRTKSFLNNDGIDELKPMTRKKRVSSL
                     SLSDQYSVSQNSMQPLTSMTPLHGKGSEDGTAGQGNVRRSSSHSRRSSMKLSRSSSVR
                     TKREIIDHERIASYAFAFDIDGVILRGPDTIPEARQALRMLNGENKYNIKVPYIFITN
                     GGGRSERARCKDLSKRLGITVTEDQVIQGHTPMKDLVPAHHNVLVVGGVLNSCRDVAK
                     GYGFENVYTPLDIMKWKPSVTPYYTLSEEEKACALDVDFSKISIDAILVFADSRNWAA
                     DQQIILELLLSKNGVMGTVSETADEGPGLYFAHSDFVWSTDYSLSRYGMGALQVSIAA
                     LYQEHTGKELQVTRFGKPQRATFRFADKVLSKWRRNTLEEHVEQLGMTISDTRDRIPN
                     GAAPAGHGDTETGESPFGPDSETDQETDLTSSTEDDEEDDEDDEGIVMEKHSKLLLEL
                     PPASTVYFVGDTPESDIRFANSHDSSWYSILVKTGVYQEGTIPKYKPKQICENVLEAV
                     KFAIEREHKKELEEWNRTAEVTVPVVKEEKETIQKTN"
     gene            complement(<268027..>269115)
                     /gene="AHA1"
                     /locus_tag="KLMA_50124"
                     /db_xref="GeneID:34716739"
     mRNA            complement(<268027..>269115)
                     /gene="AHA1"
                     /locus_tag="KLMA_50124"
                     /product="hsp90 co-chaperone AHA1"
                     /transcript_id="XM_022820099.1"
                     /db_xref="GeneID:34716739"
     CDS             complement(268027..269115)
                     /gene="AHA1"
                     /locus_tag="KLMA_50124"
                     /codon_start=1
                     /product="hsp90 co-chaperone AHA1"
                     /protein_id="XP_022676596.1"
                     /db_xref="GeneID:34716739"
                     /translation="MVVHNPNNWHWVDKNCIDWAKKYFEERLVGLATGEATEALYARI
                     SKLSSLEGDCEVNQRKGKVISLFDLKLNLGIEGHVNDEKWEGSITIPEVAFDSDPEDY
                     QFDISIFKENSKLSEIKPVIREKLIPQLRDIFSNFGKELLLTHANDIQVSSDKVTSEF
                     TKSNQQSSFQNVASTGTPLKKESSSSSSAAGGKKSETSSSTGDSSQKASNSNTPKYNT
                     TKLHLESSFQVPAVELYNTFIEKPRIEAWSRSPIQPDPSSGKLGSGSKLELNDTFKLF
                     GGNITMKLISGEPGKNLVFDWRLNEWKQGHYSQLSMEFHESQEYHETKLIVNWSGIPI
                     GEEDKARGNFEEYYIRSIKLTFGFGAIL"
     gene            complement(<269418..>271805)
                     /gene="UPC2"
                     /locus_tag="KLMA_50125"
                     /db_xref="GeneID:34716740"
     mRNA            complement(<269418..>271805)
                     /gene="UPC2"
                     /locus_tag="KLMA_50125"
                     /product="sterol regulatory element-binding protein ECM22"
                     /transcript_id="XM_022820100.1"
                     /db_xref="GeneID:34716740"
     CDS             complement(269418..271805)
                     /gene="UPC2"
                     /locus_tag="KLMA_50125"
                     /codon_start=1
                     /product="sterol regulatory element-binding protein ECM22"
                     /protein_id="XP_022676597.1"
                     /db_xref="GeneID:34716740"
                     /translation="MSTERMQSSDEEKSRRGRKKSSAKVELIEIDGKTVSKTATGKRK
                     FHKKSKNGCAHCKRRRVKCDETRPHCLNCKKMNLDCVYTPVQPRSRKNSTTTVTKASA
                     KVEKPTVASSPADALSMNQVDILVNTMKAEAQLHQNQQEQEQQVPQQPQLQPHPLKRQ
                     VQHENIAAKNSSAAMSGLPKQGSTGAAGVTAPVGTPGAAGSTATPENVHLPPLAQNPH
                     FLQHLQQQIQQQPYLLPQLMTLTNSEKFAAQFEVPNSPSTGTLQSQPMNISNSIASLL
                     AGSKIPSNLSSNPLALFQQLTQSPQRPNAKMNNAGNPLSNLGGFNLKQLGTFPTAGIG
                     GVTYDFQELLGLKSAPNSATNDSTTATVGTDPSKQDTAVEVLAGLQMKQEKSTNSLVH
                     NSLDLNTRNLPNNPTISPAAPMSPLNKLNDGQTSLNSATKSVSENGTSIANGVATDMS
                     KIDTQDSESTNGTTSSRIGSIANMIEFSTQTNLNLVDLKLFHHYCTKVWPTISAAGIS
                     EKKIWAEDVPEIAFEYPFLMHSLLAFSATHLSRTESGLERYVTQHRLEALRLLREAVL
                     EINEANTDALVASAIILIMDSLANAATPVASGVNSPISAGSLSASAWIFHVKGAATIL
                     TAVWPLTEKSRFYNLINVDLSDMGDIINQENGSITELVCFDESIADLYPVEINSPYLI
                     TLAYLDKLNKEKGQPGFILRVFAFPALLDKTFLALLMTGDLGAMRIMRSYYQLLRGFA
                     SEMKDQVWFLEGITQVLPQDVDEYSGGGGMHMMLDFLGGGLPSMTTTNLSDFGIF"
     gene            complement(<272852..>274531)
                     /gene="TCP1"
                     /locus_tag="KLMA_50126"
                     /db_xref="GeneID:34716741"
     mRNA            complement(<272852..>274531)
                     /gene="TCP1"
                     /locus_tag="KLMA_50126"
                     /product="T-complex protein 1 subunit alpha"
                     /transcript_id="XM_022820101.1"
                     /db_xref="GeneID:34716741"
     CDS             complement(272852..274531)
                     /gene="TCP1"
                     /locus_tag="KLMA_50126"
                     /codon_start=1
                     /product="T-complex protein 1 subunit alpha"
                     /protein_id="XP_022676598.1"
                     /db_xref="GeneID:34716741"
                     /translation="MAQVYGNQRSDTLFLGGEKVSGDDIRNQNVLASLAVANVVKSSL
                     GPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVDLAQQQDREIGDGTTSVV
                     IIASELLKKANDLVKNKIHPTTIITGYRVALREAIRYINEVLSVPVESLGKDTMVNIA
                     KTSMSSKTIGSDSEFFSNMVVDALLAVKTQNGKGEVKYPVKAVNILKAHGKSATESVL
                     VHGYALNCTVASQAMPKQISGGNVKIACLDLNLQKARMAMGVQINIDDPDQLEEIRKR
                     ETGIILDKVKKIIDAGAQVVLTTKGIDDLCIKEFVNAKIMGVRRCKKEDLRRIARATG
                     ATLISDMSNLDGDEVFESSYLGTCQEVVQTKFSDDECILIRGTQKHSSSSIILRGPND
                     YSLDEMERSLHDSLCVVKRTLESGNVVPGGGCVEAALNIYLDNFATTVGSREQLAIAE
                     FASALLVIPKTLAVNAAKDSSELIAKLRSYHAASQQAKPDDLKRRKYRNYGLDLIKGK
                     IVDEVEAGVLEPTISKVKSLKSALEACIAILRIDTMITVDPEPEKEGDGCA"
     gene            complement(<275483..>276058)
                     /gene="CDC42"
                     /locus_tag="KLMA_50127"
                     /db_xref="GeneID:34716742"
     mRNA            complement(<275483..>276058)
                     /gene="CDC42"
                     /locus_tag="KLMA_50127"
                     /product="cell division control protein 42"
                     /transcript_id="XM_022820102.1"
                     /db_xref="GeneID:34716742"
     CDS             complement(275483..276058)
                     /gene="CDC42"
                     /locus_tag="KLMA_50127"
                     /codon_start=1
                     /product="cell division control protein 42"
                     /protein_id="XP_022676599.1"
                     /db_xref="GeneID:34716742"
                     /translation="MQTLKCVVIGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTV
                     MIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVH
                     HHCPGVPCLIVGTQIDLRDDKVIIEKLQRQRLRPITPEQGERLARELRAVKYVECSAL
                     TQRGLKNVFDEAIVAALEPPVIKKSKKCTIL"
     gene            complement(<276452..>278656)
                     /gene="GCD6"
                     /locus_tag="KLMA_50128"
                     /db_xref="GeneID:34716743"
     mRNA            complement(<276452..>278656)
                     /gene="GCD6"
                     /locus_tag="KLMA_50128"
                     /product="translation initiation factor eIF-2B subunit
                     epsilon"
                     /transcript_id="XM_022820103.1"
                     /db_xref="GeneID:34716743"
     CDS             complement(276452..278656)
                     /gene="GCD6"
                     /locus_tag="KLMA_50128"
                     /codon_start=1
                     /product="translation initiation factor eIF-2B subunit
                     epsilon"
                     /protein_id="XP_022676600.1"
                     /db_xref="GeneID:34716743"
                     /translation="MSGKKTKSGKANSNKKQELVQDERLQAIVLTDSFETRFMPLTSV
                     RPRCLLPLANIPLIEYTLEFLAKAGVNEVYLICASHGDQIQEYIDQSKWSLPWAPFKI
                     STIMSLESRSVGDAMRDLDNRGLITGDFVLVSGDLVTNMDFEKALDIHKQRRKNDKDH
                     IVTMCLSKATQFHKTRSHEPATFIFDKSNDRCIYYQDIPLASSKEKTTIDIDPELLEG
                     VDEFVLRNDLIDCHVDICSPHVPAIFQENFDYQYLRRDFVKGVLSSDLLKKHIYGYIT
                     DEYATRAESWQTYDAISQDFIARWCYPLVLNSNLLEGQTYSYESQHIYKEKDVVLSQS
                     CKIKKNTAIGSGSKIGEGTVIENSVIGRNCMIGSNIQIKNSYIWDNVTINDNSNIVHS
                     LVASGVKVGSNVTLNDGCIIGFDVIIDNDVTVPVGTKIAATSVQRDSSFFLDADHSLD
                     SSDNDEDEEDSNSSSSSDLGNRSTQTTRAKISKEIVGPNGKGVLYESDDDDEDEDGST
                     EKGVSNTLTYKNDEIYFSDTSISSTTQKHRKRRTMSMTSVYTDFEGEDDEEEDFEKEA
                     IATVERAIENNHDLDTSMLELNTLRMSMNVTYHEVRNASVIAILRRIFHFVATQTLGP
                     KEAVTKVLQQWGPMFKRQAFDNEEFRDLMNIFLNRVLDQKFEKPDFILFHLYNTLYDM
                     DIIDEDIIYKWWDVVSADDKYATVIALLGKWIDWLKTADEESSEEEDSDDSE"
     gene            complement(278958..279094)
                     /locus_tag="KLMA_R501"
                     /db_xref="GeneID:34718724"
     tRNA            complement(join(278958..278996,279060..279094))
                     /locus_tag="KLMA_R501"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718724"
     gene            complement(<280305..>282758)
                     /gene="MSS4"
                     /locus_tag="KLMA_50129"
                     /db_xref="GeneID:34716744"
     mRNA            complement(<280305..>282758)
                     /gene="MSS4"
                     /locus_tag="KLMA_50129"
                     /product="probable phosphatidylinositol-4-phosphate
                     5-kinase MSS4"
                     /transcript_id="XM_022820104.1"
                     /db_xref="GeneID:34716744"
     CDS             complement(280305..282758)
                     /gene="MSS4"
                     /locus_tag="KLMA_50129"
                     /codon_start=1
                     /product="probable phosphatidylinositol-4-phosphate
                     5-kinase MSS4"
                     /protein_id="XP_022676601.1"
                     /db_xref="GeneID:34716744"
                     /translation="MIAGHRVRDRDRGDSNGNMKLDMNLNLDHHHLNLQMPMVSKGLD
                     DDGDGDGNGDEHLHGGGLEKFSNYRPLPKSSSTPLTSAGVEQLEPTTTAPVDPLITTQ
                     TAGAAGMHARKMSLPPVTKVGNSPAQQVVMNNAHRLSTKSLPVTRRSTRESIRYAPYH
                     PGKHARIIPVDSDSSSTCSSDSGAELHSQHSAARSPSSYNVGPGMGASITGTATTTVT
                     ALRTISTGSNNSVPSLQYASPRGRRSIVKSSTELYLAGPRRSMQHSRKNSEYAPGQAA
                     AAALSGSMQSLNLNQQQQQQQQQQPGISKPKHSYESRHTINNDGGPKMSESAALEIQK
                     MRQSLLHKREMRRKQKKFLDDDKVLVGKKVTEGHVNFIIAYNMLTGIRVAVSRCSGIM
                     KPLTDKDFKLTKKLAFDYHGNELTPSSQYAFKFKDYCPEVFRELRALFGLDPADYLMS
                     LTSKYILSELNSPGKSGSFFYFSRDYKYIIKTIHHAEHKHLRKILRRYYEHIKVNPDT
                     LISQFYGLHRVKMPISFRSKIKYRKIYFLVMNNLFPPHLHIHTTFDLKGSTWGRYTKW
                     DKSQDSQETPVLKDLNWIEMKEKINLGPLKSKKFLQQLEKDVDLLAELNIMDYSLLLG
                     IHNIEKGNDLIEDGAKDASTGAGAGASADVGVDGDINGVGLGDDEDFANSSQDPTVMP
                     LLTHTQSSRRNTLHQHHPNHRHHRRHTHHSIIQPTNNTQVVSHFFQQDEGGIRASDQL
                     NRDLNQIYFVGIIDCLTNYSLVKRMETIWRSLNHDLKTISAVPPRLYGNRFYHFIEDS
                     VNKHYYEDNPDQPRYTDNL"
     gene            <283818..>284447
                     /locus_tag="KLMA_50130"
                     /db_xref="GeneID:34716745"
     mRNA            <283818..>284447
                     /locus_tag="KLMA_50130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820105.1"
                     /db_xref="GeneID:34716745"
     CDS             283818..284447
                     /locus_tag="KLMA_50130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676602.1"
                     /db_xref="GeneID:34716745"
                     /translation="MQWFKVVLLTALTISLVFQLFSVITVPITSNIFIAQYKGYRFGV
                     FGWCKLKASVCSQIRMGYALQDIMLINDNEYLHLPTNAKYALSKLLLVHAISLVCVFM
                     LWLASIVICVFWLRVSKNVLFGAVLWSMVTFMVSLLAFLIDVLMFGSYVTWASWLMLV
                     SAFFVALSGLMICLLIRELPYKRFVKLQKEVEIDVPMRKRAGSEEAWVS"
     gene            complement(<284492..>285328)
                     /locus_tag="KLMA_50131"
                     /db_xref="GeneID:34716746"
     mRNA            complement(<284492..>285328)
                     /locus_tag="KLMA_50131"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820106.1"
                     /db_xref="GeneID:34716746"
     CDS             complement(284492..285328)
                     /locus_tag="KLMA_50131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676603.1"
                     /db_xref="GeneID:34716746"
                     /translation="MSRKLVVLGGTGFLGKRICEAAVEANFKVTSLSRSGKAVSSEAW
                     AQEVEWKSCDIFEPKSYASELRNATDVVHSLGILLENENYKKQVNGTSLWPTSIPELP
                     KMSTLFGKNPLEKGGHGNGANAKKSSATNFTYEMMNKYSATLLVDTYMKVNAGNARTF
                     SYVSADRGFPMIPRGYIDSKRAAEAHIMQYEDEIRPIILRPGFMFDERNTRADGRARV
                     RDLLQLLNCGNELLLGKKVGCVNELVRPLISTQQVAHALMAVLNDAEFKGVLSLEDMI
                     SV"
     gene            complement(<285975..>287045)
                     /gene="GCD7"
                     /locus_tag="KLMA_50132"
                     /db_xref="GeneID:34716747"
     mRNA            complement(<285975..>287045)
                     /gene="GCD7"
                     /locus_tag="KLMA_50132"
                     /product="translation initiation factor eIF-2B subunit
                     beta"
                     /transcript_id="XM_022820108.1"
                     /db_xref="GeneID:34716747"
     CDS             complement(285975..287045)
                     /gene="GCD7"
                     /locus_tag="KLMA_50132"
                     /codon_start=1
                     /product="translation initiation factor eIF-2B subunit
                     beta"
                     /protein_id="XP_022676604.1"
                     /db_xref="GeneID:34716747"
                     /translation="MSDINVVIDSFIDRLKRKQVVGSYQAALETLQILMRYVSAIRWT
                     STDDLITQIKKFGNSLEKAHPYEYTCGNVVRRVLSMIRDEIDEEQNTAEPMISSMFNL
                     LQKPMTDAKVKKTQDTRVDVRQTIVQSIRDLIDEIKNIDDGIQQIAIELIHDKEILLT
                     PTPDSKTVLRFLLKARDRHSRNFTVLVTEGFPNNTAVAHEFAKKLSEHDIETIIIPDS
                     AVFALMPRVGKVILGAKTVFTNGGTISSTAGVSSVCECAREFKTPVFAVAGLYKLSPL
                     YPFDVEKMVEIGGSQHVLPTTENDRVGTVALETINPIADYIPPENIDIFITNIGGFAP
                     SFIYRVVWDNYKQEDVNLEEKI"
     gene            complement(<287357..>287938)
                     /gene="SEC72"
                     /locus_tag="KLMA_50133"
                     /db_xref="GeneID:34716748"
     mRNA            complement(<287357..>287938)
                     /gene="SEC72"
                     /locus_tag="KLMA_50133"
                     /product="translocation protein SEC72"
                     /transcript_id="XM_022820109.1"
                     /db_xref="GeneID:34716748"
     CDS             complement(287357..287938)
                     /gene="SEC72"
                     /locus_tag="KLMA_50133"
                     /codon_start=1
                     /product="translocation protein SEC72"
                     /protein_id="XP_022676605.1"
                     /db_xref="GeneID:34716748"
                     /translation="MLRYDTNTKKLSLKDDADTNQDRINNLNQINRLTTALVAENNPN
                     FQPQPSNETTNMIKNMFQAGMQQAQKKNLPDALKKVDLALQMRNKARKPWEPFAFQLQ
                     ELQMMLRNRTDLELVSQRNLDAWQDLEMLLSCGLIVPEVFLRLTDCLLKLNLVELAKP
                     CCERGLSLDPSNAQLITLYKDCERRLLELDGDN"
     gene            complement(<288319..>288963)
                     /gene="GSP1"
                     /locus_tag="KLMA_50134"
                     /db_xref="GeneID:34716749"
     mRNA            complement(<288319..>288963)
                     /gene="GSP1"
                     /locus_tag="KLMA_50134"
                     /product="GTP-binding nuclear protein GSP1/Ran"
                     /transcript_id="XM_022820110.1"
                     /db_xref="GeneID:34716749"
     CDS             complement(288319..288963)
                     /gene="GSP1"
                     /locus_tag="KLMA_50134"
                     /codon_start=1
                     /product="GTP-binding nuclear protein GSP1/Ran"
                     /protein_id="XP_022676606.1"
                     /db_xref="GeneID:34716749"
                     /translation="MSAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV
                     HPLAFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWH
                     RDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLW
                     LARKLAGNPQLDFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL"
     gene            complement(<290134..>290466)
                     /locus_tag="KLMA_50135"
                     /db_xref="GeneID:34716750"
     mRNA            complement(<290134..>290466)
                     /locus_tag="KLMA_50135"
                     /product="ATP synthase subunit H"
                     /transcript_id="XM_022820111.1"
                     /db_xref="GeneID:34716750"
     CDS             complement(290134..290466)
                     /locus_tag="KLMA_50135"
                     /codon_start=1
                     /product="ATP synthase subunit H"
                     /protein_id="XP_022676607.1"
                     /db_xref="GeneID:34716750"
                     /translation="MFRAVPLTLRASRGFSTSLIRRNVIQDLYLKELKSVNLKPVTAA
                     DAQGAVKPWTAPAAPKIPELELQSADALKEYAAADVETVKEATEQANEVEEGDWLVLE
                     EIEDDHHH"
     gene            <291602..>292894
                     /gene="TUF1"
                     /locus_tag="KLMA_50136"
                     /db_xref="GeneID:34716751"
     mRNA            <291602..>292894
                     /gene="TUF1"
                     /locus_tag="KLMA_50136"
                     /product="elongation factor Tu"
                     /transcript_id="XM_022820112.1"
                     /db_xref="GeneID:34716751"
     CDS             291602..292894
                     /gene="TUF1"
                     /locus_tag="KLMA_50136"
                     /codon_start=1
                     /product="elongation factor Tu"
                     /protein_id="XP_022676608.1"
                     /db_xref="GeneID:34716751"
                     /translation="MSFLVPRFAVAKAFRPLSVGARAFSSSLRVSAAAFDRSKPHLNI
                     GTIGHVDHGKTTLTAAITKTLAERGGADFLDYSSIDKAPEERARGITISTAHVEYETE
                     KRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHI
                     VVFVNKVDTIDDPEMLELVEMEMRELLTQYGFDGDNTPVIMGSALCALEGKQPEIGEQ
                     AIMKLLDAVDEYIPTPARDLEKPFLMPVEDIFSISGRGTVVTGRVERGNLKKGEEIEI
                     VGHNTTPFKTTVTGIEMFRKELDQAMAGDNAGVLLRGVRRDQLKRGMVLAKPGTVKAH
                     TKFLASLYILTKEEGGRHSGFGENYRPQIYVRTADVTVVLKFPESVEDHSMQVMPGDN
                     VEMECELVHPTPLEAGQRFNIREGGKTVGTGLVTRILE"
     gene            complement(<294393..>295601)
                     /locus_tag="KLMA_50138"
                     /db_xref="GeneID:34716752"
     mRNA            complement(<294393..>295601)
                     /locus_tag="KLMA_50138"
                     /product="zinc finger protein"
                     /transcript_id="XM_022820113.1"
                     /db_xref="GeneID:34716752"
     CDS             complement(294393..295601)
                     /locus_tag="KLMA_50138"
                     /note="C2H2-type"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_022676609.1"
                     /db_xref="GeneID:34716752"
                     /translation="MYSQQYNSPASLPECSVRRHSSVEIDCRYANNKVLYDLVKDKTI
                     ELGALVDRLLQSDALNAVEQRDIQKTIWQIIEKFPGFVPPSSSSSVTAPTMLSPLTNH
                     GKPVVNNPPNSISNYATAGCKNVSTSFSVSSITENSYGAAPITPSNQTFELAPRLSLV
                     NPHYNYSYHIQPRHSFSNERQFSDAQPQNSGSRRSPEHAFSHTNRSRSFVQLPPVKTL
                     LTKDDQMTDDQVMHGYSHRDHLPLQMHVHMQTIKEEKPNIDLSPSISSSSSSSSLNPQ
                     AHMTDALDTKRKRPVETGQENAAQSPTSSNVQLSSVITVPRKEKVTTLKKNQCHICGR
                     ICSRPSTLQTHLSIHTGDKPYKCPWPSCNKCFNVKSNMLRHYKRHECKSRANQSTSAI
                     RASKTNIVSI"
     gene            complement(<298889..>300649)
                     /gene="fnx1"
                     /locus_tag="KLMA_50139"
                     /db_xref="GeneID:34716753"
     mRNA            complement(<298889..>300649)
                     /gene="fnx1"
                     /locus_tag="KLMA_50139"
                     /product="multidrug resistance protein fnx1"
                     /transcript_id="XM_022820114.1"
                     /db_xref="GeneID:34716753"
     CDS             complement(298889..300649)
                     /gene="fnx1"
                     /locus_tag="KLMA_50139"
                     /codon_start=1
                     /product="multidrug resistance protein fnx1"
                     /protein_id="XP_022676610.1"
                     /db_xref="GeneID:34716753"
                     /translation="MEETDRTSLLQSARDKMNPELAEGLPAYVGVEVAEAENLLGDEG
                     NERGVSDFSESDDKKSDMAQTRLNIIIGSMCLGSFLAALDNTIVTTLLSHIASEFNEL
                     SRISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFIVGCLICGLSKNLWTLV
                     IGRFIAGIGGGGVTSLGSITASDIVPLRSRALYQGIFNFFFGMGVAIGGLIGGWFSES
                     KNGWRMAFLIQVPLSTISLILIITFLKLPKGCKGLGLVSNGVNGKINVFNKLKSIDWY
                     GSFTLVTFLFSFMLASSLGGKEIAYSSIIFKLLLFVIIVSGGLFVYVELYISADPILP
                     IRFLSNRSILGASFANWFCMMSSITLTFYVPVYWSSVLNLSPTEMGKRIAPNFFSTAF
                     GSMGAGYYMKKTGRYYSFLLKFAGLMAIGQLQILLMKPDISTWRQFTLLPIPQFGAAV
                     LITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSIGAALFRNRLSSRLYEDVLG
                     FESEEYSREYLLSIVRKAVESSEYVHTKAPKFIQGTLIHCYESACHLTFSFCFVICIL
                     AWISCSIIKEYKLHTSMERK"
     gene            complement(<301101..>303203)
                     /gene="ENP2"
                     /locus_tag="KLMA_50140"
                     /db_xref="GeneID:34716754"
     mRNA            complement(<301101..>303203)
                     /gene="ENP2"
                     /locus_tag="KLMA_50140"
                     /product="ribosome biogenesis protein ENP2"
                     /transcript_id="XM_022820115.1"
                     /db_xref="GeneID:34716754"
     CDS             complement(301101..303203)
                     /gene="ENP2"
                     /locus_tag="KLMA_50140"
                     /codon_start=1
                     /product="ribosome biogenesis protein ENP2"
                     /protein_id="XP_022676611.1"
                     /db_xref="GeneID:34716754"
                     /translation="MLLKSTSASEISVYQVSGTNIARSLPDWIAKKRKRSLKNDLEYQ
                     NRVELIQDFEFSEASNKIKVSPDGNYAMATGTYKPQIHVYDFSNLSMKFERHTDAENV
                     DFCILSDDWTKSVHLQNDRTIQFQNKGGIHYTTRIPKFGRSLAYNRVNCDLYVGSSSN
                     ELYRLNLEQGRFLNPFKLDTEGVNHVSLNDVNGLLAASMETNIVEFWDPRSRSRVAKL
                     QLENDLDSSPFQVTCSSFKNDGLNFACGTSNGYSYIYDLRTSEPSIVKDQGYGFAVNK
                     IIWLDSVEDSNKILTCDKRIAKIWNKNDGKAYASMEPSVDINDIEHIPGTGMFFTANE
                     GIPMHTYYIPNLGPAPRWCSFLDSITEELEEKPSDSVYSNYRFITKADVQKLNIQHLI
                     GSKVLRAYMHGFFINSELYDKVALIANPNSYRDEREREIRRRIEKERESRIRSTGAVT
                     KAKVKVNKVLVDKLSEKRGGKVAEKVLEDDRFKEMFENDAFQVDEDDYDYKQLNPVKS
                     ARETTEGAAKRIRALTAAEESDEERIALKEGKSNYSDESDSESDSDSDSEVNNKERKQ
                     ELTEKEKKLIAKQVAAVKRRREQKEREEKFMNELTVGQVESHQEDTVNMTFDKKVKQL
                     NKELAKKSNDAIVHKNHRGEAELTFVPKKVPKKKKQVRYEDNSDDDSDESSKPDNGRT
                     KPRFDGRRRASKNVFRGM"
     gene            303659..303731
                     /locus_tag="KLMA_R502"
                     /db_xref="GeneID:34718725"
     tRNA            303659..303731
                     /locus_tag="KLMA_R502"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:34718725"
     gene            complement(<303941..>304987)
                     /gene="GTR2"
                     /locus_tag="KLMA_50141"
                     /db_xref="GeneID:34716755"
     mRNA            complement(<303941..>304987)
                     /gene="GTR2"
                     /locus_tag="KLMA_50141"
                     /product="GTP-binding protein GTR2"
                     /transcript_id="XM_022820116.1"
                     /db_xref="GeneID:34716755"
     CDS             complement(303941..304987)
                     /gene="GTR2"
                     /locus_tag="KLMA_50141"
                     /codon_start=1
                     /product="GTP-binding protein GTR2"
                     /protein_id="XP_022676612.1"
                     /db_xref="GeneID:34716755"
                     /translation="MDTNSVDASKATILLMGLRRGGKSSICKVVFHNMQPLDTLYLES
                     TTSPTQEHFSTLIDLAVMELPGQLNYFEPSYESEQLFKSVGALVYVIDSQDEYLNALT
                     NLAMIIEYAKNVNPYLNVEVLIHKVDGLTEDFKMDIQRDIMQRIGDELLDLGIEGIQL
                     SFYLTSIFDHSIYEAFSRIVQKLIPELPFLENMLDNLVQHSKLEKCFLLDINSKIYVS
                     TDSSPVDIQTYEVCAEFVDVTIDLQDLYKGKLQSADNKKGNEMKSVSVLNNGVIIYLK
                     QMIRGLALVTLMRPDDTDIESRLTVMDYNVDIFKKGLEKIWEKSKLITDSDDNTKNIH
                     SGNQVTVSNASATY"
     gene            complement(<305527..>308643)
                     /gene="TIF4632"
                     /locus_tag="KLMA_50142"
                     /db_xref="GeneID:34716756"
     mRNA            complement(<305527..>308643)
                     /gene="TIF4632"
                     /locus_tag="KLMA_50142"
                     /product="eukaryotic initiation factor 4F subunit p150"
                     /transcript_id="XM_022820117.1"
                     /db_xref="GeneID:34716756"
     CDS             complement(305527..308643)
                     /gene="TIF4632"
                     /locus_tag="KLMA_50142"
                     /codon_start=1
                     /product="eukaryotic initiation factor 4F subunit p150"
                     /protein_id="XP_022676613.1"
                     /db_xref="GeneID:34716756"
                     /translation="MGESTPEQQQQQQPSQVPAQAPAQGQSQQQHHAVEENTTGSPQK
                     NSGGAGFSKSPRNPKYDSRRNSRPYNQRGGNSNNGSSSTGKHFQKYNQPAYGVHAGYV
                     PNYGVADYNPLYYNQYQQQQQMYAAAYQTPVSQNYVAPLVTPATVSGKPAKVEITNKS
                     GEHIDISSIAHSHPHSNARSIPVVSPAASGSASNSASASPAVKLQSPAVVPAAASSAS
                     ASASPAPIPNGKEQSPAKTEEPKKDTLIVNDFLEQVKRRKAALAAKKASGGKSTPQPE
                     AVAAAKEEDAKVESQEKEETAPAESTETAAAVEKEATPEVSKEATPTPAPEPKPLTLA
                     EKLKLKRMKAAEQAQAEEPKKEEPKTEEAKVEEPKTEEAKVEEPKAEEPKAEEPKAEE
                     AKVEEPKVEEAKAEEAKAEEAKVEEAKAEEAKAEEPKAEEPKAEEPKVEEAAAEEVKA
                     EEEPKAEETTTAEEEPKAEEATAEEATSEEPKAEEETPAPVQDNDNDKITMTEFLKKL
                     HEVSPVDDIYSFQYPSDITPPNDRYKKAKVKYTYGPDFLYQFKDKVNVKYDPEWMAEM
                     SSKIVIPPRQQGSVGRGGDDRFSKGKVGSLRGEGRSNSRSNSKRKSKKDDRRSNRSYT
                     SRKDRERIREEEPEEPKVEIEVAPLVPSANRWVPKSKMKKAEVKLAPDGTEIYDAEDV
                     SRKMKSLLNKLTLEMFEPISDDIMKIANQSKWQEKGETLKIVIEQIFYKACDEPYWSS
                     MYAQLCGKVVKDLDDSIKDSETPDKTGSHLVLHYLVQRCQEEFQKGWTDKLPTNEDGS
                     PLKPELMSDEYYKMAAAKRRGLGLVRFIGFLYRSNLLTSRMVFFCFKRLMKDIQNSPT
                     EDTLESVCELLETIGEQFENARIQVTADAVIEGSSLLDTLFEQIKDVIKTGEISSRIK
                     FKLLDIVELREKKNWNSSKKNDGPKTIAQIHEEEALKRAMEERERENNRHGSKGGSRR
                     MNSERNSSRRDFAPQHSHNSNRDGFQTTRSSSMRYNEPKKEEQAQTPSKSPGVANMFD
                     ALMDAEDD"
     gene            complement(<309379..>310593)
                     /gene="RPT6"
                     /locus_tag="KLMA_50143"
                     /db_xref="GeneID:34716757"
     mRNA            complement(<309379..>310593)
                     /gene="RPT6"
                     /locus_tag="KLMA_50143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820119.1"
                     /db_xref="GeneID:34716757"
     CDS             complement(309379..310593)
                     /gene="RPT6"
                     /locus_tag="KLMA_50143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676614.1"
                     /db_xref="GeneID:34716757"
                     /translation="MSAVQVSSVPVTSHESGIKPFFDQKIQETEIKIREKTANLRRLE
                     AQRNTLNDKVRFIKDELRLLQESGSYVGEVVKVISEKKVLVKVQPEGKYIVDVAKDIN
                     VKDLNVSQRVCLKSDSYQLHKVLENKVDPLVSLMMVEKVPDSTYDMVGGLTKQIKEIK
                     EVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELV
                     QKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSGGGDSEVQRTMLELLN
                     QLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRIHSRKM
                     NLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVMNKN
                     DETAISVAKLFK"
     gene            <310950..>311642
                     /gene="ALG13"
                     /locus_tag="KLMA_50144"
                     /db_xref="GeneID:34716758"
     mRNA            <310950..>311642
                     /gene="ALG13"
                     /locus_tag="KLMA_50144"
                     /product="UDP-N-acetylglucosamine transferase subunit
                     ALG13"
                     /transcript_id="XM_022820120.1"
                     /db_xref="GeneID:34716758"
     CDS             310950..311642
                     /gene="ALG13"
                     /locus_tag="KLMA_50144"
                     /codon_start=1
                     /product="UDP-N-acetylglucosamine transferase subunit
                     ALG13"
                     /protein_id="XP_022676615.1"
                     /db_xref="GeneID:34716758"
                     /translation="MQFGTPTLSDHHKINIDLRNLSWRGIQYKFCSGKVRKMRTVLVT
                     CGATVSFPGLIETIVDSKVLKTLKELGYERILLQYGRGYGREFVKLVENRFKDASMGS
                     KSDISLIQDAQVVKIQGLQIYGFEFSRQIETLIQDYADLVVSHAGTGSILDSLRLEKP
                     LIVVINDTLMDNHQQLIANKFEQQKLLWAIHARVPEMVRALERSEGEQLCKIGSSYNK
                     QFEQLLCAVACE"
     gene            complement(<311690..>312349)
                     /gene="GET1"
                     /locus_tag="KLMA_50145"
                     /db_xref="GeneID:34716759"
     mRNA            complement(<311690..>312349)
                     /gene="GET1"
                     /locus_tag="KLMA_50145"
                     /product="Golgi to ER traffic protein 1"
                     /transcript_id="XM_022820121.1"
                     /db_xref="GeneID:34716759"
     CDS             complement(311690..312349)
                     /gene="GET1"
                     /locus_tag="KLMA_50145"
                     /codon_start=1
                     /product="Golgi to ER traffic protein 1"
                     /protein_id="XP_022676616.1"
                     /db_xref="GeneID:34716759"
                     /translation="MDSWLYVILAFLVLDRVWPLVETLLQGFIQANSSRLKDLMRQRG
                     DLILAQKEISAQDEYAKWTKNNRALDKINKQIEEEKKALLAQVDGTKATLKKFKLAAI
                     TVPFTFLKFYKGKMPIYELPKGIFPNYLQGLMQHGWIYVPLGPLNLKKVSEGATVTVS
                     LGIWLFALLKVVSTLNQMWNAFTSPAVPAPAVSTPAVPAVPAETETETSVSHPVDQPV
                     D"
     gene            <313058..>313888
                     /gene="CKB1"
                     /locus_tag="KLMA_50146"
                     /db_xref="GeneID:34716760"
     mRNA            <313058..>313888
                     /gene="CKB1"
                     /locus_tag="KLMA_50146"
                     /product="casein kinase II subunit beta"
                     /transcript_id="XM_022820122.1"
                     /db_xref="GeneID:34716760"
     CDS             313058..313888
                     /gene="CKB1"
                     /locus_tag="KLMA_50146"
                     /codon_start=1
                     /product="casein kinase II subunit beta"
                     /protein_id="XP_022676617.1"
                     /db_xref="GeneID:34716760"
                     /translation="MSLIEAANDSSDSGAYEEWIPTFCSRFGHEYFCQVPTDFIEDDF
                     NLTGLSQEVAYYRKALDTILDLESTSDEEDEKPANGKGHDDQQQVTRSIIEHSAEQLY
                     GLIHARYILTKPGLQAMAEKFDRKEFGTCPRYYCGSIQLLPCGLSDTLGKQTVRLYCP
                     SCQDLYIPQSSRHLSLEGAYWGTSFPGVFLKHFKELEDYVEKKSKDTYELKIFGFSIA
                     KEAVCGPRMRWLRQYPKTDEEWEEFKKCEFEIPSSLLEDAKDTDPNSGSNDINSSNSK
                     "
     gene            complement(<314133..>314696)
                     /gene="JAC1"
                     /locus_tag="KLMA_50147"
                     /db_xref="GeneID:34716761"
     mRNA            complement(<314133..>314696)
                     /gene="JAC1"
                     /locus_tag="KLMA_50147"
                     /product="j-type co-chaperone JAC1"
                     /transcript_id="XM_022820123.1"
                     /db_xref="GeneID:34716761"
     CDS             complement(314133..314696)
                     /gene="JAC1"
                     /locus_tag="KLMA_50147"
                     /codon_start=1
                     /product="j-type co-chaperone JAC1"
                     /protein_id="XP_022676618.1"
                     /db_xref="GeneID:34716761"
                     /translation="MYRFLVRKYSSEGSKNLFQLFPKTFVHGKPQWEVDLKKLRKEYR
                     QLQSEYHPDVLTSTVNDMSSQLNKAYKTLSKPLTRSQYILSLHGIDLSQDGEAQKVMS
                     KDPQLLMQVLDVHEQLEDISGESDLKVIEQANKQRLKDCEERLKKAHESQDWEAAATL
                     TVELRYWSNLDNAIKEWEPGKPILLTH"
     gene            <315249..>316748
                     /gene="ATE1"
                     /locus_tag="KLMA_50148"
                     /db_xref="GeneID:34716762"
     mRNA            <315249..>316748
                     /gene="ATE1"
                     /locus_tag="KLMA_50148"
                     /product="arginyl-tRNA--protein transferase 1"
                     /transcript_id="XM_022820124.1"
                     /db_xref="GeneID:34716762"
     CDS             315249..316748
                     /gene="ATE1"
                     /locus_tag="KLMA_50148"
                     /codon_start=1
                     /product="arginyl-tRNA--protein transferase 1"
                     /protein_id="XP_022676619.1"
                     /db_xref="GeneID:34716762"
                     /translation="MNLAEKLIISRPLYISDSDDPKCGYCKGQKDNDNKFATEGWRDL
                     HKDDLDTIKFQSTTVGFHTELITAEMYDKLCNLGYRRSGNFIYKTDMLRNCCRLYTIR
                     TNKTYLKMSKELKMCLRKFKKNITSAEFKPKSHYSDWVEELCDYQSNSSTFKTVFEPA
                     LFSEEKFQLYVKYQESIHHDEGNTRDQFESFLCNSPFSEEEIMGTSEEWEQLNNWFNL
                     KSDDVILRNGPVHECYYHNGKLIAVAVLDFFPSGISSVYFIWDPDYSKWSLGKVSALR
                     EIAILSKINRPYYYLGYYIEDCPKMNYKAKYGGEILDVCNNKYIPLSKVSPMLKNGEL
                     FVGTNQPTGALRQEIDTLSTEKVNFEENFHNAADEIYGPNGVAFETSNQSAQLLKRYG
                     LNYDVTKTRDIYIHNDNNDKTDPHSRSRIHRFPNFVPGLVPLTEILEYFEKGTIREVN
                     RNTMIFDTRFHSIRVLKDLELENSDTKTAICDVIRLIGLNNTKNAIVII"
     gene            <317025..>320207
                     /gene="KAP122"
                     /locus_tag="KLMA_50149"
                     /db_xref="GeneID:34716763"
     mRNA            <317025..>320207
                     /gene="KAP122"
                     /locus_tag="KLMA_50149"
                     /product="pleiotropic drug resistance regulatory protein
                     6"
                     /transcript_id="XM_022820125.1"
                     /db_xref="GeneID:34716763"
     CDS             317025..320207
                     /gene="KAP122"
                     /locus_tag="KLMA_50149"
                     /codon_start=1
                     /product="pleiotropic drug resistance regulatory protein
                     6"
                     /protein_id="XP_022676620.1"
                     /db_xref="GeneID:34716763"
                     /translation="MDINQIVSLIESFNSSHDSKVINDIQNTLQEHQKSDHGIDLANA
                     LLSLDNVSANVKYFGALTYTVQLTSCLHSESQLWSIFQGNLIHLTRLIVMYTTHPTDN
                     SSLIVTITKLMSNLSFIFLTVNQNSDGSINASKFPPWHNPVNTCIKLLQHCNESNLNQ
                     WNVNNTEISQNLIQSSMNAEVSYAELIECIKSSEALNKLVLLFTKVIVEDLNKYQSKR
                     NSMSQVYEVVHQHLYISTMAILNYNLENMMSPNFSSEVFQCITSWINYISMARSVSTQ
                     GNMDLTEIFNNAINLMCITNANSVEFPYSESVISIFDDVFSNDPTLMSFEIRAKLEAI
                     FLGVSRHSVNLSNDWMMAYMNHLVTNGLYEDLKVLASCVVDFLQISNLDVCNKLFTNI
                     HGDTDENTLMEYIKVLLQLTNFPLVPILQETYSSKMVEFWLDLAEAYGNLSQESLKPN
                     ANEIAENIFNQVVQIYLPKNSLMNKQKILEEDDDQSLIHEFDDFRSATQDLMEILWTI
                     LGHSKLTIVLIQGVGQADTNNVDLYQVEAMSFLLAKLLDGVNFSQSPFISDAIGENKL
                     IDNLLYLLQTGCKQKETTKTAQILKLDFVKATCTLLGVMATYFHVDSKPLGPIVQCLF
                     ECLETSRQYNTVEYAIKMELQLNKTLSLICEHCRRELIPFLPDFIVVLRSIMLPTSPV
                     SHFTREKFVKSIGNIIQMCVSEGPEAQATHISNMVDMIGGLMQNTTDKSDMLSLLSCL
                     SELGSGLSQLPDDEEFIENNPQYLQQLPIFQSYWQQDPMRIRDKVMQLVQYALSQHAT
                     DSEFVEVSCLVIGKAICLPDDIPHFLRYPLSDIISFLHSCASNCNYPAALPYIEYQLE
                     KAITGFKDELTPQAFDEIFKQFFLNYYEEYITSDPDLIQSMVSWVNSVLESKPHLALK
                     SQYWSSFIVPEFLKFLQAKEKFTISSTTKFWIKTLNNRRYTQEDTEFINNMFGSMGKQ
                     LVYQTMYSLFHAQRSDVPQYAELIRTLFAKYSMPMKGWLTEVLPEITGKPITFHERFI
                     NKLTVTRASRATSNIVLEWWLDCNGLPSLQ"
     gene            <321282..>322715
                     /gene="ARO8"
                     /locus_tag="KLMA_50151"
                     /db_xref="GeneID:34716764"
     mRNA            <321282..>322715
                     /gene="ARO8"
                     /locus_tag="KLMA_50151"
                     /product="aromatic amino acid aminotransferase 1"
                     /transcript_id="XM_022820126.1"
                     /db_xref="GeneID:34716764"
     CDS             321282..322715
                     /gene="ARO8"
                     /locus_tag="KLMA_50151"
                     /codon_start=1
                     /product="aromatic amino acid aminotransferase 1"
                     /protein_id="XP_022676621.1"
                     /db_xref="GeneID:34716764"
                     /translation="MTGCKDLSHLLSDEAKIRKPSPIKTTMKYFSDPDIIFLGAGMPP
                     GDMFPFQSVSFESVSLDDDTSSSSTVKGCIGTNKDDLELQDDIPLGRALQYGNSRGQP
                     ELVSFLKEHSTIFHNIRYDDWDLITTAGSTQAWDACLRLFCNKGDTVLLEEYTYSSSV
                     EAATAQGLNCVAMKTDNHGIVPEELEKLLQNWNSHSQGPFPKLLYTIPNGQNPTGSTL
                     KDERKPAIIKLASKFDLLIIEDDPYYFLQMNEFGQPQSTIPDDLSSDPKEAKTQLLGQ
                     LSKSLLEWDYEGRVIRMDSVSKTFAPGCRLGWVIGPKYLLDNLWNYHEVSMQSTCGFA
                     QTVINGMLQRWGQIGYMKWLLKLRNSYSIKRDHSLNQCFKYLPKDICSVNLPTSGMFF
                     MVFIDAKKHPQFESKFQSNTDLMEQYLYEKFVNRGLLLACSSWFRVDPQKKDTLAFRG
                     SYASVSAGKMEKGIRTLGDVIREEFQV"
     gene            <323167..>325755
                     /gene="HIR1"
                     /locus_tag="KLMA_50152"
                     /db_xref="GeneID:34716765"
     mRNA            <323167..>325755
                     /gene="HIR1"
                     /locus_tag="KLMA_50152"
                     /product="protein HIR1"
                     /transcript_id="XM_022820127.1"
                     /db_xref="GeneID:34716765"
     CDS             323167..325755
                     /gene="HIR1"
                     /locus_tag="KLMA_50152"
                     /codon_start=1
                     /product="protein HIR1"
                     /protein_id="XP_022676622.1"
                     /db_xref="GeneID:34716765"
                     /translation="MKLLKLPWLQHREEHKSYEIYTCDVSPDSMRLATGGLDGKVRIW
                     SVPDIVRFAKNPEIAMDKNVTLKPLSTMSRHAGSVTTVKFSPDGKYLASGSDDRILLI
                     WELEAGPVQPMLGGESTDVEHWNVRRRLVAHDNDIQDICWAPDSSIMVSVGLDRSIII
                     WNGATFEKVKRFDVHQSHVKGVVFDPANKYFATASDDRTIKMFRYHKTGETSFSVEHV
                     ITEPFKGSPLTTYFRRLSWSPDGQHIAAPNAMNGPVSTVAIIERGTWESSISLVGHDQ
                     PTEVASFNPRIFKRKKAKAIEDKTEDGETIDVKKSRSADDVDCIVASSGQDKTLAIWS
                     TSKARPILVAQDICSKSVTDMSWTPDGNVLFITSLDSSIVVLVFDDDEFGNAIPLEQN
                     IEYLHRYGVDKDSLVFPETVDQLILEDEAKKSRKSTVDLSLLENRLGKPGTIAEPNIL
                     QVRSKKKVNLNDKKTADATNYEPPHVNILQVKRKNKITGVTEVLNDTVMKNGKKRVAP
                     TLVSMGHSPDKGKKRATLQSGGTSLNSSLSQNSTKGGSEDRVSSANTLSKLQKSKLSK
                     SSFNIPRLGIHTLIMGMKERARDNFFNQSSVESSLEENAVDVMQTPQPADQEVAEEHI
                     LTLNSKTTIDKIWRDEPNTRYLEFNSILPDADAVLREMGRIDDLYVLEVRNGVERSIQ
                     FDTEALYDNPTRVIGYHTGQRSFELFFPDVVLSCVGSMEMKTWVLATTTGQVYFIDTL
                     GQARCPRISIGHKIIKLSTSGRHVVAITETALIYVWDLEKMTMTHKQIPLLPLLARDP
                     ITGNRARFTSKIKAIRVTENDHIEITMTDSDPISEQATTAAIQFNYSSDLCCWCSNAA
                     ELSASV"
     gene            <326341..>328695
                     /gene="LEU1"
                     /locus_tag="KLMA_50154"
                     /db_xref="GeneID:34716766"
     mRNA            <326341..>328695
                     /gene="LEU1"
                     /locus_tag="KLMA_50154"
                     /product="3-isopropylmalate dehydratase"
                     /transcript_id="XM_022820128.1"
                     /db_xref="GeneID:34716766"
     CDS             326341..328695
                     /gene="LEU1"
                     /locus_tag="KLMA_50154"
                     /codon_start=1
                     /product="3-isopropylmalate dehydratase"
                     /protein_id="XP_022676623.1"
                     /db_xref="GeneID:34716766"
                     /translation="MSQAATKPSGPQTLYDKVFQDHVVHKDESGSYLLYIDRHLVHEV
                     TSPQAFEGLRNAGRKVRRVDCTLATVDHNIPTVSRKDFVDIASFIKQADSRLQVETLE
                     QNVKDFGVTYFGMSDDRQGIVHIIGPEQGFTLPGTTVVCGDSHTSTHGAFGALAFGIG
                     TSEVEHVLATQTIIQAKSKNMRIYVDGPLSPSVTSKDLILHIIGVIGTAGGTGCVIEF
                     AGQAIEELSMEARMSMCNMAIEGGARAGLIQPDQTTFDYIKGRPLAPKGAEWEKALKY
                     WKTLHTDEGAHFDYDITIKASDVIPTITWGTSPQDALPITAAVPDPAKISDPIKKASV
                     ERALSYMGLTPNTPLKDISIDKVFIGSCTNARIEDLRAAAAVVKGHKKAESVKLAMVV
                     PGSGLVKKQAESEGLDKIFEEAGFEWREAGCSMCLGMNPDILDPHERCASTSNRNFEG
                     RQGALSRTHLMSPAMAAAAGIAGHFVDIRDHEYRDNDVPKVSIEQEAQDKVLQEAVYE
                     HEKEPLQPGESVDEKSDDEKLDIPPSDHVTQETPAKEAPKSAPSAMDPFLTLEGIAAP
                     IDKANVDTDAIIPKQFLKTIKRTGLKNGLFYEWRFTKDADGKDKETDWVLNVEPWRKA
                     EILVVTGDNFGCGSSREHAPWALKDFGIKCMIAPSFGDIFYNNSFKNGLLPIRLPQDV
                     IESKLSPLANAGAKLTVDLPSQKIMDSEGNVLIEHFDVEPFRKHCLVNGLDDIGITLQ
                     KEEFIQEYEKMRRDRFSFLEGGSKLIKPIKGTKKSPFGVRAQEW"
     gene            complement(<328976..>332689)
                     /gene="SLA1"
                     /locus_tag="KLMA_50155"
                     /db_xref="GeneID:34716767"
     mRNA            complement(<328976..>332689)
                     /gene="SLA1"
                     /locus_tag="KLMA_50155"
                     /product="actin cytoskeleton-regulatory complex protein
                     SLA1"
                     /transcript_id="XM_022820130.1"
                     /db_xref="GeneID:34716767"
     CDS             complement(328976..332689)
                     /gene="SLA1"
                     /locus_tag="KLMA_50155"
                     /codon_start=1
                     /product="actin cytoskeleton-regulatory complex protein
                     SLA1"
                     /protein_id="XP_022676624.1"
                     /db_xref="GeneID:34716767"
                     /translation="MTIFLGVYSVLYDYEAQTDEELSVKEGDLLYLLEKSEVDDWWTV
                     KKRVIGSDQDEPVGLVPSNYIEEAQVNGSVVALYDYAEVQNANEELVFHEGDVFSLYD
                     DRDPDWFLVKNSKTGEVGFVPGNYVEKQGSAPAASASASTSTPAPVPISELPPPPQRV
                     DLKPATQSSEKHTSAASMSSPTTEVQKSHAHAEPAAPAMPQRPSTTDHQTSYGEEPSS
                     QRKSRAYDNYEDDEDDEDIPPLPSRSGATATTGAARSSSSGAPSSTVEHVWSVNEIDG
                     RKKRKAKLTVSADRIHFFSAKTKVDQEWGVADLISYDNEKKHLFLEFKNPYINLELHT
                     GSTDTANEIIGVLGEIKGAHVAVGLREVKDASRPVLMKKRAKVIYDFFANADDELTVR
                     EGEYVNILDDKTSKDWYMCESVETNKRGIVPAQFVQTRKSGSGSQGDKDVSPSKQRTR
                     SRSNTTRSMSSAGNQNLPGSWKEDADQDLSKKKSKTGGFFSKKKKTESKTSSSSSQHA
                     DKEKDFPDPKKVRIWVDRTGTFKVEAQFLGCVDGKINLHKVNGVKIAVAADKLSEDDI
                     LYVERLTGMSMEKYKPRSKSTNGDSSVVNQERERRRKLKERERELEERERDRQLREQE
                     LKELQRTRALLEQEREKMRQAQDKELPPVQPPRPGSEGSKQHRSVPSTTNKPDYDWFE
                     FFLNCGVDVNNCQRYTINFEREQISEEILQDIDPTLLRNLGLREGDILRVMKYLDNKY
                     GRKQEASPSTGLFTEADGTLKVNHTGAANSAGVSHNLLPAEAPASKDDDAWTVRPAAK
                     AAETSNKSHDFSGSLQDLLDLKPLEPKKKEAPAPDVKHLEPVSAQHTSKPEESVTENK
                     TGTSLVPLDPFKTGGNNLIPIATGGIVMMPVATGGLVPFQATGGFLPMQRTGGLVTSQ
                     STGFLPLQRTGGLVAPQTTFGMHPTGTVLPVQKTANGLIPANTGGLIPQTTFGLQQSS
                     TFTGNLNAGPLPLQRTGGGLPQTSFGAQPLQPTTTFGNQFTGGANIQPVNTFGNQLTG
                     GAMGMQPQTAFGNQLTGGAMNMQPQTTFGNQLTGGMNMLPQTSFGNQLTGGMNMQPQT
                     TFGNQFTGGAMNMQPQPNLGNQLTGGQLLQQSQISFNNQLTGGANMPQQFGTSIPQTS
                     FGALQPTGGFQPQSSFGLNLQRTGGMNAGPQTSFNNQTSVNQVTTSFQNMGLSQQPLQ
                     NQPTGFGFGNGPQAQQQRQANIYNASADNPFGF"
     gene            complement(<333746..>334261)
                     /locus_tag="KLMA_50156"
                     /db_xref="GeneID:34716768"
     mRNA            complement(<333746..>334261)
                     /locus_tag="KLMA_50156"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820131.1"
                     /db_xref="GeneID:34716768"
     CDS             complement(333746..334261)
                     /locus_tag="KLMA_50156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676625.1"
                     /db_xref="GeneID:34716768"
                     /translation="MSSNSNLFDLEAQLAFYKAYHNTSGNVFIHSIFVPTILFTSMRI
                     LNDVEVYGGYKLSQILAAAFGIFYIALKVPTGVLASAILVGMNKVLNDGTVDITAKTA
                     WILFVVSWIFQFIGHGVFEKRKPALLDNLVQSLVLAPYFILFELLFSIGLMPDLKKSL
                     QARVDAERKSR"
     gene            <334588..>335328
                     /gene="SCL1"
                     /locus_tag="KLMA_50157"
                     /db_xref="GeneID:34716769"
     mRNA            <334588..>335328
                     /gene="SCL1"
                     /locus_tag="KLMA_50157"
                     /product="proteasome component C7-alpha"
                     /transcript_id="XM_022820132.1"
                     /db_xref="GeneID:34716769"
     CDS             334588..335328
                     /gene="SCL1"
                     /locus_tag="KLMA_50157"
                     /codon_start=1
                     /product="proteasome component C7-alpha"
                     /protein_id="XP_022676626.1"
                     /db_xref="GeneID:34716769"
                     /translation="MSTAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAVRSQSC
                     SVVISQKKVPDKLLDPKTVSYIFPVARHIGFCATGPIPDARNIALRCKAEASEFRYKY
                     GYDIPCSVLAKRMANLSQIYTQRAYMRPLGVILTFISYDEETGPAIFKCDPAGYYTGY
                     KATATGPKQQELNSTLEKHFKKLGSDKLDEDSWEKVVEFGITTLIDSLGTDFGKNDLE
                     VGVAVKDKFFTLTAEEIEERLVSIAEQD"
     gene            complement(<335418..>335882)
                     /locus_tag="KLMA_50158"
                     /db_xref="GeneID:34716770"
     mRNA            complement(<335418..>335882)
                     /locus_tag="KLMA_50158"
                     /product="chromatin structure-remodeling complex protein
                     RSC14"
                     /transcript_id="XM_022820133.1"
                     /db_xref="GeneID:34716770"
     CDS             complement(335418..335882)
                     /locus_tag="KLMA_50158"
                     /codon_start=1
                     /product="chromatin structure-remodeling complex protein
                     RSC14"
                     /protein_id="XP_022676627.1"
                     /db_xref="GeneID:34716770"
                     /translation="MGYYDAISALNVADGPEQVAFTKNQLVFLAKEEIQQRKDRDTLK
                     KSDEVEGRRVPVHEYLGPLSAKQAEAAAFAEYHWDHQLLGPYVPKSKLESLSATEFAA
                     YFDKRQFEEGRRALERVSMVPAVVLPINNGPGEVVYGDMGGRPRHQQRQYRQ"
     gene            <336364..>338568
                     /locus_tag="KLMA_50159"
                     /db_xref="GeneID:34716771"
     mRNA            <336364..>338568
                     /locus_tag="KLMA_50159"
                     /product="GAL4 domain-containing family protein"
                     /transcript_id="XM_022820134.1"
                     /db_xref="GeneID:34716771"
     CDS             336364..338568
                     /locus_tag="KLMA_50159"
                     /codon_start=1
                     /product="GAL4 domain-containing family protein"
                     /protein_id="XP_022676628.1"
                     /db_xref="GeneID:34716771"
                     /translation="MVNEVKKRTKPCISCKLSKVKCDYTVSLPCKRCLKLGINCQYGN
                     NSRSVPIPVPLAGPVHAQGTLPGMVPMPIPTNGMPQPQPQPQMQQPRRVPAQTMNNVT
                     TDLNMQGGNNPQIWAHSVDNRLNNFESLLETILSALYNNKIEQQTRMDQMQNEINSQA
                     TLTQNLITSQKTNRQAPIRLPNLSELEQSIDMSKRVQHTRQESPPVTAYPKYLNPLDR
                     NGNGNGGRTDDHDVKDFRTESVITKQEAHKLLDHFVKYFGPHLYGFPFDGLNVDNLWN
                     DSPLLLVAICTITCAHYPNLDSKFEALNSSLHWFASQLLRTPDSNMNLEHDILGLIIA
                     SLWLSQSKMFSSLAIQLARTWRIDQLYSPKLEKLWYLLYILDGTENLTSHKSPSIYKD
                     MEPIIKDSRRSVIEKLENTSTEGQFFRKALIDYDQNTKHTATHKQLELLNEVRSEKFE
                     LDNTTLQDLRLLTQLEYHMAMESVFHNKNTHLSSLHDESLEATMTLLPTEKFGIPWTN
                     NMDLDKWMISWTIALQNIKMQNDPWCFKSTLLYYNFARMHINTKALLQGKKSALIGDV
                     GSSELVNLWHSQTPTNRTKVDSTELSATKEISRSSAITLLKLATKDKDLVPIFQFFPV
                     HIYIMLYYASLVVLNPSMINEISQKEAQQGFTLVTKFKNVLEDVAISDRVLKKNLVKA
                     LSQLLQNFKLEFSAINKDSRKVYELIDHEKTTTPNEKQRPILAWPGTNPGHP"
     gene            <338869..>340107
                     /locus_tag="KLMA_50160"
                     /db_xref="GeneID:34716772"
     mRNA            <338869..>340107
                     /locus_tag="KLMA_50160"
                     /product="BAR super family and SH3"
                     /transcript_id="XM_022820135.1"
                     /db_xref="GeneID:34716772"
     CDS             338869..340107
                     /locus_tag="KLMA_50160"
                     /note="Src homology 3 domains"
                     /codon_start=1
                     /product="BAR super family and SH3"
                     /protein_id="XP_022676629.1"
                     /db_xref="GeneID:34716772"
                     /translation="MELKTDSFKQQLSSLGDKVLKTPQQVKQRLYTGPRTKDVTVEEL
                     KNRFEVVHGCGIQLLHGCNQFSRNIQSLLVHFQRTIEIFNAIYDIKNDPDKSHRDFES
                     LQKRFEIIKNKIEGDLPFFDQNVVLPIQNFHATCGNIQNTIDKRDLASYKADSLKHKL
                     ASISPQKLRTPGLKYENEKIKAESKYEKALKEYEPLNDQIRSELGIFLQMANSFFHDW
                     FLNHYYITYSMYYNMYTFIGTCAEVRRIVIDSQTGIGTQDEFSPNSQQMISMIDIANN
                     NLTTQFHNDFDVIAQEIKKLGISDFESFYARSTANANARRLLEGTNAEYSPIRHSSDI
                     DSTRAYRHDQDFGLQYCKATTDFVPSPEDAENTLALRKDDVVKVYRKETEDWWYGQSL
                     RTNKIGYFPLHCTTMANGLR"
     gene            <340647..>342413
                     /gene="DAK1"
                     /locus_tag="KLMA_50161"
                     /db_xref="GeneID:34716773"
     mRNA            <340647..>342413
                     /gene="DAK1"
                     /locus_tag="KLMA_50161"
                     /product="dihydroxyacetone kinase 1"
                     /transcript_id="XM_022820136.1"
                     /db_xref="GeneID:34716773"
     CDS             340647..342413
                     /gene="DAK1"
                     /locus_tag="KLMA_50161"
                     /codon_start=1
                     /product="dihydroxyacetone kinase 1"
                     /protein_id="XP_022676630.1"
                     /db_xref="GeneID:34716773"
                     /translation="MAVEIKSFEVSDPLNASLAGFAEINKNLTLIPKEKVFFRTTEKD
                     KVALVSGGGSGHEPAHAGFVGKGCLSAAVCGDIFASPSTKQILNAIKVVAQNSKGVVL
                     IVKNYTGDVLHFGLAAERARALGIDCSVVVVGDDVAVGRNKGGLVGRRALAGTVLVHK
                     MVGAFTEKYSARYGVEGVVKVAHAINENLVTIGSSLDHCKVPGRKFETELNGKQMEVG
                     MGIHNEPGVQVLDSIPSVEELVEKHMLPKLLDPKDKDRHFVEFDDSDEVVLLINNLGG
                     VSNFILTAIVDVTRKYLKDNYKIVPVETVCGTVMTSFNGNGFSITLFNASRASATIKK
                     EIKEIDSVLELLREPTDAPGWPVKEPEVKKAPSFDESLLEDVIDVQKAGAYDFAKVSE
                     LLKAGAEQLVKSEPHITHLDNQVGDGDCGYTLVAGAKAITENLNSVSSKYLSQTLAEF
                     SDHIESAMGGTSGGLYSIFISGLSKGIIEECGDDNDAQVDKQKFGRALQTAYDTLCKY
                     TRARPGDSTMIDALEPFVKEFSSSHDFHQAFLKAEKGAKSTGNLEAKFGRASYVEDTE
                     AIPDPGAVGLVEFLKGVDSKLN"
     gene            <342761..>344434
                     /gene="POB3"
                     /locus_tag="KLMA_50162"
                     /db_xref="GeneID:34716774"
     mRNA            <342761..>344434
                     /gene="POB3"
                     /locus_tag="KLMA_50162"
                     /product="FACT complex subunit POB3"
                     /transcript_id="XM_022820137.1"
                     /db_xref="GeneID:34716774"
     CDS             342761..344434
                     /gene="POB3"
                     /locus_tag="KLMA_50162"
                     /codon_start=1
                     /product="FACT complex subunit POB3"
                     /protein_id="XP_022676631.1"
                     /db_xref="GeneID:34716774"
                     /translation="MSTDFDRIYFNQSKLSGRFRLAEGGLGWKASASGGSASAQANEP
                     LLLAADEVTSIQWSRGCRGYELKISTKNKGLIQMDGFQQEDFGLLKNDFQRRFNMQLE
                     HKEHSLRGWNWGTLDLARNEMVFSLNGKPTFEIPYKHINNTNLTAKNEIALEFDTQNE
                     NYNPAGDELVEMRLYVPGTVEEEDEDQDQNMVKEEGAEEETKVKSEVKSEEGSEEPEV
                     QEEKTLAEYFYEELRAKADIGDISGDAIISFQDLFFTTPRGRYDIDIYKNSIRLRGKT
                     YEYKLQHRQINKIFSLPKADDIHHLMVLSIDPPIRQGQTSYPFLVLQFQKDEETEVQL
                     NVEDDEFEKLYKDKLKKQYDAKTHIVLSHVLKGLTGRRVIVPGEYKSKYEQCAVSCSY
                     KVNEGHLYPLDNAFLFLTKPTLYIPFQDVAAANISRAGQTSTSARTFDLEVVMRANRG
                     TITFANISKEEQQLLENYLKSKNLRVKNEDKEAEQRLQTAFGSDSDDDDVDINMGSAG
                     EDEESVDEDFHASDEDDDVAEEYDSDASVSDSGDDEDTSSRPPKKAKLE"
     gene            <344671..>346038
                     /gene="ITT1"
                     /locus_tag="KLMA_50163"
                     /db_xref="GeneID:34716775"
     mRNA            <344671..>346038
                     /gene="ITT1"
                     /locus_tag="KLMA_50163"
                     /product="translation termination inhibitor protein ITT1"
                     /transcript_id="XM_022820138.1"
                     /db_xref="GeneID:34716775"
     CDS             344671..346038
                     /gene="ITT1"
                     /locus_tag="KLMA_50163"
                     /codon_start=1
                     /product="translation termination inhibitor protein ITT1"
                     /protein_id="XP_022676632.1"
                     /db_xref="GeneID:34716775"
                     /translation="MNDEGDSLKDEIELIKCMYPEIKIKDHSDELLEGVLDVCMEADT
                     SIMVQYGDQAIDIDELPYNKVHFVIEKCYYPDYNKSLEWKIQSPWLTDEDCSKIRELM
                     SSEFQEMSNEVGSPLIYLLLDTLSHRALSTLTTRNNHNDKRIYDCKDAGQWEKFQHLK
                     SDFETYQQLYENYRCCICIEDKKGFDMVRLPCSSHLLCKDCIKEYYHAMIHEGRIESI
                     RCPECDYKPRDLSSFKSFDELKTYLFLPAIPYDFFSGLLNDKDVERYKTLHIQEAFMK
                     LAQYSPYSCVRCPSCENWCAKDDLDEQMVCCNSCEMVFCFDCLHAWHGKYNSCGTRVA
                     IDLKYVEEYADECTTPQRKRELEIKFGKRMMELELDSYLADRMFEMFLEDKNSGTTKC
                     PGCQTVIEKSEGCNKMKCTVCLKYFCFLCRAMLHQQDPYAHYNDPFSPCMGKLFEGMP
                     GTEQI"
     gene            complement(<346131..>346712)
                     /locus_tag="KLMA_50164"
                     /db_xref="GeneID:34716776"
     mRNA            complement(<346131..>346712)
                     /locus_tag="KLMA_50164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820139.1"
                     /db_xref="GeneID:34716776"
     CDS             complement(346131..346712)
                     /locus_tag="KLMA_50164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676633.1"
                     /db_xref="GeneID:34716776"
                     /translation="MKKTTVKAPNRPNTNHHTGLRATFMLEKESSGPSVGLIKPASLK
                     EFKGVTMDLHKLAAEWQSDIKRDEVQRQLLQNEFLSSVTEASKTQLENVDEKADISSL
                     NWDQMYEVSAELMDNYSKEMEGILGELDEVYKKWFMWQEAAFTIDSHRGATRIAKAET
                     WIKSKENYLRYTKEELESSAKVIKTAIEELSQK"
     gene            complement(<346951..>348073)
                     /gene="ERV41"
                     /locus_tag="KLMA_50165"
                     /db_xref="GeneID:34716777"
     mRNA            complement(join(<346951..347942,348043..>348073))
                     /gene="ERV41"
                     /locus_tag="KLMA_50165"
                     /product="ER-derived vesicles protein ERV41"
                     /transcript_id="XM_022820142.1"
                     /db_xref="GeneID:34716777"
     CDS             complement(join(346951..347942,348043..348073))
                     /gene="ERV41"
                     /locus_tag="KLMA_50165"
                     /codon_start=1
                     /product="ER-derived vesicles protein ERV41"
                     /protein_id="XP_022676634.1"
                     /db_xref="GeneID:34716777"
                     /translation="MASLRTFDAFPKTDEQHVKHSSKGGLSSVLTYLFLLFIAWSEFG
                     SYFGGYVDQQYIVDDQVRETVPINLDLYVNMPCKHIQIHARDITGDRRFVSEDVEMEG
                     MPFYIPIGTRLNEMNEIVTPELDEILGEAIPAQFRESFPSSGDGQDNFNGCHIFGSIP
                     VNKVKGELHITAQGWGYRSQARVPEDQLNFAHVINELSFGDFYPYIDNPLDNTGKFSE
                     NNVKAFYYFTAVVPTLYRKMGAEVDTYQYSLSEAEYGPKSKATSIPGIFVRYQFEPMK
                     IVVTDNRIGFFSFILRLVDILALIIYSMSWLFRFADRLIILVLGPKWSLRYSRDQTPS
                     HGLLED"
     gene            complement(<348307..>349467)
                     /gene="SMA2"
                     /locus_tag="KLMA_50166"
                     /db_xref="GeneID:34716778"
     mRNA            complement(<348307..>349467)
                     /gene="SMA2"
                     /locus_tag="KLMA_50166"
                     /product="spore membrane assembly protein 2"
                     /transcript_id="XM_022820143.1"
                     /db_xref="GeneID:34716778"
     CDS             complement(348307..349467)
                     /gene="SMA2"
                     /locus_tag="KLMA_50166"
                     /codon_start=1
                     /product="spore membrane assembly protein 2"
                     /protein_id="XP_022676635.1"
                     /db_xref="GeneID:34716778"
                     /translation="MKFKYLSFIILTFFSLLIWFSHLSNFTCTSSANLPICMPQYIFH
                     FKDDTPTSRVLFGTVKEFFSLLSFFTLDFNWDIDLNDLHEKYNQSDLINVFHPSNVYY
                     VNAFGYCKEQTHDAKLDRYCMDNTNGLNIISVLVRDLGFQFGVLSENNVKITSDSFWI
                     IYQTLVSSFNKFLEDDKRGNTLLKMITPNDPEEMEQLKTKLWIVNIYDTVNIILKWTV
                     VTNCILASLCLMLLLFWIYMKIEHKKNQSPIKQLNWNVNSICIATRWISVSNVIITFL
                     YILHILMLAFMINCFRYKRLQIIHASLGSGAWFHISRFFVELIFAILCFKWMRSEAAV
                     TAETPTGSDPGSGSGSGSTPIDNDQEKETDDNYSVLNPASGVTAVDGYLSTV"
     gene            complement(<349673..>350857)
                     /gene="ECM7"
                     /locus_tag="KLMA_50167"
                     /db_xref="GeneID:34716779"
     mRNA            complement(<349673..>350857)
                     /gene="ECM7"
                     /locus_tag="KLMA_50167"
                     /product="protein ECM7"
                     /transcript_id="XM_022820144.1"
                     /db_xref="GeneID:34716779"
     CDS             complement(349673..350857)
                     /gene="ECM7"
                     /locus_tag="KLMA_50167"
                     /codon_start=1
                     /product="protein ECM7"
                     /protein_id="XP_022676636.1"
                     /db_xref="GeneID:34716779"
                     /translation="MRLNNFAPWRFLTVTLFHLDAFDTMMLWVRFGLSLSIIIFVLVL
                     TAFSAIYPDKLFLGRFDTSSVDIFQGLFDKLSSSVVDDWYTGLNNGLGLTTSEVLVLT
                     KYLESQVHDLPKYVKTSVYGWCTTKYAEEEVWQQDGTWKQIHNSTTETSCRFEGAHYL
                     MNYRDLLNELGLGLVLSFAYGYKYKSGQLIDDTPEGKSFEKYIITFSWRKYQLLSVLY
                     AIGVMELAILVGIFPYYNLKYNPLRQRMSRILLHSLSVLKLLIFALAVVTVVCFTIIT
                     LSMRYKISIELDSYGFSYHLGGAWFTFLWLFAFSNIASCLLWSGYEWCITNPSILHDS
                     EETTFMLGVHMIPMQKSSAGSRKNINIEETSYEGNLIRTNSSDTVYSRAEAILPSSAF
                     HF"
     gene            <351313..>353943
                     /gene="ORC1"
                     /locus_tag="KLMA_50168"
                     /db_xref="GeneID:34716780"
     mRNA            <351313..>353943
                     /gene="ORC1"
                     /locus_tag="KLMA_50168"
                     /product="origin recognition complex subunit 1"
                     /transcript_id="XM_022820145.1"
                     /db_xref="GeneID:34716780"
     CDS             351313..353943
                     /gene="ORC1"
                     /locus_tag="KLMA_50168"
                     /codon_start=1
                     /product="origin recognition complex subunit 1"
                     /protein_id="XP_022676637.1"
                     /db_xref="GeneID:34716780"
                     /translation="MASTLAEFEQNWLIHKTDLDGNPLAESIGRRRKRGEASVQEVIN
                     LVRTDGLKLRPGTTIFCKDEGTNEVSAYMIHEIRLNTSNYVELWCFNYLSWFELKAVE
                     YFKQLNPDFYERNKEKGDKFFEEELASKVVKNELYLTAELSEIYLRDIEFVAKMLSEE
                     EFYKSSKEQKQDPHAYLCRYGCLPSGTNLARLDIHSCEKSVLEMPPKVSLSYLRDITV
                     PKTGKSNGKSKSNSQSQSQSPSKQGSNANASDRSISQSHNQYPSKLNDPDSAYSDVSS
                     DNEASDNYQSAEEELEDSQDDENDKPAENKRRKTSQSIIAPPESPTKHQIITQTTSSS
                     SAYSSPRKYFKNNTVRAKKAYTPFSKRYTNPNDIPDLNNIFQQDNNDLDIAALEDKFR
                     TVSAKGKIETIFSKVKKQLNSRNSKEEILKAADFENYLPARENEFASIYLSLYSAIEA
                     GTSTSIYIAGTPGVGKTLTVREVVKDLITSAGQKELPKFQYIEINGLKIVKASDSYEV
                     FWQKISGEKLTSGAAMESLEFYFNKVPATKKRPIVVLLDELDALVTKSQDVMYNFFNW
                     ATSPNAKLIVVAVANTLDLPERHLGNKISSRIGFTRIMFSGYTHEELKTIINLRLSHL
                     NESSFYVDPKNGNSYMITPDDEREQAIDTNSEKENKPDFTNFKRVKLRINSDAIEIAS
                     RKIASVSGDVRRALKVIKRAVEYAENDYMQKHQESQSAKSNSAVNDTYEEIQTVEIKH
                     VTKALNESSSSAEQQFISNLSFSGKLFLYALVNLIKKKQGEIQLGDIVDEMKLLIDVN
                     GNSKYILELKRILFQNDSVDTKEQLRVISWDYILMQLMDAGIVVRQYLKNERLSSIKL
                     NISMEDVEQCLKNDEVLKSF"
     gene            complement(<354125..>354793)
                     /locus_tag="KLMA_50169"
                     /db_xref="GeneID:34716781"
     mRNA            complement(<354125..>354793)
                     /locus_tag="KLMA_50169"
                     /product="protein TEM1"
                     /transcript_id="XM_022820146.1"
                     /db_xref="GeneID:34716781"
     CDS             complement(354125..354793)
                     /locus_tag="KLMA_50169"
                     /codon_start=1
                     /product="protein TEM1"
                     /protein_id="XP_022676638.1"
                     /db_xref="GeneID:34716781"
                     /translation="MSTDKVPSLRHQVRVKVGLIGDAQVGKTSLMVKYVQNVFDEEYT
                     QTLGVHYLERKVVLGSTDVIFSIMDLGGQREFINMLPLVSEGAVAIVFLFDLTRPETL
                     NSIKEWYRQARGFNETAISILVGTKYDLFVEMDSKYQEEVSRTAMKYAQVMKSPLIFS
                     STQSSINVQKIFKVVIAKAFNLTLKVPEYKQIGEPLLIYKSLGPTRPPSPNKRQVHTP
                     PPSS"
     gene            <355794..>356561
                     /gene="RPS1"
                     /locus_tag="KLMA_50170"
                     /db_xref="GeneID:34716782"
     mRNA            <355794..>356561
                     /gene="RPS1"
                     /locus_tag="KLMA_50170"
                     /product="40S ribosomal protein S1"
                     /transcript_id="XM_022820147.1"
                     /db_xref="GeneID:34716782"
     CDS             355794..356561
                     /gene="RPS1"
                     /locus_tag="KLMA_50170"
                     /codon_start=1
                     /product="40S ribosomal protein S1"
                     /protein_id="XP_022676639.1"
                     /db_xref="GeneID:34716782"
                     /translation="MAVGKNKRLSKGKKGLKKRVVDPFTRKEWYDIKAPSTFENRNVG
                     KTLVNKSVGLKNASDSLKGRVVEVCLADLQGSEDHSFRKVKLRVDEVQGKNLLTNFHG
                     MDFTTDKLRSMVRKWQTLIEANVTVKTSDEYVLRIFAIAFTRKQANQVKRTSYAQSSH
                     IRQIRKVISEILTREVQNSTLAQLTSKLIPEVINKEIENATKDIFPLQNVHIRKVKLL
                     KQPKFDLGALLSLHGEASAEEKGKKVAGFKDEILETV"
     gene            complement(<356865..>357908)
                     /locus_tag="KLMA_50171"
                     /db_xref="GeneID:34716783"
     mRNA            complement(<356865..>357908)
                     /locus_tag="KLMA_50171"
                     /product="THO complex subunit MFT1"
                     /transcript_id="XM_022820148.1"
                     /db_xref="GeneID:34716783"
     CDS             complement(356865..357908)
                     /locus_tag="KLMA_50171"
                     /codon_start=1
                     /product="THO complex subunit MFT1"
                     /protein_id="XP_022676640.1"
                     /db_xref="GeneID:34716783"
                     /translation="MSLQEEAVEKRLSLYHFSKVFPNYLSQLQQIQSLVQRLLDHNLN
                     ENDQLSIEEVKNLRVSLEDKYLEAKNFVETERLSYNALDVSLERTVDNTKNGMESQLS
                     VLRDLREELAERNDRLHQLHLDIADFNEESVHLNTHSTTLKCTKSEWINNVLEDEASF
                     DKLLEYRVFKPVGNGLYSVTEELFDGEIELKRMNQLMKKDIDRLKMDLDDYKQKWLDN
                     YDTMSKIGSIIKGKLNERSNGSEENEDDYEEEEEAIERIKKNDVYESEDDGEERSSFN
                     TDEEEDEEEDEDEYGIEQDEEDIDIADSGADADADVKVEIGENAVDSNDSTGLNEGEN
                     NNDGDADQEMNDA"
     gene            <358185..>360218
                     /gene="SEC39"
                     /locus_tag="KLMA_50172"
                     /db_xref="GeneID:34716784"
     mRNA            <358185..>360218
                     /gene="SEC39"
                     /locus_tag="KLMA_50172"
                     /product="protein transport protein SEC39"
                     /transcript_id="XM_022820149.1"
                     /db_xref="GeneID:34716784"
     CDS             358185..360218
                     /gene="SEC39"
                     /locus_tag="KLMA_50172"
                     /codon_start=1
                     /product="protein transport protein SEC39"
                     /protein_id="XP_022676641.1"
                     /db_xref="GeneID:34716784"
                     /translation="MNPQLYLCASVFSTRGDSERVSRVLRAIRSDHDDDKIAILKLIS
                     VLWPEMDDPMKLAFVWDASESNGTDDENDLLISLIQEDTLLTAIVEMDIDTITIRMNT
                     VSSFIEEKLGKFGLEFGSDSMMEDFLRARTLVVNSVNKDALCTVDLLQQSHKDSLKSW
                     IEGTLKPLAHLNRRLDPGSKLSIYELESLSIQDVVATMWDLPVKEPSVVRSMMLYELK
                     PYLEERKTYEPFYQVIFNEANFPLDTFDNFQIFKFLSNNPLIDDTKFKTTKWEIIYNH
                     CINLRNIPLPNMLFELESIIKSFGDDSQIYSGMSLKQWLINIRFMNAMDIKDLKSLKQ
                     LKNEDSLAQASYFSMIAQNMFQGRIGIETVQSILEFIDSSILFDKLSVDVQTSIVLET
                     LLKHGNFDVLEQFASSSGIKIADRVIIQHFWRFFNAASSASRSDINLKNAGRTLNLLN
                     DKNANSNLFDILALVNRLSHYSLSFKRGVPFRPVHLLEFKSNPMEIIEKLLDLNPKLR
                     KDIDTTFALLQEIYGVLKIKPSDDNFTKEFSKLLAEHINNSLANGDFNFAFDQALKLV
                     DRPGASDHWVTIFQVGKYIDPNWIDGETPTEIIYLQLGILSKLLHVCPEKEYEVIVSQ
                     WSSLELELSTRNLISDKYSLENYQRSNDNFMNDVSTNVGNFLSGKFQWNLGSS"
     gene            complement(<360310..>362868)
                     /gene="PIF1"
                     /locus_tag="KLMA_50173"
                     /db_xref="GeneID:34716785"
     mRNA            complement(<360310..>362868)
                     /gene="PIF1"
                     /locus_tag="KLMA_50173"
                     /product="DNA repair and recombination protein PIF1or
                     ATP-dependent helicase PIF1"
                     /transcript_id="XM_022820150.1"
                     /db_xref="GeneID:34716785"
     CDS             complement(360310..362868)
                     /gene="PIF1"
                     /locus_tag="KLMA_50173"
                     /codon_start=1
                     /product="DNA repair and recombination protein PIF1or
                     ATP-dependent helicase PIF1"
                     /protein_id="XP_022676642.1"
                     /db_xref="GeneID:34716785"
                     /translation="MWRNHQRLVSNYRFFGSFLGPRRTPFLSSFHTVGYQQNLLSSYA
                     PKHNPERKSMQNKPIPEDLIEIIDDSLEEIGNPSYDAWDTSGDDDILMHVADLEKLNP
                     RFSIQQDNWKKQHQHPNLPAMEFAKKPLKEEKNLNSNNESDRKLTAKVPKLERLDTID
                     DLAEHENKLKTEQKHENITYQDKERSRPSDDHPKLQLSHNRQITFLTQQMSMNEYTSN
                     DSRESSVTPDSGRKRVRAITLSEEQEHVIELARRKMNIFYTGSAGTGKSVLLKELIKT
                     LKSMYGNTGAVAVTASTGLAACNIGGITLHSFAGIGLGIGDEAMLLKKVRRSAKHRER
                     WKSIKALVIDEISMIDGNLLDKLDGIAKTIRRSKKPFGGIQIILCGDFFQLPPVTKSN
                     QQLKFAFQSYAWRTAIDATIILRKVFRQQGDHRFIEMLNEMRTGVISNQTLEEFRQLS
                     RPLPNDDIVPAELFSTRSEVDGANYSRLRTLPGETMTYDASDGGVLENEDLRKKLLEN
                     FLAPKKLELKIGAQVMNIKNIDATLVNGSLGKVLAFLDSDTFAFLKGPFKSNKILSDE
                     DVDQLSENPQLEDYWSEEEDTTAKQSKQRKKEVELEKSFMQQQKERIQIESPLSDTVF
                     DFFMTDSSNLSERLKKNVERKKQIVRNLHKSARGAKLPLVQFFTPSGDARVVLIRPET
                     WAMEDEKDVPLVSRTQLPLILAWSLSIHKSQGQTLSKVKVDLKRVFEKGQAYVALSRA
                     VSRSGLQVLNFDRTKVKAHDVVVEFYQSLSSASSVMKELNEKKVLCEKDTNDTKAPSK
                     TNQTEPRPQKRNLETMLMNRMTKIKRKKSDEIPGKTIVDLAYESVSENRLSQEN"
     gene            <363327..>364490
                     /gene="OGG1"
                     /locus_tag="KLMA_50174"
                     /db_xref="GeneID:34716786"
     mRNA            <363327..>364490
                     /gene="OGG1"
                     /locus_tag="KLMA_50174"
                     /product="N-glycosylase/DNA lyase"
                     /transcript_id="XM_022820151.1"
                     /db_xref="GeneID:34716786"
     CDS             363327..364490
                     /gene="OGG1"
                     /locus_tag="KLMA_50174"
                     /codon_start=1
                     /product="N-glycosylase/DNA lyase"
                     /protein_id="XP_022676643.1"
                     /db_xref="GeneID:34716786"
                     /translation="MTGKILFQAGELILRNSLHCGQSFRWVNKENTELFYSTVKIGDT
                     HELVFLNQTEDDCVEYDCYNKQNLPKLETFFRDYFRLDLSLDNLMRDWIEVDPERFKY
                     KQHRGVRVLKQDPWETLCSFICSSNNNISRITKMCHSLATQYGDEVGEFEGVKQYSFP
                     SSDQLVSKATEDELRDLGFGYRAKYIMGTAQLMSMEKDGMTDSEYMLSWRTKGKMSYE
                     DAKEKLMMYPGVGPKVADCVLLMGGLGFDEVVPVDVHIARIAERDYKFNSTSKEIEKL
                     QAKYKNFPITRKKVNYKLDVYRKRFQELWGQYAGWAQCILFSQEIGKTVGANSNDKIV
                     QKRKIDEYEEINKIGEKMDIVSVKVEEEEVSIEEYSVTGRPLRKAVKRAKKVY"
     gene            complement(<364709..>365707)
                     /gene="MRPL4"
                     /locus_tag="KLMA_50175"
                     /db_xref="GeneID:34716787"
     mRNA            complement(<364709..>365707)
                     /gene="MRPL4"
                     /locus_tag="KLMA_50175"
                     /product="54S ribosomal protein L4"
                     /transcript_id="XM_022820153.1"
                     /db_xref="GeneID:34716787"
     CDS             complement(364709..365707)
                     /gene="MRPL4"
                     /locus_tag="KLMA_50175"
                     /codon_start=1
                     /product="54S ribosomal protein L4"
                     /protein_id="XP_022676644.1"
                     /db_xref="GeneID:34716787"
                     /translation="MFAAKRGFHSTVNAAARTRFTKPKPKPPKRENVRPPTQKTHHDA
                     DLKVTAPIPPAAANLKCPDDHPLWQFFSDKKFLRTPDELDTLSRSWSIPELRRKSFND
                     LHSLWYACLKEQNILMREIHLVRFQFDGQTEGYDELNEKIRTTMWRIRHVLSERDWAF
                     RNASKEFESEKEAFVQKFEKEFLEAPANEDEEAFESLQRFQLAVYGISEYIDENKVDR
                     TFVDGLKAIATLKLKKFSPRNEEIKLFLEESNNEIVDAGESFLLYTSDNTLEGVLEAC
                     KAVRELRESGSSVSRYDEIETVAEYVNKLAQAQLAKAAEAEVKLQEEDAKTNANVL"
     gene            <366180..>366431
                     /gene="LSM3"
                     /locus_tag="KLMA_50176"
                     /db_xref="GeneID:34716788"
     mRNA            <366180..>366431
                     /gene="LSM3"
                     /locus_tag="KLMA_50176"
                     /product="U6 snRNA-associated Sm-like protein LSm3"
                     /transcript_id="XM_022820154.1"
                     /db_xref="GeneID:34716788"
     CDS             366180..366431
                     /gene="LSM3"
                     /locus_tag="KLMA_50176"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm3"
                     /protein_id="XP_022676645.1"
                     /db_xref="GeneID:34716788"
                     /translation="MSDTPLDLLKLNLDGRVYVKLRDARELVGTLQAFDSHCNIVLSD
                     AKETIYELEDGELKSTEKFAEMIFVRGGLVTLVTTPEDE"
     gene            complement(<366649..>371088)
                     /gene="NTE1"
                     /locus_tag="KLMA_50177"
                     /db_xref="GeneID:34716789"
     mRNA            complement(<366649..>371088)
                     /gene="NTE1"
                     /locus_tag="KLMA_50177"
                     /product="lysophospholipase NTE1"
                     /transcript_id="XM_022820155.1"
                     /db_xref="GeneID:34716789"
     CDS             complement(366649..371088)
                     /gene="NTE1"
                     /locus_tag="KLMA_50177"
                     /codon_start=1
                     /product="lysophospholipase NTE1"
                     /protein_id="XP_022676646.1"
                     /db_xref="GeneID:34716789"
                     /translation="MWFFSYFLPKVKSILLLQFHITLPLNYLVILLIGTVVFTYLGLR
                     SRILSNYSNLKNDVSDENNINRTEYIDASSAPFLLNHEKHKGFTSYLDEFLSAIKIFG
                     YLEKPVFHELTKSMKTEKLQEGEIILLDDSIGFTIVVEGTLQILHKVENRRMGAFSSS
                     QDFDSPFVSPMDDDGYLINGERFQLLNIVKSGNPLSSLVSILKLFSNSPVQPPSSMQD
                     EERAQRLSTSGDSSDAQSPRINITGHINSFLDSTVHHRFNTTDGSCNTINTNNSNNSN
                     STNNINNSNTSSNDNRASTPISPIEFDSNFDNMSESSSNTTSPKLPELIARASSDCTI
                     AIIPSSSFQRLLAKYPRSASHIIQMILTKLYRVTFQTAHTYLGLTNEIIFTEFQSMNK
                     DSVKLPEVFRRSIIGYFTDQQDNSASTAKSKKQKRPQMHRLDSNSSVSYGSRHVVLNS
                     RDQYNPGDLLSNVPLPRLSTPQRNNLSASTSSSTLSTGDNKPKLLNNFSTSHFEETET
                     SSWRLALIDIIFQQLDITKDTIQRPVSDNISLSEQFPDDQSLRRRSSYSSFASLSSSV
                     ATQSSNRLVTFLPKEAHQFSRLEKKGNKLPKLRKNLQEPNVSRSREEKTHPLDEHRNE
                     KNNNDGQFSDFETVKEDFSKCIKILRFEGNETILYQNSNPQGIFYVVSGEVDVISETT
                     NPDTNESHERILYTVSEGFVLGCLSSILGCKSLVSLKVSKGPAYLALIPYDDLERLCD
                     KYFMIYLRLSEMLTNSLSPNLLRLDYFLEWIHLDSSETLFNQGDPANGVYLVLNGRLR
                     QLFYEDEESDVVTQMAELSKGESFGEVEVLTAINRLNTVVAIRESELARIPRTLFEFL
                     AIEHPSIMIHVSRMVAKKAMLMNFKSGIGFTGTEKKSKAVKRNTDDQKRFDFNLNIKS
                     NQSSKKNNSWSNTVNYKTITILPITEGLPVEEFAYKLINALRSCGKSTIGLNQRTTLS
                     HLGRHAFDKLSTLKQSGYFSELEELYEIVVYIADTPVSSSWTQTCISQGDCILLLADA
                     MREPKVGEFERLLLKSKTTARTDLVLIYPERFVVPGSTSKWLKNRIWIQSHHHVQFTP
                     SDKIHEPEPILNNKPLSQLVEKFKENTKRTQESFVKYLPDSIKTTVETLSGKYINPKA
                     NSKFYTSVNPVKNDFLRLARILSGQAVGLVLGGGGARGLSHLGIIKALEERGIPVDII
                     GGTSIGSFVGGLYAMDYDLVPMYGRVKKFAGRVGSVWRTLTDLTWPVTSYTTGHEFNR
                     GIWKTFRDYRIEDFWLPYYCNSTNITESVQEIHTSGVAWRYIRASMSLAGLLPPIVDN
                     GNMLLDGGYVDNLPVTEMKQRGCRIIFAVDVGSVDDRTPVSYGDSLNGFWIILNRWNP
                     FSKHPNIPNMAEIQMRLGYVASVNALERAKNTPGVVYMRPPIENYATLDFGKFEEIYQ
                     VGVAYGHDFLQHLQDTNQLPQIAGTTGLVLSDKQNMLQRRNSI"
     gene            complement(<371522..>372835)
                     /gene="CAR2"
                     /locus_tag="KLMA_50178"
                     /db_xref="GeneID:34716790"
     mRNA            complement(<371522..>372835)
                     /gene="CAR2"
                     /locus_tag="KLMA_50178"
                     /product="ornithine aminotransferase"
                     /transcript_id="XM_022820156.1"
                     /db_xref="GeneID:34716790"
     CDS             complement(371522..372835)
                     /gene="CAR2"
                     /locus_tag="KLMA_50178"
                     /codon_start=1
                     /product="ornithine aminotransferase"
                     /protein_id="XP_022676647.1"
                     /db_xref="GeneID:34716790"
                     /translation="MVVTAEFNLSSAKTIEYEQKYSAHNYHPLPVVFSKASGAHVWDP
                     EGNEYLDFLSAYSAVNQGHCHPHIISALVDQASKLTLSSRAFSNDCFAAFAKYVTEFF
                     DYEAVLPMNTGAEAVESALKLARRWGYMVKKIQPDEAIILGAQGNFHGRTFGAISLST
                     DEEDSRLNFGPFLDNVTAKIPGGAKGEFIRYGEIEDYKRAFESHGDKICAVIVEPIQG
                     EAGIVVPKPEFLTNLQQLCKQHNVLLICDEIQTGIARTGKLLCYEHSPNCKPDIVLLG
                     KAISGGVLPVSCVLSSREIMACFTPGSHGSTYGGNPLASRVAIAALEVVQNENLVERS
                     ARLGEFLQNGLRELQKESNGIIKEVRGKGLLTAIVIDHDKANGRTAWDLCLLMKEQGV
                     LAKPTHENIIRLAPPLVISEEDLLKGIDSIRQSLSKLPTVPKSNH"
     gene            <374074..>374541
                     /gene="DIF1"
                     /locus_tag="KLMA_50179"
                     /db_xref="GeneID:34716791"
     mRNA            <374074..>374541
                     /gene="DIF1"
                     /locus_tag="KLMA_50179"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820157.1"
                     /db_xref="GeneID:34716791"
     CDS             374074..374541
                     /gene="DIF1"
                     /locus_tag="KLMA_50179"
                     /note="RNR_inhib super family conserved domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676648.1"
                     /db_xref="GeneID:34716791"
                     /translation="MSNQSPTKKQLHNAIQPTQIQYEYQDKLSTIGMRIRQAVDNGYK
                     GVTVGSNGVSGAASSTGNAMAADNNGSGFSNICVQDNTRFTIPEYKRVALTKQAPMLV
                     NQRTVSMNSNLEQWEQNLDQRLSSIDDDIMRNKLGANDFLSGASKRSFDDLEF"
     gene            <375287..>378370
                     /locus_tag="KLMA_50180"
                     /db_xref="GeneID:34716792"
     mRNA            <375287..>378370
                     /locus_tag="KLMA_50180"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820158.1"
                     /db_xref="GeneID:34716792"
     CDS             375287..378370
                     /locus_tag="KLMA_50180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676649.1"
                     /db_xref="GeneID:34716792"
                     /translation="MGNTDSKLIIYKEHLLRLATDEIIPLYGTSTSTDSLISSKTGQT
                     NGNAKSADFAAGAGKTATSNGRNNGNTNFKNILSPFDPFYTNLVSADLPPQYLSTYLN
                     TTELRAILQHNKTNFTNLLHFLTYSIIQYSSFPKSLKDPNNRRSLTNCLRILCKLIPV
                     LFEQSDLEGCLEAEVFWSKTTWPNVLSLNSGHSEVSNTATVGIPDSPYNSSSGNTNSS
                     SINSTSVNVDYKPSPQDSLRVTIPNQQDPLDPCFLGAKLLSALVVLSSQEGFVYGSEV
                     ISQTSPLSSVHYDIHLLDILRLFITLLSKPLYKPSQTNRFLESFLMDSNSAFKIHELA
                     SSLLKVIVRFDPRVIDPIKKSLFYTSLQFFNITMKFTSEDDEQIILLFFQTLSPKMVA
                     DKIYQPLQDILSIIIEGEDLSNFQSCLPIFQFLFNLFLLNPETRTELSSRFGTVLLTT
                     LIIYAKVISQERYCKPMLQFVAHFMAYLSSLPQIHQMSSSNLKSCQLTFLSEKVRNQP
                     ISIREFCIIQLVRHIIPILTTQDAVVDPCYIETLYNLLRIPSSLNYSACMSIQNLLTT
                     FHESIQLPVTYSSHYSHSLSFKLDLLSVLIHALVSNILEDFQHNKILLFVLCRNEAVL
                     QQLLQLIENLSQDESRNKPLAPAMITKESDFPLPILHGHKSFIERLDFDYNLLDSDIT
                     LVKLRPSWPIGMSLRSKQKLKWDSVLAKTWLGNKYAYALIKAIQIINSEFPSILKITR
                     KEDLKRVLLHLKIFEPTLMKLMEPVIPLPLTRRNTTCRYLSWDHFSWMKDKSVAYWFD
                     YLLWSDVFNSTSDKVYISEQDIDSFGPLSSPGNSNSGSGSGTVNSRQSNRLERFNSNG
                     SILSRTNTNDDMKPKNSFEHVPGNNRDISGNGVSPNNNTSNNNNNINSNNSNNMNSNN
                     GNSSGNNRNSGSSSSSWFRMPWSSHDDGKNHNNNSTNNTNSHVTENMEYYKTLSKPNI
                     WTGTNIRLFPLVVEECESEFSFVDMTSSLLKRLRFNSTASLSSMETYHTLNTNYT"
     gene            complement(<378391..>379026)
                     /gene="TSR2"
                     /locus_tag="KLMA_50181"
                     /db_xref="GeneID:34716793"
     mRNA            complement(<378391..>379026)
                     /gene="TSR2"
                     /locus_tag="KLMA_50181"
                     /product="pre-rRNA-processing protein TSR2"
                     /transcript_id="XM_022820159.1"
                     /db_xref="GeneID:34716793"
     CDS             complement(378391..379026)
                     /gene="TSR2"
                     /locus_tag="KLMA_50181"
                     /codon_start=1
                     /product="pre-rRNA-processing protein TSR2"
                     /protein_id="XP_022676650.1"
                     /db_xref="GeneID:34716793"
                     /translation="MEVVTHIDESDFVEAVEGRNSLEFGDEKQQARFELGVSMMVYKW
                     DALDIAVANQWGGPESEEKRDWITGVIVDLFKNEKVVDVQLIEETLVYAMFDEFETNV
                     EDDSALHIAAGIISVYRECANEDYSTVERLFLNWNENKDKKQPRKIVVTGDSSDEEDE
                     GEEGSDEDMDMCDHDHDHAHKHEPEETSEIPEPVVDEDGFELVQKKGKKRY"
     gene            <379373..>381010
                     /gene="CMP2"
                     /locus_tag="KLMA_50182"
                     /db_xref="GeneID:34716794"
     mRNA            <379373..>381010
                     /gene="CMP2"
                     /locus_tag="KLMA_50182"
                     /product="serine/threonine-protein phosphatase 2B
                     catalytic subunit A1"
                     /transcript_id="XM_022820160.1"
                     /db_xref="GeneID:34716794"
     CDS             379373..381010
                     /gene="CMP2"
                     /locus_tag="KLMA_50182"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 2B
                     catalytic subunit A1"
                     /protein_id="XP_022676651.1"
                     /db_xref="GeneID:34716794"
                     /translation="MSQEAIENTRKINAALRVIESKPTVSDNDKKRGLKEYVMEDGTV
                     CSTQERVVKSVPPVAATVPRDDELFKDNGLPDHQFLKQHFIKEGRLSRDQTMRILQMV
                     TDILAKEPNLLQLNSPLTICGDIHGQYYDLMKLFEVGGDPSETPYLFLGDYVDRGSFS
                     FECLLYLYVLKINFRDTFFLLRGNHECKHLTSYFTFKAECLHKYDLSIFEACCKTFNF
                     LPLAAVMNNQYFCTHGGISPELVTVQDVNKINRFREIPSKGLMCDLMWADPIENYDEE
                     TESDDRFVPNSLRGCSYAFTYKAVCAFLKRNGLLSVIRAHEAQDQGYRMYRNTKTMGF
                     PSLMTLFSAPNYLDTYKNKAAILKYGDNLMNIRQFNMSPHPYWLPNFMDVFSWSLPFV
                     GEKVTEMLIAILNICAEEELDEEIPVIDNDVGNLDRDDNSQTSEESKKNILDEAKRKS
                     LRNKIMAIAKVSRMYTVLREESEKVQYLKTMNAGTLPKGALSHGSEGLSETLSEFERA
                     RKEDLINERLPAKLEDLELEREKYYKEMLEKIKRDEL"
     gene            complement(<381306..>383254)
                     /gene="IMD4"
                     /locus_tag="KLMA_50183"
                     /old_locus_tag="KLMA_50184"
                     /gene_synonym="IMD3"
                     /db_xref="GeneID:34716795"
     mRNA            complement(join(<381306..382420,382801..>382840))
                     /gene="IMD4"
                     /locus_tag="KLMA_50183"
                     /old_locus_tag="KLMA_50184"
                     /gene_synonym="IMD3"
                     /product="inosine-5'-monophosphate dehydrogenase"
                     /transcript_id="XM_022820161.1"
                     /db_xref="GeneID:34716795"
     CDS             complement(join(381306..382420,382801..382840))
                     /gene="IMD4"
                     /locus_tag="KLMA_50183"
                     /old_locus_tag="KLMA_50184"
                     /gene_synonym="IMD3"
                     /codon_start=1
                     /product="inosine-5'-monophosphate dehydrogenase"
                     /protein_id="XP_022676652.1"
                     /db_xref="GeneID:34716795"
                     /translation="MKREFGFAGFPVTEGGKMPGKLLGIVTSRDIQFVEDDSILVSEI
                     MTKDVVTGKKGITLEEANQILKSTKKGKLPIVDDENVLVSMLSRTDLMKNQSYPLASK
                     SATTKQLLCGAAIGTIEADKERLALLVDAGLDVVVLDSSQGNSVFQLNMIKYIKETYP
                     DLEVIAGNVVTREQAASLIAAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTEF
                     ANKFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFYRDGKRLKTY
                     RGMGSIDAMEKTDVKGNAATSRYFSESDKVLVAQGVSGAVVDKGSVKKYIPYLYNGLQ
                     HSCQDIGVVSLTELREKVDNSEVRFEFRTASAQLEGGVHNLHSYEKRLHN"
     mRNA            complement(<382790..>383254)
                     /gene="IMD4"
                     /locus_tag="KLMA_50183"
                     /old_locus_tag="KLMA_50184"
                     /gene_synonym="IMD3"
                     /product="probable inosine-5'-monophosphate dehydrogenase
                     IMD4"
                     /transcript_id="XM_022820162.1"
                     /db_xref="GeneID:34716795"
     CDS             complement(382790..383254)
                     /gene="IMD4"
                     /locus_tag="KLMA_50183"
                     /old_locus_tag="KLMA_50184"
                     /gene_synonym="IMD3"
                     /codon_start=1
                     /product="probable inosine-5'-monophosphate dehydrogenase
                     IMD4"
                     /protein_id="XP_022676653.1"
                     /db_xref="GeneID:34716795"
                     /translation="MPFQDTAKALEALKAYEEKDGLSVSQLMDSKTRGGLTYNDFLIL
                     PGKIDFPSSKVNLATKLTKKISLNAPFVSSPMDTVTESEMAIHMALLGGIGIIHHNCS
                     AEEQAEMVRKVKKYENGFINQPVVISPQLTVGEAKIMKREFGFAGFPVTGMF"
     gene            <384745..>386073
                     /gene="ATG23"
                     /locus_tag="KLMA_50185"
                     /db_xref="GeneID:34716796"
     mRNA            <384745..>386073
                     /gene="ATG23"
                     /locus_tag="KLMA_50185"
                     /product="autophagy-related protein 23"
                     /transcript_id="XM_022820164.1"
                     /db_xref="GeneID:34716796"
     CDS             384745..386073
                     /gene="ATG23"
                     /locus_tag="KLMA_50185"
                     /codon_start=1
                     /product="autophagy-related protein 23"
                     /protein_id="XP_022676654.1"
                     /db_xref="GeneID:34716796"
                     /translation="MDLNTVLLQQQEVETLLSNLQDTHKRVLNSETGTNEDLDRIRRD
                     ILICLNDLRKVNLMIIDSRDGLIKKSVAKLEKYEDRLKALQAEEAIIEEKLNEWTTEE
                     RASTSHSSQKDKDKDEQWGSISIKLVGNHSSILNSYIDTVGIENTTLADDGNEEDANH
                     HTPMETAAKFTREQLLDNVQKLRLCEEQVNVEIEQLRSLLSQYEKDKSIITDELRRNN
                     DHIQGEINSLLREKDRINDQRRKILRKLGLIKDHDQIQTHKSKLLFSLSALTAPDNSD
                     FDIALSQAFEFIDAKKQVLKKILRENKAQTSILHHRFSTWEEVLQLVQGLEANLQKEF
                     VERNGNVPRETIATMINNTLKQVISIMGNEKEDSTFTSIHCEINALQRALKELNIERI
                     STPTPIRSSSKAPDILQMGKSPPKVGISREFASNMSQSVDDFSLKSNKND"
     gene            complement(<386377..>392379)
                     /gene="SEN1"
                     /locus_tag="KLMA_50186"
                     /db_xref="GeneID:34716797"
     mRNA            complement(<386377..>392379)
                     /gene="SEN1"
                     /locus_tag="KLMA_50186"
                     /product="helicase SEN1"
                     /transcript_id="XM_022820165.1"
                     /db_xref="GeneID:34716797"
     CDS             complement(386377..392379)
                     /gene="SEN1"
                     /locus_tag="KLMA_50186"
                     /codon_start=1
                     /product="helicase SEN1"
                     /protein_id="XP_022676655.1"
                     /db_xref="GeneID:34716797"
                     /translation="MTTNPVGIDPAIISAALPFKNQILNSLDDKVGPDFEELSLVTKI
                     VETIGPLIHDKNYHFFCDKDLGPVISFLVIIFSVPREQQAIEWYCDKFAPILASCQDC
                     CKSFYSFKNRIIKRYIENKGIAYSNIDGFDLMICRWRADTLTKRLGGISSDNLTKEQE
                     IAFCECFWYPRVLKHSQNLKVLFNNAFCLLKEKNHPLLSYSTENVLSKLSSGTVFLLM
                     EGTPIQISHSLGLLDWMYDRNDMITLENMPLDALQEINTHYIYLISKQFGKDLQPSAL
                     ALNSMGIAWIRLTALFSLMTKEVMEHHFLEPKFTQSLKNAGTREVPSIIHLWYNWFSV
                     PNPERPLDVMLKVLNLFLDKFGQDFWTYLKPFNFHTLLDLIFAQGTFANTLLRKQDFP
                     ILKDGKETWLSLDGSVSDLITWCIPFYNSLSSAKKMQMVKKISTGFLMTICECSKLLR
                     TLPKLLLMSYSLQLLNNVLEIDEKKGSLLYKNSDLQNELYTVADCRKVVNHPKISQLL
                     CDTVQSPEIVFPGMQVESLSLSAMKVLANCVEYDILNLCETTFNLYSGKTINKHHILD
                     LDMRRFFLNPLIQNINLSRLGTNGPKHALYIMAALRNANGLMTLTAKGMEIENQNKLT
                     QEYINVIKQLVMKCSELPSDELIKILSDRNAAHGLWSCLFSSDSELYQEATNILYEVF
                     NVEGRLEGLQELFKSSLSTSLHCISVVLKQLTKTKFFEPCPRAIRMMMDVLTLFNEPV
                     TGIFSNYEKLKDDESDKELFNFWGASWKFLDMIYLETIQWTSKHSNVVLENFTRDVLD
                     VSNMLMVSYREFSDVLVKGKVTENDLFKFPMSPFKNMLYWLRLNDEQLLASCVKLIVS
                     ASDLAKEKQFQFDEMLVLDMVKYASKARKYPNKLSPAQSQELLERARFFNVALTNEVV
                     KESEKYHLEKELLKKGIKANVPNTDIKSALQSSHQVLTKPSMTSGQRADLMLKKANAG
                     SSLTSRPKGQSTLSSYGFFKPGGTPTVSSAPSKPLSRFELERKKLLEKRVIHPPQNQV
                     FNTRPSIHAKKEESSSEDESDFENAAELFAVAKSKARTYSPGVLDINGKEIKKSTTAA
                     DLRQLEEENMRRRLNVDLAPFYEKILKWDYKRTSEYPDDQENNYSDVKDTFKSASAYQ
                     SIMEPLLLLECWQGLCSARDREEQKSFSFVVGNRTVVSDFYEVYASINKDVVRDTGIN
                     DSDLIVLGYFPDRVSSKPLTDKEFKRTQYTCLAKIKELKNSKGDSMDLTFRIHRNHKF
                     SNFLTLRSEIHALKVMQMTTVEREYSSLKGLPYYDLVDQILKAQPSVPESMDLKEIER
                     IKTKFSLNASQAKAILSTVSTQGFSLIQGPPGTGKTKTILGIVGYFISKAKKNSNTVT
                     HTIITPTTTTSTEQLLERQKVLICAPSNAAVDELVLRLREGVLDYSGNIFHPEIVRIG
                     RSDAVNDSIKDLTLEEKVDRKLGGSDYDMVQDSALNQKFQETLQKRRMLTDKLNKENG
                     NPNSTLSSADIADIQMQIRDLRKAISEMGKQKDEIRESNSLKYRNREIDRRKAQARIL
                     AESDIICSTLSGSAHDVLASLGVKFDTIIIDEACQCTELSSIIPLRYGGKRCIMVGDP
                     NQLPPTVLSGAASDMKYNQSLFVRMQKNCSPYLLDVQYRMHPAISKFPSLEFYKGKLQ
                     DGTHVQEINKREWHGKYPFGPYKFFDIVTGKQKQNMKTMSYTNPEEIKVAIELVDNLL
                     SNYETNYDFTNKIGIISPYREQMQSMRNQFRRYFGDQIRSYVDFNTIDGFQGQEKEII
                     IISCVRADDNSTSVGFLRDFRRMNVALTRAKCSLWILGHHKSLVNNKLWKHLISDAKE
                     RNCLELACPGFLNPSDKFAQDTIQKFKGSHDYIANLDTYDPYQNNVPSDGDRNKHRFS
                     DHSSSNQHSKKKLKLENWKKQRTESASESANENQKPNDFKSSPATKVPGRKKKSSIFS
                     ASRTALGSPLDNASRLGAHTDADGSYKPKPYINDSSSDSKRK"
     gene            complement(<393123..>396788)
                     /gene="RPB2"
                     /locus_tag="KLMA_50187"
                     /db_xref="GeneID:34716798"
     mRNA            complement(<393123..>396788)
                     /gene="RPB2"
                     /locus_tag="KLMA_50187"
                     /product="DNA-directed RNA polymerase II subunit RPB2"
                     /transcript_id="XM_022820166.1"
                     /db_xref="GeneID:34716798"
     CDS             complement(393123..396788)
                     /gene="RPB2"
                     /locus_tag="KLMA_50187"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB2"
                     /protein_id="XP_022676656.1"
                     /db_xref="GeneID:34716798"
                     /translation="MSEYYDEDPYGYDDEEAAISAEDSWTVISAFFREKGLVSQQLDS
                     FNQFINYTIQDLILEDSTLILEQLAQHTTETDNISRKYEISFGKIYLAKPSMTESDGV
                     SHAMYPQEARLRNLTYASGLFVEIQKRTYQAVDIPGRDLKYEIIHEESEENEENNKIF
                     IGRVPIMLRSKYCLLDDLTESDLYRLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQ
                     VFKKSAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSTSRTIKATLPYIKQDIPI
                     VIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEEGFVIQDRETALDFIGRRGTA
                     LGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDR
                     DHFGKKRLDLAGPLLAQLFKTLFRKLTRDILRFMQRSVEEAKDFNLKLAVKATTITAG
                     LKYALATGNWGEQKKSMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQL
                     HNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPLPIITFLNEWGMEPLEDYIPH
                     QSPDATRVFVNGVWHGIHRNPAKLVDTIRKLRRKGDITPEVSIVRDIREKELKIFTDA
                     GRVYRPLFIVDENTKTGRKELKVKKGHVRKLMLTEYQDIEGGFDDEEEMNYTWTSLLN
                     EGLVEYIDAEEEETILIAMQHEDLEPAVQQATETEEELDPARRIRAAHHANMFTHCEI
                     HPSMILGVAASVIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQK
                     PLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSY
                     MDQEKRIGMSITESFEKPHRTNTLRMKHGTYDKLDDDGLIAPGVRVSGDDMIIGKTTP
                     IPPDAEELGQRTAFHSKRDASTPLRSTENGIVDQVLITTNQEGLKFVKVRVRTTKVPQ
                     IGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSK
                     VAALSGNEGDASPFTDITVDGISRLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTY
                     YQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKE
                     RLMEASDAFRVHICGICGLMSVVAKLKHNQFECRSCKNKIDIYQIHIPYAAKLLFQEL
                     MAMNIAPRLYTDRSKDF"
     gene            <397489..>398208
                     /gene="MRP20"
                     /locus_tag="KLMA_50188"
                     /db_xref="GeneID:34716799"
     mRNA            <397489..>398208
                     /gene="MRP20"
                     /locus_tag="KLMA_50188"
                     /product="54S ribosomal protein L41"
                     /transcript_id="XM_022820167.1"
                     /db_xref="GeneID:34716799"
     CDS             397489..398208
                     /gene="MRP20"
                     /locus_tag="KLMA_50188"
                     /codon_start=1
                     /product="54S ribosomal protein L41"
                     /protein_id="XP_022676657.1"
                     /db_xref="GeneID:34716799"
                     /translation="MPRFLPSLKQGFRNLATTVETETASSQLNTSRQSVQSRILEWSR
                     KAIDEGKPHFRVGGTEVFFPKARVILLRPNAKHTPFQAKFIVPKSFNKLDLRDYLFHL
                     YGLRALNVTTQLLHARYTRATPVSPRYRTPQIKKMTIEMAEPFIWPEEPEDKSAWNIE
                     FQKELEQYRSDRMRLGSDTNKPSEAFGGALGPYPETAKPFIPRFLKRRLINKKEREAK
                     REEYLEQLGKVSKVLSKSELV"
     gene            complement(<399002..>399613)
                     /gene="ORM1"
                     /locus_tag="KLMA_50189"
                     /db_xref="GeneID:34716800"
     mRNA            complement(<399002..>399613)
                     /gene="ORM1"
                     /locus_tag="KLMA_50189"
                     /product="protein ORM1"
                     /transcript_id="XM_022820168.1"
                     /db_xref="GeneID:34716800"
     CDS             complement(399002..399613)
                     /gene="ORM1"
                     /locus_tag="KLMA_50189"
                     /codon_start=1
                     /product="protein ORM1"
                     /protein_id="XP_022676658.1"
                     /db_xref="GeneID:34716800"
                     /translation="MSQLKPFPSYGQESVNSASGIEPVKDHRRRRSSSIISHVEPESF
                     EDENDQQMMTNMNATWVNQRGAWIIHIVIIGLLRLFFNLLPGVTNEWSWTLTNITYVI
                     GSYIMFHLVKGTPFDFNGGVYDNLTMWEQIDDGVLYTPTRKFLITVPIGLFLVSTHYC
                     RYDLHLFLLNFVLTTFVAVVPKLPLTHRLRISIPWITGPAQIS"
     gene            <400614..>400978
                     /gene="ACB1"
                     /locus_tag="KLMA_50190"
                     /db_xref="GeneID:34716801"
     mRNA            join(<400614..400640,400742..>400978)
                     /gene="ACB1"
                     /locus_tag="KLMA_50190"
                     /product="acyl-CoA-binding protein,ACBP"
                     /transcript_id="XM_022820169.1"
                     /db_xref="GeneID:34716801"
     CDS             join(400614..400640,400742..400978)
                     /gene="ACB1"
                     /locus_tag="KLMA_50190"
                     /codon_start=1
                     /product="acyl-CoA-binding protein,ACBP"
                     /protein_id="XP_022676659.1"
                     /db_xref="GeneID:34716801"
                     /translation="MVSQLFEEKAKAVNELPSTPNNDELLKLYALYKQATVGDNNKPK
                     PGMFNLKDRYKWDAWELLKGTSQEDAEQQYIELVDLLIKKYSA"
     gene            <401764..>404349
                     /gene="KAP95"
                     /locus_tag="KLMA_50191"
                     /db_xref="GeneID:34716802"
     mRNA            <401764..>404349
                     /gene="KAP95"
                     /locus_tag="KLMA_50191"
                     /product="importin subunit beta-1"
                     /transcript_id="XM_022820170.1"
                     /db_xref="GeneID:34716802"
     CDS             401764..404349
                     /gene="KAP95"
                     /locus_tag="KLMA_50191"
                     /codon_start=1
                     /product="importin subunit beta-1"
                     /protein_id="XP_022676660.1"
                     /db_xref="GeneID:34716802"
                     /translation="MSASEVAQFLENIIVTPDPTVRLQAETTLKKLSNDNFLQFAGLL
                     SQILADSSVRLEARILAGLTLKNELISKNPTKAQQFAQRWSTQIDPDSRHHIKQFTLQ
                     ALVDPETRVANAAAQLIAAIAEIELPLNQWPELMKIMVDNTAQDQPENVKRASLLALG
                     YICESANQSDETLINQSNNILIAIVQGAQSNEPSKVVRLTALNALADSLAFIKNNMER
                     EGERNYLMQVVCEATQAQDEDIQAAAFGCLCKIMSLYYFYMKPYMEQALFALTVATMQ
                     SSNEKVAAMAVEFWSTICEEEIDIAFELSQYSNPGLESYNFALVSIQEVVPTLLQLLT
                     KQNEDPDDDDWNVAMSAGACLQLFAQNCGNFVVAPVLNFVEQNITSDNWRQREAAVMA
                     FGSILDGPDKTQLTSLVHQALPPILNLINDPVLQVKETVAWCIGRIADSVVAAIDPQE
                     HLSDVINACLIGLKDHPKVATNCSWTIINLVEQLADTPSSPIYNYYPVLVSALLEASN
                     RTDNEHNARASVFSALTSLVEFANDQVGETTTSISTFVLDKLGQTMQVDEAQLTAEDR
                     QNLHELQSNILSVLAAVIRKNPQSVNPVADMLMDLFMKLLSKSDTTYVEDDVFYAISA
                     LASALGKQFQKYLETFSPYLVNALNQVQSQVCITAVNLIADISNSLEDDFKRFAPSFM
                     NVLGQMLSSPDAKKELQPAVLSVFGDIATNIGSDFVPYLSQVMSVCVIAQNYKPNYNS
                     SDALDYQYKLYESILDAYVGIITGLHDQPDALFPYTGSIFQFINLLADNPSVSLEESI
                     ARTAVGIVGDIAAMYPDGRLKQFYTQPWMTKFIKDVKSNQSFAQTTRDTARWAREQQK
                     LQSNL"
     gene            <405020..>405715
                     /gene="CAX4"
                     /locus_tag="KLMA_50192"
                     /db_xref="GeneID:34716803"
     mRNA            <405020..>405715
                     /gene="CAX4"
                     /locus_tag="KLMA_50192"
                     /product="dolichyldiphosphatase"
                     /transcript_id="XM_022820171.1"
                     /db_xref="GeneID:34716803"
     CDS             405020..405715
                     /gene="CAX4"
                     /locus_tag="KLMA_50192"
                     /codon_start=1
                     /product="dolichyldiphosphatase"
                     /protein_id="XP_022676661.1"
                     /db_xref="GeneID:34716803"
                     /translation="MSELTALQSRIPFDDTYILYDPNDKLSFICCYFSLLPVGILVFY
                     FSWFIITREIEAIILAGGHVLNDIINNIVKNIVKEDRPVDFGTFQKDSVRSGYGMPSA
                     HSQFMGFFGMYVGLRVWFQWGGLTKVHKILASILILVAAIGVIFSRVYLGYHTLKQVV
                     VGASIGALFGSCHFIASTLVRYLGIIDWLLSWKLFQWFLIKDSCFQAPFSLRDEYNAY
                     LERRKLEPKTKKE"
     gene            complement(<405928..>407589)
                     /locus_tag="KLMA_50193"
                     /db_xref="GeneID:34716804"
     mRNA            complement(<405928..>407589)
                     /locus_tag="KLMA_50193"
                     /product="putative 6-phosphofructo-2-kinase/fructose-2"
                     /transcript_id="XM_022820172.1"
                     /db_xref="GeneID:34716804"
     CDS             complement(405928..407589)
                     /locus_tag="KLMA_50193"
                     /codon_start=1
                     /product="putative 6-phosphofructo-2-kinase/fructose-2"
                     /protein_id="XP_022676662.1"
                     /db_xref="GeneID:34716804"
                     /translation="MSAILSDDDELINGLGSEVVITKPLPGNHMARTRKRWSSGSADK
                     KPDVINRLIDGVHTDVTKDYISPGQLYSTESGRLFHAGKILIVLVGLPATSKTLLSVA
                     ITRYTRWLGVRTRSFHVSEYRREKVKTERGEVPDDYFSAKPSSKEGCKFRKDIQDKII
                     QDMMEFFDAKKGQLAVYDALNILREDRSFIEKSFSKMHIKVLFIESVVTDQELVKRNV
                     ELALKSDDYKGWSTKYAEEDFMKRLQANKHLYEEMSPDENLSYVKYINFGEKLTVNNN
                     NYGYLINKIVFFLMNLRDKKGCVYFARCGTSNKDKYIDDEELNEEGLEYSRVLTDLVL
                     EQINKRRLNANDTTTPTPEVQRTPSLVSLTERCKSPLVATSASLKRSESTGNAMYRQP
                     ASGDGVDDDSFVVWTAPRKRTYDTAKYFAELGISVRQRSQLQQLHPGVVADMTDEEIS
                     EKFPGEYQEYLKDPYHFRFSRAESYHDLAVRMEPLLLEMERMCGDILIIGHESTLRVL
                     YGYLMAFSCSEIPRLSFTRDELIEISFGPFENSVKRIPVRMDWNK"
     gene            complement(<408157..>408881)
                     /gene="RPL26B"
                     /locus_tag="KLMA_50194"
                     /db_xref="GeneID:34716805"
     mRNA            complement(join(<408157..408585,408843..>408881))
                     /gene="RPL26B"
                     /locus_tag="KLMA_50194"
                     /product="60S ribosomal protein L26-B"
                     /transcript_id="XM_022820173.1"
                     /db_xref="GeneID:34716805"
     CDS             complement(join(408157..408585,408843..408881))
                     /gene="RPL26B"
                     /locus_tag="KLMA_50194"
                     /codon_start=1
                     /product="60S ribosomal protein L26-B"
                     /protein_id="XP_022676663.1"
                     /db_xref="GeneID:34716805"
                     /translation="MIIVRKKSFDNKQQKHSFTNISFVIIIFITPFFTDVSSDRRKAR
                     KAYFTAPSSERRVFLSAPLSKELREQYNVKALPIRKDDEVLVVRGSKKGQEGKVSSVY
                     RLKFAVQVDKLTKEKSNGASVPTNIHPSKVVITKLHLDKDRKALIQRKGGKLE"
     gene            complement(409927..410000)
                     /locus_tag="KLMA_R503"
                     /db_xref="GeneID:34718726"
     tRNA            complement(409927..410000)
                     /locus_tag="KLMA_R503"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:34718726"
     gene            <410393..>411109
                     /gene="TIM21"
                     /locus_tag="KLMA_50195"
                     /db_xref="GeneID:34716806"
     mRNA            <410393..>411109
                     /gene="TIM21"
                     /locus_tag="KLMA_50195"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM21"
                     /transcript_id="XM_022820175.1"
                     /db_xref="GeneID:34716806"
     CDS             410393..411109
                     /gene="TIM21"
                     /locus_tag="KLMA_50195"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM21"
                     /protein_id="XP_022676664.1"
                     /db_xref="GeneID:34716806"
                     /translation="MLRRSVLKPSIFSQRKFSSIAFTRPVTITSTFKTRHFALQYSTF
                     NAQQNNSNNQHKNTKKIPLWPRIKAFTSFTVSGILVVGATGLAGIVIYLIGAELFSPS
                     GDTQIFNRAVTKVENDETARKLLQCNDTATSKERLKAYGEILTDDKWTRNRPISSTKK
                     IDKEGKEHYFMRFHVESKQKMGMVHVEAKESDVNYQPDFVSMYLDIPGEKRHYLIKPH
                     LNIITRPKGFLGVNWGPKKN"
     gene            complement(<411398..>412978)
                     /gene="GAS2"
                     /locus_tag="KLMA_50196"
                     /db_xref="GeneID:34716807"
     mRNA            complement(<411398..>412978)
                     /gene="GAS2"
                     /locus_tag="KLMA_50196"
                     /product="1,3-beta-glucanosyltransferase GAS2"
                     /transcript_id="XM_022820176.1"
                     /db_xref="GeneID:34716807"
     CDS             complement(411398..412978)
                     /gene="GAS2"
                     /locus_tag="KLMA_50196"
                     /codon_start=1
                     /product="1,3-beta-glucanosyltransferase GAS2"
                     /protein_id="XP_022676665.1"
                     /db_xref="GeneID:34716807"
                     /translation="MLFKYYWVSLIFLRLISAQNSSSVKLAPIEAYGNKFFNSKTKEQ
                     FFIKGIAYQPSRALDEVSADGIIYETNYIDPLADTSICLRDLPYLKKLHVNTVRVYSI
                     DPTKNHDECMEAFANAGIYVLLDLSEPDVSISRDFPTWDVQIFQRYKDVVDAMSTYDN
                     VLGYFAGNEVTNDKTNTDASPFVKASIRDIKKHIASAPYRNVPVGYSTNDDSDTRDSL
                     ANYFVCGEFEADFYGINMYEWCGYSSYGGSGYRERTLEFKNFPVPVFFSEFGCNSVRP
                     RPFTEVGALYGPLMTPVWSGGLVYMYFEEENEYGVVKVTKNGQVIELEDFKYLQNEFG
                     KAKPKTITIQKHLENHKSTKRKCPQKSMLWKASIDLPPQPDSDKCRCLEENLPCISSS
                     LKDSQSYKNYFDYICAQVDCSDIESNGVDGQYGKYSDCNAKQKLSLQLSKLYYNSDKN
                     NNECPLSNKDFYFNFKSYKTKGKCEAVVNSIKESAKSKPTKNVSEDKNEEFSNKGNEE
                     KIWSLLLVLTAGIYVLFL"
     gene            complement(<413564..>419242)
                     /gene="FKS1"
                     /locus_tag="KLMA_50197"
                     /db_xref="GeneID:34716808"
     mRNA            complement(<413564..>419242)
                     /gene="FKS1"
                     /locus_tag="KLMA_50197"
                     /product="1,3-beta-glucan synthase component FKS1"
                     /transcript_id="XM_022820177.1"
                     /db_xref="GeneID:34716808"
     CDS             complement(413564..419242)
                     /gene="FKS1"
                     /locus_tag="KLMA_50197"
                     /codon_start=1
                     /product="1,3-beta-glucan synthase component FKS1"
                     /protein_id="XP_022676666.1"
                     /db_xref="GeneID:34716808"
                     /translation="MSYNHNDPYQDQGEIPRDGYDQQQYDEYGQPIYGQDQYYPEDQG
                     YYDQSGEYYQQNAQGDISGAPDSGAYHDQGYYDQPRGMGQDPENFSDFSYAPPGTPGT
                     PGGYDSYGGGSGNGYAQYTPSQMSYGDPRSSGASTPIYGGEGFDPSAVAMALPTEPYP
                     AWTADTQTPVTASEIEDVFIDLTNKFGFQRDSMRNMFDHFMTLLDSRASRMSPQQALL
                     SLHADYIGSDSANYKKWYFAAQLDMDDEIGFRNMSLGKLSRKARKARKKNKKAMEEAT
                     QSENPESALDQIEGDNSLEAADFRWKAKMNKLSPIERVRQIALYLLLWGEANQVRFTP
                     ECLCFIYKCASDYLDSPLCQNRQDPIPEGDFLNRVITPIYRFIRSQVYEVQDGRYVKR
                     EKDHNKIIGYDDVNQLFWYPEGIAKVVLEDNTRLIDLPAEERYLRLGDVIWDDVFFKT
                     YKETRSWFHLVTNFNRIWVIHATVYWMYTAYNAPTLYTHNYQQLVNNKPLAAYRWASC
                     ALAGSLASIIQIVATIAEWFFVPRNWAGAQHLSRRFWFLVLILAVNLGPIIFVFAYDP
                     LTVYSKAALVVSIVMFFVSLATVLFFSVMPLGGLFTSYMKKSTRKYVASQTFTASFYQ
                     LEGLDMWMSYLMWTTVFAAKYAESYFFLTLSLRDPIRILSTTVMRCTGDYGYKDKLCR
                     QQPKIVLGLMIATDLILFFLDSYMWYIICNTVFSVGRSFYLGISILTPWRNIFTRLPK
                     RIYSKILATTDMEIKYKPKVLISQVWNAIVISMYREHLLAIDHVQKLLYHQVPSEIEG
                     KRTLRAPTFFVSQDDNNFETEFFPRNSEAERRISFFAQSLATPIPEPLPVDNMPTFTV
                     LTPHYSERILLSLREIIREDDQFSRVTLLEYLKQLHPVEWDCFVKDTKILAEETAAFE
                     GNDEEDSEKEGGMKSQIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTVSGFMN
                     YARAIKLLYRVENPEIVQMFGGDTEGLERELERMARRKFKFLVSMQRLAKFKPHELEN
                     AEFLLRAYPDLQIAYLDEEPPLNEGDEPRIYSALIDGYCEIMENGRRRPKFRVQLSGN
                     PILGDGKSDNQNHALIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEELNVEQVNPY
                     APGLKYEDQNNNHPVAIVGAREYIFSENSGVLGDVAAGKEQTFGTLFARTLAQIGGKL
                     HYGHPDFINATYMTTRGGVSKAQKGLHLNEDIYAGMNAMLRGGRIKHCEYYQCGKGRD
                     LGFGTILNFTTKIGAGMGEQMLSREYYYLGTQLPLDRFLSFYYAHPGFHLNNLFIQLS
                     LQMFMLTLVNMSALANQSVLCIYNKYKPITDVLYPIGCYNFMPVIDWVRRYTLSIFIV
                     FFIAFIPIVVQELIERGIWKATQRFFRHLLSLSPMFEVFTGQIYSASLLSDLTIGGAR
                     YISTGRGFATSRIPFSILYSRFAGSAIYMGARSMLMLLFGTVAHWQAALLWFWASLSA
                     LMFSPFIFNPHQFSWQDFFLDYRDFIRWLSRGNNKYHKNSWIGYIRMSRSRITGFKRK
                     LIGDESERAAGDAARAHRSNMVFAEVIPCVIYAAGCFTAHSFINAQTGVKNAAIINSW
                     LRIVICTLGPIVINMGVLGFCLMMSCCSGPLLGMCCKKTGSVMAGIAHGIAVIVHIVF
                     FIIMWVLEGFNFTKMLIGVITSMQCQRLIFKLMTLFMLTREFKNDHSNTAFWTGKWYN
                     TGLGYMAWTQPSREFVAKIVELSNFAADFVLGHVLLFCQLPILCFPMADKFHSIMLFW
                     LKPSRQIRPPIYSLKQTRLRKRMIRKYCSLYFLVLIVFAACIVGPAVAASRVDLQKIS
                     DNVDKSGNEIFHGLIQPRRQKNNDTGHGMSTYKGHFFTKTPSIAPWSTKA"
     gene            <421585..>421995
                     /locus_tag="KLMA_50198"
                     /db_xref="GeneID:34716809"
     mRNA            <421585..>421995
                     /locus_tag="KLMA_50198"
                     /product="protein NAG1"
                     /transcript_id="XM_022820178.1"
                     /db_xref="GeneID:34716809"
     CDS             421585..421995
                     /locus_tag="KLMA_50198"
                     /codon_start=1
                     /product="protein NAG1"
                     /protein_id="XP_022676667.1"
                     /db_xref="GeneID:34716809"
                     /translation="MFPFTIASLRIPSGIRDLNRNWPVSSSLTLCKTVNKNCLTTMLS
                     STLFNRSIACVFVFTVGSSIIFKSALTYRGNAFCGFVATGAFSRLTSIEHMSGLRRTT
                     LIAAFAPIECPSIIGFFSKSRDFTHLSTSAAIPM"
     gene            complement(<423451..>425649)
                     /locus_tag="KLMA_50199"
                     /db_xref="GeneID:34716810"
     mRNA            complement(<423451..>425649)
                     /locus_tag="KLMA_50199"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820179.1"
                     /db_xref="GeneID:34716810"
     CDS             complement(423451..425649)
                     /locus_tag="KLMA_50199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676668.1"
                     /db_xref="GeneID:34716810"
                     /translation="MSLSVRSQSQENKVQLDLSEKKSFFKPFQENEDCSDNLISFDNA
                     ERKFVPDSTIGSSIKLDGSSVVRFSIRVEDQSRTCERKEQSLINTGTQESENRTNRAV
                     GISIIKNDLFINKLENLLEDDIFHCFESSKSNFVDMFDGIVDNSVLINEFESDDPLIA
                     ATAATEDEEAVEDVIVRDNRYNLENRLADLCDLVLVLDKVLDFLERVTNFPPHEDVLK
                     KCMDLITRLVKVAPENELAVLLRQARTEINQSEAQIAEAKGNCLTSVIALQTLTNVPK
                     QLLKSLYFEVEGQDLSVTESKNLKTSYSFLLVYHMMSLLLRKLFELCLLMDCTSHKVL
                     EALEGFIWIAIEMDKSDIIIRMEDQFWRWNNQNKWIDETEVQAWCINLVIKMEENFNK
                     EVTSCQDEDEQLNIKDKYNLAKLFINEFNDMLFSLRKANDGTEATREYTDLLTRFANS
                     LETRLSGRGIRRHWEEDGMDEEVGMGSIMESHSPLISERNFALGSLVLGSSSVTMIVD
                     ANIELQLPQEPSYEASRSIIIDAREVDETKSDIVKSQLREASGTGPGPEPETEPATIE
                     EQEQEQTQRIDGGTEFDTMVLHDGSIYFHTRPVRWLHFMTTVPHDGYRYKIWMKLRKI
                     KEHCVIHWPRPAGSGEGFAHGIQDQEQDERQDQDQNQNSHQNSHQALSVRSKNKAKTK
                     VSSHIRNGLIFQDEYLNTTYGDLDPPTPGRFSRLREKKKRLMFKFFGDDD"
     gene            complement(<426013..>426948)
                     /gene="RPP0"
                     /locus_tag="KLMA_50200"
                     /db_xref="GeneID:34716811"
     mRNA            complement(<426013..>426948)
                     /gene="RPP0"
                     /locus_tag="KLMA_50200"
                     /product="60S acidic ribosomal protein P0"
                     /transcript_id="XM_022820180.1"
                     /db_xref="GeneID:34716811"
     CDS             complement(426013..426948)
                     /gene="RPP0"
                     /locus_tag="KLMA_50200"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P0"
                     /protein_id="XP_022676669.1"
                     /db_xref="GeneID:34716811"
                     /translation="MGGVREKKVEYFAKLREYLEEYKSVFVVGVDNVSSQQMHEVRKQ
                     LRGKAVVLMGKNTMVRRAVRGFISDFPDYEKLLPFVKGNVGFIFTNESLQEIKDVIIA
                     NKVAAPARAGAIAPEDIWVKAVNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVD
                     AGKKVGASEASLLNLLNISPFTYGLTVVQVYDNGQVFPASILDITDDELVSHFVSAVN
                     TIACVSLAAGYPTLPSVGHSLINNYKNLLAVAIAADYVYPEIEELKDRIENPDKYASA
                     APVAAAAASSDAPAEEAEAEEAEESDDDMGFGLFD"
     gene            <427682..>428173
                     /locus_tag="KLMA_50201"
                     /db_xref="GeneID:34716812"
     mRNA            <427682..>428173
                     /locus_tag="KLMA_50201"
                     /product="ribonucleases P/MRP protein subunit POP6"
                     /transcript_id="XM_022820181.1"
                     /db_xref="GeneID:34716812"
     CDS             427682..428173
                     /locus_tag="KLMA_50201"
                     /codon_start=1
                     /product="ribonucleases P/MRP protein subunit POP6"
                     /protein_id="XP_022676670.1"
                     /db_xref="GeneID:34716812"
                     /translation="MSESIRLIYQQKDVDVDPSNHSDVTAYISNVILPDTLRNCGMSE
                     STTPLTGNSSKSVDITYATFSKNSNIKQSVDSLVKKAGMNNDIVVVSYGMHIQKTLSI
                     IEIFKSTDAGKKLHQFNRLDSFVEVKPGRNELLDQKVNIPILIIAFTIEDVKNLSGFT
                     KQS"
     gene            <428533..>429996
                     /locus_tag="KLMA_50202"
                     /db_xref="GeneID:34716813"
     mRNA            <428533..>429996
                     /locus_tag="KLMA_50202"
                     /product="DUF3445 domain-containing protein"
                     /transcript_id="XM_022820182.1"
                     /db_xref="GeneID:34716813"
     CDS             428533..429996
                     /locus_tag="KLMA_50202"
                     /note="This family of proteins are functionally
                     uncharacterized"
                     /codon_start=1
                     /product="DUF3445 domain-containing protein"
                     /protein_id="XP_022676671.1"
                     /db_xref="GeneID:34716813"
                     /translation="MIIDLSLILRKQVTFPLLCYILYQLYKDLVSKEPKSVETEIIAE
                     DTPSEEPCTPEPVDNAVYQKKRWQPVDYMRNLKPSEQEKDYTPWSTTNPFPYQPFKPG
                     EYRLTMGVKSIPLEHWFMFENTLKSRIEKKWEIIKEAYKDVMYHLDPAMVNCDTYYNS
                     DYTDEVLVTAKDVEIADAAVCEWYNSVVSYLVTRFPQYFQVVLSPDDETPGVLHNSIM
                     DEYHPVNAEKYLQLGNTDVPFLKYYCFNVGIIPAELTNPKNLRDKVGRIPLVTTEKTR
                     RAHELILSVQRMVEEDLILLSPNANKQFDGEYILMSGCFAFAAGFNPRERFLKPLTQI
                     HGPVPEYKIKLQSQMNKFFQTHKPQKLVMRINFSFQTHSKLYVTDDNKGVATEEIRAK
                     TLDELHGGHDLHYRSERQCLIKFENTQAMCFSIKTYLWNLQDEFLPNDYYSQEGVIQD
                     LCEAVKGMQYTIGQYKRRPEWGPALLEMLEPKLNSKV"
     gene            complement(430175..430246)
                     /locus_tag="KLMA_R504"
                     /db_xref="GeneID:34718727"
     tRNA            complement(430175..430246)
                     /locus_tag="KLMA_R504"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:34718727"
     gene            <431292..>433742
                     /gene="VRP1"
                     /locus_tag="KLMA_50203"
                     /db_xref="GeneID:34716814"
     mRNA            <431292..>433742
                     /gene="VRP1"
                     /locus_tag="KLMA_50203"
                     /product="verprolin"
                     /transcript_id="XM_022820183.1"
                     /db_xref="GeneID:34716814"
     CDS             431292..433742
                     /gene="VRP1"
                     /locus_tag="KLMA_50203"
                     /note="intron?"
                     /codon_start=1
                     /product="verprolin"
                     /protein_id="XP_022676672.1"
                     /db_xref="GeneID:34716814"
                     /translation="MAGPPPPPAPPPPMFGGQSAPAAPPPAAVPGRDALLSDIRKGAK
                     LKKAHTVDKSAPMIGGSSVSSAPSSAPVPGKMPGSAPAVPPAMPGGPQLGDILAGGFP
                     KLKHVQPNSGSAPAVPASAPPLPGHGNMNKNSNGSNSQSSPRIPSNRPQRKHTQSSRS
                     DGGSSNTTSAPSMPSSAPPIPSMSAPPTPHVPSSGSAAAKAPAPPTAAPPLPGAAPSP
                     PATSFPAVPSQAPPIPGAPPPPPSTSFPSSNSAAAPPPPPPAPPAPPAAAPPAPSAPA
                     PKPKSSNGHSSSSAPKAPPAPAGGLPFLAEIQKKRDDRFVVDGTNNTSHSQNHSTSNK
                     SKPSSAPPPPPAPPSGPPPPSQAPPPPTQAPPPPTQAPPPPSQAPPPPSGAPPSGGLP
                     FLAEIQRRKDDSHVVQNSTSHSQHKRVPSQPSGAPPPPPPMQAPPTPSIPKSSAPVPP
                     AAPPAAPPAPPSVPKSTPSAPPASGGLPFLAEIERRKDNTHVIENVSSPPPPPPGSSA
                     PPPPPSSQAPPPPPAPPVQAPPAPTPPKTSAPTPPASGGLPFLAEIERRKDNTHVIEN
                     VSSPPPPPPMSAAPPTPSIPKTSIPAAPPAPPAAPPAAPPAAPPAAPPAPPASSANGG
                     LPFLAEIERRKDDSHVIDSPASRSTESHAPPSLPHSLPPQPFGAPPPPPPPQAPPASS
                     APDISTLQSSKPPPPPPTAFSPSEPEESLQQQEERGKRDFKHRLFSTGNEQSRPAQSQ
                     NPYTNAAEIDVGDFTIEGSGNSVGVKTNRSGVKIDDSKFNWSNSSDLPKPRKFLGKTK
                     LYPSGRGSSVPLDLSLFT"
     gene            complement(<433879..>434572)
                     /gene="ERV1"
                     /locus_tag="KLMA_50206"
                     /db_xref="GeneID:34716815"
     mRNA            complement(join(<433879..434361,434486..>434572))
                     /gene="ERV1"
                     /locus_tag="KLMA_50206"
                     /product="mitochondrial FAD-linked sulfhydryl oxidase
                     ERV1"
                     /transcript_id="XM_022820184.1"
                     /db_xref="GeneID:34716815"
     CDS             complement(join(433879..434361,434486..434572))
                     /gene="ERV1"
                     /locus_tag="KLMA_50206"
                     /codon_start=1
                     /product="mitochondrial FAD-linked sulfhydryl oxidase
                     ERV1"
                     /protein_id="XP_022676673.1"
                     /db_xref="GeneID:34716815"
                     /translation="MSNNTETDKQVNIGPSGRQIIYDEDGKPFFVTGKLTSEKSGAGA
                     GAMAGATTVDMSDQTKDLPSAASKEPANLIPGSKSFTKVDPPDVEELGRSSWTLLHSI
                     AAKYPNRPSDTQKQEMKQFMTIFSHVYPCNWCAKDFEKFIKQNAPKVESKEALGRWLC
                     KAHNEVNRKLKKEEFNCDLWKKRWVDGWE"
     gene            complement(<434906..>435988)
                     /gene="MSP1"
                     /locus_tag="KLMA_50207"
                     /db_xref="GeneID:34716816"
     mRNA            complement(<434906..>435988)
                     /gene="MSP1"
                     /locus_tag="KLMA_50207"
                     /product="protein MSP1"
                     /transcript_id="XM_022820186.1"
                     /db_xref="GeneID:34716816"
     CDS             complement(434906..435988)
                     /gene="MSP1"
                     /locus_tag="KLMA_50207"
                     /codon_start=1
                     /product="protein MSP1"
                     /protein_id="XP_022676674.1"
                     /db_xref="GeneID:34716816"
                     /translation="MAPRIDLKTITDLSVLFGTAISVYYLVNRLLAEAEGGPLSGNSK
                     DSKERQSLVWQRLCAMNPELEEVSLNGYERSVLASVITPHDIDVSFEDIGGLEDVIEE
                     LTESVIYPLTSPEIFQESSLLEAPKGVLLYGPPGCGKTMIAKALARESGANFISIRMS
                     SIMDKWYGESNKIVDAMFSLANKIQPCIIFIDEIDSFLRQRASSDHEVTAMLKAEFMT
                     LWDGLTSNGKVMVLGATNRINDIDSAFLRRLPKRFPVSLPNADQRYKILSKFLRDTKV
                     DPRDFDLDYIVQCTAQMSGSDLRELCRDAALTAARDYIKEKRKITESGKVDDLNNLKM
                     RPLTNDDFLKNLKVDVGVAFSRAALD"
     gene            <436302..>439514
                     /gene="SGD1"
                     /locus_tag="KLMA_50208"
                     /db_xref="GeneID:34716817"
     mRNA            <436302..>439514
                     /gene="SGD1"
                     /locus_tag="KLMA_50208"
                     /product="MIF4G domain family protein"
                     /transcript_id="XM_022820187.1"
                     /db_xref="GeneID:34716817"
     CDS             436302..439514
                     /gene="SGD1"
                     /locus_tag="KLMA_50208"
                     /codon_start=1
                     /product="MIF4G domain family protein"
                     /protein_id="XP_022676675.1"
                     /db_xref="GeneID:34716817"
                     /translation="MSKKHSIRLPGVLLDELKGQNYDEDDSRFQTPKVKSSGRNGKRK
                     APLGRKELRKQQRESKKAKRSGKSDSHPVKKTQHEVKKVSKVQDTIRKNQKSSTSKKS
                     ESKPKQVRFAEKDDVKVFSSDDELSASDFDEFSEGDLDEEEWEQLRELEGDDEDEDED
                     QPLTAEETMMKLKELKEKKMKSNGNSETAMPAPDVDSDDDDQLSSDYSDIDEDDDEDQ
                     PLTAEETMMKLQELKEKKMKNSNNSKAVAAAPDVDSDDGDDDELSSSEYSDAEDDEAD
                     DKEMTVEETMAALKAMKEKKQKSKSQDMKPKKNTTQSKKDRTYAPLTPEERAAIERDE
                     QDMKYYARKLGLKKNKLHAADEYDAIGGLLEGLDYFENFGEEGEEGEEDEEDEIMSEE
                     DNEDEIMSEAEDEIISGNEEEEEEVENPFSSDDELSSGDFEEFSEGDLDEEEWEQLRE
                     LEGGKPSKAPKEKENIYTAPVSDTSQAYIPPSLRKKQLEDSDSETYKELKKKVKSLLN
                     KLSDSNITVIVTSLNELYDNYARQYVNDAINNQIIEVVAQKNKLLDTFIMSYAGVAFS
                     MWKLKGTEAGASFIQALVQKFLDIYNEQMEFIQSKGPNPEEAMLISKEATNLLTLLSY
                     SYNFGLVSSRLIYDIIKELIQNPNEYTTELLLRIISVSGSLIRGDDPRALKDIISELL
                     NNVKGLKQTSRLSFLLETLTDLKNNRLKPSVMAASHQSLKKTIIGSLRISTSASSEPL
                     LASLDDIKNVETKGKWWLIGASWKGNQETAFDEVKKTNTDSSIDTKLNIELEDNLLSE
                     IIDWNEVARQQRMNTDVRRAIFVSIMSAEDYLDAFAKLEKLNLKSKQSLDITRVLVHC
                     LCNDGATTGYNPFYSLLAAKLSEHNHKLLKSFQFLFWEIVKKFETESYSDDENEDTLF
                     NNDSLDEDAKLQTLAKQGRFFGFLIANGSLKLDIFKHVPLMGGINSDGFVFFEILLFQ
                     MFLTIGKTAEKKVKKDGKKSFEYNSNELLSLIDNGITNENKTVILKALKWFINKHFEY
                     TKYISGVEGSKDYERESRRLSWAVNTFKSLIDDALKTSDF"
     gene            complement(<439608..>441836)
                     /gene="NUP2"
                     /locus_tag="KLMA_50209"
                     /db_xref="GeneID:34716818"
     mRNA            complement(<439608..>441836)
                     /gene="NUP2"
                     /locus_tag="KLMA_50209"
                     /product="nucleoporin NUP2"
                     /transcript_id="XM_022820188.1"
                     /db_xref="GeneID:34716818"
     CDS             complement(439608..441836)
                     /gene="NUP2"
                     /locus_tag="KLMA_50209"
                     /codon_start=1
                     /product="nucleoporin NUP2"
                     /protein_id="XP_022676676.1"
                     /db_xref="GeneID:34716818"
                     /translation="MSKRFAGSQMTREGLENGDSRSGSDDETGMEKPKIASESVMSTR
                     KIAMPKRKMGNFNTGEKPNMFKLMKNNNTNVGIKPQEKDTTADTNEKIAALNLQFKSK
                     IVATLDSDPVADLSLLFDKYKTYLQSLKPTKVSASETPKFGATSGFTNEETKDKPKAD
                     DKPKPAFAFNKPADSKSNLSSAPVQPAKKVETKAESESDSDDEKKPAVSVEGPKFVLS
                     KKPTTSDPPFSFQNKKRREPSSDSDSEVEVKGPQFTFTGTLSSKTFQLPKTEQSNTTA
                     EESKKNDVPASIFGNSSSRPSPEFGSKPETDSSGTKPTFPSFGSIKSDSGNTTAAPTS
                     QFSFSFGGANKDTKTENASTISTSEAQKNGDSNSKPSLSFPAPSSSTENTKQEDKEQV
                     KPSFTFGAPAQTNATSTESSKPSFTFGAPAQTNATSTESSKPSFTFGAPAKTNDTSTE
                     SSKPSFTFGAAAKADTSTDSSKPSFTFGAAAKNNTSTDSSKPSFTFGTVNNDKKNNDS
                     SKPSFTFGSNQSNTTASFTFGKQDTEKKDEKKPTFTFGSSAAPAVPAFSFGAKKEENS
                     QTQDSSSGFKFSLPFAPTTSSADSDSAKKHDEQKSTDNNTEEAAKEEEEPSKALNLTN
                     GEENENLLFSQRAKLMIFNSETKAYDSRGVGEFKILQSKEDKSKARLLCRSDGMGHIL
                     LNTSVVKSFSYEALDPNNENLVKCPVVNPEGGLDTYVIKVKQKADGRKLIQAIKDAQQ
                     QM"
     gene            complement(442217..442290)
                     /locus_tag="KLMA_R505"
                     /db_xref="GeneID:34718728"
     tRNA            complement(442217..442290)
                     /locus_tag="KLMA_R505"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:34718728"
     gene            <443397..>443723
                     /gene="RPS25B"
                     /locus_tag="KLMA_50210"
                     /db_xref="GeneID:34716819"
     mRNA            <443397..>443723
                     /gene="RPS25B"
                     /locus_tag="KLMA_50210"
                     /product="40S ribosomal protein S25"
                     /transcript_id="XM_022820189.1"
                     /db_xref="GeneID:34716819"
     CDS             443397..443723
                     /gene="RPS25B"
                     /locus_tag="KLMA_50210"
                     /codon_start=1
                     /product="40S ribosomal protein S25"
                     /protein_id="XP_022676677.1"
                     /db_xref="GeneID:34716819"
                     /translation="MPPKQQLSKAAKAAAAMAGGKKSKKKWSKKSHKDKAKHAVVLDQ
                     EKFDRIMKEAPTYRYVSVSVLVDRFKLGGSLARVALRHLENEGIIKPVSKHSKQAIYT
                     RAAASE"
     gene            complement(<445041..>445856)
                     /locus_tag="KLMA_50211"
                     /db_xref="GeneID:34716820"
     mRNA            complement(<445041..>445856)
                     /locus_tag="KLMA_50211"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820190.1"
                     /db_xref="GeneID:34716820"
     CDS             complement(445041..445856)
                     /locus_tag="KLMA_50211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676678.1"
                     /db_xref="GeneID:34716820"
                     /translation="MSTMKVIRKRPSKKDAEGKQKILWIAGHWMTLTLGALYVVYALV
                     HAFTIPRRRSWKTAFLTKKFEIQPVTWKNSTWRQYLFSWSPEVLYQGSLFGVLLSYSI
                     TEFQKWSTSKPSFYDLISSENFQGILMALLWVISRRSSFKLIPFIIVSYLHISNKNAA
                     NTENLNDISVKNAKLLHVMAYSEIITLVTLLVNTLIFKEPLAGYLLVSLVAIFWLRVN
                     FSAYAQATVLQLVLKVDKKIPEGKRKKWDELKSVIYDKMKSREMMLEKSKLVR"
     gene            <446217..>446930
                     /gene="THG1"
                     /locus_tag="KLMA_50212"
                     /db_xref="GeneID:34716821"
     mRNA            <446217..>446930
                     /gene="THG1"
                     /locus_tag="KLMA_50212"
                     /product="tRNA(His) guanylyltransferase"
                     /transcript_id="XM_022820191.1"
                     /db_xref="GeneID:34716821"
     CDS             446217..446930
                     /gene="THG1"
                     /locus_tag="KLMA_50212"
                     /codon_start=1
                     /product="tRNA(His) guanylyltransferase"
                     /protein_id="XP_022676679.1"
                     /db_xref="GeneID:34716821"
                     /translation="MAKSRFEYVRQFEVHDVLLPDTYIVVRVDGKKFHEFSKYYEFAK
                     PNDERALKLMNASAKNVLMQYRQEIICAYGESDEYSFILRKETKLFNRRKDKISTLFV
                     SLFTANYVSLWDKFFPEVKLHHKHLPYFDSRCVCYPNLTSVKDYLCWRFVDTHINNLY
                     NTVFWYLIIKCGLTPQESEQKLCGTLSSDKQEILFSECGINYNNELEMFKKGSLINSK
                     GEILHIDVVKNIDDIFNGF"
     gene            complement(448292..448363)
                     /locus_tag="KLMA_R506"
                     /db_xref="GeneID:34718729"
     tRNA            complement(448292..448363)
                     /locus_tag="KLMA_R506"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:34718729"
     gene            complement(<448788..>452399)
                     /gene="RPA135"
                     /locus_tag="KLMA_50214"
                     /db_xref="GeneID:34716822"
     mRNA            complement(<448788..>452399)
                     /gene="RPA135"
                     /locus_tag="KLMA_50214"
                     /product="DNA-directed RNA polymerase I subunit RPA2"
                     /transcript_id="XM_022820192.1"
                     /db_xref="GeneID:34716822"
     CDS             complement(448788..452399)
                     /gene="RPA135"
                     /locus_tag="KLMA_50214"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I subunit RPA2"
                     /protein_id="XP_022676680.1"
                     /db_xref="GeneID:34716822"
                     /translation="MAAVATPSSISPVGGNRTASFRTLEREQRFINPPKDKSAYPLLA
                     DAVQPHIGSFNALTEGPDGGLLNLGVKDIGSKVIFDGKGSDTNPNYLGNKLSLSVEKV
                     SISKPMSNDGVSSAVERKVFPAEARQRLTSYKGKILLQLKWTVNDGEETFTEVRDCGG
                     LPIMLQSNRCHLNKLSPYELVQNKEESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAII
                     RPSFANRGASYSQYGIQIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMI
                     LRALYDTNDREIFDHIVGGDTSNSFLTDRLELLLRGFKKRYPTLKNRKQTLQYLGDKF
                     RVVFQASPDMTDLQVGEELLRRIVLVHLGENNKDKFNMLLFMIRKLYSLVAGECSPDN
                     PDAAQHQEILLGGFLYGMIIKEKIEEYLQNIKLQIQTDINRGLAINFKEQKYMSKVLM
                     RVNENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFF
                     AQLKTTAVRKLLPESWGFFCPVHTPDGSPCGLLNHLAHKCKISTEQSDVSRLPSILYS
                     LGVTPASHIIAAGPSMCCVQLDGKIVGWCSHEQGKVVADTLRFWKVEGKTPGLPVDLE
                     VGYVPPTTSGQYPGLFLFGGRSRMMRPVRYLPLDKEDIVGPFEQVYMNIAVTPEEIEN
                     NIHSHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKL
                     YRLQTGQTPIVKANLYDEYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFA
                     YGTMYKVEKVNLSMNRTRGDPITQHFGFGTDEWPKEWLDKLDDDGLPLIGTYVEEGDP
                     ICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSKFQELQAITIKYRIRRTPQIGD
                     KFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGA
                     LHGIAQDSTPWTFSESDTPADYFGDQLLKAGYNYHGNEPMYSGATGEELRADIYIGVV
                     YYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQ
                     DRLLNCSDYTQTSVCRDCGAILTTQSSVPKIGSMSTVRCRRCAIKFDEAKKLIAKYEP
                     GEEPIHIADSEIWEDGQGNKYVGGGNTTTVAVPFVLKYLDSELAAMGIRLRYNVEPK"
     gene            453057..453131
                     /locus_tag="KLMA_R507"
                     /db_xref="GeneID:34718730"
     tRNA            453057..453131
                     /locus_tag="KLMA_R507"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34718730"
     gene            <455356..>456135
                     /gene="CWP1"
                     /locus_tag="KLMA_50215"
                     /db_xref="GeneID:34716823"
     mRNA            <455356..>456135
                     /gene="CWP1"
                     /locus_tag="KLMA_50215"
                     /product="cell wall protein CWP1"
                     /transcript_id="XM_022820193.1"
                     /db_xref="GeneID:34716823"
     CDS             455356..456135
                     /gene="CWP1"
                     /locus_tag="KLMA_50215"
                     /codon_start=1
                     /product="cell wall protein CWP1"
                     /protein_id="XP_022676681.1"
                     /db_xref="GeneID:34716823"
                     /translation="MKFSAAFTVALLSLAKFIAADSESFGLVSLRSGSPLQFSGVYAK
                     DGALYLGSNQNFSGVVTDDGKLKFSDNSYAVAGDDGYLTTTTDASKATTGFAVKNGYL
                     QLNNSEAFYGVQSGSDYKVAVKSEGSNSQSVSLSARSTNGQTVPDFTPGSSGSSSGSS
                     SAAPASSAAPASSSAAPASSSEAAKTSAAPVSQIGDGQIQATTATPKPTAQPVSQIGD
                     GQIQATTGTQSVLVKTDVGNNAGKVTLGSSAAVAALAALLL"
     gene            <456981..>457850
                     /gene="YJU2"
                     /locus_tag="KLMA_50216"
                     /db_xref="GeneID:34716824"
     mRNA            <456981..>457850
                     /gene="YJU2"
                     /locus_tag="KLMA_50216"
                     /product="protein CWC16"
                     /transcript_id="XM_022820194.1"
                     /db_xref="GeneID:34716824"
     CDS             456981..457850
                     /gene="YJU2"
                     /locus_tag="KLMA_50216"
                     /codon_start=1
                     /product="protein CWC16"
                     /protein_id="XP_022676682.1"
                     /db_xref="GeneID:34716824"
                     /translation="MSERKSTNKYYPPDYDPVKAEREARKLSKRLKTMNKDTITIRLM
                     TPFSMRCLKCNEFIPKSRKFNAKKESLPEKYLDKIRIYRFEIRCPSCNNVISFKTNPR
                     TGDYTMDFGGVKNFSASSESEKQSSVPENETLEQTLERLEKEQEREQLEANAGPGERQ
                     AGSLDDEGKDRIELIEERLAKLQKEQEDDLALEELALQEQQKHGKLDELHEARKRMQE
                     DQEVLDEMIADQAFEEVEQQQQTEAKVQTESSELDPDQRPKPVLEAIVPKKLSLKRKK
                     NPLGVKLKKKKTV"
     gene            <458147..>459103
                     /gene="YJU3"
                     /locus_tag="KLMA_50217"
                     /db_xref="GeneID:34716825"
     mRNA            <458147..>459103
                     /gene="YJU3"
                     /locus_tag="KLMA_50217"
                     /product="serine hydrolase YJU3"
                     /transcript_id="XM_022820195.1"
                     /db_xref="GeneID:34716825"
     CDS             458147..459103
                     /gene="YJU3"
                     /locus_tag="KLMA_50217"
                     /codon_start=1
                     /product="serine hydrolase YJU3"
                     /protein_id="XP_022676683.1"
                     /db_xref="GeneID:34716825"
                     /translation="MTSLAYEKNIKTEIPVVQKEKFNGADFTYLKWPASSTNSNGSDD
                     TTTTTKCRVIIVHGFCEYYKLYYKLMDRLAQNGVESFIFDQRGAGETSPGKEKGNTDE
                     TRTFQDLDHFIEKNLKECEALGNRKLFLFGHSMGGGIVLNYGCSGKYRSKIAGIMTTG
                     PLIELHPKSNPMYIVRKLSPVLAAVLPNFKIDTSLNVEGITGSKENQELLKKDPNLKL
                     VGSFRQIYDMLERGKRLLSDPVRAEGFRTPVLIMHGEQDTINDPKASEKFIRDRLPHL
                     QDKTLKIYHDARHSLLSLERDEYFDQAFGDMIQWIDVHTITE"
     gene            <460850..>462022
                     /locus_tag="KLMA_50218"
                     /db_xref="GeneID:34716826"
     mRNA            <460850..>462022
                     /locus_tag="KLMA_50218"
                     /product="protein MBR1"
                     /transcript_id="XM_022820197.1"
                     /db_xref="GeneID:34716826"
     CDS             460850..462022
                     /locus_tag="KLMA_50218"
                     /codon_start=1
                     /product="protein MBR1"
                     /protein_id="XP_022676684.1"
                     /db_xref="GeneID:34716826"
                     /translation="MGEQNSVCQCGSINSRDSIFERSVQDPFCSVLYRLDREGEQEDP
                     EYDETTFNEQQEENGQQDRDMQSELDPLQEEPYSTNKEYVTTENAIDDEINGSSNGNG
                     NDDDNDSDFADDGVNPFRPTVPRQDVLESREWYVCPNCHRHRKQRSKSFASNGAHSFY
                     PDVKPISRANSIVLPLSKQSTRQSIGSDFFTSLDSGDNYAHLQQALGESGHPHSHSNS
                     NSNSNSNINQNQNQGQHVPEANSLSGSRSSISLSTNHIPTHLYSLERYISSELDSATE
                     SFFDKSKMLGDEGHHPHEAFSSSFTKLSLHSSPDASETTLPNTQDQSQGLNQGQGQSQ
                     SHNQSRRHSHSHSPSSPTSPFTHKHKTNNDHFSPPFLDARKRKKSFIELALAESFS"
     gene            <462766..>465639
                     /gene="NAM7"
                     /locus_tag="KLMA_50219"
                     /db_xref="GeneID:34716827"
     mRNA            <462766..>465639
                     /gene="NAM7"
                     /locus_tag="KLMA_50219"
                     /product="ATP-dependent helicase NAM7"
                     /transcript_id="XM_022820198.1"
                     /db_xref="GeneID:34716827"
     CDS             462766..465639
                     /gene="NAM7"
                     /locus_tag="KLMA_50219"
                     /codon_start=1
                     /product="ATP-dependent helicase NAM7"
                     /protein_id="XP_022676685.1"
                     /db_xref="GeneID:34716827"
                     /translation="MKERFSSDSESEASVKDYLSDSDDLVAEDYSEFGDDAGNSGPVA
                     EHACAYCGIDNTSCVVKCNNCNKWFCNSKNGTNTSHIINHLVLSHHSTVSLHEDSELG
                     DTTLECYNCGRTNVFVLGFVPAKSEAVVVLLCRLPCAKVKNVNWDTDNWQPLIEERKM
                     LTWVAEEPSEEDQLKARMITPSQITKLEARWKSNKDATIMDIDMVEPDEEIPPTLMRY
                     TDAYQYQRSFGPLIQLEADYDKQLKESQALEHISVTWNLALNNRHLATFALSTFESNE
                     LKVAVGDEMILKYSGPQHPEWSGKGFIIQLPNNFKDEFTLELKPSNKPPPINCTSGFT
                     AVFVWRGTSYKRMQESLRKFAVTKKSISGFLYYKILGQEVPDVEFDVALPKNISVPHF
                     TELNQSQVNAVKHVLQRPLSLIQGPPGTGKTVTSATIVYHLSKIHQQRVLVCAPSNVA
                     VDHLAAKLYSMGLKVVRLTAKSREDVESSVSELALHNLVNRSAEGKLKKLLNLKEKTG
                     ELSAPDTAKFVKLVRKSEAAIIQKADVICCTCVGAGDKRLDYKFRTVLIDESTQASEP
                     ECLIPIVKGAKQIVLVGDHQQLGPVILDRKAGDAGLKQSLFERLISLGHIPIRLEVQY
                     RMNPHLSEFPSNMFYEGSLQNGVTIEQRTVAKSTFPWPIHTIPMMFWANYGREEISGN
                     GTSYLNRIEAMNCEKIITRLFKDGVKPEQIGVITPYEGQRAYVVQYMQMNGSMDKSLY
                     VNVEVASVDAFQGREKDYIILSCVRANERNTIGFLSDPRRLNVALTRAKYGLIILGNP
                     GALSRNSLWSHLLLHFREKGCLVEGFLDNLQLCTVQLTKPSRAPRKATSENYNYSDYN
                     GAKDVDTQSLMSFGGQNNSGNVFVPSTDLSSLLNQQYWNGQSVDITKSTSRKQDNNHY
                     DKNSTNFDGSLANGLQKYDGIGSKYQKVDEEVTIQNIKNLDIN"
     gene            complement(<465804..>468947)
                     /gene="BUD2"
                     /locus_tag="KLMA_50220"
                     /db_xref="GeneID:34716828"
     mRNA            complement(<465804..>468947)
                     /gene="BUD2"
                     /locus_tag="KLMA_50220"
                     /product="inhibitory regulator protein BUD2/CLA2"
                     /transcript_id="XM_022820199.1"
                     /db_xref="GeneID:34716828"
     CDS             complement(465804..468947)
                     /gene="BUD2"
                     /locus_tag="KLMA_50220"
                     /codon_start=1
                     /product="inhibitory regulator protein BUD2/CLA2"
                     /protein_id="XP_022676686.1"
                     /db_xref="GeneID:34716828"
                     /translation="MGSNNKNGHPFPVGKPMSAPLPMGRVKPATNPGKKAYLDMLDFT
                     ERVRVSQGKFNGLVQWCSNLQLGDWRINHLEINDRGQLVHAVSKSDVRSLQNTMDEDV
                     TDSIDMKSYNHPIIKHLQSCQIQLVPTEATEYTTPIVKVQASHNTLYLKTDARDSFYD
                     LFSSLIFWKSLKSNNVFNKTTVIQPIFHKPEDPANVILCQCHVFGPIPRSKHVQLSTE
                     LPTPPDFHHDENEYGWFAAMGVLKSDGILELLLQSDGSLIYSIDVTKFLRSEIQIVNS
                     SIFQSDKYLSMGILPDLRSQLQVSAKESCFVDFPRTSFRTRKLIQKVYIRLPLRIDLE
                     DWFVALNSFAMPDVLSLIGTDKSNELRISNRFKISILEADLRDLEIDSPNLYAVLDLW
                     GQPVARTAIVGRSKAPFWREEFDFNFSVRTDTIKIIIKCCESENSYSTTDPIIGQIQI
                     TQEMINDPNLNKETRLPVFSHTNKNFQIGTICIKVISSLNFILQPVNFSKFEEVLSNV
                     SLPKICDYMKDSKIATSLKLEDISLVFLDVFQALGRENDWFQALIDREFDELDKSITI
                     SSANNQSSNHIYNSLFRGNSILTKTMETYCYRVGQEYLDKCIGSLIRELAEVDESYEI
                     DPNRIREADEATKDLLIKKNFQRLLKLAEKTWGRIFETSNDLPQGIKTQLKCFRKKLE
                     VIETDENSSMKSLLNCFSGFLFLRFFCPVILNPKIFNFVENHPGENARRSLTLLAKIM
                     MNLSTLTPFGPKEPYMTKMNSFIDDHREELLEYLDRITEKKLDFTPKKLKLSSNLTRP
                     KLELNQDILKHLPANPFLIDKYLRETEIINAFATSKESETSTTVRSVSMEHLFQIVQE
                     KPAETKQFSIGGLEFEKLSENNTEVFGEDLLKLLGKEESNNKRESLASANTTSSNDSN
                     LIFQLEQESVLLFNKIKQLVTVLNDYEYPNEIILGKSEYASFLANSLFYDKDKNVYLD
                     FQNLYAVKEGYIRLFSSATTAERFFLSSDKKDQSILNGSPGESVTKTSKFSVFGKNPA
                     ELKQKSESKLARWFKKS"
     gene            complement(<469699..>470604)
                     /gene="SEC14"
                     /locus_tag="KLMA_50221"
                     /db_xref="GeneID:34716829"
     mRNA            complement(<469699..>470604)
                     /gene="SEC14"
                     /locus_tag="KLMA_50221"
                     /product="SEC14 cytosolic factor"
                     /transcript_id="XM_022820200.1"
                     /db_xref="GeneID:34716829"
     CDS             complement(469699..470604)
                     /gene="SEC14"
                     /locus_tag="KLMA_50221"
                     /codon_start=1
                     /product="SEC14 cytosolic factor"
                     /protein_id="XP_022676687.1"
                     /db_xref="GeneID:34716829"
                     /translation="MVSEQEILESYPQKCPADALPGTPGNLDAAQETALKELREQLEA
                     LGYKARLDDSTLLRFLRARKFDVEAAKVMYENCEKWRKEFGVDTIFEDFHYEEKPLVA
                     KYYPQYYHKIDKDGRPVYIEELGSVNLTQMYKITTQERMLKNLVWEYEAFVRYRLPAC
                     SRKAGYLIETSCTILDLKGISISAAAQVLSYVREASNIGQNYYPERMGKFYLINAPFG
                     FSTAFRLFKPFLDPVTVSKIFILGSSYQKDLLKQIPAENLPKKFGGLSEVDESEGGLY
                     LSDIGPWREKEFIGPEGEAPKAFEM"
     gene            complement(<471335..>473935)
                     /gene="PTK2"
                     /locus_tag="KLMA_50222"
                     /db_xref="GeneID:34716830"
     mRNA            complement(<471335..>473935)
                     /gene="PTK2"
                     /locus_tag="KLMA_50222"
                     /product="serine/threonine-protein kinase PTK2"
                     /transcript_id="XM_022820201.1"
                     /db_xref="GeneID:34716830"
     CDS             complement(471335..473935)
                     /gene="PTK2"
                     /locus_tag="KLMA_50222"
                     /codon_start=1
                     /product="serine/threonine-protein kinase PTK2"
                     /protein_id="XP_022676688.1"
                     /db_xref="GeneID:34716830"
                     /translation="MTQSASKSMIPDDIKCTTPSSEEIARAQSAASNGNRTHSNSTTT
                     SFLNNPDHMPPYRSTSLRSGSTSSGHSQGHGQVPVPMPLQPLQPLQPQPLQHGAQQVP
                     LPMAPSPKLVNKQQQEASHSKNPLKKIFGRSKSHHAADQGKNSGSGNGQSPDLKQRVS
                     PKPDGKPSSTSVRARGASLLHKDRDVTQHMHLIKSSSAISNLSHNTNPFLTSSNGRIP
                     IESLDIHTRPPTISQLYHSPSSASATPSSTSLGFYQTEGDSKGENILPLPLKNPNDFL
                     PEELQQPSVMLTDNFAFADSGRKNLGEGGSSQVMTVMSIYRKKNVYALKRFKLFKDET
                     PDHFYHRCVSEFLIAKKLSNHVNIVKTYYLMKTPSISNGPKRSWAFLMQRCSQDMFHF
                     TTLTGWASKPLDEKWCCFKQISRGVRYMHSLGIAHRDIKLENVLVTEYGALKLTDFGI
                     SAYGIKDPDDPSSERIKIRGYCGSPPHVPPEVMILSEKKRKVIPVPKEKEEYDPFKMD
                     TWALGILMFNLVCSFALFGEAHKDDSKYRNFASFHEQFCKHSPHFKKPGIYRSGPGAE
                     HPDFGKMGSVEASRVCLRLLDPDPNTRYSIEDLFNDPWMEKVETCFDEDDEEPLKEPE
                     LRKATTDDDPVPHDIPSTSSSFNEDSTTLTHSSNPFLQSNINNGNNAVKSPKIKSKSM
                     LFIAEEEDMRRSATNSSSGSPQVAATNNNAQVAPTSLPTLDEEKTKDVDDDIKGTPET
                     FAKAQQPPQSPVPVNNALTERISSLSLNTANSVNPADHGENSANTLMRNEGEAPSTSN
                     DGPNSLYSNSITQKPSFASDTVSRSSSITSKNNSPMLSNSTTMSSRKRKKNLGHHHSE
                     CGGKPIFVLK"
     gene            complement(<475158..>478319)
                     /gene="PEX1"
                     /locus_tag="KLMA_50223"
                     /db_xref="GeneID:34716831"
     mRNA            complement(<475158..>478319)
                     /gene="PEX1"
                     /locus_tag="KLMA_50223"
                     /product="peroxisomal ATPase PEX1"
                     /transcript_id="XM_022820202.1"
                     /db_xref="GeneID:34716831"
     CDS             complement(475158..478319)
                     /gene="PEX1"
                     /locus_tag="KLMA_50223"
                     /codon_start=1
                     /product="peroxisomal ATPase PEX1"
                     /protein_id="XP_022676689.1"
                     /db_xref="GeneID:34716831"
                     /translation="MDGQELHFQGLRIVYSQELSSNLVRLPNKICRLLDQSDIPVQEF
                     GIKINADVDVGWDGQTSKSFRGTDQTLEMNAILAGEYKLQMGQLVDISIKRYDSSSFV
                     TEVHVEPKGFQDWETIESNAAFFQDQILYQTRLVRKGAHLLCFMRNVVCKFSIKSMMP
                     DHLEVGRLTNDTLVIVEPKLREEVETNEGLVVDNSQKVIKRTLLDKGDLSGVSIALKT
                     RENKYEYATVSVIRAPFEEDKSKGKTKSGGGGSSSTSSSVPSSIGMGMGICCKVYEDD
                     SLRDESVKMSRMLRKALQLPANNGYKVRVSYVKKLPKTPFDVVICPHGSGSSGTEGEE
                     DSTTTVEEYFNCIKKLDILSDNLLVQDKDLDVKFTVKLRGGKGSPVPFGKCPADVSKV
                     TVSERTNIALDVGLDPTSSPRKLIGFEKTYLEILDTVRAPLAMSSSFLVQGGAGMGKT
                     LVLQNLAFDLINDGYHVQYVDGDAVPDSTNLAKTKQYLSELVHSAYWHMPSVILFDNA
                     DSLFTAAKSVDDQPSSGNSRGLYSQTSTKLTQMFMSDVQRAMDVAAGGSGSGVEVEIK
                     VVFGAKSQESLNKMLFQKQFVGDTWTLKPPTRYQRNDILQWLLSEKSIELAGDTSVTE
                     LSLETEGYSPADLALLVDRLFYEVVSRDHAQQQQQQQPLTRAMVESCVSQFTPASLRS
                     VKLQKGTGVKWSDIGGLREAKRLLLETLEWPNKYAPIFARSPLRLRSGILLYGYPGCG
                     KTMLASAVAQQCGLNFISVKGPEILNKYIGASEQSVRELFERAQAAKPCILFFDEFDS
                     IAPKRGHDSTGVTDRVVNQLLTQMDGAEGLEGVYVLAATSRPDLIDSALLRPGRLDKS
                     VLCDIPDEEERAEILRAITRGKMALDASCDVGAVARLARGFTGADLQGVVNNAYLKAV
                     HRSLGEDRPGDHSGVHPAPQDAPQNDASQGDTRPPYICLGKRKPLDGETLERIGGKLK
                     QLGISIGSASASASATGTGRTSGIVVSAEDLEAACLDAKPSISRQELEKLTAVYRKFI
                     GDREGKMPSGEASQKVGGRTTLA"
     gene            <478673..>479119
                     /gene="APS2"
                     /locus_tag="KLMA_50225"
                     /db_xref="GeneID:34716832"
     mRNA            <478673..>479119
                     /gene="APS2"
                     /locus_tag="KLMA_50225"
                     /product="AP-2 complex subunit sigma"
                     /transcript_id="XM_022820203.1"
                     /db_xref="GeneID:34716832"
     CDS             478673..479119
                     /gene="APS2"
                     /locus_tag="KLMA_50225"
                     /codon_start=1
                     /product="AP-2 complex subunit sigma"
                     /protein_id="XP_022676690.1"
                     /db_xref="GeneID:34716832"
                     /translation="MSVQFIICLNKQGIVRLLRWFVKLDTSEHATHQEYIQHVFKVVS
                     QRDHRHQSNFIEFSEHTKLVHKRYAGLYFIMGVDKGDEELIYLSQIHLFVEVLDSFFG
                     NVCELDILFNFYKAYMVMDEMFVAGEIQSTSKQQLLERIGELDKLN"
     gene            complement(<479167..>479799)
                     /gene="CDC8"
                     /locus_tag="KLMA_50226"
                     /db_xref="GeneID:34716833"
     mRNA            complement(<479167..>479799)
                     /gene="CDC8"
                     /locus_tag="KLMA_50226"
                     /product="thymidylate kinase"
                     /transcript_id="XM_022820204.1"
                     /db_xref="GeneID:34716833"
     CDS             complement(479167..479799)
                     /gene="CDC8"
                     /locus_tag="KLMA_50226"
                     /codon_start=1
                     /product="thymidylate kinase"
                     /protein_id="XP_022676691.1"
                     /db_xref="GeneID:34716833"
                     /translation="MTRGKLILIEGLDRTGKSTQSEKIVKELGDEVVLFKFPERSTPI
                     GGLINQYLTDRSFDLPPQSIHLLFSANRWEVNAKIRSLLESGKHVVLDRYVYSGVAYS
                     AAKQIPGMDISWCLNPDKGLVKPDLTLFLSNQDSSSLQDRDGYGEERYEKAAFQKKVR
                     ETFFQVFDAIPDDNVVIVDVTGKSIEQVFDTIMPLVRKVLGNNSEDYLYF"
     gene            480071..480162
                     /locus_tag="KLMA_R508"
                     /db_xref="GeneID:34718731"
     tRNA            join(480071..480107,480125..480162)
                     /locus_tag="KLMA_R508"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:34718731"
     gene            <480503..>482044
                     /gene="CDC14"
                     /locus_tag="KLMA_50227"
                     /db_xref="GeneID:34716834"
     mRNA            <480503..>482044
                     /gene="CDC14"
                     /locus_tag="KLMA_50227"
                     /product="tyrosine-protein phosphatase CDC14"
                     /transcript_id="XM_022820205.1"
                     /db_xref="GeneID:34716834"
     CDS             480503..482044
                     /gene="CDC14"
                     /locus_tag="KLMA_50227"
                     /codon_start=1
                     /product="tyrosine-protein phosphatase CDC14"
                     /protein_id="XP_022676692.1"
                     /db_xref="GeneID:34716834"
                     /translation="MGKRLSMDNTIEFLKGRVYLGAYDYIPEDDDEVVFFTVENTLFY
                     NRFHLDFGPMHIGHLYRYAVIFHEILNDPENFQKAVVFYSSTSTRQRSNAACMLCCYM
                     VLIQGWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDVVYGIWRAKENGLIDLS
                     NFQLETYEKYERVENGDLNALTPDFIAFASPQEEMRRHQPLGASSKALSSKPHLNQPF
                     RKVLEYFKENDVQLVVRLNSHLYNKKHFEDIGIQHLDMIFEDGTCPDLSIVQNFVGAA
                     ETIIKQGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFMRPGMVVGPQQH
                     WLYLNQNTFREWKYTMRLSQEPSDVIGGLYPLITLEEYKIQKKKKKVAYESEYTQDDH
                     TMTPPSVSRKTMGFQKSTTTAVPQQSPGQPRKGHGGNTIEDINKKENQGAGKIADNNS
                     DLDDSMNTENSMKTSPSDTRPINSSLVEDADALKQVLPKNRRLVSSNGKRTTSGVRKV
                     SSSKR"
     gene            complement(<482247..>482999)
                     /gene="ECO1"
                     /locus_tag="KLMA_50228"
                     /db_xref="GeneID:34716835"
     mRNA            complement(<482247..>482999)
                     /gene="ECO1"
                     /locus_tag="KLMA_50228"
                     /product="N-acetyltransferase ECO1"
                     /transcript_id="XM_022820206.1"
                     /db_xref="GeneID:34716835"
     CDS             complement(482247..482999)
                     /gene="ECO1"
                     /locus_tag="KLMA_50228"
                     /codon_start=1
                     /product="N-acetyltransferase ECO1"
                     /protein_id="XP_022676693.1"
                     /db_xref="GeneID:34716835"
                     /translation="MPKGLTSKAKKSVQSTLQFSSTPVVIKCTKCLMTYSNTSPSDLL
                     QHKQYHDLRLNGKKWSNSWGDVVTRMEPRKGSPCSNYQSDEYIVMISPKKPKEVKATL
                     ELLTIVNDELNAPHDENAFWSEINESGGQQGKAFVYIKNNRAVGVITVEYIENTHRGK
                     WMVLETKSIVPKVVPDVKLGISRIWVCRNQRNQKIATRLLESARIKSIYGCVVNKWEM
                     AWSQPSQSGSKLAESYNAVKHGSGKLLIPCYI"
     gene            483213..483285
                     /locus_tag="KLMA_R509"
                     /db_xref="GeneID:34718732"
     tRNA            483213..483285
                     /locus_tag="KLMA_R509"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718732"
     gene            <483479..>484108
                     /gene="DAS2"
                     /locus_tag="KLMA_50229"
                     /db_xref="GeneID:34716836"
     mRNA            <483479..>484108
                     /gene="DAS2"
                     /locus_tag="KLMA_50229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820208.1"
                     /db_xref="GeneID:34716836"
     CDS             483479..484108
                     /gene="DAS2"
                     /locus_tag="KLMA_50229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676694.1"
                     /db_xref="GeneID:34716836"
                     /translation="MSRPIVINIASGHYAGAEQISESIKEKLQGIFKHEIKMINLNER
                     AISPKQYSDKDYDFNKIIKEIECLPSTSGLVIVLVYGCYSIYDAKLNELSSLKVYVDS
                     DGDKRLINMINQESVNASEELAACITHYMDRLRPEMIKYVEPSKAHADIILPSMNDNL
                     GTAIIVDGIVKVVEQHQGGELKESPTLFPHLDFNIERLEMESERYYDLS"
     gene            <484456..>486135
                     /gene="TCM62"
                     /locus_tag="KLMA_50230"
                     /db_xref="GeneID:34716837"
     mRNA            <484456..>486135
                     /gene="TCM62"
                     /locus_tag="KLMA_50230"
                     /product="mitochondrial chaperone TCM62"
                     /transcript_id="XM_022820209.1"
                     /db_xref="GeneID:34716837"
     CDS             484456..486135
                     /gene="TCM62"
                     /locus_tag="KLMA_50230"
                     /codon_start=1
                     /product="mitochondrial chaperone TCM62"
                     /protein_id="XP_022676695.1"
                     /db_xref="GeneID:34716837"
                     /translation="MLRFSRSIKTLHTPTHFGDVSTRSNLMSKVKLLDEILSRVSYDR
                     SVLYTPKYKRIPQLITSRDTVRMGTLIRNFTDNLTMDQAYNNAKQLDPQEKLGKVGLE
                     LFIDCNKNHITPLSAHLSVMLMEIYNRYDSNSGFLERMLDELAEVRSFLAANKFQLKD
                     RADIDMLVDKLSFTQQDAATIKDVLYQLDYNLFSDDIVRVVKGNTMHDSIDLSKGWKY
                     QAGILDSNDAYLRSLEIDKKKLVSISEPSLVLLFDGTLRDADKIQPSLHYAAKKRQSL
                     LLIVNGDVKGDALTAITINNNKNRRDGNPSKVVILRYFDKDHNNIALQENYDLMKFCQ
                     LPEGLGSIYSPKFSDYVPSSASAKLYYGSIESIKATTGECFLYNPTVDMGDETKVNSL
                     QTSVTVKIGGQSEFEIDQRRASIDNILNEILCHGLRDGFVPGHGIALAKAAHHISQLP
                     LKEESLLARSVRNELLEALTQPMDKAIENKYACSRFARAKAISGTMEVVSFQHAVLPD
                     SDTPTDTLTGGDVEPWTKLDQTLDNVSNFVKMITSCNAYITRIFEKPKRRD"
     gene            <486684..>487865
                     /gene="GCV1"
                     /locus_tag="KLMA_50231"
                     /db_xref="GeneID:34716838"
     mRNA            <486684..>487865
                     /gene="GCV1"
                     /locus_tag="KLMA_50231"
                     /product="aminomethyltransferase"
                     /transcript_id="XM_022820210.1"
                     /db_xref="GeneID:34716838"
     CDS             486684..487865
                     /gene="GCV1"
                     /locus_tag="KLMA_50231"
                     /codon_start=1
                     /product="aminomethyltransferase"
                     /protein_id="XP_022676696.1"
                     /db_xref="GeneID:34716838"
                     /translation="MLQFKRFNSSAGAAALKKTALYDMHVSLGATMVPFAGYSMPVLY
                     KGQTHIESHKWTREHAGLFDVSHMMQSTISGSNAIQFLHQVTPTDFQALKPKVGTLSV
                     LLNANGGIVDDTLVTKISDEQFYMVTNAGCIERDTEFLTEELARVPEGTVSWEVLKDR
                     ALLALQGPEARYALAKLVKHGDLKTLYFGQRDEFQLSENITAQVARSGYTGEDGFEIS
                     VSNSDAPVLAQLLLDQPEVKPIGLAARDSLRLEAGMCLYGHELDETITPVEASLNWLI
                     SKSRRDGSLGKFNGFDKIIAQIKDKSYDKVRVGFKYLGKGPAARQETPILNDANEQVG
                     VVTSGSASPSLNNINIGQAYVQKGLHKKGTQLRVQIRNKTYPIEIAKMPLVPTNYYKP
                     T"
     gene            <489076..>490827
                     /gene="SAM3"
                     /locus_tag="KLMA_50232"
                     /db_xref="GeneID:34716839"
     mRNA            <489076..>490827
                     /gene="SAM3"
                     /locus_tag="KLMA_50232"
                     /product="S-adenosylmethionine permease SAM3"
                     /transcript_id="XM_022820211.1"
                     /db_xref="GeneID:34716839"
     CDS             489076..490827
                     /gene="SAM3"
                     /locus_tag="KLMA_50232"
                     /codon_start=1
                     /product="S-adenosylmethionine permease SAM3"
                     /protein_id="XP_022676697.1"
                     /db_xref="GeneID:34716839"
                     /translation="MSDSAKDTMQVSENLSASLATEDDHRALLHRVKDSFKRQDLETS
                     KEIDSEVDGMTEYQKTNYRLAKQPFQKNLSQRHLTMIAIGGTLGTGLFIGIGYSLASG
                     PGNLLIGFLLTGIAIFCVVQCAAELSCQYPVSGSFASHVSRFVDPSWGFTVTTNYCLS
                     WAISFPSELIGCAMTIRYWNSSVNPAVWVAIFYVFILALNLIGVRGFAETEYFLSIFK
                     ILAIIIFLIIGIVLICGGGPHSKGYIGAKYWHDPGSFEKPVFKSLCNTFVSAAFSFGG
                     TELVVLTAAESRKVESVSRAAKGTFWRILIFYVSTVVVIGCLVPYNDPRLLGGSSSED
                     ISASPFVIALSNTGKFGTRVSNFMNAVILIAVLSVCNSCVYAASRVVQSLGASRELPS
                     IFGYVDRKGRPLMGILVVAIFGLLAFLVASKKEDQVFDWLFALCSISSMFIWFSICLS
                     YLRYRYALKKQGRSNDEIAYKSMLGIWGGYLGALLSLLLIIGEIYVSLFPLGGSPNAE
                     DFFKNCLSIPIMIVVYFGHKLVTKNWTPVVIPAQQIDLDTGLSFNDVELMKHELQLER
                     AKIANKPIYYRIYRFWC"
     gene            <491628..>493646
                     /gene="QDR3"
                     /locus_tag="KLMA_50233"
                     /db_xref="GeneID:34716840"
     mRNA            <491628..>493646
                     /gene="QDR3"
                     /locus_tag="KLMA_50233"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820212.1"
                     /db_xref="GeneID:34716840"
     CDS             491628..493646
                     /gene="QDR3"
                     /locus_tag="KLMA_50233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676698.1"
                     /db_xref="GeneID:34716840"
                     /translation="MDGASSLNGPESLRSLRSGTKSISSDGVSPHVPCVLHHDELSGD
                     ISSAAVSEEGQEPGQERGERVERVETLGKMLTNISTTFRDKSKIVPRSERRGLFANLA
                     LVPEYTDAREYPLGLKMFIVVVIAYSAIMGPMGTSIVFPAIGPLVADFNTSTIMVDVS
                     VGIYLLSLGIFPIWWSSLSELKGRRTVYVISFSLMVGFTIGSALSPNISAFIVFRMLQ
                     GASSASVQSVGAGTISDLFIPEERGKNLGYYYLGTLMAPLLSPIIGALLVNRWSWRST
                     QWFMVILAGVNVLLVTLLLPETLRKQDNSAAIAMILAERRMKQTNGTVTEEPQAAAAA
                     TTTTTENDSGPAANDEKEKEREKQQFATELQRYKSHTSTIATIPNKNEDVYDTHLPQL
                     SKIRTHDARLEEETYQNDLRRAQTQLMEEIEKIESSKHPKTELWKEEMYIYFIKPLKS
                     LHFLKYPPVTLAIIFSAISFAILYVVNMTIEYCYSRPPYNFKPLYIGLLYIPNSVTYI
                     IASIYGGRWVDNLLIRYKEKHGVIAPEARIGWNVVVAVVTFPIGLLIFGWCLDKHEHW
                     VTPLIGTAIFGFASMMTIGTTVSYLVDSLPGRGATGVALNNLIRMILAAVSVFITTPM
                     LKGMGVGWTFTMLALIVVASSSVLVLLKRNGDYFREHYDLQDFYAKLE"
     gene            <494075..>495286
                     /gene="CST26"
                     /locus_tag="KLMA_50234"
                     /db_xref="GeneID:34716841"
     mRNA            <494075..>495286
                     /gene="CST26"
                     /locus_tag="KLMA_50234"
                     /product="uncharacterized acyltransferase CST26"
                     /transcript_id="XM_022820213.1"
                     /db_xref="GeneID:34716841"
     CDS             494075..495286
                     /gene="CST26"
                     /locus_tag="KLMA_50234"
                     /codon_start=1
                     /product="uncharacterized acyltransferase CST26"
                     /protein_id="XP_022676699.1"
                     /db_xref="GeneID:34716841"
                     /translation="MIKIILYRIYKVIVTLASIVIFVQGALSIVIYQYIINFFYRGNL
                     AKRQKYLNKTKKRFILLLVTILSMVAPSQVRITSENKSIPKGSIYMDRKKGRLVSKAR
                     SNAVVIANHQIYTDWVFLWWLAYASNLAGDVYIMLKKSLESIPLLGKGMQNYKFIFMN
                     RKWEQDKINLTNILNELDLDARGVGLIDGNTPVNKTEEGIYEWDETKVVRPGEKWPYW
                     LILFPEGTNLSAGTRAKNNQYAAKNGLKPFRHVLLPRTTGLKFCLKQLRKSCEYVYDI
                     TIAYSGINSDQYGQDIYKLGNIFLKGESPKLVEIYIRAIKLEDIPLEDDDKFQAWLFE
                     VWKFKDDLMDTYYKTGNFGLDLDLNSSVTGPCRVSVMSVISILLFPVLTLIPLIYLLF
                     TKLHSLLPAHT"
     gene            complement(<495435..>497471)
                     /gene="FAT1"
                     /locus_tag="KLMA_50235"
                     /db_xref="GeneID:34716842"
     mRNA            complement(<495435..>497471)
                     /gene="FAT1"
                     /locus_tag="KLMA_50235"
                     /product="very long-chain fatty acid transport protein"
                     /transcript_id="XM_022820214.1"
                     /db_xref="GeneID:34716842"
     CDS             complement(495435..497471)
                     /gene="FAT1"
                     /locus_tag="KLMA_50235"
                     /codon_start=1
                     /product="very long-chain fatty acid transport protein"
                     /protein_id="XP_022676700.1"
                     /db_xref="GeneID:34716842"
                     /translation="MPHTNQSMSELMKLYILVILRTLSRVILFPFRLLIFLVNKALPT
                     DLMDKLDPNYRWRDDYHIATYFIASVVKYIWLIYSNRFQYWYIIESQVKKHPNSLAIS
                     YAKPLAKKGEFELQEFTYAETYKIVLRLSHYLFNVHRVKPGDNIALDFTNKPLFIFLW
                     FALWNLGATPAFLNYNTLGQPLIHCIQVSNISQIFIDPFAAEPIKKTEDDLKKELPHT
                     QLHYLDEDELFETVLLNEDYPTLRVDDAIRSPNSARDFEAAMLIYTSGTTGLPKPAIM
                     SWRKATIGCSLFGRIMRVTPGKAVFTAMPLYHSTAALLGVCAIFAHGGCVAISNKFST
                     STFWKQVCLTNATHIQYVGEVCRYLLNSPVSPYEKQHHVEIAYGNGLKTDIWKEFKER
                     FNIKIIGEFYASTESPFATTSLQRGEFGIGACRNYGPVVNAFLSIQQCLVKVNPDDET
                     QIYRNEKGFAETTDVGQAGELLMRIFIPKRPETSFQGYLGNKKDTESKVIRDVFRKGD
                     AWYRSGDLLRADENGLWYFTDRLGDTFRWKSENVSSAEVENQIMSASKDIILEAVVVG
                     VQLPSNEGRAGFAVIKLKKVDISVEEKVELLNSLLSHLKNNLPKYALPIFIKFVENIE
                     LTHTHKVAKSKYRNQVLPHGESGNETLFWLCNYKYYKVLTDDDWEEIAKGTNKI"
     gene            complement(<497834..>498730)
                     /gene="FIG1"
                     /locus_tag="KLMA_50236"
                     /db_xref="GeneID:34716843"
     mRNA            complement(<497834..>498730)
                     /gene="FIG1"
                     /locus_tag="KLMA_50236"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820215.1"
                     /db_xref="GeneID:34716843"
     CDS             complement(497834..498730)
                     /gene="FIG1"
                     /locus_tag="KLMA_50236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676701.1"
                     /db_xref="GeneID:34716843"
                     /translation="MLFSVKLGYTLMKKMPRVLVILNSLISIFLLIFLLVGCYKPNQS
                     STYLVRYKFNDDSPLYSVISKQFSSKPSTKGLEKVNILSGYMGVCIDNIPSNYYKNTT
                     DKASTVCFNRKKVDDMQIYDDLTIKIFSFGYQNSSKQTDSSDINILGLAHQNSAEIVH
                     PYILMVVVIFTILLFGITTYAAIPKLPYKDYTQRVLMGLTALTAFLWTIGAIWAHVAI
                     NASASLVPRASMNIMKVHKGRKSQTMTWFAFAFMLINCFIIWMIYFRDRKELDEKLDD
                     VKSVGNPFSNKYSSDSNTLTSV"
     gene            complement(<499614..>500483)
                     /gene="ATP3"
                     /locus_tag="KLMA_50237"
                     /db_xref="GeneID:34716844"
     mRNA            complement(<499614..>500483)
                     /gene="ATP3"
                     /locus_tag="KLMA_50237"
                     /product="ATP synthase subunit gamma"
                     /transcript_id="XM_022820216.1"
                     /db_xref="GeneID:34716844"
     CDS             complement(499614..500483)
                     /gene="ATP3"
                     /locus_tag="KLMA_50237"
                     /codon_start=1
                     /product="ATP synthase subunit gamma"
                     /protein_id="XP_022676702.1"
                     /db_xref="GeneID:34716844"
                     /translation="MFVRNSASVMRSASRNYATLREIETRLKSIKNIEKITKTMKIVA
                     STRLSKAERAKNSAKQYVVADAAFYKNAETSPLEDAEKKDLIVAITSDKGLCGSIHSQ
                     LAKAVRLQLNETPNADVVAIGDKVKAQLLRTHPENLKYAFNGVGKEAPTFEECALIAN
                     KILEGGAANYRKVSIFWNNPISSLSFEPSQKPVFNAQTIEQSPSYSKFEIDADNNVSQ
                     DLFEFTLSNEILAAMAEGYAAEVSARRNAMDNASKNAGDMINSYSILYNRTRQAVITN
                     ELVDIITGASSLD"
     gene            complement(501072..501143)
                     /locus_tag="KLMA_R510"
                     /db_xref="GeneID:34718733"
     tRNA            complement(501072..501143)
                     /locus_tag="KLMA_R510"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:34718733"
     gene            complement(501173..501245)
                     /locus_tag="KLMA_R511"
                     /db_xref="GeneID:34718734"
     tRNA            complement(501173..501245)
                     /locus_tag="KLMA_R511"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:34718734"
     gene            <502087..>504798
                     /gene="KCS1"
                     /locus_tag="KLMA_50238"
                     /db_xref="GeneID:34716845"
     mRNA            <502087..>504798
                     /gene="KCS1"
                     /locus_tag="KLMA_50238"
                     /product="inositol hexakisphosphate kinase 1"
                     /transcript_id="XM_022820217.1"
                     /db_xref="GeneID:34716845"
     CDS             502087..504798
                     /gene="KCS1"
                     /locus_tag="KLMA_50238"
                     /codon_start=1
                     /product="inositol hexakisphosphate kinase 1"
                     /protein_id="XP_022676703.1"
                     /db_xref="GeneID:34716845"
                     /translation="MNESVSQRQPQRQQGHEQNHEQTTLVAARLRDLSVEDQGNLHTK
                     ALDESHHVDLQGKSIHSHKKKPVIHGRKASTYLRVFDDNDTDEHIDEHRLRSYSSGGL
                     GAGSHQSGMVHRSNSYMKASVDQRPVLKNTLKPIDEPANVDSLALQPQTSASAIYLTD
                     EDRNVLSSHNDISIIDEKDKTTMSMFEPEVVVPSIHIGAARNEKIPTEQKQPDPLTST
                     PAPAPAPAPEDLSPRTSTSPLMQDTNQQQQQQPDPNYKEHIYNEDNNGNLSRYQQKLP
                     NESAIADEDDDIDERGDFPLAVELKPFKNKVGGHTAIFKFSERAVCKALVNAENNWYE
                     TIEREHKELLQFMPRYIGVLNVRQHFHTKEDFLQEINNEGGVDYKDAGNNSTVNTENT
                     KKGNTNSNSKGDMTRTSSNRVLSPTLLGQKEDVYDDITPLPEVVLDDNKHIIPNSLYQ
                     QYSSSRSHSNSPSSAPIDSFLLSHSLDDDQVLKSDFNQGSGSTSVNTKLQELVLKEAF
                     MKRKPSNSYQSCALDHRNRVGSSSSLKECKASRSSSSSSHNKMKTLGIQPYHRRNSTR
                     HNITLTPNRGDNSAVDDYDDVMFKLDDEVHDADIKSPEHEKGSFNHESVSLEETSHTI
                     VSKFILLEDLTRKLKCPSVLDLKMGTRQYGVDAKRSKQLSQREKCKKTTSRKLGVRLC
                     GLKIWDKKKKYYITRDKYFGRRVRVGWQFARVLARFLYDGETRRSIIKQIPLLIQQLD
                     TLHSEIGKLKSYRLYGSSLLLFYDGDNPQNKRSPVKVNIIDFARCVTDHDIENHLDTF
                     KIAPHFPNREDQGFLRGVKSLKFYLLHIWKYLTNDNSIISEESLLAEYLDQNSEKFDT
                     CWDWLDQFDSEDEADANNAQSPLRVKWRKYELIFDVEPRYVDEEISD"
     gene            <505583..>505900
                     /gene="DAD1"
                     /locus_tag="KLMA_50239"
                     /db_xref="GeneID:34716846"
     mRNA            <505583..>505900
                     /gene="DAD1"
                     /locus_tag="KLMA_50239"
                     /product="DASH complex subunit DAD1"
                     /transcript_id="XM_022820219.1"
                     /db_xref="GeneID:34716846"
     CDS             505583..505900
                     /gene="DAD1"
                     /locus_tag="KLMA_50239"
                     /codon_start=1
                     /product="DASH complex subunit DAD1"
                     /protein_id="XP_022676704.1"
                     /db_xref="GeneID:34716846"
                     /translation="MTDEVQILSAGDKYFMEQRDLILQEINESMDAILNQLNGLNITL
                     ENSIAVGKEFENVSQIWKLFYNGLESEQVSTESNVEANIGQEPTPGLLPEHTPKDNDN
                     ETR"
     gene            506159..506234
                     /locus_tag="KLMA_R512"
                     /db_xref="GeneID:34718735"
     tRNA            506159..506234
                     /locus_tag="KLMA_R512"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:34718735"
     gene            <508084..>509082
                     /locus_tag="KLMA_50240"
                     /db_xref="GeneID:34716847"
     mRNA            <508084..>509082
                     /locus_tag="KLMA_50240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820220.1"
                     /db_xref="GeneID:34716847"
     CDS             508084..509082
                     /locus_tag="KLMA_50240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676705.1"
                     /db_xref="GeneID:34716847"
                     /translation="MKSKGKLRPKIYDVVFLYLTFIPFAVLGTYARLGIYRLSKYEPS
                     YITPTSTIWPNIVASFLLGATRETHSIISIDSVMLPCLTTGFCGTFSSFSSLMLELFQ
                     HSTNKGLDRKAYPNAGYGVMEFIAVLLVQLAASCGGLILGQSIMRNILNYYYNCHRTL
                     VRLIRGIGYISQIACIPIVASQIALAVIFKGDSRFWTVGSLFGVVGAAVRLELSNRLN
                     NKFGWFPLGTFMCNVISTTIASVLFMLKNGLKDHNSQRLVNNNEALSMMTYLTLGFCG
                     GMSTLSTFVYEGQVMGLPKACIYYLLSIGIGFALTIIIIGSYAWKHNLEATQQLFT"
     gene            <509384..>510061
                     /gene="PDX3"
                     /locus_tag="KLMA_50241"
                     /db_xref="GeneID:34716848"
     mRNA            <509384..>510061
                     /gene="PDX3"
                     /locus_tag="KLMA_50241"
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /transcript_id="XM_022820221.1"
                     /db_xref="GeneID:34716848"
     CDS             509384..510061
                     /gene="PDX3"
                     /locus_tag="KLMA_50241"
                     /codon_start=1
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="XP_022676706.1"
                     /db_xref="GeneID:34716848"
                     /translation="MSEETKKPIIFAPKTYQYDKFSLDESSIDSDPIVQFTKWFNEAK
                     DDPTESIPESVSFATAELPSGKVSCRILLFKELDDRGFTVYSNWGTSRKADDIKSNPQ
                     AAMTFFWKNLQRQVRVEGFTEHVSRETSQRYFKTRPRGSKIGAWSSPQSHRIENREEL
                     NALLKKNEEKFKDAEDVECPEFWGGIRVVPLRIEFWQGRASRLHDRLVFERKSENDAW
                     ELVRLAP"
     gene            complement(<510124..>511860)
                     /locus_tag="KLMA_50242"
                     /db_xref="GeneID:34716849"
     mRNA            complement(<510124..>511860)
                     /locus_tag="KLMA_50242"
                     /product="protein RAD61"
                     /transcript_id="XM_022820222.1"
                     /db_xref="GeneID:34716849"
     CDS             complement(510124..511860)
                     /locus_tag="KLMA_50242"
                     /codon_start=1
                     /product="protein RAD61"
                     /protein_id="XP_022676707.1"
                     /db_xref="GeneID:34716849"
                     /translation="MRVYGHRSKFQALAKKYLSRRNDDANSTSDDSFTSSEDEAESSS
                     TTFDRTHETSPLVPKQIDQQHGNNATSLDPFDILDEIPIKSDVSKSRTRQRKVTRILK
                     PVIYGNSELDITNQEPAGEANEYQHEFQTTIDSISSMISSLKDSNEVISSYSLIETAP
                     KNSSGSGEQIRYGRTRTLRQSETDAQDEEVAETNNVKVNTKKQKTITSSSNLRDDGDD
                     NAVIHVNQLKALGEGLKYEDELDFLRIEAKDEGHFVATLINCCLQLMNNEELVLYVSK
                     YKADELWDWFLQNSSLENTVMCFLQSWIAHRVPLSRNSPQWQTVSEFARVCVSLQSVP
                     ELTKGSKITKLNFRDLTRRIESSPKDIALALWEQNITPNSNDFITLIELLVEPSSQLL
                     GVLEKYLNENITEEVMVLMHSQVMNLVTDFIENINLIKILIKLTNHIFFLNLLSMKER
                     VLIIENCLSYMIQAYNAGTLSKQSFIDTLILQLGVVLNIVAHSKVELCPSIAKEVWVI
                     IENWGDGDKFLLQLLALVFVLYVRHNYSDWTETKKESINKNLQDLSQNIQNTNKTIYN
                     NVQVAFDILSNI"
     gene            <512197..>512832
                     /gene="PSF1"
                     /locus_tag="KLMA_50243"
                     /db_xref="GeneID:34716850"
     mRNA            <512197..>512832
                     /gene="PSF1"
                     /locus_tag="KLMA_50243"
                     /product="DNA replication complex GINS protein PSF1"
                     /transcript_id="XM_022820223.1"
                     /db_xref="GeneID:34716850"
     CDS             512197..512832
                     /gene="PSF1"
                     /locus_tag="KLMA_50243"
                     /codon_start=1
                     /product="DNA replication complex GINS protein PSF1"
                     /protein_id="XP_022676708.1"
                     /db_xref="GeneID:34716850"
                     /translation="MYGDLANKLVLEAKRTQQLSQAGFNKQQLPAYQDELIRGIIREV
                     SALKKNVDYLREEQLADQNNKMTQCRYVVAMLSMERNKRCLLAYEKLRSELLDAMVWD
                     NNGMEFSSLLSTSNSKTQFDSSMLSHAEQEYLKEYSQLLTELKSGQLSEIDLTGTLEP
                     PSDVFIDVRVLKDAGQIETEYGVFNLIKDSQFFVRQSDVERLIQQGYLQKI"
     gene            <513180..>514226
                     /gene="HMT1"
                     /locus_tag="KLMA_50244"
                     /db_xref="GeneID:34716851"
     mRNA            <513180..>514226
                     /gene="HMT1"
                     /locus_tag="KLMA_50244"
                     /product="HNRNP arginine N-methyltransferase"
                     /transcript_id="XM_022820224.1"
                     /db_xref="GeneID:34716851"
     CDS             513180..514226
                     /gene="HMT1"
                     /locus_tag="KLMA_50244"
                     /codon_start=1
                     /product="HNRNP arginine N-methyltransferase"
                     /protein_id="XP_022676709.1"
                     /db_xref="GeneID:34716851"
                     /translation="MSKTEVHDSATQKNELNEHEQHYFTSYDHFGIHEEMLQDTVRTL
                     SYRNAIAQNKDFFKDKVVLDVGCGTGILSMFAAKNGAKHVIGVDMSSIIEMAKQIVEL
                     NGLSDKITLLRGKLEDVVLPYKKVDIIISEWMGYFLLYESMMDTVLYARDNYLVEGGL
                     IFPDKCSIHVAGLEDAKYKNEKLNYWQNVYGFDYSPFIPLVKREPLVDTVENSAVNTT
                     KCKLIEFDLNTVTIPDLAFKSKFKLHTKRQDFINGIISWFDIEFPAPKGKKPVTFSTG
                     AHAAYTHWKQTVFYLEDDLECEPNDVLEGELVCVPNKVNNRDLDITISYNFKAGGPDG
                     KERSRKGKNSYIMH"
     gene            complement(<514805..>515896)
                     /gene="RPL4B"
                     /locus_tag="KLMA_50245"
                     /db_xref="GeneID:34716852"
     mRNA            complement(<514805..>515896)
                     /gene="RPL4B"
                     /locus_tag="KLMA_50245"
                     /product="60S ribosomal protein L4-B"
                     /transcript_id="XM_022820225.1"
                     /db_xref="GeneID:34716852"
     CDS             complement(514805..515896)
                     /gene="RPL4B"
                     /locus_tag="KLMA_50245"
                     /codon_start=1
                     /product="60S ribosomal protein L4-B"
                     /protein_id="XP_022676710.1"
                     /db_xref="GeneID:34716852"
                     /translation="MSIPQVAVLSLNGETTSTDLPLPAVFRAPIRPDIVHSVFTSVNK
                     NKRQAYAVAENAGHQTSAESWGTGRAVARIPRVGGGGTHRSGQAAFGNMCRGGRMFAP
                     TKTWRKWNVKVNQNEKRYATASAIAASAVPSLVLARGHRVEKVPSIPLVLSDDLESIQ
                     KTKEAVAALKAVGAHSDVIKVIKSKKLRAGKGKYRNRRFTQRRGPLVVYSQDNGLVKA
                     FRNVPGVETANVASLGLLQLAPGAHLGRFVIWTQSAFSKLDQIWGSETVASVKAGYSL
                     PSNIISTSDVTRIINSSEIQSVLRAAGQSTQKRTHVQKKNPLKNKQVLLRLNPYAKVF
                     AAEKLGSKKVDNSKKVKPSAATMETLKHD"
     gene            complement(<516258..>517919)
                     /gene="RKM3"
                     /locus_tag="KLMA_50246"
                     /db_xref="GeneID:34716853"
     mRNA            complement(<516258..>517919)
                     /gene="RKM3"
                     /locus_tag="KLMA_50246"
                     /product="ribosomal N-lysine methyltransferase 3"
                     /transcript_id="XM_022820226.1"
                     /db_xref="GeneID:34716853"
     CDS             complement(516258..517919)
                     /gene="RKM3"
                     /locus_tag="KLMA_50246"
                     /codon_start=1
                     /product="ribosomal N-lysine methyltransferase 3"
                     /protein_id="XP_022676711.1"
                     /db_xref="GeneID:34716853"
                     /translation="MSNTDISDLSGILSFVHDAQGYINTKSCEIRRSQHGGLGVFALD
                     DLEEDTILLRLPKSSVFTPENSSIANLLVDSELSGILALNIAFIYEMFVFGEANLWYK
                     YLKSITFKHGDKLYLPPAYWSEEYKRFLKNTCLDTVFEALSPQDEIEEGFKVGVALSH
                     KWNEEFGLKIPYIFDFDLDNEAATAKNFMEFVAIAYAISSRVFEIDNYHDSGLVVIAD
                     LFNHHSSSPDVRFESIYDVCGKCGEMGACRHIIAATKIMDMEAQKSESDVPKGSGPGT
                     GTISMELIEELENEEEDDEDGDEDGDDEKEKIQMPGKINPDECVDIVLSKPVDAGAEI
                     FNSYGDHSNSYLLARYGFCVVDNPHDVVDLSEEVLEYGKKNQKRIGERMEWWENGLHL
                     SFKEWYQASRQEIQDEEEDQEEETSTGEQDQDNDDEDEDEDEDEDEDEDEEEEEEELD
                     AWQFMYLDFDGKPNEILLAIINLLTMPSAAYKKFLSAKDDSSKLLRKLPQLESPLSKE
                     GKSLLKTLCSSKKYANIPGTEGDYNLDQIRILVSSERSILRKAMS"
     gene            complement(<518241..>518633)
                     /gene="MRP49"
                     /locus_tag="KLMA_50247"
                     /db_xref="GeneID:34716854"
     mRNA            complement(<518241..>518633)
                     /gene="MRP49"
                     /locus_tag="KLMA_50247"
                     /product="54S ribosomal protein MRP49"
                     /transcript_id="XM_022820227.1"
                     /db_xref="GeneID:34716854"
     CDS             complement(518241..518633)
                     /gene="MRP49"
                     /locus_tag="KLMA_50247"
                     /codon_start=1
                     /product="54S ribosomal protein MRP49"
                     /protein_id="XP_022676712.1"
                     /db_xref="GeneID:34716854"
                     /translation="MSRIVKQKAFLNKISATTVKPQVVLDPSKYSALNLKFQQQNFNG
                     HMGARKFWHEFLPTLQFYNPTLPINVTRIKNEDKKVDIPCVLQVTGPDGNVLAEVGMK
                     DKHSSEIMDELLQKVEHTKVPSDQIIKV"
     gene            complement(<519439..>520884)
                     /gene="TPK1"
                     /locus_tag="KLMA_50248"
                     /db_xref="GeneID:34716855"
     mRNA            complement(<519439..>520884)
                     /gene="TPK1"
                     /locus_tag="KLMA_50248"
                     /product="cAMP-dependent protein kinase type 3"
                     /transcript_id="XM_022820228.1"
                     /db_xref="GeneID:34716855"
     CDS             complement(519439..520884)
                     /gene="TPK1"
                     /locus_tag="KLMA_50248"
                     /codon_start=1
                     /product="cAMP-dependent protein kinase type 3"
                     /protein_id="XP_022676713.1"
                     /db_xref="GeneID:34716855"
                     /translation="MLYGLRPLKRRKMTPYDKDYEGYMPGRNDQIELPVVQAVSTVSS
                     LEESQSQDHSQTLSVREDLPSASNSIGGNTIHSISSNIGETRTGNSNSNTTTTTNNNN
                     SNSNSNSNNTDAKSDTITGNYTSESTDRISGNNDKSSQTTRLQRHPSHLGMSPTIKPK
                     VTSGKYALFDFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTND
                     ERNMLSIVSHPFIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAA
                     EVCLALEYLHSKGIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIA
                     PEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYDSNTIKTYENILNAPLKFPPFFHED
                     ARDLISKLITRDLSQRLGNLQNGSEDVKNHPWFSEVIWEKLLCRNIETPYEPPIQAGQ
                     GDTSQYDRYPEEEVNYGVQGEDPYHSIFADF"
     gene            complement(<522849..>524693)
                     /locus_tag="KLMA_50249"
                     /db_xref="GeneID:34716856"
     mRNA            complement(<522849..>524693)
                     /locus_tag="KLMA_50249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820230.1"
                     /db_xref="GeneID:34716856"
     CDS             complement(522849..524693)
                     /locus_tag="KLMA_50249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676714.1"
                     /db_xref="GeneID:34716856"
                     /translation="MAVSEMVPEDEELPTAQHPESHNGRVMSAQEYANEGMEYVVENT
                     GVAIFENSFIDEEDEDDSDEVRWLREARKKHADMKWWTRPSVVYLCAILAAIGLTESF
                     VIPPTTLLSMKRVCESIAYSDNTWNADGSPICDSAKVQKELSELNSIVFLVNGIAGTL
                     LSGKLGQLSDRFGRVPIFIYISFMKTAGLALMIYVFITSRPFPRTLFIIGQCIPSLGA
                     STISLIANGNSYISDIVEPEARPLYISFVMSTIYGAIGLGPFFSSLLVKASNGNNFVP
                     MWTALGLAVCVTLVCAFLMGESRHDMAKQKSQVQFLRRRQSMESIATQNSSTGTLGSI
                     SVKARYTLAQFFDFLSPIRKLWIAPTAAGSLIPRYMVLLLVTIDCLFMTSTAASVPAL
                     VLAFVFMFNWSSEELGYFVSCIGLGRAAALLFLAPLVLHFLKKRFKVLEKSIDHTDTF
                     VIRTSLVFILLSLIAVIAIPNETAVVIFVLFQILSSMLSPTIQSTVIKYGSKSSTGEY
                     FGALALIRSGTMMVLPSFFLSLYSHTVSINPTLFVYIPLTMSVLACVLSAFLKIVEDP
                     ELLRRQSEVALPTLNMRDAKARYGSTSSIPKPQRRESSAKSLRIPTTR"
     gene            complement(<525162..>527927)
                     /gene="MCD4"
                     /locus_tag="KLMA_50250"
                     /db_xref="GeneID:34716857"
     mRNA            complement(<525162..>527927)
                     /gene="MCD4"
                     /locus_tag="KLMA_50250"
                     /product="GPI ethanolamine phosphate transferase 1"
                     /transcript_id="XM_022820231.1"
                     /db_xref="GeneID:34716857"
     CDS             complement(525162..527927)
                     /gene="MCD4"
                     /locus_tag="KLMA_50250"
                     /codon_start=1
                     /product="GPI ethanolamine phosphate transferase 1"
                     /protein_id="XP_022676715.1"
                     /db_xref="GeneID:34716857"
                     /translation="MWNKHRAYFIIAGVLFHLFYLWSIFDIYFVSPLVHGMRQHLSTN
                     EPPAKRLFLIVGDGLRADTTFEKLVHPVSGEHDFLAPYIRQLVQNEATYGVSHTRMPT
                     ESRPGHVAMIAGFYEDVSAVTKGWQENPVDFDSFFNQSTHTYSFGSPDILPMFKQGAT
                     PNKVDAWMYGHEFEDFTQSSIELDAFVFRHLYELFDASKVNKTLGNEIKQDGNVFFLH
                     LLGCDTAGHSYRPYSAEYYDNVKYIDEQVKILVKKVHEFFGDEDTAFIFTADHGMSAF
                     GSHGDGHPNNTRTPLVAWGAGLKKPVKNEVPIFDNYTENWHLADIKRNDVNQADIASL
                     MSYLIGVNYPVNSVGELPLAFIDASEEKKLNALFNNAKSILEQYLVKEEEIIASQFVY
                     KEFEGFVQKPYNQYLEEIQNLIDRIAQGENSLEPEAIKLTEELMKVTLDGLAYLTTYN
                     WRFIRTIVTLGFLSWIVYSFSIFLRLFILNKEYNTEKSVLNYFVFGTLTIVLNYVLYY
                     QKAPFNFYMYLLFPLIFWSQIFTDHAVLHDGIREFLKDISISHRIGLLLGIVFVYEAI
                     VYAFFDRWIFSFVFNMLSFYPMVCGYKNWKRNILWFVTSACISVFTLLDPVKIENLTQ
                     INISSAMIVLASIGGFLHLRKQLNTYTRITFVTQILLVILMTLATNKSVISLQNRDGL
                     PKDAQVAGWVILVTSLIVMPLVHYMHPNNNYKVRMLIIFLTFAPTFIILTISFESFFY
                     LVFSAYIVQWIEIESKIKEQRTKSDDYRQLIRVTVIGFFLLQNAFFGTGNVASISSFS
                     LDSVYRLMPIFDPFPMGALLMIKLIIPYIILSAGLGILNLKLRIKDYTISSLIISTSD
                     ILSLNFFYLLKTEGSWLDIGITISNYCLAILSSLFMLILEIVAHLVLRNVQLSKPLAV
                     DSDKKNT"
     gene            complement(<528455..>530404)
                     /locus_tag="KLMA_50251"
                     /db_xref="GeneID:34716858"
     mRNA            complement(<528455..>530404)
                     /locus_tag="KLMA_50251"
                     /product="J protein JJJ2"
                     /transcript_id="XM_022820232.1"
                     /db_xref="GeneID:34716858"
     CDS             complement(528455..530404)
                     /locus_tag="KLMA_50251"
                     /codon_start=1
                     /product="J protein JJJ2"
                     /protein_id="XP_022676716.1"
                     /db_xref="GeneID:34716858"
                     /translation="MGSENGFQLDETTLYSILGLKYGATDVQVRKAYMKLARQLHPDK
                     SKSEEAGELFKKVAHAHFILTDKKEKMKYDSKLLAKGLYDYTPRTTTNSTQFSETKKP
                     FQPVNKNGDIGSVKQKTRKSRPYEEQPYGFGVDSNRGPSKNIPLFKTFNAKSYQNSKK
                     ATTPPREEQSSEQNKRHTSTSHERPTNKLDALGKTYSKEKNSSETGLKSDSRTPSSGS
                     DTSTTSASTAGSTEESEAYVQNKMPRKDQNSGAKIRFNGPKAPDSPFQDPARRHFART
                     KYVSGLQGRRSLSPVKNTPNSSTETLNNVKNIFNSMSDRLRHTLFGENDEGYEDSKES
                     KWKNSRSENDEASGRLFKKSKLPERKIFTDEEIYEYMKQQNESDNYDDPDRQDFNSSI
                     HLNTEHLDDKNELNTQDFRQASVTDTKIDQAHTTTEMNTQKQKDEEDEDEDDVIKLKE
                     LEQTLPNSKEPFDMRNVGDTLDNYKVKRMKVPTYGKRVSSTTSTSASHAEENLQEAVN
                     IPLPRVYKPESIPLENYKIDTSIANIVLPEIPNLLCNVLDRSQVLECQQKTIEFTQQT
                     NETKHKLLQILSQRFTADEMLHEKLYRIENVNNLVAAKRYDMELLAKLNELQNRQRIV
                     AENHANLMNTVYASGLFESSKGVKQ"
     gene            complement(530753..530826)
                     /locus_tag="KLMA_R513"
                     /db_xref="GeneID:34718736"
     tRNA            complement(530753..530826)
                     /locus_tag="KLMA_R513"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:34718736"
     gene            complement(531232..531303)
                     /locus_tag="KLMA_R514"
                     /db_xref="GeneID:34718737"
     tRNA            complement(531232..531303)
                     /locus_tag="KLMA_R514"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:34718737"
     gene            <531801..>532328
                     /locus_tag="KLMA_50252"
                     /db_xref="GeneID:34716859"
     mRNA            <531801..>532328
                     /locus_tag="KLMA_50252"
                     /product="mitochondrial membrane protein FMP33"
                     /transcript_id="XM_022820233.1"
                     /db_xref="GeneID:34716859"
     CDS             531801..532328
                     /locus_tag="KLMA_50252"
                     /codon_start=1
                     /product="mitochondrial membrane protein FMP33"
                     /protein_id="XP_022676717.1"
                     /db_xref="GeneID:34716859"
                     /translation="MRISRLLQQQSNSNSPNSGDAGPKTPSQKIRSAPKYVQNSPTKA
                     NVVANVIINSLFALGLYCLYRDYTITKEKSGSAGTVRIIDTPSNKVSDKKPSEIQQAG
                     SFSQVIHSLTYRDLSALSVTMGFLGYITDVARQSFGKKSLIYRTSVFSLFLFPTSSYL
                     LYKSRYDKTHKLFDY"
     gene            complement(<532672..>533637)
                     /gene="PIR1"
                     /locus_tag="KLMA_50253"
                     /db_xref="GeneID:34716860"
     mRNA            complement(<532672..>533637)
                     /gene="PIR1"
                     /locus_tag="KLMA_50253"
                     /product="cell wall mannoprotein HSP150"
                     /transcript_id="XM_022820234.1"
                     /db_xref="GeneID:34716860"
     CDS             complement(532672..533637)
                     /gene="PIR1"
                     /locus_tag="KLMA_50253"
                     /codon_start=1
                     /product="cell wall mannoprotein HSP150"
                     /protein_id="XP_022676718.1"
                     /db_xref="GeneID:34716860"
                     /translation="MQIKKTFAASALAGSAIAAYVPSEPWTTLTPAATYNGGLTDYAS
                     TFGIAVVPITTSVSTHSAPGATHTASAESKGKRDVAAISQIGDGQIQATTATLKPTPK
                     TTAAAVSQIGDGQIQATTATPKPSPKTTAAAVSQIGDGQIQATTATPKPSPKTTAAAV
                     SQIGDGQIQATTKTTAAAASQIGDGQIQATTKTSSSASASSAAPSVAPASHNSTSVDP
                     VTAESCKSTGTLEMTLKGAVLTDGKGRIGSIVANRQFQFDGPPPQAGAIYAKGWSLTP
                     AGNLAIGDSDVFYQCLSGEFYNLYDESIGDQCKPVYLQAIDLLDC"
     gene            <536564..>537739
                     /gene="PIR1"
                     /locus_tag="KLMA_50254"
                     /db_xref="GeneID:34716861"
     mRNA            <536564..>537739
                     /gene="PIR1"
                     /locus_tag="KLMA_50254"
                     /product="cell wall mannoprotein HSP150"
                     /transcript_id="XM_022820235.1"
                     /db_xref="GeneID:34716861"
     CDS             536564..537739
                     /gene="PIR1"
                     /locus_tag="KLMA_50254"
                     /codon_start=1
                     /product="cell wall mannoprotein HSP150"
                     /protein_id="XP_022676719.1"
                     /db_xref="GeneID:34716861"
                     /translation="MQIKKTLAASALAGSAMAAYVPSEPWTTLTPSATYSGGLTDYPS
                     TFGIAVIPITTSVSTHSAPGATHTSAPSDKKASDKKSSDKKASNKKDKRDGAAISQIG
                     DGQIQATTATLKPTPKTTAAAVSQIGDGQIQATTATPKPTAQAVSQIGDGQIQATTAT
                     QKPTAQAVSQIGDGQIQATTATQKPTAQAVSQIGDGQIQATTATQKPTAAAVSQIGDG
                     QIQATTSTQKPTAQAASQIGDGQIQATTKTTAKTTATAASQIKDGQVQATTSSGAPAA
                     SGSAAPANPNDPVKAQSCKTNGTLSMTLKGAVLTDGKGRIGSIVANRQFQFDGPPPQA
                     GAIYAKGWSLTPDGNLAIGNSDIFYQCLSGGFYNLYDESIGDQCKPVNLQAIDLVSC"
     gene            complement(538578..538649)
                     /locus_tag="KLMA_R515"
                     /db_xref="GeneID:34718738"
     tRNA            complement(538578..538649)
                     /locus_tag="KLMA_R515"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:34718738"
     gene            complement(<539374..>540402)
                     /gene="PIR3"
                     /locus_tag="KLMA_50255"
                     /db_xref="GeneID:34716862"
     mRNA            complement(<539374..>540402)
                     /gene="PIR3"
                     /locus_tag="KLMA_50255"
                     /product="cell wall mannoprotein HSP150"
                     /transcript_id="XM_022820236.1"
                     /db_xref="GeneID:34716862"
     CDS             complement(539374..540402)
                     /gene="PIR3"
                     /locus_tag="KLMA_50255"
                     /codon_start=1
                     /product="cell wall mannoprotein HSP150"
                     /protein_id="XP_022676720.1"
                     /db_xref="GeneID:34716862"
                     /translation="MQIKSAAQLLALATAVSAATTKAQEENSSSWTTLKPTATYSGAT
                     SDYSSSFGIAIEPITTGSLAPTSTSSAKASSKAKRDVVSQITDGQVQATTKPTGKPSS
                     KAPEKPKGTAPAVSQITDGQVQATTKTLAPAAKPKPTTNAASQIGDGQVQATTGTAAP
                     APKPKPTTNAASQIGDGQVQATTGTEKPKTSAASQISDGQIQATTGSASAAKATGASQ
                     VSDGQIQASGAPKSSEDQKDGIQLSACATNGTLSMTLKDGILYDSHGRVGSIVANRQF
                     QFDGPPPQAGAIYANGWSITPDGNLAIGDNDVFYKCLSGNFYNLYDETLGAQCSAIHL
                     NIVSLTDC"
     gene            complement(<541507..>544272)
                     /gene="FAR1"
                     /locus_tag="KLMA_50256"
                     /db_xref="GeneID:34716863"
     mRNA            complement(<541507..>544272)
                     /gene="FAR1"
                     /locus_tag="KLMA_50256"
                     /product="cyclin-dependent kinase inhibitor FAR1"
                     /transcript_id="XM_022820237.1"
                     /db_xref="GeneID:34716863"
     CDS             complement(541507..544272)
                     /gene="FAR1"
                     /locus_tag="KLMA_50256"
                     /codon_start=1
                     /product="cyclin-dependent kinase inhibitor FAR1"
                     /protein_id="XP_022676721.1"
                     /db_xref="GeneID:34716863"
                     /translation="MIQVRTPTIDRPKKTHSPPSSTNTPSASSKFLKDVTGKGLRKIG
                     AKLNRTPTSQSTATFSPEVEYVQTFSDGPTPNSTKQLKTQFDLLKKRPAPLKLQPLTP
                     PASLKKPVLEESDEDAVARLESPIVLKFDKSTGRESSIYSASLGKQDILSFSSTLFDV
                     PRSSFTLSVDDKPFNMGTYDELESPTCVMQMQRNMRKANGTKKYNSCMCSICDESMQR
                     LLGGGERIVELECKHQCHMECFLAMMDGVTFEPPSCNVCGKKSQPADKQVSLDMVLKK
                     MKESKNGDSTPSATHSNMESSNGEVVMQSLLATNTSNTGATVTMSGISARKLVTPKNQ
                     LIHSAQVSTNGFNDVFNMLDEAFDEVSTPTNLICVEPLDFESVPKDELRINIMPKLER
                     YVIHEGSKVIVPHILSTHLPKDDEIEDIKTVQIIMCVSLVNNDPVNISNETFLETLKH
                     RVNTLLENLKPNDTFGLIVVGKDGSGTLGCKSTFYGFITKDWDGWQDIIDGWEVVVAS
                     EPVFPNPMWEAKEMLQATHRLLLTTGDPEEAQIRHVVMMNGVQHISKRHYRLEDDIFA
                     RKIEVLLEKIMAVHKCSLSQWIDEDEGHPFILRDYAPKWQYRIRTVFFEKLSFDIAKL
                     LKELRRVVVDGVTVKLECAIDKMVKLHSLDFNGKLYRCEGDHRNSLEINLPPFRYGDF
                     KLAIVELEVDVAMVQKHIEQMGSTISLLNYHGSQTGARAESGCVTFQIRHERPTCASP
                     PLSLTTPLFHGNGTGGAADTDAGAGAAGTDSVANAGNTDNNNTVTRSTSAARPRQEDS
                     LERASQYLDLPLVPPSSPSSDSLFVTRHIELMAVESLRKLVVQQDSSSSTTSGTSPEV
                     AIRELTSVVYGMSRECSAMNPQYYEETGHENRLEFYIETLTCRLEDILHHNNPRLMIH
                     KLIQSLA"
     gene            complement(<545201..>547348)
                     /gene="SSY5"
                     /locus_tag="KLMA_50257"
                     /db_xref="GeneID:34716864"
     mRNA            complement(<545201..>547348)
                     /gene="SSY5"
                     /locus_tag="KLMA_50257"
                     /product="SPS-sensor serine protease component SSY5"
                     /transcript_id="XM_022820238.1"
                     /db_xref="GeneID:34716864"
     CDS             complement(545201..547348)
                     /gene="SSY5"
                     /locus_tag="KLMA_50257"
                     /codon_start=1
                     /product="SPS-sensor serine protease component SSY5"
                     /protein_id="XP_022676722.1"
                     /db_xref="GeneID:34716864"
                     /translation="MVSKFFGFGKSKQSGRSEQQAPAVSSASSSRSSPAPSISGEHDV
                     NEDMVSQVTTSLQSSSIFSKGRHTIGTGTSSNLTDGSSLFDKGLGLTAIDENDSHGRS
                     TVGKPLRVLDYERLTSLNPVIEEESVSMKEYNDDHSGLASGSGSGMGSGNVSTSANST
                     LSKHNAGLNSSRRSERHYSTTSLEVLENELKLLNENLVSLMDDIHQNVTNVSKAVIQA
                     IEFFKKFLPDTNRVTYTVTMSNSLQLRSITKIVSHFVDNLLNASAFQNSRSILLKAYF
                     SFLQKLNINVFEDQMDNIHTLPTMRNFAIDDKCALPNMDKISLIVDEIVRCDPSCISD
                     QDGAFIAPVLRGLSRKSAILTVMFGLPNPQQEHHDMIKALFSTFPDLHFYCVKDYIKP
                     CAEVLSGISPEMKAKPMETTKAPTFVPPFRVPIDAFSPPISLSISTQESQKMTGTLGG
                     YLYPKIPKNDPKFAQFADATFAVTCAHVVLSENQDYPYVSAPSALLQNTYKNSLMEER
                     QHYSITSPEYDGFNQELQRVESNLKWQSDHKFGQVVWGERSIVDKSLSDFAIIKVNPE
                     FTCQNYLGDDINGLPDPALRFRNLYVTEKIENVKPGANVFKIGATSNYTTGKVNGTKL
                     VYWADNRIQSNEFVISSPQPLFANAGDSGAWVLSKLDGKLGLGVAGILHSYDGELKQF
                     GLFTPIQTILTRLQAVTGVEWDINPPPVASTTD"
     gene            complement(<548632..>550002)
                     /gene="FBP26"
                     /locus_tag="KLMA_50258"
                     /db_xref="GeneID:34716865"
     mRNA            complement(<548632..>550002)
                     /gene="FBP26"
                     /locus_tag="KLMA_50258"
                     /product="fructose-2"
                     /transcript_id="XM_022820239.1"
                     /db_xref="GeneID:34716865"
     CDS             complement(548632..550002)
                     /gene="FBP26"
                     /locus_tag="KLMA_50258"
                     /codon_start=1
                     /product="fructose-2"
                     /protein_id="XP_022676723.1"
                     /db_xref="GeneID:34716865"
                     /translation="MPVYTVSNVQNIRVCVVMVGLPARGKSFISQKIVRYLSWLSINA
                     KSFNVGNYRRQHAGAEHPDAEFFDFANKEAYKIRQHAVTMAVEDMMRWFNEKEGVVAI
                     LDATNSTPERREWILKLCRENGIEPMFLESWCDDQDLILRNISEVKTTSPDYQGIDPD
                     VATKDFLKRISKYESVYEPLDEIKDKDKTFVRLINVAQQVIINKIETYLESRIVFYVM
                     NLHIRPRSIWLSRHGESIYNVEKKIGGDSHLSPRGLQYAKKLPDLVRQSAGDVDLTVW
                     TSTLVRTGETAQHLQYKQLQWKALDELDAGVCDGMTYEEIEEKYPEDFKARDDNKYEY
                     RYRGGESYRDVVIRLEPIIMELERQENILIITHQAVLRCIYAYFMNVPQEESPWMSIP
                     LHTLIKLEPRAYGTNVTRIKANIPAVSTYKEKGTSQVGESEQGGVKSRSILMSAPELD
                     VKSTKT"
     gene            complement(<550435..>553083)
                     /gene="VPS35"
                     /locus_tag="KLMA_50259"
                     /db_xref="GeneID:34716866"
     mRNA            complement(<550435..>553083)
                     /gene="VPS35"
                     /locus_tag="KLMA_50259"
                     /product="vacuolar protein sorting-associated protein 35"
                     /transcript_id="XM_022820241.1"
                     /db_xref="GeneID:34716866"
     CDS             complement(550435..553083)
                     /gene="VPS35"
                     /locus_tag="KLMA_50259"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 35"
                     /protein_id="XP_022676724.1"
                     /db_xref="GeneID:34716866"
                     /translation="MAAVLPYSENMEQAISHIKQQTILMQRSLVQKKLMDALKHCSDM
                     LKELRNPDLSPKLYYELYIMIYDSLSILSQYLVENHPTRHHLADLYELVQYTGNILPR
                     LYLMITVGVSFMQTKDCPAEEVLKDMIEMCRGVQHPIRGLFLRYYLSQRTKQSLTTDI
                     SLDKKFDVQFIITNFIEMNKLWVRLQHQGPLRERDIRTKERKELQILIGSNLVRLSQI
                     LDDSFILYKNEVLPQILEQVVQCRDVVSQEYLLDVICQVFPDEFHLGTLSQLLDTTLK
                     LNPDVSINKVVLSLIARLNGYLDRQDDPAKSIEALKDLHLNDQEESSDTKNDADSGKP
                     DEAVSESAPQPSFDLFFVFWKYLTKIVEERPDLPLHEIIPLVHSIMILSMKWYPSNLS
                     NVEILYKFCWERYEDFGKEIPEECEQCFKELFLYPLGTDLFYDIITTCDSFQKLLSVQ
                     SVPLQKNIIDSILDKILSSDIKIKDKSHLEKIGLICEPIIQMPNDRAKTSILNVDDDL
                     EDELVFLNAEQEKLAKIVHLIYHPNVEQHTELLLICKNRYYKGGKQIRFTYPAIVTAF
                     WKLIRKLHFKGLKRPQKKEKYNATIKQLFKYISRCHTDLFNICGISICDLLFKLNLQT
                     AALADQLSLSEISYDFFSQAFSIFEESLSDSKVQFQAIVNMAQVLQKTRSLYNEENYY
                     DTLITRCTLHGSKLLKKADQCRAVYLCSHLWWATELSLVGEEEGVTKNFFREGKRVLE
                     CLQRSLRVADSVMDNIQSCQLMVEILGRCCYYFIHGDESETHVGVKYIAGLIELIQAN
                     LKGLLLEESTDAQDATVPAQKIVIGCDGSYICKTLTSSTCRVSLKTPNVRVSDLIAVP
                     VSYFERTLQYIENQKQVDDRFNAIAT"
     gene            <554124..>555161
                     /gene="CCP1"
                     /locus_tag="KLMA_50260"
                     /db_xref="GeneID:34716867"
     mRNA            <554124..>555161
                     /gene="CCP1"
                     /locus_tag="KLMA_50260"
                     /product="cytochrome c peroxidase"
                     /transcript_id="XM_022820242.1"
                     /db_xref="GeneID:34716867"
     CDS             554124..555161
                     /gene="CCP1"
                     /locus_tag="KLMA_50260"
                     /codon_start=1
                     /product="cytochrome c peroxidase"
                     /protein_id="XP_022676725.1"
                     /db_xref="GeneID:34716867"
                     /translation="MSSFRAAFKGINVKALSYVVGAGALAGSVTGAVMEHQNWENSNN
                     RNYNKQKLAALAAAHLAAKEKNDASKYQQVYNDIALKMREEDEYDEYIGYGPVLVRLA
                     WHCAGTWDKKDNTGGSFGGTYRFKKENTDPSNNGLQNAAHFLEPIHAKYPWLSHGDLY
                     TLGGVTAIQEMQGPKIPWRSGRVDQPEETTPDNGRLPDATKDAKYVRCFFSRLAFNDR
                     EVVALLGAHALGKTHLKNSGFEGPWGAASNMFTNEFYNNLLNEKWKLITNEAGNKQYI
                     NDKGWMMLPTDMALVQDSKYLPIVKEFAKNENAFFQEFTKAFVKLLENGIEFPKENKP
                     IVFKTLDEQDL"
     gene            <555856..>558117
                     /gene="SWE1"
                     /locus_tag="KLMA_50261"
                     /db_xref="GeneID:34716868"
     mRNA            <555856..>558117
                     /gene="SWE1"
                     /locus_tag="KLMA_50261"
                     /product="mitosis inhibitor protein kinase SWE1"
                     /transcript_id="XM_022820243.1"
                     /db_xref="GeneID:34716868"
     CDS             555856..558117
                     /gene="SWE1"
                     /locus_tag="KLMA_50261"
                     /codon_start=1
                     /product="mitosis inhibitor protein kinase SWE1"
                     /protein_id="XP_022676726.1"
                     /db_xref="GeneID:34716868"
                     /translation="MPSKEKHRLPVGFGRALEDTALSPRVDVYQDINDEETDHTYHSD
                     IDADIDADLDVDLDVGFHYYDRLSHFNSNSNNLKFYSEPPNSGLHSNDTPLGLTRSVG
                     VLNLSLGAKTQYQDQESFADNDNDNESENNNNNNSKDNDDDKGNDDDDDNDKGQLHAP
                     AKLQGAPILSSTAIGTSTSLKRTMSKTGFSITSPFSKNPSQNKTWHDFSSSEYTNLAT
                     VKTAETSNHSFSEAKPDPAAFQSSGLISKMKQKVLPKKLTIPDTPMKKSPLVTRHSDN
                     ELLGTPILEYSSIMSAHNHTTLPTMHESQLFKSPPMINTFPPSSDNSPTSSSNPRSKK
                     RTKIVKNTELTSMLRQITDDLYGHDQESSIFSHSQSKDALQTPTKTSFDIGPDSPALI
                     PKLQKEPLFSSQPSQHRTINASIMRNPDFHLTTKFSNVSIMGKGQFSTVYQVTFPGTG
                     LKYAIKSVRPTKHNFTNRILQEINMLSTIQDSITNDSEGKEYIIEFISSWSHKGSFYI
                     MTEFCENGNLDNFIQEHVIAKQQRLEDWRVWKIIVELCLALRFIHDSCSIVHLDLKPA
                     NVLITFEGNLKLADFGMATKLPIKDKSFENEGDREYIAPEIISDGIYDFRADIFSLGL
                     MMVEIAANVILPDNGSAWHKLRSGDLSDAGRLSSTDIHSSSLFSNKKDHTNITDITTS
                     DSKIPAWVPRFLLDGMSLEKMIRWMIEPDYRDRPYASDLLRTEELEYVEMTRKTGAVI
                     HEDDYGPKPEFFS"
     gene            <560436..>560828
                     /gene="RPS22"
                     /locus_tag="KLMA_50262"
                     /db_xref="GeneID:34716869"
     mRNA            <560436..>560828
                     /gene="RPS22"
                     /locus_tag="KLMA_50262"
                     /product="40S ribosomal protein S22"
                     /transcript_id="XM_022820244.1"
                     /db_xref="GeneID:34716869"
     CDS             560436..560828
                     /gene="RPS22"
                     /locus_tag="KLMA_50262"
                     /codon_start=1
                     /product="40S ribosomal protein S22"
                     /protein_id="XP_022676727.1"
                     /db_xref="GeneID:34716869"
                     /translation="MTRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKH
                     GYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKISDVEKWTANLLPARQFGYV
                     ILTTSAGIMDHEEAHRKHVSGKILGFVY"
     gene            complement(<561174..>562239)
                     /gene="RPS14"
                     /locus_tag="KLMA_50264"
                     /db_xref="GeneID:34716870"
     mRNA            complement(join(<561174..561568,562230..>562239))
                     /gene="RPS14"
                     /locus_tag="KLMA_50264"
                     /product="40S ribosomal protein S14"
                     /transcript_id="XM_022820245.1"
                     /db_xref="GeneID:34716870"
     CDS             complement(join(561174..561568,562230..562239))
                     /gene="RPS14"
                     /locus_tag="KLMA_50264"
                     /codon_start=1
                     /product="40S ribosomal protein S14"
                     /protein_id="XP_022676728.1"
                     /db_xref="GeneID:34716870"
                     /translation="MANAKDNSQVFGVARIFASFNDTFVHVTDLSGRETIARVTGGMK
                     VKADRDESSPYAAMLAAQDVAAKCKEVGITAVHIKIRATGGTRSKTPGPGGQAALRAL
                     ARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL"
     gene            <563246..>563950
                     /gene="SOP4"
                     /locus_tag="KLMA_50265"
                     /db_xref="GeneID:34716871"
     mRNA            <563246..>563950
                     /gene="SOP4"
                     /locus_tag="KLMA_50265"
                     /product="protein SOP4"
                     /transcript_id="XM_022820246.1"
                     /db_xref="GeneID:34716871"
     CDS             563246..563950
                     /gene="SOP4"
                     /locus_tag="KLMA_50265"
                     /codon_start=1
                     /product="protein SOP4"
                     /protein_id="XP_022676729.1"
                     /db_xref="GeneID:34716871"
                     /translation="MQYIFALILLLCQLVNPCLAFDIKGRLDLKLRNVSNHDIMRTQF
                     KIYRINDDSNDIYSLSTRLESAAGEFTFRDVPIDTGLNQTTYFALHSSSLEFNLKPNR
                     ILIEVIGSGADAEPTVKAYENKFGREYFPSPDILFPETLKPVELDAEGRITITVMNKQ
                     PIRRYIIVRNPGILSSGPIASILNSRLKLAGVITVIMMFVFPFLLEKLDPETAKAVRQ
                     QKFEKANAKYLTKDKK"
     gene            <564182..>570163
                     /gene="BPH1"
                     /locus_tag="KLMA_50266"
                     /db_xref="GeneID:34716872"
     mRNA            <564182..>570163
                     /gene="BPH1"
                     /locus_tag="KLMA_50266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820247.1"
                     /db_xref="GeneID:34716872"
     CDS             564182..570163
                     /gene="BPH1"
                     /locus_tag="KLMA_50266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676730.1"
                     /db_xref="GeneID:34716872"
                     /translation="MVSKCIELLTSVLYLEPADSEDAINLLKDICTPSEESKTGDISQ
                     YNIEFGLLTSFTNISPIEQNFVFTDITQWEKLLSLQSTDVEYAAALEIILKLASISIL
                     NRQSLAQKPAIKAFVKNRLKDDHLEPHLVRAFEELYYQIFSVQADSEEMRYVYEEQYP
                     YRWNLLSLISEHLNNQWAQTHLIFKNAYVTFTDQKLPDKFTIETNIELLGVTSNRILT
                     LGRDFYIGIENEYLCISDDSYTLAVFSEYDFREGIVYKLAIRYDLGSVSLFVNGDFVQ
                     SITLHKHKINNVSVVEIGSVISYFKLYQFSIIDDCLRVQDDENDRNKYHLTDKLKRRS
                     LILNVDIDEIINTSSKDTKAFELAEISNSFSTGKCFYYQTSDIVGLFESMNILETLIH
                     RLLREDNLDIMILIVNHLIKCLKNTEIESIFLKFNGYSVLNYILMAKTQEGYNIPFSF
                     LYEDDRITRLLSDIYNADNFLTYESPLKIELNFRLTAPSRHLISVFDGLNEVERDSKL
                     SRDNILALQRTIIFQLYSFFSQSELSSTLESNNSSVNVLLECFLIKNIHENGTIVHLQ
                     FPYFCLVTGNIVLAKLLLQTLESTFSYYQEKDQDFLCKDIPRTLYIKVFLILLEAGIE
                     HVDVIETVYAVLLKFFENQSLIFEQFMDTNGYTLLLGILSTYQKSTLQLIACILKASN
                     RDQTNSLVIGTRKINYPSEDRLSIFSHCLIINVLEHFISKDPFDIQDTVVAFIDYLND
                     IREETPDHMIFHGSNYRLVNQLMELQISLEMTNAEDLLLSVGSKNKSLLAEIIVHLMT
                     NMDYKSFESLLRVLANDVNGKKAGGSTKYRRMGFIFMVSPEIFKTLLKFTSKMDIGMD
                     ALLSFGKKLIILLSTCSVYWRVHDASWDSIFDLHRIVAITKEHIVTSHLNNVYAQKLL
                     KNLNEAHEEIDNWLFAFAVNNLECLDNKLLEEFLHSLLYYQEVLFIERHRKTAFSNET
                     VANLLGFLKVTIPSFQPNLHFLGLTIFRAVCTLRFSDLELISKLSSKKVTQCCNFLNE
                     CMKEDDEKLLSNLQLSENSVLFEKSINRLRYLFQGSAMATNGSRRSSRSQFIHVVFKE
                     KTDHYKWDVKELSSIHSLFKKDNLNLTKNMFFIEDKRLQDFFADLKYQDDLGYHLTLK
                     LIRKSSAVSYLRNFPVHRKWFVSERENVKRQRKQLLPIFEPDQNIPTLDGKYCLQQEE
                     NVRSQFSDISNTFSSSEDLGSDFKKEGIKDVILDKNRAVLQLLKSSENITNIWNTTKI
                     MGLSITPGVIVLTTASIYFIPGCYYHLEEKKVMDIATFPGPLKNSIVDAISSDLLLKP
                     SHSNSENISLNSEWDIHTLYYVIKRPFLLRDTAMELFFGYKSTVMFSFESQQLRNEVF
                     LVLRKIASKDSGYSIWSSILEEVNFKSNVLGRNNGITHTSVSDKLTNALTILSKQHVP
                     TSMIDLWNEGLLSNFDYIMAINTLAGRTCNDLTQYPVFPWVIADYESDEINLDDPATY
                     RDLSKPMGAQNEQRKQAFIERFEALKGLDDESPPFHYGTHYSSAMIVSSYLVRLEPFS
                     STYKTLQGGQWGPPDRLFNSISRAWKSASSEASTDVRELIPEFFYLPDFLENKNGYEF
                     GVTQTGHEVSNVSLPPWAKNDPKKFIEINRQALESKYVSEHLHEWIDLIFGFKQRGSP
                     AVEAVNVFNALSYPGNVDIDKIDNENERKAITGIIYNFGQTPLQIFQNPHPQRKVKSH
                     SSDIDKGLLEVSTASPYTEDTKKAKLSVLKIHHKGFKINGKVFRQGHSSPINVLKTID
                     DKLFATGDQIGLIKVWRIEDDRLNSMTSLSGHETGIKAIESSLQYDLLFSLDADGVAI
                     TWDLTEGRVINKFPTPARLISLSPSTGNLAIVGDKGISVYDINASLYCLCDISDQITA
                     IKFIEHDMFWPYRFHEQVDTILVAMTHKIVVYSLKLVGSEWQLLPVETLESSKVDHIT
                     DINIKTGNSLANTEGKANKVELVTTDKNGNRWLWT"
     gene            complement(<570204..>571346)
                     /locus_tag="KLMA_50267"
                     /db_xref="GeneID:34716873"
     mRNA            complement(<570204..>571346)
                     /locus_tag="KLMA_50267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820248.1"
                     /db_xref="GeneID:34716873"
     CDS             complement(570204..571346)
                     /locus_tag="KLMA_50267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676731.1"
                     /db_xref="GeneID:34716873"
                     /translation="MGRIIWKFRSLIPISSDTNIAVPIVCLCWYAISSFGSQITKRIL
                     TECPMPLFLGEFQFIFIVLSACITCLIGHYVPGVRKLFPEGTFPRSQDPGVNVIMRPS
                     KEVLLTVFPLGLFQFMGKYYGHRATSLVPVSTVASIKTLSPIFIILAQKMLKRFDHKL
                     NRAIYLSLGCVMLGVWVIVYSDSKNTVPKTQISDLDDQAIKTSHYGVLFASISMLIFV
                     IQNIYAKNIFTYKSDHNELPIATSKSDYRRSLRSPRKYDKLTLMIYISVVGFSISLGW
                     FIALELPTLWANFFHEPHNVEIPWRLIILNGVLHFLQSMITFYLLGEISTLSYSIANI
                     MKRIAIISFSWLYTAHSITMIQVLGILLNVTGLFFYERLMKKNQIR"
     gene            complement(<572072..>573571)
                     /locus_tag="KLMA_50268"
                     /db_xref="GeneID:34716874"
     mRNA            complement(<572072..>573571)
                     /locus_tag="KLMA_50268"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820249.1"
                     /db_xref="GeneID:34716874"
     CDS             complement(572072..573571)
                     /locus_tag="KLMA_50268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676732.1"
                     /db_xref="GeneID:34716874"
                     /translation="MDYYYSDANLHSVFDIAQEDCFDQVSPSLNFSCHSGDLLVKNAS
                     LWQLLDASPTQIFKTDATDVTEFITTKYSEESFIIFNDNKGDSITDTTVNTTQDIEQT
                     VEPKSADNYLNPQVLSINGSELLKDNFLLSDSSQTKEAAVPRKVNVDYFKPVSTFFSS
                     NPLQPLQTANILNIQPQQMFGVPMLSDSKKTSHRRRRPSRITKIARPQRKHVRFYYDQ
                     KLDGRFNVVFKGGFIRQSVIKSYFPDYELDNFTLPNNWNPVTVELENDFYGSMEESIN
                     SQIKEGVSHVRTYWKMTKRMVGSKFFITIQEESLDCDPIFDDDNYYFNIITTVVESGS
                     FGAIERGARNRDKIQRAITKDDAAANFRWCHFITSSEMKGIFDFFLADYDYCANDNSV
                     LEKLKVGAKPDPFKHHESRIRSHMLGYISGKSCKLHATKLKDKPKLFSEQMYRLIMSF
                     DDYKRPFNTTKDISVMEMKYMFENLSDLLEKYYWVDPSTVPEGGYPMKN"
     gene            <574327..>575625
                     /gene="WRS1"
                     /locus_tag="KLMA_50269"
                     /db_xref="GeneID:34716875"
     mRNA            <574327..>575625
                     /gene="WRS1"
                     /locus_tag="KLMA_50269"
                     /product="tryptophanyl-tRNA synthetase"
                     /transcript_id="XM_022820250.1"
                     /db_xref="GeneID:34716875"
     CDS             574327..575625
                     /gene="WRS1"
                     /locus_tag="KLMA_50269"
                     /codon_start=1
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="XP_022676733.1"
                     /db_xref="GeneID:34716875"
                     /translation="MAEKVTEDLKNLSTKEEPVADQVVTPWDVEGAVDENGVQQSIDY
                     EKLIKQFGTKAIGEETLARFEAVTGRKPHHFLRKGVFFSERDFNKILDLYEQGKPFFL
                     YTGRGPSSDSMHLGHMVPFIFTKWLQDVFDCPLVIELTDDEKFLFKPKLTINDVKKFT
                     KDNAKDIIAVGFDAKKTFIFSDLEYMGGGFYETVVRISRQITGSTAKAVFGFNDSDCI
                     GKFHFASIQIAAAFPSSFPDVLGLPDKTPCLIPCAIDQDPYFRVCRDVADKLKYSKPS
                     LLHSRFFPALQGSTTKMSASDDTSAIFMTDTPKQIQKKINKYAFSGGKVSIEEHRKYG
                     GNPDVDVAYQYLSFFKDDDEFLKKCYDQYKSGEMLSGEMKKLCIETLQVFVKDFQERR
                     AAVDDETLDKFMKPHKLVWGQEERLVPVKPKEDKKKDSKA"
     gene            complement(<575810..>576442)
                     /gene="RIB3"
                     /locus_tag="KLMA_50270"
                     /db_xref="GeneID:34716876"
     mRNA            complement(<575810..>576442)
                     /gene="RIB3"
                     /locus_tag="KLMA_50270"
                     /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
                     /transcript_id="XM_022820253.1"
                     /db_xref="GeneID:34716876"
     CDS             complement(575810..576442)
                     /gene="RIB3"
                     /locus_tag="KLMA_50270"
                     /codon_start=1
                     /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
                     /protein_id="XP_022676734.1"
                     /db_xref="GeneID:34716876"
                     /translation="MVEFTSIEVAVEKFKNNEFVIVMDDESRENEGDLICAANNITPA
                     QMAFLVRYSSGYICAPMSNEWADRLDLPLMRQLSCKSNADDRHGTAYTITCDYVHGTT
                     TGISAHDRALTCAKLADKTTTPNDYLKPGHIVPLRAHDSGVLGRRGHTEAAVDLCKLA
                     KIPPVGVIGELVKDEDGDMMRLDDCVEFGKKHNISIISIEELVDYIQKHQ"
     gene            complement(<577423..>578457)
                     /gene="SUR4"
                     /locus_tag="KLMA_50271"
                     /db_xref="GeneID:34716877"
     mRNA            complement(<577423..>578457)
                     /gene="SUR4"
                     /locus_tag="KLMA_50271"
                     /product="elongation of fatty acids protein 3"
                     /transcript_id="XM_022820254.1"
                     /db_xref="GeneID:34716877"
     CDS             complement(577423..578457)
                     /gene="SUR4"
                     /locus_tag="KLMA_50271"
                     /codon_start=1
                     /product="elongation of fatty acids protein 3"
                     /protein_id="XP_022676735.1"
                     /db_xref="GeneID:34716877"
                     /translation="MSVPSCVQELLAKLEELPWVEYQVPSVERPFGLHLWPIFSKGFE
                     AVAGYPADEFQFIHNKTLMANGYHAIAAIIVYYIVIFGGQALLRKANAAPLKLNFLFQ
                     LHNLVLTSVSLGLLLLMIEQILPMIYHHGLFYAICSKEAFAPKLVTLYYLNYMTKFLE
                     LFDTVFLILKRKKLLFLHTYHHGATALLCYSQLQGKTSIEWLVIMLNLGVHVVMYWYY
                     FLSSRGIRVWWKEWVTRFQIIQFLIDLVFVYFATYTFYADKYFPDILPNKGTCYGTES
                     AAAYGYLILTSYLVLFISFYIQSYRKGASKKRESEAKAAAANKAASATTTGAQTPQKS
                     KGKGKSSKRV"
     gene            complement(<579247..>582942)
                     /gene="ROM2"
                     /locus_tag="KLMA_50272"
                     /db_xref="GeneID:34716878"
     mRNA            complement(<579247..>582942)
                     /gene="ROM2"
                     /locus_tag="KLMA_50272"
                     /product="RHO1 GDP-GTP exchange protein 2"
                     /transcript_id="XM_022820255.1"
                     /db_xref="GeneID:34716878"
     CDS             complement(579247..582942)
                     /gene="ROM2"
                     /locus_tag="KLMA_50272"
                     /codon_start=1
                     /product="RHO1 GDP-GTP exchange protein 2"
                     /protein_id="XP_022676736.1"
                     /db_xref="GeneID:34716878"
                     /translation="MNYSANDLEHGSRRQLFTHIFGIKRPLSPPPSTVPRDIPDSLDM
                     MNLKAVLNEDVEKDLQQRQPQHDSIFSSPVHVRQISDVSSIEQENNLTPPDSESPQPY
                     RSKDTNLPRQRPASHQTHGRPTPPVMDMIHESPRRTKSENFNTKPSLAPLSTSSINDN
                     TSNHNHNNNNSRGSFTSKKSPLQGFGLFSRSSSKDLQADANLTMTNSNHHHHNNNSNN
                     NNNNNNHNSLSSDHLFARTQSISSSTFKNFTSPFQGKSKTAGGRTIPQKYDHTVNPLS
                     ESSMGLGLKQRASSASLSTENTGSRHIRRTSTSSLYTKHFVVSSSIRRPQVYPAILSR
                     VATAFKKSITLGEYKKDGLVYRDAFTGQQAIDVICSIIRTNDRNLALLLGRALDAQKL
                     FHDVIYEHRLRDSPNEVYEFTGNSRVIGKGIYEIEPSGTFSTSQSTATLLPSQSESSL
                     SLMEKAEDPDTFHQVNGVFTLLAECYSPTCTRNRLCYSISCPKRLEQQARLNLKPNGG
                     LKRNISMAIDDDDEEKTSWTSSVPEEVWSKLSKREIKRQEAIYEVYSTEKKFVKSLEI
                     LRDTFMKKLAETNIIPADIRKNFIKHVFAHVNDIYSVNRRLLDALAERQKASPIVDGI
                     GDILLRFIPFFEPFVMYVASRPYAKYLIETQRSVNPYFARFDDDLMNSKLRHGIDSFL
                     SQGVSRPGRYVLLVREIMKSCDPVADKRDLENLTRALEALRAFMKRIDKASGAAQDRH
                     DVKLLKQKILFKNEYVNMGLNDDKRKIKHEGLLSRKEVTKNDNGGFGDIQFYLLDNML
                     LFLKSKAVNKWNQHKVFQRPIPLPLLFAAPGEEMPSLKKHICGKADSQGTVIIPEGVA
                     VANPRNAITFLYYGAKQKYQVTLYAAQFAAMQTLLEKIKQEQARIIKENDIFNICKIS
                     DRYFDYSNKINSVASCDGGRKFIIATSQGLFVSSVRRVENTISFGTPTKLLSKNNISQ
                     LSVLEEFQSILILVDKKLYSCSFELLNITEPQAGNTYFKKHAKELATHVSFFSTGDCN
                     GKKLIVTAHTSHNSIKYFEHQHPLLHDKKHAKKKYTEVQFDSEPVSISFLKANLCIGC
                     KKGFQIVSVSQNAHEPLLDPADTSLDFAIRDSLHPQVIYRVGNMFFLCYTEFAFFVNN
                     QGWRKKEYHIIHWEGEPEKFAIWYPYIIAFDNNFIEIRKVETGELVRCIVGEKIRLLQ
                     TSSQEILYVYEDERGYDTIASLDFWGK"
     gene            <583808..>584338
                     /gene="ARC18"
                     /locus_tag="KLMA_50273"
                     /db_xref="GeneID:34716879"
     mRNA            <583808..>584338
                     /gene="ARC18"
                     /locus_tag="KLMA_50273"
                     /product="actin-related protein 2/3 complex subunit 3"
                     /transcript_id="XM_022820256.1"
                     /db_xref="GeneID:34716879"
     CDS             583808..584338
                     /gene="ARC18"
                     /locus_tag="KLMA_50273"
                     /codon_start=1
                     /product="actin-related protein 2/3 complex subunit 3"
                     /protein_id="XP_022676737.1"
                     /db_xref="GeneID:34716879"
                     /translation="MPAFHSTFPADPSTDRFVGNFVLLPLNTKYRGPAYQANSDYDII
                     DECLDLFRANSFFKNFEIKSPADRVLIYGILFINDCLANLNSSTSYNEAVKKLMNLAL
                     DSFAIPGTPGFPLNTVYSVPLENPAEVELLKSYIQQFRQELAMRLLDRVYKDNKEVPS
                     KFWLAFTRRRFMNKSL"
     gene            complement(<584441..>586384)
                     /gene="SSQ1"
                     /locus_tag="KLMA_50274"
                     /db_xref="GeneID:34716880"
     mRNA            complement(<584441..>586384)
                     /gene="SSQ1"
                     /locus_tag="KLMA_50274"
                     /product="heat shock protein SSQ1"
                     /transcript_id="XM_022820257.1"
                     /db_xref="GeneID:34716880"
     CDS             complement(584441..586384)
                     /gene="SSQ1"
                     /locus_tag="KLMA_50274"
                     /codon_start=1
                     /product="heat shock protein SSQ1"
                     /protein_id="XP_022676738.1"
                     /db_xref="GeneID:34716880"
                     /translation="MKRVMLRRGLFYRNSARSGALRYASSKVIGIDLGTTNSAVAYIR
                     DSNDKKSATIIENEEGQRTTPSMVAFDKNGSVLVGAAAKRQSLINHENTFFATKRLIG
                     RSFKDAETQKDLKIVPYKIVENKSNGQAYLQTSKGDTKSPSEIGSLILKYLKNVAEKY
                     LDEPVDKAVITVPAYFNDSQRQATKDAGTMAGLKVLRVVNEPTAAALSFGLDALNDGI
                     IAVYDLGGGTFDISILDIEDGVFEVKATNGDTHLGGEDFDNVVVNYVVDHFLKQNPSL
                     EREAIINNRELMQRIKEASEDAKIRLSHVKETRIEIPFAVENKHIDVTLKEEDLDNIT
                     MHLIKQTISPVKKALKDADIEVDEVDDVILVGGMTRMPKIRSIVEDIFNKKPNTSVNP
                     DETVALGAAIQGGILSGEIKNVLLLDVTPLTIGIETYGGVFSPLIPRNSTLPIKKTEM
                     FSTGVDGQTGVDIRVYQGERGLVRDNKLIGDLKLAGIPPMPKGVPQIKVTFDIDADGI
                     INVSAAETSSGKEETITVIANSGLTEEEINAIIEEANANKDRDNLIRQRVELITKADI
                     MVSDTENAFERFHDTIVKSPLYEEASKAVKGIRAKIDHFKKNDSDLSLDVNEIKRETD
                     KVQNLCLKLFQDAAKHTQNAKNS"
     gene            complement(<586613..>588349)
                     /locus_tag="KLMA_50275"
                     /db_xref="GeneID:34716881"
     mRNA            complement(<586613..>588349)
                     /locus_tag="KLMA_50275"
                     /product="F-box-like family protein"
                     /transcript_id="XM_022820258.1"
                     /db_xref="GeneID:34716881"
     CDS             complement(586613..588349)
                     /locus_tag="KLMA_50275"
                     /note="cyclin-like"
                     /codon_start=1
                     /product="F-box-like family protein"
                     /protein_id="XP_022676739.1"
                     /db_xref="GeneID:34716881"
                     /translation="MPQLLDLPEELLFRIAVLLPAQDLISFASTSSQLRASLRANREL
                     WLTKCTEEWFTTENAYESCIYDLIKPKDESKITDYMSYFTKRKQIERRASQDIAHMAE
                     IGFSRHYWELFFEHSMEYEIVPYLAAIDSKFPITRLDAKDKICGSLLTTMRHNLVFKA
                     MEKYSESYNHMESFETKLLLPLSAMDTSFFNAISYRTSFYNKCHATMKKRIKNLEKVK
                     SVSPTIIIKHSISVLESVLRQNFRAKESHHHGIEEFLLPRVYCGEANPNELLFICILQ
                     EFSRQLGIKVKVANGALVISDSLSPQGVIYLILQKKSNFQYEYQFLTQTTFKQLLNNM
                     NAVQGAAMAIDFETATKEMTGRDVYTEFFIGISQFEEASIIKNNELCQDLKLLEKAYP
                     VTKCGIEVEEISYFGTFRKLLQFHGTRNFQPHNFEVIQLKFKRSILRWYPMDLSIKFK
                     IIETETAKSTFLSTQLREYLTEPHAIPLIYSDIIGRFIDRNEEGYPGLILNYDRRNDR
                     DAFEVLGKNGKKYTLFANVSTLTFIEYSVDDPLYHEFLTLNKRQRLDYLFTQKVSPEN
                     KVILIPSRNAYL"
     gene            <589497..>591662
                     /gene="ART5"
                     /locus_tag="KLMA_50276"
                     /db_xref="GeneID:34716882"
     mRNA            <589497..>591662
                     /gene="ART5"
                     /locus_tag="KLMA_50276"
                     /product="arrestin-related trafficking adapter 5"
                     /transcript_id="XM_022820259.1"
                     /db_xref="GeneID:34716882"
     CDS             589497..591662
                     /gene="ART5"
                     /locus_tag="KLMA_50276"
                     /codon_start=1
                     /product="arrestin-related trafficking adapter 5"
                     /protein_id="XP_022676740.1"
                     /db_xref="GeneID:34716882"
                     /translation="MFSLGKSGSSGSGNGSTAHHHHSGIGSLSKKSPIIFDIRIASSG
                     GNVKFMSGSALDSEPTVLHGDIVFSLPETLHVKRITLRLIGKFKLEFLQVGQHKNTNL
                     ASIVKEDQTIFEAFWQNLLVDKEGIILKGSSAGSGNSSSQGSVLGVTAKPILSRVRSV
                     PMINTGKKKSHKSDSPGVLKLPSNGVSGTPYNETMAPSGSSFILPPGNYELPFQITLP
                     QDTPETVEGLQSGSVLYTMECSIERQGFNKANFTKYEYLRIFRTLKPDDMAIQEEVYV
                     GKNWPNKLQYEISIPSRAIPIGGATPINVKIYPFQKGYKLRRITASLIQHYEFKDSAG
                     EVYDDENVIQKQMLTKFDDIPGCDSSRDNLLIDEVKINSVIQFPDDLKRATQDCDVAD
                     DLIKVRHKLQVVLNLRRDVIDEASGSKPYEQSTDIKVNLPIKLYVMKHVPIQGRLVLL
                     DHFGKLHFRPGQFCTLFEPSTDSSALGISSNNSSSSSGGGVGNVNNVNSTANGNGNGN
                     GDEDGNMNANSNLRGNRTIRRLEDGSYSVQYFPERDTQAPPSYESHWNDVTIDPVTRS
                     LPTTPLRQLDDVLNGPNPSPSYFDLPTSDARIQAPQPNQHAVALGTLLRSHQPRVPNL
                     DHLHHQSRSSSSTRLSALTAAAAAVAGGSSVPRATGSADGSTTAASNGSTTPASREDF
                     LNHLQRLPSYDESRARYESVSREPTPLYFPIQQDQQEQE"
     gene            <593216..>596041
                     /locus_tag="KLMA_50277"
                     /db_xref="GeneID:34716883"
     mRNA            <593216..>596041
                     /locus_tag="KLMA_50277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820260.1"
                     /db_xref="GeneID:34716883"
     CDS             593216..596041
                     /locus_tag="KLMA_50277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676741.1"
                     /db_xref="GeneID:34716883"
                     /translation="MVASQRKYICSFCASAFSRSEHKARHERSHTGSKPFSCSICSHS
                     FVRRDLLQRHIRTVHKSTLTIMQKSSSKNIEEVMNSLIRVSSSTQAATAAQTTKVLPN
                     KPITAPVPAATVSTTVSTPVSASMSVPVPATEVYSSKESSVTDAGGSVDDNKIHTAHG
                     SIKSLPMTPSDDDDAGEVGEASCEKNVSSSNGISLDSDILKTVFSGRFGNILDNPEIM
                     LNMSLSYLHSKSLFTNSLANEWKEATRDESTFDHWCKNSPLPLALLSVNLLDLNTTDS
                     TGGHDKKQGLIEIWQSCWQKCMKNPYDKSFLPLSILIYVHVHSKENLSHSVLTTSIMY
                     QQILFAMIKSETNPLTQQVEEIWAIFDIFVSLLLKCEEFTEVSTLIFHWFLGQNLYQN
                     FTLAELLDRILGDATDDGSLPTYALLVVNQALFCETIMFKCFATHYKSKDTLHNAVIL
                     ANRLASQRLRKIRQVDHQSHTFDTWKIQVFILHAPPKFVDMINSYCVNPSLPQYWHLL
                     IATWFEFIQDVVPISSDAEHYNWSKFHLNNRWYQCKVKDSNNSTNNDSSTSTSHHILE
                     DLRSSPLIYKNINNNLAICSLPIISSLQHNWSIGDPVVKKLVSDTLLFQLKIFATTLL
                     LNDDASEEAITESMKVFSNPIIHLLLFVWYSSIYHRADGMPKLLYRRGVESDFDNYTM
                     ENHAVSQFIKKYIALSRKCVDTDALIENDFKKLLFREKVENAEEFTYFKGYHFLLSRI
                     ILSIIRHLQEISNPSDPDFNFTMKLISELYATISKIQEKVNVHPSNNDGQSTLIRPVS
                     PISTSSPSSLTNTPREDVRRANSVSIGVIHSMEDYQLRDRFNSQSMGTGVQLPPLNLN
                     PSQNHHNHHNHHNHHNRQQQQPQRFEEFAPNNNIINNKFSFDSAVHNNKRNDHIVLPP
                     PMVQNTFMNRERERFTLPPPSAFFKMK"
     gene            <599356..>601191
                     /gene="VHT1"
                     /locus_tag="KLMA_50278"
                     /db_xref="GeneID:34716884"
     mRNA            <599356..>601191
                     /gene="VHT1"
                     /locus_tag="KLMA_50278"
                     /product="vitamin H transporter"
                     /transcript_id="XM_022820261.1"
                     /db_xref="GeneID:34716884"
     CDS             599356..601191
                     /gene="VHT1"
                     /locus_tag="KLMA_50278"
                     /codon_start=1
                     /product="vitamin H transporter"
                     /protein_id="XP_022676742.1"
                     /db_xref="GeneID:34716884"
                     /translation="MGGFNWRKYIPHERVVYEKYEAEYVSSSSDDVSEVDGQVLGQKQ
                     TVEEYTKPVSVVTSMGELRSDIPYELRDEAGRKWWKFFDEFEYRANKEYKKSRNWYSF
                     LYPNHTTHSKAERTLLYKLDLVIGVYFLMLCWSKSLDTNNLTNAYVSGMKEDLHMKGN
                     DYINTSVIGTVGAIVFQLPFMYILPRYPAHIVLPVMDMGWTWFTFACYRAKSLAELRA
                     YRFILNAFGSAYYPVSQYILGCWYAPDEISSRVCLFFCGQLLGGVTSGLLQARIYKGL
                     DGTFGIAGWRWMFLIDAVAISLPTVIIGFFVIPGIPSKCYSLFLTDEEIRIARRRNIR
                     NQIIDGVEKSKLPSLLSFKLWKKVFTSPNFWVLIVFDMCSWNCMTAFSGSYTLWLKSI
                     PSYSIVQVNNLSVLPACLGFAYVFFCAFGADIFRCKWIFMVFAASMNIISCAILIKWD
                     VSSSAKWFAFLMTYWSVASSPCLWSFINDFLRFDPQMKAIIWIAIYAFSQSTYAWIPT
                     LAWQTVEAPKFKTGYIVSIIFGTIYGLWTFVVLFFYKRQERKHAFGNGIILFNSSKQE
                     PIPSFVEEDLVKRGEYYYLKTEPTNTDMYPEGNKTTTSTEETFSS"
     gene            complement(<601228..>601563)
                     /gene="GRX8"
                     /locus_tag="KLMA_50279"
                     /db_xref="GeneID:34716885"
     mRNA            complement(<601228..>601563)
                     /gene="GRX8"
                     /locus_tag="KLMA_50279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820262.1"
                     /db_xref="GeneID:34716885"
     CDS             complement(601228..601563)
                     /gene="GRX8"
                     /locus_tag="KLMA_50279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676743.1"
                     /db_xref="GeneID:34716885"
                     /translation="MSKYIAIAREVVSSHKFVQLSASWCPDCVYSNSVWKKFGVTDKI
                     FNYDIAAVTKDRAEWNEIRDAFQQVTGSRNLPTLYVDGKVWGTEAELHKFEKNGTLKA
                     ELQKIGLVE"
     gene            <602183..>602491
                     /gene="SPT4"
                     /locus_tag="KLMA_50280"
                     /db_xref="GeneID:34716886"
     mRNA            <602183..>602491
                     /gene="SPT4"
                     /locus_tag="KLMA_50280"
                     /product="transcription elongation factor SPT4"
                     /transcript_id="XM_022820264.1"
                     /db_xref="GeneID:34716886"
     CDS             602183..602491
                     /gene="SPT4"
                     /locus_tag="KLMA_50280"
                     /codon_start=1
                     /product="transcription elongation factor SPT4"
                     /protein_id="XP_022676744.1"
                     /db_xref="GeneID:34716886"
                     /translation="MSTDRACMLCGLVQSTAEFNRNGCPNCQSIFEEAGVSAIECTSP
                     SFEGLIGMCKPNKSWVARWMSIDGYIPGMYAVKIDGRLPLEVTDLLPHYKPRDGSQVD
                     "
     gene            <602877..>603821
                     /gene="COX18"
                     /locus_tag="KLMA_50281"
                     /db_xref="GeneID:34716887"
     mRNA            <602877..>603821
                     /gene="COX18"
                     /locus_tag="KLMA_50281"
                     /product="mitochondrial inner membrane protein COX18"
                     /transcript_id="XM_022820265.1"
                     /db_xref="GeneID:34716887"
     CDS             602877..603821
                     /gene="COX18"
                     /locus_tag="KLMA_50281"
                     /codon_start=1
                     /product="mitochondrial inner membrane protein COX18"
                     /protein_id="XP_022676745.1"
                     /db_xref="GeneID:34716887"
                     /translation="MLLLRRASAVYPVKGSRKFGSLQTVADTFVQLHDASGLPWLVLI
                     PSATFALRTALTFPLSVWQRKRIVKQQELRKVVQSVPPVVKLRLASMTAKANEEELSS
                     SGSKISTKEETVDALQRKKRQLTPEQITMLSLKEMRKRQKSLFKKYNVQMWKNSILPL
                     VQVPLWVSISMGLRTLTNERLVDTNMPHGHILQDLSETNWLTYLGSLDLSLPIDAAPM
                     LLPIILGTVSMINVEYNGKMMQATTIGTSGITTATDTQSAASQTLNSILTATRISTIF
                     LIGVSTQASCLLSLYWISSQVFSLVQNQILDWLWPYQR"
     gene            complement(<603919..>604191)
                     /locus_tag="KLMA_50282"
                     /db_xref="GeneID:34716888"
     mRNA            complement(<603919..>604191)
                     /locus_tag="KLMA_50282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820266.1"
                     /db_xref="GeneID:34716888"
     CDS             complement(603919..604191)
                     /locus_tag="KLMA_50282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676746.1"
                     /db_xref="GeneID:34716888"
                     /translation="MPQKALKVTKKAKDPRRITKKQKNLKKAAPLQIKSKKQSLQHLK
                     KLNKTYSITEATERLIASRVGHLELLKGTRKQLEKHEKKLGTTNKK"
     gene            <605070..>609119
                     /gene="ADE6"
                     /locus_tag="KLMA_50283"
                     /db_xref="GeneID:34716889"
     mRNA            <605070..>609119
                     /gene="ADE6"
                     /locus_tag="KLMA_50283"
                     /product="phosphoribosylformylglycinamidine synthase"
                     /transcript_id="XM_022820267.1"
                     /db_xref="GeneID:34716889"
     CDS             605070..609119
                     /gene="ADE6"
                     /locus_tag="KLMA_50283"
                     /codon_start=1
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="XP_022676747.1"
                     /db_xref="GeneID:34716889"
                     /translation="MSVSILAGPQALSQFRIDSLVKGLESYCNSTGFIKEVRSCYVHY
                     VDLKAELSKEDQELVSVLLTYDTALDLSDDFNKKLVESVTSNAAASLGDDTYLIRITP
                     RRGTISPWSSKATNIAHVCNLEDKVARIERGLALLIKCNAGFPLMERLNDVSLKNVYD
                     RMTQELFLDQPPVVTELFNHDAPKPLVHVPLVSQTSKSPSETLAKANVELGLALDQGE
                     IDYLIRAFVETMKRDPTDVELFMFAQVNSEHCRHKIFNADWTIDGLQKQLTLFKMIRN
                     THQITPDFTVSAYSDNAAVLDTENDSYYYAPEFKTKKWTATKERVPMLIKVETHNHPT
                     AVSPFPGAATGSGGEIRDEGATGRGSKSKCGLSGFSVSDLLIPGKEMPWELNVGKPNH
                     IASALDIMIEAPLGSAAFNNEFGRPCINGYFRTLTTKVVNADGKEEIRGFHKPIMIAG
                     GFGAVRPQFALKNKPITPGSSLIVLGGQSMLIGLGGGAASSIASGEGSADLDFASVQR
                     GNPEMERRCQQVIDACVSLNENNPIQSIHDVGAGGLSNALPELVHDNDLGAKFDIRKV
                     LSLEPGMSPMEIWCNESQERYVLGVSQQDLATFESICKRERAPFAVVGHATAEQKLIV
                     EDSLLKSTPIDLDMSILFGKPPKMAREAITEPLQLPQPNLSQIPSMEDAIDRVLHLPA
                     VGSKSFLITIGDRTVTGLIDRDQFVGPWQVPVADVGVTATALGDEIRSTGEAMAMGER
                     PSAALVSAAASAKLSVAESLLNVFAADVKSLKHIKLSANWMSPASHKGEGAKLYEAVQ
                     AIGMDLCPDLGVSIPVGKDSMSMKMKWDDKEVTAPLSLNITAFAPVKNTSKTWTPLLS
                     KESGETILVLVDLAALQEQRSLGASALLQVYNQIGNTVPTVHDNKVLKGFLESILELH
                     ETDLVLSYHDRSDGGLLVTLLEMAFAARCGLDVIVDSSKDGNAFVPLFNEELGAVFQI
                     KESSLTQFQSILAKHGVSHQYVSVVGKPNFVSNMVTITEKSGAVLYENTRAELQKSWS
                     STSYEMQKLRDNPKTTIQEFSAIADDKDPGLHYALTFNPADDLQIGTQLANVRPKVAI
                     LREQGVNGQMEMAWCFQQAGFDAIDVTMTDLIEGTFNLSEFTGIAACGGFSYGDVLGA
                     GAGWAKSVLYHEGVRKQFVNFFQEREDTFAFGACNGCQFLSRLKSIIPGCEDWPSFER
                     NMSEQYEARVCMVEIVQDQTRQTESVFFNGMVGSKLPIAVAHGEGKATFESQEQLDKF
                     ESQGLTGVRYIDNYGNVTEKFPFNPNGSPNGISGITSPNGRVLAMMPHPERVSRLEAN
                     SWYPQGKFEEWEGYGPWIRLFRSARKWVG"
     gene            complement(<609553..>610506)
                     /gene="ERG25"
                     /locus_tag="KLMA_50284"
                     /db_xref="GeneID:34716890"
     mRNA            complement(<609553..>610506)
                     /gene="ERG25"
                     /locus_tag="KLMA_50284"
                     /product="c-4 methylsterol oxidase"
                     /transcript_id="XM_022820268.1"
                     /db_xref="GeneID:34716890"
     CDS             complement(609553..610506)
                     /gene="ERG25"
                     /locus_tag="KLMA_50284"
                     /codon_start=1
                     /product="c-4 methylsterol oxidase"
                     /protein_id="XP_022676748.1"
                     /db_xref="GeneID:34716890"
                     /translation="MATEHVMSSVFSNGTIAALIGEGQGLSYSQVLSNIKTVQPQLNF
                     MEQYWAAWYCYMNNDVLATGLMFFLLHEFMYFFRCLPWAIIDQLPYFRKYKIQPTKIP
                     SAKEQLFCLKSVLLSHFLVEAIPIWTFHPMCQKLGISVAVPFPSLTTMAKQIALFFFL
                     EDAWHYWFHRLFHYGVFYKYIHKQHHRYAAPFGLAAEYAHPVETLSLGFGTVGMPIFY
                     VMYTGNLHLFTLCVWITMRLFQAVDSHSGYDFPWSLNKFLPFWAGAEHHDLHHHYFIG
                     NYASSFRWWDYCLDTEAGPEAKAEREERMKRKVEQKSKKVN"
     gene            <612070..>612777
                     /gene="NMD4"
                     /locus_tag="KLMA_50285"
                     /db_xref="GeneID:34716891"
     mRNA            <612070..>612777
                     /gene="NMD4"
                     /locus_tag="KLMA_50285"
                     /product="nonsense-mediated decay protein 4"
                     /transcript_id="XM_022820269.1"
                     /db_xref="GeneID:34716891"
     CDS             612070..612777
                     /gene="NMD4"
                     /locus_tag="KLMA_50285"
                     /codon_start=1
                     /product="nonsense-mediated decay protein 4"
                     /protein_id="XP_022676749.1"
                     /db_xref="GeneID:34716891"
                     /translation="MILNFILDSSSFEKGLGNITIWSQLENADLTINAYIPLYTIQEL
                     DFQRFKRKSVVAKRSLYFIDQLKETRSFKLHIEYPELNEAISWNETLKLCEQNAASTM
                     SAQQISALPVRFKKLLKSCYYKCHYMREKEEHGDSQDPEEKGWVLVTEDDTVRDLAQQ
                     FKIPFISVVEADAIINACIKDKSYVVNKKFSKHVIKKANQVKEQEDGSKVFVTNFNDD
                     FLAPRAKSGTLWTPKSR"
     gene            complement(<613884..>615536)
                     /gene="SPR3"
                     /locus_tag="KLMA_50286"
                     /db_xref="GeneID:34716892"
     mRNA            complement(<613884..>615536)
                     /gene="SPR3"
                     /locus_tag="KLMA_50286"
                     /product="cell division control protein 3"
                     /transcript_id="XM_022820270.1"
                     /db_xref="GeneID:34716892"
     CDS             complement(613884..615536)
                     /gene="SPR3"
                     /locus_tag="KLMA_50286"
                     /codon_start=1
                     /product="cell division control protein 3"
                     /protein_id="XP_022676750.1"
                     /db_xref="GeneID:34716892"
                     /translation="MTSMNNGWGSYMDRSVESSDIGSSSGSNAQEKYLAPNESMEIIQ
                     EHPEEDNLEIASISHGEDGVLGSVKKLFAADSIESSKSLTKNSDNEQNAQADYYTPNS
                     AINSEVFDSNGGEKNRRFVNAPVIDPNYYIGIDTIPIQKQTFIAKNGGRFTMMVVGQS
                     GLGKTTFINTLFGTSLLPTVWEGDLSDREVTKTTKIVRHESELVEGDFALKFTVIDTP
                     GFGDHANNSFSWSPIVNYIDEQYRSYIFQEEQPLRGSLKDNRIHCCLYFIKLTRHGLS
                     ALDIAAMEEISKRVNLIPIIAKVDGLTPDDVSIYKKNIRETIQKQQIKVCAFLDQNDP
                     NCQTIFDMYPFGIVCSDEMVPNEEGKLVRGRKYKWGNVEVENPEHSEFTALRTVLMSK
                     NLVDLVVGCENYYERCRTHMLLSRINQAKVNNPDFIESSGLNLEDPNQNGLDNYKFYE
                     TFNKKYMDELIIEWSPEFIHKQLEAKKRLNEIVSLEEKRFKDWKQDLLNKQNLFNHEI
                     EDLHTLVQQIRSECNEMEAKANKQRARRFSRLGLSSHSELAK"
     gene            complement(<616032..>617363)
                     /gene="PEF1"
                     /locus_tag="KLMA_50287"
                     /db_xref="GeneID:34716893"
     mRNA            complement(<616032..>617363)
                     /gene="PEF1"
                     /locus_tag="KLMA_50287"
                     /product="peflin or Penta-EF hand domain-containing
                     protein 1"
                     /transcript_id="XM_022820271.1"
                     /db_xref="GeneID:34716893"
     CDS             complement(616032..617363)
                     /gene="PEF1"
                     /locus_tag="KLMA_50287"
                     /codon_start=1
                     /product="peflin or Penta-EF hand domain-containing
                     protein 1"
                     /protein_id="XP_022676751.1"
                     /db_xref="GeneID:34716893"
                     /translation="MGSKKLNYSAGDELPLFATPEEAMREGQRREEAERRRRQMKYGM
                     NSHQQPQMHQQSHMSVNPAVHKAPTPHSQSSSHYRQPIPAAQGNVPLPYEHGAGVGIG
                     SGAGNGSSRSQSRVSSYDMHGHGSSRSTPQLPAQMPSQLPNQMPGQMPGQFPGQIPGQ
                     MPGHGQVPHASSVPSMRSYSQPHQPQPQLQHQQPPQQPIQQPQQQPLQPQQKYYPNQA
                     TTINHLPPEPRVSHQPVASQTQYRQQLPTSVSSTNSAASNDSLQEQQDTQIATQLFNN
                     HDIRNIGRLTADELQNLLQNDDGTKFCSSSIDSLLSLFGGSRFGTVNLNEFISLYKRV
                     KKWRKCFVDNDLNGSFTLTMAEYHKAVQSLGYLIPFEVSEKLFECYAEFFEQPMVSKE
                     MKFDKFVETLVWLMRLTKVFRKYDTKQEGTATIEYKDFIDITLYLGKFLPH"
     gene            complement(<618216..>618536)
                     /gene="RPS10A"
                     /locus_tag="KLMA_50288"
                     /db_xref="GeneID:34716894"
     mRNA            complement(<618216..>618536)
                     /gene="RPS10A"
                     /locus_tag="KLMA_50288"
                     /product="40S ribosomal protein S10-A"
                     /transcript_id="XM_022820272.1"
                     /db_xref="GeneID:34716894"
     CDS             complement(618216..618536)
                     /gene="RPS10A"
                     /locus_tag="KLMA_50288"
                     /codon_start=1
                     /product="40S ribosomal protein S10-A"
                     /protein_id="XP_022676752.1"
                     /db_xref="GeneID:34716894"
                     /translation="MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEVDTKNLYVIK
                     ALQSLTSKGYVKTQFSWQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQSNDSRPQ
                     GKKY"
     gene            <619254..>620237
                     /locus_tag="KLMA_50289"
                     /db_xref="GeneID:34716895"
     mRNA            <619254..>620237
                     /locus_tag="KLMA_50289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820273.1"
                     /db_xref="GeneID:34716895"
     CDS             619254..620237
                     /locus_tag="KLMA_50289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676753.1"
                     /db_xref="GeneID:34716895"
                     /translation="MPLSLPDESGFHSFESGLRDRVVGKIDEGKMWLWDMVDKIRHFK
                     IFKITVIHWGVLVTWIGLLLHFTSVYRSLYRSSALLATMCSNVLLFGTSDCLAQCISC
                     FMCYKVDPVPKALDDMTKNIMSGLGSHRRVSRMEEDDDYNDNDDMGSDDASIFNDYGI
                     QRDARHPDDEYRVDSQDMEWMSDFDSDVPDHELFSFYRWVCFMCWGWILSFCQVPWYK
                     FLNYLYTEDHTFVQVLERVLTDQLVYSPISLYCFFMYSNYIMEHGDAASFETKIRNIY
                     VSTLGCNYLVWPMVQFINFLLVPKHLQVPFSSSVGVLWNCFLSMRNSSNAA"
     gene            complement(<620318..>624634)
                     /gene="YPK9"
                     /locus_tag="KLMA_50290"
                     /db_xref="GeneID:34716896"
     mRNA            complement(<620318..>624634)
                     /gene="YPK9"
                     /locus_tag="KLMA_50290"
                     /product="probable cation-transporting ATPase 2"
                     /transcript_id="XM_022820275.1"
                     /db_xref="GeneID:34716896"
     CDS             complement(620318..624634)
                     /gene="YPK9"
                     /locus_tag="KLMA_50290"
                     /codon_start=1
                     /product="probable cation-transporting ATPase 2"
                     /protein_id="XP_022676754.1"
                     /db_xref="GeneID:34716896"
                     /translation="MSVDNKLDGMPRRSNQSARPSFSSTRTGSSTNTTASVILEQNNS
                     EPYSGAAVETVPSSIVSFYHPHSFQSSGYGVSASSSNFERRGQTSENENDALLLSAST
                     SRRSSASRGGRGFHFFTEAQVENAEGISSSLENADYDMDWDAIPTYEQERLHIQPKSS
                     KASLRHNSNDFAMKTLVSQRQNSLRSHPLENRTYSTSPRSSSSSSRYTLRDRIPAELE
                     PDETNDQDDTELRSNESSEEADDDDLSNEDYYSRAEENQEQAKKSYHAKFLKPEYHDR
                     FFPHNVPHLHYQRFYIAEEDLVVAIAGYRTSQFKLYCYYFLCIISLGFAYLLFRWKPS
                     MKVKLTGVKTPLGKAEWVVIENEFGELTIEPVKRRWYNRPLSTVLMEINEDRINPPEG
                     HHYHHETSSNPNLPILITFNYRYFTLVYSPVADIFKSNSNWADPDWLDLEQVQKGLSS
                     SIQEDRTLAFGKNAVNLKQKTVFEILFDEALHPFYVFQIFSIVLWLADDYYYYAGCIF
                     IISVLSIIDTVLETRKNSARLAEMSHFSCEVRVYKDGFWTQVNSSELVPGDLFEISDP
                     SLTALPCDAVLISGDCIVNESMLTGESVPVSKFAATESTMVHLLEDFKSSQVSSIVSR
                     SFLFNGTKIIRVRSQPGMGMALALVTRTGFSTTKGSLIRSMVFPKPVGFKFYEDSFKY
                     IGFMTLIAMLGFSISCIQFIRLGLEVRIMVLRALDIITIVVPPALPATLTIGTSFALT
                     RLKKKGIFCISPTRVNVGGKVDLMCFDKTGTLTEEGLDVLGVHFAEPKGSSSVLHLSK
                     LITSCDDLIKKDKLSDCKNQKEFKEKNLFMSLLTCHSLRNIDGELLGDPLDFKMFEFT
                     KWEYEEGYESWKFKNGEDKAGISPAVVHPTANSPFIENDPNNLIGIVRSFEFLSELRR
                     MSVIVKGFKENNYWSYTKGAPEIIADICNPSTIPKNFHELLQYYTHNGFRVIACAGKS
                     LAKNSWLYSQKVSREEVEDNLEFLGFIVFENKLKTRTKQVLHDLRDANIRTVMCTGDN
                     VLTAVSVGRESGLITSDRVFIPSINENLGENDQLISWRDVDDPNSFLDSVSLEPLTDS
                     EKSYSLAITGDIFRILFRNDEILPENYINTILLKGSIYARMSPDEKHELVEQLQKLDY
                     NVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSSIFDISCVLDVIKEGRASLVT
                     SFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPSEKL
                     VKKRPSANLVSPKILVPLCLNILIILIFQLIPWIAVQYTSWYLKPIPAGDDAVQSSDN
                     TVLFFVSNFQYILTAVILSQGPPYREPLTKNYGFVIDISVSLIMSFALMNLNVNSPLG
                     KLLQLTNISGSFKWFIIATVIANFYSEKYIPEKAKNLFKKKYSSKRYKNILRMQQQAV
                     NV"
     gene            <625819..>631023
                     /gene="RRP5"
                     /locus_tag="KLMA_50291"
                     /db_xref="GeneID:34716897"
     mRNA            <625819..>631023
                     /gene="RRP5"
                     /locus_tag="KLMA_50291"
                     /product="rRNA biogenesis protein RRP5"
                     /transcript_id="XM_022820276.1"
                     /db_xref="GeneID:34716897"
     CDS             625819..631023
                     /gene="RRP5"
                     /locus_tag="KLMA_50291"
                     /codon_start=1
                     /product="rRNA biogenesis protein RRP5"
                     /protein_id="XP_022676755.1"
                     /db_xref="GeneID:34716897"
                     /translation="MVAQQSKRKRDEESPLTRQDATEAPSKSALSKSDEISFPRGGSS
                     ALSPLEVKQVANEVVADVLFGKDDAATGSEQPKKKRKNSKKGTALEGTELDNEDKEDK
                     TDLVEHFGMKQMNKDTILLGQIQSISKHELKVSLLDGLHGYVSLTDISEQMNKTLEKL
                     DEDMESENEDSDSEYDSSDDEDESNALASKELPDLSNYFKVGQWLRCIVHENTSSTEV
                     KKGKKKLELSIEPSLVNKFDEDDLTKHCVVQCAVKSIEDHGLMLDIGLDNLTGFISKK
                     DLPDFKSILPGAVFLANVNKRSGRTVNVNLDLGGKSTKTDKISSIDAILPGQTIDFVP
                     QTITNHGIIGKAFGLIVAFLPLPHSNCFTVEELKQKYAIGNVINARILATTVMKSGNK
                     VAVVSTQPHINALTPKLQEIEALESFPVGYIFDSCTYKGRDSQFFYVSINDEQVGQIH
                     ISKAGETEPTGSVRARVLGYNNVDKLYSLTSDPAQLEVKYLRATDIPIGELLSNCEVV
                     TVSEKGIELKIFNGQFKAFVPPLHISDTRLVYPERKFKIGSKVKGRILNIDSVGRITV
                     TLKKSIVNADEDVLKLVYSEDDVVKVENEELRTIATVELFKPNGCLVSFFNNIKAFIP
                     NKEISEAFVKKPQEHLRLGQTVIVKILNHDFQRNRIIATCKISAESSSKQKEAIESLI
                     VGRSIIDAIVIEKSKDSAVVEAKESGLRGVVYTGHLSDDRIEQNRASLKKLKIGSEIR
                     GLVLDKDTRTRVFNMSCKKSLISDAENGTLPLTYSDIKSKEKTTPMHGYVKSISDRGV
                     FVAFNGKFVGLVLPSYAAETRDIDINKKYYVNQTVTVYLLRTDDEHERFLLTILKPKE
                     EKTQGTSSNLMNPVDKSVKNMSDFTIGKVTKATIISVKRNQLNVALADNVHGRISISE
                     VFDKFEDIKNQKAPLSVFKKDDIIKVKIIGFHDIKSRKFLPISHTNSKSHLVELSAKP
                     SALNSPLSEKTLKDFTAEQTVLGFINNYSKETAWLTITPTVKAKLPIFEISDQGNDFS
                     LPIDEKYPIGTALKVTVKSIDTEHDSLIVTARSHNISSINEIKEGDVLPARVISVQDT
                     YVLLSLGKDVTGVSFITDALDDYSQSLKDVYDSKKKSIVSATVLNVDIANKKINLSLR
                     SASPKDRSIKSSEELKRGDVVRGFVKSITDKGLFISLSSTLQAFVPVSKLTDAFIKEW
                     KKFYNRGQSVVGKVVNCDDDKHILLTMKESEVNGELNVLKTYSEINVGDIFQGSVKNV
                     TEFGVFIKLDGTVNVTGLAHKTEVADAKIENLENLFGEGDKVKAIVLKTNPEKKQISL
                     GLKASYFTKNDSSAVSEQEEVEEENDSEMEVDNEDEEAVAPSEKQSDITVSKKTDDDD
                     EIMDDVQFDYSDVEDKEDRANSNKNVMSTDGLSLSTAFDWTGSILDQAQDEEESSDEE
                     DFIQSKKQKKKRANQVQDKTIDINTRIPESVGDFERLIMGNPNSSVVWMNYMAFHLQL
                     SEVEKAREIVERALKTINFREEAEKLNIWIASLNLENTFGTEETLEDVFNRACQYMDS
                     FVMHMKLLSIYQMSQKNEKAKELFKVTAKKFGSEKVSVWVAWGGFLIDIQEIDEAHEV
                     LGKALKALPKRNHIEVVKKFAQLEFSKGDPEQGRSLFEGLIADAPKRVDLWNVYIDQE
                     IKANEKSKVEDLFERVVTKKITRKQAKFFFNKWLQFEEQKDDQKQVDYVKAKAAEYVA
                     KHKSSQEE"
     gene            <631212..>632327
                     /locus_tag="KLMA_50292"
                     /db_xref="GeneID:34716898"
     mRNA            <631212..>632327
                     /locus_tag="KLMA_50292"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022820277.1"
                     /db_xref="GeneID:34716898"
     CDS             631212..632327
                     /locus_tag="KLMA_50292"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022676756.1"
                     /db_xref="GeneID:34716898"
                     /translation="MTQNNKHQKSMMREPLERTWSDQKLLIITILLTTWSWFSRSNEK
                     YERIINDSLRSYERCLEDENTVEQCINYFKVEVLHGARKVFKQQYSKEIQSCFDNQEK
                     RLLKLGRSDVRKALNSFNTCFVNKKQDVVSNGNIKLKYIIIAFIFGILGFSILRAIVI
                     FSSWKSSNGRLERKCDKFTAKTNDSIKQIGEKLNIMTEQLNRTNQKIFELEYDNELWK
                     KVQELEEIQTRLQLLLDQIKKDSSWELAKINTSIKPLLENKNLDKSPLVIQEKNTGLL
                     FDMKTQKGITNWKKYVGKIEDHEGPPTKIPELTPLSFSPISPDLSKVNLFDKNGKPFR
                     RVFLPGTGWITRNKCIQIMKEASISLRADENTNSITY"
     gene            complement(<632441..>633448)
                     /gene="MTF1"
                     /locus_tag="KLMA_50293"
                     /db_xref="GeneID:34716899"
     mRNA            complement(<632441..>633448)
                     /gene="MTF1"
                     /locus_tag="KLMA_50293"
                     /product="mitochondrial replication protein MTF1"
                     /transcript_id="XM_022820278.1"
                     /db_xref="GeneID:34716899"
     CDS             complement(632441..633448)
                     /gene="MTF1"
                     /locus_tag="KLMA_50293"
                     /codon_start=1
                     /product="mitochondrial replication protein MTF1"
                     /protein_id="XP_022676757.1"
                     /db_xref="GeneID:34716899"
                     /translation="MSKTTLLQRLLPLANSIKTTYGSQFLKNPKIITQIFDKLKLESQ
                     YKSKELQVVDIYSGPAVQSAMLTERLHPKKCVLFDDRRKFAELYQQVLDGNGPIVHYN
                     KNPYKWESFLELTEQDKILTPSFQARDHIHDEFLVTANLTNKKGEQLYVQYLQCVANQ
                     NWLQRFGLVKMLVWIPSQTAKKLFAPFSNKDRNRITLLSEMASNTKLIATSEASLKYF
                     LPESLSKFDPVIIPSKEPHTEDLSLVEINPRNHNLDLDNWDYVTQKLMILKSQPIGDS
                     IEVLGHGAKDWFSPRLRPELLKKKPYEMTYMEINEIAECFALWPFKPHILIDFYDDDS
                     A"
     gene            <633936..>636083
                     /gene="TAF7"
                     /locus_tag="KLMA_50294"
                     /db_xref="GeneID:34716900"
     mRNA            <633936..>636083
                     /gene="TAF7"
                     /locus_tag="KLMA_50294"
                     /product="transcription initiation factor TFIID subunit 7"
                     /transcript_id="XM_022820279.1"
                     /db_xref="GeneID:34716900"
     CDS             633936..636083
                     /gene="TAF7"
                     /locus_tag="KLMA_50294"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 7"
                     /protein_id="XP_022676758.1"
                     /db_xref="GeneID:34716900"
                     /translation="MGPTIRISKPKEPESKEGNEPKLKKIKLKTAGNNTQAKPAPKIK
                     LKLKKRETKIEKEASPNAAKPIKLKINLKKRDDVQQTASHSQSQSHQQTQQRKGGAVV
                     KTPKFRIKPVRVPGEGYDSEASDVEDDPLIEEGIILRVLPDLSAEFVKNSIESGDYSG
                     VSIKWKGERHAVVKVNNVQYGAVLVDLPSIIEVNKSVDRRNLLKTFDVSQMLICVDTI
                     NKEEDVFALQVSDTEDLTKKHFEEYSKEILEQRKQQLRGYNGGPLTDAESKNIDQIIN
                     KGYDYKHGITPPLYNARNRRFRHKMGPTEFDYVERTVERLLKQDAEAEEFGYELVSED
                     SLPQQRSTSAVSISQYEQMDEDDHIMDSMDTTINIKPQTSQQQQHAHSSHVKQHHGVA
                     GEDDDHEEDLELELEQALQVEASDNGIADESGSSSGGGSAAAATAAAATSASAGSAPE
                     QGQLLEETGDDVEQDNGEDDEDEDEDEDEDEDEGEEEEIDDGVSGSGNMSSSNGTSGV
                     MSRGSVNKPVDEAAQHAELLRDELRELESTLELNRGKASKTTNPLLKTRFLESIKKLE
                     KEVELKRKQLGEATGEEISSTGEENSNTDAGQGRGQDRDGKAHNNLGQDGTSAAGISD
                     HKGSSGANSNAVSGAGGAGARTSTGTANAGAGFEPDDDDDDDDMGFDDDDDDDDEDQD
                     QDQDQDQEEPRQPTEELDQDDMDMMLLFGADND"
     gene            <637881..>642821
                     /gene="SNF2"
                     /locus_tag="KLMA_50295"
                     /db_xref="GeneID:34716901"
     mRNA            <637881..>642821
                     /gene="SNF2"
                     /locus_tag="KLMA_50295"
                     /product="transcription regulatory protein SNF2"
                     /transcript_id="XM_022820280.1"
                     /db_xref="GeneID:34716901"
     CDS             637881..642821
                     /gene="SNF2"
                     /locus_tag="KLMA_50295"
                     /codon_start=1
                     /product="transcription regulatory protein SNF2"
                     /protein_id="XP_022676759.1"
                     /db_xref="GeneID:34716901"
                     /translation="MESEFSPPRREYTREEINRCYLRWQQLRNEHGANVESMKEYQYY
                     TAVLRMAAKQQQQRQAQAQAQAQQGSQGPQASYGSPNGGGNGAPNGAPNGVPNGMPTP
                     GSNNNASNGMGMGMGMGMNMNMGMNMGATRNGAAGMAPSPAAAAAAPVPPTQPTQPAQ
                     PVQAAAAAAAANTPSSTHSNPANTAATASSASRSLFTDEQSLLLKAQIQSLKIMANHM
                     AVPPEIMMVIDRSLTNLPDFKSILLALSADLQAHNNGGATTGATTGTGTSTRQQQQQQ
                     QQQQPQASPPVRNQQAAAAAAQQAQSPPTIQRVAKQPVQSPAAAAGAVAGAVAGTERQ
                     VPMGKQSPMANQIPSASQAPATPVIETPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAP
                     IPVKDQEPPKQEPPVLLSTYKQQHKDIEKFEDVSSPFIMADCFSYPDQGIPSSTPPIN
                     YTDLLNQQFLSIIPSLLPTGLDPRSAMEIYQTLIALDLDTSLDYCLQQLLQNPDTNSN
                     SDSKTRENLILDYNAMQLLPLQKAIRGYVLSFEWYQSTLLTNIHPNFLSKNRSLNIQD
                     ALLTRELFRARELQRYKKQQMEKTYKLNAVLERCKSLHDARIDSKAQRVKLGHRLINL
                     HANLEKEEQKRIERNAKQRLQALKANDEEAYIKLLDQTKDTRITHLLKQTNAFLDSLT
                     KAVKDQQSFTKDKIESHIDTKELSEDIIGDRNQNSDSDSDSDSEDMEREKIDYYEVAH
                     KIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLT
                     YLYEKKGIHGPFLVIVPLSTLTNWNAEFDKWAPTLRKIAFKGPPTERKPKQAAIKNRE
                     FDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILT
                     GTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLIIR
                     RLHKVLRPFLLRRLKKDVEKELPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDST
                     HQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQLNPTRETNDNIWRSAGKFELLERIL
                     PKFRATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTTLLNTFNAPDS
                     EYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLI
                     TDNSVEEAILDKAHAKLDIDGKVIQAGKFDNKSTAEEQEALLRQLLEAEEEEKKRREL
                     GLEEDEQLDDNELNEILARNEDELKAFQEIDAKRIRTQMENGITSRLMENSELPECYN
                     VDIEAKLAEEEQQKVFVGGRGNRERKTTHYSEDLSEEQWLKQFEISDNEDDEGGPKRR
                     RTRTADSANNAKRVKLESPSSSSSSTTTTMATGANNNEAEGQAEGQVDSSAATGATPD
                     GVAAAANENTPKLETGDSNGTDVKQHGNTTGGKTSAKTAKKTSKGRKKTSSNTRRNGR
                     NYLRSIDKNAKPLKERQDISKKARELYDYAVYYRNSDDRRLSDIFLVKPSKRLYPDYY
                     LLIKYPAAFENVMKHIEMNAYDSLKQVVEDFHLIFANARIYNTEDSIIFKDSLELEDA
                     VIKKYKEMTNDTEEMDFTEFDEEYATPPLVPPSTIA"
     gene            643071..643143
                     /locus_tag="KLMA_R516"
                     /db_xref="GeneID:34718739"
     tRNA            643071..643143
                     /locus_tag="KLMA_R516"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:34718739"
     gene            complement(<643447..>644253)
                     /gene="sdh"
                     /locus_tag="KLMA_50296"
                     /db_xref="GeneID:34716902"
     mRNA            complement(<643447..>644253)
                     /gene="sdh"
                     /locus_tag="KLMA_50296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820281.1"
                     /db_xref="GeneID:34716902"
     CDS             complement(643447..644253)
                     /gene="sdh"
                     /locus_tag="KLMA_50296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676760.1"
                     /db_xref="GeneID:34716902"
                     /translation="MSQGRRAAERLQNKTIFITGASAGIGEATALEYLDAANGNVKLV
                     LAARRLSKLQALKDKIAAEYPEAKVYIGELDVTETEKIKPFIQGLPEEFKDIDILINN
                     AGKALGVDPVGAIDSEDIKGMIDTNVLGLINVTQAVLPIFKAKNSGDIVNLGSVAGRE
                     AYPNGSIYCATKHAVRAFTQSLRKELINTKIRVIEIAPGNVETEFSYVRYKGDTDAAK
                     KVYKGTTPLYADDIADLIVYATSRKQNTVIADVLVFATNQASPYHIYRGE"
     gene            complement(644951..645025)
                     /locus_tag="KLMA_R517"
                     /db_xref="GeneID:34718740"
     tRNA            complement(644951..645025)
                     /locus_tag="KLMA_R517"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718740"
     gene            <645313..>647040
                     /gene="ILV1"
                     /locus_tag="KLMA_50297"
                     /db_xref="GeneID:34716903"
     mRNA            <645313..>647040
                     /gene="ILV1"
                     /locus_tag="KLMA_50297"
                     /product="threonine dehydratase"
                     /transcript_id="XM_022820282.1"
                     /db_xref="GeneID:34716903"
     CDS             645313..647040
                     /gene="ILV1"
                     /locus_tag="KLMA_50297"
                     /codon_start=1
                     /product="threonine dehydratase"
                     /protein_id="XP_022676761.1"
                     /db_xref="GeneID:34716903"
                     /translation="MLLSTLKLRGASMPLGAYRLAIRFNSSNAATTSGASPFSDNLQK
                     MYSNLKDDERLADGSPDYVRLILRSSVYDVIEETAISHAVSLSSRLNTTVQLKREDLL
                     PVFSFKLRGAYNMIATLDDAQKNAGVIACSAGNHAQGVAFSSKHMNIPATIVMPVSTP
                     SIKYQNVSRLGAQVVLYGNDFDEAKLECSRLAEERGMTDIPPFDHPYVIAGQGTIAME
                     ILRQVHKGSNIGAVFCAVGGGGLISGIGSYLKRIAPQIKIIGVETYDAPTLHTSLTNG
                     KRTSLKSVGTFADGTSVRLIGEETFRVCQDVVDEVILVNTDEICAAVKDVFEDTRSIV
                     EPSGALSVAGLKKYVTQLHPEIDHSKKTYVPILSGANMNFDRLRFVSERAVLGEGKEV
                     FMLVTIPDIPGSFKKLQNVIHPRAVTEFSYRYNVHRHDSENDVPMACIYTSFNVVDRE
                     KEIKQVVQQLSALGFEAVDISDNEMAKSHGRYLVGGASEIPNERVIAFEFPERPGALT
                     KFLSGLSASWNLTLFHYRNHGADIGKILAGISVPPSDNEIFQKFLDDLGYKYHEETDN
                     MVYRKFLKY"
     gene            <647849..>649237
                     /locus_tag="KLMA_50298"
                     /db_xref="GeneID:34716904"
     mRNA            <647849..>649237
                     /locus_tag="KLMA_50298"
                     /product="DUF1875 domain containing protein"
                     /transcript_id="XM_022820283.1"
                     /db_xref="GeneID:34716904"
     CDS             647849..649237
                     /locus_tag="KLMA_50298"
                     /codon_start=1
                     /product="DUF1875 domain containing protein"
                     /protein_id="XP_022676762.1"
                     /db_xref="GeneID:34716904"
                     /translation="MAMIGGGLDDPLMRHLDDNVAYPKRLRTSLSKIMDKQLEYSNIG
                     NVVPMGSRTRSRSRSGSISGESGCSQAPITAMLRSSSPVRMGSVSMTEHPPVQLPKMF
                     KKEYLLKNNNSSQVIKNVPLGCKKDSVVKPIMLNPKQGHSRTTSTCSQMTNVTTKYVE
                     LDAPALGNRFPSSDSFASSSPTVTAELKLRLLADEETQLSGHSNKRQSILSNFMNDEQ
                     IWLNEKQDFQYPDDTYFDKERIDLTIKNLELRIDELKLDNDKLHLDNKNLKLENATLT
                     KENESLAFQNKTLFNHMQSLPRISNTDFIIRKQGRADHDLPIPEKLLLQSDELVKIAV
                     EGKIKELEKDLARYKCIRKAVESRLSPRKSRFKYLTGEQLDALVEDDSDEHDTSLNNN
                     ATATKASGDKKTQVISTVKLKLNVELPPEQRSELESESESASSPTRLQNGFNLRLKLA
                     SPAKNDENYNQL"
     gene            <649897..>651126
                     /gene="PEX13"
                     /locus_tag="KLMA_50299"
                     /db_xref="GeneID:34716905"
     mRNA            <649897..>651126
                     /gene="PEX13"
                     /locus_tag="KLMA_50299"
                     /product="peroxisomal membrane protein PAS20"
                     /transcript_id="XM_022820284.1"
                     /db_xref="GeneID:34716905"
     CDS             649897..651126
                     /gene="PEX13"
                     /locus_tag="KLMA_50299"
                     /codon_start=1
                     /product="peroxisomal membrane protein PAS20"
                     /protein_id="XP_022676763.1"
                     /db_xref="GeneID:34716905"
                     /translation="MSQSTGVARPKPWEQKAAQDAVVSDGGLTDKGNALTAASNEPVL
                     PSRPSGLDSEGLDSTNGSSMLRNGMSGMSGMSGMSGYGSSLYGGGYGMGSMFGGGLGS
                     MYGGGYGMGSMYGGGLGSMYGGGYGSAYGMNGMNGNGGPSGIAESTQATFQLIEGLIG
                     AVAGFAQMLEATYMATHNSFFTMITVAEQFQYMKELLGSFFGIFAIIKFIKKILYKVT
                     GGKMGVVPSKKQINGAHGQGQSSDLSKKLVEEFNAKRGQDGVNKKGKRISWKPLIMFL
                     AAVFGFPYLLNKFIQKLQQQQRKKLTGTMNQRTLDPNNLEFARAIYDFVPENPRIECA
                     LKKGELMAIISKQDPMGNNSEWWKVRTKQGNIGYVPYNYLELIKKRKPADPTTPKEQT
                     PTKSRAETPGATSQIQA"
     gene            complement(<651343..>651822)
                     /locus_tag="KLMA_50300"
                     /db_xref="GeneID:34716906"
     mRNA            complement(<651343..>651822)
                     /locus_tag="KLMA_50300"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820286.1"
                     /db_xref="GeneID:34716906"
     CDS             complement(651343..651822)
                     /locus_tag="KLMA_50300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676764.1"
                     /db_xref="GeneID:34716906"
                     /translation="MISLIQRNNEQYIQTIIVEQIASYTKKTNMMITKTIYRGSRSPA
                     ASRIFTNATTVSNVTLSRSLYNSSGDSKSTIKQTLEDVNKKVGQAAAEGLEKTEEASH
                     KVGENIQQAEEKVKNIFSKTSADAKEKAEQGKEHLEAKGRESVARGKEKLDEFEKKH"
     gene            complement(<652589..>654367)
                     /gene="DLD1"
                     /locus_tag="KLMA_50301"
                     /db_xref="GeneID:34716907"
     mRNA            complement(<652589..>654367)
                     /gene="DLD1"
                     /locus_tag="KLMA_50301"
                     /product="D-lactate dehydrogenase [cytochrome]"
                     /transcript_id="XM_022820287.1"
                     /db_xref="GeneID:34716907"
     CDS             complement(652589..654367)
                     /gene="DLD1"
                     /locus_tag="KLMA_50301"
                     /codon_start=1
                     /product="D-lactate dehydrogenase [cytochrome]"
                     /protein_id="XP_022676765.1"
                     /db_xref="GeneID:34716907"
                     /translation="MLPRFVVRSGAAGRNLGFSFTRKCDHTFLSKTVRNDLSHRPYST
                     GTNGNGSANAGKSQSGLLFGVFGGTLIGGGLVAYFLGSKFDQQQSSSQQVSDLSIARL
                     EDLDSPKYCDKKTFATAVEELKQVLDNNPENFSDAKSDLDSHSDTYFNSHHATPEQRP
                     EIVLFPRNTEDVSKLLKICHKYSIPVIPFSGGTSLEGHFMPTRPGSCVVLDISKYMNQ
                     IIQLNKEDLDVVVQGGVPWEDLNDYLNDHGLLFGCDPGPGAQIAGCIANSCSGTNAYR
                     YGTMKENVVNITMCLADGTIIKTKRRPRKSSAGYNLNGLIIGSEGTLGIVTEATIKCH
                     VRSNFETVAVVPFPSVADAASCSSHLIQAGIQLNAMELLDDNMMKIINKSGATSRTNW
                     VESPTLFFKIGGRSEKAIKEVVKEVEKIASQHNNSNFEFASDEETKLELWEARKVALW
                     STIDAGKKLDPNVNVWTTDVAVPISKFAQVINDTKEEMNASGLLTSLVGHAGDGNFHA
                     FIIYNAEQRKTAETIVENMVKRAIDAEGTCTGEHGVGIGKREFLVEELGEDTIAVMRK
                     LKLALDPKRILNPDKVFKIDPNDHQH"
     gene            complement(<654887..>655702)
                     /gene="HCR1"
                     /locus_tag="KLMA_50302"
                     /db_xref="GeneID:34716908"
     mRNA            complement(<654887..>655702)
                     /gene="HCR1"
                     /locus_tag="KLMA_50302"
                     /product="eukaryotic translation initiation factor 3
                     subunit J"
                     /transcript_id="XM_022820288.1"
                     /db_xref="GeneID:34716908"
     CDS             complement(654887..655702)
                     /gene="HCR1"
                     /locus_tag="KLMA_50302"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3
                     subunit J"
                     /protein_id="XP_022676766.1"
                     /db_xref="GeneID:34716908"
                     /translation="MSWDDEDFEVPSAAKEKPVLDSWDDEFAEQDNDEPVLESWDDDE
                     TEKKPKPAAAKPKPAAPSKKKTDPSKKVLLEIDTLDEKTRKELLKKAEVESDLNNAAD
                     LFGGLGVAEEHPRARAERERQQLEALSKPAALTKDTPIESHPLFQNLETKKDYQNLRK
                     ALATAITSTSSNSLLNYSGGLAIDLIRDISKPMAIENIRQTVATLNVLIKEKEREERQ
                     ARLARVKGGTATGGAGKKKAKAARANLGGAFKKDNDIDMGNSNFDDFGDDDFM"
     gene            <656461..>656946
                     /locus_tag="KLMA_50303"
                     /db_xref="GeneID:34716909"
     mRNA            <656461..>656946
                     /locus_tag="KLMA_50303"
                     /product="protein PAR32;Protein phosphorylated after
                     rapamycin 32"
                     /transcript_id="XM_022820289.1"
                     /db_xref="GeneID:34716909"
     CDS             656461..656946
                     /locus_tag="KLMA_50303"
                     /codon_start=1
                     /product="protein PAR32;Protein phosphorylated after
                     rapamycin 32"
                     /protein_id="XP_022676767.1"
                     /db_xref="GeneID:34716909"
                     /translation="MGEYRVSTGRGGAGNVITSHEKPAPKVVAQGSPVPNIISPVYST
                     GRGGAGNMRRNVDPVITRTAQDVDDGDEDIIDVISSNKSGGIQKVKSRRHSDVPKNVS
                     IGRGGAGNMLSPKTSSKKVKKQGQPQAQGQGQPQPQAHGSDDLHRSKSGLFTKLKSIF
                     K"
     gene            complement(<657135..>663554)
                     /gene="GLT1"
                     /locus_tag="KLMA_50304"
                     /db_xref="GeneID:34716910"
     mRNA            complement(<657135..>663554)
                     /gene="GLT1"
                     /locus_tag="KLMA_50304"
                     /product="glutamate synthase [NADH]"
                     /transcript_id="XM_022820290.1"
                     /db_xref="GeneID:34716910"
     CDS             complement(657135..663554)
                     /gene="GLT1"
                     /locus_tag="KLMA_50304"
                     /codon_start=1
                     /product="glutamate synthase [NADH]"
                     /protein_id="XP_022676768.1"
                     /db_xref="GeneID:34716910"
                     /translation="MISSGKYDPLEESYEGGCSLDERPLSSKTHVYKSWANVIPDKQG
                     LYDPEFERDACGVGFVANIKGESSHKIVSDARFLLCNMTHRGAVSSDGNGDGAGILTG
                     IPHEFMKREFKLDVGIDVPEQFQYAVGNVFFKKDSPEALEGSKRTFEQLAESLELKVL
                     GWRSVPHDSSILGAVALSREPEILQPVVVLKELADSPSLSKEEFSSKYETRFKTQLYI
                     LRKQASTSIGLQNWFYVCSLNNNTIVYKGQLTPAQVYNYYHDLTNAHFKSHMALVHSR
                     FSTNTFPSWDRAQPLRWLAHNGEINTLRGNKNWMRAREGVMASKVFGEQLDKLYPIVE
                     EGGSDSAALDNVLELLMMNGVLSLPEAIMLMVPEAYHKDMDSDLKAWFDWASCLMEPW
                     DGPALLTFTDGRYTGATLDRNGLRPCRYYITSDDRVICGSEVGVIPVDNSLVIQKGKL
                     KPGDMLLVDTELGRMVDTKKLKQQFAKRQDFKSWLSKVIKVDDLLEKTSKYIPPALVS
                     DSDLKVQADPRLLALGYTYEQVSMILVPMALGGKEALGSMGNDAPLACLNEDPVLVYD
                     YFRQLFAQVTNPPIDPIREANVMSLECFVGPQGNLLEMHPSQCDRLLLKSPILHWDEF
                     EALKNIEKAHPSWQTANIDITFPKEEGLLGYTATIDRITQEASDAIDQGKKILFISDR
                     QLSASRVPISSLIAVGAIHHHLVRNKQRSQVALILETGEAREVHHFCVLLGYGCDGIF
                     PYLAMETLVKMNREGLVRNVDNDDSSIDDRTLLENYKHAVDGGIFKVMSKMGISTLAS
                     YKGAQIFEALGIDNSVVDLCFAGTASRIRGVTFEYLAQDSFSMHERGFPSRFTIQKSV
                     NLPESGEYHWRDGGYKHINDPTAIASLQDSVRNKNEDAWEMYVRKEMEAIRDCTLRGL
                     LELDYEESDAIPLEQVEPWTEIARRFATGAMSYGSISMEAHSTLAIAMNRLGAKSNCG
                     EGGEDAERSIVAPNGDTMRSAIKQVASARFGVTSFYLSDADEIQIKIAQGAKPGEGGE
                     LPAHKVSKDIAKTRHSTPYVGLISPPPHHDIYSIEDLKQLIYDLKCSNPRAGISVKLV
                     SEVGVGIVASGVAKAKADHILVSGHDGGTGASRWTGIKYAGLPWELGLAETHQTLVLN
                     DLRGNVVVQTDGQLRTGFDIAVAILLGAESFTLATVPLIAMGCIMLRKCHLNACAVGI
                     ATQDPVLRSKFKGQPEHVINFFYYLIQDLRKIMAKLGFRTVDEMVGHSEKLKKRDDVK
                     TKALNIDLSPILTPAHVIRPGVATKFTKKQDHKLHTRLDNKLIDEAEITLDKGLPVNI
                     DANIINTDRALGSTLSYRVSKRFGENGLPQDTVVVNINGSAGQSFGAFLASGLTFILD
                     GDANDYVGKGMSGGRLIIRPPKDSKFKSDENVIVGNTCFYGATSGYAFISGCAGERFA
                     VRNSGATVVVERIKGNNAFEYMTGGRAVVLSQMESLNAFSGATGGIAYCLTSDYDDFV
                     GKINHDTIELESLTDPVEIAFVKNLIQEHYNYTKSELAKRILGNFNHYLKNFVKVIPT
                     DYKKVLENEAKEKIKLKRENTEEFLKKLNSSRDTSLDATNGEVDLIKPNKPVSHKSTL
                     NEPKVLDLEDSIQDATNLKNAEKKIEKIRGFMKYKLKHEKYRNAQSRTSDWKELSTAI
                     TKKQAKEQTARCMDCGVPFCTSDTGCPISNVIPKFNELVFKNQWKLALDKLLETNNFP
                     EFTGRVCPAPCQGACTLGIIDDPVGIKSVERLIIDNAFKEGWIKPCPPEVRTGKVVAV
                     IGSGPAGLACADQLNRAGHTVVVYERADRCGGLLMYGIPNMKLDKSIVQRRLDLLAAE
                     GIQFVTNTEIGKDISVQELKSKFDAVVYTVGSTIPRDLRIPGRELKNIDFAMTLLKKN
                     TKALLDNDLETVKEQIKGKKVIVIGGGDTGNDCLGTSVRHGAASVLNFELLPQPPSER
                     SKDNPWPQWPRIMRIDYGHAEVKEHYGRDPREYCILSKEFIGNEEGEVKAIKTVRVEW
                     KKSQSGVWQMVDVPGSEEIFEADIVLLSMGFVGPEVIDDPSFVKSKRGTITTLSDSSY
                     SVDGDKVFAAGDCRRGQSLIVWAIQEGRKCATAIDTFLMGSTNLPGNGGIVKRDYRLL
                     EELASTI"
     gene            <665021..>666955
                     /gene="UGA3"
                     /locus_tag="KLMA_50305"
                     /db_xref="GeneID:34716911"
     mRNA            <665021..>666955
                     /gene="UGA3"
                     /locus_tag="KLMA_50305"
                     /product="transcriptional activator protein UGA3"
                     /transcript_id="XM_022820291.1"
                     /db_xref="GeneID:34716911"
     CDS             665021..666955
                     /gene="UGA3"
                     /locus_tag="KLMA_50305"
                     /codon_start=1
                     /product="transcriptional activator protein UGA3"
                     /protein_id="XP_022676769.1"
                     /db_xref="GeneID:34716911"
                     /translation="MGSVVAHEQHQHRRKRSKKGCLTCKVRKKGCSEDRPVCKDCARL
                     KLECVYPDNLSKDQIRGAKVRLQTVLKKKNLRALLMSNDDARDGTMPGFVADVDAGVS
                     DVDVSEAQVQVVPRLSEMSPSMLDMVLNDFCVGDNSSTEAAMSPVFSPLDKDQDENTM
                     VVVNSGTHSHAGLGSASDSPEREDQLFKQYTQTNSNAIISSSSHTNPYMSQPLTEPLL
                     QQLDATGIHLYNYYRDHLAQVICIAPARQNFYLQCFLPMAHKHRGILYGILAWSAHHL
                     SISQAAPALDEGSSTRLIMDKDSHFSKLANNYTLGSLQCLNEPQQQQQQKDSPSFLYS
                     LAQILVLCGAEICQGDVNRWQILLKTAAKLIKEHIGGTDLISLLKSDNHSGFDAIDLM
                     TRNWLLANFIYHDIMGSQTTKFPMVQYERLLLSSSGSFTDWSLQVDSLHGLNRPIFKV
                     LGETTNLIRQMKAEKINLYSSNFKAIMFNALDLNQQLLNMAPDEQGLALLAHSTDEID
                     YRELSKHLFEIFRLSALIHLKTNVLKVENNTFEVSFYTKTLLSKLDLVLGTKLESSLC
                     FPMFICGINCLEHDREIIENKFIRYISTYKCRNVVRAHDIMHSVWKMDDEGESIGSSG
                     IRERDWIDICDDMGWDISFA"
     gene            complement(<667320..>667847)
                     /gene="UPS1"
                     /locus_tag="KLMA_50306"
                     /db_xref="GeneID:34716912"
     mRNA            complement(<667320..>667847)
                     /gene="UPS1"
                     /locus_tag="KLMA_50306"
                     /product="protein UPS1"
                     /transcript_id="XM_022820292.1"
                     /db_xref="GeneID:34716912"
     CDS             complement(667320..667847)
                     /gene="UPS1"
                     /locus_tag="KLMA_50306"
                     /codon_start=1
                     /product="protein UPS1"
                     /protein_id="XP_022676770.1"
                     /db_xref="GeneID:34716912"
                     /translation="MVLWHNNSHTFGRSFDTVTIAFFNRYPNPYASHVLSIDTLSRHV
                     DEEGKLVSTRLIKKMGKLPNWVKPFLGKITESWIIEHSVVDTKKGVMLTYTRNLDHTK
                     IIKVEEYQRFEKDGDNTQVKSMVKFSSGFGIGIRNRIESWSHQKFDENIKKSRQGMAF
                     VMERLELSRMNKTPN"
     gene            complement(<668189..>668782)
                     /locus_tag="KLMA_50307"
                     /db_xref="GeneID:34716913"
     mRNA            complement(<668189..>668782)
                     /locus_tag="KLMA_50307"
                     /product="predicted solute binding protein"
                     /transcript_id="XM_022820293.1"
                     /db_xref="GeneID:34716913"
     CDS             complement(668189..668782)
                     /locus_tag="KLMA_50307"
                     /note="General function prediction only"
                     /codon_start=1
                     /product="predicted solute binding protein"
                     /protein_id="XP_022676771.1"
                     /db_xref="GeneID:34716913"
                     /translation="MKNVFFPLTTLFLLQVANGAVLGSLDDDAQSKKDTKEKSTQTQT
                     TIAPTSPVISEISTQVTSPITSPAVSLLTSETTSQKTSVVESTSIPTAASSKLTSPTS
                     ALTPTQSTSTRNYDEPLTTLTTTNSAGETITSKIWWLPSTTFETSKTTTGSTASSSSS
                     SSSSTHNSSHSLYSNGTNGAPATFPKHIIYLAAIALI"
     gene            complement(<669295..>670644)
                     /gene="NMT1"
                     /locus_tag="KLMA_50308"
                     /db_xref="GeneID:34716914"
     mRNA            complement(<669295..>670644)
                     /gene="NMT1"
                     /locus_tag="KLMA_50308"
                     /product="glycylpeptide N-tetradecanoyltransferase"
                     /transcript_id="XM_022820294.1"
                     /db_xref="GeneID:34716914"
     CDS             complement(669295..670644)
                     /gene="NMT1"
                     /locus_tag="KLMA_50308"
                     /codon_start=1
                     /product="glycylpeptide N-tetradecanoyltransferase"
                     /protein_id="XP_022676772.1"
                     /db_xref="GeneID:34716914"
                     /translation="MSSEDQEKTRKIEELLKLLKVHDGDMSKFTAQQRKDMKEYKFWK
                     TQPVTKFDEVIKQEGPIDSSKRVEDIPDAPLKLLPEFEWCTVDVNDNKQLEDVYVLLN
                     ENYVEDKDSTFRFNYSQDFLNWALKPPGWKSEWQVGVRVKETKRLIGFISAIPTNLQV
                     REKEVRSVEINFLCVHKKLRSKRLAPILIKEVTRRVNKHDIWQALHTGGVVLPSPVSV
                     CRYAHRPLNWSKLYDVEFTALPANATKTQMIAKYTLPKTPLTNIKVMEEKHVEQAFAL
                     FNKYQERFELRPDFSLEEFKHWVLTREDVVYSYVIENEEGKVTDFVSFYSLPFTIINN
                     PLYKDLGIGYMFYYASDADFGLDRFSKEGTEKLRKRLNALINDACILARNLKMDVFNA
                     LSSQDNALFLDDLKFGPGDGFLNFYLFNYRCFPITGGIREDQTFDMEKRSNVGVVML"
     gene            <671186..>672913
                     /gene="PWP1"
                     /locus_tag="KLMA_50309"
                     /db_xref="GeneID:34716915"
     mRNA            <671186..>672913
                     /gene="PWP1"
                     /locus_tag="KLMA_50309"
                     /product="periodic tryptophan protein 1"
                     /transcript_id="XM_022820295.1"
                     /db_xref="GeneID:34716915"
     CDS             671186..672913
                     /gene="PWP1"
                     /locus_tag="KLMA_50309"
                     /codon_start=1
                     /product="periodic tryptophan protein 1"
                     /protein_id="XP_022676773.1"
                     /db_xref="GeneID:34716915"
                     /translation="MLSATSWVPRGFASEFPEKYELNDEEMERINQLAQLNLDDARAD
                     LEEAGVEAEAEAEGEEEEEEKPAKANTSAFKDQLEVDDDLKEFDLEHYDDPEDDANAQ
                     NAMFMGLSEDVKFYEGEEGEDPYISLPKAKEDAEEKQELQVYPTDNMVLATRTEDDVS
                     YLDVYVYDDGAGFHDEDVPVEKGDELDPDVARGLVRDSSLYVHHDLMLPAFPLCVEWI
                     NYKPGSNDDQAIANFAAVGTFDPSIEIWNLDCVDKAFPDMILGEPTDNSAAVLMPKKS
                     KKKKSKGKHVTTHHTDAVLSLAHNREFRAVLASTSADHTVKLWDLNTGIAARSLINIH
                     SNTNVSASQWHPSNGSVLLTGGYDSRAALSDVRIENDNDMSKYWKVGSGEEIECVRFA
                     DENVFMCGTDNGNVYSFDIRNGAESKPVWTLKAHDAGVSSVEVNQHIPNMLLTSAMGE
                     KTVKLWKCPLESQPGKGPSMVLSRDFGVGNVLTTSFAPDVEIAGNIVVGGVSPGLKLW
                     DVFTNRSVRKSFQSELKDLQNKAREEAKALGRSSRIARKYTKNDNPETVLTVDDQNDE
                     DEDEGDDEE"
     gene            complement(<673100..>673612)
                     /locus_tag="KLMA_50310"
                     /db_xref="GeneID:34716916"
     mRNA            complement(<673100..>673612)
                     /locus_tag="KLMA_50310"
                     /product="protein UGX2"
                     /transcript_id="XM_022820297.1"
                     /db_xref="GeneID:34716916"
     CDS             complement(673100..673612)
                     /locus_tag="KLMA_50310"
                     /codon_start=1
                     /product="protein UGX2"
                     /protein_id="XP_022676774.1"
                     /db_xref="GeneID:34716916"
                     /translation="MRELYLSSSMLASETGIAYEVSDSYSSRRHGSEDNGKIQYVISM
                     AHSQGFDWNQDFFATRYEQMCQVVYDGHVDSVESVIEELRSRGCLDEEESSSDADGGM
                     SESPVDVLSIQKYRRISDAFIRPRRKSDRSISFSADREQGNFKRAEVIVIDVESDTPE
                     NRVLKSLVKS"
     gene            <674269..>675819
                     /gene="NOP56"
                     /locus_tag="KLMA_50311"
                     /db_xref="GeneID:34716917"
     mRNA            <674269..>675819
                     /gene="NOP56"
                     /locus_tag="KLMA_50311"
                     /product="nucleolar protein 56"
                     /transcript_id="XM_022820298.1"
                     /db_xref="GeneID:34716917"
     CDS             674269..675819
                     /gene="NOP56"
                     /locus_tag="KLMA_50311"
                     /codon_start=1
                     /product="nucleolar protein 56"
                     /protein_id="XP_022676775.1"
                     /db_xref="GeneID:34716917"
                     /translation="MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSF
                     TKLVELVSFAPFKGAAQALENANDISEGLVSDHLKALLDLNLPKGSSKKTVTLAISDK
                     NLGPSIKEVFPYVDCISNELAQDLIRGVRLHGDKLLKDLQPGDLERAQLGLGHAYSRA
                     KVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKL
                     VLFIKDKASLNEESLHDLSEILDNDAGISERVIDNARISMGQDLSETDMENVTIFAQR
                     VVSLVEYRRQLYDYLCEKMHLVAPNLSELIGEVIGARLISHSGSLTNLSKQAASTVQI
                     LGAEKALFRALKTKGNTPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRIDNYS
                     DEPTNAFGQVLKKQVEQRLEFYATGAPTLKNESAIKEAIELYNKDKPATEEEVDTTEP
                     SKKRKLEESSDEEEEEEEKKEKKSKKEKKDKKEKKEKKEKKEKKEKKDKKEKKEKKDK
                     KEKKSKKD"
     gene            complement(<676185..>677068)
                     /gene="PBA1"
                     /locus_tag="KLMA_50312"
                     /db_xref="GeneID:34716918"
     mRNA            complement(join(<676185..676961,677060..>677068))
                     /gene="PBA1"
                     /locus_tag="KLMA_50312"
                     /product="proteasome chaperone 1;Proteasome
                     biogenesis-associated protein 1"
                     /transcript_id="XM_022820299.1"
                     /db_xref="GeneID:34716918"
     CDS             complement(join(676185..676961,677060..677068))
                     /gene="PBA1"
                     /locus_tag="KLMA_50312"
                     /codon_start=1
                     /product="proteasome chaperone 1;Proteasome
                     biogenesis-associated protein 1"
                     /protein_id="XP_022676776.1"
                     /db_xref="GeneID:34716918"
                     /translation="MLTFKQWQNDQSPRHQLDSVAQSDPYSLVDKNLPKVTVSPENLD
                     LIQFNHCLVLPSSLKWLLPKSIINLTHIGVISGTLQNDSNTDPQSMKIVSGMYDTEDS
                     ITGSSTEEFLINYNLWKLQDTVIVIIEENEMKYPTIVTNFMTRQLAQLIGNVCERTIL
                     VNSDRLTELKTLTDLIPPEFITGSITNLILSLKDKSAKVLVVPAEGPSGFEKYNFNVV
                     DSLVDEMSKLLCSYPSQTDYYVSECIKLWKLDGCTTTQGGLYI"
     gene            <677336..>677674
                     /gene="YKE2"
                     /locus_tag="KLMA_50313"
                     /db_xref="GeneID:34716919"
     mRNA            <677336..>677674
                     /gene="YKE2"
                     /locus_tag="KLMA_50313"
                     /product="prefoldin subunit 6"
                     /transcript_id="XM_022820300.1"
                     /db_xref="GeneID:34716919"
     CDS             677336..677674
                     /gene="YKE2"
                     /locus_tag="KLMA_50313"
                     /codon_start=1
                     /product="prefoldin subunit 6"
                     /protein_id="XP_022676777.1"
                     /db_xref="GeneID:34716919"
                     /translation="MSAEEVSQRYTKLQGELEELIVARQKLETQLQENKIVNEEFANL
                     KEDTTVYKLTGGVLLPVEQFEAKGNVEKRLEFIETEIKRCEGNIKTKQQELETVKNQL
                     ISMRTQQQQQ"
     gene            complement(<677790..>678545)
                     /gene="COQ9"
                     /locus_tag="KLMA_50314"
                     /db_xref="GeneID:34716920"
     mRNA            complement(<677790..>678545)
                     /gene="COQ9"
                     /locus_tag="KLMA_50314"
                     /product="ubiquinone biosynthesis protein COQ9"
                     /transcript_id="XM_022820301.1"
                     /db_xref="GeneID:34716920"
     CDS             complement(677790..678545)
                     /gene="COQ9"
                     /locus_tag="KLMA_50314"
                     /codon_start=1
                     /product="ubiquinone biosynthesis protein COQ9"
                     /protein_id="XP_022676778.1"
                     /db_xref="GeneID:34716920"
                     /translation="MSSRVFTRLYHPNMLEHAIPKVIKPLTYGADSVQYKVLSNTIKN
                     HVPSQGFNERAIVQSLNELGLGSSYLSVLGSANSPSFFNVSPAVQELVKFHLVTKRTQ
                     LINELPLDTDKPLPDLETLFLRRLQLNESVAPHLSQMLSIMSIPGEFMVQTALPELHR
                     LTDDMIFYSNETDNHDFAWYSKRLAISTAYVSSELFMAQDKSHNFSETMEFAQSRLEN
                     VKKMGKMYNNTEEYLWFTLLSSINLVKSQLTRG"
     gene            <679586..>680740
                     /gene="SFA1"
                     /locus_tag="KLMA_50315"
                     /db_xref="GeneID:34716921"
     mRNA            <679586..>680740
                     /gene="SFA1"
                     /locus_tag="KLMA_50315"
                     /product="S-(hydroxymethyl)glutathione dehydrogenase"
                     /transcript_id="XM_022820302.1"
                     /db_xref="GeneID:34716921"
     CDS             679586..680740
                     /gene="SFA1"
                     /locus_tag="KLMA_50315"
                     /codon_start=1
                     /product="S-(hydroxymethyl)glutathione dehydrogenase"
                     /protein_id="XP_022676779.1"
                     /db_xref="GeneID:34716921"
                     /translation="MSSETAGKPIECVAAVAYEAGKPLTVEKITVDAPKAHEVRVKVT
                     HTAVCHTDAYTLSGVDPEGAFPCILGHEGAGIVESVGEGVTNVKVGDHVVLLYTAECG
                     ECKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNAKGEPLLHFMGCSTFSQYTVVADV
                     SLVAIDPKAPLSSVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKA
                     RGASKIIVVDVNDQKKQWSFDFGATDFVNPTKDLKEGETIVSKLIDMTDGGLDFTFDC
                     TGNVKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRS
                     EMGQLVSSYQKGDLKVDDFITHKRPFTEINAAFEDLHHGDCLRTVLDLEK"
     gene            complement(<680980..>682647)
                     /gene="NRP1"
                     /locus_tag="KLMA_50316"
                     /db_xref="GeneID:34716922"
     mRNA            complement(<680980..>682647)
                     /gene="NRP1"
                     /locus_tag="KLMA_50316"
                     /product="asparagine-rich protein; Protein ARP"
                     /transcript_id="XM_022820303.1"
                     /db_xref="GeneID:34716922"
     CDS             complement(680980..682647)
                     /gene="NRP1"
                     /locus_tag="KLMA_50316"
                     /codon_start=1
                     /product="asparagine-rich protein; Protein ARP"
                     /protein_id="XP_022676780.1"
                     /db_xref="GeneID:34716922"
                     /translation="MFYVLFECNTVYSDEAPKDHTMICSIAYHVISAETLQPVWQSPK
                     EFQVDETHSLQMLIQTLETDVTAAVGTEEFVICSLGSIWHIRVTLPRQARDESWLLPP
                     FMQHPKLFDLWREVNVWVSNHPERCGKTTDQRNKQHISTKFNKNWETLGYLLGDGAAE
                     TLNLSPIEQCSKVLITLHSSCSTEKDQELVLTHPYNSNLDIKCFLQEKSKVLYINNLP
                     QDTTQSELESWFTQFGSRPVGFWTVKNVVEVASNSSNSNNSLYVDEPDSISGFVVYQT
                     HEEALDSLSLNGRSILSNMSNTKQPRVVEHVVEIQTSSATVLEKVQEILSPFPQSKNR
                     PRPGDWTCPSCAFSNFQRRTACFRCSFPASSAVQVNKNGYNKIQTQQAHNGTQYSKSR
                     SQTADYNDNVQNQQQLLLGQLASAQDFSQKMKMQQQQRFGYSNRAMQSSQLSLQGGAT
                     SGSKVPFRAGDWKCTICTYHNFAKNVVCLRCGGPKNPAVNTTTTTTTNTNTTTPNDVY
                     DFVTSATVPTPSPVYATNERTIPVQIADGFGLSLSERSSSEPTLRKG"
     gene            complement(<683029..>683667)
                     /gene="FAP7"
                     /locus_tag="KLMA_50317"
                     /db_xref="GeneID:34716923"
     mRNA            complement(<683029..>683667)
                     /gene="FAP7"
                     /locus_tag="KLMA_50317"
                     /product="putative adenylate kinase FAP7"
                     /transcript_id="XM_022820304.1"
                     /db_xref="GeneID:34716923"
     CDS             complement(683029..683667)
                     /gene="FAP7"
                     /locus_tag="KLMA_50317"
                     /codon_start=1
                     /product="putative adenylate kinase FAP7"
                     /protein_id="XP_022676781.1"
                     /db_xref="GeneID:34716923"
                     /translation="MESVRYRPNIIISGTPGCGKSTTCELLRRRVSDEYKYFNISDFA
                     KEKDCYDGYDEARKSHIVDEDRLLDELEPLLRKGGCIVDWHVNDIFPERLIDLVVVLR
                     CDNAGLYDRLKKRGYHDAKIDENLDAEIMGVVLQDALDSYAKEIVVELQSDTTEDMDK
                     NVDRIAAWLDQWLEQHEDGVTNELEGAQEGDSDGQESQEEEEEESQEEEEED"
     gene            <683994..>684548
                     /gene="CDC36"
                     /locus_tag="KLMA_50318"
                     /db_xref="GeneID:34716924"
     mRNA            <683994..>684548
                     /gene="CDC36"
                     /locus_tag="KLMA_50318"
                     /product="general negative regulator of transcription
                     subunit 2"
                     /transcript_id="XM_022820305.1"
                     /db_xref="GeneID:34716924"
     CDS             683994..684548
                     /gene="CDC36"
                     /locus_tag="KLMA_50318"
                     /codon_start=1
                     /product="general negative regulator of transcription
                     subunit 2"
                     /protein_id="XP_022676782.1"
                     /db_xref="GeneID:34716924"
                     /translation="MEKYGLKDLLAVIRHEGLYDSNMTLGMDLNSLLSSLDITRDTKS
                     HHCLDAFESPWVETSRSEVQPTFFIPESFKNIKGMLGTDQVEFTSVNRDQPRISLLQD
                     ETLFYLFYKHPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGS
                     YVFFDPQRWEKCQRDFVLHYNAIM"
     gene            complement(<684693..>685976)
                     /gene="MSS51"
                     /locus_tag="KLMA_50319"
                     /db_xref="GeneID:34716925"
     mRNA            complement(<684693..>685976)
                     /gene="MSS51"
                     /locus_tag="KLMA_50319"
                     /product="protein MSS51"
                     /transcript_id="XM_022820306.1"
                     /db_xref="GeneID:34716925"
     CDS             complement(684693..685976)
                     /gene="MSS51"
                     /locus_tag="KLMA_50319"
                     /codon_start=1
                     /product="protein MSS51"
                     /protein_id="XP_022676783.1"
                     /db_xref="GeneID:34716925"
                     /translation="MIGINVPRSTLKSACRGSMGRRVMTRPLMGFVRNALGLDPPASP
                     DDPTPENRFHPWDQSPSPDLRERAARIKAIAKCPVTHKDIAFTCPYSGIPTHHSKEAW
                     EQDTEYHSSKRYELLKKVNIYEHDLRSGRPFPEFDFPQEQDYDRMVNMTNWDLFFYTR
                     SFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPVTLEGLKSLAALRYTLY
                     PEQSGRYRAGQDTPLRIFILGTRAEAQLPGHVWKQLQYLFPETNIELHFVGPESLYDK
                     EKRGYVQSATETVVKRIDESMQLFYHTDFFHVFHEAQDFFPYDPYNDVFFCFHPGFAA
                     PETKEYWMGDTMKALLQTKCAVFTTGFSKQDLLRDINIVQDQYGDELDILMDPVPNTF
                     GSTKWELNDSNPHEVYQFNQYIAGFRGKRYHAIEL"
     gene            <686579..>686917
                     /locus_tag="KLMA_50320"
                     /db_xref="GeneID:34716926"
     mRNA            <686579..>686917
                     /locus_tag="KLMA_50320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820308.1"
                     /db_xref="GeneID:34716926"
     CDS             686579..686917
                     /locus_tag="KLMA_50320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676784.1"
                     /db_xref="GeneID:34716926"
                     /translation="MLRSVFGPRIGCFVAQNAFFGARRMGMVTMTRSEGSLLGGMVPL
                     ARPMGSPMGSPLSSLIGSPLTSPLETPSETPDMHLDSVMRKRRTKMKKHKLRKRRKRQ
                     KAEKRKQSQG"
     gene            complement(<687031..>688077)
                     /gene="HMX1"
                     /locus_tag="KLMA_50321"
                     /db_xref="GeneID:34716927"
     mRNA            complement(<687031..>688077)
                     /gene="HMX1"
                     /locus_tag="KLMA_50321"
                     /product="heme-binding protein HMX1"
                     /transcript_id="XM_022820309.1"
                     /db_xref="GeneID:34716927"
     CDS             complement(687031..688077)
                     /gene="HMX1"
                     /locus_tag="KLMA_50321"
                     /codon_start=1
                     /product="heme-binding protein HMX1"
                     /protein_id="XP_022676785.1"
                     /db_xref="GeneID:34716927"
                     /translation="MLQYRGLVVQGISLLFGWLVKVQPEIQQHPKPMAATTTEHMTTI
                     PSPTDVGALANRINFHTRDMHNKINAYMSIKMAFAMRHGFIYRQGILAYYFVFHAIEQ
                     EIDRLLERAETAQEERVKGILQQFWCEEFRRSDKLVLDLQVLYHDEYPSGNELQEFLD
                     TFEIPPQLQAFVDEIHANVAAEPYTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKF
                     GHLSSKELVRRATNFFTFSDEGVDDENRLRWQYKRGYELATRQTLSEAEKLRVIEVAT
                     DIFEWNMKVVAEIGEINRAQLMGKFSYKLLSFISEEWKYSEKLTPEIKKIVVLAVVLF
                     NMVLLYAILRRYLL"
     gene            complement(<688329..>690473)
                     /gene="CDC9"
                     /locus_tag="KLMA_50322"
                     /db_xref="GeneID:34716928"
     mRNA            complement(<688329..>690473)
                     /gene="CDC9"
                     /locus_tag="KLMA_50322"
                     /product="DNA ligase 1"
                     /transcript_id="XM_022820310.1"
                     /db_xref="GeneID:34716928"
     CDS             complement(688329..690473)
                     /gene="CDC9"
                     /locus_tag="KLMA_50322"
                     /codon_start=1
                     /product="DNA ligase 1"
                     /protein_id="XP_022676786.1"
                     /db_xref="GeneID:34716928"
                     /translation="MLRLALRLVNATSYRGGPRHVGRRSYSVSPVQMSVKRKQVTLDA
                     LFGGSKKVKPEAKPEVKPEVKPEARLEDSNSKVKNSTPTPTPPGSSSNAAVVSNIPFA
                     ELCDTFQAIEETSSRLAITAICSKFLYSVLERDAKSLVPVTLLFIHKLGPDYEPGLEL
                     GLGESLLIKTISEACGKTTQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGEVF
                     NNLVAIAKASGKDSQSKKSSLIKKMLTACKGFEAKFLIRSLESKLRIGLAEKTVLIAV
                     SKAILTHEHKGEEPSADMVERAESLIRDAFCQIPNYEIIITTALEHGIMNLDQHIKLK
                     PGIPLQPMLAKPTKSISEVLDRFQGTRFTCEYKYDGERAQVHLLSDGTMRIYSRNGED
                     MTERYPEINVSDYIRKEGSAAGGESTAPVVTSFILDSEAVAWDQEQNKILPFQVLSTR
                     KRKGVELKDVKVRVCLFAFDILCLNDEPLINKSLSERRDILRATFDPTPGQFVFANEI
                     TTTNLDELQKYLDQSVKDSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDS
                     LDLVVLGAYYGRGKRTGTYGGFLLGCYNQDTEEFETCCKIGTGFSDEMLQTLYDRLQH
                     TTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAYGKGISLRFPR
                     FVRIRDDKGVTDATSSDQVIEFYESQASVRGQ"
     gene            complement(<691206..>691754)
                     /locus_tag="KLMA_50323"
                     /db_xref="GeneID:34716929"
     mRNA            complement(<691206..>691754)
                     /locus_tag="KLMA_50323"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022820311.1"
                     /db_xref="GeneID:34716929"
     CDS             complement(691206..691754)
                     /locus_tag="KLMA_50323"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022676787.1"
                     /db_xref="GeneID:34716929"
                     /translation="MLRKYSTAPKPLFGGSTPPPPYSHSYQQLQSSLTRKPFLEIALV
                     IGVGALTYFAIDNYNERIKLESKLNNHIVKSQQMQEVYLKQMNAQRKKRELQILNERK
                     STLQRQMKMALHIAMLRKQLADLGQDPVSISTIQQEYANSVKMENSISNVSGTALWIA
                     DNSELKSYLPNAREYDEEKGSN"
     gene            <692174..>692443
                     /locus_tag="KLMA_50324"
                     /db_xref="GeneID:34716930"
     mRNA            <692174..>692443
                     /locus_tag="KLMA_50324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820312.1"
                     /db_xref="GeneID:34716930"
     CDS             692174..692443
                     /locus_tag="KLMA_50324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676788.1"
                     /db_xref="GeneID:34716930"
                     /translation="MTTSLVDDFVHFFNLSLGSTESSQSLLCDLSGSLFTSVSDQFDQ
                     SSFVWSQRSDFLNDASDENGSLGSSTLSVRDLWGWGQLVDLLTFV"
     gene            complement(<693675..>694442)
                     /gene="MRPL24"
                     /locus_tag="KLMA_50325"
                     /db_xref="GeneID:34716931"
     mRNA            complement(<693675..>694442)
                     /gene="MRPL24"
                     /locus_tag="KLMA_50325"
                     /product="54S ribosomal protein L24"
                     /transcript_id="XM_022820313.1"
                     /db_xref="GeneID:34716931"
     CDS             complement(693675..694442)
                     /gene="MRPL24"
                     /locus_tag="KLMA_50325"
                     /codon_start=1
                     /product="54S ribosomal protein L24"
                     /protein_id="XP_022676789.1"
                     /db_xref="GeneID:34716931"
                     /translation="MKIFAGSQRSFSTVSSLFREWRLVESRQVPAPKEYKVGDVKPLY
                     IPKEKKEFPEYPYGESPIYKQSNKGLYGASFIQFGNNIPESKTKTRRSWSPNVIRKGL
                     WSETLNRKISIKMTAKVLRTVTKEGGIDNYLTKEKAARIKELGPTGWKLRYRILQSKE
                     QAKTPVHKDAETVVDANGNEVTVLFKVTVDGEPLRITVGKRKLLHSLYPLEKMEHKAD
                     GMFLSYKKFLEDYASREVADIVSRLKELKFDLSTITV"
     gene            complement(<694860..>697109)
                     /gene="GYP5"
                     /locus_tag="KLMA_50326"
                     /db_xref="GeneID:34716932"
     mRNA            complement(<694860..>697109)
                     /gene="GYP5"
                     /locus_tag="KLMA_50326"
                     /product="GTPase-activating protein GYP5"
                     /transcript_id="XM_022820314.1"
                     /db_xref="GeneID:34716932"
     CDS             complement(694860..697109)
                     /gene="GYP5"
                     /locus_tag="KLMA_50326"
                     /codon_start=1
                     /product="GTPase-activating protein GYP5"
                     /protein_id="XP_022676790.1"
                     /db_xref="GeneID:34716932"
                     /translation="MDSIEFSGLKWSQRHWSTVFNMSDHEEINEDTKSVASGDVRSEN
                     GVEKDIKDEENVTASPESDEDKADINNDKQAEVNADNSEHSNEEPSEKEPEAIPAETG
                     NESLDEGNHSINPEEATSNEPADASESVEASSKAEEHEEFHDTQGSETVQVKDETEED
                     EDKDSVSDASLLKNKQDDLEQKIESFSEKPEPPKLPPRTHIASGSVSPPQLPPRSHVA
                     NSMSGPIHTVPPPLTEEMKSPEFRTHFNKHKRSDSSDFDLILNRFIQNETELELRDEK
                     ERENAKKGTETLIEEYDELVDHTEKELVDIDWPFWSKLVHSFSEVVKEDSKKLESEVG
                     KGIPPQIRGIVWQLLTSSNYKEMEEFYNSLLAIESPHEKGIRRDLSRTNFIPEGKSDS
                     LFNVLKAYSLYDPPVGYTQGMAFIATTLILNCDEEWQAFSLLTKLMKVYGFRSLFLPG
                     MPGLMLKLYQFDTLLEEHDPQLYNHLLRQGIRSTMFATQWFLTMFAYKFPLDFVLRIM
                     DIVILEGIESILKFSLNLMIKNSRNMIVLTFDSLLDFLKEDLFQYYASEENPEGYDID
                     KFISDSLEIKITPLQLERYCKEFEEIHKLETEKEQRYEEQRIKNRELQKELKRLEHDY
                     ALVNKEHVAIANELIENRLRMETLQDENRDLQQEIQDLQKQLEREIYKQTLPNPDAEI
                     PTDLKEDLNKTMERNLQVMTENQELRERLDQLEKENYELRTGKTWTKEATSPRGSRLG
                     SWAFKTPWK"
     gene            complement(<697379..>699175)
                     /locus_tag="KLMA_50327"
                     /db_xref="GeneID:34716933"
     mRNA            complement(<697379..>699175)
                     /locus_tag="KLMA_50327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820315.1"
                     /db_xref="GeneID:34716933"
     CDS             complement(697379..699175)
                     /locus_tag="KLMA_50327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676791.1"
                     /db_xref="GeneID:34716933"
                     /translation="MSTEKAEFSSHGGIDFEAIPGNVHLVDIEKKKSKENGKIVLVPT
                     PSDDPDDPLNWELKRKLLALSCCLVYTLGVGVPSAAIYSVLNDVSLKTGISLSQLNNA
                     TGYLFLFYGIGCFAFQPLALQYGKRPVYVFSMLATALVCVWPPYTKTKGEWIGSKVVQ
                     GFFGSAIESLPEITVSDLFFEHQRSTGLATYGVTLLFASYIAPCIAGFISDGQSWEWV
                     MWWCAIFAAVCAVFLFFFMEETNYNRKLKIDSKTGQPITMSHGDGTVVSNVFSHINKD
                     NNIDDLLDDKAGNKVAVDETDSESQGNEAADEAGLHNVLSAENSNILNQLSQVEVVDA
                     STVVQRKSTKTFISKLSMTSGQKDKFLLHHYFLAPFLLFRLPGVVWAGFFYGQSLIWF
                     NVLNATENLILAAPPYNFSSTQCGLAYISPMLFSFIIYFLVGNFSDWLKVRIARYRGG
                     LSLPEDRLYTIILYCIFGVFACILWGVGAYYKVHWFGLVFGLGLLGGCSMFGITISTT
                     YVIDCYKELDTEAMVVVIIIRNCMSFAVSFGITKWIENLGLKHAFISVAFILLACNLT
                     FVFMVIYGPRMRNNSKHFYWSLVQKYRELGMH"
     gene            <700202..>701938
                     /locus_tag="KLMA_50328"
                     /db_xref="GeneID:34716934"
     mRNA            <700202..>701938
                     /locus_tag="KLMA_50328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820316.1"
                     /db_xref="GeneID:34716934"
     CDS             700202..701938
                     /locus_tag="KLMA_50328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676792.1"
                     /db_xref="GeneID:34716934"
                     /translation="MTVDAAPIDAQTFEKYKPLIEKYNAQRVEDMKSYDPDFYAKCVE
                     VIPSDEVLDTEPIDARKFLVELLSEKDLKIVNGYTIDDLISKQLDGSLTAVEIANAFI
                     KSSIIAQLATNCVMQFLIPYALEKAQQLDAYLKENGKIVGPMHGIPISLKEHLDFKGK
                     VTSAGYVALLEAVSSKHALTVDIFEKQGAIYHIRTAQPQSIMHLDTWNIISGRTRNAL
                     STKLSPGGSSGGEAAAVAMHASIMGVGTDIGGSIRCPSAFGNLYGMRPTTKRNSLLHS
                     TPGTGGQESIVATIGPLARSIDELDYYMEHYLNDGKPWETDPTCVPIPWRKPSLPEKI
                     KIGVLNTDNLVTPYPAILRGLQTVAKQLKKHSDVFEIVDLAPYWFTEEEMEKIYTTNL
                     VLYTIDGNKAQMSVFEKSGEPILPLTQHFFNFGGGNALSAYENRQHNTVRDEYQLKIF
                     EKFFEKGTDGLGLDFILSPTYVGPAELPGQSLYWGYTSFWNLFDYPNVIFPTGVTHDP
                     ELDANVEKSSLKSNSYEKMAWLDNSGSLKYDPSDYVNGPVALQLTGKRFDDESVVSAV
                     KRINEILNVERR"
     gene            complement(<702102..>704144)
                     /locus_tag="KLMA_50329"
                     /db_xref="GeneID:34716935"
     mRNA            complement(<702102..>704144)
                     /locus_tag="KLMA_50329"
                     /product="GAL4 domain-containing family protein"
                     /transcript_id="XM_022820317.1"
                     /db_xref="GeneID:34716935"
     CDS             complement(702102..704144)
                     /locus_tag="KLMA_50329"
                     /codon_start=1
                     /product="GAL4 domain-containing family protein"
                     /protein_id="XP_022676793.1"
                     /db_xref="GeneID:34716935"
                     /translation="MILGNNSVDEMPALIGSGRGSVKVRYRKTKRVKEKNEETIVVER
                     RSNNGCLTCRDRHKKCNEQRPICSGCRENFLNCVWRDHEEHQEASHMFLNFRIDEWKV
                     RKKHKKRTSYYFAASPKLSFYNLTTSEDAVAIVDEENGSLEKLERFPTVRQLGVYDDD
                     EEELNVEDGNGDFTTDVPTTDVPFLDASTIWLSRQVTPHLTDSLQILNSSIEKAIEDY
                     TPNDISPEVREENTFYNYLFDDTHPLAQKFDSVMKSLNRGEFDVIPKYCTDELFLLYI
                     AVKHWLVGVGPQETHPLLTTQSTFTRNFQDNPVLKEVFLCCGATFMEYYDSEIFSKLS
                     TELYQSSLTLIKKYLEDNPEENNKPWLLASYQLLCLRNKTAINSTVNDCVQCLSNSYQ
                     VIKSPYYLSKIKSISTTKEKYVEELVLEIEHDTSLEKPELEPHDRMYLESFIYNYSVA
                     LLWAVDISKLPNPYSVYEVLGKSLRCFIYQCDFRWMNNPVVGASSEAFEILAKVSYIA
                     RLPLPLEKNGIWYKRALQLQKQAYYHTPSILPNLDQAKIGEKMYNRCKVNLLVGEIVA
                     KTSFLLISKVIEYKKFDILSCQKLVSEIVRNIEKIPKGDLIWAILTWSVIVCGVFATE
                     TENQKKLLSFLDYIRDKFHMLHLFNSKIFLFKAWELPINDRLDILFDRDNLTRVNA"
     gene            complement(<704858..>707557)
                     /gene="LAC9"
                     /locus_tag="KLMA_50330"
                     /db_xref="GeneID:34716936"
     mRNA            complement(<704858..>707557)
                     /gene="LAC9"
                     /locus_tag="KLMA_50330"
                     /product="lactose regulatory protein LAC9"
                     /transcript_id="XM_022820319.1"
                     /db_xref="GeneID:34716936"
     CDS             complement(704858..707557)
                     /gene="LAC9"
                     /locus_tag="KLMA_50330"
                     /codon_start=1
                     /product="lactose regulatory protein LAC9"
                     /protein_id="XP_022676794.1"
                     /db_xref="GeneID:34716936"
                     /translation="MRKYKVVKDVSGSRSGSGGPTGGGSGSSSGDLVHAKVESRRGDS
                     QMRREPGIPELDEMKKENERSEHGSRNGSQNAKEGSAGESGDNSMHRACDACRKRKLK
                     CSKTLPKCDTCLKNKWECTYSPRVARSPLTRAHLTAMENRVVELEQFLQQLFPGWDID
                     KLLQQKDVYRVRELLVGGSTGATTAVGPGTSIPFKQAQQTPGFQLQAPLATTGATQGP
                     PQGTLRQNQQFTSMGQRGTGTGTGTGSGAAIATSTSSSGMYPVMGNFSGSSMPPVTAT
                     FFQWYESENTIDNSYFSKDSIRHWLNQLLTSENIMHIPAKRINDTLQQANVNNQRSPV
                     IINNDISHHTSDVRAAAAAGAAGAGASQSRANIPLITGSTGTGPAVSSNSGTGPSSDS
                     TTASNTSGKNAMSAMDIPDPTFLTKRETTSSYIDAFFKHYHPFYPFIDEDRFFAQYND
                     QIQPPNMEIWQILLNTVLTLGAWCLNSNGTHDTFYFENALSYLSATVFQTGTIDLTCA
                     LLLLTHYVYKIQKPNTAWTLLGLCSHMATSLGLHRELPNLSLQAQQIRRTIWWTIYCT
                     ECDLTVETGRPSQLPNLQSIDAILPVSSAGLNEPSIYSSIIQESQWSKIVQQMLTENA
                     YQHSAADCLVWFDSIQEFVNMRPIPSTEAELKALNETQLAWLPLAKFRPYWIFHCSLI
                     ALFTRFFQAEPSNDSNVARCKELCLQLSSRNILSLLTFVRTYRLNSLSCWYATHYLIR
                     SSLVPLYFTAQVSPQHPFWDSVKTQMIAAHEAMEALSQQSPLALQFDKILNKNCSELL
                     QREGINNKNQVLPPTPSLQSTSFSDLLSLWSTNTDDAPKNGAPSQQSTTITDSLLQSS
                     TTQMRPNPSGWQEINTFLNPSTQHLFNTTTMDDVYNYIFDNEE"
     gene            <708223..>713046
                     /gene="SGS1"
                     /locus_tag="KLMA_50331"
                     /db_xref="GeneID:34716937"
     mRNA            join(<708223..708235,708992..>713046)
                     /gene="SGS1"
                     /locus_tag="KLMA_50331"
                     /product="ATP-dependent helicase SGS1"
                     /transcript_id="XM_022820320.1"
                     /db_xref="GeneID:34716937"
     CDS             join(708223..708235,708992..713046)
                     /gene="SGS1"
                     /locus_tag="KLMA_50331"
                     /codon_start=1
                     /product="ATP-dependent helicase SGS1"
                     /protein_id="XP_022676795.1"
                     /db_xref="GeneID:34716937"
                     /translation="MMNESAKRSVQEPRTLSWNGGAYTNSTVAVATVLDSDGEGPVRG
                     NIMSIGHDVSGDNKGGDFVDESDEEGDSVLEVIVDEPVPKEVPKVMSVERPGERKIAS
                     PKPVSSSTETLISLLRRQAALLEEKCVLLESTSLSQDNKRTRITTSIDPALRDIKRQL
                     TRIESGTGTGTGAEAPAPVPAPVQRQNQGQIQGPHPSPSIPPQSSPHSSPQIKVPSRT
                     LRRRDPDKNYYIPTMSQLDENPHLWRDPAQGLPQGRPQGRPHGIPEYPDSDVSLEAES
                     EDSHFLTTQEEDRLDEIHESDKEFVVDGDYLDDDQDVSYHEEETETQTQTQTQTGTVA
                     NLDEHTEYPTNQIIINSSPGNSPVKSPSQPPLQQQTQTQTQILAPPIELHPPPSPSPE
                     FHQTPQIRLIDDDEIEFLEDPISESLPIDHTIATAQDELEPLSDTDLEEFDAEREDQT
                     QFDEIKELDDDLKIISESRLDEEAIPLSFTVKKEPHAFDSQLQLHNQPKPTSVAAAAM
                     PVTEVIEDDDFSMADLEPYMSSQKEREREREREREREGSTRASSLQPQYAWTSEMYHK
                     LRRVFGLDSFRPNQLEAVNATLEGRDVFVLMPTGGGKSLCYQLPAIVKSGKTFGTTIV
                     VSPLISLMQDQVEHLLAKNIKASMFSSKGTAEQRRMTFNLFINGMLELVYISPEMIKA
                     SVQCKKAISKLYQDRKLARIVVDEAHCVSNWGHDFRPDYKELSFFKQEYPDIPMIALT
                     ATASEQVRMDIIHNLQLNNPVFLKQSFNRTNLFYQVLKKEKNSIFHMCDMIKTKFKNQ
                     TGIIYCHSKNSCEQTSALMQKNGVKCAFYHAGMDPDERLQVQQDWQADRVQVICATVA
                     FGMGIDKPDVRFVFHFTVPRTLEGYYQETGRAGRDGNQSQCIMYYSFRDVRTIQTMIQ
                     KDKNLDMVNKEKHLDKLQQVMQYCDNRTDCRRQLVLSYFNERFDPKDCEKNCDNCRNA
                     SNVVYQTRDVTEEAKDIANLVKSIQDSKVTLIHCQDVYKGSKYQKIVQLGHHQLPYHG
                     KGKDWKKADIERIFFKLVTERILNEYSVSTGRGFFSTYVKVGPRAKDLFKDRMRVEIR
                     FVANEEQNSNTNGNTISKNGDRTSKEKDNRIVTSRPFTERSSSGTVLSTPTVSRSLTV
                     NNNNNNIDIQTGNSREFIQKFRHDESAVNTYSTPVQLIKGSTYVSSQEQAHINKSYNV
                     LKDIAVNVSSKFNFPDYTALIPDAVLWKIANELPVDQASFGRLGNSNDPALAKRFKYF
                     SAILKKLKKERHHIIVVSSDRSVNTSGETGMKSGYFKNHEDMDDSAVISQIRETMFAS
                     SAASTQSATYSQKRTKPKSNSGNGRWKKSWKSKRR"
     gene            complement(<713248..>715023)
                     /gene="SEO1"
                     /locus_tag="KLMA_50332"
                     /db_xref="GeneID:34716938"
     mRNA            complement(<713248..>715023)
                     /gene="SEO1"
                     /locus_tag="KLMA_50332"
                     /product="probable transporter SEO1"
                     /transcript_id="XM_022820321.1"
                     /db_xref="GeneID:34716938"
     CDS             complement(713248..715023)
                     /gene="SEO1"
                     /locus_tag="KLMA_50332"
                     /codon_start=1
                     /product="probable transporter SEO1"
                     /protein_id="XP_022676796.1"
                     /db_xref="GeneID:34716938"
                     /translation="MSLVRELVVDPFRRLKWGFIPVRRVVEDDVEEDEVDAKVETNSS
                     VTSSSDLAKNGSSKTEEDAHSETYEVSTLEGGLEYEYRDEADRKWYKFFDEQEYRINK
                     QQNEQWKWYHWFAPDMSTKEKKLLLKLDVLLAFYSCIAYWVKNLDTSNLNNAYVSGMK
                     EELHFKGNDFVNTQVMYTVGNIIFQLPFIFILNKIPLNYVLPTLDLCWSLLTVGAGYT
                     HSVKQLKAIRFFIGVFEAPSYLAYQYLFGCFYKHDEMVRRSAFYYFGQYAGILSSGGI
                     MSAVHTALDGVGGKSGWRWNFIIDGVISVAVGILGFYMLPGDPYNCYSIFLTDDEIRL
                     ARKRLRENKTEKSDFHTKFFDKEVWKRILFDWKIYVLTLWNVFCWNNNNGSSGAFLLW
                     LNSLTKNGGTEKRFSIAKKNQWSMITPGLGMVYLFLTSLLADKGHTRWGAIIATQVFN
                     FTGNVILAVWDVPDGAKWFAFMLQYFGWAMAPVLYSWQNDICRRDAQARAVVLVVMNM
                     LAQTSTAWISVLVWKTTEAPRYLKGFTWTAVSSFCLSVWTFVVLYYYKRDERRNAKDN
                     GIILYNSKTGDNYPPQKASKEEATA"
     gene            complement(<715688..>718780)
                     /gene="GCV2"
                     /locus_tag="KLMA_50333"
                     /db_xref="GeneID:34716939"
     mRNA            complement(<715688..>718780)
                     /gene="GCV2"
                     /locus_tag="KLMA_50333"
                     /product="glycine dehydrogenase [decarboxylating]"
                     /transcript_id="XM_022820322.1"
                     /db_xref="GeneID:34716939"
     CDS             complement(715688..718780)
                     /gene="GCV2"
                     /locus_tag="KLMA_50333"
                     /codon_start=1
                     /product="glycine dehydrogenase [decarboxylating]"
                     /protein_id="XP_022676797.1"
                     /db_xref="GeneID:34716939"
                     /translation="MLRFRVARQAIGCGRRLPVGCRFVSSKCDVSSVQYERIYSAKKT
                     GDEAFGSLDTFQRRHLGPSPGNVGKMLEQLGYTDLDQFIEGVVPVNILAKRPLEIDAP
                     KNGYTEQEMLKHLQALASKNKHEVRNFIGKGYYGTVLPPVIQRNLLESPEWYTSYTPY
                     QPEISQGRLESLLNFQTVISDLTGLPVANASLLDEGTAAGEAMLLSFNVAKKKKLTYV
                     IDKRLHPQTKSVLLTRAEPFNIRLVEIDPLDQSTWGVLTDAESRKDVAGCLVQYPDTE
                     GNIVPGANLTQLAQLVHESKGLLAVASDLLALTLLKPPAEFGADIVLGSSQRFGVPFG
                     YGGPHAAFFSVIEKLNRKIPGRIVGVSKDRLGKPALRLALQTREQHIKRDKATSNICT
                     AQALLANIAANYCVYHGPEGLKQIASRVYGLTTILANAIQKSSSSNGGHTLLNKSQWF
                     DTLTIKLNDSVSAPEFLKLAVDKYQINLFQVDDKTVSLSLDETTTKQDLISLLELFGC
                     DTELPSTIPEFPQELKRTDQILSNEVFNTHHSETAMLRYLHRLQSRDLSLANSMIPLG
                     SCTMKLNATVEMIPITWPQFANIHPFQPRDQVGGYELLIKSLERDLASITGFDKVSLQ
                     PNSGAQGEYTGLRVIKRYFESRGESHRNICLIPVSAHGTNPASAAMCGLKVVPVNCLK
                     NGSLDLVDLQAKAEKHKDNLAAIMITYPSTYGLFEPGVKDAIEIVHANGGQVYLDGAN
                     MNAQVGLTSPGDLNADVCHLNLHKTFSIPHGGGGPGVGPICVQSHLSPFLPTHDVVPM
                     ITGVGSPESIKSVSSAPYGSASILPISYSYIKMMGTNGLPFSSVIAMLNANYMMSRLS
                     SHYKIMFIGEKTDADATALKHCGHEFIIDLRQYKDQGIEAIDVAKRLQDYGFHAPTLA
                     FPVPGTLMVEPTESENLEELERFIDAMISIKQEIDLYIAKDPRGQVLKNSPHSLDDIV
                     SSNDWETRGYTREQAVYPLPYLKYNKFWPPVARLDDTYGDTHLMCTCPSVEDVANTVD
                     "
     gene            complement(<719448..>720941)
                     /locus_tag="KLMA_50334"
                     /db_xref="GeneID:34716940"
     mRNA            complement(<719448..>720941)
                     /locus_tag="KLMA_50334"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820323.1"
                     /db_xref="GeneID:34716940"
     CDS             complement(719448..720941)
                     /locus_tag="KLMA_50334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676798.1"
                     /db_xref="GeneID:34716940"
                     /translation="MDYRSSKRSSISFGSYQRQLNPLEGVGGFYQRQQQQQQQQQQQV
                     GNLGGLGSLGLGGSSNYTLDKLKTVTACQYECSAPLFSVAWNYNDQVALGTYKEDSYN
                     RIEIINASSDYSTWECAHVANVVYPVSRIQWMPQNNARLATCSDSLRIWSLDGSLQEQ
                     INLSLYKYGKHPSSASQKDTATLGQLPPVTSFHWSPISPNLLLSCSIDTTCTVWDLSN
                     STNYIKTQLIAHDSEVFDVKFLAQSTQLFASCGSDGSVRVFDLRSLAHSTIVYEHGSE
                     QSRAPSANNKNTTLRVSSNANAANNNNNTTNSNANANHNANHNNNNNATNNNNNANNN
                     DTSTSGEPDDTLTSSQLDQTDMDQGSCALVRLEPNPFDPNVIVTVPQDSNAIIVLDMR
                     YPGTPLLTLEGHIGPVNQVQWHPKRPGVLASCGDDCQVLYWDINSLLGQSATSSTRWA
                     NSNVVHSVDTPQMAYTTETEANNIVFNAQGSHVGVVHGKTFTAVGLP"
     gene            complement(<723413..>723730)
                     /locus_tag="KLMA_50335"
                     /db_xref="GeneID:34716941"
     mRNA            complement(<723413..>723730)
                     /locus_tag="KLMA_50335"
                     /product="transposon Ty1-H Gag-Pol polyprotein"
                     /transcript_id="XM_022820324.1"
                     /db_xref="GeneID:34716941"
     CDS             complement(723413..723730)
                     /locus_tag="KLMA_50335"
                     /codon_start=1
                     /product="transposon Ty1-H Gag-Pol polyprotein"
                     /protein_id="XP_022676799.1"
                     /db_xref="GeneID:34716941"
                     /translation="MKFRMLDILSHKLPLLNLPLREGSRYNQVPVSSSSEPPKVDKNL
                     YVTEKDYKSNVKKLQQVVGLLSYVAHRFRFEAIYHVNVLAQYQLYPTEEVMRWANELT
                     QYF"
     gene            <726733..>727431
                     /gene="MRPS17"
                     /locus_tag="KLMA_50336"
                     /db_xref="GeneID:34716942"
     mRNA            <726733..>727431
                     /gene="MRPS17"
                     /locus_tag="KLMA_50336"
                     /product="37S ribosomal protein S17"
                     /transcript_id="XM_022820325.1"
                     /db_xref="GeneID:34716942"
     CDS             726733..727431
                     /gene="MRPS17"
                     /locus_tag="KLMA_50336"
                     /codon_start=1
                     /product="37S ribosomal protein S17"
                     /protein_id="XP_022676800.1"
                     /db_xref="GeneID:34716942"
                     /translation="MARQNFIGMVISQGKMQKTVKVRVETKVFDKRINKELFHRKDYL
                     VHDESEVSREGDIVRIEATRPLSKRKFFSIAEIIRNKGQQFALFHEQAKVNVAKEENE
                     KTREFLERRQAKQGIESTLLKDVRALQKAYAEGNQDSEVVSEIKKRYGIEEFSPESLK
                     QILQLDIVSMEAQVKKQQAKIDQITARLGEYMENESLANEFLKSKGLENPHELKKNIK
                     KNILRKHILEEVNV"
     gene            complement(<727600..>728427)
                     /gene="RBD2"
                     /locus_tag="KLMA_50337"
                     /db_xref="GeneID:34716943"
     mRNA            complement(<727600..>728427)
                     /gene="RBD2"
                     /locus_tag="KLMA_50337"
                     /product="rhomboid protein 2"
                     /transcript_id="XM_022820326.1"
                     /db_xref="GeneID:34716943"
     CDS             complement(727600..728427)
                     /gene="RBD2"
                     /locus_tag="KLMA_50337"
                     /codon_start=1
                     /product="rhomboid protein 2"
                     /protein_id="XP_022676801.1"
                     /db_xref="GeneID:34716943"
                     /translation="MNIRNFLVPAGKPFSGLASGLSIFLTFLYLINVFVYPINDHIIL
                     KPDSLYTFDLNRISLYPLAHLSIFHLFFNVISIYPMISMFEESHGTLYTGVILNLLAV
                     FSAIPYCIIGSVFFPNVEVGGASGWFFSFLGYFGVKESRIRPSAMVTTNRSFPTIYFP
                     LALLAITAFLVPGSSLPGHSIGLAIGYFMGFKENVVAKLVPSSNILKKIETFADPLIN
                     KIPFGIKYYREVEVNRSSEYNSIYIGSESTLPLHSTTQPAQPSQATPFQGNGRVLGA"
     gene            <729197..>730525
                     /locus_tag="KLMA_50338"
                     /db_xref="GeneID:34716944"
     mRNA            <729197..>730525
                     /locus_tag="KLMA_50338"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820327.1"
                     /db_xref="GeneID:34716944"
     CDS             729197..730525
                     /locus_tag="KLMA_50338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676802.1"
                     /db_xref="GeneID:34716944"
                     /translation="MIRTMTKVAKKSIKNAGQNRAQTVTQNVRSEAIQKLSDIKLSDE
                     QLQLKNNVFQFIEDKISKFDGRNTSMYVIEGDAGTGKSVILNALFNDLQKQSLPTSTN
                     EVLRNTKNYLVVNHPEMLKLYHQISRSFPYIKKSSLERPTSLINQLKKQEGAKCDVII
                     VDEAHLLATSKDAFKRFYGDNHLEELMDLAKVLIVVFDAKQSLRMGSYWDDQPGNGST
                     LQQYYKALPEENKKWYRLKQQFRVVAEKDILEWIQQISTTGKILPMPSSVKEGKSTFD
                     FKIWDDCGAMYEELKRLNDKYGQCRMLATYDFPYRLDGKDYFVECGDTFKVRWDRYTP
                     RAIAPWSERADTIDEVGSVYTIQGFDLNWAGVILGRSVGYDAETDSIKLKPEFYDDHA
                     GFTKKKNIKDVEKVKAKIIMNSINVLLTRGVKGLYIYAWDPELRKRLAKL"
     gene            complement(<730563..>731564)
                     /gene="HUT1"
                     /locus_tag="KLMA_50339"
                     /db_xref="GeneID:34716945"
     mRNA            complement(<730563..>731564)
                     /gene="HUT1"
                     /locus_tag="KLMA_50339"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820328.1"
                     /db_xref="GeneID:34716945"
     CDS             complement(730563..731564)
                     /gene="HUT1"
                     /locus_tag="KLMA_50339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676803.1"
                     /db_xref="GeneID:34716945"
                     /translation="MINDILKPVFAVGGIYCSFLTWALLQEPLNTKVWPNSGCTFQLP
                     CIVALTQACVAMVCGLLYLRQKRPVYTLSSFWKDHYKDMMMISLSQAVAAPLASYSLS
                     YVDFLTYMLAKSCKLLPVLMVHLVIYRTPIPRTKKLVAVIVTLGITIFTLDGKKTGAK
                     KDEESKSVLGFVLLGMSLFLDGLTNAKQDKLFQNAKQKISGAHLMFALNLFLIMWNAL
                     YMLLWDRNQLSKGVQMLHADPQIGRYLLAYACCGAVGQCFIFYTLEKYGSLVLVMVTV
                     TRKMVSMLLSIVVYGHSVSVQQWVGILIVFVGVVCEATAKKGKGKQKNVTASKPKAS"
     gene            <732100..>733866
                     /gene="SRP68"
                     /locus_tag="KLMA_50340"
                     /db_xref="GeneID:34716946"
     mRNA            <732100..>733866
                     /gene="SRP68"
                     /locus_tag="KLMA_50340"
                     /product="signal recognition particle subunit SRP68"
                     /transcript_id="XM_022820330.1"
                     /db_xref="GeneID:34716946"
     CDS             732100..733866
                     /gene="SRP68"
                     /locus_tag="KLMA_50340"
                     /codon_start=1
                     /product="signal recognition particle subunit SRP68"
                     /protein_id="XP_022676804.1"
                     /db_xref="GeneID:34716946"
                     /translation="MVYSPLGVTYGFRSDLMLESFADYQKYHKKVNHKLQQLRGRLRL
                     ISKDTKNYKGQEKLLKVGPEDYQRNRLYGFLMLLLAERDMAYVESLKAGGRSRGFLRS
                     SELKLMRARIKKAIKYCNRLESLAQVEDEDEDKNKWHIRAEIMIYEKLLRTEYELYGK
                     KQVKYADAEKISAHLSLALCGVNFLVESKLLKEDVAEAIKSKYLYIFKEKANAFSSRD
                     QQLRFANAISENSDDALLELLQAHGFTFSVPETESTKSQSRKISWRSYSATIEDGKVF
                     EVYSDLEDLKGSNKLSNLNDKLLKWNKAIDLQKEYMATLEENTENNQILLTYLQYNAM
                     LTSVERDNSLFDSLLAQWDRSANKSFTSRLNKYKEVDHIMKNLKSLLTQLMDLPGVYS
                     DNDLTNQIFLLKTYYETSFASKLLADIYQSKKRYVESLAIHNNGLKLIENAEESLINW
                     DEISLPAVLLSKKKIDSLKEFISTKWRSVIALAEHEKALEVPKKSLKFAPSLVDIIDT
                     NISPKEVSLDNIFSLRPRLLPVPPKAFVYDLAYNYFSFADETPSFSDYSASSTEPATP
                     KHDEPQGEQKRTKKGLFGLFGG"
     gene            <734198..>735580
                     /locus_tag="KLMA_50341"
                     /db_xref="GeneID:34716947"
     mRNA            <734198..>735580
                     /locus_tag="KLMA_50341"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820331.1"
                     /db_xref="GeneID:34716947"
     CDS             734198..735580
                     /locus_tag="KLMA_50341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676805.1"
                     /db_xref="GeneID:34716947"
                     /translation="MQLRVLFDKLLKKQYVCWVCLDSECDKDEWIVHECGCNLQVHRK
                     CLIGWIFDLNKSKLGSYYTYDTYKINTAEEVSRRMCYLIDKHRDMGREVGFAETVQMI
                     PVVGQTWASFICVGDLMFRAFARLSAPDSSFSYDDLWRGLPQDIPPCPQCKQKLLKTT
                     SALQYRSKSVILSLFALGRNVTRYTATLLTLHSYFFNPVKSLFKVGLWQLRTLFSESS
                     LRKLLDISNTKALDVYADSFKGLLSLSSHKLCSIIGFPIYLFMVNGNGNMPIIIKIGF
                     PYFFLQYAQGQRLLRNSITCHSIALGLHNLLVRPLINKIHNVWIQETKPYFLSKQILQ
                     QSRPSEDSTGSLIQGNVEASDLIIRSQWYDSLVAALAWPFICKWLGQKLFAYCPQINA
                     WLLNKYPNSTPDECTMAHSLICSVILYISYGFVKLGITYLRMKEIKEVQSIVRLSNEP
                     QAEPDATIIE"
     gene            complement(<735690..>740162)
                     /gene="IQG1"
                     /locus_tag="KLMA_50342"
                     /db_xref="GeneID:34716948"
     mRNA            complement(<735690..>740162)
                     /gene="IQG1"
                     /locus_tag="KLMA_50342"
                     /product="ras GTPase-activating-like protein IQG1"
                     /transcript_id="XM_022820332.1"
                     /db_xref="GeneID:34716948"
     CDS             complement(735690..740162)
                     /gene="IQG1"
                     /locus_tag="KLMA_50342"
                     /codon_start=1
                     /product="ras GTPase-activating-like protein IQG1"
                     /protein_id="XP_022676806.1"
                     /db_xref="GeneID:34716948"
                     /translation="MATLSGSPGKAGLINSRMQEYMKNLNKDSQPVLKQISPSKMNSN
                     SNLNGILEGKKPSPMSSPSRFMGKENSPTKPLQFKTSDKDVASHNSSPFLSPSSSKLS
                     PKDRDYQEFLIRVEEAKRWIEAIIEESLPSAIDMATTKCMSDGVYLAQLVAKVKPELV
                     KKIIPPGNKLMYAHTQNINAFLDLVDYVNVPDLFRFELNDLYDRKNIPKVFETIHATA
                     SILGTQYGSVIPPMQNLSGQVNISMEDVKTCQRKLPGVRAFRSFNEFTSRPSSPKKSS
                     PQKGLLDSAVPLTPTKPSKPQKSIEIQEPIELKSPPKTPNRYPSAIVHDIQDFSLKDI
                     ETKTPHLSYDSLSSPQRLTYSPDRTFSYYSPGVSRQLSYRTEDIGYFNRRRHQWDYDF
                     DYYDTYRYSSSQYSPKRKERMTEVEFLDTLTHLQAVLRGLNTRYDIHLKKLTLKHKAT
                     NFPEFQAHCKAVAVRKAFETLKTKYQPDESLPGLQAILRGTVIRNELYQFRLRIIKKE
                     QLLWKLRSHLRGVAQRKLTKNKLQYREAHGNNITSLQAIIRAIIKRREVTAYSSFVNR
                     HSKEVIKLQAISRGKVMRLNMIQAQGSTLQIQLQALLRAVVQRNKIKTYAAVRESTGF
                     QRFGPILKGYLVSNRYTVAPTKVTNEVVTFNAIIKGMLTRFAMELLIDIVENNGAYEF
                     QANVRGYLVRKHLADKMNFYEQNKKAVILIQKNIKRYQVERAYKELISATCPSLSSVR
                     RFVHILNQSDTEVFSMQLQKLKSKINDINEEIGEVESSLQQKTLQKDCLESRGIDVSK
                     FLTIAGRQQLELHFQSVNTEGVSKKLQSVYGKVGFLLQVDSYYWKMLSKKDPNFCLSN
                     IPKIYAPIRGNINERENSLYVKVIGDLMSEDIDESPTLDAFLTEENSFWGKALQEYLI
                     NFRNKEVQLAFSQLYKYLDSEMVDFESDPSILYSKLHPSQPPQSPQFAIEDPQTNSQF
                     IKNMTSLWAAVDMTCAIIQNLSSTRNELRYLATKVCRLAANKDSHEKSTLQAISKLLI
                     DIVASTVLLQRENFGSVAPGPGYYKKAQILLDTLNVAFGFREFEGYFSPLNQYSTHSE
                     DQFTETLKGLLVDPEEVNEYETIVYRDMADSVKPTMMVYHQTFIKIIEKLRSVKEELP
                     HDDPMVLLLDEIRQEFDKTSVNGHTQLTINLDPSVFKVTLNNGRTDLIYKEAKQGICY
                     LMQVEEVNTNLTDLLVSEILPEDEIAFESLLAENPNIANTLSDDTGTISYTEFKKSLL
                     YRVKELAALGILQKENNYQFILVDIANTIKTRPRIEELNCKEMKLMTAVYNALTEKQR
                     NLILLVDALDKATRKAIEAIQAQRSYTPLKKSGLGNKLKDAYHKTQKKNTDSNSGISY
                     KWSSKQLFDQGILVRTSGSSLQSSSVNFFGSTGPKAPAIDFKISTTDGEVFGIEMIDI
                     KNRTLDMHAVVRFTDLIAKESIDSKATISLFEKKNKTVMRVSKLLDLLVHSFFR"
     gene            complement(<740480..>741462)
                     /locus_tag="KLMA_50343"
                     /db_xref="GeneID:34716949"
     mRNA            complement(join(<740480..741267,741372..>741462))
                     /locus_tag="KLMA_50343"
                     /product="tubulin-specific chaperone C"
                     /transcript_id="XM_022820333.1"
                     /db_xref="GeneID:34716949"
     CDS             complement(join(740480..741267,741372..741462))
                     /locus_tag="KLMA_50343"
                     /codon_start=1
                     /product="tubulin-specific chaperone C"
                     /protein_id="XP_022676807.1"
                     /db_xref="GeneID:34716949"
                     /translation="MRRMTLLSSIKSDGTLNANDLSSEFNLIYQNLEANVNSGHNLDQ
                     CKDDIISLSKQLTSVSSLLSRFDQELYSTKIDQLLKKITTKQLTLAKEDRRSRWKSMG
                     LRAKHTASPPVSSDRKVVASPTTEKTVDPKPEIKDTDIKYQISTKSYQNLNNCKLSWT
                     GDDILQEYATLQVQNVKKSTIYFNIVPFNQGSLLLEGFQDSYVIIITPEKSNLQLRLH
                     KMDNCKLYIKRQAGSEVQDVVIEDFSHCVFHKDTKDYVRIHNFNQLTYQNKESNDGYT
                     FVEFEVQEPLEPLSAS"
     gene            complement(<741879..>744020)
                     /gene="HSP82"
                     /locus_tag="KLMA_50344"
                     /db_xref="GeneID:34716950"
     mRNA            complement(<741879..>744020)
                     /gene="HSP82"
                     /locus_tag="KLMA_50344"
                     /product="ATP-dependent molecular chaperone HSC82"
                     /transcript_id="XM_022820334.1"
                     /db_xref="GeneID:34716950"
     CDS             complement(741879..744020)
                     /gene="HSP82"
                     /locus_tag="KLMA_50344"
                     /codon_start=1
                     /product="ATP-dependent molecular chaperone HSC82"
                     /protein_id="XP_022676808.1"
                     /db_xref="GeneID:34716950"
                     /translation="MVNQETYEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALD
                     KIRYQSLSDPKVLETEPELFIRITPKPEEKVLEIRDSGIGMTKAELINNLGTIAKSGT
                     KAFMEALSAGADVSMIGQFGVGFYSLFLVADKVQVISKNNDDEQYIWESNAGGSFTVT
                     LDETNERIGRGTILRLFLKEDQLEYLEEKRIKDVVKKHSEFVAYPIQLMVTKEVEKDV
                     PVAAEEEEKKDEEKEEDDKKPKLEEVDEEEEEKKKDEAKTKKVKETVKELEELNKTKP
                     LWTKNPSEVTQEEYNAFYKSISNDWEDPLAVKHFSVEGQLEFKAILFVPKRAPFDLFE
                     SKKKKTNIKLYVRRVFITDEAEELIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKV
                     IKKNIVKKLIETFNEIAEDSEQFDKFYTAFSKNIKLGIHEDTQNRAALAKLLRYNSTK
                     SVDELTSLSDYVTRMPEHQKNIYFITGESIKAVEKSPFLDALKAKNFEVLFLVDPIDE
                     YAFSQLKEFEGKQLVDITKDFELEETEEEKEQREKEIKEYEGLTKALKDILGDQVEKV
                     VVSHKLVDAPAAIRTGQFGWSANMERIMKAQALRDSTMSSYMASKKIFEISPKSPIIK
                     ELKKRVEEGGADNKTVKDLTNLLYETALLTSGFSLEEPASFASRINRLISLGLNIDED
                     EAASEDAAAPEAAPEAPAEEISAETEMEEVD"
     gene            <744458..>745588
                     /gene="ASP1"
                     /locus_tag="KLMA_50345"
                     /db_xref="GeneID:34716951"
     mRNA            <744458..>745588
                     /gene="ASP1"
                     /locus_tag="KLMA_50345"
                     /product="L-asparaginase 1"
                     /transcript_id="XM_022820335.1"
                     /db_xref="GeneID:34716951"
     CDS             744458..745588
                     /gene="ASP1"
                     /locus_tag="KLMA_50345"
                     /codon_start=1
                     /product="L-asparaginase 1"
                     /protein_id="XP_022676809.1"
                     /db_xref="GeneID:34716951"
                     /translation="MPNENIEVRTLNSDAELPQFALHAAVNSEGVAKEEGTGPGQGAL
                     PRHLPRVKILGTGGTIASKGSKSSDTAGYRVDLTIDELLEAIPDIKDVCEIEYEQLCN
                     LDSKEIGVDELWKIYRGVCESLQRFDGIVITHGTDTLAETTFFIESTIDAGQVPIVFV
                     GSMRPSTSISADGPMNLYQAICIAANKESRGRGVLISLNDQISAGYYITKTNANTLDS
                     FNVRQGYLGNFVNNEIHYYYPPVKPLGCHKFKLDVGEELRLPSVCILYAHQSFSPELV
                     ELVAQQYEGIVIATMGAGSLSSEVNETCKKLRLPIVYSKRSMDGMVPVANLPIEPSNP
                     ASTIIASGYLNPEKSRILLQLCLKQKYSIPKIRTVFQGVYGG"
     gene            <746073..>747119
                     /locus_tag="KLMA_50346"
                     /db_xref="GeneID:34716952"
     mRNA            <746073..>747119
                     /locus_tag="KLMA_50346"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820336.1"
                     /db_xref="GeneID:34716952"
     CDS             746073..747119
                     /locus_tag="KLMA_50346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676810.1"
                     /db_xref="GeneID:34716952"
                     /translation="MSNPLQVIDISGPQEKTAADLLKAATEQGFLFVDGHDFTQQEVN
                     QLFDLSKDFFTGTEHSEKKKYAIKSNNIGYTDFSNEQLDPRKARDFKEGYNFGYINFK
                     TGEYNLSEDYYYKRTETNDPSENPVPELFKQNEPLVVSTMQKLHNTAREILRLITIAL
                     EIEDEEFFTKRHDQEEPSGTVFRMLRYPLIREDDLDSTGNGTFDPTIRAGAHTDYGAL
                     TLLFQREGQQGLELQMDKDKDSDDSWVKVPYVASKHEGKAPPLVVNFGDLLSYWTSGV
                     LRSTVHRVKFSPGETRTSDRYSIVFFVHPSNKTTLDPVPSELVKKAGKGVTPPAITAL
                     DHLKQRLEETYNWK"
     gene            <747501..>749642
                     /gene="QNS1"
                     /locus_tag="KLMA_50347"
                     /db_xref="GeneID:34716953"
     mRNA            <747501..>749642
                     /gene="QNS1"
                     /locus_tag="KLMA_50347"
                     /product="glutamine-dependent NAD(+) synthetase"
                     /transcript_id="XM_022820337.1"
                     /db_xref="GeneID:34716953"
     CDS             747501..749642
                     /gene="QNS1"
                     /locus_tag="KLMA_50347"
                     /codon_start=1
                     /product="glutamine-dependent NAD(+) synthetase"
                     /protein_id="XP_022676811.1"
                     /db_xref="GeneID:34716953"
                     /translation="MSQLITVATCNLNQWALDFEGNRDRILESIRIAKERGAKLRVGP
                     ELEITGYGCLDHFLEDDVLLHSWEMYGQIIGRPETHGILLDIGMPVMHRNVRYNCRLL
                     SLDGKILFIRPKAWLANDGNYREMRFFTPWVKPAQTEEFLLPPMIQKLTGQFRIPFGD
                     AVISTLDTCIGAETCEELFTPQSPHIAMSLDGVEIFTNSSGSHHELRKLDKRLDLIMS
                     ATRRCGGVYLYANQRGCDGDRLYYDGCALICVNGKIVAQGSQFCLKDVEVVTATVDLE
                     SVRNYRSTVMSRGLQASLSETKYKRIDVEVQLATMRDRFNSAVVPTEARDVFYHIPQE
                     EIALGPACWLWDYLRRCNGTGYFLPLSGGIDSCATAMIVHSMCRLVVQEANAGNEQVI
                     KDARNIARMGDDWIPSSPQELAGKIFHTCFMGTENSSTETRSRAKQLAKDIGAYHVDL
                     NMDSLVSSVVTLFEVTTGKRPIFKIFGGSQIENLALQNIQARLRMVIAYLFAQLLPWV
                     RSIPNSGGLLVLGSANVDECLRGYLTKYDCSSADINPIGGISKTDLKKFIAYASKEYE
                     LPILDEFLNATPTAELEPITKDYVQSDEIDMGMTYEELSVFGRLRKVEKYGPFSMFLK
                     LLHEWTPRLTPAQVAEKVKRFFFFYAINRHKQTVLTPSYHAEQYSPDDNRFDLRPFLI
                     NPRFPWAFKKIDEVVAQCEGKIDALDVMTVE"
     gene            complement(<749754..>750938)
                     /gene="PPE1"
                     /locus_tag="KLMA_50348"
                     /db_xref="GeneID:34716954"
     mRNA            complement(<749754..>750938)
                     /gene="PPE1"
                     /locus_tag="KLMA_50348"
                     /product="protein phosphatase methylesterase 1"
                     /transcript_id="XM_022820338.1"
                     /db_xref="GeneID:34716954"
     CDS             complement(749754..750938)
                     /gene="PPE1"
                     /locus_tag="KLMA_50348"
                     /codon_start=1
                     /product="protein phosphatase methylesterase 1"
                     /protein_id="XP_022676812.1"
                     /db_xref="GeneID:34716954"
                     /translation="MSEDIQRQALLKNFQKAGKMLKINESDLEEDQLGELPSITNSTR
                     GNSSALKSKDSENNSGINERTQEEKNIPNWSNFFTNNETVTIPGRNFTFNTYFKVPKD
                     LNADLKSIPIFLAHHGAGSTGLSFAPLAKTLEEELGSSFGFFSFDARGHGQSKPLDPS
                     AVSYYLDDFIMDFVELIVWYNEKYLKSFDQSKLSLVLVGHSLGGSVCTNTFEHLPEYI
                     RKKTIGVAMLDIVEEMAKFVLTKVDHFLAITPNVFGSVSEAIDWYQSHNYSKVKESAE
                     ISVPALFHKTKSGKIVRITNLASFKPYWDSWFNGLSAKFVSLPTSKLLILAGNDNLDK
                     ELIVGQMQGKYQLIVFQDSGHFIQEDVPRKCAISLVDFWRRSDNKNVAVKSNWGAASK
                     NP"
     gene            complement(<751296..>753944)
                     /gene="APE2"
                     /locus_tag="KLMA_50349"
                     /db_xref="GeneID:34716955"
     mRNA            complement(<751296..>753944)
                     /gene="APE2"
                     /locus_tag="KLMA_50349"
                     /product="aminopeptidase 2"
                     /transcript_id="XM_022820339.1"
                     /db_xref="GeneID:34716955"
     CDS             complement(751296..753944)
                     /gene="APE2"
                     /locus_tag="KLMA_50349"
                     /codon_start=1
                     /product="aminopeptidase 2"
                     /protein_id="XP_022676813.1"
                     /db_xref="GeneID:34716955"
                     /translation="MSQEQAQVQAQTLPTDFRASHYEVELSELDTDKNTFIGCVSIHI
                     KTNKPSDTISLNMRDIEIVSAVVERENNALLEMQDKTVDAENDVVSLKFSEVISVPTF
                     TLKINYKGIIQTNMSGFYRSDYTDVATGEKKAMFSTQFEATDARRAFPCFDEPSLKAT
                     FDICIIAHEKYTVLANMPLKSSKKLQESDQISYRFHTTPLMSTYLVAWAIGEFDYIES
                     ETEKDIYPTIDNYNTQDGSSSTHGKLPIKVYTAKGKANQGQFALSVAKKVIDFFSESF
                     EIPYPLPKLDLLCVESYSHNAMENFSLITFRPSALLYDGDLAEADAAALQKIAYVVSH
                     EIAHQWFGNLVTMKWWDELWLNEGFATWIGYLAVEKFFPNWDVPSMVMLQSHEVALEL
                     DSLKESHPIKVAVRNAKDIDQVFDSISYLKGCSILEMVGGFLGQDVFLKGVALYLKRH
                     KFSNATMEDLFNCIGEYSGVEVLERCKNWILTIGYPVVTVSESEDPEKLTLTQERFLS
                     GGKPKPEENTTKWWIPLMPSEGDFKIDFSEEITQVPKSAFNHFNSDALGFYRVKYNGE
                     NLFKALLSNLEKLSSRGKMGLVSDLEVTGSVQDLLTLISEFSKTQEPQEYYVWSIIFE
                     SLKRMKSLLSSDATVKQALNDFTLELIKPSEEKLLEYLDQHKTNSFNKSPESFLSNQF
                     FELLALVAGGASHPETVSKCREMYASKSYSPAFRNVLLQIVLCQPDTTKEVVESVLKE
                     LETATLTYKESLLTALGGVQNEELFDTVLNLLLTIEPMDVQFLADALGSNVSIRSKLW
                     AFIKANYTELHKRLAINTIVIDRFLRFSMKDLMGEDVKKEFEQFFADKNLEGFDRGVR
                     QTLERIEKNTRYLKTNQSLVKEYFKL"
     gene            <755238..>756338
                     /gene="MRPL35"
                     /locus_tag="KLMA_50350"
                     /db_xref="GeneID:34716956"
     mRNA            <755238..>756338
                     /gene="MRPL35"
                     /locus_tag="KLMA_50350"
                     /product="54S ribosomal protein L35"
                     /transcript_id="XM_022820341.1"
                     /db_xref="GeneID:34716956"
     CDS             755238..756338
                     /gene="MRPL35"
                     /locus_tag="KLMA_50350"
                     /codon_start=1
                     /product="54S ribosomal protein L35"
                     /protein_id="XP_022676814.1"
                     /db_xref="GeneID:34716956"
                     /translation="MFQRGFHQSVKSLERTVVWKDFSKRSPSLSIASESVKKYIFEGG
                     KSEDGKVMGPPSLKRRFNRVKYRSPEHIDEMFQLSYEFMSKRAAEIYAKLEKESDGLV
                     RSQLEVEAEKHNPEVQYNFQYHDKLENDRRVIDYDVAVYRHLGLKHWESYGQMLLMQR
                     LESLGVIPDTMATLAPKAEVNLRFPFSTGVNKWIEPGEVLSSSVTSMVPTIKIQEYEH
                     NIDFSKQRYTVLIVNPDEPDLINDSFKTTLTFGLSNLKIDYNDNVVDPRKYDDSQVIA
                     SYVPPVPEKNAGKQRFAVWVFRQNGELSVPAMSPADRDYFDIRSFAAEHKLEPVGAHV
                     WRSEWDSNVAAVREKYGLPEGRVFTRVRRTTV"
     gene            complement(<756517..>756798)
                     /gene="TIM11"
                     /locus_tag="KLMA_50351"
                     /db_xref="GeneID:34716957"
     mRNA            complement(<756517..>756798)
                     /gene="TIM11"
                     /locus_tag="KLMA_50351"
                     /product="ATP synthase subunit e"
                     /transcript_id="XM_022820342.1"
                     /db_xref="GeneID:34716957"
     CDS             complement(756517..756798)
                     /gene="TIM11"
                     /locus_tag="KLMA_50351"
                     /codon_start=1
                     /product="ATP synthase subunit e"
                     /protein_id="XP_022676815.1"
                     /db_xref="GeneID:34716957"
                     /translation="MSTVNVLRYSALALGVAVGLKTDLSLKSAAEKEHEKNELEAQLK
                     LVEKAKAEYAKLHPVKKETAAASSTKIDLEDPNLDYAAVILNAVESLKQ"
     gene            <757546..>758592
                     /gene="PTC7"
                     /locus_tag="KLMA_50352"
                     /db_xref="GeneID:34716958"
     mRNA            <757546..>758592
                     /gene="PTC7"
                     /locus_tag="KLMA_50352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820343.1"
                     /db_xref="GeneID:34716958"
     CDS             757546..758592
                     /gene="PTC7"
                     /locus_tag="KLMA_50352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676816.1"
                     /db_xref="GeneID:34716958"
                     /translation="MFVGIRQNAPRALFRSKFPVLVAFLIYVLLTYFGIDYKTLSYRY
                     FSSSAGSNGSNSWSSSSSSYPAASDGLNYNVAVAYQAKDRNEPIYAKLKASLESPTGE
                     DNYFVASRASSDIYAGVADGVGGWANHGYDSSAISRELCNAMKDIALGSGKNIPPKEL
                     LSMAYRTISDEGKVKVGGTTAIVAHLHPNGQLNVANLGDSWCGVFRDSKIAFQTEFQT
                     VGFNAPYQLAIIPQKILDDASRNGGSFIMNKPSDADEYSFQLKKNDVVVLATDGVTDN
                     IAVEDMELFLKDRMETDTPLQDITQEFVSKVVTLSKDPTFPSVFSQEYSKLAGQDYLG
                     GKEDDITVVVIRVT"
     gene            complement(<758730..>761918)
                     /gene="NMD2"
                     /locus_tag="KLMA_50353"
                     /db_xref="GeneID:34716959"
     mRNA            complement(<758730..>761918)
                     /gene="NMD2"
                     /locus_tag="KLMA_50353"
                     /product="nonsense-mediated mRNA decay protein 2"
                     /transcript_id="XM_022820344.1"
                     /db_xref="GeneID:34716959"
     CDS             complement(758730..761918)
                     /gene="NMD2"
                     /locus_tag="KLMA_50353"
                     /codon_start=1
                     /product="nonsense-mediated mRNA decay protein 2"
                     /protein_id="XP_022676817.1"
                     /db_xref="GeneID:34716959"
                     /translation="MNNEWRLELNKLNSAAWSGIDVFPNKASKLDSSIKRNTGFIKKL
                     KQGITKDSKGSLITDIAEVSLEKYLSEIISTTNESLLKNSGKTDDIIAAVEVISGLHQ
                     RFNSEFTIPLIECFLFVFESSTEEIDSEKDRIARVNVLKNSVRILIELQLTGILPNVE
                     DLNKSKLPSFIANRYAKKEPILFVVLREVLNYKFKEAFTTPVATLIAKRYPQLLSDGE
                     TEFDSLIVNLNLKTLLRSLFKIYTDIVFQQVVDSNKKAVKLMKEHQKAQIRTGKESSE
                     YLDSYNEVNPIFERFSAAAVGLAEVFDLTPPEIIDIEEVVQEQQPSVILNEGKEGQQK
                     IWENEETRRFYESLADLSEVHSQFNPDTVPNPEDVNAFFTSLETIETAEQVDEISRNY
                     WAQNLDNRATRKRLMRFFIECKDWSKIALYARFIANNAEYLEEVKNELVNHFDTGLKF
                     QIHNEKMNVKNIIFFAELVKFMLVPGFMIFHKIRSLAVHITVPNNIEILTALFENLGK
                     FLINKPEFRPQMEKMMALIQEKKKDHLLTISNKAALDNLIILIYPPKLNALNQEKLEL
                     TPEQHFYKILIRRELGNVSLNTAYKLILKASWKDEKIQKTLFSVFSKPEKVSYQSLPK
                     LANMLTYLFKYYKPFTVRVVDTLLDKIYVGLESGGYNLNMARVAQVKYLTELYNTSFI
                     KFDVLLDTMYKILRFGYPGGQPNPFFINEGDLPDNYFRISLISTILLGMERKSETATK
                     KLNIFIQFFEYYILCKDQPLPKEVSFKTDNVFALFPDFKRSINWQSSYENLIALLKEL
                     GINSTKSMEGNDNEGEDEEEEEEDDEDEEGTSEPAGILDEIEQENQLAEDIDALSLSD
                     GSSSDFSSDSDNISADEVDEGEGEEEEEEDDDEDEDEDEDEDEDEDEDEDEDEDDEDD
                     EDEEEDEDDDDDDDDFLIDREKERKRIMEEFEKKLQDDNELKAQAALDKQFQQMMDES
                     LGSIKNETVPTVSIPKHFSIQVSNTSPATNKPKGGKIPFTFLSRSGKKTQAHAINVPS
                     DTKFATEILEEEQRLIEERQKIKSIVMNRNFD"
     gene            complement(<762264..>763871)
                     /gene="PEP7"
                     /locus_tag="KLMA_50354"
                     /db_xref="GeneID:34716960"
     mRNA            complement(<762264..>763871)
                     /gene="PEP7"
                     /locus_tag="KLMA_50354"
                     /product="vacuolar segregation protein PEP7"
                     /transcript_id="XM_022820345.1"
                     /db_xref="GeneID:34716960"
     CDS             complement(762264..763871)
                     /gene="PEP7"
                     /locus_tag="KLMA_50354"
                     /codon_start=1
                     /product="vacuolar segregation protein PEP7"
                     /protein_id="XP_022676818.1"
                     /db_xref="GeneID:34716960"
                     /translation="MTEGNGRSLGSEASLGQEITDTDVLNCPVCGDELKSLRKLNAHL
                     DTVHGFNDGSPSDTDVDSSRESSVIGLNTLEQSVADKSDSAKPRDVQYKGRYKIKTSH
                     WKKPVDGKYHCFQCNCKITGKTGAINCRKCGEIFCLKHCRNVIKLNENSEYDPIKGMW
                     CKCCRRCFTSREGYNDFGYYRNITEDFLGIRKLKNEDGDLIALQLENRLLNLINGIIK
                     IYLRHMSSIIGSMMIRREVHALERSIVEWKDDRSVSECSICSNSFQMLMRKHHCRLCG
                     QVVCDRVATRCSSDIPVLNLMSAAPDLSFESIANIRDISQFTTCVRVCSLCLRSVYAK
                     RKLEFQKQSPLPSILQEYENLHNLEVLVTKLLPHFNECVNKIHENTTPDEKLVQDLAQ
                     LRRKLLQNLTLYDKISKKLIHMDVHSQAELKIQQSIASHASTFIEEKMLPLKRIPNVF
                     TPASEEIKVTSSSDLLFNNLTIAEVKRYREELMVLKEQRYLVETMLNSAAKERRFEEA
                     ITLKSNLAEIDKNVENLESRLGQEGFD"
     gene            <764138..>765700
                     /locus_tag="KLMA_50355"
                     /db_xref="GeneID:34716961"
     mRNA            <764138..>765700
                     /locus_tag="KLMA_50355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820346.1"
                     /db_xref="GeneID:34716961"
     CDS             764138..765700
                     /locus_tag="KLMA_50355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676819.1"
                     /db_xref="GeneID:34716961"
                     /translation="MFMLIVCVLSFWLVFDRSYKVLWFKVQQVFNVLPKYTDSTSQSL
                     TFGSASISSADSGSEDGFLYKFYSEYSISSRRIYEIVRIIFCVTCSCYVIAIEIVLWQ
                     IKVADSGEQTSVLTSVLWPVVLSLLSVSLILVQPFLILTFLLNKFFGDKMGVNKLVAT
                     SVFSTIIWLGLLHFLAVGPFNYTSNLLTKLSVVGVTVMGILSGLASISTPYYVVQYLL
                     NRNDKDSRYAAHSKVTNLLYNENVIRDKIREYETCINKDISALNGADISKQERLREGI
                     AWYQLELVKLNGKLHESREFRMLKQMFQLVFLVYCVYKLTSIWFVSVPRLILHFINYP
                     TDYSYEYFDNDSKKKDPLAISLANMLDFFLFRFQHQTDLDSLVKQISLLLSISLFICS
                     LSTVTTTISYLLTLLPVKLQILALRTMQNSEAPSSLPKTTKDMYDKKKPPSIIKNLAV
                     CELTGIYILATILLIRSNLPYDVSSKVNQLLGERFTIPNVIIDVWSDKMFAWSSMLTF
                     IGIIVADRTLYK"
     gene            complement(<765784..>767994)
                     /gene="UTP4"
                     /locus_tag="KLMA_50356"
                     /db_xref="GeneID:34716962"
     mRNA            complement(<765784..>767994)
                     /gene="UTP4"
                     /locus_tag="KLMA_50356"
                     /product="U3 small nucleolar RNA-associated protein 4"
                     /transcript_id="XM_022820347.1"
                     /db_xref="GeneID:34716962"
     CDS             complement(765784..767994)
                     /gene="UTP4"
                     /locus_tag="KLMA_50356"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 4"
                     /protein_id="XP_022676820.1"
                     /db_xref="GeneID:34716962"
                     /translation="MIETGKKQVVHRSRFVKLTPGNITALAFSHPSTDKVAPAELRLA
                     VGRSNGDIEIWNPRDDWVQENVILGGEGRSIEGLAWCSVAGEPLRLFSIGGSTVVTEW
                     DLTTGLPLVNYDCNSGVIWSIAMSNDMTKLAVGCDNGSVVLINISGGKGVLEHESILT
                     RQESRILSLTWTANDESLVAGCSDGRIRIWCTKAEDPNKGRVLHTMKVDKSKKESTLV
                     WSVLYLAKQNQIVSGDSTGCIKFWDLNYATLTQSFKVHDADVLCLATDLNNTHLFTSG
                     VDRKIFQFSYIDTGKTMKWISTSNRLFHSNDVRSMCSYQCKGSDFLVSGGIEKSLVMC
                     SMSSFADGNYRKMPVVTPFHKNIIVNKQQRLLIMWQDNIVRIWYVGEDVNEVKNYKLV
                     SKLVLKDEQHIQTCALSTDGQVLLVGRLSTTKVFHLQPSESKLNVTKLDNEFLLRTGC
                     KFAKFIDDSKFIMCSQNDEIIRVDLEEDDDEKVVTIELPESPATKSSSKLTYLNTVNH
                     LDVHGGYAVVSRGTGALDAIDLETNVSKVLIRMNNFITALCITPRTTVVVVTSENKIY
                     EFNLNSEKDQLLTEWFKANHENLPQQFNTLKGRCTGVFSDELNKDKVWFWGTDWLVNI
                     DMSLDLPVSKRKKQKKRGRDGLTISTDPSQIDGEEEDEEDEELEVKEDYLLKTQKAQY
                     VSSKKRSDKAFFYTDRYRPMLFAGKIADDEIIIVERPNFLISQQPAFELEKLVF"
     gene            <768407..>771454
                     /gene="YCG1"
                     /locus_tag="KLMA_50357"
                     /db_xref="GeneID:34716963"
     mRNA            <768407..>771454
                     /gene="YCG1"
                     /locus_tag="KLMA_50357"
                     /product="condensin complex subunit 3"
                     /transcript_id="XM_022820348.1"
                     /db_xref="GeneID:34716963"
     CDS             768407..771454
                     /gene="YCG1"
                     /locus_tag="KLMA_50357"
                     /codon_start=1
                     /product="condensin complex subunit 3"
                     /protein_id="XP_022676821.1"
                     /db_xref="GeneID:34716963"
                     /translation="MSIEGSSRPESIQKDQEGQSSTNNRVLNAIAEVFQTAQRSYVGH
                     RRHVAVLYKIYLKCIEQGLLDVFQYWFVKMTVKILPLKKQEIVGDRIVRLISGFIASV
                     ESNITKMKSGNVSESDSSVDVKALEEHFGQFVDGFIRHLLRGVESKNKNVRYRVMQLL
                     AATVDNMGEIDEDLYELLLWILKHRIYDKEPQVRIQAIFCLTKFQNDNVSLTNESTEM
                     DEAMQNLLSVIRNDPSAEVRRAAMLNIVRSKPTQNVILERARDVNFINRRLIYSRVLK
                     SLGKDVFNEVESDVLDRLLTWGFEDRDETVSTSCKKLVAFTWLNVLEGDIIELLERID
                     VMHSSYSEKALYALFEQRPDVIEKVKFPNEVWESLTVETVFLLKCFYFHCLDNNLEAV
                     VEENFPEALKFAEYLAVYFNRRMNNDGSLTKTDIKYLDFILEQLLEIAYRYDFSDEVG
                     RRDMLNIVRNFIGKGVVLNERLIKIALKVLKILSINERDFITMTVEIINDIKYEDIER
                     QELEESKRREKNGKEKGNDTDKDLDDEDMADNAALESFHSAVDNLVSGKPPQSSSSNR
                     SNDRDTNNDNDADDEDEHQVSPQTLITCLTMSRHLLEQINSSLEENIILSSLIDTLIT
                     PAVRNPQPEIRELGVRCLGLCCLLDLQLATESMYILGMCVSKGNSSLKYIALQVIVDI
                     FSVHGTKVVDGEGKVDSISLHKIFYKILKTNDLPECQAIAAEGLCKLFLGDIFTDDDL
                     FETLVLSYFSPVNSKNEALIQAFAFCLPVYCLSHINHQTRMSRIAADVLLRLTMLWDE
                     LQNSDSTDASEKESMLKPNEIFHQLIYWCDPRCLVNSKDEEVESNTSQIDFLIDVLTV
                     FERFERKDVKKMLLMNIQKFNLTPRQPKAKLLKIKQLLEEIMEYSAIDKLCKNAVANF
                     MANLYSTLSAYDEDSQEISETQDTINTTVGHDPAQITTSDVSKLTSNSDTKESISFVD
                     ESRESRGTKRIRESDSSSISDSSLSVANTLEGSKSVSFSVSEQ"
     gene            complement(<771517..>774933)
                     /gene="IRE1"
                     /locus_tag="KLMA_50358"
                     /db_xref="GeneID:34716964"
     mRNA            complement(<771517..>774933)
                     /gene="IRE1"
                     /locus_tag="KLMA_50358"
                     /product="serine/threonine-protein kinase/endoribonuclease
                     IRE1"
                     /transcript_id="XM_022820349.1"
                     /db_xref="GeneID:34716964"
     CDS             complement(771517..774933)
                     /gene="IRE1"
                     /locus_tag="KLMA_50358"
                     /codon_start=1
                     /product="serine/threonine-protein kinase/endoribonuclease
                     IRE1"
                     /protein_id="XP_022676822.1"
                     /db_xref="GeneID:34716964"
                     /translation="MLAMRKSWLDSLLRIVCFTLFLALVRGSLWERNRVSDQSISSVT
                     GVPVLDHRPVVRQRPSSVTKVASAKLYRKPASTTSTIQEVNEKLTRKNNVKVTPVGWL
                     GASRHHSEHAETQEQSNSLISISGNIRDLSTLTLSDILIATDIEGGLHGIHRTTGKVL
                     WSIDHPELPPLLEIRHPSSVINETLIVEPFGDGNVFYFNPYQGLQKLPVTIKHLIEAS
                     PLSIKSKVVIDDIGTTIEDEKIYTGSRRTDLYTIDATSGEIISAFGPGTENKVYNKEK
                     VDCTDYIGTQDCENIVVIGKTNYELTIHSNEQTLYNVRYSQWQHNTLVNHLANQNTVS
                     KDGIYIAPFRDKSLVAIDSDFNLAKWVCPNLPAIVNNVFDIFIDYSTNEKVLLPHPHQ
                     ALDDNEEADSSDVQVYVDLTEDGTWFALSSRYFSSLVNDAPASKFSLNSRWRQPEIFQ
                     DPLLLRMSIVGVHHLNPQQYRKVLINNEPYETIPSLPSDTDYNFPPALPKGSDSDELS
                     KGIGKYISPEELKEYKQNLEERLTNSISEEQTLFHRISRFFIRIIESGLMMVLALLIF
                     YLLASFNIIPPLHVVLTETGILPKMTIPTQPPEIQTYHQHNESPGPEMLPSEKTTEKN
                     MGEECESKSISSGTAVNPEDTDGLEGKKKRKRGSRGGKKTKKKTAGPEEDDSTLLNLK
                     DFEQEGQLKHLSISNKVLGYGSSGTVVFQGKFQNRPVAVKRLLIDFYDIASKEIQLLS
                     ESDDHPNVIRYYFSESTEKFMYIAVELCIASLEDIVEGSRDPAKSALIQKNMDPLNVL
                     FQIISGVNHLHSLKIVHRDLKPQNILIAPPKRYSDITDGSKSNLRVLISDFGLCKKLE
                     FDESSFRTNNFNNPTGTTGWRAPEIISGKVSISGSFVSDSSNNSTAGSSLPLDVGSAS
                     NLMNKRLTRAVDIFSLGCIFYYVLSKGDHPFGDRILREANILKGEYMLDGIKKTVKER
                     SVCIEATDLIRTMIDPNPLLRPTSDQILKHPLFWSVSKKLEFLLKVSDRFEVERRDPP
                     SPLLLKLEEVSTKVITNDNWTLKFDAMFMENLGKYRKYKGEKLMDLLRALRNKYHHFR
                     DLPQELEEVMGPIPNGFYKYFIQRFPNLLMEIYYVVEKNLKDDQVLGEFF"
     gene            <775505..>776269
                     /locus_tag="KLMA_50359"
                     /db_xref="GeneID:34716965"
     mRNA            <775505..>776269
                     /locus_tag="KLMA_50359"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820350.1"
                     /db_xref="GeneID:34716965"
     CDS             775505..776269
                     /locus_tag="KLMA_50359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676823.1"
                     /db_xref="GeneID:34716965"
                     /translation="MAIVQMFENGGTKTTTASASSLYQFLKSFELLSVRQQVGIKKSN
                     IHIDQKLVKGLTEKVPRYAAATLSQSYKKRAPAMDHSQNKSQYLNNLKCSTTHLFRAN
                     STVRTKGSKLPGFYSVFKPPSGSENGSYLNMDAEDSIKSDCMVSMRKIFQKEPRSATC
                     EFTSEYVTAEFSQRYKSTEPLLVQEYNKALLEDMVSLGVSKPHIKKILKTLARNEQTI
                     QELENECLVYKQSKENLESALVSIQSLCSLQYASMV"
     gene            complement(<776576..>778276)
                     /gene="KHT2"
                     /locus_tag="KLMA_50360"
                     /db_xref="GeneID:34716966"
     mRNA            complement(<776576..>778276)
                     /gene="KHT2"
                     /locus_tag="KLMA_50360"
                     /product="hexose transporter 2"
                     /transcript_id="XM_022820352.1"
                     /db_xref="GeneID:34716966"
     CDS             complement(776576..778276)
                     /gene="KHT2"
                     /locus_tag="KLMA_50360"
                     /codon_start=1
                     /product="hexose transporter 2"
                     /protein_id="XP_022676824.1"
                     /db_xref="GeneID:34716966"
                     /translation="MSEAAGLQTGTAAQSTPVDTKSFESSQVSTPTNVGSKDELKVDE
                     TNTEVELPKKPASAYITVSILCLMVAFGGFVFGWDTGTISGFVNQTDFVRRFGSTHAD
                     GTHYLSNARTGLIVSIFNIGCAIGGIFLSKAGDMYGRRIGLMFVVVVYVVGIIIQIAS
                     INKWYQYFIGRIISGLGVGGIAVLSPMLISETAPKQLRGALVSCYQLMITFGIFLGYC
                     TNYGTKTYSNSVQWRVPLGLCFAWAIFMICGMLFVPESPRYLIEKDRIEEAKASIAKS
                     NKVSIEDPAVQAEADLLIAGVEAERLAGSASFKELFSTKTKVFQRLIMGIMVQSFQQL
                     TGNNYFFYYGTSIFKSVGMTDSFETSIVLGIVNFASTFLGIYIVGRFGRRQCLLWGAA
                     LMTCCMVVFASVGVTKLWPKGPNGGVSSKGAGDCMIVFTCFYILCFATTWAPIAYVVV
                     AESYPLRVKSKCMGVATASNWVWGFLISFFTPFITSDIHFYYGYVFMGCLVAMFFYVF
                     FFVPETKGLTLEEVDEMWLEGVLPWKSESWVPSSRRGNDYNADDLQHDDKPWYKAMMK
                     "
     gene            complement(<780188..>781900)
                     /gene="KHT2"
                     /locus_tag="KLMA_50361"
                     /db_xref="GeneID:34716967"
     mRNA            complement(<780188..>781900)
                     /gene="KHT2"
                     /locus_tag="KLMA_50361"
                     /product="hexose transporter 2"
                     /transcript_id="XM_022820353.1"
                     /db_xref="GeneID:34716967"
     CDS             complement(780188..781900)
                     /gene="KHT2"
                     /locus_tag="KLMA_50361"
                     /codon_start=1
                     /product="hexose transporter 2"
                     /protein_id="XP_022676825.1"
                     /db_xref="GeneID:34716967"
                     /translation="MSEAAADLQTGTAAQNTPVEKTSFDSSQVSTPTNVGSKNDLDVD
                     HSNAEIEAELPKKPASAYITVSILCLMVAFGGFVFGWDTGTISGFVNQTDFLRRFGSK
                     RHNGTHYLSNARTGLIVSIFNIGCAIGGIILSKAGDMYGRRIGLMFVVVVYVVGIIIQ
                     IASINKWYQYFIGRIISGLGVGGIAVLSPMLISETAPKQLRGALVSCYQLMITFGIFL
                     GYCTNYGTKTYSNSVQWRVPLGLCFAWAIFMICGMLFVPESPRYLIEKDRIEEAKASI
                     AKSNKVSIDDPAVQAEADLLIAGVEAERMAGSASFKELFSTKTKVFQRLIMGIMMQSF
                     QQLTGDNYFFYYGTTIFKAVGLKDSFETSIVLGIVNFASTFIGIYVVGRFGRRQCLLW
                     GAATMTCCMVVFASVGVTRLWPHGPNAGISSKGAGNCMIVFTCFYIFCFATTWAPVVY
                     VVVSESYPLRVKSKCMGIATAANWIWGFLISFFTPFITSDIHFYYGYVFMGCLVAMFF
                     YVFFFVPETKGLTLEEVDEMWLEGVLAWKSTSWVPPSRRGADYNVDDLQHDDKPWYKA
                     MMKH"
     gene            complement(<784139..>785437)
                     /gene="KHT2"
                     /locus_tag="KLMA_50362"
                     /db_xref="GeneID:34716968"
     mRNA            complement(<784139..>785437)
                     /gene="KHT2"
                     /locus_tag="KLMA_50362"
                     /product="hexose transporter"
                     /transcript_id="XM_022820354.1"
                     /db_xref="GeneID:34716968"
     CDS             complement(784139..785437)
                     /gene="KHT2"
                     /locus_tag="KLMA_50362"
                     /codon_start=1
                     /product="hexose transporter"
                     /protein_id="XP_022676826.1"
                     /db_xref="GeneID:34716968"
                     /translation="MYGRRIGLMIVVVVYVIGIIIQIASIDKWYQYFIGRIISGLGVG
                     GIAVLSPMLISETSPKHLRGTLVSCYQLMITLGIFLGYCTNYGTKTYSNSVQWRVPLG
                     LCFAWAIFMIGGMAVVPESPRYLVKRDRVEDARLSIAKTNKVSIEDPAVQAETDLLIA
                     GVEAERLAGSASFKELFSTKTKVFQRLVMGIMVQSFQQLTGNNYFFYYGTSIFKSVGM
                     TDSFETSIVLGIVNFASTFLGIYIVGRFGRRQCLLWGAALMTCCMVVFASVGVTKLWP
                     KGPNGGVSSKGAGDCMIVFTCFYILCFATTWAPIAYVVVAESYPLRVKSKCMGVATAS
                     NWVWGFLISFFTPFITSDIHFYYGYVFMGCLVAMFFYVFFFVPETKGLTLEEVDEMWL
                     EGVLAWKSTSWVPPSRRGADYNVDELQHDDKPWYKALLKH"
     gene            complement(<787888..>789600)
                     /gene="RAG1"
                     /locus_tag="KLMA_50363"
                     /db_xref="GeneID:34716969"
     mRNA            complement(<787888..>789600)
                     /gene="RAG1"
                     /locus_tag="KLMA_50363"
                     /product="low-affinity glucose transporter"
                     /transcript_id="XM_022820355.1"
                     /db_xref="GeneID:34716969"
     CDS             complement(787888..789600)
                     /gene="RAG1"
                     /locus_tag="KLMA_50363"
                     /codon_start=1
                     /product="low-affinity glucose transporter"
                     /protein_id="XP_022676827.1"
                     /db_xref="GeneID:34716969"
                     /translation="MSNQLTDTTSAGSAASHHSADSVNAKGESPNQYSDEQSQEYHEL
                     EKIVEEKLSQRSKKEYVFVSICCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGSTRH
                     NGTHYLSNVRTGLMVSIFNIGCAIGGITLSKIGDMYGRRIGLMAVVVVYIIGIIIQIA
                     SINKWYQYFIGRIISGLGVGGINVLAPMLISETAPKQLRGTLVSCYQLMITCGIFLGY
                     CTNYGTKTYSNSVQWRVPLGLSFAWAIFMICGMLFVPESPRYLVEKDRLDDARASLAK
                     ANKVATDDPVVRFEMLNLQATIEKERLAGEASWTELITGKPAILRRTIMGIMIQSLQQ
                     LTGDNYFFYYGTTIFKAVGMDDSFETSIVLGIVNFASTFFALYTVDNFGRRNCLLYGC
                     VGMVCCYVVYASVGVTRLWPDGPNAGISSKGAGNCMIVFACFYIFCFATTWAPVAYVI
                     ISESYPLRIKAKAMSIACAANWIWGFLISFFTPFITSDIHFYYGYVFMGCMVFAFFYV
                     YFFVPETKGLTLEEVDEMYAEGVLPWKSTSWVPPSRRGAEYNIDDLNHDDKPWYKRMS
                     FKKN"
     gene            complement(<791953..>793641)
                     /gene="RAG1"
                     /locus_tag="KLMA_50364"
                     /db_xref="GeneID:34716970"
     mRNA            complement(<791953..>793641)
                     /gene="RAG1"
                     /locus_tag="KLMA_50364"
                     /product="low-affinity glucose transporter"
                     /transcript_id="XM_022820356.1"
                     /db_xref="GeneID:34716970"
     CDS             complement(791953..793641)
                     /gene="RAG1"
                     /locus_tag="KLMA_50364"
                     /codon_start=1
                     /product="low-affinity glucose transporter"
                     /protein_id="XP_022676828.1"
                     /db_xref="GeneID:34716970"
                     /translation="MSNQLTASTSTASKHSVESALKTGQLSDNVSQHELNDLEKVVEE
                     KLNKKPKSEYIFVVLSCLMVAFGGFVFGWDTGTISGFVNQTDFLRRFGSTRHNGTHYL
                     SNVRTGLIVSIFNIGCAIGGIILSKAGDMYGRRIGLMIVVLIYVVGIIIQIASIDKWY
                     QYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGT
                     KKHSNSVQWRVPLGLCFLWAIFMIGGMAVVPESPRYLVKRDRVEDARLSIAKTNKVPL
                     DDDTVKLEIMNLEASVEMERLAGEASWTELITGKPAILRRTIMGIMIQSLQQLTGDNY
                     FFYYGTTIFKAVGMDDSFETSIVLGIVNFASTFFALYTVDKFGRRKCLLYGCVGMVCC
                     YVVYASVGVTRLWPHGPNAGISSKGAGNCMIVFACFFIFCFATTWAPIAYVLVSESYP
                     LRIRSKGMGIACAANWIWGFLIGFFTPFITSNIHFYYGYVFMGCMVFAFFYVYFFVPE
                     TKGLTLEEVDEMYAEGVLPWKSESWVPSSRREAGYNVDDLQHDDKPWYKRISLK"
     gene            complement(<795253..>796461)
                     /gene="SVF1"
                     /locus_tag="KLMA_50365"
                     /db_xref="GeneID:34716971"
     mRNA            complement(<795253..>796461)
                     /gene="SVF1"
                     /locus_tag="KLMA_50365"
                     /product="survival factor 1"
                     /transcript_id="XM_022820357.1"
                     /db_xref="GeneID:34716971"
     CDS             complement(795253..796461)
                     /gene="SVF1"
                     /locus_tag="KLMA_50365"
                     /codon_start=1
                     /product="survival factor 1"
                     /protein_id="XP_022676829.1"
                     /db_xref="GeneID:34716971"
                     /translation="MLKWIQGGISAVTGIAEPEYGPEYIHTSAERVKGKQPFHVTDRK
                     DFEWQNPDHTSVETATFYFTDLENGYAGFAQVIHSNIVGLHTTAQFTFKIYHKEDVDK
                     QIWTSVKLENFRIEGPNFYADNLSIEMNEEGTEVEFKSTVAENVDVQFKIKRSVSGVK
                     VGEDPSTYYGDDVTQPWGSMRHVFWPRNSITGTISAKNEQQDVSIDLTLSEEHKHYSM
                     YVLAMQGMKPHHAAKAWNFMNFQSETHSAVLMEFITPKSYGTTKMSVGIVCDSSNVLA
                     VTVDNDAQHVDPQIDSVGWPVPKEIAISFKGVPATATDETVETAEPFLAVVKGKLDNL
                     VERVDVMAEIPNFVKNIVSGVAGTKPYIYQFFEDFTLTIKDEESKGLGWCEVTFISEA
                     NDVEVPEGEE"
     gene            <796951..>799065
                     /gene="RRM3"
                     /locus_tag="KLMA_50366"
                     /db_xref="GeneID:34716972"
     mRNA            <796951..>799065
                     /gene="RRM3"
                     /locus_tag="KLMA_50366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820358.1"
                     /db_xref="GeneID:34716972"
     CDS             796951..799065
                     /gene="RRM3"
                     /locus_tag="KLMA_50366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676830.1"
                     /db_xref="GeneID:34716972"
                     /translation="MFSFTKKKKKTGSSGKAQAAGKAQATGKAAPGQSTLNMFFKVKK
                     EPERPERQGLGSGPGSRLTAGSRTSSLLSSFQSQGSFDNDSGNDGFSLLQPKKQVKNF
                     KPVASSTRQLPPQPMMPVERSLSGVKRTLSSLDVFSESSFSQGSAATATTSQSFGSSQ
                     GGSASQSISLSAVKRLKPIPRGSVASHGSSKGQKTSGASSLQLTQEQRRVIDYVCKDR
                     LNVFYTGSAGTGKSVVLKTIISVLNSKYGKDAVAVTASTGLAAVNIGGITINKFSGVG
                     IGQGDAPRLINMVKRNKNSLQRWKRTKVLIVDEISMIDGVFLDKLDAIGRGLLNKSKP
                     FGGIQLVFTGDFFQLPPVPDRDSNKPAPIFCFESNVWKYAIHKTILLQQVFRQTDNEL
                     IELLNDIRMGTTSPDTMRLIKKFEKPVNYDDGIEPTELYPTRKEVDLSNKRRLERLPG
                     YEIVYQAVDFIPPHINSNVLNNVMAEKEIKLKEDAQVMMLKNIDDTLVNGSLGKVLFF
                     TTTSLFAEISKLFPDLSDPEVIEDMRCVCRATGLPPSGRPAQLQEDINARPTHRQEVL
                     QFLLEKASKISNAPGVLSTIMFPVVKFIDKQDIRGYQIKLVEPEEFTVGETEKDSAIR
                     KQLPLMLCWAISIHKSQGQTIDRLKVDLKRTFESGQVYVALSRAVSKDRLQITNFDAS
                     KIKVNEKVKEFYQGLHKVSAQP"
     gene            <799372..>806027
                     /gene="PAN1"
                     /locus_tag="KLMA_50368"
                     /db_xref="GeneID:34716973"
     mRNA            join(<799372..800647,801778..>806027)
                     /gene="PAN1"
                     /locus_tag="KLMA_50368"
                     /product="actin cytoskeleton-regulatory complex protein
                     PAN1"
                     /transcript_id="XM_022820359.1"
                     /db_xref="GeneID:34716973"
     CDS             join(799372..800647,801778..806027)
                     /gene="PAN1"
                     /locus_tag="KLMA_50368"
                     /codon_start=1
                     /product="actin cytoskeleton-regulatory complex protein
                     PAN1"
                     /protein_id="XP_022676831.1"
                     /db_xref="GeneID:34716973"
                     /translation="MRVRFTKLLGRRALALLTGLVLLFFLLPSDQYVVNVDGTTSVLP
                     KFEGKRAIVYSPFYKLANALSMGKSLSKILQASEKYHQIGTEWQRLKLQDKCRYYFEA
                     TAEINAEWSNDAVKTFHNENNLDDPLAELMMERIRMYDTCFLSGGLSWKKVFHKSKVD
                     PTKLESRIFPFLSKTAKLRDMWPVIIDANHWTQTPKFSNPLLEGKDTWKLDDNHSFFY
                     NWNMFASGKGIAMSLGLRHLDQFKKLLLTLEALNNTLPIQVVYNGAELTEFFLDDVHR
                     FLNINALSQRVYFVNIGPLVDKSFASNYVKYFVNKWMALLFNTFSECILMDADVVSFT
                     KPESYFDMNEYKNTGMLMFRDRNIIDEHTFKYCTDTMRMLFPSSEETILMDHKPTFPS
                     SLIGNDNVDVDALSIEESIFYKFFIDLQLHHVDTPNQQQQPQQQQPIQPQQPVQQQYT
                     GFQSFSNAGALAQQPTGYGQAQQQQQQPQVQQQPLQQQSTGFNSMMPQTSFGQQQMPT
                     TFNNGMNAGPTAPLKPQQTGFYSQQQPLEPLKPTATGFINSFSNSGFNSTLKIPAMRL
                     SFITTQDQAKFEKLFRSVVSPGSNTITGEQCRNILVKSGLQPSQLAKIWTLSDTNKAG
                     ELLFPEFALAMHLVNSVLQGDSIPYELDTKTKNEVSSFVDAINFSVSSDLDSEPKPKT
                     PFDDLTAGISMMQPQPTGYMPQLSFGGPSQQPAAPQQQPSFTGLTQQPTGGYAPAPQT
                     SFGNNLGAVGSQALQPQSTGYVAQTTTGGFPQQALNPQPTGGFSQQPLNPQATGGFTS
                     VLNSQPTGNMPNTSFSQPQVPMQTGFSSTGGLLQPQATGYLPPSNFQATAPLQAQKTG
                     FGNNDLYTQANLTSKFIAQKEDTITPEEKSLFYKIFETYDIEKKGQLNSATAVEIFRK
                     SGLNRSDLEHIWNLCDINNSGNLDKQEFALGMHLVYRRLNGEVLPNTLPPSLVPSSTK
                     ILNTLKDQLKSNRDNKTKQPTKEDGYRFKNNDDELLPSSRNRRKTIDQSKKINENKEK
                     IENLKRLINEKKELLQLEKSRLEKDKQREQSESADLLRSIENLKSQIQSLPSAQRNNS
                     SNTAVPHDLQAKFDSLTIRLPNLLSEIAQVSTELNNAQLKSFKLKTPSSIIGTGPNGE
                     ITEYDRKKAKQKQILAARMAALTGKPVEENSSSSLEAEEQRYNEEVSRIQREHEKNRS
                     IINDISTSIQELSSSVHAAIHGGASSGFEMEKWESGIGLEPEVRDFIIAWKNRRSFSN
                     PSSNSGYPYGGMPSNNQGYTNGADSGSRQPSFSSPEEQAAYEKAQAKKKMEEKLAALG
                     IKRKSGNSQSVSASPNPPQLSQRPSPQQSYSPQQQQQQQQQQQQQQQQQPPPAPPAPP
                     APPATQAQSAPQQQYQQHYQQQYQQPTQQQYQQQNASSPVNAVSPPPPPPPAVAAAPV
                     AHEESDEDSDEEERRLLQQLEKLKLKKKQEKEARLAARNQSPVPAATQQPSAHVPALA
                     PASVKPEKKDDEHDSWDDEPTPTNPPPRESQSSSHHQHNPFGQNQNTANTQPTPSETP
                     KLSSTPTGGRNPFFKQTPTQTSSFDMRAAEQQRRIQRGLDDSDGWSEDEDEDDKKKEQ
                     EEEKKKEANAALVPVAPPLPQVSSSPEKESAQSAAPVPIAPPPIPSLGAGSSVIPPPP
                     SLPSSINEEEPPVPVAPPLPQVNNNDNNNSSLPPVPVAPPLPQVNSSNSSLPPVPVAP
                     PLPQVNSGNVAPAPVAPPVPVAPPLPQVSSNTDTLAVSGASADGEQAGSDDASDVLSI
                     PDSVASDDDKFHTPAPTTEPQPEPESSVPDASAPSSAIPVPPPPPPMPVIPPPPPMP"
     gene            complement(<806136..>806654)
                     /gene="IST3"
                     /locus_tag="KLMA_50369"
                     /db_xref="GeneID:34716974"
     mRNA            complement(<806136..>806654)
                     /gene="IST3"
                     /locus_tag="KLMA_50369"
                     /product="U2 snRNP component IST3"
                     /transcript_id="XM_022820360.1"
                     /db_xref="GeneID:34716974"
     CDS             complement(806136..806654)
                     /gene="IST3"
                     /locus_tag="KLMA_50369"
                     /note="U2 snRNP protein SNU17; Increased sodium tolerance
                     protein 3"
                     /codon_start=1
                     /product="U2 snRNP component IST3"
                     /protein_id="XP_022676832.1"
                     /db_xref="GeneID:34716974"
                     /translation="MNQVRSIQKLSERELECGILEPEKSWHHQYKDQAYINFGGMHQE
                     LTEGDILTIFSQYGCPVDIKLVRDQNTGDSKGFGFLKYEDQRSTILAVDNLNGSRICG
                     RVIRVDHAFYRPRDGEEEYEEAVKRELENDLVVPGKGSDTDKRSEPEPGPMPGSDSAD
                     EFADPMAAFLKK"
     gene            <807004..>807726
                     /locus_tag="KLMA_50370"
                     /db_xref="GeneID:34716975"
     mRNA            <807004..>807726
                     /locus_tag="KLMA_50370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820361.1"
                     /db_xref="GeneID:34716975"
     CDS             807004..807726
                     /locus_tag="KLMA_50370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676833.1"
                     /db_xref="GeneID:34716975"
                     /translation="MTSYAARLKRFTTCDISDGLLNLYGIANGGYFPNLTRRSGSGTI
                     VGKAYTVLFGDPKETGSPEAANYIDSVPEGSVLTMAVTEDLQMHHAPYTKPSQAMYGG
                     LMSTRAQYLGSEGSVVFGRIRDLQEHRDLDHSVFSYGIGTCAPKAALKPIALDVPLRI
                     KISDGTTDTITPGDWLICDENGVVRIPGEVNGRALDLDRLLEYVEKSVEADELVSQDI
                     KNGEPAKASQKKRRAVLKKYIE"
     gene            complement(<807805..>809076)
                     /gene="DJP1"
                     /locus_tag="KLMA_50371"
                     /db_xref="GeneID:34716976"
     mRNA            complement(<807805..>809076)
                     /gene="DJP1"
                     /locus_tag="KLMA_50371"
                     /product="dnaJ-like protein 1"
                     /transcript_id="XM_022820364.1"
                     /db_xref="GeneID:34716976"
     CDS             complement(807805..809076)
                     /gene="DJP1"
                     /locus_tag="KLMA_50371"
                     /codon_start=1
                     /product="dnaJ-like protein 1"
                     /protein_id="XP_022676834.1"
                     /db_xref="GeneID:34716976"
                     /translation="MVVDTTYYDLLGVSTDATAIEIKKAYRKKSIKEHPDKNPDDPAA
                     TERFQAISEAYQVLSKDELRAKYDKFGKEEAMPQDGFEDAGEQFAAIFGGEAFVSYIG
                     ELTLLKNIQKTQELSEEDEKQKEKEKENTKQEAESQETRRLASGESEAQGAVESDVNA
                     SAKTDSKADASASKKKGKLEEFEEQQKRDKEKSIEELSKILCDRLSILTESEYDDACK
                     QSFDKKFEEEANMLKMESFGLDILHTIGDIYCEKANIFLKSQFLWGIGGFYHSVKAKG
                     ELVMDTVRTVSAALDAQSTMTELEKLKETANSQEPLTDANGNTVEKPTVEELAQLEQL
                     LMGKVLSAAWYGSKFEIMSTLRSVCDNVLEDSSVDIQTRIRRAESLKRLGKVFRKAYR
                     TKSEQEDAQVFEELVAEASKKSHKHHRNSTS"
     gene            complement(<809366..>811177)
                     /locus_tag="KLMA_50372"
                     /db_xref="GeneID:34716977"
     mRNA            complement(<809366..>811177)
                     /locus_tag="KLMA_50372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820365.1"
                     /db_xref="GeneID:34716977"
     CDS             complement(809366..811177)
                     /locus_tag="KLMA_50372"
                     /note="Conserved hypothetical Protein of unknown function
                     DUF3210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676835.1"
                     /db_xref="GeneID:34716977"
                     /translation="MTRIIFPGLQAEVKAKPCEGYTSTPGERQHTRQYTRLHDVRCSQ
                     EVYQVPGEIESGVMETESTPKIPERPRRRVEVPGSGQVPLEAEVPQVPQVPHVPKTRP
                     KRRAGAAVSPSPGPSVGSEADLESETKPNAGLVPEKSPEEPSQEPSQERSQESQAEIE
                     QEIEALKGEEPESEPSGEIPAPKESQSPIEKETQESGLEPSVAEASETPVESKPEGVS
                     EKVSEEVSEETPEETPEEVPEELSQSSEPLREELSEPSEVPVPEQSEKPSSEKPSSEE
                     VSSEKASSEESPKELSTSSASAPETSIPALDTVNDEPVKPADATPQIPHIPAQQPSRP
                     SKKPPIRPPKPSSKIAAFQQMIQEQQRQFQGVPEPEPHGEGKSAPKSTPKNFPKPLPG
                     MFALPGMAMGQMNPALAKKLGIATEDSQEKESQSIPATPSRPKRSKGPAKRLPKNVSS
                     IEKVDAKSTFDVGVVKAWSVVVKPTPTTQEEPQLPEEAQEAQVESSPVPEASEQTPAP
                     EPEIDQSELTAQSTGESIQDVSESFHDTLESPEQEQEQEQVNVDNPSDPTAFILDEYD
                     EDTEVENPLESQQNVPESIQINQEEEPHPEQHEPTLS"
     gene            complement(<811428..>811805)
                     /gene="NTF2"
                     /locus_tag="KLMA_50373"
                     /db_xref="GeneID:34716978"
     mRNA            complement(<811428..>811805)
                     /gene="NTF2"
                     /locus_tag="KLMA_50373"
                     /product="nuclear transport factor 2"
                     /transcript_id="XM_022820366.1"
                     /db_xref="GeneID:34716978"
     CDS             complement(811428..811805)
                     /gene="NTF2"
                     /locus_tag="KLMA_50373"
                     /codon_start=1
                     /product="nuclear transport factor 2"
                     /protein_id="XP_022676836.1"
                     /db_xref="GeneID:34716978"
                     /translation="MSVDFSSLAQQFTEFYYNQFDSDRTQLGNLYREQSMLTFETTQV
                     QGAKDIVEKLVSLPFQKVAHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQV
                     FHLMPEGSSYYVYNDIFRLNYSA"
     gene            <812595..>816611
                     /gene="SEC3"
                     /locus_tag="KLMA_50374"
                     /db_xref="GeneID:34716979"
     mRNA            <812595..>816611
                     /gene="SEC3"
                     /locus_tag="KLMA_50374"
                     /product="exocyst complex component SEC3"
                     /transcript_id="XM_022820367.1"
                     /db_xref="GeneID:34716979"
     CDS             812595..816611
                     /gene="SEC3"
                     /locus_tag="KLMA_50374"
                     /codon_start=1
                     /product="exocyst complex component SEC3"
                     /protein_id="XP_022676837.1"
                     /db_xref="GeneID:34716979"
                     /translation="MLRKISHSRENSASHKRKSSLGGTPPVSGHKRNTSRSSNSSVNS
                     NFLAEQYDRDRTAIINSCFQKIDPRTGSPVSSYITHVRIIEDSRFPSSRPAANSPLEN
                     KKKRVLIISSSSGSSSGGSRMQLHKARENSNGSFQIGRTWDLTELESVERDLEVAQGF
                     TVVMGKKYYWETNSAKERTVFIKSLVSIFMENSGGRVPRLINWDLAMFYLDETSYERA
                     VIVPKPKSKAKPQTQAQQPSVAPAAKAAAVKAATRPADGPRPSVSQKAQNNIPAPASV
                     PLPLPGGPGPGPGPGPGPASSGRQGLPTAPPVRSTRSSGTSGVSGGSGTGSVTPGTPG
                     TPGTPGSPKKATFSSQPYAQSASINDAERQLHYNKISQEKNQNQYQNADQQNTAKGYA
                     QTSPQNPQFQLQTPTAPSSPSHSPPVSRSPSRPVSYASSDADSNNKNVLQELDAMLHA
                     SPLKTVDFRHRASSYHEAEELVDGDDDYNRDGNRQEETNFNDSPDLSEEDDDDDDDDP
                     LNDYTDQTFDQTFDQTVETLTEQGQDQDQYQYQYQYQYQYQYQEQDQEPRHLPEMQTQ
                     TEYHQVNTIPEEQSELVDTTTDLFPPKLTTEENSRPESPARNLEQTINEEILLEVLTE
                     VNWGVNDDSSSLLEKLHSRLADVDYQFNKSLLLLPQGLKELVPFKDRVFKECDKLDPT
                     LSLFTMELSSVSNDIDFVESQRNGLQVRVANRKLLWNELNEILDSVSINEQALCELLT
                     LPVSKTSIERIETLLSKLYAALKAIDGSKDQFLVQREEYDLSDMRALSERRHAYERVK
                     ELFIERIQEQMAQKYKEIERATDNTKDALANTLVFSSLILFCKDVSANSYEKLIDMWN
                     DSVYKLYERKTNILLSKMRPVAVNQNSQQSHLSINQSEQDALFDWWYTLRVRKAPYME
                     NTDLNPQLVSAIKATKEMESICIVYQNFASAFFHLSSRHSFNDFVDSVSPNERGFMDL
                     QKIWPMESVRKNASNINNLVSKIMQNQLVKFFKAVYTVAANNRLDNPALLLYLEERIK
                     DLESSNQEVLRNYLIKAYQRIQHDFSSYIDEHCVYIERAVINFKSRSLSPSIVSLPVL
                     TRTVENSLKATVDWLHLDPNFMYDSHKFAEQAYMRIADSTLKLLTTSTTQDVSSEIVV
                     DNINSNSTEKLDETVSILLNANLILETLPLFDMDVFSDVLQEAKRLFDAEKETYSEML
                     LTSSMRDLTAFVQGAQSLIKSGANGAPTANSHTDPKQWAAYSEQNLNKILSSYTSREI
                     ADMINQLYANMESHFLTADSTANNATKILCQKLWSNIQGRTVSFYLSLYSLIERHYKN
                     TSIQFNKNDIIAAFEHHK"
     gene            <816875..>819973
                     /gene="MPH1"
                     /locus_tag="KLMA_50375"
                     /db_xref="GeneID:34716980"
     mRNA            <816875..>819973
                     /gene="MPH1"
                     /locus_tag="KLMA_50375"
                     /product="ATP-dependent DNA helicase MPH1"
                     /transcript_id="XM_022820368.1"
                     /db_xref="GeneID:34716980"
     CDS             816875..819973
                     /gene="MPH1"
                     /locus_tag="KLMA_50375"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase MPH1"
                     /protein_id="XP_022676838.1"
                     /db_xref="GeneID:34716980"
                     /translation="MAELSDLSDDDLESLLENNVNRSVNETITRHSIPVQRDLFMNVI
                     PGQQTFYEERTVDVSYGPTHHELNHENLGTYKYPTNYEVRQYQYDIVRCALFENVLCA
                     IPTGTGKTFIASTVMLNYYRWTKRAKIIFTAPTRPLVAQQIKACLGITGIPYSDTAIL
                     LDKSRKNREEIWQQKRVFFTTPQVVENDLKRGVLNPKDVVLLVIDEAHRARGNYAYVE
                     LTKFIDRFNTSYRLLALTATPAADLEGVQEVVNNLHISKIELRTEDSLDVARYMKRRD
                     REMVEISLIPEIEEVVEQLGIAIAPVLQEAIQLGIYESCEPHQINAFVAMQQSQKVIL
                     NPSIPEGLKWKNFFILQLLSQVGHMYRRLRIYGLRAFYNYFQNKYTEFTTKYNMKKST
                     NKTAANFYYSPILKTTLDKCKQRLDEAGFYSHEKLEYLNSELTDFFSCAPPDSRAIIF
                     TELRESALEIVKSIDSLNEQSLRPHIFIGQAKGKEGFDEESYVRKNKPKGRTKADRLR
                     RLEEEKQLEEAKKRQKEQEKQERIARRTGSSEEAQLSGMNQRQQKKVISDFKKGAYNI
                     LVCTSIGEEGLDIGEVDLIVCFDSTSSPIKNIQRMGRTGRKRDGRIVLLFSGNEKFKF
                     EQAMNDYENLQTAITQNVLEYTKSDRILPPTANPVCEEEFIVVSNENDEFNKLDDSDE
                     VIKYATQAMLGKIKKKTDKETKPKATAKTKTKSKAKSQSKEKTFFMPDNVTEGFTSAS
                     NLLNKFTINEFGEKVSIGPAKLGNDVVKKPKTEWNMLDEIEYDSIEVSPAKSNVEPSQ
                     KPKDAGAPALTSQLAAINGGILTPDETTNQIQSASSSLSRTRFDSDSVTESMPMPMSM
                     SESPNEPDSSHVTEPVLKRLKLASEQKEHYHGQPLVSHYTTGDPLSPQERKHFLKNYV
                     PDRIQWSIAPQISHPKTSKLPHTPKIQTILDTFTDMRTDKREKIIDMNRTNALARSVG
                     YNRSVGMELEVMLPSIIVPNPPPSNTQNSDSRGHSLGKSSDIDTLGDVLDEEGLSDLL
                     DD"
     gene            <820781..>821326
                     /gene="TMA20"
                     /locus_tag="KLMA_50376"
                     /db_xref="GeneID:34716981"
     mRNA            <820781..>821326
                     /gene="TMA20"
                     /locus_tag="KLMA_50376"
                     /product="translation machinery-associated protein 20"
                     /transcript_id="XM_022820369.1"
                     /db_xref="GeneID:34716981"
     CDS             820781..821326
                     /gene="TMA20"
                     /locus_tag="KLMA_50376"
                     /codon_start=1
                     /product="translation machinery-associated protein 20"
                     /protein_id="XP_022676839.1"
                     /db_xref="GeneID:34716981"
                     /translation="MFRKFTREDIHTRSNVKSSIQRNLKAKLIAQYPKLEEVIDEIIP
                     KKAQIELYKCEGKIHLYLVNGEVLFFQNFDELIPSLRFVHKFPEAFPTVQVDRGAIKF
                     VLAGSNIMCPGLTSPGAKLPEAPGYEKDTIVVVNAENKGAAMAIGKLIMSTEEIKEVN
                     KGPGVEMIHHLGDPLWTFSAD"
     gene            complement(<821352..>822887)
                     /gene="PAC2"
                     /locus_tag="KLMA_50377"
                     /db_xref="GeneID:34716982"
     mRNA            complement(<821352..>822887)
                     /gene="PAC2"
                     /locus_tag="KLMA_50377"
                     /product="protein PAC2"
                     /transcript_id="XM_022820370.1"
                     /db_xref="GeneID:34716982"
     CDS             complement(821352..822887)
                     /gene="PAC2"
                     /locus_tag="KLMA_50377"
                     /codon_start=1
                     /product="protein PAC2"
                     /protein_id="XP_022676840.1"
                     /db_xref="GeneID:34716982"
                     /translation="MMPCTVCVKINDRLNINGELCTVKYIGSIPAWPNTVAYGVEWDH
                     DRRGKNNGSLQGVTYFSTTDNRTSGSFIKEKALLSTMIQGISFEEALLMKYGDNRTRS
                     SDIKYKFGSKETEAYGFERLNESNSNFSQLKSITLSQTNINKATNPDIQDSMVFNNLF
                     TSVRYLDLSFNLFSDINEVYRILTRFPCVKTLVLSGNCFPVLKIDDESFKFPQVKEIS
                     LARCKLKNNDLGEILTVFPSLEIIDLSCNFLTDLTVIQSSWKQLNISGNMFSKIPAQL
                     LTKGSSLTHIEVSNNKITGLDGLPTNEKIESLRVDANNIQNWNEIDRCNNVFPNLRTL
                     WVQKNPIVEPDTQANFYSTIARISSLTCVNGTPINEELRKEAELYFISQVLSGQIHLD
                     DHYRDHNDSSVWEHLVKKHKIDTKATRSEMRPRNFLDAEMSDLTIVYGSHSEKIPILK
                     SIGVRFLKTLLRHKLHLPGSSSSSIKLQYSVREDATRHEFRYEFSPLALYNIEESTVY
                     VNT"
     gene            complement(<823251..>824840)
                     /gene="NUG1"
                     /locus_tag="KLMA_50378"
                     /db_xref="GeneID:34716983"
     mRNA            complement(<823251..>824840)
                     /gene="NUG1"
                     /locus_tag="KLMA_50378"
                     /product="nuclear GTP-binding protein NUG1"
                     /transcript_id="XM_022820371.1"
                     /db_xref="GeneID:34716983"
     CDS             complement(823251..824840)
                     /gene="NUG1"
                     /locus_tag="KLMA_50378"
                     /codon_start=1
                     /product="nuclear GTP-binding protein NUG1"
                     /protein_id="XP_022676841.1"
                     /db_xref="GeneID:34716983"
                     /translation="MRVRKKQSKRTSTRMREGIKKKAAAQHRKERKQAKKDITWKSNK
                     TKDPGIPANFPYKNKILEELEEKRRRDLEEKQRKRQERLEAKRRAKELGEEYMGDEDS
                     MDEDDLDDGNNGLSALLESAQQAAQEFNGETSNAQQQQEEDIEVQEYDVDFYEDASEN
                     DSELEKSRKAYDKIFKTVVDASDVILYVLDARDPEGTRSRKVEQAVLQAQGKRLILIL
                     NKIDLVPTYVLQQWLTYLKSSFPTIPLRAAPGATNATSFNKTLTQAATASSLLEALKT
                     YSNNSNLKRSIVVGVIGYPNVGKSSVINALTSRRGGSNKACPVGNQAGVTTSLREVKV
                     DNKLKILDSPGICFPSESKKMSRVEQEAELALLNALPPKYIIDPYPAVLKLVKRLSKS
                     EEMTENFKKLYELPPIPAADADSFTKQFLIHIARKRGRLGRGGVPNLASAGISVLNDW
                     RDGKIMGWVLPNSSKFTAEAAAAAASGATPTLGTGATAAPAKVEQTAIVQEWSKEFDL
                     DGLFQSLDNAIQAEQNQSADA"
     gene            <826668..>829133
                     /gene="HAK1"
                     /locus_tag="KLMA_50379"
                     /db_xref="GeneID:34716984"
     mRNA            <826668..>829133
                     /gene="HAK1"
                     /locus_tag="KLMA_50379"
                     /product="high affinity potassium transporter"
                     /transcript_id="XM_022820372.1"
                     /db_xref="GeneID:34716984"
     CDS             826668..829133
                     /gene="HAK1"
                     /locus_tag="KLMA_50379"
                     /codon_start=1
                     /product="high affinity potassium transporter"
                     /protein_id="XP_022676842.1"
                     /db_xref="GeneID:34716984"
                     /translation="MSTREGEYSSKYMVEEEDNSGVDSASAAPMETDIENYAEYSEKR
                     PSKKATIASVAFLGYSSLGSIYGDIATSPLYTVPSIFSGSNLDVTENNLMGVVSCIFW
                     LFTIVVIVKYTSLVLVYGPNDGEGGQIALYCKIAKCLRNGPVDQLMLQNKTQSEDQLL
                     LSRYETTNSQTTSIFKHESSWLQNKSFRKWVGRVTLILCFLGCSMVISDGLLTPTTSV
                     LSAMEGITVAVPSFHGKTMPTSVAILVVLFLAQVMGIGKITMLFSPIVALWFIVLLVI
                     GGINIAAAPRIFKALNPVEAINLLRRQGKINIMGDVMLSITGVEAMFADVGHFSPLSV
                     QLSLLLVVYPSLMICYLGQGAYLIKHPEQLSNVFYESIPGKSGQGFYWFVFVLAILAT
                     IIASQALILGVSSISKQLIAVGFLPKLKVIHKSASHSGRIFIPVVNFLLMIGVLVCCV
                     GFKTSARVTAAYGLTVSMDLFITSLFMSIMFVCVQKFHVGIAVLFLCVFGSLECCLIG
                     ANLLKVPHGAWVPLMVSGALFIFLLVWRWCYTMKANREARDRISLTKLLQDCQQQITY
                     SSNITGAGISQRIQEEDEGDDDDDDNDDDDDDVDEDAVANTQNTPDVRFSQPPQRRSS
                     NKLDSTRPVIARPGSTHHVGSLDKIPRSNYVGIMFTDLATLLKHPASVPRLYKDLTKS
                     FGAISRVFAFVGVHICNEPYVENEDRILVQKMQQDGFYRCIVRLGFMEAASDDEKKIE
                     QLVSVLSMEEGINLHTIPVVEICSADQIIGKTLTEASIWKKSLYIARKFVIEYIYAPI
                     YYSTERTNKEEENVVYFGKTVVI"
     gene            <830183..>831256
                     /gene="SUA7"
                     /locus_tag="KLMA_50380"
                     /db_xref="GeneID:34716985"
     mRNA            <830183..>831256
                     /gene="SUA7"
                     /locus_tag="KLMA_50380"
                     /product="transcription initiation factor IIB"
                     /transcript_id="XM_022820373.1"
                     /db_xref="GeneID:34716985"
     CDS             830183..831256
                     /gene="SUA7"
                     /locus_tag="KLMA_50380"
                     /codon_start=1
                     /product="transcription initiation factor IIB"
                     /protein_id="XP_022676843.1"
                     /db_xref="GeneID:34716985"
                     /translation="MSLPQAASANVAATSRRRGPNLNIVISCPECKVYPPKVVERFAE
                     GDIVCALCGLVLSDRIVDTRSEWRTFSNDDQNGDDPSRVGEASNPLLDGSHLSTRIGQ
                     VQGSDARVTRDLNRAQSKSIVDKKDNELQAAYAKITMMCDAAELPKIVKDCAKEAYKL
                     CFEERVLKGKSQESIMASVILVGCRRAEVGRSFKEILSLTNVRKKEIGKTFTIIKNIL
                     RDKNDKGFANIDTSNITTGQTSAETFIPRFCSHLGLSVQVANAAEYIAKHSKDVNVLA
                     GRSPITIAAAAIYMATLLFNLNISPTKVSQTLQVTEGTVKGGYKALYEHKEKVVDPQL
                     IESGIVKWENLPKVSNDKSEKAN"
     gene            complement(<831814..>833790)
                     /gene="YND1"
                     /locus_tag="KLMA_50381"
                     /db_xref="GeneID:34716986"
     mRNA            complement(<831814..>833790)
                     /gene="YND1"
                     /locus_tag="KLMA_50381"
                     /product="Golgi apyrase"
                     /transcript_id="XM_022820375.1"
                     /db_xref="GeneID:34716986"
     CDS             complement(831814..833790)
                     /gene="YND1"
                     /locus_tag="KLMA_50381"
                     /codon_start=1
                     /product="Golgi apyrase"
                     /protein_id="XP_022676844.1"
                     /db_xref="GeneID:34716986"
                     /translation="MIVTGSETQYGIVIDAGSSGSRLHIYQWDSPQYTLHTEEKNQDH
                     EDTNGVMLLKSVPQIHQQKNWTHKISPGLSSFKDKPSQAYSKHIKELLDFAKDIIPAD
                     KISETPIFIQATAGMRLLSKRKQELILDGLCKSIRSETKFLLEDCHSQIQIIDGETEG
                     LYGWLSLNYLLGNFNNYVPENQLQHSSSGFMDMGGASTQLAFMPSDPEEISKHKEDIH
                     TIYLKNINGDIQEWDVFVSTWLGFGANRARSRYLAQLINSLPENANEEDDDDYETRQI
                     NDPCLPRGAKTKFEFKDKDFEINGVGDFSHCLKSMYPLLLNNLPCAEEPCLFNGVHAP
                     NINFEKDKFVGISEYWYTANDIFKMNGEYNFHEFSSKVKEFCESDWDTLKKNNDDGLY
                     NNIPDSFLMDSCFKANWILNVLHEGFDLPRMDVDIKDTDSADDRHVPFKSADKINGKD
                     LSWTLGRILMYASGLVTVGDKGTTVGIMPSPMEVKKLGKKFIPGAIEKLQNNVTGTGS
                     PSIWFSLKTWMFNIMLVLFIFVPIYICINKFRLMKHVPLHRIREGFNVLHSHLYKFKN
                     YSKLSRDEETLSKLEEGTMERGRFGRQEMENTSNFRSRSMMNLGGSMGEREAYPLSDR
                     KSSHFQNSNPDLVSGVRPVFSMTDFSSYKNPNRS"
     gene            complement(<834069..>834746)
                     /gene="FMP52"
                     /locus_tag="KLMA_50382"
                     /db_xref="GeneID:34716987"
     mRNA            complement(<834069..>834746)
                     /gene="FMP52"
                     /locus_tag="KLMA_50382"
                     /product="protein FMP52"
                     /transcript_id="XM_022820376.1"
                     /db_xref="GeneID:34716987"
     CDS             complement(834069..834746)
                     /gene="FMP52"
                     /locus_tag="KLMA_50382"
                     /codon_start=1
                     /product="protein FMP52"
                     /protein_id="XP_022676845.1"
                     /db_xref="GeneID:34716987"
                     /translation="MNALVFGATGLCGSAFLRHAAQSPAISKVYAITRSELPEDLKSS
                     KVSSVVNGESDKWSELIPEDAEIFMTGLATTRAAAGGLDKQYKIDHDMNIELAKAAKA
                     KGYKVCVIVSSSGASVDSRLPYFRMKGEIERDILALDFDKTVILRPGVLLGQRYRNFR
                     GFGANVAEKLGGWVYRGKLQSLLSYPIYGDEVGKVGVQLATDTSKKEKVQIIGAKELL
                     ELSQEKK"
     gene            complement(<835009..>835686)
                     /locus_tag="KLMA_50383"
                     /db_xref="GeneID:34716988"
     mRNA            complement(<835009..>835686)
                     /locus_tag="KLMA_50383"
                     /product="dynactin subunit 5"
                     /transcript_id="XM_022820377.1"
                     /db_xref="GeneID:34716988"
     CDS             complement(835009..835686)
                     /locus_tag="KLMA_50383"
                     /codon_start=1
                     /product="dynactin subunit 5"
                     /protein_id="XP_022676846.1"
                     /db_xref="GeneID:34716988"
                     /translation="MEWLETGQGIRISKQANIVGLDRIVLEGHSVISAGCQVEANVYM
                     VDGDERRTKAAVSLGRYCVLEKNVRVKPPVVGYKKRTPGSQSSQSTQSTQATQSSQGK
                     MPIHCDMSVRSHVWIGQGCKVYCRTIGSSVIVGAGTQLNRCSEIGSVVLIDSGLIIPE
                     RFKIPSYSRVSRHPSMPNSIIIEPISPTFGPMIEQWCKKRYLGAPVDLLGDPQLPTMR
                     EDTDMAL"
     gene            <835800..>837463
                     /gene="PMI40"
                     /locus_tag="KLMA_50384"
                     /db_xref="GeneID:34716989"
     mRNA            join(<835800..835812,836178..>837463)
                     /gene="PMI40"
                     /locus_tag="KLMA_50384"
                     /product="mannose-6-phosphate isomerase"
                     /transcript_id="XM_022820378.1"
                     /db_xref="GeneID:34716989"
     CDS             join(835800..835812,836178..837463)
                     /gene="PMI40"
                     /locus_tag="KLMA_50384"
                     /codon_start=1
                     /product="mannose-6-phosphate isomerase"
                     /protein_id="XP_022676847.1"
                     /db_xref="GeneID:34716989"
                     /translation="MAGSGSKLFRLDAGFQQYDWGKIGSSSAVAQFAAHSDPSVKIEE
                     DKPYAELWMGTHHKVPSYNHETKESLRDIIESNPVEMLGQGIIDRYGSKNELPFLFKV
                     LSIHKVLSIQAHPDKALAKVLHFNDPANYPDDNHKPEMALAVTDFEGFCGFKPLEEIA
                     DELQRIPELRNIVGDEVAEKFIKGIKPEAVKDSADDESNKKLLQEVFSKVMNASNETV
                     VENARALIKRAHESPADFNKPTLPKLLIDLNEQFPDDVGLFCGGLLLNHCTLKAGEAI
                     FLRAKDPHAYISGDIIECMAASDNVVRAGFTPKFKDVKNLVEMLTYTYDSVEKQKMTP
                     EVFDRSSGDGKSILFNPPIDEFAVLYTTFENGAGVRHFEGFHGPSIVITTKGNGYIQL
                     GDLKLKAEPGFIFFIAPETSVDFIAEDPEFTTYRAFVEPN"
     gene            complement(<837654..>838385)
                     /gene="NOP16"
                     /locus_tag="KLMA_50385"
                     /db_xref="GeneID:34716990"
     mRNA            complement(<837654..>838385)
                     /gene="NOP16"
                     /locus_tag="KLMA_50385"
                     /product="nucleolar protein 16"
                     /transcript_id="XM_022820379.1"
                     /db_xref="GeneID:34716990"
     CDS             complement(837654..838385)
                     /gene="NOP16"
                     /locus_tag="KLMA_50385"
                     /codon_start=1
                     /product="nucleolar protein 16"
                     /protein_id="XP_022676848.1"
                     /db_xref="GeneID:34716990"
                     /translation="MASVRRRKMAKSSVRKVSRRNKDKQKKVNIKGNPIIAENWDYSL
                     TLAQNYKRLGLKVKMGKFAGGEEADLTKVVKKEVYQHSAFSDSEDESGSESESDSESK
                     GQDDEKNPDELNSDGEYDETKIPEGEARIVRDEEGNIVKIYYGKKKTIDIDMDVEELR
                     RQVEQNENKTEVVKKLEAFASRPVAKKERSFSDREDQWLEQLYKKHGDNYRKMFFDTK
                     LNVYQQTENQIRRKLLKWKKLHNIE"
     gene            <839155..>840213
                     /gene="SGN1"
                     /locus_tag="KLMA_50386"
                     /db_xref="GeneID:34716991"
     mRNA            <839155..>840213
                     /gene="SGN1"
                     /locus_tag="KLMA_50386"
                     /product="nuclear localization sequence-binding protein"
                     /transcript_id="XM_022820380.1"
                     /db_xref="GeneID:34716991"
     CDS             839155..840213
                     /gene="SGN1"
                     /locus_tag="KLMA_50386"
                     /codon_start=1
                     /product="nuclear localization sequence-binding protein"
                     /protein_id="XP_022676849.1"
                     /db_xref="GeneID:34716991"
                     /translation="MTMTEEEIQGVSHSNLDQENPEIVTVDKSMKNLSLDGKAGEDDH
                     NGHDDEGSVKTESEQTASEKDVVDEDKESPEQEDLVNGKSSSKKDQHQTRAERLEKQI
                     ELDSRSIFVGNITTEATAESLEEHFKDCGEIVRVTILYNKLTGAPKGYAYIEFENVDS
                     VAKALEKKDSQLHGETINVAKKRTNVPGYNNKNNYPRKEWIYPSWQGNVVRQWYYPYS
                     APAYQNYKPNGMPMPPPPPQNAFYSQYPYVSRPAHNGGQKMPGYSRGYYRGNYRGNYN
                     GRRGNSNYRGPRNQNNGHYSRPDSHRNENGDATPATATATTPSPSTTSPVSETSEGNT
                     QVETVETTSDVPASKVEE"
     gene            <842106..>842831
                     /gene="IRC22"
                     /locus_tag="KLMA_50387"
                     /db_xref="GeneID:34716992"
     mRNA            <842106..>842831
                     /gene="IRC22"
                     /locus_tag="KLMA_50387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820381.1"
                     /db_xref="GeneID:34716992"
     CDS             842106..842831
                     /gene="IRC22"
                     /locus_tag="KLMA_50387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676850.1"
                     /db_xref="GeneID:34716992"
                     /translation="MKFSKILLFSSSLTAAFAQIQQHIDVSDIKIDTTQNDDSVEEKA
                     DSMIEPDVQEEPKIAKFLIEYDVVEAEKKNSKGIVEAHKGEEITFFYNFTNQEDSDVN
                     VFGIGGSIIEPSSGQVIAQIPLAEFSPLYVAVNESTNFKQLLPVNLHEGIFYVIPHVY
                     VNKEGEEMTVAAAGSAIQVVPPPMSIFNPQFLSIQVFFLAIIASVSYYVFGFSLNSSK
                     EKPAKKQAKANPIEEWLPETHKK"
     gene            complement(<842928..>844472)
                     /locus_tag="KLMA_50388"
                     /db_xref="GeneID:34716993"
     mRNA            complement(<842928..>844472)
                     /locus_tag="KLMA_50388"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820382.1"
                     /db_xref="GeneID:34716993"
     CDS             complement(842928..844472)
                     /locus_tag="KLMA_50388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676851.1"
                     /db_xref="GeneID:34716993"
                     /translation="MSSGENKSVELDKNFLELCYACRIGDVENADILISSGANVNGVD
                     EFDNSPLFLASLCGHEDVVNLLLRRGAVCDRDRYEGARCIYGALTDSIRNILLKFDIS
                     KAVDVKQPFASHLSSLLNEESLSIASFDFVFIFDGEEYIHAHKFMLVARSAYFKKKFE
                     GPWAHLTRKVMPEGSNVEAFKLILKFIYLVPILHELKPKHLKAVRQLGKKLCLSDFLK
                     YLDMVDHVSDPSEKATLMTEFQYKFNTDSRTQLEAFVHEKIFSNRVEVGGLTDHKIRL
                     LLGQSDNKSFGDTILIVPTADGREFAYLCHKAILIRSTLFKTMFSSLFLEAEAELPIV
                     ALPGPVSCEVAEVVLSYLYYDSTDIPWEITLDVLSVSDYLLTDRLKTMAAVTITQSEE
                     FLKKYSVFDVLHAAWSCSIERLEHHAAKVIAYDMERYIDDDLLKSAIIESSQRIKSRQ
                     DTDTIELVDDIRFYLLQKHDLQPDILELLDSEEDIDFLKKSGLLEYKRDIEIFDSLLQ
                     GLGFDV"
     gene            <844835..>847621
                     /gene="INP51"
                     /locus_tag="KLMA_50389"
                     /db_xref="GeneID:34716994"
     mRNA            <844835..>847621
                     /gene="INP51"
                     /locus_tag="KLMA_50389"
                     /product="inositol-1"
                     /transcript_id="XM_022820383.1"
                     /db_xref="GeneID:34716994"
     CDS             844835..847621
                     /gene="INP51"
                     /locus_tag="KLMA_50389"
                     /codon_start=1
                     /product="inositol-1"
                     /protein_id="XP_022676852.1"
                     /db_xref="GeneID:34716994"
                     /translation="MKLYLRKSPRAIAVVSNGYVLNFEQRKHESSSKVTVQAVGENFF
                     DLGGFTALSNNLSFDGLFGLISVKGQVFIGVIVSSKKVAVPRWRLDQDDRIVEEETVY
                     QVLNINFYCIDNDRYDSMFDDLSDVNYERQLTEHPCGHFKKLISDGSFYYSKNFDMSN
                     CLQERGLVHRVEYTIDNQDQQYIWNFNQISELVQLRSRIAAQERVYFDSGYFLVFLIR
                     GFCQSMIDEKSASVTLISRISTEGMENLQEFKGIDHNGKVSNFVETETIVQTKRYVFS
                     YVMTGGDIPLNWELVEGQLLHTKKPKLLTGAHTVQPSFDLHFDELMSKYGVVSIVNVS
                     KSKNDAYDTLVDTYKECAVSKGIDICLIEDSASSLNKIPHRIIFLLKDKIYEFGSFAY
                     DVEKKIYVGKQTGVFRISAVNLFKNLNVVAKAISHDVLELTANELEEKDISSTFWKLH
                     ESLWKNNEFWLKRLNTKHSKNPSKYRKIYRSLFSPGSIVNLYDPLHIYVSRFLKQRKH
                     DFTFEKEISIFAGTFNVNGKLTKEKVESWLKPIEESPDIYVIGLEEIVELSPGHMLST
                     DPYTKAFWEKKLLTEINSYNDRKYHAVWSSQLGGLALLIFTDDENKARIKHIEGDMKK
                     TGFGGISSNKGAIAVHLSLSNTKFCFVVSHLSAGLENVEQRHNDYKSIAKHIRFSRGT
                     RIKDHDGIIWMGDFNYRILLSNDDVRRAIVERNYHMLFEKDQLNQQMISGESFPFFDE
                     MEITFPPTYKFNPGTSEYDTSEKMRIPAWTDRILSRGEVLRQELYGSAEDILFSDHRP
                     VYALFTATLTVVDETKRAALVSGIKDTINEVLKDLTEEEKLAYLEENDILASNEESKA
                     ANATKPTEAKRNKKLPPPSSDQHKWWVGNGKQAKVTLPVDPEEYMLNPGRNCNPFEPS
                     ELPLYVKRERRLSG"
     gene            <848233..>849537
                     /gene="WBP1"
                     /locus_tag="KLMA_50390"
                     /db_xref="GeneID:34716995"
     mRNA            <848233..>849537
                     /gene="WBP1"
                     /locus_tag="KLMA_50390"
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit WBP1"
                     /transcript_id="XM_022820384.1"
                     /db_xref="GeneID:34716995"
     CDS             848233..849537
                     /gene="WBP1"
                     /locus_tag="KLMA_50390"
                     /codon_start=1
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit WBP1"
                     /protein_id="XP_022676853.1"
                     /db_xref="GeneID:34716995"
                     /translation="MFGVNRAFITLFFMLFAVVNALSVHGLKTLVVYDKRVTDLDQYT
                     NFFTSLKERTYEIVSASVNEDAELLSLYSGEERLYDNVIIFPLKTRQISKEISASKLV
                     QFFSEGGDILAVTSPEGLADPVRVFLNELGIYPSPKNFVTKNFNVDGPTEVLEISTSG
                     VLNKWVYDTTNTTPSDLIYEGSAALLDNSEYIVEILRAPRESVTKDVNNKEEDWTVGT
                     QGHLIAGFQNLANARATWIGSSTFLDDQHFSANGEFIQELTKWTFEEKSVIKSVGFSH
                     KHSNGASYDQVAYKIKDEIVYEIGLSAWNGEKWIPFVTDDVQLELRLVDPYYRLTLKP
                     NRNDEVTQYYSSGDFKLPDHHGMFTFLVDYKRSGLSFVTESDTRAIRHLANDEYPRSY
                     EITNAWVYLTAIASVIVSFVLFIIFFISSSASLPVDSVKKQQ"
     gene            complement(<849640..>849966)
                     /gene="GIM4"
                     /locus_tag="KLMA_50391"
                     /db_xref="GeneID:34716996"
     mRNA            complement(<849640..>849966)
                     /gene="GIM4"
                     /locus_tag="KLMA_50391"
                     /product="prefoldin subunit 2"
                     /transcript_id="XM_022820386.1"
                     /db_xref="GeneID:34716996"
     CDS             complement(849640..849966)
                     /gene="GIM4"
                     /locus_tag="KLMA_50391"
                     /codon_start=1
                     /product="prefoldin subunit 2"
                     /protein_id="XP_022676854.1"
                     /db_xref="GeneID:34716996"
                     /translation="MDSVLQLKYNDYKNTLEELQSKIIELGRDKDEHEVVLRTLNETE
                     PERKCYRMIGSALVDTDVKSTIPVLQTKRDNLEQTINSLKNQLITTAQEFEKWKKDNK
                     IQVVRQ"
     gene            <850708..>851586
                     /gene="VAB2"
                     /locus_tag="KLMA_50392"
                     /db_xref="GeneID:34716997"
     mRNA            <850708..>851586
                     /gene="VAB2"
                     /locus_tag="KLMA_50392"
                     /product="protein VAB2"
                     /transcript_id="XM_022820387.1"
                     /db_xref="GeneID:34716997"
     CDS             850708..851586
                     /gene="VAB2"
                     /locus_tag="KLMA_50392"
                     /codon_start=1
                     /product="protein VAB2"
                     /protein_id="XP_022676855.1"
                     /db_xref="GeneID:34716997"
                     /translation="MNFLFYGDVHHPRKRESYQFKTIASSEHYKGLQNLPSLPSSSNL
                     RQDQIFNKVSNELNQIVADISVVYSKLQDEVDSEGIQTEEINTKVNHSVRKLEASFAK
                     LLKLRSKFIRQAEKKRTRFDDTYGEIDKKIRMIKDANEELLEYVSQRNIAGIDKDQFP
                     RIMGLLKERFPDLNMEPEEEPEEPEDEPEEEPEEPEEREEEPEEEPVESKTGKTSVTA
                     SATLFQHSAPSLSSTPLTFSSICVASEPSIATTLESICITEPFSRPQNTVSTTSTSAP
                     TSAGVGAAAHTQTSLP"
     gene            complement(<851588..>852424)
                     /gene="CFD1"
                     /locus_tag="KLMA_50393"
                     /db_xref="GeneID:34716998"
     mRNA            complement(<851588..>852424)
                     /gene="CFD1"
                     /locus_tag="KLMA_50393"
                     /product="cytosolic Fe-S cluster assembly factor CFD1"
                     /transcript_id="XM_022820388.1"
                     /db_xref="GeneID:34716998"
     CDS             complement(851588..852424)
                     /gene="CFD1"
                     /locus_tag="KLMA_50393"
                     /codon_start=1
                     /product="cytosolic Fe-S cluster assembly factor CFD1"
                     /protein_id="XP_022676856.1"
                     /db_xref="GeneID:34716998"
                     /translation="MSSDLEIQAMPESLKGIKHIVLILSGKGGVGKSSVTTQTALTLC
                     LKGFKVGVLDIDLTGPSLPRMFGMEKKQVYQDSRGWIPVSVPVGSSGSGELKLMSLGF
                     LLDDRGNSVVWRGPKKSSMIKQFIKDVDWGQLDYLIIDTPPGTSDEHISIAEELRWAA
                     PDGAIIVTTPQGVATADVRKEINFCKKVNFNIIGVVENMSGFICPHCAECTDIFSRGG
                     GFKLAQEYNIPYLGNIPIDPTFVELIEKQTGYKESLVDLYKDSSLYTIFSQIIDKVVS
                     GE"
     gene            <852823..>853266
                     /gene="BET1"
                     /locus_tag="KLMA_50394"
                     /db_xref="GeneID:34716999"
     mRNA            <852823..>853266
                     /gene="BET1"
                     /locus_tag="KLMA_50394"
                     /product="protein transport protein BET1"
                     /transcript_id="XM_022820389.1"
                     /db_xref="GeneID:34716999"
     CDS             852823..853266
                     /gene="BET1"
                     /locus_tag="KLMA_50394"
                     /codon_start=1
                     /product="protein transport protein BET1"
                     /protein_id="XP_022676857.1"
                     /db_xref="GeneID:34716999"
                     /translation="MSSNYGGFQGDLTQRDASRTQLFDGADFSKYQQRQQKPTSSFEK
                     SSSGIDYSQATLSQLESQSDEQMNMMSQKIHALKSLSLRMGDEIRGSNQTLDQLGNVF
                     EQTTNRLKRTFKNMMVMAQKSGVSIKTWLIIFGGLTLLFFYIWIR"
     gene            complement(<853473..>855581)
                     /gene="EPS1"
                     /locus_tag="KLMA_50395"
                     /db_xref="GeneID:34717000"
     mRNA            complement(<853473..>855581)
                     /gene="EPS1"
                     /locus_tag="KLMA_50395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820390.1"
                     /db_xref="GeneID:34717000"
     CDS             complement(853473..855581)
                     /gene="EPS1"
                     /locus_tag="KLMA_50395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676858.1"
                     /db_xref="GeneID:34717000"
                     /translation="MRFLLFFIQSWWWLLVFVTATETSSNPSLKFPEPLTEENFKSTI
                     SENLHIVEFFSPYCPHCKSLAPIWEATYFDFYEESQKLNISFHQVNCIESGDLCEQEK
                     IMFYPNIRLYGPDGYIKDYPGGSVHAKEDLINFARQEALDADNLDLTKLRSKSKFATD
                     ADLLKLLSEPQTEPYLVSFWPSTDFEDVDSSYSFKDCEKCSQFQRIWKLVSNKADSEG
                     ITTIHFNCANNTKNSKNDLICRELSYDSLTNERSSREDRYPRVALILPHFKSGSFVKF
                     PYGKLQSDSYSIMDFAVRTLHNSKVPEIDRFEIQNFVEQPMKDILSPDIEDDKMILVF
                     NYDPKTVVPEDTEFLEQLIEPLTYLPNVYLYKCPSDLMALSHNFYKKLYEKFNVDPAV
                     EFSENRFIASSITQLPTFYLFKKSTFTPIIFPGFSTTETRDIKTILDWLTINSMPLVN
                     ELTPRSYRPLIGFEPEIYDKAVIQVINRSSNKFEKGSRKLVEGLRDAAHSYEVVRDEI
                     VYDSLQLARDDKNKAVDKLKSKNVPSRRVVEAMRKEIDHIYDHKALFLYLDINSDPFF
                     LDDLGLNANRRDYKTGDILIFDKKNGFYYEKDAKGEYLTLKTLPRTLAAINFPQRYPE
                     LQIERVRVVTPFAVLYNLADTFREATGLYYLLVPVMLFTLYKLPKVIQYHKLKKRYAA
                     KRDTHGILGAKLSKETKLID"
     gene            complement(<856045..>857154)
                     /gene="YIA6"
                     /locus_tag="KLMA_50396"
                     /db_xref="GeneID:34717001"
     mRNA            complement(<856045..>857154)
                     /gene="YIA6"
                     /locus_tag="KLMA_50396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820391.1"
                     /db_xref="GeneID:34717001"
     CDS             complement(856045..857154)
                     /gene="YIA6"
                     /locus_tag="KLMA_50396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676859.1"
                     /db_xref="GeneID:34717001"
                     /translation="MAEPATTQPMSRELPDGMGDSVPGNVSEVGVSEVGNLGHAPDNG
                     NALRKGYFNDTEITALSGALAGFLAGVVVCPLDVAKTRLQAQGLQEVAVGKTAGYKYY
                     NGIWGTLTTIVRDESVRGLYKGIVPIVLGYFPTWMIYFSVYERCKLTYPQLFHNSEFL
                     SHSMSALSAGAISTTVTNPIWVVKTRLMLQSGKDIKGMTHYKNTLDAFVKIYKHEGIK
                     SFYSGLVPSLFGLLHVAIHFPVYEQLKKILHCYPYKDPRLASDSSSPENIDNQSSQLG
                     QLGRLILASCGSKMIASTLTYPHEILRTGLQLKSDVKPSIGSIIRSTYSKEGIRGFYS
                     GFLTNLLRTVPASAITLVSFEYFRKHFKLWNDEMV"
     gene            complement(<857921..>859285)
                     /locus_tag="KLMA_50397"
                     /db_xref="GeneID:34717002"
     mRNA            complement(<857921..>859285)
                     /locus_tag="KLMA_50397"
                     /product="Gti1/Pac2 family domain-containing protein"
                     /transcript_id="XM_022820392.1"
                     /db_xref="GeneID:34717002"
     CDS             complement(857921..859285)
                     /locus_tag="KLMA_50397"
                     /codon_start=1
                     /product="Gti1/Pac2 family domain-containing protein"
                     /protein_id="XP_022676860.1"
                     /db_xref="GeneID:34717002"
                     /translation="MDVKPTLNRAYIESIDDALKVVECVLSGYLHSVSRRPYEIERPK
                     LICSGHIFVFIEEKSGIKRWTDGVSWSPSRIVGKFLVYKELFKASGQAVASPGGLNGG
                     PNGAAGPSYSYRSDGLIKKALSLRVRAKPGELKEEDVEQALNQNVDYFTVHIISYYTL
                     DDISNGILLTPSELEPFRGVVPSQRLLEALEMSSIGNNKTVGPPKFKHRDRPKPKAVG
                     AASAGAVAGSKVSSSAAASKASKKISPRISTPILGQFPPRPFPLQHSSSQMGSQMGSQ
                     MGSHNSPIVLMPPLSLAHQLPQPVSQQPVSQQFAGSPSAAPYGIHFQYHHQPFPFPCP
                     NPQYPQEPYNSYLPALPMPQPVLHTLPALAPYQTPHQSTNQGPGQYMGPHHRQLANTS
                     ASITFSTSASASASTSTSTNISTKPQYPVPTTGLTPGPVPSGPASSGTAPGQAPGPPA
                     PVKP"
     gene            <862997..>864100
                     /gene="GCN4"
                     /locus_tag="KLMA_50398"
                     /db_xref="GeneID:34717003"
     mRNA            <862997..>864100
                     /gene="GCN4"
                     /locus_tag="KLMA_50398"
                     /product="general control protein GCN4"
                     /transcript_id="XM_022820393.1"
                     /db_xref="GeneID:34717003"
     CDS             862997..864100
                     /gene="GCN4"
                     /locus_tag="KLMA_50398"
                     /codon_start=1
                     /product="general control protein GCN4"
                     /protein_id="XP_022676861.1"
                     /db_xref="GeneID:34717003"
                     /translation="MIKELNKKMNMNMNMNTSTNMNNMNEDMSVNPFQQQYMNLSSAK
                     SSDVAMAATAADVKIELNQSSTMGELIFDKFINHVVDHPVHQAESPVAPVSGDRNTTI
                     VESSASSHHDVSPTLFHMNSADPTIGSTEISATELSASIVDNFFDPSSSTDSTPMFEL
                     DNQDLGGVETWTSLFDNDIPVTLDDVSASANAATLELELESNAQHASESQVQLESVAS
                     ESNVSIVNDLVAPSTTSMASLKQNQFLPTPMLEDDLQLPKPRKASASTSASGKVTKSS
                     SRNSTSGTKLDDLGVVAYSRKQRSAPLTPVIPESDDPLAVKRAKNTEAARRSRARKLQ
                     RMNQLEEKVKELLERNSDLENEVVRLRSLLGSQ"
     gene            <864633..>865301
                     /gene="NAS2"
                     /locus_tag="KLMA_50399"
                     /db_xref="GeneID:34717004"
     mRNA            <864633..>865301
                     /gene="NAS2"
                     /locus_tag="KLMA_50399"
                     /product="probable 26S proteasome regulatory subunit p27"
                     /transcript_id="XM_022820394.1"
                     /db_xref="GeneID:34717004"
     CDS             864633..865301
                     /gene="NAS2"
                     /locus_tag="KLMA_50399"
                     /codon_start=1
                     /product="probable 26S proteasome regulatory subunit p27"
                     /protein_id="XP_022676862.1"
                     /db_xref="GeneID:34717004"
                     /translation="MNKLEAVASTENNGIPNALVSRVNDLPHLGFSEVSQLKKDIEHE
                     LERQFDLLSLNNVDLNTPLITAEGFPRDDLDLVTIRLIKRNVNVLRNDLRRVIERLEY
                     LLPLEFESLQRQNSAVQKLEALDTSLVDDDSLLAFAKVVDVKIGSPSHEAGLQSDDLI
                     VKFGTIHALNHNNLYNVGKLVQQQLNKEISLRVKRDDEIITIQLVPRPWQGAGLLGCR
                     IIRI"
     gene            complement(<865339..>865644)
                     /gene="URM1"
                     /locus_tag="KLMA_50400"
                     /db_xref="GeneID:34717005"
     mRNA            complement(<865339..>865644)
                     /gene="URM1"
                     /locus_tag="KLMA_50400"
                     /product="ubiquitin-related modifier 1"
                     /transcript_id="XM_022820395.1"
                     /db_xref="GeneID:34717005"
     CDS             complement(865339..865644)
                     /gene="URM1"
                     /locus_tag="KLMA_50400"
                     /codon_start=1
                     /product="ubiquitin-related modifier 1"
                     /protein_id="XP_022676863.1"
                     /db_xref="GeneID:34717005"
                     /translation="MVRVTVEFLGGLDVIVKKQRQYKVDVKVDGKDEVDVGDLIQWIV
                     DNLIEHERDVNVFLENDSIRPGILTLINDTDWELEGEKEYVLEDGDVVSFTSTLHGG"
     gene            865936..866008
                     /locus_tag="KLMA_R518"
                     /db_xref="GeneID:34718741"
     tRNA            865936..866008
                     /locus_tag="KLMA_R518"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:34718741"
     gene            <866621..>868360
                     /gene="LEU4"
                     /locus_tag="KLMA_50402"
                     /db_xref="GeneID:34717006"
     mRNA            <866621..>868360
                     /gene="LEU4"
                     /locus_tag="KLMA_50402"
                     /product="2-isopropylmalate synthase"
                     /transcript_id="XM_022820397.1"
                     /db_xref="GeneID:34717006"
     CDS             866621..868360
                     /gene="LEU4"
                     /locus_tag="KLMA_50402"
                     /codon_start=1
                     /product="2-isopropylmalate synthase"
                     /protein_id="XP_022676864.1"
                     /db_xref="GeneID:34717006"
                     /translation="MPFYKDPSVKYKPFVSTVKLQERTWPTKTLQKAPRWLATDLRDG
                     NQSLPDPMNVEEKKLMLEKLCDMGFKEIEVAFPSASNIDFEFTQYAVKNVPDDVSVQV
                     LSPCREPLIERTVESLIGAKRATVHIYLATSPCFREIVFNNMSHEECIEKAVKCTKLV
                     RSLTKDHPERQETDWSFEFSPETFSDSEPEFVIEICEAVKAAWEPTSENPIIFNLPAT
                     VEMSTPNVYADQIEYFSKSISEREKVCISLHPHNDRGCAVAAAELAQMAGADRVEGCL
                     FGNGERTGNVDLVTLALNLYTQGVSPKLDFSDMASIIEVVERCNKIPVHARAPYGGQL
                     VVCAFSGSHQDAIKKGFEKYDAKVKALQEREGPDAVVPWKMPYLPLDPQDIGRTYEAI
                     IRVNSQSGKGGSSWVILKNLELDLPRGLQIAYSKIVQAETEVVGRELKSDELVSLFEK
                     SYFVGTCSDSGKFKFVDYKFDKSPKESTLSVVLTDGSQEWDLKGKGNGPISSFIDAVN
                     TKFNTKLDVKDYHEHSLGKSSDSRAATYISISSDDFVQWGVGIHEDTTQASFLALLSC
                     INGLERANRFSTN"
     gene            868567..868677
                     /locus_tag="KLMA_R519"
                     /db_xref="GeneID:34718742"
     tRNA            join(868567..868601,868639..868677)
                     /locus_tag="KLMA_R519"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718742"
     gene            868806..868877
                     /locus_tag="KLMA_R520"
                     /db_xref="GeneID:34718743"
     tRNA            868806..868877
                     /locus_tag="KLMA_R520"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:34718743"
     gene            <869093..>869638
                     /gene="EST3"
                     /locus_tag="KLMA_50403"
                     /db_xref="GeneID:34717007"
     mRNA            <869093..>869638
                     /gene="EST3"
                     /locus_tag="KLMA_50403"
                     /product="telomere replication protein EST3"
                     /transcript_id="XM_022820398.1"
                     /db_xref="GeneID:34717007"
     CDS             869093..869638
                     /gene="EST3"
                     /locus_tag="KLMA_50403"
                     /codon_start=1
                     /product="telomere replication protein EST3"
                     /protein_id="XP_022676865.1"
                     /db_xref="GeneID:34717007"
                     /translation="MPNVVLSSKLRPYDSIFLQEWIHSAVQRHYIRNKSKRFWHPEQN
                     LVAPLPQTQEHSFFHAAFHPGSYTFVRIVKFHKVHNYTVYATIRDASHMILCFFTSQC
                     VLDYEMHNNDRITLNTINTLFVVGQVTLEFWNQAEVQRHYGLSFPNMPMVPILKIEQA
                     QIFDRDQIGSTKPFNWVYYAF"
     gene            <869995..>871353
                     /gene="APM1"
                     /locus_tag="KLMA_50404"
                     /db_xref="GeneID:34717008"
     mRNA            <869995..>871353
                     /gene="APM1"
                     /locus_tag="KLMA_50404"
                     /product="AP-1 complex subunit mu-1-I"
                     /transcript_id="XM_022820399.1"
                     /db_xref="GeneID:34717008"
     CDS             869995..871353
                     /gene="APM1"
                     /locus_tag="KLMA_50404"
                     /codon_start=1
                     /product="AP-1 complex subunit mu-1-I"
                     /protein_id="XP_022676866.1"
                     /db_xref="GeneID:34717008"
                     /translation="MASYIAFCDSKGKPLLSRRYKDDVSQAAVEQFQHLLIEKEQESS
                     ITPPCFQHNGVHYMYVQYNDIYVLALTRSVLMNVTTLFSFLYKLIGVVEEYVKRVEEE
                     SIRDNYIIIYELLDEMMDKGIPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTEL
                     TNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTIKVRSRLSGMPDLK
                     LGLNDKGIFTTQNGSDDSPEPGMPSSSSTSAASRARGANIELEDLKFHQCVRLSKFEN
                     EKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVKVLVHSGSRIEIHCRAKAQIKKKSIA
                     NNVEILIPVPEDADSPTFKYSRGSIKWVPEKNAILWKFSSFQGGKEYSMAAELGLPSV
                     SDFETPKLKRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTI
                     RL"
     gene            complement(<871413..>872048)
                     /gene="DOT5"
                     /locus_tag="KLMA_50406"
                     /db_xref="GeneID:34717009"
     mRNA            complement(<871413..>872048)
                     /gene="DOT5"
                     /locus_tag="KLMA_50406"
                     /product="peroxiredoxin DOT5"
                     /transcript_id="XM_022820400.1"
                     /db_xref="GeneID:34717009"
     CDS             complement(871413..872048)
                     /gene="DOT5"
                     /locus_tag="KLMA_50406"
                     /codon_start=1
                     /product="peroxiredoxin DOT5"
                     /protein_id="XP_022676867.1"
                     /db_xref="GeneID:34717009"
                     /translation="MVELRRSSRLSANKTATQDSDSNSDSIKTQPKTKTESKVTKPKE
                     SSKKEIDTKVIEKKLSELQVGDEIPDLTLKNQDDEPVSLKDVASKNPLVIFFAYPKAS
                     TPGCTRQACGYRDNYSELKEHAAVFGLSADSPKAQKNFQTKQTLPFDLLSDPKREFIG
                     LLGAKKTPASGVIRSHWIFKNGKLEVKRVQVSPEVSIQEGKKEVLELAKSL"
     gene            complement(<872549..>874345)
                     /locus_tag="KLMA_50407"
                     /db_xref="GeneID:34717010"
     mRNA            complement(<872549..>874345)
                     /locus_tag="KLMA_50407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820401.1"
                     /db_xref="GeneID:34717010"
     CDS             complement(872549..874345)
                     /locus_tag="KLMA_50407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676868.1"
                     /db_xref="GeneID:34717010"
                     /translation="MSSNNHPQEVPKEEEEILQYFLEVRSFLSKMKQNRSQFLNSKDV
                     MESYQKVLTKVRELDELRKNSHATPSNSATTLIHSAELHNRVDSVIDDVFQLLSLSFL
                     TVGLKNSAPATYASLSTVQSLLEHLNESNVYTHHDLRPIKERLDEVSAIVEQNKYDTE
                     ASAAAASASSAYVDPDVEDPELEEYALKKDEELNKNKIEEDLLLRAKLQHCIDEYHVI
                     ESKLEEIHPDLQSCMETLFQIRRGLLSLASSTKRQDSASEVKAEAESKSKSKSKPSSS
                     SQSHHILPEDVVDSKLKELKERLEKLEAHRDSNGKFKSLETDKVEEKGQNVLNGLLDD
                     CHDLINDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLLVTRRWTLRETDLFTYQKK
                     LGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKLLESSEPVSESLQRVHNQL
                     STVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRTDGIFYDSDGNIPEGQGTLNAL
                     LAECFDIIHELKIEAEERAEESLDINENGDESVEMTKDPTMRDVQEQPTARYMDVYAH
                     DEDDEDDEAEDTNFSEHSYEDEEYTTTSYAED"
     gene            complement(<875011..>876309)
                     /locus_tag="KLMA_50408"
                     /db_xref="GeneID:34717011"
     mRNA            complement(<875011..>876309)
                     /locus_tag="KLMA_50408"
                     /product="protein SLG1"
                     /transcript_id="XM_022820402.1"
                     /db_xref="GeneID:34717011"
     CDS             complement(875011..876309)
                     /locus_tag="KLMA_50408"
                     /codon_start=1
                     /product="protein SLG1"
                     /protein_id="XP_022676869.1"
                     /db_xref="GeneID:34717011"
                     /translation="MLKLYICVLIALGRVASGLQQVGCFSSLPSSFSGGSTNEYQSSG
                     ACAQTCSGSQYFALYNHNKCFCGDENPSGSVSKSDSCNAYCFGYRQEMCGGTDAYLVY
                     AIGGVSSGSSSSSSSGGSSSGSGSETSTSTGSGTDSDGATSSDGTFTSSSSGTGSVTS
                     TSTSSSSSSSSSSSSSNGPTSTTSNTGTSTQSEPEPSVVYSTLIKTVSGSVLYTTTNV
                     ATASVASGNTDTGKGSSSHGSKKKTNVGAIVGGVVGGVVGLLLIILAVVFAIRHISRR
                     RENERMEKEYQEAIKPVEYNAQKENYYASSFSDHMHTGDSGHSNPSLSEGNVFQNHHT
                     PMDDMSHVTPMTGGTVTPLGGGPPGGPNTGLSDPLSSGVVGGGPGSGAGGPGGGLGVA
                     VPPGISDPFADPRRFSNGSLLDPSLNQGERNKLTIVNPDE"
     gene            <879717..>882341
                     /gene="MUC1"
                     /locus_tag="KLMA_50409"
                     /db_xref="GeneID:34717012"
     mRNA            <879717..>882341
                     /gene="MUC1"
                     /locus_tag="KLMA_50409"
                     /product="flo11 super family"
                     /transcript_id="XM_022820403.1"
                     /db_xref="GeneID:34717012"
     CDS             879717..882341
                     /gene="MUC1"
                     /locus_tag="KLMA_50409"
                     /codon_start=1
                     /product="flo11 super family"
                     /protein_id="XP_022676870.1"
                     /db_xref="GeneID:34717012"
                     /translation="MRLLNVANKVFGTLAIIQGITSANPLPGLSGDSLSKRTYSSSND
                     VDFVKGKNTGSTPVSFTNGCPCLDFTYHAETQNTLVYHMDMVSVKWDHDNIYLITIHV
                     YADEQISIENMWSLKIIGVDSPDGSTFQLYGHNENTYLINNPTDWTATFRVYATPDSS
                     NPDIQWMPNFQIQYEYCQGSATCDSNWSGKYKASSFDLITGCNNFDNNKRSQTDFPGY
                     YWFKDHQEHSGVYPPSYACSKQPTTPTSTTTTADKKTTSTTTTTTPDKKTTSTTTTTT
                     PDKKTTSTTTTTTPDKKTTSTTTTTPTTTPDKKTTTTTTLAPSQGTSTTTAKTPTTTT
                     TSKSTPVTTTATTPTTTTTTPGITAETTTSKSSPASSAPASSTASSSAPLSSTQTSSV
                     PTSSAPESSTASSSVPASSAPTSSAPESSTASSSAPLSSTQTSSVPTSSAPESSTASS
                     SVPASSAPTSSAPESSTASSSVPASSAPTSSAPESSTASSSVPASSAPTSSAPESSTA
                     SSSVPASSVPTSSAPESSTASSSVPASSAPTSSAPESSTASSSVPASSVPTSSAPESS
                     TASSSAPASSTTPTTLAPTQGTSVSSSSELSSSVTVLTASSETQSTLTTDVSSSVPPS
                     LAPSTTSGVSSTVSTITYTTSGVVKTLTTTICNATSTEPTPSSTVKTITYTSSGTVKT
                     ATITNCGDRDCTATGVTTTPVVTAATASSPGAPGAPSSTVKTITYTTEGTVTVLTTTI
                     CSTPVGPAPAASTTTPVGPAPAASTTTPVGPAPAASTTTPVGPAPAASTTTPVGPAPA
                     ASTSTPVGPAPAASTTTPVGPAPAASTTVPSVSVSVYTSAPASSTQTVQTYAGYAAIN
                     TQNGFTLLSSFLAAMLLI"
     gene            <883362..>884849
                     /locus_tag="KLMA_50410"
                     /db_xref="GeneID:34717013"
     mRNA            <883362..>884849
                     /locus_tag="KLMA_50410"
                     /product="cd14688 domain-containing protein"
                     /transcript_id="XM_022820404.1"
                     /db_xref="GeneID:34717013"
     CDS             883362..884849
                     /locus_tag="KLMA_50410"
                     /codon_start=1
                     /product="cd14688 domain-containing protein"
                     /protein_id="XP_022676871.1"
                     /db_xref="GeneID:34717013"
                     /translation="MIVYQDLKPKDKSYQKQVGTGNGVGKELRDTSKGPQLSRKWVLP
                     PKSVRRVDLEGSGQASVSKSGVMSVPVPVSGGTGSDKDSGSYNGIGVGSGSGSGGGNG
                     VTYAEKRRKQNREAQRAYRERKASKMQELQQAIDFWKRKCESLQHESNVWKSRYESAV
                     LESRNVSQAYESRLASYMRENSELRAKSSAIATDTTSSAAAAAAAVQGLDTPVTISHN
                     TSPAITSGLNIEVQYDKNGNPTGIPSSSDASTGLSKDSPAGHTSGKSCTICADGSCIC
                     DELELSGSSTSPGPTSFQDPLLQFTIDNWKPIKPVSIQAKRAGSVTPAGSTLPQFKRL
                     RTTPVGNVQPVGNVPPVGNMVTEDCGFCSESSTCVCREAANETACKQEPGSCSACQAD
                     SNSRKFCQNVVRWARGVSPGGQTEVEGEASGSIASASSSSISSASSNEYIPINDAFQR
                     IKKHMKNSSNLSPNTINYDALALKGRKVQLKSVMDIINDMNKNFI"
     gene            complement(<884974..>886437)
                     /gene="GAS5"
                     /locus_tag="KLMA_50411"
                     /db_xref="GeneID:34717014"
     mRNA            complement(<884974..>886437)
                     /gene="GAS5"
                     /locus_tag="KLMA_50411"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820405.1"
                     /db_xref="GeneID:34717014"
     CDS             complement(884974..886437)
                     /gene="GAS5"
                     /locus_tag="KLMA_50411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676872.1"
                     /db_xref="GeneID:34717014"
                     /translation="MKFSKVCAVLASALCVSAQDSTGASAGTGTSTASGASSTGSSSG
                     NGTLPAIEIKGNAFFDSSSGERFYIRGVDYQPGGSSNLTDPLGDETVCSRDIPYFKEL
                     GLNTIRVYTIDNSLDHTACMKLLDEAGIYLILDLNTPGASISRYRPECSYNADYLQSV
                     FATVDEFAKFDNTLGFFAGNEVINSENTTNTAVYVKATVRDIKKYLKARNYRKVPVGY
                     SAADVSSNRLLAAEYFNCGDDADARIDMFGVNDYSWCGSSSFQVSGYAQKMQLYKNYS
                     IPIFLSEYGCNKVPGSRPFTEVTAIYSDLMSSVFSGGLVYEYSQEDNKYGLVQIDGDS
                     VTELQDYKNLKAEFQKVQNPQGDGGYSENNKYSDCPAYEKGIWESNSTLPSMPDAASA
                     YFKSGAGSPLGTGVITQEMCDKEDDDDSSSSSVTATATSTSKSASASSHSSSASGSAS
                     HSGSASSTSSTSKSKGIAGSVEAPLAYGIMAFFSFLI"
     gene            complement(886913..886985)
                     /locus_tag="KLMA_R521"
                     /db_xref="GeneID:34718744"
     tRNA            complement(886913..886985)
                     /locus_tag="KLMA_R521"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:34718744"
     gene            887395..887466
                     /locus_tag="KLMA_R522"
                     /db_xref="GeneID:34718745"
     tRNA            887395..887466
                     /locus_tag="KLMA_R522"
                     /product="tRNA-Met"
                     /db_xref="GeneID:34718745"
     gene            <887680..>888399
                     /gene="ADI1"
                     /locus_tag="KLMA_50412"
                     /db_xref="GeneID:34717015"
     mRNA            <887680..>888399
                     /gene="ADI1"
                     /locus_tag="KLMA_50412"
                     /product="1,2-dihydroxy-3-keto-5-methylthiopentene
                     dioxygenase; Acireductone dioxygenase"
                     /transcript_id="XM_022820406.1"
                     /db_xref="GeneID:34717015"
     CDS             887680..888399
                     /gene="ADI1"
                     /locus_tag="KLMA_50412"
                     /codon_start=1
                     /product="1,2-dihydroxy-3-keto-5-methylthiopentene
                     dioxygenase; Acireductone dioxygenase"
                     /protein_id="XP_022676873.1"
                     /db_xref="GeneID:34717015"
                     /translation="MSKHLFKPVSVLLFVFKALSENDIYIINPCASLDKVFLTKKLAI
                     SKPLAPLGPLIPLQKPPMLSYIHDNNDTVDFREAHDTGKPVSLERLASLGLIYKHFDD
                     QEDVDSFAKERNYKNRDIVNISKDSFPNQQAMLDKLAVFYAEHLHEDEEIRYCLDGEG
                     YFDVRDPFTEEWIRCKLNKGDLLVLPAGIYHRFTLTSSNYIKALRLFKEEPKWQAYNR
                     PEADSNPYRKEYLSQVQAGTV"
     gene            <888761..>889909
                     /locus_tag="KLMA_50413"
                     /db_xref="GeneID:34717016"
     mRNA            <888761..>889909
                     /locus_tag="KLMA_50413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820408.1"
                     /db_xref="GeneID:34717016"
     CDS             888761..889909
                     /locus_tag="KLMA_50413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676874.1"
                     /db_xref="GeneID:34717016"
                     /translation="MGFVDVIRRATEALEKDISGSSGDAVAAVAEAAEAASGSGSEGY
                     FSKIDQFYIPEWLTMQFIANNLISFTPLFSYGTTVLAIQKSQTALGFSLDICATMLIA
                     SILRVSYYLITPYELALLRQSIVMILIQLLLLKTALRYRPDDYKYDNLEPVETLYELI
                     QDVWVQYFPSNPFDDVYNEDWRPLLRSLSWKNLLGFTYKIFLVFLYKFLKFFDPSFKR
                     FKGFWQWNDDKQYWKFLAVFGCCQFFITLLISKVFNWEAFSQWVGSLIGSLGLFIESL
                     LPLPQISIFYKLKSVQGFKLIILVSWLCGDILKISYLVFGANNISIIFLCFGLFQMSL
                     DIYIACQYIYYKYYYPYLRHSDEDVEALRLREEVELRDLSSLQKEMVV"
     gene            complement(<890035..>892158)
                     /gene="PET127"
                     /locus_tag="KLMA_50414"
                     /db_xref="GeneID:34717017"
     mRNA            complement(<890035..>892158)
                     /gene="PET127"
                     /locus_tag="KLMA_50414"
                     /product="Pet127 family protein"
                     /transcript_id="XM_022820409.1"
                     /db_xref="GeneID:34717017"
     CDS             complement(890035..892158)
                     /gene="PET127"
                     /locus_tag="KLMA_50414"
                     /codon_start=1
                     /product="Pet127 family protein"
                     /protein_id="XP_022676875.1"
                     /db_xref="GeneID:34717017"
                     /translation="MLRYRYGAVRCASKGRQPNISATDGLKRQETWIKKVITSQSLTR
                     RNDKFSAFTDQLTPVPKEYTGELSKPPTLKHSLTQCLYQPMNIVPLRDNRTSVFNFTP
                     FLESLIDVEDFDFDGISPFIPPSQDPKLAKITENMDKRYFSSTSSMTGLLSHMHFLLS
                     NFRPLNLDQLTRSISPQYPTFTRGARSSCAIIMKRTKNGCDRFSISADKSINKDIILS
                     RLGHCLEMLLTTPEQEFDKRYNKNVRNKAEQKTLSSSTSVDNYHYATIGDFVLRSQLD
                     AYEPNLPGTGVFDLKTRAVAAIRHDLCHVENNDNYTGYELNRRYGSFESFEREFYELV
                     RSTMLKYSLQARIGNMDGIFVAYHNISKMFGFQYIPQQEMNHILHSNVGNAAKRKLKA
                     GADVLRVIYGDEKYVTKHEYETNQYQIAQKVAEAEFNISMQFVSSFFKNIESLLEKDQ
                     HARIVIKTTASKRKNTSVMHVLVTPLDEKELETLESMKLSQVLFQQDHKHINEYIIKL
                     NDIHHNMMWKTVGYTVSVDHEFDNRFDETSNRLPYYGSESEKTKEYIRSVLRNHSEDW
                     EHPYFHYPEEVNDWKVKFNITPITDNRELRSLLRKTLGEQLGFLESQTVEKTDDKMLK
                     GPEFVRSQLSKLVHGKGRSLDELHLRKHDDNDISTLQSMLRALGDKKRNQDANKKSAS
                     SHSNSPVMWNQNEKPSSKSNNHPKP"
     gene            <892850..>894094
                     /gene="AIM17"
                     /locus_tag="KLMA_50415"
                     /db_xref="GeneID:34717018"
     mRNA            <892850..>894094
                     /gene="AIM17"
                     /locus_tag="KLMA_50415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820410.1"
                     /db_xref="GeneID:34717018"
     CDS             892850..894094
                     /gene="AIM17"
                     /locus_tag="KLMA_50415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676876.1"
                     /db_xref="GeneID:34717018"
                     /translation="MSFKFLFRPQFVRFNCTSPKIIAKDVTKYGITLQIQQGTDIKKQ
                     YLDHFLLRDASQSPTSVDTVSGQKLFTMGSLLNHPSGPIRPQLADIVQDGAALEVHWS
                     DGDQFTYTSKYLESLYDDSVSIKKFEPEIWNKDAPLSLSKISVDFHSYMDPHDETHLY
                     EMMKVLDRYGIALITNIPNEAITNYTDWYVQMICERIGHVRTTFYGELFDVKNLETQA
                     NNIAYTSKPLPLHMDLLYLENVPGWQLLHCIKNSKDSGQNYFADTLAALQHIKSVDDS
                     VLKALEQIPLSYHYRRDDKRYYQRRPLVEHKKHETVINYSPPFQGPVNLTEVDLSSSS
                     EKQTLEKFKKGLAMFENYINDPQNQFQIMLPENSCVIFHNRRVLHARKAFEGERWLKG
                     CYLDADTFSSRLTALYEKFGEE"
     gene            <894243..>895376
                     /gene="SPO11"
                     /locus_tag="KLMA_50416"
                     /db_xref="GeneID:34717019"
     mRNA            <894243..>895376
                     /gene="SPO11"
                     /locus_tag="KLMA_50416"
                     /product="meiosis-specific protein SPO11"
                     /transcript_id="XM_022820411.1"
                     /db_xref="GeneID:34717019"
     CDS             894243..895376
                     /gene="SPO11"
                     /locus_tag="KLMA_50416"
                     /codon_start=1
                     /product="meiosis-specific protein SPO11"
                     /protein_id="XP_022676877.1"
                     /db_xref="GeneID:34717019"
                     /translation="MDCSLRTLMDGCHSRAELKQRMLPRSRVVEFSKIKSEEECQRQI
                     TNNMRFMRLALKEHGIPIEIRFHNSRNNEVSWKYPEFGSNWKKCSKVPQLLQLLSIVN
                     ERLKLKKTSTTVRDIYYGNVELFGNQSTVEQLLQRLESMFQVEKQFFNIVSTQKGLLF
                     AGPKLSIEGQIFHQECQLVPYMNKEEVPISIGAGESCAKVVVLEKDAIFQQLIQCKNL
                     VQNWIVITGKGYPDLLTRQLLHHMGQKLPQEVEFLIYTDSDPYGIDIVTKYMSHATLR
                     NVQCSRIKHKGVLLSQLIARNRPGTHQMLVLLPLSLRDSTFAMNLIRRMMCQDTQIEE
                     KTKRSLRDELQKQLFFQRKGEMNVVNNGDLEQYFSEEALRNTT"
     gene            complement(895455..895578)
                     /locus_tag="KLMA_R523"
                     /db_xref="GeneID:34718746"
     tRNA            complement(join(895455..895492,895545..895578))
                     /locus_tag="KLMA_R523"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718746"
     gene            <896004..>896633
                     /gene="ERP4"
                     /locus_tag="KLMA_50417"
                     /db_xref="GeneID:34717020"
     mRNA            <896004..>896633
                     /gene="ERP4"
                     /locus_tag="KLMA_50417"
                     /product="protein ERP4"
                     /transcript_id="XM_022820412.1"
                     /db_xref="GeneID:34717020"
     CDS             896004..896633
                     /gene="ERP4"
                     /locus_tag="KLMA_50417"
                     /codon_start=1
                     /product="protein ERP4"
                     /protein_id="XP_022676878.1"
                     /db_xref="GeneID:34717020"
                     /translation="MIFALIPLLTVFFCSFCAAQSSNYAPFAIALPAFSKECLYHDLL
                     DANDALVVSYQVLTGGNFEIDFDITAPDGSTIVTEKQKKYSDFLLRSFGIGQYKFCFT
                     NTHGTALKKVEVTLEMAKNEMSDDQTEKPEDLITNNAIEEIDRNLNKITKMMNYLRAR
                     EWRNMYTVQSTESRIVWLSILTMGIMAGISILQATIVHFMFKDRQRNYV"
     gene            <897004..>898230
                     /gene="RPN7"
                     /locus_tag="KLMA_50418"
                     /db_xref="GeneID:34717021"
     mRNA            <897004..>898230
                     /gene="RPN7"
                     /locus_tag="KLMA_50418"
                     /product="26S proteasome regulatory subunit RPN7"
                     /transcript_id="XM_022820413.1"
                     /db_xref="GeneID:34717021"
     CDS             897004..898230
                     /gene="RPN7"
                     /locus_tag="KLMA_50418"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN7"
                     /protein_id="XP_022676879.1"
                     /db_xref="GeneID:34717021"
                     /translation="MPEETETQYSDPAVNRVPNYEASDHAFVLSQERLAHLHEESREK
                     LLEIVREEEMAPYYKHLSGELPSSVFEWDQSFYDGLVARNEEEIAKLKAHLEEIEEKD
                     EGELEKAQSWINLGEYYAKIGDRENAEETLTKALDKAVSTGAKIDIMLTITRLGFFYN
                     DQHYVKQKLEAVNSLIEKGGDWERRNRYKTYKGIHSLAIRDFKTAASLLVDSLATFTS
                     TELTSYENIATYAFVTGLFAFERTDLKDKIIDSPELLALMTTTPALQSISSLSISLYT
                     SEYKSYFPYLLETYDKVLLPSKYLNQHADYFVREMRRKVYAQLLESYKTLSMKSMAGA
                     FGVSEDFLDKDLCKFIPTKQLNCVIDRVNGIVETNRPDNKNAQYQLLVKQGDGLLTKL
                     QKYGAAVKLTGTDRII"
     gene            <899080..>900729
                     /gene="CTT1"
                     /locus_tag="KLMA_50419"
                     /db_xref="GeneID:34717022"
     mRNA            <899080..>900729
                     /gene="CTT1"
                     /locus_tag="KLMA_50419"
                     /product="catalase T"
                     /transcript_id="XM_022820414.1"
                     /db_xref="GeneID:34717022"
     CDS             899080..900729
                     /gene="CTT1"
                     /locus_tag="KLMA_50419"
                     /codon_start=1
                     /product="catalase T"
                     /protein_id="XP_022676880.1"
                     /db_xref="GeneID:34717022"
                     /translation="MPSDPPVYSTSNGFKYPHHPYGAQYARPGGPILLQDSHLIESLA
                     RFDRERIPERVVHAKGGGCHFEFELTDSLSDITYADPYQTPGYKCPGVVRFSTVGGES
                     GTPDTARDPRGVSFKFYTKWGNHDWVFNNTPVFFIRDANKFPHFIHTQKRYPHNHLGQ
                     ASDSGMYWDYLTQNVESIHQITYMFGDRGTPASWTDMSAYSGHTFKFVNKEGDLTYVQ
                     IHVLPENGFKTLPLEKASELAGKNPDYHQQLLYEKLQRGEKPKYTCYVQTMTPEQAEN
                     FRYSINDLTKVWPHKEFPLRKFGTITLTENVTNYFEEIEQIAFSPSNTCIPGIEPSND
                     SVLQSRLFSYPDTQRHRLGANYMQLPINRPANMGKEMCPFAGANFQRDGPMCLFNFKD
                     QPNYIATHAGENAVKFAECTREGGQIAPHDKFTGVVLEKDVLEEIKKQEEKRSGHEQV
                     VNAKINEYYIVNGCSPLDLEQPRALYEKVYDDEMKEHFVNNVVAHASNISIPEIKTRV
                     SQYFGLLNADLGQKIAKGLGIAWEPLTFEEYAAKISTSAAY"
     gene            <901164..>904139
                     /gene="NNF2"
                     /locus_tag="KLMA_50422"
                     /db_xref="GeneID:34717023"
     mRNA            <901164..>904139
                     /gene="NNF2"
                     /locus_tag="KLMA_50422"
                     /product="protein NNF2"
                     /transcript_id="XM_022820415.1"
                     /db_xref="GeneID:34717023"
     CDS             901164..904139
                     /gene="NNF2"
                     /locus_tag="KLMA_50422"
                     /codon_start=1
                     /product="protein NNF2"
                     /protein_id="XP_022676881.1"
                     /db_xref="GeneID:34717023"
                     /translation="MPCEDVSLSFIRKHHFKDSLALLVVFLSFNHIASLLLLVSFSIV
                     TRSRNFLSECFIRFFLPKSHYNGFINDDDYQIKPVCGGSVQVASGNSNASGNAKIPKK
                     KLGAAAAKQQQQQQQQQQQQQQQQQQQQQQQQQSHHQQQQQQQQQPTVLISGGVDRPS
                     ILSGGGDIGKSKYASSKKKKVFLLIQELLVASLLRYYGDKYFSEPIENLAMSIVASCL
                     VNDPKDALSVATTCSIMYALSTQWIQKLMMILDIKNTFIGFPARPSSARLIEKYPQLM
                     HKLPAIFEVLSFSSKYIRYASYLASFHVVVSQIKQNLIVQSYERKSESINSSNNNNNN
                     NSNNNSSNGSTNGAETPGAAATGGANNSGENGANGSPALTPVKDTSTSNSHTNAGNGS
                     GIQAASMTQAASISSIVSNGAAGSAATGTVSGGGGGTTPGGTPTNGSVFLQPLPIYSS
                     LVKDSSVNDISITSPSASNNQTWVPNITTAFSTDHNPDHRNDLSNQVYNLELNLDSQD
                     NCPNLSTISTVNLQNFVRQLFRWKNHHIIPPIWAIFTATQTLISEKNNIKVSNDNVAP
                     LTTTVAVDDDKIGPTVGNNNNNETSANSELSPVSSGANGNGNGNGNGNANGIGQAQGK
                     GVFSSKSISDSMTLIAPAMDDYHKLNLVSTEFKNDYRVCITFIGSNSITFRIDSLFEG
                     ELIVLVNGVIWSQVGSAIVPSVPGQEYTIVSGLVPLCSYDIQFINRLNELEDYLIADL
                     MVRTIGKSGDQEALDLSFPSYYHRKFLSPILTLQHSILTTNANLAEERAKLKKTRREV
                     TKKLNTMKQDIETFKSKLEFNVTQDEKSASKVENLKMALKQGENQTAQLENKLKQLTQ
                     EESELEEVYLIEKDRHFQRTLECSKAEDQWKMKVKETESQLNKLKQELQQLQVKKSKS
                     VNKHVKLQKEVDQMNDDFHKYSAAFLEKRNKERVERNQLRSREATDLELRIKGLEQDI
                     SRLEGEANQLHQIIQNGAF"
     gene            <905797..>909336
                     /gene="TY2B-LR1"
                     /locus_tag="KLMA_50423"
                     /db_xref="GeneID:34717024"
     mRNA            <905797..>909336
                     /gene="TY2B-LR1"
                     /locus_tag="KLMA_50423"
                     /product="transposon Ty2-LR1 Gag-Pol polyprotein"
                     /transcript_id="XM_022820416.1"
                     /db_xref="GeneID:34717024"
     CDS             905797..909336
                     /gene="TY2B-LR1"
                     /locus_tag="KLMA_50423"
                     /codon_start=1
                     /product="transposon Ty2-LR1 Gag-Pol polyprotein"
                     /protein_id="XP_022676882.1"
                     /db_xref="GeneID:34717024"
                     /translation="MNLMTFRQELIHVFLVQINQKCFYLENVRDIMLDSGTTVALVPN
                     KKLLYNIKDESNIKLLAAGQNEITVEGEGILKLKLNENISIEMKAMIVPSIKINIIPL
                     ASLYENNLYVDETCDNIKSLNGETITSIFKKDKLLWISGNHIQLPTEEHKVYQTTKSK
                     KYKVTLRELHRRLGHTNVRCVRETVKRGGIEDLSMSDVNWEGIDEFQCESCMKGKASR
                     HPHIKNSRDQYNEKYGPFEYIHTDIFGPIRLSEDSKSYRYMITFTDECTRYTWTIPLY
                     LKTERQVRVAFLTIIKQTRTQYNKRIKVFHMDRGSEYTSEWIRQVLKSRGVKLIYTTV
                     ADSRGNGVAERLNRTLLDRCRTLLDETGLSKEFWYHAIEHVVYDLNHTYKEKLKCSPI
                     EKAGIKPPKLKHIHAFGQLACYRINTNSKLDNRAKLGYLLHPSQESYGYIILDAETNK
                     LVDTTDFRPFYKNGPEGITEKEFYEQVGKWLHKAQTKMSSNNQEENNEPEFTTESHNK
                     RRKLTVHESEKNKSSTNDSDTVRHEENLDTQDVPSCGGGEIHSDPKDDSTKESDSDST
                     KLASAQDSQVSHNPNTESEQTTAEEFTAHKHPNDDFNPLQDAHKQLKRKITETVEDPE
                     EGSEKRFRVNYVKAVTDHDTIPYSEDATLSYSQAITGNKNKLLRDQFTQAFNKEINQM
                     RKMHVWDENKLIDISEVDRNKVINPMLVFSIKRDGTKKCRLVARGDQQDLSTYSKDRQ
                     QDTINNMALMTVLAVALDHNLIIKQLDISSAYLYADLKEEIYIRAPPHIKQKGKVLRL
                     NKSLYGLKQSGANWQKTIKDYLKGKCELEEMRFWPCVFTKGKFLEIIVCLFVDDIVIA
                     GNNINTINQFITDLQNRFDTRIVNDGSPNERDAVRYDILGIDVEYKKGVSMKFGMLES
                     LTKKLPLLGVEFKKESRYNIVPGTPDRSLKQDLDIPCDKDYDAKVNWIQRAIGLCNYV
                     AMKYRFDIAYYTNILAQHQLYPSDEVLYETERLLQYLWTTRGKRLVWKRNEKETSELI
                     GLTDASHAKGLKYKSQAGYFCIWNGKKLFARSTRTSYVCESTAQSETYAASECLAISR
                     SINYLLTTLTGKKPDQMLLTDNKALIDSVKGTKTIKPGARHNDLKLYAIKDKYQEGQL
                     KVEHIPTDQNEADLLTKPLKIKQFKVLTDKWMK"
     gene            909690..909763
                     /locus_tag="KLMA_R524"
                     /db_xref="GeneID:34718747"
     tRNA            909690..909763
                     /locus_tag="KLMA_R524"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:34718747"
     gene            <910420..>914043
                     /gene="UTP22"
                     /locus_tag="KLMA_50424"
                     /db_xref="GeneID:34717025"
     mRNA            <910420..>914043
                     /gene="UTP22"
                     /locus_tag="KLMA_50424"
                     /product="U3 small nucleolar RNA-associated protein 22"
                     /transcript_id="XM_022820417.1"
                     /db_xref="GeneID:34717025"
     CDS             910420..914043
                     /gene="UTP22"
                     /locus_tag="KLMA_50424"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 22"
                     /protein_id="XP_022676883.1"
                     /db_xref="GeneID:34717025"
                     /translation="MASVKRVASGDNGEKSGLTKQQLVKALTEERGVESLEHGSESSG
                     GESSEEEEEEEESGEEEEQEEEHKAKRQKLSSQDIQIARETAELFKSNIFKLQIDELL
                     EQVKLKESHIIRVEKFLHKLYDLIQEVPEWKPHTLEEVEAYFSGKVVAVPFVDPKPQA
                     NSTQYKFNYLKPDVSLVGSFGLKTAIFQPQGSSVDVLLTMPESIFDKKDFLNFRCFHK
                     RAVYLAYLTHHLSIILKKNQLEFLQLEYSNFNNDPLQTVLKVSCKEKTSSEYNFYKTK
                     FSINVIVGFPYNMFDAKKLLPSKNCIRVGQDNETPTPFYNYAVLSSSSYEHYLKYLHK
                     SKKQTEQFKQACVLGKLWLSQRGFSSNMSHSAALGGFGNFEFATLMAALLNGGGVNGN
                     RILLHGFSSYQLFKGVIKYLATMDLCTEGHLQFYSDYNCSSSATVTTSKYVSEGFQTP
                     TIFDKTTKVNILSKMSVSSYQVLKLYAQESLLMLNDVVKDQFDNMFLTNLNKLKTVKY
                     DACYDLDIPSIKLLLSQFGPVEKITFISFENFICNKVSNIVKLALEDRIKAFEVALVN
                     NKSSFPITKRKISAVPNFTSINIKLLINPAECEKLVTKGPENRDELAEEAKDFKNFWG
                     KKASLRRFKDGSIANCCVWSTSATEPVVSSILSYALRLHLTEDCKVTNNSTSHFQQLL
                     PLANLPASSKTSVLNLSSYYNLKKSFDDLYKIMFELKLPLSIKSLLPIGSAFRYTSMC
                     QPVPYAYSSPDFLQDVVIEFETSTKWPDEITSLEKAKTAFLLKIQESLAETHSEYRCY
                     FSRDESIPYNLEIVTLNILTPEGYGFKFRVLTERDEVMYLRAISNARKELRPELEKTF
                     LKFTAKYQAAIRHTRTLETISHSYPFYSPVVRLFKKWLDSHLLYGHLPEELVELIAIK
                     PFVDPQPFTIPGSVENGFLKVLLFLANWNWREDPLILDLVKPDEFADQETSIGASELD
                     SSVLKRLSEKLTLAQYKTIQSNFQQLRKEDPQGLRTQFFVASKNDPSGIIYSSDILLP
                     VATRLTALARVAINLIQSHGLNKQTIELLFTPALKDYDFVIKLKIPVGLKLSSGVMNP
                     DEFKNLNEQLTSFPKDLDSMSSKMDPTYQLVKYLNMKYKNSIVFYSHRHIGVTGGKNG
                     DENVITGLIKPQFKKPLKFKVNMDCNVKPSGSSDLVELNKDAIFHEIGSFCQELIVGF
                     ESG"
     gene            <914257..>915087
                     /locus_tag="KLMA_50425"
                     /db_xref="GeneID:34717026"
     mRNA            <914257..>915087
                     /locus_tag="KLMA_50425"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820419.1"
                     /db_xref="GeneID:34717026"
     CDS             914257..915087
                     /locus_tag="KLMA_50425"
                     /note="conserved hypothetical membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676884.1"
                     /db_xref="GeneID:34717026"
                     /translation="MTSDEVDVPAKDGETEYRVQTKEFRRNLTVQLQLLGFVLIVVSQ
                     LKYAGSIVLFMVRLGVQSVLGAPFPSEERLMRFTAYYRANNSANSSETNSLRHSFKKL
                     EAMLLYVTLVMNFGVMVCGVVWPIDFEKEVDGFRVPGMGRGLSSYGSPFNHMGSRVIE
                     GEVRRHWFTQYIGERVPSSNVRGNASYMWYQWGILVVQVGLGLMFGTEPGTEPGTGPG
                     LVPGSGPEGEGDLEARPLSRPPMVLEMDPERSIREVLGSGPGPEPGPEPRPRPVDDMV
                     "
     gene            complement(<915177..>916184)
                     /gene="RPC40"
                     /locus_tag="KLMA_50426"
                     /db_xref="GeneID:34717027"
     mRNA            complement(<915177..>916184)
                     /gene="RPC40"
                     /locus_tag="KLMA_50426"
                     /product="DNA-directed RNA polymerases I and III subunit
                     RPAC1"
                     /transcript_id="XM_022820420.1"
                     /db_xref="GeneID:34717027"
     CDS             complement(915177..916184)
                     /gene="RPC40"
                     /locus_tag="KLMA_50426"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases I and III subunit
                     RPAC1"
                     /protein_id="XP_022676885.1"
                     /db_xref="GeneID:34717027"
                     /translation="MSNIVGIEYNRVTNTSSTDFPGFASDQDNAWDLDRFKNSFDVRI
                     ESLDDREVNFDLIGVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVLQDEVLAHRIG
                     LVPLKVDPDMLSWIDSSLPESERFTDENTIVMSLNVKCTRNPDAPPNCEDPRILYRNA
                     HIYARDLKFEPQGKQVEQFAKCPVVAADPDILLAKLRPGQEISLRAHCILGIGSDHAK
                     FSPVATASYRLLPQIDILDEIRGEDAKKFVKCFAKGVADIDSEGRAYIKDPRKDTVSR
                     EVLRHEEFQGKVKLGRVRDHFIFNVESAGAMTPEEIFFKSVRILKNKAEYLRGCPIGS
                     A"
     gene            <917996..>919252
                     /gene="PRP31"
                     /locus_tag="KLMA_50427"
                     /db_xref="GeneID:34717028"
     mRNA            <917996..>919252
                     /gene="PRP31"
                     /locus_tag="KLMA_50427"
                     /product="pre-mRNA-processing factor 31"
                     /transcript_id="XM_022820421.1"
                     /db_xref="GeneID:34717028"
     CDS             917996..919252
                     /gene="PRP31"
                     /locus_tag="KLMA_50427"
                     /codon_start=1
                     /product="pre-mRNA-processing factor 31"
                     /protein_id="XP_022676886.1"
                     /db_xref="GeneID:34717028"
                     /translation="MDLLDDISEDENIQEDENLQEDSLGTLGQGHSPGDDLDKSKGPG
                     PGQGPGQDPGPSQDQLDSALRQVIDTFKHRFPGVEEVLHGEQYVRWIAQQVDFHWDSP
                     GESQSQSQESFVISPEQQLIVSTLSHRFPQGLEAPSGQELAPLQRFLHLSSALKTIHA
                     QLTASIHLQAPNVCALVGPEIAARLVAHYGSVRELSCVPSCNLVTFGRNRQGPSQGQG
                     NALGIGKGNGLIYSCDIVQQQHPEFRKQAARMVCAKLVIAARIDANGPGHGPGPAPAN
                     ADALSGAAGTQLRTQILERLQKVSTPPQLSRVKPLPVPEDKPKKKRAGKRFRKYKQQF
                     QLSHMRQLQNRMEFGRAEHTTMDAYGEEIGMGLARVSGPELSLGPSPGPSPGPRPKMS
                     KAMRKRLESGNTGPVNGSGPESLGPL"
     gene            <919964..>921358
                     /gene="DBF2"
                     /locus_tag="KLMA_50428"
                     /db_xref="GeneID:34717029"
     mRNA            <919964..>921358
                     /gene="DBF2"
                     /locus_tag="KLMA_50428"
                     /product="cell cycle protein kinase DBF2"
                     /transcript_id="XM_022820422.1"
                     /db_xref="GeneID:34717029"
     CDS             919964..921358
                     /gene="DBF2"
                     /locus_tag="KLMA_50428"
                     /codon_start=1
                     /product="cell cycle protein kinase DBF2"
                     /protein_id="XP_022676887.1"
                     /db_xref="GeneID:34717029"
                     /translation="MYFLDYYCDMFDYVISRRERTRQVINYLEEQRRAHLMDSTSINN
                     EWQGYLTRETNILRKRRLKPKNKDFEMITQVGQGGYGQVYLARKKDTKEICALKILNK
                     KLLMKLEGTDHVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLIN
                     TRFLQAPHARFYISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTV
                     SMERIESMKIRLQEVKNLEFPEFTERSMDDRRRMYHKLREQEVKYAHSTVGSPDYMAL
                     EVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGNTTNETYENLRNWKQVLQRPKCDNG
                     RYAFSDRTWELITRLIADPINRLKSFEHVKRMRYFSEIDFATLRTVHPPFIPQLDNEE
                     DVGYFDDFSNEEHMARYADVFKRQDRLTAMVDDSMSDSKLVGFTFRHRNGKNGSSGVL
                     YGGVEHSDPFATFY"
     gene            <921597..>923216
                     /gene="DRN1"
                     /locus_tag="KLMA_50429"
                     /db_xref="GeneID:34717030"
     mRNA            <921597..>923216
                     /gene="DRN1"
                     /locus_tag="KLMA_50429"
                     /product="CWF19-like protein DRN1"
                     /transcript_id="XM_022820423.1"
                     /db_xref="GeneID:34717030"
     CDS             921597..923216
                     /gene="DRN1"
                     /locus_tag="KLMA_50429"
                     /codon_start=1
                     /product="CWF19-like protein DRN1"
                     /protein_id="XP_022676888.1"
                     /db_xref="GeneID:34717030"
                     /translation="MLKVLTLNAGEDSLLDVLAVANSLHSKSGPFACALIMGDVPSSS
                     SDAELKDQEMLLPTYICGGSRQVEGKDNGSFEMNENLTLLNGFGFLKLASGLRVAYMA
                     DCGCVGDAKARLQVVEEFERVSSLESCDILLSHDWSDAISARENVLLGEATASGQGQG
                     QGQGLVDQIAKMLKPKYHFSGQNKKQFFELDPFCWDHAHSNGQEHDHVCRFINVAQFK
                     SGSKWAYAFKIRLQNGPEYIPDNLIDNPYAAAELANNKKRSLEEEESSTSNTTKKKTA
                     KQILPADCRFCLSNSKLNDHMIIAISKSSYLTIAKGPLSTPTDTMNFSGHCLIIPIEH
                     IPKLNPETNQEDSTNSSTTTTTTFNFADSPLNLDMLRFESSIAEMFFKRFDMSTLVFE
                     INSTNAIHFHKQLLPIPKYLIANFTNALHRQVHLNNEKYKGNAKLEFREYQGFNNDEY
                     LSLVNDPKTNYFQFTIRETATSEPRVFISTFKKDDRIDLQFGRRVAAFLLKQPKRTRW
                     DSKECLQSKQEEEQEVTEFQRAYKEYDFTMQ"
     gene            complement(<923278..>925971)
                     /gene="MRD1"
                     /locus_tag="KLMA_50430"
                     /db_xref="GeneID:34717031"
     mRNA            complement(<923278..>925971)
                     /gene="MRD1"
                     /locus_tag="KLMA_50430"
                     /product="multiple RNA-binding domain-containing protein
                     1"
                     /transcript_id="XM_022820424.1"
                     /db_xref="GeneID:34717031"
     CDS             complement(923278..925971)
                     /gene="MRD1"
                     /locus_tag="KLMA_50430"
                     /codon_start=1
                     /product="multiple RNA-binding domain-containing protein
                     1"
                     /protein_id="XP_022676889.1"
                     /db_xref="GeneID:34717031"
                     /translation="MSRVIVKGLPKYLKEDRLRDLIEKRLRDKHQSSDVKQYLSDVKL
                     MKNRDNESRRFAFIGFRDEEDAFDCVNFFNGTFVDTSKIEVSMAKSFADPRVPQPMRE
                     KRREALKRLREREEMLLGEKQEKNKKSKPESNKKHDIDAEIAKNKQLQEFIETMKPSS
                     QVTSWETVQSSKSLEEQQQEQEKLGEDKDVGTENADDEGASSNPLLSQALALKTGSGT
                     ADEDVDMFKIPGNESDDEYVELNKNGKSNNNEEDDSESKMMSLDSFVPADDIAKDETV
                     SDLDWLKNRRVRIKDGAETPESKAEDGKVSQEEQGQGQREEAAQEAAQEPEEPQESEE
                     ERALKKIRETGRLFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYIL
                     FKKPDDAATAYVELDKQIFQGRLLHILPADAKKSHKLDEFDLKNLPLKKQRELKRKAN
                     SAQQTFSWNSLYMNQDAVLSSVADKLGMKKADLIDAENSSSAVKQALAEASVIGDVRK
                     FFEARGVDIAKFGQLKSGERDDRVILVKNFPYGTTREELAELFLPFGKLQRLLMPPAG
                     TIAILQFRDVPSARAAFSKISYKRFKDGIIYLEKGPANCFTRDAQGDELVDGDATEEI
                     NAKEAKISSADLLESKGNVEGSAAAGGEQVDDDDDDVPVGPTVSIFIKNLNFSTTSQQ
                     LTEKFKPFSGFVVAQVKTKPDPKHDGKTLSMGFGFAEFKTKEQAVAVINAVDGMVVDG
                     HRLQLKLSHRQGTSSASTSDKKKMNKKKNQGKIIVKNLPFEATRKDVFELFSSFGQLK
                     SVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMEFVEQDPEDVEQQ
                     IEKMTRKVKKQVNTTKIASMRNAGKRKLDLDELDENDGLQG"
     gene            <926959..>930264
                     /gene="VAS1"
                     /locus_tag="KLMA_50431"
                     /db_xref="GeneID:34717032"
     mRNA            <926959..>930264
                     /gene="VAS1"
                     /locus_tag="KLMA_50431"
                     /product="valyl-tRNA synthetase"
                     /transcript_id="XM_022820425.1"
                     /db_xref="GeneID:34717032"
     CDS             926959..930264
                     /gene="VAS1"
                     /locus_tag="KLMA_50431"
                     /codon_start=1
                     /product="valyl-tRNA synthetase"
                     /protein_id="XP_022676890.1"
                     /db_xref="GeneID:34717032"
                     /translation="MLKCFSVSSFNLLRNQLLNSQLHKSSYCYFRNMSTESKQGAGEA
                     GPALPQVDEKTGEIIINPLKEDGTPKSAKEIEKERKKAEKLLKFAAKQAKQAQNQAGK
                     AKNAAKKEKKKKEAEPVPEFVDKTVPGEKKVLVSLDDPALKAYNPANVESSWYDWWTK
                     SGFFEPEFTADGKIKPEGLFTIPAPPPNVTGSLHIGHALTIAIQDSLARYNRMKGKTV
                     LFLPGFDHAGIATQSVVEKQIWATEKKTRHDYGREEFVSKVWEWKEEYHSKIKNQVKK
                     LGASYDWSREAFTLDPKLSKAVMEAFVRLHEEGIIYRASRLVNWSVKLNTAISNLEVE
                     NKEVKARTQLSVPGYDEKVEFGVLTSFAYPVVGSDEKLIVATTRPETIFGDTAVAVHP
                     DDARYKHLHGKFVQHPFLDRKLPIVCDSEAVDMEFGTGAVKITPGHDQNDYNTGKRHD
                     LEIINILTDDGLLNENCGPEWEGVKRFDARKMVIEQLKQKGLFIGQEDNEMTIPTCSR
                     SGDIIEPLLKPQWWVSQKEMAKEAIKAVREGQITITPKSSEAEYFHWLENIQDWCISR
                     QLWWGHRCPVYFVNIEGEDNDRNDDAYWVAGRDLKEAEAKAAAKFAGKKYTLEQDEDV
                     LDTWFSSGLYPFSTLGWPDKTPDMEQFYPASMLETGWDILFFWVARMILLGIKLTGQV
                     PFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIKLDDLHAKLLVGNLDPREVEKA
                     KAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFA
                     LMRLGDDYQPPASEKLSGNESLVEKWILNELTKTAKTVNEAFEKRDFLNSTTAIYEFW
                     YLICDVYIENSKYLIQEGTPVQQKSAKDTLYILIDNALKLIHPFMPFISEEMWQHLPR
                     YASEKTESIVKASYPVFKEEFSNETAAKEYELILNITKEARSLLAQYNILKNGKVFVE
                     SSNESFFTTVDSQKDSIVSLIKAIDEVAVVKSSSEIPEGCVLQSVNPEVNVHVLVKGH
                     VDIDAEIAKVQKKLEKTLKSKAGIEKIVNTADYETKANDQVKQFNKERLEHAAAEIDT
                     LEATIANLERLKL"
     gene            complement(<930400..>931077)
                     /gene="RRP46"
                     /locus_tag="KLMA_50432"
                     /db_xref="GeneID:34717033"
     mRNA            complement(<930400..>931077)
                     /gene="RRP46"
                     /locus_tag="KLMA_50432"
                     /product="exosome complex component RRP46"
                     /transcript_id="XM_022820426.1"
                     /db_xref="GeneID:34717033"
     CDS             complement(930400..931077)
                     /gene="RRP46"
                     /locus_tag="KLMA_50432"
                     /codon_start=1
                     /product="exosome complex component RRP46"
                     /protein_id="XP_022676891.1"
                     /db_xref="GeneID:34717033"
                     /translation="MQASTQVLSHVDGSSTVLSNGTKVICSVSGPIEPKARQELPTQL
                     SLEIIVKPAEGVQSTREKLVEDQVRAVLTPVLARYLHPRQLVQICFQVLEAGERVEYT
                     VKEVSVCVNAAILALIDAGVPMLSMGCGTSLGILRENGQIIVNPSFEQLEQCESVHVC
                     CLELGTDVEKNVEVRNVLLLDSVGSFSETQLFQVLEAGEKECIRLYTEMRQTAKEKVA
                     RDFIWKG"
     gene            <931431..>932378
                     /gene="TPC1"
                     /locus_tag="KLMA_50433"
                     /db_xref="GeneID:34717034"
     mRNA            <931431..>932378
                     /gene="TPC1"
                     /locus_tag="KLMA_50433"
                     /product="mitochondrial thiamine pyrophosphate carrier 1"
                     /transcript_id="XM_022820427.1"
                     /db_xref="GeneID:34717034"
     CDS             931431..932378
                     /gene="TPC1"
                     /locus_tag="KLMA_50433"
                     /codon_start=1
                     /product="mitochondrial thiamine pyrophosphate carrier 1"
                     /protein_id="XP_022676892.1"
                     /db_xref="GeneID:34717034"
                     /translation="MSNNSNGKDHLRKGQKVAWYDSMIAGSVSGVVARVATAPMDTVK
                     IRYQLQPLHETKYQGLISTVRTIVKEEGVRALWKGNVPATAMYVIYGAVQFGSYTGFN
                     NIVSKRWPDTLSQHVQSLVVGALAGVTSSGASYPLDLLRTRLVADRNITGTRLIEVCR
                     ETMQTEGLRGFFTGISTAMTTVTLSTATMFLTYESVNILCEKHESQPWSQPLRASSGM
                     IAGLVSKTIVFPIDTLRRRMQIMNSKRTSSFTELPQVYENYRYKSSISIVLDILKREG
                     PVALYKGLTVGLLKSVPTTAISLFVYEKCMVLLEEVSTA"
     gene            <932822..>933529
                     /gene="PIS1"
                     /locus_tag="KLMA_50434"
                     /db_xref="GeneID:34717035"
     mRNA            <932822..>933529
                     /gene="PIS1"
                     /locus_tag="KLMA_50434"
                     /product="CDP-diacylglycerol-inositol
                     3-phosphatidyltransferase"
                     /transcript_id="XM_022820428.1"
                     /db_xref="GeneID:34717035"
     CDS             932822..933529
                     /gene="PIS1"
                     /locus_tag="KLMA_50434"
                     /codon_start=1
                     /product="CDP-diacylglycerol-inositol
                     3-phosphatidyltransferase"
                     /protein_id="XP_022676893.1"
                     /db_xref="GeneID:34717035"
                     /translation="MSKSEAGSKEAKVNAKDVLWYIPNQIGYLRVVTMILSLFLMAKH
                     PLWTMWVYGVSCLLDALDGTMARKYGQTSSFGAVLDMVTDRSTTTALICFLCVAYPAW
                     SPIFQLLVALDISSHYIHMYATLSTGSQSHKAIEKEQWLLNLYYTKRKVLFSICALNE
                     MFYMGLYIMAFPQFRSYAVPVLGQVHIGGVIALVCLPGYIFKQIANVVQLNRAALMLA
                     NKDAAEATERRLKQKHN"
     gene            <933861..>934844
                     /locus_tag="KLMA_50435"
                     /db_xref="GeneID:34717036"
     mRNA            <933861..>934844
                     /locus_tag="KLMA_50435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820430.1"
                     /db_xref="GeneID:34717036"
     CDS             933861..934844
                     /locus_tag="KLMA_50435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676894.1"
                     /db_xref="GeneID:34717036"
                     /translation="MEDVSRSVLSQYLPECICNNMDAFIRTVMTLPAHPHLSQHVVPF
                     LESNKWITSPSILSHLHTVLYIAFGYHLLFLVSMWFIFPPIAGYRLSWNTKDANRNKR
                     ELVIQSSLRLVSWIQSLIVLYLSFEAILYNNSVHPQSNSYDRIFRSDPYNVQVCVFAI
                     GYFLWDIYISLVYSTMPFVLHGVVSTVVYTIGLKPYINYYAGIFLMFELSNPFLNFRW
                     LGIKYMPQLTNDPASRTLAAKICNVVQLVNNIILIVVFFAARICWGFYQFFRLCKDFY
                     AVRNDPHFLPLDTSIIVVGNLSLDVLNLIWMSSMLAVAARIIKKGGKVQDK"
     gene            <935288..>938482
                     /gene="RGC1"
                     /locus_tag="KLMA_50436"
                     /db_xref="GeneID:34717037"
     mRNA            <935288..>938482
                     /gene="RGC1"
                     /locus_tag="KLMA_50436"
                     /product="protein ASK10"
                     /transcript_id="XM_022820431.1"
                     /db_xref="GeneID:34717037"
     CDS             935288..938482
                     /gene="RGC1"
                     /locus_tag="KLMA_50436"
                     /codon_start=1
                     /product="protein ASK10"
                     /protein_id="XP_022676895.1"
                     /db_xref="GeneID:34717037"
                     /translation="MDNRGQEGQIGSEAGQQEGYQEQAEWEECSVPETWSIDSGDSNY
                     LLDLADETEYEDILPKTHFNSPYYINVPTPKHSTLSGQAGGSSVGVSPAAGVNASDGL
                     DLYDDGTASFVREYPTDILADRFHKWRKILKGLVVYLREVAYSQEQYARINYSLKNAV
                     KFSFLSDLDENTSKVFDPLTKNMPQKKPQPSPAMKSPREEKPDPFASASNFSASTATF
                     NTSSLDLGQELQLEPHEGCSGSGFMSFGSGSIQDIQVILKKYHLSMSSQQIKSSKEIT
                     QQIIPKLEDLRKDLNHKIKEIKELNADFKTNIQEHVALTGQLLHKYIASVNFLNDSAQ
                     RSDLIKLKKNQALKPKHDPYLLKLQLDLQLKRQLLEENYLQEAYINLQTSGMELEKII
                     FSTVQKTLQRFSSIIDANARVSINNLCKELQKGILSKPPCVEWDNFVTHHPRCLLPWK
                     STEPIPQPRKLSDIRYPKMKSSMAKCIRAGYLLRKSKYLKSYNKSYFVLTSNYLHEFK
                     SSNFFKLTQDNSEKDDHAIVPSSNNKSRSIVPLMSISLNDSELIEEQDKFTINCKSTY
                     IQQEEQKESFSQDIKKITKSTSTISKFFKQGSSKQSKLHLSLTPNNSSLNVSGGATGK
                     GDNEDNVKSSSITFKRPNDVDVKEFKKWIANLKDLTSFSNTAARSKYIEEKILKAHSK
                     VAASSSLNLAQSSKTTSMHLNSQSTPSLAQRPEYIQITPSSMQLNMRSKVNTPAIDDN
                     GNLIFASERPRAMFNSESMMMSQPQIPSNDASPSSFVSNDSYAASNKQGLTSPQQGGM
                     SYAITSNGMTPVHQPNPSQQGHHSRNVSGGGSSLGPGSMFNTDFKFTPTQNVSSGPVT
                     SASNNSSGSGGGYFAIPVQNNSQNNSQNNSHNNSTAVSQASTPGTHSPIQGSNVNSNQ
                     GLTSNGPYGHTKSPSDVIPRIHINELEAPMPVKVSPVNYPPEPRNNRNGPYNNLKKNS
                     SASSVPSINSLYTASPVLSNPAHNSSSPSLQAGKPQTQPVRRHKKTVSFNSLNSLMFS
                     KKAGNPSNNQYLSDAKINEDDDPDGINIHGSLYS"
     gene            complement(<938652..>939338)
                     /locus_tag="KLMA_50437"
                     /db_xref="GeneID:34717038"
     mRNA            complement(<938652..>939338)
                     /locus_tag="KLMA_50437"
                     /product="flavin reductase like domain-containing protein"
                     /transcript_id="XM_022820432.1"
                     /db_xref="GeneID:34717038"
     CDS             complement(938652..939338)
                     /locus_tag="KLMA_50437"
                     /codon_start=1
                     /product="flavin reductase like domain-containing protein"
                     /protein_id="XP_022676896.1"
                     /db_xref="GeneID:34717038"
                     /translation="MILCNARLIYESFAKRCYSTSKISINEVTKQKFRETMGRICNQA
                     MILTTAVPIHCSHDKFRGVTLSSVTSLSLKPVPLVQFNLQLPSFTSDFLHDFNHFALH
                     LMKPNAQSIELARNFSKGAMRHADNDEIIPTQPFIGLSEGLEYDTYEIEGTNLRIPLL
                     KNAERVIVCQGLKHFNVGDHEIWVGKVEDIVNRSLEDGIEGDDPVSGGLLYCNRDFYS
                     VGNPIKRNKE"
     gene            <939563..>940408
                     /gene="RRG8"
                     /locus_tag="KLMA_50438"
                     /db_xref="GeneID:34717039"
     mRNA            <939563..>940408
                     /gene="RRG8"
                     /locus_tag="KLMA_50438"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820433.1"
                     /db_xref="GeneID:34717039"
     CDS             939563..940408
                     /gene="RRG8"
                     /locus_tag="KLMA_50438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676897.1"
                     /db_xref="GeneID:34717039"
                     /translation="MTKDWKQFLVSRGRKFTKKKLEAPKVQSPLLTNFHQWAGKKRLF
                     EFNDPDEVSKVLGNDSWGVSKNLFANILASPMRTDMSKRIKLPRELLIQIKLEPIKNG
                     TNEGKLVALRPQLEISKSGNNSYICNSLRFLQGKRASLGQLVPNSVHSSNTYTLNMNE
                     ILMDKRLFTEKHKQDLSECITTLLESLCERTDKENVPVTVEDWDVILTYDEKSNNDIE
                     LVKLKHLPSVPTVIILNLKLLDNDSIGRLINDRLRNHDIGVVLKFLKDERLIKLVYSL
                     LNFSR"
     gene            complement(<940440..>945212)
                     /gene="ESP1"
                     /locus_tag="KLMA_50439"
                     /db_xref="GeneID:34717040"
     mRNA            complement(<940440..>945212)
                     /gene="ESP1"
                     /locus_tag="KLMA_50439"
                     /product="separin"
                     /transcript_id="XM_022820434.1"
                     /db_xref="GeneID:34717040"
     CDS             complement(940440..945212)
                     /gene="ESP1"
                     /locus_tag="KLMA_50439"
                     /codon_start=1
                     /product="separin"
                     /protein_id="XP_022676898.1"
                     /db_xref="GeneID:34717040"
                     /translation="MKRVLIDMKPNNTVKRPLLSTSTKNSTVSEVHLESSRLYNGANN
                     TESSNAIDWKRLYDLVDNKSQDFENYIHVNDSFIQLYRQLIWRHQSKKLKELPKKHMS
                     WIIRLMDIGKLTQASNQILTLYNETNLIQADNLHDILLSDFGPSNEHYLATLKILTMQ
                     LILKTHTTERYAESLLELFAHDSHYLLRDSHIKTNAIVKLILNFFTLLPQYKPLFALK
                     FIQYMSEFELDFEAYIKNMDFETFQKQIPKLLRKENSSNCVIYLNKYYNDYLTKATKS
                     RRRNMESLNLREYLTGQSVDKRLFDDITKELRSSKLQKGNIDTILRPLLYHPALSKET
                     TRTCDNIILFMNKSIRELHEDVLLYTLTYLFKIFLLSNDLKRCDNVSAVMYNCFVIKK
                     KLFFLERASVSNYKLYLKTNDIVSYSKKFERLIGCCSDKSTQKSIFAYCCNIFMTFQQ
                     DDLNSIWTLTRKYMFNCFRRLKLEKFEIFRFSSEPILCFLYSGSNISNEFKWSPLCRS
                     LNAILTNNYEENIELDFKVNALDSLAKYEVLIKSIYCLNYEMKKNSCLYLRKIFEIVL
                     EKWINPKNSFNKDEELSDLEITFFDTLIPYLHQNKIFKLSTKLCLSLLSLPRYNGISG
                     RVKFWLLESYIGLQLNSSVIATIKQYFDPLEEMITSLKDMSIHDIYVPLCAVLSILSW
                     KKDSKLFNNLINDVLKTSKPQLFDIQNKSKMNISDYLKVLMLNIKLTHCASQIQFYEK
                     NVYASLKELKRSLKICRLLIGKETVLSANYRFEVIALIDDIFRRIINVYVHTGVFKDC
                     AFFTNEYQRVILALDNPTTTFNLFACLYSYYQLIDEFESAQTCLKKLNTVFDQIDGSI
                     NIDALGQFLYLNKEYEKLVNSMELFFEEDASKSEITDYWLLKTGQTYTINNHRRDFDS
                     LVCMNNAKDLYNKVKKQLNADSFFKSMHESVMTIPSCNQQNTLSEDVTSDPKSLKAPH
                     FLKGLNDSPRPSSLTPRGKSSTNKSFNRGNVVNNLQMMIRFIQNADTTSLKSYEVREL
                     ANLYSLTLSIFFNISTKTKLEDYFIRNLELKDRPRSLSLFYEKSFSDMGTEIYETFIP
                     DTIKSDYHEIPQSKNIHSEFGKKWSHLSFSVVELDVCELTGDLLITRFDTIRNKHLHL
                     RLPLNRHNSRDLGEDVLDFNSALKEIDDIITSNNMTTSADITSAITTKEQRKGWWDER
                     YSLDTRLGAILSKIEDSWFCGFKGIFNPQAIDDEQFNVFKKGFESILYSQLPSRKLQR
                     QSASFIQIDDMLIELFVLLDVINQPTEKAVSMMEDLIYFIFDALLFHGEENAYDEIDV
                     NLIHIKFEELLEEYNASIIAKGRQQTVNHTFLILGNKCHSIPWESLNFMKDLSVSRVP
                     SLEVLDQLLTKNSELEPEIDISRNLAFVLNPGNDLNRSEMTFGSDFKALSEKTTESKA
                     YIGKAPSSDEFYNAVAKSNLFVYIGHSGGEQYVKLKNLRKCQRLAPSLLFGCSSAHLR
                     YCGSFESSGTVYSYLLGGSPMVVGNLWDVTDKDTDKLTMGIFEKTGLVQTEKSIKGHS
                     SLNVSEAIAQSRSQCNMKYLNGAAMVVYGLPMKFTRSK"
     gene            <945465..>947498
                     /gene="TEL2"
                     /locus_tag="KLMA_50440"
                     /db_xref="GeneID:34717041"
     mRNA            <945465..>947498
                     /gene="TEL2"
                     /locus_tag="KLMA_50440"
                     /product="telomere length regulation protein TEL2"
                     /transcript_id="XM_022820435.1"
                     /db_xref="GeneID:34717041"
     CDS             945465..947498
                     /gene="TEL2"
                     /locus_tag="KLMA_50440"
                     /codon_start=1
                     /product="telomere length regulation protein TEL2"
                     /protein_id="XP_022676899.1"
                     /db_xref="GeneID:34717041"
                     /translation="MKQCVSSVLDYKCDQATISDVLGQLLVNKVCSSDEVLPIIKNVI
                     PIYPSLNRESKSQLLRLCSYNYNFITQMSEYAKELGEKAESAIYQDVVIDVLKLEKGS
                     LFNYVSVVSRSEAPFLKSGLFGSKIFNALSSRISIVDYLGYMQTQWEYLFLHTHQYER
                     LHLELFLTCLQLNVPLGIDIFIESVILHSHALWNAFLEMFSKGSSIHQRRLFIHHLVP
                     YFNKIIDARSCSVAFTLLSQIPFTLPVYSQCFNWSNVYFKIAYLGALSDTQRVQLFKE
                     ILPYFEQIDSYSDDMVAEMLVLLLNHLSEDSRDELYRDPLSLSFVTKRLHSEERLVRE
                     RTMFVAKLLTNNKLEYDSDFTIDVPNIKLEKQANVTLPISIDNIPTEKVNSTAQRDLI
                     KQVKTISLQDSDDEDDEDDEDDDQYFRDILFLKDLVIEFDKAEKDDTSELKLLKNTVK
                     LVRQKKDFPTEVAFYSTQLLKSITTLANKFDEPAFEEWKTNALVSIIVVCPDKITVLY
                     EILFSAELSLQQRMVILTAASLAARELRGFNDDFVLKPVYDFPTKRLPWDTESRSEKL
                     NEQGKIQDVSDIKNLGTVWRSKRLDIEKSRLNSTQNINKFRKYATKFFYPLAHAWLNG
                     IDLGSFDKLFKMHYLSVLRMIITCANPHFEFETMQTLMEEVLKDAIKQQIPIS"
     gene            <947794..>954993
                     /locus_tag="KLMA_50441"
                     /db_xref="GeneID:34717042"
     mRNA            <947794..>954993
                     /locus_tag="KLMA_50441"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820436.1"
                     /db_xref="GeneID:34717042"
     CDS             947794..954993
                     /locus_tag="KLMA_50441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676900.1"
                     /db_xref="GeneID:34717042"
                     /translation="MSYGIFSLLSYGLKSILLLIALIFVMQQAFFKLILICLNVRSIL
                     SKAQFGFYFGKSIFWIHLIYNGYSIKIREVLILSLFRKFEIRDVDVECKIAGKIPKEL
                     PEEHSLNLEIPLSVGRLKFLSKILPLDLRLVNFSLRSGDTVISSELALLKFEYDVNAT
                     QLRAVILFYGVKLGDNVNLSQVKVSSQSSLVYKSSDKVYFDKWSCGLNIGGLEYRTSD
                     DNKNKSKNNYSNSVPINSTLYEKALKKLETFTVHLENVNITLPNKRSCFVSSASLNLN
                     PSKEYNLFTHSIENHNITIALNSLVYTFSPDQDIKIPAMNILLNCDIMTFLKEELDYQ
                     SFSGLCTINIIDPKLSIMIDRIKEIKEHYPSSSSSSSSPSSSRSLMDRLGSFKFPPII
                     VKLLISNSKVTLKQNSDTYYELVADNVNSELNLTSLFAGVNDSFSADMRKLPVNTLKL
                     ESVSVKYMLDAQSSSSMRRLMGFDKWVLTCDRYGVSPNKIFGVLHTVSINVDELRLLD
                     GLLSIIAIMTTKEEKKVEKHYVAKQLHFFAYELDLHIKEISITVSAIDYFPAHLRNLH
                     DNEKVLRDGKYSIGLHCKNTKLEYSNVLKHIEFHALNVTKQSEISNNKDSSEMLLFDN
                     LTLDISDSLIKIDIPQLKYEFDVNSIWFWFYFKHSIIKRIKPKLRQERKALKHTKPMD
                     LNISKILAVFNLPQNMTLLMVLNDTAYTTTSSEFSIADVNLLVESVYTNDHTVHVPLL
                     KMASIRASFSSTTGLDIVSDYMTLKMEYHFRFYTIVDRLSTTIKVYKLLRAAFKTPET
                     FNILYPKADPPVHLPNIKIQTKTLSIMANEDLFEQELGLIYKVGVLEQRERLEKMTIF
                     LNSERVNNSSELREDQYRRLYEHFSTSWIVRYRVAKRKFHGAKAFAIKSSILGYEFST
                     FSVDNDVNTFKLSIEDVDLKLSQPSFPLGEYGTFLHKHGKGVPFNTEYTINIPMGIDL
                     KTGSFQILLRDYPLPALFFPNTHVSGDIVFTEAMASSKSWRKIYVPFNNILPEGSEKH
                     DTIFGSHVIRTLTPIKTFMDIKFRIDSDSPTVITWGKSLQPGYQSVMLWFDFLTKPPL
                     DPSPKLGFWDKFRLLVHGVLAFEWIANSSVHLNIKGSSDPYSIADVGAGLTFAWKGNA
                     RLLVNGSDEPDSFLQIKSNEFQMGIRDFFSSTKFDKVIMKLFGKVEWKMGLLFESGDS
                     KMVGYEPRSKYLKPHYQVELVHPDQIVDITKHDSYKGFRTDFIHMSFGVYSDKSSVAK
                     NTVHLAPESLSHFLAWWRLFSTYTSGPIRQGSLFPDLLQNGKKFGKSLFTVKYQLSLA
                     PIEITHVHRHADSQMNLKQNNNIAFTGIKANIESLKLDLHQKRIKAVAQNDILQISRP
                     VWRFCMSLAELDFVEADIRVLFAVFDQEAVEELLAKTLGLSADSDDVLGTKKDEGYGF
                     TNSSWFDKEDYIDLHQVQLISQTPIKFSAIPFIYSPRITYFRNLAEQGLKLKFPFGDE
                     DMHSCYLGQIHPEITQKHLVQGREIQLRQQISNLQAQLDALIGDRASLNSLNNELSKK
                     KDELQSSLHFLKHSLHLIHEMLKDLEISENAQMQDPNTDCESSIADSDLGLTFSNKDK
                     SDLLRMNTIDSFIKLKHFGDINNESSFDNRFIFHNVLIKIDKSIRDHLLDYITSIAIR
                     TQYQFFITHKAMMIFDELLKNRFRKSFIAEPQLSQDSCSSSLSNKELLEMFEDFIREV
                     SDGFEAFDNYSIRLLSPQLQITSDVEPEKAIVVVSRDVEISIIDVHTTLEMKAEHLGV
                     NTLMETRYCFNIADSQFFILDRLETREWPQMMAHSNTYGVEDSKHSWPPWLPLEVCYS
                     TDFLGSHLFLNRNDMFITFIRPNSLFFDKQTSTMSGRESRFHVGFPRLYLTSTSEQYS
                     AIFNIVEDMLSFVSDKNKKVDKLAQVFLADEIKLNLGKLDTTVVENLQKKIRALKYLD
                     SFTRFNDPITYSKCSQDILVEFQTAKLQLNLLMSAIKRNYDRLHFQNKSQKNNRLSWW
                     ISADELMWELFDENKESFVVFGLGASHFVRTETYYGSTSNKISISTLQCYNIQPKTVY
                     KELLGPFEKHSKFDPSKPFLEITWNMGMPVGGISNLLDLDFTSQPIIFKMDFRTSEKL
                     MSYLFPKVKEQRGGKNVVLKQSFEMSDTESRELSRRPSLTSISTSSTVMTPVTRRMIL
                     SDWDVQGFTKVLERNGENNYTKHVYDPDKEMDEMVKRSSKYFNVGKITVNPLVMSVSY
                     KGSKSVITNVDNLIVKVPTIQYKNKIWSSEDFIVSFKKDIIKIVLQHAGTIIGNKFVP
                     HKNENRYEPLKQISNLLKPDLQKIQKSTASLPTLAKLSSKNTTRSSVPTNPSTVNSNS
                     VTENSKSIKTRSEDQDTNNPVETYDVEEFYPDNSQ"
     gene            <955457..>958321
                     /gene="MDR1"
                     /locus_tag="KLMA_50442"
                     /db_xref="GeneID:34717043"
     mRNA            <955457..>958321
                     /gene="MDR1"
                     /locus_tag="KLMA_50442"
                     /product="GTPase-activating protein GYP2"
                     /transcript_id="XM_022820437.1"
                     /db_xref="GeneID:34717043"
     CDS             955457..958321
                     /gene="MDR1"
                     /locus_tag="KLMA_50442"
                     /codon_start=1
                     /product="GTPase-activating protein GYP2"
                     /protein_id="XP_022676901.1"
                     /db_xref="GeneID:34717043"
                     /translation="MSFFEAIRNTANSVKEKFSESPSPGLTRDERFRLEYNLPNAEYI
                     LDDTSAEISVLSPYKGFKSGNGTRSQFERSIENTYVYSGRLFLTPHFLVFRDSFDHKS
                     AVLVLNISTVKRVERAHIASYAFSLQITLLSGARIIIQFIGLRYRSEEFSHKLKVQLK
                     ANIPQTKDMPAFLNSLYSEYLIEKNISKNHDLKPPPLGLGQIYRYPGDPALQKEKAKL
                     RLWFEYFKANGVNLWLVKHPAFYKLIRVGVPNRLRGEIWELCSGSMYERFMNKNLYQK
                     LLDDHKGEKSQAIEEIEKDLNRSLPDYPAYQEPEGIDKLRNVLVAYSWKNPDVGYCQA
                     MNIVVAGLLIFMTEEQAFWCLCNLCELYVPGYYSKTMYGTLLDQRVFEAIVESKMPVM
                     WNHIARFDIQLSVVSLPWFLSLFFTAMPLHFAFRIMDIFFVNGPKTLFQVALAVLKVN
                     SDDLLEVDDDGMFIAILKSYFQRLDESAHPEASDPKYRQVTKFQELLVVAFKEFDVIT
                     DELVESERNKYKKGILHDIESFAKRTQLRNVVKAINLTDDEVSNIYDIYYQSIDSYRI
                     SMGTGSSKMDFTSFVQFLAKICDWCKASSSDLDPRFRKQRTDFLKRLFRSWDKEGLGE
                     LTLNDVISGLDKMKTDDIMESMNNFFGLYDEENKGKIQREQMLQMSEDLLILTEPWKS
                     GRCIDLLTQRSIENDIAESIVKKNDGKIVSIEEIELPKGVVIDDEKYKAEQAERYLHA
                     ASSFLQRCFEYAQPLEQEISIDLLDLSDDNENDDEETRKKRNEKKWKSLKANAALNPN
                     TPCVLDLATFRMLVLADETYEQFFAYTLRHSIHVDQQVYALESRSKALRNVFDGLIAD
                     GRRVANQVRRRVDSVATQQSASPSQEKPIDLDDFTSDHAEDGMELLHTDYNYNELIGM
                     EDGEDQAERKKLDSFALNPSTSKQSASSKSNNNDLIDFEA"
     gene            <958665..>959693
                     /gene="PCP1"
                     /locus_tag="KLMA_50443"
                     /db_xref="GeneID:34717044"
     mRNA            <958665..>959693
                     /gene="PCP1"
                     /locus_tag="KLMA_50443"
                     /product="rhomboid protein 1"
                     /transcript_id="XM_022820438.1"
                     /db_xref="GeneID:34717044"
     CDS             958665..959693
                     /gene="PCP1"
                     /locus_tag="KLMA_50443"
                     /codon_start=1
                     /product="rhomboid protein 1"
                     /protein_id="XP_022676902.1"
                     /db_xref="GeneID:34717044"
                     /translation="MSAPMSNFARTCGRQFFLSNAIHLQSPKVAPWNLLKPLKSSLLM
                     FGRSTSGINSVLRPQTRFFTTSGQAKVSIRDMFNGSQSRYTRLNRFQQYNRSSGNNRD
                     LIKLTLYGALFMGITLIGAPYLFQIPPFSYFKRHPTHLPYAIIGINLAVFGLWQVPRF
                     WGPLQRYALLQKDHIYSKWSLLGSAFSHQEFWHLGMNMICLYSFGTTLATMLGPGNFT
                     SLYLNSAIAGSLFSLWYPKFARIIMMGPSLGASGALFGLFGCFSYLVPHAKMMFFIFP
                     IPFGAWFTFLGLVTWNVAGCALRWGSFDYAAHLGGSVMGILYGWLIAESIKKQREKRM
                     AIATFPRF"
     gene            complement(<959831..>960352)
                     /gene="GTF1"
                     /locus_tag="KLMA_50444"
                     /db_xref="GeneID:34717045"
     mRNA            complement(<959831..>960352)
                     /gene="GTF1"
                     /locus_tag="KLMA_50444"
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit F"
                     /transcript_id="XM_022820439.1"
                     /db_xref="GeneID:34717045"
     CDS             complement(959831..960352)
                     /gene="GTF1"
                     /locus_tag="KLMA_50444"
                     /codon_start=1
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit F"
                     /protein_id="XP_022676903.1"
                     /db_xref="GeneID:34717045"
                     /translation="MKRTIARHGISFVRFNSLKAGYSSNTKIGSRITTDHEVDQLINK
                     KSWDIREYVPTSLDTELLPPKETVIKLLKISGLPAKNIEQTRVRLANQLSFINILHGL
                     PVDESINPNHARIMDRKPKALDYKSLLQRIEKQEKSEELGEISGSWDSTQQAKLTKDR
                     FFILREGLLRNRE"
     gene            <961010..>962824
                     /gene="NOP7"
                     /locus_tag="KLMA_50445"
                     /db_xref="GeneID:34717046"
     mRNA            <961010..>962824
                     /gene="NOP7"
                     /locus_tag="KLMA_50445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820441.1"
                     /db_xref="GeneID:34717046"
     CDS             961010..962824
                     /gene="NOP7"
                     /locus_tag="KLMA_50445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676904.1"
                     /db_xref="GeneID:34717046"
                     /translation="MRIKKRNTRGNARNFITRSQAVRKLQISLADFRRLCIFKGIYPR
                     EPRNKKKANKGSTAPTTFYYYKDIQYLMHEPVLAKFREHKTFAKKLTKALGRGEVSAA
                     KRLEENRPNYQLDHIIKERYPSFADALRDLDDALNMLFLFANLPATDQVSSRITQSAQ
                     QLCNQWSAYVAKERCVRKVFVSIKGVYYQATVKGEEVRWLVPYKFPENIPSDVDFRIM
                     LTFLEFYSTLLHFVLYKLYTDAGLVYPPKLDSKKNKLIGGLSAYILESNDEKSSLAPK
                     INEISDNVEVKELGAKALKSALKADSGEHEEEQEQEQEQEDGVEDVELDKFEDHNKNQ
                     GDLLEQPSKFDSPIATLFSDFVFYVGREVPLDIVEFLILSCGGSVVSEAALDQLTDKQ
                     DIDLSKVTHQIVDRPVLKNKVANRTYIQPQWIFDSINKGELVPANLYLPGEPLPPHLS
                     PWGDATGYDPTAEDDEEDEEDDEEDEEDEEDSDEKEEGVAEEVAVGEDDEDDEEELRQ
                     QKELELEAQGISYSEAKDVIETDSGDKKKKKTNKRKVTEEEEEKDLKLIMMSNKQRKL
                     YKKMKYSNEKKDERIEQLKQKKKQISKKKEKLAKLDKK"
     gene            complement(<962915..>963682)
                     /gene="SRB5"
                     /locus_tag="KLMA_50446"
                     /db_xref="GeneID:34717047"
     mRNA            complement(<962915..>963682)
                     /gene="SRB5"
                     /locus_tag="KLMA_50446"
                     /product="mediator of RNA polymerase II transcription
                     subunit 18"
                     /transcript_id="XM_022820442.1"
                     /db_xref="GeneID:34717047"
     CDS             complement(962915..963682)
                     /gene="SRB5"
                     /locus_tag="KLMA_50446"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 18"
                     /protein_id="XP_022676905.1"
                     /db_xref="GeneID:34717047"
                     /translation="MVQQLALYSAIEDESYALCVETLTILSSNKPRLFANLNNVYKPN
                     PSLQIEKVNAKNQMVEQTRVKLSTAIPISTLGNGEELSYHFMSNLNTDEISSFNLQRF
                     MEEVENNNSNHWAFQISDIPAAGNNRKLSNQTIHESVIQSSSGSVSSFIDELGYVDDY
                     HYIVVGVKFQFVTGIIVEVYKVWQVVQTDNAPATKLIAKNGFMIKAMYNVNKSTDIES
                     INKGSRYLLKLKSDLRDYIDLDIPDRKCMDTRLNHLD"
     gene            <963955..>964329
                     /gene="VMA21"
                     /locus_tag="KLMA_50447"
                     /db_xref="GeneID:34717048"
     mRNA            join(<963955..963974,964101..>964329)
                     /gene="VMA21"
                     /locus_tag="KLMA_50447"
                     /product="vacuolar ATPase assembly integral membrane
                     protein VMA21"
                     /transcript_id="XM_022820443.1"
                     /db_xref="GeneID:34717048"
     CDS             join(963955..963974,964101..964329)
                     /gene="VMA21"
                     /locus_tag="KLMA_50447"
                     /codon_start=1
                     /product="vacuolar ATPase assembly integral membrane
                     protein VMA21"
                     /protein_id="XP_022676906.1"
                     /db_xref="GeneID:34717048"
                     /translation="MPADVPRSVITKLMFFTVAMVALPVLTFFVVQQYTDNTLVSGGL
                     AAAMANVVLIAYVIMAFAEDTTSSSSEGEGKDESKKEK"
     gene            complement(<964425..>965219)
                     /locus_tag="KLMA_50448"
                     /db_xref="GeneID:34717049"
     mRNA            complement(<964425..>965219)
                     /locus_tag="KLMA_50448"
                     /product="v0 assembly protein 1"
                     /transcript_id="XM_022820444.1"
                     /db_xref="GeneID:34717049"
     CDS             complement(964425..965219)
                     /locus_tag="KLMA_50448"
                     /codon_start=1
                     /product="v0 assembly protein 1"
                     /protein_id="XP_022676907.1"
                     /db_xref="GeneID:34717049"
                     /translation="MAGFLTVILGLLWFIQCSFGADMTSFFSINAERYVDAVKTEKVS
                     SLKELLEMSRAEEPLIVLQFDKFDLVNAFDEKHEGTYPFISSLLKSSLDTFLEEKGLP
                     DGQKGYNGARVLKVGEIPASAGEELRHRFKKSDNAVVVEFTKERYDVAELDDYLETLY
                     AFMENSLKNVDNIVLRVPKSGNSGADIEKIEELREPEKSGEPGDGDDNDDDDSLSSLW
                     TEGLLSCLLVSLLLIAILVVAISWIASLDISYGALEKSANPLKKNN"
     gene            <965721..>967595
                     /locus_tag="KLMA_50449"
                     /db_xref="GeneID:34717050"
     mRNA            <965721..>967595
                     /locus_tag="KLMA_50449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820445.1"
                     /db_xref="GeneID:34717050"
     CDS             965721..967595
                     /locus_tag="KLMA_50449"
                     /note="Fungal specific transcription factor domain."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676908.1"
                     /db_xref="GeneID:34717050"
                     /translation="MDSRTKRKVPGESVIQFCNNNARHGSKGGRVSTSCKSCSRSKKK
                     CIFDGTGDKCQLCAARGIECSLKRSRETGSGSVALAGTSDQEWLTVFLNEDAPFYNLN
                     VLNTTPQSPEHRYVTRSLGYEGFSGMLYGILGEYDPLLRDKFFQYDDNDECCFHEKFF
                     RRIEKNGFSHIFAYKKYDVAEREDFRLCHLSHGLDFYLNKVSNLHGYIPALVTLYVKF
                     ILPSLPIFDGTSINSVFSASAGAEESVDYGEFSDPLILLLLYRLTYRWFYYDTTIPIK
                     GMDIMKGDDLQFIFGEEFFSVVWNQINRELIAPTITTLKSMILFYHIISFKGTGYRTP
                     FESNLLSSIVNTSYIMGLHLDCSGWNVPKDEKNLRKRLWWTILVLDIWNKLANSLPTL
                     AMNNSMFECNEPTSSVWFDMFDDIDDFFPESTIYSFYLFSKISYTTSKMVKTLFGGKT
                     TIDDPEIQDFDDILDMWLEEYSSLSLEASVPYSSVALCYAVAKILIFRLKFKLIANDM
                     EYNRLCFNGLINLFGKVMEILEGPSSSGVNCFWYNFSRSHFFYLRDVLLLLMVISSDK
                     PQSLTVFRLVRRFKEWLANNARTLKIVLPALVRINITISSLGKQVKRLKDEQASKLYN
                     "
     gene            complement(<967651..>970260)
                     /gene="OPT2"
                     /locus_tag="KLMA_50450"
                     /db_xref="GeneID:34717051"
     mRNA            complement(<967651..>970260)
                     /gene="OPT2"
                     /locus_tag="KLMA_50450"
                     /product="oligopeptide transporter 2"
                     /transcript_id="XM_022820446.1"
                     /db_xref="GeneID:34717051"
     CDS             complement(967651..970260)
                     /gene="OPT2"
                     /locus_tag="KLMA_50450"
                     /codon_start=1
                     /product="oligopeptide transporter 2"
                     /protein_id="XP_022676909.1"
                     /db_xref="GeneID:34717051"
                     /translation="MQSDEVSNKKDYQYSVQEKESSTENGNLEEFDGDTPSFRRAIIE
                     ACGHNPDDFESDELPEDLQYMINVITSLPIDDALKILERAVEEHHDDANFSSDLLKKI
                     ELLLDRDQYLRTGHNEFEWFEQCKIDAGLIHYHSPYPEVRTVTSPIDDESIPVETFRA
                     YFFGFFWTILGAGVNEFFSHRKPLISLTAPVMQILLYPCGKFFERVLPNRVFKLGKVS
                     VNFNPGPWSYKEQMFATIIFNVSTNYTYVAHNIYVQKLKVFYGNDWLDFGYEVLLMLC
                     SQLLGFGYAGILRKFVIYNEKCLWPTLFPTMALNGALLRPDNKENTNGWRMTRYKFFM
                     VFFLTMFLYNWIPTYLFQGLSSFSWMTWISPKNFDLAMVTGSTSGLGLNPIPTFDWNI
                     IDYNYSLSIPFFSQLNQYIGTFIGFFVVLGLYYSNYKWTGYLPMNSNDIFTNTGDSYA
                     VQEILDSNSKLVESKYQAYSPPFYTAGNLLVYGGIFAQYPFAFAYVFFTEWKAISRCF
                     KQIYYQMKSFRSIGNKTTTYDGFDDPQTRLMKKYKDVPDWWFLVVLVVALVLGILCIK
                     LYPTQTPVWGLFYILAFNFLFLIPICFIFSTTGFSITMGVITEIIIGYALPGNGLALM
                     TIKSLGYTIDNQAESYIADQKLAHYAKIPQRAVFKGQLVGVLIQCFVALGVINWQIVN
                     VKNICTSKAENKFTCPKEVNFYSSSVFWGVIGPKRVFNGLYPILKYTFLIGFLLSILC
                     CAIKYFFPKQTRNFHPTILMGGLQQFAPYNLSYVTGGLYISFAFMFYIKRYYTKWWEK
                     YNYVLSAAFSSAIASSAIVIFFAVNYKPKHINWWGNNIIDTGVDGGEGRQTLKNVTSL
                     QGGYFGPRVGSYP"
     gene            <971205..>972503
                     /locus_tag="KLMA_50451"
                     /db_xref="GeneID:34717052"
     mRNA            <971205..>972503
                     /locus_tag="KLMA_50451"
                     /product="acyl-coenzyme
                     A:6-aminopenicillanic-acid-acyltransferase 40 kDa form"
                     /transcript_id="XM_022820447.1"
                     /db_xref="GeneID:34717052"
     CDS             971205..972503
                     /locus_tag="KLMA_50451"
                     /codon_start=1
                     /product="acyl-coenzyme
                     A:6-aminopenicillanic-acid-acyltransferase 40 kDa form"
                     /protein_id="XP_022676910.1"
                     /db_xref="GeneID:34717052"
                     /translation="MTVVDINKDLESSGYPFLVVKGTPYERGWQHGQAMRHKIAQLGQ
                     HYRASDTLPPWDWCKNIIDNCYLPALAEYDPFAMEEIKGISEGSGVALDIIMLINARY
                     DLTKYKNNDQFSKFAEAASDECTVGTLIDEGSVKMVQNWDLDDYVYKNDLCIILEAHT
                     SPQEKLPKCILTLGEVGQLGRSGMNSKGLGLCASALNTTSDFFAFPTNFQDKEQVKEI
                     EKKYGIQLPVIPISFARRKYLSCHSYANGLKYIVRAPRHVSGNIMVATREALSIDFEL
                     TSTAYQMINPTYVDSKTGSEVLPCSDARAILTHSNHFLMPRYGPSGEYVQCKNPGGSS
                     FYRHNLLTKRFVDVIKSTPVKKGISVDAVREAVSDTTCSPNSLSESPNPRCETSFDEP
                     EEILMTVATAIYDLTNGVATFCKGPPHLARNWRKVHISME"
     gene            972748..972829
                     /locus_tag="KLMA_R525"
                     /db_xref="GeneID:34718748"
     tRNA            972748..972829
                     /locus_tag="KLMA_R525"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34718748"
     gene            <973062..>974300
                     /gene="MRI1"
                     /locus_tag="KLMA_50452"
                     /db_xref="GeneID:34717053"
     mRNA            <973062..>974300
                     /gene="MRI1"
                     /locus_tag="KLMA_50452"
                     /product="methylthioribose-1-phosphate isomerase"
                     /transcript_id="XM_022820448.1"
                     /db_xref="GeneID:34717053"
     CDS             973062..974300
                     /gene="MRI1"
                     /locus_tag="KLMA_50452"
                     /codon_start=1
                     /product="methylthioribose-1-phosphate isomerase"
                     /protein_id="XP_022676911.1"
                     /db_xref="GeneID:34717053"
                     /translation="MSLKAIVFDRAPGSCKVQVLDQLLLPYQSQYLAINSIDDGFRVI
                     KSMQVRGAPAIAIVGVLSILLECQLLLDESFLRTQSYYDLAHLSDRLNQRLDFLLSSR
                     PTAVNLSNAINDIRKLIKSDLKIIYDSIYKYACDLVDEDFADNVTMGENGAKHLLKEL
                     EKEQFQGDFGVLTICNTGSLATSGYGTALGVIRSLHQRSKAENDSADPTSPASKKAKT
                     SNAKMVRVFPLETRPYNQGSRLTAYELLHDEIPSTLITDSSISYLISTSKIPIKAAFV
                     GADRIVKNGDTANKIGTFQLSLICRHFGIKFYVVAPTTTFDNKTETGDKIVVEERPPN
                     EFRFVQGTLIDGSSSLPVIDQLSNTPVKAKVGITPLDMPVWNPSFDITPHDYIDGIIT
                     EKGVFTKAEDGKFHLESVSV"
     gene            complement(974477..974566)
                     /locus_tag="KLMA_R526"
                     /db_xref="GeneID:34718749"
     tRNA            complement(join(974477..974513,974531..974566))
                     /locus_tag="KLMA_R526"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34718749"
     gene            <974868..>975650
                     /gene="fabG"
                     /locus_tag="KLMA_50453"
                     /db_xref="GeneID:34717054"
     mRNA            <974868..>975650
                     /gene="fabG"
                     /locus_tag="KLMA_50453"
                     /product="3-oxoacyl-(acyl-carrier-protein) reductase"
                     /transcript_id="XM_022820449.1"
                     /db_xref="GeneID:34717054"
     CDS             974868..975650
                     /gene="fabG"
                     /locus_tag="KLMA_50453"
                     /codon_start=1
                     /product="3-oxoacyl-(acyl-carrier-protein) reductase"
                     /protein_id="XP_022676912.1"
                     /db_xref="GeneID:34717054"
                     /translation="MLSHSLFQDKVAVVTGASTGVGEAIATALFEKGALVFITSRHLA
                     EIQQTANRIDPTGKRVFGRAVDVTRAEEVKNLFAEIEATFGSLHHLVNNAGITGPHNT
                     GIENYDLDDWKRVIDTNINGMFYTLKYALPLMESTVGSEKNCIETTVVNLSAVNGIVG
                     IPGISPYTASKHAVAGITQSVALEYAQRHIRINAVAPGYVSTPRINDLPPEVQNWMAR
                     QHPMQRMASLSEVSNTVLFLLSTLSSFTTGVVYPIDGGYLAQ"
     gene            <976876..>978507
                     /gene="CLB2"
                     /locus_tag="KLMA_50454"
                     /db_xref="GeneID:34717055"
     mRNA            <976876..>978507
                     /gene="CLB2"
                     /locus_tag="KLMA_50454"
                     /product="G2/mitotic-specific cyclin-2"
                     /transcript_id="XM_022820450.1"
                     /db_xref="GeneID:34717055"
     CDS             976876..978507
                     /gene="CLB2"
                     /locus_tag="KLMA_50454"
                     /codon_start=1
                     /product="G2/mitotic-specific cyclin-2"
                     /protein_id="XP_022676913.1"
                     /db_xref="GeneID:34717055"
                     /translation="MSKDKYERSLKNLNMLRRPVLNNVTNTTDSSLNTFGKVLRQAKS
                     KLQNNRGNITQSATDFDSNSSNSIPLREGHAIREDKENLNPLGKIDEREELEPSHKTL
                     NTQKHVTIDDKQQIIGYSHLGFDKSAPSTSSSTTSSNNTNSAGSSATSSYKNDPRTNA
                     EGELLAKTHLQTKQDDIVLHRREVPGNNSDDAIGSGSGSSESENALTNTASLNDNTTA
                     STNTQLITEQLEVEDSKKRPISTVVEQTLPKKFKVCEKGKEYEWEDLDEEDINDPFMV
                     SEYVNDIFEYLHRLEMMTLPNRHELFKHANIQQNRDILVNWMVKIHNKFGLLPETLYL
                     ALNIMDRFLCRELVQLEKLQLVGTACLFIASKYEEVYSPSVKHFAYETDGACDEEEIK
                     EGEKFILKTLEFNLNYPNPMNFLRRISKADDYDIQSRTLAKYLLEISIVDFKFIGILP
                     SLCAAASMFLSRKMLGKGKWDGNLIHYSGGYTKDELAPVCNMVMEYLVQPVVHDELFK
                     KYASRRFMKASVISRQWAKKVMSHNYDIMTLHDAE"
     gene            complement(<979316..>980659)
                     /gene="CLB5"
                     /locus_tag="KLMA_50455"
                     /db_xref="GeneID:34717056"
     mRNA            complement(<979316..>980659)
                     /gene="CLB5"
                     /locus_tag="KLMA_50455"
                     /product="S-phase entry cyclin-5"
                     /transcript_id="XM_022820452.1"
                     /db_xref="GeneID:34717056"
     CDS             complement(979316..980659)
                     /gene="CLB5"
                     /locus_tag="KLMA_50455"
                     /codon_start=1
                     /product="S-phase entry cyclin-5"
                     /protein_id="XP_022676914.1"
                     /db_xref="GeneID:34717056"
                     /translation="MTSVCSTGSQSCEVEPQVDIRIETKVESGRIKSDRDSQSISTME
                     NTSSSIPRKRTALSEKPTEENKLKSSVASLRKQQESGSNSSSSSSSVSVGGSQRFYGK
                     KPVSLKRSIYRDNEQETEASSGSGSSSSTSSEPERHVKRLKSERLEKRREELDSQDKD
                     DVTMCYDYADEIFEHLYKRQFETTTRLNYLKDKNYEFYLRPTMRSILVDWIIEVHCKF
                     QLLPETLYLAINIMDRYLSFNKVTLPKLQLIAITSLLIAAKFEEVNLPKLSNYSYITD
                     SAYSNEEIKQAEFVILNKLEYNIGWPNPLNFLRRISRCDNYDSTTRQLGKCLLEYMVC
                     CPHFISLVPSQIASVAMYTAQKIVHPDFQWDELWSHYSLHPFDDNETELREQAQILIN
                     DIAKPSTQLNALIYKYKKIGIWNKIHNWCLENSIINSEEESSSDCASSIASSVSA"
     gene            <982189..>982440
                     /locus_tag="KLMA_50456"
                     /db_xref="GeneID:34717057"
     mRNA            <982189..>982440
                     /locus_tag="KLMA_50456"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820453.1"
                     /db_xref="GeneID:34717057"
     CDS             982189..982440
                     /locus_tag="KLMA_50456"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676915.1"
                     /db_xref="GeneID:34717057"
                     /translation="MEGLKTKFSKFKRYLSGSPVEGETYEETRVSDLPHMKDADGALV
                     AVSSGKRELSPVLSAKYNIQPGKSGSAAEPANQIDDTIN"
     gene            982881..982973
                     /locus_tag="KLMA_R527"
                     /db_xref="GeneID:34718750"
     tRNA            join(982881..982917,982935..982973)
                     /locus_tag="KLMA_R527"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:34718750"
     gene            <983487..>987020
                     /gene="AXL1"
                     /locus_tag="KLMA_50457"
                     /db_xref="GeneID:34717058"
     mRNA            <983487..>987020
                     /gene="AXL1"
                     /locus_tag="KLMA_50457"
                     /product="putative protease AXL1"
                     /transcript_id="XM_022820454.1"
                     /db_xref="GeneID:34717058"
     CDS             983487..987020
                     /gene="AXL1"
                     /locus_tag="KLMA_50457"
                     /codon_start=1
                     /product="putative protease AXL1"
                     /protein_id="XP_022676916.1"
                     /db_xref="GeneID:34717058"
                     /translation="MSSTGIKKIDIPLYTPISNSNRSHQYIQLDNGITALLISDPSEP
                     LASFSASIMTGSHNDPDNVPGLAHLCEHMIIASESKNFPKATYYHNLLTEYNGNQNAF
                     TTGEQTCFYFEIPNSNNKTGKPIFDELVKVFADKLKSPLFSASVINQEIQAIDNEHNN
                     NKNLNSKLLYHAIRKLANPKSQFSRFGTGNSLTLAQVPLVGKASSLKNILQKYYTDHF
                     ISENINVVVRGSQSIHYLRKLVLSNFGDFRSGTKLHKSIGNSSNRPFQKLFDKWDPIY
                     SEPVFEHKNSSVPNTIFLQSSKAPLLRLVFPVPCKGGSFSRNEINIFAKVWSDLFGDE
                     NEGSIHSHLCAKNLLNKHVSQVSKFTVNDKGLVLHFDLTTKGWESGVDSILTHLFRDF
                     IPYILNLDPDIIAIYLNEWNAINMLKFLYQDLDSSTMDKCSDLCVEMAQCEEPSFILN
                     NGMTAPCNHLDSGIDSYYENTPSRNWWIRLAIRFQSFIRTYMNSENCKYILLGELKKS
                     KSFQEAMGHSKQNFSMSVDEYFGLEYVFLRTPTKYSAPTAQELEPINFQLPCSKQFLF
                     GLERNLSALKQSLSAVLQKSQQSSLSMIAKSELLDTQPELHRKNDNYELWIKREHLLQ
                     YSSRSIITVELINMKLSASAENTMNLEILTQLLFLYINETLYSSERVGYMYQIAANNR
                     GDVRLALTISGFPQGVLKILQVIMDKLVSICQPTFEISKEMFRASRVAVRNKYEEAAR
                     ANSCTLASLGVIILLEKNLTTLEERLDALEEITLESFKQFSSKLWIPKSNYMNLFIQG
                     DISILDPVNEYMNGVIHHLDSGMTTEKFHLKEPETIRLPKGKDYYIQLSGFKEDPTNS
                     VVYFIETGDRKSPIDYTMTSLLEFFMSLTLVPDLRHKKQIGYVVLGGLRLLTDSLGIH
                     ISVMSNLDPETIETKIEEYLYYLEHEVLDKMTEKEFQETILQKYIQLIKSNSLDKLIK
                     TAGPANLMAQIEGSVHSGNYPSTIQSQGYTLGHHKKLKDEISFRTYNFSTSTVDIALL
                     SQLTLASWKHYFNSKISISSEQRRKLSVRFKTSMSQTDVTANIMTMQLDYFLKSKGFH
                     IQKEELQAIVTRTGGKPASLFKELFHHFRAQGQSLKLCTLVLKEICKQIMALTSTSTV
                     ASPTSSKQRIPLPLSLAKTEIISVQQFKQIW"
     gene            <987502..>988704
                     /locus_tag="KLMA_50458"
                     /db_xref="GeneID:34717059"
     mRNA            <987502..>988704
                     /locus_tag="KLMA_50458"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820455.1"
                     /db_xref="GeneID:34717059"
     CDS             987502..988704
                     /locus_tag="KLMA_50458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676917.1"
                     /db_xref="GeneID:34717059"
                     /translation="MTLKLKFEAVTDPEVIRFTHIENGSVWSSRFLSQEEYADREWVL
                     GQSDLGQLHRSQEHIDKYDSNAVYLGLKYFVLKDVSLPETSKTSQIVASCETMNRTGW
                     AMLPGDSTGQIHEVLVACIGGVFTLKHHRGRGYARRMIELLNEYYDSLAQNSEEPFLK
                     HLAVHLYSEIGEYYAKNGYVSYHVPLYELHNLDGLQEHYCEKYSCDNETTITANDIRY
                     LGYDDYEDLVELQKQHFKKQLLQAHDACGGSRFIFTVQPSLKIYKWFEDRDLFLYKKF
                     REEKPTRFGAALADGSHIVWHHSWTSGTLILLKVQIMGEDQEKKLALLLKECIQEARS
                     SDITHLEFWQDELPGEKFPIFHSTIRALEPGSNLEKINSSLSAVRAAQGEFRGEILWL
                     NNTKFCWF"
     gene            989120..989190
                     /locus_tag="KLMA_R528"
                     /db_xref="GeneID:34718751"
     tRNA            989120..989190
                     /locus_tag="KLMA_R528"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718751"
     gene            <989587..>990033
                     /gene="DUT1"
                     /locus_tag="KLMA_50459"
                     /db_xref="GeneID:34717060"
     mRNA            <989587..>990033
                     /gene="DUT1"
                     /locus_tag="KLMA_50459"
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /transcript_id="XM_022820456.1"
                     /db_xref="GeneID:34717060"
     CDS             989587..990033
                     /gene="DUT1"
                     /locus_tag="KLMA_50459"
                     /codon_start=1
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="XP_022676918.1"
                     /db_xref="GeneID:34717060"
                     /translation="MTESLSNRLQIQLRSADAKVPTKGSSTAAGYDIYASQPCVIPAR
                     GRGIAKTDISFTVPVGTYGRIAPRSGLAVKHGIQTGAGVVDRDYTGEVGVVLFNHSDE
                     DFQINKGDRVAQLILEKIVDDAEIAVVETLQQTERGAGGFGSTGKN"
     gene            <990454..>990636
                     /locus_tag="KLMA_50460"
                     /db_xref="GeneID:34717061"
     mRNA            <990454..>990636
                     /locus_tag="KLMA_50460"
                     /product="mediator of RNA polymerase II transcription
                     subunit 22"
                     /transcript_id="XM_022820457.1"
                     /db_xref="GeneID:34717061"
     CDS             990454..990636
                     /locus_tag="KLMA_50460"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 22"
                     /protein_id="XP_022676919.1"
                     /db_xref="GeneID:34717061"
                     /translation="MQLIKGIQDLLVITRTIREKWVLSQLPENEESSMFESEETLENC
                     KNLIQQAMDTLREDIS"
     gene            <990923..>992566
                     /gene="DSN1"
                     /locus_tag="KLMA_50461"
                     /db_xref="GeneID:34717062"
     mRNA            <990923..>992566
                     /gene="DSN1"
                     /locus_tag="KLMA_50461"
                     /product="kinetochore-associated protein DSN1"
                     /transcript_id="XM_022820458.1"
                     /db_xref="GeneID:34717062"
     CDS             990923..992566
                     /gene="DSN1"
                     /locus_tag="KLMA_50461"
                     /codon_start=1
                     /product="kinetochore-associated protein DSN1"
                     /protein_id="XP_022676920.1"
                     /db_xref="GeneID:34717062"
                     /translation="MGSQGSENSRGDTSSSRRILKMHTIPTETPERKTRRSETQQSFE
                     TDDEFQFRRHSAKKSQFGDRLQEFQNVRDARRVENFNSSFQAGAGSQLQSQPPSREKG
                     MGGEPISQEQQFPLPSQLPPQGQMFPYPAQSQLQSPHRMIPMPMVYYYPATAQQQQQQ
                     QQQQQQRQQYAISPQELGINFQAMNQFMDSQYHEQQPQHYYPSLMPAPSFYPPQSAEE
                     KLPNSVYQNRPSLPPEDARAKRKSFILQRGRRLSLLNQENQLNDIISPHKDVHESEFY
                     RYMNNSFAQDLKMKQLMNWCLIRTLRKTELKNAQLENKSESKKIALTILKDFVRDIRK
                     GNHDIDWESEGPEQEPDTERVLEDEAEISNLFKDDNNVVVSPDFNSSPTKTRTEVELD
                     TDEEAKTKPKTKGKGEVSVKFARIPNEKNIQNKESVKILEKKIKTIQEEVEQWSRDLS
                     KVKLPHYKLPEPQTAVVKLPDNLQLTATSKEAVHLDFQKRIDGLQETTRLLSATSKLL
                     EQTASMKLKKLNNCMVSKTSTDKTSTKTLLRGLSRSLLQ"
     gene            complement(<992723..>993199)
                     /gene="TRS20"
                     /locus_tag="KLMA_50462"
                     /db_xref="GeneID:34717063"
     mRNA            complement(<992723..>993199)
                     /gene="TRS20"
                     /locus_tag="KLMA_50462"
                     /product="transport protein particle 20 kDa subunit"
                     /transcript_id="XM_022820459.1"
                     /db_xref="GeneID:34717063"
     CDS             complement(992723..993199)
                     /gene="TRS20"
                     /locus_tag="KLMA_50462"
                     /codon_start=1
                     /product="transport protein particle 20 kDa subunit"
                     /protein_id="XP_022676921.1"
                     /db_xref="GeneID:34717063"
                     /translation="MFYFTIIGTDDNPVYEAEFTSAKSSFRPDIKELNPYIVHSALDI
                     MEYLQWQRQPNLEVNTNTGGFLRSRHTMQENSYLGKIDSFYGLVVSGFLTYGNIKFIM
                     VHGNGVVDDPTTKTFYYEVYELYLKTLMNPFYKVNDPISNPTFDSKVRVLAKKLFT"
     gene            993452..993522
                     /locus_tag="KLMA_R529"
                     /db_xref="GeneID:34718752"
     tRNA            993452..993522
                     /locus_tag="KLMA_R529"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718752"
     gene            <994129..>995859
                     /gene="MTC4"
                     /locus_tag="KLMA_50463"
                     /db_xref="GeneID:34717064"
     mRNA            <994129..>995859
                     /gene="MTC4"
                     /locus_tag="KLMA_50463"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022820460.1"
                     /db_xref="GeneID:34717064"
     CDS             994129..995859
                     /gene="MTC4"
                     /locus_tag="KLMA_50463"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022676922.1"
                     /db_xref="GeneID:34717064"
                     /translation="MSKEVDEDEEVILRDVAREERLKRITELMLELKKGMMEDFHIDS
                     HTSVPQEEKGVGRTKISRRTREQADKVRVYLEFYYTLIEKYTKPPPGEEHRDVDNVYN
                     PLQVIRNRKIRKKYGDKTRDFHLARPPVIAIKDFSHRSSKFPWYVDIMEKSNDIVWRT
                     NHWDELKRPDGSLWFGKKLHRQHSHPHMHQPPHQFSGHWSKNSVVSSGSSGENSYNED
                     ISAGNSRSLLSRFSRGATRRPEPLEGFTQNNNDSKIVVPKIIYQTPTEYGNGKTAIID
                     VPIDPLKKPDEEQDSKPERLEPELEQNQEDEQYQEQYHDQGDQLDEQQPDHLELEQLR
                     QQLSLPSQTQSLQPKNSPKRSNGLYPTHSSTSSTKHSKANSLSLSHSNQPSSSVDLQS
                     FIVEESIRRKLYEDYRSIKCLECSWEVLRRKRVLTELAAKRRMNVTAKKLRANVRSLK
                     HEMNLTESLLGSYEAELSTDGVLLSEFKTKFLKDYSNRVNSLISFSDRFLSDINTTLT
                     LRLRILKENIDKVSLLSHQKRAWRKGLYKALEVFIVSCLWFVWLVFSILRIVQNGLII
                     VFKIVKWALF"
     gene            complement(<995945..>996307)
                     /locus_tag="KLMA_50464"
                     /db_xref="GeneID:34717065"
     mRNA            complement(<995945..>996307)
                     /locus_tag="KLMA_50464"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820461.1"
                     /db_xref="GeneID:34717065"
     CDS             complement(995945..996307)
                     /locus_tag="KLMA_50464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676923.1"
                     /db_xref="GeneID:34717065"
                     /translation="MGQVQPIHYDPATVKQLTKEILIASGIGALKGATVGIVTGLLLR
                     RFSTTYRNVRTQVRVFYHCSWISMGIVFNADKQLIRFQDRYYAEELKRRERILDEAAE
                     RGIFLEEEAVSLSTTKQP"
     gene            complement(<996876..>997943)
                     /gene="STS1"
                     /locus_tag="KLMA_50465"
                     /db_xref="GeneID:34717066"
     mRNA            complement(<996876..>997943)
                     /gene="STS1"
                     /locus_tag="KLMA_50465"
                     /product="protein DBF8"
                     /transcript_id="XM_022820463.1"
                     /db_xref="GeneID:34717066"
     CDS             complement(996876..997943)
                     /gene="STS1"
                     /locus_tag="KLMA_50465"
                     /codon_start=1
                     /product="protein DBF8"
                     /protein_id="XP_022676924.1"
                     /db_xref="GeneID:34717066"
                     /translation="MSQSVGFEWGFRPSVCNENSDVSGRNRNSQRSGGIANGMASSSS
                     SASSGNGVAHGQLHSSLHGNTGVSINRISKPRGKRRYTEEDVQGSVAVTPAAPAAAAG
                     AGAGAPASGYRVSKRKPAYRNFIQGQPLPFPRSVELMDKQLLQSVLLSLVREHPEIQH
                     ALLSKVQSLSFNMEQYMTILEEKLRKVYEDIPYSKYNQNSDGSLNDYAFGRMKASIME
                     FLNCIIDYLLSSIPPQSDNVVQSLRFLKCCTELLNQLPEFETASNNYYKNMCFEQISE
                     IWCSCIQFASTDLSFMSVISNLEEWETELRTLNHRSNDKLQKPLQLIASIKNSGALVG
                     QNGHSLSQSQPSTMGFLNISS"
     gene            <998468..>999760
                     /gene="SQT1"
                     /locus_tag="KLMA_50466"
                     /db_xref="GeneID:34717067"
     mRNA            <998468..>999760
                     /gene="SQT1"
                     /locus_tag="KLMA_50466"
                     /product="ribosome assembly protein SQT1"
                     /transcript_id="XM_022820464.1"
                     /db_xref="GeneID:34717067"
     CDS             998468..999760
                     /gene="SQT1"
                     /locus_tag="KLMA_50466"
                     /codon_start=1
                     /product="ribosome assembly protein SQT1"
                     /protein_id="XP_022676925.1"
                     /db_xref="GeneID:34717067"
                     /translation="MDNSEVSNVAEQPEGEFIGEEEVGEVVAVDNGDNMMDVEADEDE
                     EMGEGEEVGESLEIDMSNNSNGFFDKHTDSIFCIAHHPSLPLVMTGGADNVANLWTSH
                     SKPPKFAGSLPHTESVISGGFTPDGKFLITADMNGKVFVYKSMKGGAQWKVCSELQEV
                     DEVVWLKLHPVVSGVFAFGGVDGSVWCYQLNNVDGSLSQIMSGFSHQQDCTMGEFINV
                     EEGENNLTLVTCSLDSSIVAWNCYMGQPLFKITQADVKGVEAPWVSLSAAPMALTNNT
                     PVIAAGSNNGLLVIINCTNGSVLNLTTVIELKPEQDELDASIESIAWSPKLPLMAIGL
                     VCGDVLLYDTKTWRVRHKFELEDSATKLVFDSNNGHNLIASCINGKVYIFDARTGQEV
                     HVCVGHNMGVLDFILIENNKKLITAGDEGVSLIFDLPQ"
     gene            complement(<999898..>1000611)
                     /gene="RIB5"
                     /locus_tag="KLMA_50467"
                     /db_xref="GeneID:34717068"
     mRNA            complement(<999898..>1000611)
                     /gene="RIB5"
                     /locus_tag="KLMA_50467"
                     /product="riboflavin synthase alpha chain"
                     /transcript_id="XM_022820465.1"
                     /db_xref="GeneID:34717068"
     CDS             complement(999898..1000611)
                     /gene="RIB5"
                     /locus_tag="KLMA_50467"
                     /codon_start=1
                     /product="riboflavin synthase alpha chain"
                     /protein_id="XP_022676926.1"
                     /db_xref="GeneID:34717068"
                     /translation="MFTGIVEHIGTVAEYKELDESVSGGNGVSVTIKDASPILGDCHI
                     GDSIACNGICLTVTEFDSDSFKVGISPETINRTEIASWKVGTKINLERAVSQEVRFGG
                     HYVQGHVDSVATITSRRPEGNSIVFGFKLRDDTYNKFIVEKGFIALDGTSLTVTQIDD
                     DGTFYIAMIAHTQEHVVMPLKKIGDLVNVEVDVTGKVIEKQIDVHLEAQISNPKSSLA
                     QLVGKLVEQKVAEYISKSK"
     gene            complement(<1000976..>1002481)
                     /gene="BAR1"
                     /locus_tag="KLMA_50468"
                     /db_xref="GeneID:34717069"
     mRNA            complement(<1000976..>1002481)
                     /gene="BAR1"
                     /locus_tag="KLMA_50468"
                     /product="aspartic proteinase yapsin-3"
                     /transcript_id="XM_022820466.1"
                     /db_xref="GeneID:34717069"
     CDS             complement(1000976..1002481)
                     /gene="BAR1"
                     /locus_tag="KLMA_50468"
                     /codon_start=1
                     /product="aspartic proteinase yapsin-3"
                     /protein_id="XP_022676927.1"
                     /db_xref="GeneID:34717069"
                     /translation="MVYSLGALLLLSSVVNCRHIEAQEKAGTISVNLHKNHKSEVHNL
                     IKRSKNVPGPILRHDEDYSYYVELGVGTPRQNVKVILDTGSSDLWIPSKTNPYCLPNT
                     AEALAKRAVTPDIDCSINGVFDASASTSLKKTGYNFSIEYADLSTSDGYWALDDVTLN
                     GVTVEGAQLAVADTTDIEAGILGVGLPRLESFKGYPGAPNKTYDNFPQMLKKEGYISK
                     VAYSLFFENGNVDSGTLLFGGVDQKKYEGQLYTYPMVNIHPFLTKPAEFHVTLQGFGY
                     RSEAKCDEGVYFHEKAPALLDSGTNVLQAPDSVVKTIVKQLDGEWSEEDGLYVAQCPS
                     STDDTTYFFDLGEVKIKMPIQDFFFPPNDGETKCQIRLIPGEDEWILGDLVMQHAYLV
                     YDLEAYQISIAPGKKTTGSRIETIGRDGVIPDTVLSTASPWTIGGDNTSSSASVFDSN
                     LTCTKSNSKRSLHKALIDRDVEVANSGSQIVRGSSLLPVLMSVAYAIVSLF"
     gene            complement(<1003278..>1003796)
                     /gene="SNL1"
                     /locus_tag="KLMA_50469"
                     /db_xref="GeneID:34717070"
     mRNA            complement(<1003278..>1003796)
                     /gene="SNL1"
                     /locus_tag="KLMA_50469"
                     /product="HSP70 co-chaperone SNL1"
                     /transcript_id="XM_022820467.1"
                     /db_xref="GeneID:34717070"
     CDS             complement(1003278..1003796)
                     /gene="SNL1"
                     /locus_tag="KLMA_50469"
                     /codon_start=1
                     /product="HSP70 co-chaperone SNL1"
                     /protein_id="XP_022676928.1"
                     /db_xref="GeneID:34717070"
                     /translation="MDKLQEYAETVLADVKSIHSVEDALQSLTVRVTGMLFVTALAVW
                     ISSRSTTGGSSSGKKKSKKKSKGRTKGKVVKKKVMTEEETIKDVINRFEKEYEQGLTK
                     LLENFDPSSETMQYERNYYNEMLLHLLLDLDGVHLGNLEGDKKEEVRLQRKAAIKKIQ
                     LELKKLDKLEKK"
     gene            <1004453..>1007362
                     /gene="VID28"
                     /locus_tag="KLMA_50470"
                     /db_xref="GeneID:34717071"
     mRNA            <1004453..>1007362
                     /gene="VID28"
                     /locus_tag="KLMA_50470"
                     /product="vacuolar import and degradation protein 28"
                     /transcript_id="XM_022820468.1"
                     /db_xref="GeneID:34717071"
     CDS             1004453..1007362
                     /gene="VID28"
                     /locus_tag="KLMA_50470"
                     /codon_start=1
                     /product="vacuolar import and degradation protein 28"
                     /protein_id="XP_022676929.1"
                     /db_xref="GeneID:34717071"
                     /translation="MVVQEKRKITKEVLLELRKSIIGDQNSKFIIYKEHRDLIEAVIE
                     YDRHLSLKLDVLLILAHLDKGSCKELGRHGTELFVRILGMEIPNDSDVEDIAKYVKLR
                     RICIENCTEAETNEQFFFQEFYDNEPLNVFKASADQLVKTDEAVYRDIVIEYMRYLST
                     LPFVITSPELVSVLREIIYFYVDKYLPTVNFKYTMVTSAKERYEAECDVFYDPNNTSA
                     ELLKKINNYSSGSSSSGSSSANKQPCFDSLPQCMTISDPFDMQLIFVLSNLLTVLQSG
                     GTGQFAFLADIKINIFYASLVRHPDIRLKTSALSFFYCQLGDSWFAETRKDDSSSSTI
                     NNSSPFPIKLWIPTLISTLNEPELPQFFSPLAILSSLATEFTIPQKPENIVIDTFFDS
                     NLLNGMIDTFLRLLSMEKQNTDKLQLLADYLKFFSEIIGKDERCRLLFLENVSVLQYM
                     ENAFSSHLLILNNFREDWPQLKKLAPLPALFDSELVTNWAKCLKACSRSVGVLRTSLK
                     RNKLAEYTLKLAREVYEIVSSTYTGDISHLLSQELVLLGELLGAMSNFVVEFSSLRTL
                     MKKNGIIELIKNIFADPVFNTQYLDRAASQPIDYSKAKPVTLFQNEPNIYSQIIVIQT
                     NSLWVLRHLIYNSETCDKLELLSEIDLESILQFVHSTDPSVLNQCFQLLRNLTCNSRK
                     VINMILDKFKNVNVQTPDINDIMDTSSRSGSLGHGNNFLKFLAFKLRTVLYDDSYFGD
                     NKIAEALLYIVVNFTAINENKRNLVIAQDDLLNIVKEYILVEKSDEITKACLWIVTNL
                     IWDSSIQNVSYNNSLSESGNPHFESDWGLHSDNNPIPTRNDDPIARMPLSRQGSGMLY
                     DQNGNTINDDNDDDENNEEEEEEEELDDEDLESKQDDDSMSIYKHILETHGNTPSGAP
                     LSPAFIRFKKLDSLGFDEAVKKILDWNGDLDVKERAKTLLYQMETFRKSSIPAQA"
     gene            <1007724..>1010822
                     /gene="MET10"
                     /locus_tag="KLMA_50471"
                     /db_xref="GeneID:34717072"
     mRNA            <1007724..>1010822
                     /gene="MET10"
                     /locus_tag="KLMA_50471"
                     /product="sulfite reductase [NADPH] flavoprotein
                     component"
                     /transcript_id="XM_022820469.1"
                     /db_xref="GeneID:34717072"
     CDS             1007724..1010822
                     /gene="MET10"
                     /locus_tag="KLMA_50471"
                     /codon_start=1
                     /product="sulfite reductase [NADPH] flavoprotein
                     component"
                     /protein_id="XP_022676930.1"
                     /db_xref="GeneID:34717072"
                     /translation="MSNSYIVNPFGLPTESNQLPTYTTPLNAINSVLFKNLENVFSYK
                     TFSDPDLLDASIKKLAERSKNLYFKELDVRSGAGLTTLGFANQSNGVSGIIAPGYALP
                     YFVSTFKQEKQRQSRFVFNVGSLDYDEVSGSVTNDYLTALNAAKDLGFPVITPTQVSE
                     VKATSLLVLALAKYGRSLGAVQLFDGAHYARTVTRVEDELHDDFIESLNLKEGSTFDE
                     ILDAFNENSSKRLHNFQYYGSESAETVFVTYGSLESELFASVLDKSDSNIGLLVVRIP
                     LPFDSAKFVSLIPSTAKEIVVIGQSLSGQSPSWLRSQVSGALFLNNKRNLKVAEYIYQ
                     PNFVWSPSAAEQVIANFIPGFKLQLTETGQKFIYWSADNSNNADLAARLTQGLSLIDN
                     IDVSLRSKFDNIGNAGTFQTQFCSYAKNSKITVSNIDAADVVMVEDTSLLNFYDVTAT
                     LKEEGTLIIFVKTPLVEKDLSDKSFYIDELKLSPELLKAIATKNLTVTLLDVETIGDR
                     EETKGRTLSFVAQAAFWRAATNDDTQSIIRRIWNSAGPDIELLAAVLSDTISKAFEVG
                     VKNIPKDAYPKFIENENKEKEEESVQLPAFVIETSFAPNQKLSESTPDVELSNVTEIS
                     KKLVFKEAYGVSRELRPDLPVNNYIVKVKNNRRVTPEDYDRYIFHIEFDISGTGMTYD
                     IGEALGVHARNNLENVRNFLEFYGLNENDIVQVPNKDNNQFLESRTVLQAFVENLDIF
                     GKPPKRFYESLVEFCTDENDKKKLEELVSPAGATELKRFQDVEYYTYADIFELFPSAR
                     PSVGDLVKIIAPLKRREYSIASSQKVHPNEVHLLIVVVDWIDNKGRKRYGQASKFISE
                     LAVGSELVVSVKPSVMKLPPSPKQPVIMSGLGTGLAPFKAIVEEKLWQKQQGYEIGEV
                     YLYLGSRHKREEYLYGELWEAYKDAGIITHIGAAFSRDQPEKIYIQDRIRENLPELKT
                     AMIDNEGSFYLCGPTWPVPDITQALQDIIEADAKEKGITVDLNAAIEELKESSRYILE
                     VY"
     gene            complement(<1010892..>1014404)
                     /gene="SMC2"
                     /locus_tag="KLMA_50472"
                     /db_xref="GeneID:34717073"
     mRNA            complement(<1010892..>1014404)
                     /gene="SMC2"
                     /locus_tag="KLMA_50472"
                     /product="structural maintenance of chromosomes protein 2"
                     /transcript_id="XM_022820470.1"
                     /db_xref="GeneID:34717073"
     CDS             complement(1010892..1014404)
                     /gene="SMC2"
                     /locus_tag="KLMA_50472"
                     /codon_start=1
                     /product="structural maintenance of chromosomes protein 2"
                     /protein_id="XP_022676931.1"
                     /db_xref="GeneID:34717073"
                     /translation="MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDA
                     ICFVLGISSMSTVRAQNLQDLIYKRGQAGVTKASVTIVFDNSDPNNSPIGFESHSKIS
                     ITRQIVLGGVSKYLINGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE
                     ILSLIEEAAGTRMFEDRKEKAERTMAKKETKLQEIRALLSEEIEPKLEKFRNEKRTYL
                     EFQETQSDLENVMKVVNAFEYNYLVNKKAHIEETLVTREAKTQELEETIARLKNEVES
                     LNNDLQALKEQRQREVHKGGKLAELEAQESQISDELSRVETNLNIAKEDMNEEIGNIS
                     KLKDNLAKWKQQHDSKKALYDSTFEKYTSQNQNLEKLKTLLKEKQELHSTLTTGISSS
                     GTTANGYNSQLTAIKVKIQNAQVEIKEKEMEMEMLTEELNSNTPKLSAARAEKERYDN
                     EIQNLKQHSEELEKRLNEFGYNPAELKRLKDKERSLKQEYYRLGQEVESLHRKVSSLD
                     FNYVPPSKNFDVSSVKGVVGQLFSLDESNIDSSTALQVCAGGRLFNIVVDNERTASQL
                     LEHGRLRKRVTIIPLNKIASRRINESVIHLAKQLAPGKVELALNLIGYEDDVAKAMEF
                     IFGTSFICKDSQTAKLITFNRDIRSRSITLEGDVYDPEGTLSGGSRRSNNTLLLDIQR
                     YNNAASKYKQVEEELNEVSMQIKAEETKAESSKSILSELNITNHKLKLAEKNAQASNA
                     MQLFNRNNEIQTQLESLKMHTIQLSSLIDGYNHEINTIENDMQEFNKDKGAKLKQLEA
                     TLSNMSNDVNRLDAETSKLFDDYQNLSVETDQLSNDISNAENQIATAQEKITELQETC
                     NKYSDIASTKKLELNELQQNLEEERSRLSTMEEELAELETLLKNKNRLLSKSEVELQK
                     LSTDLTKHKNDTQNIDHAIEKKLGENPWLTDTAMVNDILAQNKNINIDQYKKRGHDLA
                     ESFQNLRRKVNPEVMSMIESVEKKEAALKTMIKTIEKDKQKIQETIRKLDEYKRDTLI
                     KTWQKVNIDFGNIFSDLLSNSFAKLEPSEGKDVTEGLEVKVKLGKIWKESLVELSGGQ
                     RSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKE
                     GMFTNANRVFRTRFQDGTSVVSIM"
     gene            complement(<1014898..>1016094)
                     /gene="RPL2"
                     /locus_tag="KLMA_50473"
                     /db_xref="GeneID:34717074"
     mRNA            complement(join(<1014898..1015658,1016091..>1016094))
                     /gene="RPL2"
                     /locus_tag="KLMA_50473"
                     /product="60S ribosomal protein L2"
                     /transcript_id="XM_022820471.1"
                     /db_xref="GeneID:34717074"
     CDS             complement(join(1014898..1015658,1016091..1016094))
                     /gene="RPL2"
                     /locus_tag="KLMA_50473"
                     /codon_start=1
                     /product="60S ribosomal protein L2"
                     /protein_id="XP_022676932.1"
                     /db_xref="GeneID:34717074"
                     /translation="MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRNLDYAERHGYIRGV
                     VKQIIHDAGRGAPLAKVVFRDPYKYKLREETFIANEGLHTGQFIYAGKKASLNVGNVL
                     PLGSVPEGTIISNVEERPGDRGALARASGNYVIVIGHNPEDNKTRVRLPSGAKKIISS
                     DARGVIGVVAGGGRIDKPLLKAGRAFHKYKVKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGKASTISRGAVSGQKAGLIAARRTGLLRGSQKTQD"
     gene            complement(<1019105..>1019464)
                     /locus_tag="KLMA_50474"
                     /db_xref="GeneID:34717075"
     mRNA            complement(join(<1019105..1019302,1019459..>1019464))
                     /locus_tag="KLMA_50474"
                     /product="60S ribosomal protein L29"
                     /transcript_id="XM_022820472.1"
                     /db_xref="GeneID:34717075"
     CDS             complement(join(1019105..1019302,1019459..1019464))
                     /locus_tag="KLMA_50474"
                     /codon_start=1
                     /product="60S ribosomal protein L29"
                     /protein_id="XP_022676933.1"
                     /db_xref="GeneID:34717075"
                     /translation="MEFEMAKSKNHTAHNQTRKAHKNGIKKPKTYKYPSLKGVDAKFK
                     RNHRFALHGTAKALAAKRAAEKK"
     gene            complement(<1021005..>1021382)
                     /gene="QCR6"
                     /locus_tag="KLMA_50475"
                     /db_xref="GeneID:34717076"
     mRNA            complement(<1021005..>1021382)
                     /gene="QCR6"
                     /locus_tag="KLMA_50475"
                     /product="cytochrome b-c1 complex subunit 6"
                     /transcript_id="XM_022820475.1"
                     /db_xref="GeneID:34717076"
     CDS             complement(1021005..1021382)
                     /gene="QCR6"
                     /locus_tag="KLMA_50475"
                     /codon_start=1
                     /product="cytochrome b-c1 complex subunit 6"
                     /protein_id="XP_022676934.1"
                     /db_xref="GeneID:34717076"
                     /translation="MISSITAYLEELKDAFVPTVAKAEEDVEEDVDEDEEDEDEDEDD
                     EDEDEEEQGDQLDALREECKATEEGKHLVHHYLECAERVAKAQEQPGYEDLPYKEDCV
                     EEFFHLQHYLDECAAPRLFDKLK"
     gene            complement(<1025866..>1026843)
                     /gene="FAF1"
                     /locus_tag="KLMA_50476"
                     /db_xref="GeneID:34717077"
     mRNA            complement(<1025866..>1026843)
                     /gene="FAF1"
                     /locus_tag="KLMA_50476"
                     /product="protein FAF1"
                     /transcript_id="XM_022820476.1"
                     /db_xref="GeneID:34717077"
     CDS             complement(1025866..1026843)
                     /gene="FAF1"
                     /locus_tag="KLMA_50476"
                     /codon_start=1
                     /product="protein FAF1"
                     /protein_id="XP_022676935.1"
                     /db_xref="GeneID:34717077"
                     /translation="MVLAGETATRMDEEYLRQLEVQRAAFEAQFGSLESMGFEDKTKT
                     EVVEEEDSESEEEQSSGSESFHGFSEEEEGSQDEESQEEEEQQLREVEVERQRRGPKV
                     VKFQETETDYKPSKKEQRLIRSGKVPTLQAIEKASASANANANDSDSDPDQEQENLRN
                     DIELQRFLKESHLISAFQTDKNTIHDSELHGKARARTLETRLQSLSATNAVKQRTLET
                     VPMNIRKGMVKKHKERITKYESEARDAGTVLSRVSRGEFRRIDATYKKDIERRIGRHT
                     AAGKRAQAGGRGGRSGPKRDFGLKVQTVGRSTRNGLKLSAADIAKIRGK"
     gene            <1027021..>1027800
                     /gene="HIS6"
                     /locus_tag="KLMA_50477"
                     /db_xref="GeneID:34717078"
     mRNA            <1027021..>1027800
                     /gene="HIS6"
                     /locus_tag="KLMA_50477"
                     /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)
                     methylideneamino] imidazole-4-carboxamide isomerase"
                     /transcript_id="XM_022820477.1"
                     /db_xref="GeneID:34717078"
     CDS             1027021..1027800
                     /gene="HIS6"
                     /locus_tag="KLMA_50477"
                     /codon_start=1
                     /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)
                     methylideneamino] imidazole-4-carboxamide isomerase"
                     /protein_id="XP_022676936.1"
                     /db_xref="GeneID:34717078"
                     /translation="MTRFVGCIDLHDGQVKQIVGSSLQETKKVTTNFVSNLPPAHYAQ
                     LYWDNKVTGCHVIKLGPNNDNAALEALKQCPGFLQVGGGINLDNCQYWLQYASKVIVT
                     SVLFDKKSYQFNRDTLAKLSQVCGKDRLVVDLSCKRVSEKKWVVAMNKWQTLTDLELN
                     KETFTELCEYTDEFLVHAADVEGLCNGIDEDLVACLYEWTVDLPSVKIVYAGGAKSVD
                     DLKLVEKLSHGRIDITYGSSLDIFGGSLVKFQDCVDWNRNH"
     gene            complement(<1028012..>1028935)
                     /gene="RPB3"
                     /locus_tag="KLMA_50478"
                     /db_xref="GeneID:34717079"
     mRNA            complement(<1028012..>1028935)
                     /gene="RPB3"
                     /locus_tag="KLMA_50478"
                     /product="DNA-directed RNA polymerase II subunit RPB3"
                     /transcript_id="XM_022820478.1"
                     /db_xref="GeneID:34717079"
     CDS             complement(1028012..1028935)
                     /gene="RPB3"
                     /locus_tag="KLMA_50478"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB3"
                     /protein_id="XP_022676937.1"
                     /db_xref="GeneID:34717079"
                     /translation="MSEEGPQVKIREATKDNVDFILSNVDLALANSLRRVMIAEIPTL
                     AIDSVEIETNTTVLADEFIAHRLGLIPLQSTDIDQVVYCRDCYCEDHCDRCSVELILH
                     AIGESESTTNVYAKDLQIISDLKGRNIGHPIIQDKEGNGVLLCKLRKGQEIRVKCIAK
                     KGISKEHAKWSPAAAIEFEYDPWNKLKHTDYWYEQDAKEEWPQSKNCEFEDPPNEEEK
                     FDYRAKPNTFYVNVESVGSISSEQVIVRGIKTLQDKVADILFSLKKMDQEKVNFAAGA
                     VSTHVPQQVPMEEEMDPYGGPAGSSGYDDAW"
     gene            <1029327..>1029701
                     /locus_tag="KLMA_50479"
                     /db_xref="GeneID:34717080"
     mRNA            <1029327..>1029701
                     /locus_tag="KLMA_50479"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820479.1"
                     /db_xref="GeneID:34717080"
     CDS             1029327..1029701
                     /locus_tag="KLMA_50479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676938.1"
                     /db_xref="GeneID:34717080"
                     /translation="MTRGVSRLNGDGAESLGRPALPDLRFEQTFRQSLRKEALKQHKL
                     TVSKSDGSVVDPPITAYVVAKVVFKDILLGPFVQGVLLSSFLIVTRPYLLYCRRAGLN
                     FARRITATVRSWVVAVGSVETI"
     gene            complement(<1030031..>1031287)
                     /gene="TIM44"
                     /locus_tag="KLMA_50480"
                     /db_xref="GeneID:34717081"
     mRNA            complement(<1030031..>1031287)
                     /gene="TIM44"
                     /locus_tag="KLMA_50480"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM44"
                     /transcript_id="XM_022820480.1"
                     /db_xref="GeneID:34717081"
     CDS             complement(1030031..1031287)
                     /gene="TIM44"
                     /locus_tag="KLMA_50480"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM44"
                     /protein_id="XP_022676939.1"
                     /db_xref="GeneID:34717081"
                     /translation="MLRVNGQQAVKQRVFSRTSVVRTFTASSTQLNNPRSPLQIFRET
                     FKQEWKKSQELQDNIKALQDASGKLGESEAYKKAREAYIKAQKGSTIVGKTLKKTGET
                     VEKVASKAWESEIAKSTRQAVNKTAEKLDESFEPVRQTKVYKDVSEVIDDGDSSRYGG
                     FISKEERRLKLEQAIASGKRSRAVKSNEAAGTALVATNVESKESIGKKIEDFKEKTPV
                     GRKLHEFKIKLWDESENPLIVMLRTISNKVGGLFAETESARVYGQFKMMDPGFNTEDF
                     TKHLREYIIPEVLEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGRILDIR
                     GVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRRAKTGEIAAGAESNILMSSYAMVFTRD
                     PETVDDKETEGWKILEFVRGGSRQFT"
     gene            complement(<1032018..>1034675)
                     /locus_tag="KLMA_50481"
                     /db_xref="GeneID:34717082"
     mRNA            complement(<1032018..>1034675)
                     /locus_tag="KLMA_50481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820481.1"
                     /db_xref="GeneID:34717082"
     CDS             complement(1032018..1034675)
                     /locus_tag="KLMA_50481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676940.1"
                     /db_xref="GeneID:34717082"
                     /translation="MGRIGLFKKEQDPFALLLEESENGGKSRERAGSNSMLRRSTTRS
                     RPERVRDDDDNASPEVSENQYHSPFRTEEEAQRAREIRKQKFAHISPEAAGSVDPSRL
                     GYNVITDENVAKPRDILIPAGLKETEAQQLVTLTALEMKERQLQYWKDSQKIIDLTQP
                     EDGEVVVVKDVAEDDGDDDAVDVEKEPSIEQVADAFEDTEAIVQDDEEEPIDLKREPK
                     PEAALRAFEEAEAIVQDDEEEEPVDDVEAEPPAAVAVEVLEEAEAIALGQTPPEVPLA
                     EEEEAEHPNGVEKAETDDAKEYVDPSREPKPEAALRAFEEAEAIVQDDEEEPIDLKRE
                     PKPDAALRAFEEAEAIVQDDIEEPVDDVEAEPSPEEAARALEEAEVLATGDPQYLPPP
                     PDIKSAPQVPFEVNDGTANADDKSQQRGGGGLKALGFLNIFKRSSKNTPEAAAIAAAA
                     AAGAIVTREGAPVATPEDPEHIVKTTNGYLSKVVYDKLEYDELIHQAKLNKFSEEKTA
                     KYNAKAQEYEDKIQSIQKEIADLEAQMEQCKLEHEEKMKLKQVEASQTLLDTNVKHIN
                     AKTALYRETEQIKLQTIADKEDTALCHEQVQKEIDDLLLMKEEVNKEHHEHENKVSAL
                     ITDLDTKTAALNESLAKKEETNAQIQALEEEKAKLEQEIKAVQEEHQGNVANIESIDN
                     KEYLPKVNEINNEISTLLGSLALIQQEIANQKVEFSTVTKKLEQERKEHEEQLLREKE
                     ERERLEKDRLNKQRAEYEAKAEEARLRHEEELAELKRSHEEANKKAILEKEEAHKKLL
                     EEQAKRDQVERERTRLQGEKAIAEQEKGNPADKLLEREHVEKQKRQAEAAAAAEEKLK
                     NAQKNPAMRTKDSSLYDYETVEEIITIPE"
     gene            <1036886..>1037395
                     /gene="NCE102"
                     /locus_tag="KLMA_50482"
                     /db_xref="GeneID:34717083"
     mRNA            <1036886..>1037395
                     /gene="NCE102"
                     /locus_tag="KLMA_50482"
                     /product="non-classical export protein 2"
                     /transcript_id="XM_022820482.1"
                     /db_xref="GeneID:34717083"
     CDS             1036886..1037395
                     /gene="NCE102"
                     /locus_tag="KLMA_50482"
                     /codon_start=1
                     /product="non-classical export protein 2"
                     /protein_id="XP_022676941.1"
                     /db_xref="GeneID:34717083"
                     /translation="MLSLLDNSLRAVNFVFLIIVLGLTGNLIATRHRVSSRVNFALFA
                     AVFGMVFDSIYAVLANFISAFAWPILLVTWDFLNMVFTFAAGTALAVGIRGGSCSSRH
                     FVRKNKISENSKDRCRKAQASTVFLYFSFFIFLVKFVLSVINVISTGGFGTTSTRRGG
                     VGAPTIAQI"
     gene            complement(<1038551..>1039396)
                     /gene="PHB1"
                     /locus_tag="KLMA_50483"
                     /db_xref="GeneID:34717084"
     mRNA            complement(<1038551..>1039396)
                     /gene="PHB1"
                     /locus_tag="KLMA_50483"
                     /product="prohibitin-1"
                     /transcript_id="XM_022820483.1"
                     /db_xref="GeneID:34717084"
     CDS             complement(1038551..1039396)
                     /gene="PHB1"
                     /locus_tag="KLMA_50483"
                     /codon_start=1
                     /product="prohibitin-1"
                     /protein_id="XP_022676942.1"
                     /db_xref="GeneID:34717084"
                     /translation="MSRVADIMARIAIPVGLTVSAIQYSMYDVRGGYRAVIFDRIQGV
                     QQSVIGEGTHFLVPWLQKCVLFDVRTKPKNIATNTGTKDMQMVSLTLRVLHRPDVLQL
                     PKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREIVSQKIRAELSKRADEF
                     HIKLEDVSITHMTFGQEFTKAVEQKQIAQQEAERARFLVEKAEQERKAAIIRAEGEAE
                     SAEYISKALSKAGDGLLLIRRLEASKEIAETLANSPNVTYLPSKAGNGGQDGSPNSLL
                     LNIGR"
     gene            complement(<1039801..>1041891)
                     /gene="APC2"
                     /locus_tag="KLMA_50484"
                     /db_xref="GeneID:34717085"
     mRNA            complement(<1039801..>1041891)
                     /gene="APC2"
                     /locus_tag="KLMA_50484"
                     /product="anaphase-promoting complex subunit 2"
                     /transcript_id="XM_022820484.1"
                     /db_xref="GeneID:34717085"
     CDS             complement(1039801..1041891)
                     /gene="APC2"
                     /locus_tag="KLMA_50484"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit 2"
                     /protein_id="XP_022676943.1"
                     /db_xref="GeneID:34717085"
                     /translation="MTKSEDELKLLHEEIVRSVSGTSEDEIDIVLTWLQPEFQPQIPT
                     LRIKQCLKALLEHMDEKTRYMIQEYYMTMIRTHFFTHFKDIVHWKEMMKLEKLYVSKM
                     EFLFAGDYDSGSGSETYWINNEMILFKRMLMKHNSVFRDNYQAKLEGLILDDDLERFE
                     QMYQWLAPACNGQEIEFNVKIINLKVDQLSKRMMQKRMDDRYLVMNTYNCFIKTFWSK
                     FSKLLINQDDHELTTTIYQSFENNFIWYKCDEFYTDIVPSFPESRNCLLEFRSILNKD
                     IKSVGTKVLETLYHGFVSRFLTSSLLTCEILCYYIKTVKCLKIIDPMGMCLRSLSKAV
                     RKHLNSRPDLIKILVIGLFPFKMEEGIQLLASTDNSLVHYQKLEQFSKELGDFSMGPE
                     LPQALPWFNQQHLPRCTYTGNDEVLLQYLNWVPNPPKIKLDVENFEDADADDDIKYVP
                     PTDMIQVLLDILKSKRALVDDILGVLSTKFIEAEEYTLDPEWQKIMDILLNHLEVTRQ
                     GTVTSEEDDLSHLNDVEVMLKDLALSSELRTQLSKTNSPFFQRFPHIKILSKLYWRHY
                     QNTNGKLITTSYKWNNQMKPLVQNLNKVYESLNIGRTLKFDAGSSSRVTMNLIMKSGY
                     TKKFKVKMEQYLVLSHFQDESDQVMPVPIQHSLKSLQVLTRIPTEKLQDILSFWERHE
                     VLVQDANEIYRVNE"
     gene            <1042136..>1042989
                     /gene="DCN1"
                     /locus_tag="KLMA_50485"
                     /db_xref="GeneID:34717086"
     mRNA            join(<1042136..1042138,1042225..>1042989)
                     /gene="DCN1"
                     /locus_tag="KLMA_50485"
                     /product="defective in cullin neddylation protein 1"
                     /transcript_id="XM_022820486.1"
                     /db_xref="GeneID:34717086"
     CDS             join(1042136..1042138,1042225..1042989)
                     /gene="DCN1"
                     /locus_tag="KLMA_50485"
                     /codon_start=1
                     /product="defective in cullin neddylation protein 1"
                     /protein_id="XP_022676944.1"
                     /db_xref="GeneID:34717086"
                     /translation="MEKEFMNLTGCKYSVAQQYLRRNGGRVEYALNDYYDHVDAIGGM
                     RQSYSPRLVGIFEKYTTVGQATQWDTTGLIRYIEDLGVSIEDPLALCLAEMLCIKDLT
                     KPLSREQFLDAWTDQCCDTLDQMRAHLQTLEARLETDKDYFKSIYLYIFPLNADETTH
                     HMPKDVAVEYWNILFKTKKYALKVSDSRIESWLAFINAGESDPRRQNISWDTWRMFYK
                     FVEQYPDDNSLKDTYDEMASWPLLIDEYYEYLEDNNI"
     gene            <1043456..>1045078
                     /gene="TAF12"
                     /locus_tag="KLMA_50486"
                     /db_xref="GeneID:34717087"
     mRNA            <1043456..>1045078
                     /gene="TAF12"
                     /locus_tag="KLMA_50486"
                     /product="transcription initiation factor TFIID subunit
                     12"
                     /transcript_id="XM_022820487.1"
                     /db_xref="GeneID:34717087"
     CDS             1043456..1045078
                     /gene="TAF12"
                     /locus_tag="KLMA_50486"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit
                     12"
                     /protein_id="XP_022676945.1"
                     /db_xref="GeneID:34717087"
                     /translation="MSGQGVNAQLQNLTPASMQQLADRLKSLVNEAKRIGVDTNEGKE
                     LLRQAARIKALYEAYSKQRQQQQQQQQQQQQQQIQSQGGAVNQIPVEQQQQQQQQQQQ
                     QQQQQQKQQQSSGSSNLSNNIKVLLTPEQREAYNRLVQKYEDDGQNIKGEFNFLKGNI
                     SVLDQEIRNRQGNPASVRQLEVNRNELLQKIRALSAQYSTLQQKYQEDRRKFYIECSQ
                     TNAELRRYLQLQQQKANAAKAQGAAAAGTGASAGAQSQMPPQTSAAAGAATATPQGNN
                     TQGMNTGTPIPTNLNKAGSGSPPNAAMGAPAAANTGAKIPTGQITAAAASGANSSNVQ
                     GAADKSSPTQVTTVNAAANQSAQSNARPPIFKQPNPSIPISETVAPSPTVSVSYRSNR
                     PTITGGSGMNAPALTTPVMTKLPPYEVDTERVMSKRKLRELVKTVGVDEGDGETTIDG
                     DVEELLLDLADDFITNVTNFACKLAKHRKSDNLDVRDIQMHLERNWNIRIPGFANDEI
                     RSTKKWNPTPSYNQMVNAISNNKNSRTHPEKK"
     gene            <1045478..>1048288
                     /gene="DIP2"
                     /locus_tag="KLMA_50487"
                     /db_xref="GeneID:34717088"
     mRNA            <1045478..>1048288
                     /gene="DIP2"
                     /locus_tag="KLMA_50487"
                     /product="U3 small nucleolar RNA-associated protein 12"
                     /transcript_id="XM_022820488.1"
                     /db_xref="GeneID:34717088"
     CDS             1045478..1048288
                     /gene="DIP2"
                     /locus_tag="KLMA_50487"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 12"
                     /protein_id="XP_022676946.1"
                     /db_xref="GeneID:34717088"
                     /translation="MVKSYQRFEQSAVFGLISTSSQSVYLPANNSTSGRLITGALENL
                     EIWTLKTNEVEVMSDGLPIGAVDSKLARPAVVTAMCFHKETGLLCVGYDDGVIKVWDL
                     LSKSVLMQFNGHNSGITVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAI
                     TGVWVDEKMDWLVSVAKDGLIKVWDLKAGGQCIETHMAHTGQCWSMAVNEEVIITTSM
                     DSQVKVWELDLEKPNGNKVVERGSFETESKQRGVATDFITAPNGTRFFFVQNNDKTVE
                     IFRIRPSDEVSKALKKREKRLRDKGASEEEIQEAINPNDVGVLFHPFSTIRSAYKVKS
                     TNWIHASNSKLELVLTTSNNTIETYQVAYAKRDAEPPVKRYNVELQGHRTDIRSMDIS
                     DDGKLLSTASNGELKVWNLMTKKCIRTFACGYALCSKLLPGGTLVVVGTRQGEIQLFD
                     LASSTLLTTIEAHSAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVIQQLVPGTKDKYL
                     PQLNLIHDTTLELTDDILSVKISPDDRYLAVSLLDNTVKVFFLDSLKFYLSLYGHKLP
                     VLSIDISVDSKMIITSSADKNIKIWGLDFGDCHKSIFAHQDSIMSVKFEADTHNFFSC
                     GKDGVVKRWDGDKFDCIQKLNGHQSEVWCIAVSRDGRTVVSTSHDHSIRVWQETDDQV
                     FLEEEKEREMEEEYEETLLKSLEGGSGDDQFLKDKKSTEDGSVDEVTGVNKQTLESLK
                     AGERLMEALDLGVAEIESWEAYEKQLKTWKKKKSGEAPVKPQGNAILIAMKTKPEKYI
                     LDTLAKIKPSQLEDSLLVLPFSYVIKFFKFFDVIMLQKDLVLSHLSLVCKILFFIVRN
                     NNKELVAQKNEELKQRIERVKNSIRSMLQKNADDLGFNIAGLKFIKQQWNLRHNLEFT
                     DDYEQLEHEKKTAKKRVFETVR"
     gene            complement(<1048724..>1050316)
                     /gene="INO1"
                     /locus_tag="KLMA_50488"
                     /db_xref="GeneID:34717089"
     mRNA            complement(<1048724..>1050316)
                     /gene="INO1"
                     /locus_tag="KLMA_50488"
                     /product="inositol-3-phosphate synthase"
                     /transcript_id="XM_022820489.1"
                     /db_xref="GeneID:34717089"
     CDS             complement(1048724..1050316)
                     /gene="INO1"
                     /locus_tag="KLMA_50488"
                     /codon_start=1
                     /product="inositol-3-phosphate synthase"
                     /protein_id="XP_022676947.1"
                     /db_xref="GeneID:34717089"
                     /translation="MTASSRIFTPKVKVASDAAEFTETELITKYTYRNSVVEKDADGT
                     FNVNPFSQDYEFKVDLKLPKVGVMLVGLGGNNGTTFLASILANKNKIQFQTKDGLKEA
                     NYYGSVTQCSTLKLGVDAENNDVYAPFNSLVPMVSPNDFYVSGWDINGADLGAAMARA
                     EVLGVDLQNKLRKEMSTYVPLPSIYYPDFIAANQDERADNCFNRDGKTGPVSVKDKWS
                     HVERIRSDIREFKEKNELDKVLVLWTANTERYADVLAGVNDTAENLINSIKNDHEEIA
                     PSTVFAVASILENVPYINGSPQNTFVPGVIDLAEKEGAFIAGDDFKSGQTKMKSVLAQ
                     FLVDAGIRPVSIASYNHLGNNDGYNLSSPRQFRSKEISKASVVDDIIESNQILYNDKL
                     GNKIDHCIVIKYMPAVGDSKVAMDEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLL
                     VMAEFCSRIKYRKFGDSAAEYQSFYPVLTMLSYWLKAPLTRPGFKAINGLNKQRAALE
                     NFLRLLIGLPAQDELRFEERLI"
     gene            complement(<1051233..>1052429)
                     /gene="ZRT2"
                     /locus_tag="KLMA_50489"
                     /db_xref="GeneID:34717090"
     mRNA            complement(<1051233..>1052429)
                     /gene="ZRT2"
                     /locus_tag="KLMA_50489"
                     /product="zinc-regulated transporter 2"
                     /transcript_id="XM_022820490.1"
                     /db_xref="GeneID:34717090"
     CDS             complement(1051233..1052429)
                     /gene="ZRT2"
                     /locus_tag="KLMA_50489"
                     /codon_start=1
                     /product="zinc-regulated transporter 2"
                     /protein_id="XP_022676948.1"
                     /db_xref="GeneID:34717090"
                     /translation="MSEAIVRAAAEVLLKRHSSGSGITDFESDATGTCDSGNDYDGND
                     GKRILSIFIIMISSGFGSYFPILSSRYSFIRLPDWCFFLAKFFGSGVIVATGFIHLLE
                     PASDSLGDPCLGGTFAEYPWAFGICLMSLFALFFTECITRYYTNKSYGFENHVHSHFP
                     GSREEDEEEECDNTDKYKEMLDEENIGMETSQENIPLEDRNPSMPGKNHYSHDKTHQD
                     PSIVGTPAQETAKESYRNQLVSVFILEFGIIFHSVFIGLSLAVTANNEFNTLFIVLVF
                     HQMFEGLGLGARIAEVKWNESKKFTPWVLAGAFMLTTPIAIAIGIGVRHSYAPGSRTA
                     LIANGCFDAISAGVLIYTGLVELMAHEFLYSDNFKGEEGLKKMLFAFFTMCWGAGIMA
                     LLGKWA"
     gene            complement(<1053397..>1056000)
                     /gene="SWI5"
                     /locus_tag="KLMA_50490"
                     /db_xref="GeneID:34717091"
     mRNA            complement(<1053397..>1056000)
                     /gene="SWI5"
                     /locus_tag="KLMA_50490"
                     /product="metallothionein expression activator"
                     /transcript_id="XM_022820491.1"
                     /db_xref="GeneID:34717091"
     CDS             complement(1053397..1056000)
                     /gene="SWI5"
                     /locus_tag="KLMA_50490"
                     /codon_start=1
                     /product="metallothionein expression activator"
                     /protein_id="XP_022676949.1"
                     /db_xref="GeneID:34717091"
                     /translation="MWTMNNTEQWTSLIKTPYDIDGDNNDGSPENMHSMLSSRNTNNS
                     INPPGSTDSGSGSDFQSKEYPLPDDNFENFNPMMDINIEDFLTKELKDLDIPMLPKNE
                     LSKLDLDMFPNSDLSWNVVNDNDTLANSGNINGTNDNSGITPRKLMPGQNQNGYHRKQ
                     PSGTAIFGFSQHNKSLSIGAMTINVDETKKAMMQRQQQESEQPDIKMNETLMQQQREL
                     QMALQRQKEMNEKLEEQLRMNKLQQEQLQRALEAQQMTLEQVSSIPANATPVRPDTSI
                     IVTSNGKNGKYQFPPRDPVNPSANRPIDKSKPNMEYEDKNDNGNGGSSSRNNNNGAAG
                     NGLLSPFSRASINGSPHRRRNHNYDNIEPGNNNLTLPINFSISSTSTVGNSSEQMLKM
                     SKYFRELTDDGKQHSSSLSSSNNKSSSRSPITPQDQIYDNPKTPSLRCNHTQTCRSDD
                     GTINQKNNNTDTGMNENIDTGSSSSNNHASHSSSNINQRRGKHAARDSTVSTASTIPM
                     QGDDDQCSQTYSPQQPHLQQSSVGLGLTLDSRLQLKKPPQLQMLPTIPGSSETTPLKS
                     KQSPQRPSQYQTNNMPVKHSFQHTPTKELIFNNAPNISLQPENNRRHSQTLGSGLSQQ
                     QQQMDDDEPECKFVQAQTPSPILRSQERFDCIAESPVHLQYHHNNQLGIGSSSPAASG
                     GRNGKRYGMLPREEIDKYILELGPKQFQCKFKDCQKMFNRRYNARTHIQTHLCDRPYK
                     CDYPGCQKAFVRNHDLLRHKKSHLDKMYSCGGCDKRFHSEDALTKHQERKGHEGKYIA
                     GEDEEEDDDAGYDYGYMSEGPAHILSSPVRGNQIRKPVSPKKVPNTIRENIQRDHTGA
                     ALRMQEQLNYH"
     gene            complement(<1056946..>1057767)
                     /locus_tag="KLMA_50491"
                     /db_xref="GeneID:34717092"
     mRNA            complement(<1056946..>1057767)
                     /locus_tag="KLMA_50491"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820492.1"
                     /db_xref="GeneID:34717092"
     CDS             complement(1056946..1057767)
                     /locus_tag="KLMA_50491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676950.1"
                     /db_xref="GeneID:34717092"
                     /translation="MGLVSSDYNSDSDSTNSDSETGEESSKRQCLPELPDDIVYNYNK
                     PVVIDPLNTRMYVAPVSKNIGFLFLELRLDSKQQQIMDLVLKGVNAVMDTHHRNSFEP
                     LHRGKFGAMKPLHVSLSETMMFANESELEEKMGRIRQEIRALECKSVPVALSGGWLVY
                     ENFDASLQFLAVGLSEQARGRLKPVLSIVEKYKPRSPVSRQPVGLNNLHVSFGVAQNA
                     YLQQDESISRQRLDSLRNLVATEASDRLPLLRANLQFRCHELKAKVGTSVITLPL"
     gene            <1058507..>1060126
                     /gene="CKI1"
                     /locus_tag="KLMA_50492"
                     /db_xref="GeneID:34717093"
     mRNA            <1058507..>1060126
                     /gene="CKI1"
                     /locus_tag="KLMA_50492"
                     /product="choline kinase"
                     /transcript_id="XM_022820493.1"
                     /db_xref="GeneID:34717093"
     CDS             1058507..1060126
                     /gene="CKI1"
                     /locus_tag="KLMA_50492"
                     /codon_start=1
                     /product="choline kinase"
                     /protein_id="XP_022676951.1"
                     /db_xref="GeneID:34717093"
                     /translation="MLELRPTRSIDNGDGAYIRPRSRSKSRKPPLPRRRSSSRSIKSI
                     PIDLGEDGDLKKENGKAQSLYLGESISVPFVKSTLDVTLPHDLLQEDFKSLIISLRVK
                     PWYKHDFDANKLKYTRITGAMTNAVFKVEYDGFPSLLVRVYGPNVESVIDREYELQVL
                     ARLSIQNIGPSLYGCFENGRIEQFLENSQTLSKNDIRNWKTSQRIARRMKELHSGVPL
                     LPKELQDEPVTWKRIQKWMDSLDESTWVRDENNVHSYLMVSDWEKFKSIVSQYKAWLQ
                     QKPAYHKLVFCHNDAQYGNLLFTAPVIPVTADTEISQTLSNMSLSESGASLFPSSSNV
                     SLEEIINPSIQEQAQDAKLVVIDFEYGGPNPPAFDLANHLSEWMHDYHCSTPHVTFHD
                     RFPTHEEMLNFIYSYLSHLNPSRKNMEEEVVQLYNSILEWRASVSLHWALWGIIQSGE
                     LTEVAQQVTEEGPGGEKYIITVDKLDVSAEDDVSSEGSNDGVDIDTFKYLSYSKDKLE
                     IFYTDLVQLNIIDKEDVLNYDQLKRIELKPL"
     gene            complement(<1060861..>1062228)
                     /gene="KGD2"
                     /locus_tag="KLMA_50493"
                     /db_xref="GeneID:34717094"
     mRNA            complement(<1060861..>1062228)
                     /gene="KGD2"
                     /locus_tag="KLMA_50493"
                     /product="dihydrolipoyllysine-residue succinyltransferase
                     component of 2-oxoglutarate dehydrogenase complex"
                     /transcript_id="XM_022820494.1"
                     /db_xref="GeneID:34717094"
     CDS             complement(1060861..1062228)
                     /gene="KGD2"
                     /locus_tag="KLMA_50493"
                     /codon_start=1
                     /product="dihydrolipoyllysine-residue succinyltransferase
                     component of 2-oxoglutarate dehydrogenase complex"
                     /protein_id="XP_022676952.1"
                     /db_xref="GeneID:34717094"
                     /translation="MLRSSTRVAVKSVLRSKPLSRGLSIGVRASGIVGNAASKKGVFA
                     SGRLLGNNGGIFRGSVPVSVMGVRHATSVPVPPMAESLTEGSLKEYTKKVGDFIEKDE
                     LLATIETDKIDIEVISPLSGTIAKLNFQPEDTVTVGEELAQIEPGEAPAGGAAAAAPA
                     ADAAAPKEEAAPQKEEAPAPAAAAAAPAAAAPAPKKEAPAPAPKKDAAASPAPASSAP
                     SFTSFSRNESKVKMNRMRLRIAERLKESQNTAASLTTFNEVDMSAVLEMRKLYKDEVI
                     KTKNIKFGFMGLFSKACTLAAKDIPAVNAAISGDQILYRDYTDISIAVATPKGLVTPV
                     VRNAESLSVLEIEQEISRLGKKARDGKLTLEDMAGGTFTISNGGVFGSLYGTPIINMP
                     QTAVLGLHGVKERPVTVNGQIVSRPMMYLALTYDHRLLDGREAVTFLKTVKELIEDPR
                     KMLLA"
     gene            <1063415..>1065619
                     /gene="SLX4"
                     /locus_tag="KLMA_50494"
                     /db_xref="GeneID:34717095"
     mRNA            <1063415..>1065619
                     /gene="SLX4"
                     /locus_tag="KLMA_50494"
                     /product="structure-specific endonuclease subunit SLX4"
                     /transcript_id="XM_022820495.1"
                     /db_xref="GeneID:34717095"
     CDS             1063415..1065619
                     /gene="SLX4"
                     /locus_tag="KLMA_50494"
                     /codon_start=1
                     /product="structure-specific endonuclease subunit SLX4"
                     /protein_id="XP_022676953.1"
                     /db_xref="GeneID:34717095"
                     /translation="MANAMHDDLEEAGRHLQMVDGHLSEESMEHGEIAMTQVPVMFGD
                     TEMEMETQIPEEEEDDGILVSTQVQAQIDELDEQAHVMKSFRNVLSKFALETQQGPGP
                     GRVPEQELERELEPSVSVSPKKRPTKKIVKAVKKKAAPRVQKRIKSITQFNTDKWEDI
                     RAHDRAQKMISMLSGKSAKVKKLVSKLNCDVAADAGADQTDTDSQFAPFNESEWQHII
                     ALLREKLPKVSRKEISSVQSYVYGKSQGLWEASQMSPEKQEPEENQEYFGTGPESAAA
                     AGMVQDDHRLSVYTLSQLVEGHSSNNNNNNSGSANQNSSDDSIQHIQNVPDVSCIDVP
                     SSETGYASQVADSCDTGSIISLDRRSLCMGSDWEAEAESETEAETEAEIAMEIDIDIE
                     KEKEKEKEKEKQMRAPFRTQSYDVVSSIVSPMKSTRMPSIQVPATRTTTFQDQNLVQT
                     QTQTQLQAQNSTQVPSLKHLHTVKLIVDSNTDANEILSSVGPMSNESDQPDSLSTVTT
                     SMLHRDNEIIIGSEEEKDSNEYSILEVQEVPLQVPSHPRPHPRPRPLSLVSSAHPSPK
                     IRLKTPISATDSLDSQLQPPLMTTQNSSPSTAKLRQSLRTIGLKPCKNKVQMLQVWDT
                     LEAKFPGLSDTDGPAQLRQFLTDLIVQNRDESASLMEQIYTFEPIRFEQLKSWLVSLD
                     SFTELIDDSFIKKWADLNGIVFRNNAESQSLSQSQTLPSQPLSQLQSPSLSP"
     gene            <1066073..>1075093
                     /gene="NUM1"
                     /locus_tag="KLMA_50495"
                     /db_xref="GeneID:34717096"
     mRNA            <1066073..>1075093
                     /gene="NUM1"
                     /locus_tag="KLMA_50495"
                     /product="nuclear migration protein NUM1"
                     /transcript_id="XM_022820497.1"
                     /db_xref="GeneID:34717096"
     CDS             1066073..1075093
                     /gene="NUM1"
                     /locus_tag="KLMA_50495"
                     /codon_start=1
                     /product="nuclear migration protein NUM1"
                     /protein_id="XP_022676954.1"
                     /db_xref="GeneID:34717096"
                     /translation="MGGTGTSRSDKGSNRDELKTKLDKLQKQQLQQTRSSDDSTNSRS
                     PFSNVLGKRDNRSSLPVFAGSSAHAGVINANSGEDVNFVVGLSENLLLECRRLQSENE
                     RKSSKLQTLEADYNKLKTSFERLSSKHESLTRNEDSLKDTNWQLEMKLQSLAQELNKL
                     TDAFNKNKSELQRQMEVAKDMKTELEESSLEKMGLKSELEATKQTHINEMKELKHQVE
                     ELNNENDDLHTKVNDLREKVALLAEEREVTKSKVPTDSAEQADSLSRSLSTGENQLNP
                     HDSNKNEANSEGSHTDSPHLEYQTLRSNLAHANQTIIKLRQKLNRSKPESAVNSPLHL
                     KTPRGKSKAGLQFVGGKVSTPQKSIISNVSDQGSDWNSTNSPTSIVHDDSSDFETTSF
                     ISEATDYMGERIGDDFSGEEDFSHELDYEDIERYAKDHNLAIIASSELEQLKEQASNS
                     SQNQVKIEEIETQIKNLGFFDTSAVDLKNGDISQIFQHPTEEYLITHLRDYSLTALNN
                     DVYNSIMNPSIDELNEKASQKGFTLLAKDELSQLSNPGINDLRTIAARHEHVVLPKDE
                     YNKLVEPNVEDLKSHAERQGHVVLPKDEHDKLTEPNVEDLKSHAERQGHVVLPKDEHS
                     KLVEPGVEDLKSHAERQGHVILPKEEHSKLVEPNVEDLKSHAERQGHVILPKEEHSKL
                     VEPNVEDLKSHAERQGHVILPKDEHSKLVEPGVEDLKSHAERQGHVVLPKEEHSKLVE
                     PNVEDLKSHAERQGHVILPKDEHDKLTEPGVEDLKSHAERHGHVILPKDEHSKLVEPG
                     VEDLKSHAERQGHVILPKDEHSKLVEPGVEDLKSHAERQGHVVLPKDEHNSLLHEIDN
                     PNIEKIEESLSGSNATILLTRLAEKQGLVPVDASEYETLNNLVNSPDRKYLDEKLNNL
                     GYTSLTIQEYSELKRIKDSPSLDFLAEKADEEGYIILSKPDHSELLRKSSNPSLEEMK
                     SIASVTGHLVVLQDEYDQLQKSISHPSKHYIIQEAHNLDLVVLEKSEYDDLVTKSSNK
                     DSIIESIKGFGFVPVPMVDFKTLKAQSVDNADLDTLKERISGLGYVTVTKDEYDILSE
                     PAVNKITADETIDLCNKYHLKPIAIDEYLKLQENSKAAVLSEDELIEKVRNHGHTVVD
                     SIKYEQMLTEIEKPELQYLTDHLSSFNMIAVNNDEFSKIKEISESPTYEFLEEKAKQM
                     DFALLSCKDLDNMKSRIEHPSQEELEKGAELLGLSLIPSDNLADLRKSIEEPSTSYLA
                     NKADNIGKRLVDKIEYETILRKLEKPTTEELEHYAELIHHKILPKVEYDELVRKVEKP
                     TPEEVAKYAELVEHKTLPKSEHEELVRKVEKPTPEEVAQYAELVQHRTLHKAEYEELV
                     RKVEKPTPEEVAKYAELVEHKILTKVEYDELVRKVEKPTPEEVAQYAELVEHKTLPKS
                     EHEELVRKVEKPTPEEVAKYAELVEHKTLPKSEHEELVRKVEKPTPEEVAKYAELVEH
                     KTLPKSEHEELVRKVEKPTPEEVAQYAELAQHRTLHKAEYEELVRKVEKPTPEEVAKY
                     AELVEHKTLPKSEHEELVRKVEKPTPEEVAQYAELVQHRTLHKAEYEELVRKVEKPTP
                     EEVAKYAELVEHKTLPKSEHEELVRKVEKPTPEEVAQYAELVQHRTLHKAEYEELVRK
                     VEKPTPEEVAKYAELVEHKTLPKSEHEELVRKVEKPTPEEVAKYAELVEHKTLSKLEY
                     EELVRKVEKPTPEEVAQYAELVEHKTLPKSEFEKLIKNDALSIDGLKVLCQKYGYTCV
                     SIEEYDQMRSVYEDPSAEFLAAKALEKQLVLVSANDHTQSKESTKLESNAVIEEREKV
                     AQTEKTSEKNKDPASPESDSIRDKIQNKGHVLIDTETFNNIKSSHPERISKQELIDLC
                     SKLNLVPLPDAHYAELRNPSIERIKELAQSEGLVAIDRTELDAITIQAENPSEDSIIA
                     MAPKYGYKVIRATEFENLQNEARKLSSPSKADVEKLAARLNLVVLAEESYGNLLEELK
                     KASIATSISPTSKVAASKLYFENVIKKENGIGNEVMLESGKSLGFVRLSNDEYKKLLE
                     NQQKHELTKSDIYNGAKMFDLRVLPVEEYKSLLQRKSTKDNITYDDLQIYASRFALKL
                     VPVDFTLPKEQTSINPQTSKEKSAYELRANHSRNISTTSFSSTESSESYYYEAEEPNN
                     SLILKKLASKSSMASNSTHYTDARDYSEIEGDDVSIAPTIKDDGPTLEDLKRHAEVFG
                     YVLVQKGAEHQVDSVVDDKSVSNTLSRDDIYSAAPRFGLTVLPLDEFREIEKNAKSFK
                     ELTPENIKSAADKFGLVILASSEHHKLLKNSTIQPTPEITKDNIEQKSREFGFVPVKT
                     NDFLKLIKPDSIEDITEKASKLGMVTLTEEEYSSMTKPISQEVLESRAKELDLVTLSS
                     LEYATLTKPLTLTDIKDKCEEYGYVAVTKEIYEDLSNKYDETSISRWAKENDKAIISK
                     EEYDALLDLEDQKASTMMTKEELVEKAHELNMIPIDADKFDEIQRELASSGLHNMTED
                     DIMLKAKDFGLVTVPASESVDNLKQSLNKDDLTVLAHDMGLVPIPIEQFEQIKMELES
                     PTLTREQIVDHAAEFDLIAIDIMEYKRLKKGSYLMDNDEEFDSDDEDEEDEMELVDSE
                     IKHLNKTAKRFGLLCIPESAFVATSNANTPDVHNVVVLPIKYYNTLLHQESENWAKVT
                     DERLQAEAKKRGFQIGVNLRKDFGEMPTYDHRRTSSTSTRSMISEDARKSMSQAASTA
                     AMAELENQGRSRAPSRASSIRRAPPSIQTNHASVMTNSESIGTGLSLATMASLNAPSI
                     IPALTQTMIGEYLHKYYRSLTSISHPSRHERYFWIHPYTLTLYWSSSNPVLENPGSNR
                     TRAAAIMGVESVDDSNPYPAGLYQKSIVVKTEGRDIKFTCPTRQRHNIWFNSLRYLLQ
                     RNLNGISLDDMLQDEGNAEPNPIYQQPGETPQSAIRRLSSTRRASSSSNIRQSSSKWS
                     LRAT"
     gene            <1075623..>1077947
                     /gene="VPS70"
                     /locus_tag="KLMA_50496"
                     /db_xref="GeneID:34717097"
     mRNA            <1075623..>1077947
                     /gene="VPS70"
                     /locus_tag="KLMA_50496"
                     /product="vacuolar protein sorting-associated protein 70"
                     /transcript_id="XM_022820498.1"
                     /db_xref="GeneID:34717097"
     CDS             1075623..1077947
                     /gene="VPS70"
                     /locus_tag="KLMA_50496"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 70"
                     /protein_id="XP_022676955.1"
                     /db_xref="GeneID:34717097"
                     /translation="MVAIDSQDFPVEKKDEFQDIESNLRGSRRRSQTKIKIFCKVLTL
                     FIIYQLWSTGISFLNKPLSDDRDRAKATPNELAYLKTLEDSNFAGNWSEKLTSVPHLA
                     GQGIELVNWTASKFEEYGLETEVEAFDIYLNYPVANGLTLLHDGKSVYKANLTEDVIS
                     EDPTTGGDDLVPAFHGYSASGNVTAEYVYVNYGTKEDFDLLQENNVPLEGKIAIVRYG
                     HIFRGLKVKFAQDAGCVGVLIYSDPGDDFFQEAKGDKPYPYGPARQPSSLQRGSVQFL
                     SQSPGDPTTPGRPSQGDDVVREDPYGSIPKIPSLPISFREVQPILKKLNGHGIKGSQI
                     GGSKWVGNLPGFEYWTGPSPKNTLNLYNEQKYDIVPIYNVYGTLHGSDPKAGYIMVGN
                     HRDAWIKGGASDPNSGSAVVLEIIRSLHELTKTGWKPKRTIKFASWDGEEYALLGSTE
                     FGEKNAEELKKNLIAYLNVDVAVDGGQLKIASSPFLNNAINEALALVDYPSEENVSLH
                     EHFYNHSKIGILGSGSDYTVFLEHLGISSLDTGFSATWKDPVYHYHSNYDSFHWMSTM
                     VDPGFKLHNALAKFLGTLTLRLTEDELINTKVADYSGELLKYYKSIESKVPQSWLNIT
                     NHKGKPLKKIIEKTKLRLEEFDEAATTFDTYLTDLSRQLEHKGSLPFWKRIRLHFQAV
                     HANFKLRYLERAFLHKKGLKGRPWFKHMIFASGRYTGYEGFVLPGLTEAIEDEEVKDF
                     IRWNKIFLRKVSALADSYKLKDKNGSTKMRCMHW"
     gene            complement(<1078346..>1079278)
                     /gene="CTH1"
                     /locus_tag="KLMA_50497"
                     /db_xref="GeneID:34717098"
     mRNA            complement(<1078346..>1079278)
                     /gene="CTH1"
                     /locus_tag="KLMA_50497"
                     /product="mRNA decay factor CTH1"
                     /transcript_id="XM_022820499.1"
                     /db_xref="GeneID:34717098"
     CDS             complement(1078346..1079278)
                     /gene="CTH1"
                     /locus_tag="KLMA_50497"
                     /codon_start=1
                     /product="mRNA decay factor CTH1"
                     /protein_id="XP_022676956.1"
                     /db_xref="GeneID:34717098"
                     /translation="MNYHMNSSISSQSTQTSSVFSQENEDYDARIREIEEYYIKTLLS
                     EDSEDDGVSKQQSQFYSQLQTQLPGYYAHQMMQGSQVFSGAEIGQQQQQQQQAYVQPQ
                     SWFKKSFLDTQYQDPWPQKVSAKEPSLEVEINSQYRPSNGIMPLTSENLRMIQEKAEE
                     APELLAEPSKAEPSKAHQAPAPAQSQAQQTHSKAHSEREQPEKVNKQLYKTELCESFA
                     TRGTCKYGNKCQFAHGLHELKLKQRSTNFRTKPCVNWQKHGYCRYGKRCCFKHGDDED
                     IQIYMQAGVIKKIEDQPVRKNLHADVRALQKMTW"
     gene            <1080070..>1080867
                     /gene="GIR2"
                     /locus_tag="KLMA_50498"
                     /db_xref="GeneID:34717099"
     mRNA            <1080070..>1080867
                     /gene="GIR2"
                     /locus_tag="KLMA_50498"
                     /product="protein GIR2"
                     /transcript_id="XM_022820500.1"
                     /db_xref="GeneID:34717099"
     CDS             1080070..1080867
                     /gene="GIR2"
                     /locus_tag="KLMA_50498"
                     /codon_start=1
                     /product="protein GIR2"
                     /protein_id="XP_022676957.1"
                     /db_xref="GeneID:34717099"
                     /translation="MDYQEEQKQELEILESIYPDELTVLQAEYPGIQLQIDVTVDPVP
                     MENSSYTVDSISNRHILHVRFTLPDNYPDEAPVIDIEPEEVPKFNRGDGSDEEEEEEN
                     EVEYDDHGNPIVSDFENLPDKIHFDEFVEECVEKLNLQVEEDMLLGMQMCFALVSNIK
                     DAAEQWFQERLSELEKEHDRMLLEKEQEEQKKFRGTKVTRETYLAWRSKFREEFGLDE
                     RDAQRRLQAHQGRLSGRQIFEQGLAGDEDMAEDEESVVSEGVKALAV"
     gene            complement(<1081345..>1082592)
                     /gene="ENT5"
                     /locus_tag="KLMA_50500"
                     /db_xref="GeneID:34717100"
     mRNA            complement(<1081345..>1082592)
                     /gene="ENT5"
                     /locus_tag="KLMA_50500"
                     /product="epsin-like protein"
                     /transcript_id="XM_022820501.1"
                     /db_xref="GeneID:34717100"
     CDS             complement(1081345..1082592)
                     /gene="ENT5"
                     /locus_tag="KLMA_50500"
                     /codon_start=1
                     /product="epsin-like protein"
                     /protein_id="XP_022676958.1"
                     /db_xref="GeneID:34717100"
                     /translation="MDSLGKKLSNLGLHDIRNAARFAQNVIVQYEPYQIDIRRATNTD
                     SWGPTPKHLAKVMRHRYEVTMFLMTEYTLKRLVDHMAKRPKNVYEKARKQYVNYGNEW
                     RVVLKCLILIEYFLMRSERGKELEQVLACLQTHKHILTKETMQYRVDFSSDGKMELHE
                     RGIKKKCENIIQLMEDSNYLKRERSKTAENATKIVSGSIGSRPESLYNDISISADSIA
                     DSSSSIDDMDDFEYEPQPMGHRERRSSAVDKQRRQRREMLRERIRNSEYQRKAATQQE
                     PEVDLLDLDDAPAPSNNNNSNTNSNNNNTHNMNHNNGNSNTPLAGFDDDEDDDDDFGD
                     FQSEKSPVPALPHSSSSAGAAAAGQGSSSNINANSTLNDLLDFGGSSNTTTTPVNVSI
                     NSNNNNAKHDAFADLFSMSKSQI"
     gene            complement(<1083262..>1083750)
                     /gene="CPR1"
                     /locus_tag="KLMA_50501"
                     /db_xref="GeneID:34717101"
     mRNA            complement(<1083262..>1083750)
                     /gene="CPR1"
                     /locus_tag="KLMA_50501"
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /transcript_id="XM_022820502.1"
                     /db_xref="GeneID:34717101"
     CDS             complement(1083262..1083750)
                     /gene="CPR1"
                     /locus_tag="KLMA_50501"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="XP_022676959.1"
                     /db_xref="GeneID:34717101"
                     /translation="MSKVYFDVEADGQPLGRIVFQLYNDVVPKTAENFRALATGEKGF
                     GYAGSVFHRVIPDFMLQGGDFTHGTGVGGKSIYGAKFPDENFVKKHDRPGLLSMANAG
                     PNTNGSQFFITTVPCPWLDGKHVVFGEVSEGFDVVKKVESLGSGSGATRARIVIAKSG
                     EL"
     gene            <1084620..>1085123
                     /locus_tag="KLMA_50502"
                     /db_xref="GeneID:34717102"
     mRNA            <1084620..>1085123
                     /locus_tag="KLMA_50502"
                     /product="DNA-directed RNA polymerase I subunit RPA14"
                     /transcript_id="XM_022820503.1"
                     /db_xref="GeneID:34717102"
     CDS             1084620..1085123
                     /locus_tag="KLMA_50502"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I subunit RPA14"
                     /protein_id="XP_022676960.1"
                     /db_xref="GeneID:34717102"
                     /translation="MLRGTRRPAHSTLNTPVVVHQVGTPSYLSKEEVLNFLSTFISEK
                     EAIPAVSLASRAESVTQTSITSGGVSTEEVALDTQLSSALAQLKRVERDFKGLPPQVL
                     ETEPSSSNTAQKTTPDVDTVEKSATGGKKIKFADESEPSETVNASGASKDTSDSSSSD
                     SSSSDSE"
     gene            <1085477..>1086571
                     /gene="HOM2"
                     /locus_tag="KLMA_50503"
                     /db_xref="GeneID:34717103"
     mRNA            <1085477..>1086571
                     /gene="HOM2"
                     /locus_tag="KLMA_50503"
                     /product="aspartate-semialdehyde dehydrogenase"
                     /transcript_id="XM_022820504.1"
                     /db_xref="GeneID:34717103"
     CDS             1085477..1086571
                     /gene="HOM2"
                     /locus_tag="KLMA_50503"
                     /codon_start=1
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="XP_022676961.1"
                     /db_xref="GeneID:34717103"
                     /translation="MVKKVAGVLGATGSVGQRFILLLADHPDFELKVLGASSRSAGKK
                     YIDAVNWKQTDLLPKFAESIVVSECTPEAFKECDVVFSGLDADYAGPIEKAFKDSGLA
                     VISNAKNYRREEDVPLVVPISNPEHLEMIGTKVSKAKAEGKEKPGFIVCISNCSTAGL
                     VAPLKPLVEKFGPISLLTTTTLQAISGAGFSPGVPGIDILDNIIPYIGGEEDKMEWET
                     KKILGSLNADKSKVNLLSDDEIKVSAQCNRVAVSDGHTECISLKFKNQPPPSVEEVKQ
                     CLRDYVCDATKLGCHSAPKQTIHVLEQNDRPQPRLDRNRDNGYGVSVGRIREDPVLDF
                     KMVVLSHNTIIGAAGAGILIAEILLAKNII"
     gene            <1086818..>1087780
                     /gene="RKM5"
                     /locus_tag="KLMA_50504"
                     /db_xref="GeneID:34717104"
     mRNA            <1086818..>1087780
                     /gene="RKM5"
                     /locus_tag="KLMA_50504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820505.1"
                     /db_xref="GeneID:34717104"
     CDS             1086818..1087780
                     /gene="RKM5"
                     /locus_tag="KLMA_50504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676962.1"
                     /db_xref="GeneID:34717104"
                     /translation="MQLVSLNADTLYEYLFERYIGLESNAANLSQDLGIQSRNEAELD
                     IDISPKQVAPAKSGRKTKKVELDEFNFTIKQNLTSLNSNRDNNNSTTGYVLWTTSTFI
                     LKWLLYNENAVLFRRGDDRIKSLLQSRQDENERYVLELGTGISPIFPIAISNYVEKYV
                     ATDQKDILPRLKFNIQENQAECRRRVLTSESIELDNLKRRTTTECQLDVTVLDWELFK
                     INDKTQHLLLPDGPSHLTIIAMDVIYNEYLVTPFLNTLKSLFTWYKNLGLSVSGLIGI
                     QLRTEEVVRLFLEELIIERNFEVHAVNEPELNSSRFILLHITLP"
     gene            <1087997..>1091989
                     /gene="SAC3"
                     /locus_tag="KLMA_50505"
                     /db_xref="GeneID:34717105"
     mRNA            <1087997..>1091989
                     /gene="SAC3"
                     /locus_tag="KLMA_50505"
                     /product="nuclear mRNA export protein SAC3"
                     /transcript_id="XM_022820506.1"
                     /db_xref="GeneID:34717105"
     CDS             1087997..1091989
                     /gene="SAC3"
                     /locus_tag="KLMA_50505"
                     /codon_start=1
                     /product="nuclear mRNA export protein SAC3"
                     /protein_id="XP_022676963.1"
                     /db_xref="GeneID:34717105"
                     /translation="MLGSMFAPSVPSSQTPFSGHEGHEKANKHTEKRKFKKSVVKSSS
                     RATQPISNGTTLSKKGKKMVPILDAAVNKEIGTLFGGDPSRYGFQPPSKPIERELPRY
                     LIRQAPILKPIPIVQDEWDRKNQEKMLELESSISDVTTLWETLKKMRDTERQVMEEKG
                     LVDKADQAKDLTEAITFQGTCQDMCPIFERARRSVENNVVRYEKANPNDKKVDRYRAL
                     KVFARPAAAAAPPLPSDVRPPHVLVKTLDYIVENIVPLLPDSESFLWDRMRSIRQDFT
                     YQNYSGPEAIDCNERIVRIHLLILHQMAKTDIDFSAQQELEQLHKAIITLCEIYDEVR
                     DQGGQCPNEAEFRAYALLSKIREPEYDKMAQDLPADVFNNDLIQLAITFRRILMNSNH
                     IERGVVVTENCMNLYDRFFQLIQSDKVPFFMASFLEIYLNEIRFYGFKSLSLAVTKKG
                     GNLPYQYFMEHFLFRDDLDLETFCKYYSIDFADGKITLKSLTSTSHLLPETKPLKKNW
                     LHCVEQKLQNSNTSELINNRKENTDTISSGRGTVLDNVTTVELSKNYDNYKDISNNNI
                     FEQKNEAENYQAFGFMNGNQDTRNFQLPADQNSKPVFGIQSPMDIIQNNGKLNQPKLL
                     NSTPSFTPSQPNTTGTTLSKQEELANKLKEQKEKLRRQKVLEEEQLLAREQEIQRKKH
                     ENDIKKQKEIEERRTQALEKKQERVEKLSKELLANILKERVSNTVKTVLQQQKKREVQ
                     IDNLCKSLFKSFIHERLYFIFLEVRAEKFRNKHLYQHSMSKWKAKFERRRKENELKRK
                     KQEEALRLSKELGIGRRIPSLRSSSKRERISANNTMHETSSFINSNTTNYSTPLYIEE
                     NHFTTPVRNNSDIWMPLDLKKTYFEKVATKLDNVLERGDLDSKVTLDIVLYSKSWDCL
                     SGVWLLSKFHLAETVSHKIENSSLCTNFLKLDNEYKANEFSNVNLVIFNTGVTDSDIF
                     DLDMKLQKDGERLIELICGVAFNTSYRFKLLVIYWESIENPKSVLEIKHQLKINKVLK
                     RFGDIIYDTEIVKIMGPNPESFLKQGLSNAANDFEFKLSDRGVYMETRKRRTLAGCGN
                     DSHDTTSTKENSASIDERMQSMLKQEQNKAMQNINKKTAYSHLKNHVMASPRSRYKKL
                     PVLLSDSHKPKYKTPVPLQGSRTSSITATEDSNPSHLVKKVRTTSTIPLPPHPVSGTF
                     GTPSQPRNLLNHTSVLTTPQLTCIGPQNATAPSMSSAELTTSNAANISTQSDFATPAG
                     IINPVHVHQQRNAQKDWSHASISVQGPTKSSLQDISSHETPTSGNVPPSIRELQSIIA
                     VVKKKLQDRR"
     gene            <1092555..>1095242
                     /gene="NHA1"
                     /locus_tag="KLMA_50506"
                     /db_xref="GeneID:34717106"
     mRNA            <1092555..>1095242
                     /gene="NHA1"
                     /locus_tag="KLMA_50506"
                     /product="Na(+)/H(+) antiporter"
                     /transcript_id="XM_022820508.1"
                     /db_xref="GeneID:34717106"
     CDS             1092555..1095242
                     /gene="NHA1"
                     /locus_tag="KLMA_50506"
                     /codon_start=1
                     /product="Na(+)/H(+) antiporter"
                     /protein_id="XP_022676964.1"
                     /db_xref="GeneID:34717106"
                     /translation="MVWSQLDVTKAHVAYACVGVFSCVFSLVSLFFKEKLYIGESSVA
                     VLFGLIVGPHCLNWFDPTEWGNTDNITLEISRIVLCLQIFAVAVELPKKYMLKHWLSV
                     TMLLVPVMTAGWLITGLFVWALIPGLNFSDSLLVSACVTATDPILAQSVVSGKFAQRV
                     PGHLRNLLSAESGCNDGMAFPFIYLSLNIIFHQHNSNEVAKEWICITLLWECIFGCVL
                     GAVIGYSGRRAIRFAEEKKLIDRESFLAFYVFLALMCAGFGSILGVDDLLVSFAAGTA
                     FSWDGWFSKATEESNVSTVIDLVLNLAYFVYFGAIIPWSQFNDSSIGMSVWRPILLAI
                     AVIFLRRIPAVLTFKPFIPDIKSWREAMFVGHFGPIGVGAIFAAILARSNLESHITGE
                     ETPLRHIPPKGTKYWQLIAVIWPLVCFLVLSSIIVHGSSVAVFTLGRHLNTITLTKSF
                     TVHTTNGNGLASRWMDRLPGLDTEGRSYSLRRVDTMASGANKHIGKNDTIETSGIPAK
                     PAGGMKSKKKRSKKRGLRHRGHENEKRSSLELEREIRQREAQAAAFALSKDDEHDLGT
                     TSFTSLDENDYLDNAQTTSNSSETGQGSSNHKNSNVGITPKPTFNDEKLPFPNSQNSE
                     ATEGTLEHHDASQLLPDDHAHIAYQEGSRIILEDKRGEVVNEASYVNQPPDSNSLHQS
                     EEGEALSKTTTNNTVESLKKVLTPSKFRRSTLVDADDTSKKYYAYKYGNQLVIETDKG
                     EIIRRYQINQHESEKEPEEERETKPRSDSVVAKALKIVKLGKSPSTKEHRTVSSSSAS
                     SAAAKQQMKNKKLARQLTPLPVITSLVPEDEESEEHDDNSEDYSNDEEGSENMTSDEE
                     EYTSDETEDEEEETEVERARRLTALGLSSAPRNEDDEED"
     gene            <1095587..>1098079
                     /gene="SSY1"
                     /locus_tag="KLMA_50507"
                     /db_xref="GeneID:34717107"
     mRNA            <1095587..>1098079
                     /gene="SSY1"
                     /locus_tag="KLMA_50507"
                     /product="SPS-sensor component SSY1"
                     /transcript_id="XM_022820509.1"
                     /db_xref="GeneID:34717107"
     CDS             1095587..1098079
                     /gene="SSY1"
                     /locus_tag="KLMA_50507"
                     /codon_start=1
                     /product="SPS-sensor component SSY1"
                     /protein_id="XP_022676965.1"
                     /db_xref="GeneID:34717107"
                     /translation="MSNDRPGGGLFPESYNVDVYGNSTSEDNDLNTDDVTEQSHKKSN
                     ETDSVDSSILAEILEEQYKADSVRFRESLNSNKFFISQLYDIKTGRHSDEGEKNDFMK
                     YNRRLELEYKLREKAERLLVDSSAKNELSIMNSSILNANYIGGEELQVPNTKYHLISG
                     LVSKITRPTKAKELEHHGGIPLQIINTSSGDTQIIDTENNGDWTIDHDYAPKTKTQKL
                     ESWISISRYSNNAAKKTHRGPKLLKKVNALKNSNHSVQRKLEARHIQMIASGSSLGVG
                     LFLTSGKAFTIAGPFGALLGYILCGSIVMATTISFTELCALIPLTSGFSGLASRFVED
                     AFGFALGWLYWFSFIIALPSQIVASSTLLHYYQGLNISSGKMAGFVTLFLSFAVLLNL
                     CDVRAFGNFVYFATTLKICFTILMIFVMIVLNSGGSSLGYDRVGFRFWDSSKSEPFLN
                     YGLFRPTFDLKDVGEGSVNGIGGARGRLLAVFLSMLIAAFTYSGLEMTFVASCEVRNP
                     KRTLPSAMKRTNYTMLLLYILAIFIISLNVYSGDPRLPRFYSYSDNNTQYNINHNIGT
                     TWQLKNECASNSKPTSSTIDDGNRSAWVIALRSFGRCTFGSVLNGILIFFGTTSGCSS
                     LYGASHTLYSMAIQEKAPSIFKTCTSYGVPWIAVLFSGLFGVISYMAVDQSSLNNFQI
                     LANIASATICIIWAGMNVSFLRFFYALKIRPDIISRDDPMFPYKSPFQPYLSYYGLFG
                     SIVMVVFSGFTSFFHGFWNVKIFFSCYGGLIFFIVSYVGYKIFGTSKLQRLDQVDMDV
                     GRIEMDRSIWNAKTDYKGNWKERFSKLVTWFY"
     gene            <1098365..>1099498
                     /locus_tag="KLMA_50508"
                     /db_xref="GeneID:34717108"
     mRNA            <1098365..>1099498
                     /locus_tag="KLMA_50508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820510.1"
                     /db_xref="GeneID:34717108"
     CDS             1098365..1099498
                     /locus_tag="KLMA_50508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676966.1"
                     /db_xref="GeneID:34717108"
                     /translation="MEQAIAAAREQLGLQNAKEALKILKPFKKTLSNAGQKELELVQV
                     YADTYLENGQVEKAYPLLEKSCNLDSDGKVGGCSKFFTLGQITGGPDGITIIMKGIEN
                     VSTLAGNSLSQEQANMIVSGLLSMIEIWMTDLCMEPEAEAQCEELISKAMEISEGKSS
                     EVWSTLGSIRISQQKFSEASEAFTKAWEFFKQKKAYLEEQLSSGSVSTHTEYLDLLQP
                     AISLAKMCIEMGLYEVSSQIIAAVKDIDEDNIENHYLEGFVHYLTAKLEQFKQQNPSL
                     QLSPENIYEFNEHFQEVPLDITNETLKDTIYDARVALSFACKLCENADSDDDVAKEIA
                     QGASSLLNELGGPLDISELMKLRKGEDVTEVDDIEIEVTSDAE"
     gene            complement(<1099597..>1100400)
                     /gene="NBP2"
                     /locus_tag="KLMA_50509"
                     /db_xref="GeneID:34717109"
     mRNA            complement(<1099597..>1100400)
                     /gene="NBP2"
                     /locus_tag="KLMA_50509"
                     /product="SH3 super family"
                     /transcript_id="XM_022820511.1"
                     /db_xref="GeneID:34717109"
     CDS             complement(1099597..1100400)
                     /gene="NBP2"
                     /locus_tag="KLMA_50509"
                     /note="Src homology 3 domains conserved domain"
                     /codon_start=1
                     /product="SH3 super family"
                     /protein_id="XP_022676967.1"
                     /db_xref="GeneID:34717109"
                     /translation="MSEYELDQDNDVVGYISIKDYAYEESNPLHFGYFEEEGEGESDK
                     EIDVGESEGDLRLNNRESVLLPDEYVVNRKAIAMYAFVPENDNELELNEGDIVYISYK
                     HGQGWLVAENHDRSKTGLVPEEYVQLIDEKDSEEGDEPEHARPFYLTQMITQSMCKSP
                     EEDEWEDIEEDEEEDEHVPVQEQSEQKEPELKQFPGQEEQRDLLRMPAAGQGLQRLRK
                     KSNARDYEMKFNLPNADEKMVCNGTSHDSNDDRSDVGNLAQDINDKLEL"
     gene            <1100808..>1101398
                     /gene="CWC15"
                     /locus_tag="KLMA_50510"
                     /db_xref="GeneID:34717110"
     mRNA            <1100808..>1101398
                     /gene="CWC15"
                     /locus_tag="KLMA_50510"
                     /product="pre-mRNA-splicing factor CWC15"
                     /transcript_id="XM_022820512.1"
                     /db_xref="GeneID:34717110"
     CDS             1100808..1101398
                     /gene="CWC15"
                     /locus_tag="KLMA_50510"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CWC15"
                     /protein_id="XP_022676968.1"
                     /db_xref="GeneID:34717110"
                     /translation="MTTSHRPQLEARNGAKDIQYVPTSTQHVRLLPGHKELKKRTRTD
                     TNDNEVHHTKRKRELRLEDGVTEKEDDKLKRAESESDDRVDDTGSSEEYDDDDDEEEE
                     DDEDALLDEWNRVRQERIDSKSKEKKSVSVDSSVNSNTNPDLAKPQKSGWRSKTVFGR
                     HSNKSSESNENKDKNKYINDLSRSAYHKDFMQKHVK"
     gene            complement(<1101511..>1103586)
                     /gene="SLS1"
                     /locus_tag="KLMA_50511"
                     /db_xref="GeneID:34717111"
     mRNA            complement(<1101511..>1103586)
                     /gene="SLS1"
                     /locus_tag="KLMA_50511"
                     /product="sigma-like sequence protein 1"
                     /transcript_id="XM_022820513.1"
                     /db_xref="GeneID:34717111"
     CDS             complement(1101511..1103586)
                     /gene="SLS1"
                     /locus_tag="KLMA_50511"
                     /codon_start=1
                     /product="sigma-like sequence protein 1"
                     /protein_id="XP_022676969.1"
                     /db_xref="GeneID:34717111"
                     /translation="MLRIAVSAPARVTVARSLPFRCSATLRLFHSGTIVSASEDSENG
                     MGQLFSKHGKKLKPKQDHFVVLTPRETGVIRLPKRSRVQNSRASLSVLEGYDLKRHSE
                     KDTKFSQVQDLDILSNIQETTDRLMQFKEQEDNEEMAKAIEACKPSSNTISEKRYFQL
                     EKVLDEQFTLQQLRNYCFLKHGTRKSRVPKKDLIPMIINKFWKCTIDHNKSEFEDLVV
                     ENEILLEKRDLYLLLLTKNGRILQNLSRIGATIAVLPEQNKLVVRCPSQLFRYVEVSI
                     TKILENIVSDDFCIKEFVKNHSLVGETASMTPLEMMNLLQTQSPSYIEVTEDDKYRIS
                     TIGNKSLKSINSLLLWILNYEPQISQSVINTQSDSSDARAERYRVGNYNWINWVARRN
                     SWFRLQNPVPINQDQNQEKKPDLSEKIDSIWDALKLEKTKCAKPLAYNESRSLTVTLG
                     HVLQSEDNSNTLFQSKVAEVIPKVLRLPLWEENVSEEDMLTMDQHLYLVQMKFVPNLA
                     SIQYKVNVPPVEVWFTLDEMNYADLSTVSCIHHYADSAALLQTPSLPYDFKISQTSTI
                     DVIPKDLESADVFEWLEKEQPGFRKFLQDAHLTFSDAKKPRYPQSFTLNVKLEGNSEP
                     QPIEYNAMGYFKHRVLRFRYKDKYLVHYSETNGGPLGGITSSVDFINLSENIDKQTVH
                     ELLDDVIQF"
     gene            <1104152..>1105768
                     /locus_tag="KLMA_50512"
                     /db_xref="GeneID:34717112"
     mRNA            <1104152..>1105768
                     /locus_tag="KLMA_50512"
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN5"
                     /transcript_id="XM_022820514.1"
                     /db_xref="GeneID:34717112"
     CDS             1104152..1105768
                     /locus_tag="KLMA_50512"
                     /codon_start=1
                     /product="RNA polymerase I-specific transcription
                     initiation factor RRN5"
                     /protein_id="XP_022676970.1"
                     /db_xref="GeneID:34717112"
                     /translation="MTEFTDDHLDPALHVADAIQQLEPLIQTESDNMKTNTKKKKKKK
                     EEYKSEMREAYKKWYYDEAYEFFNPYSSNQDLRKSCIHRDGKCKYLQKDDRKRSESPG
                     TIYDGASDSDFEADESSDEERRSGGYLQRQGLGTVWTGKEKQIFFHHLARHSIHTLDH
                     WAEEIPGKSKFEILTYYKVLQDNLVELKRLPTKKKGGVLDYEEFPIAYEVGDSWIELE
                     EELSRDLHEEDDTSVIPTQDETEDESSVINWTNWYKRWDTFYGKHRLLEYYPCSRNPN
                     VFSPEAMQVMEILVKRYTAKLLSETIIPVLDKKSVPRSLSQSSKILKESRTKKLRSVC
                     KIYESPEEEHDKDIIEIKTSNEEFPHIVTENDVVNALVRMRLYSHSRGNGNDKLYLTY
                     PESIVESIQKFDIELEKGKIFRNRKVLRQLRVLLYLQNSKVYSKQLTYPKSTGKENID
                     WVSGNSAATYDTTSTRKRLKHDRDLADTPEYKKQKILDITIDNNDILRSAKYTHTLLT
                     WLQLTKNSVKKGKSDTDNSAKLKERIHVTW"
     gene            <1106485..>1107885
                     /gene="PUT1"
                     /locus_tag="KLMA_50513"
                     /db_xref="GeneID:34717113"
     mRNA            <1106485..>1107885
                     /gene="PUT1"
                     /locus_tag="KLMA_50513"
                     /product="proline dehydrogenase"
                     /transcript_id="XM_022820515.1"
                     /db_xref="GeneID:34717113"
     CDS             1106485..1107885
                     /gene="PUT1"
                     /locus_tag="KLMA_50513"
                     /codon_start=1
                     /product="proline dehydrogenase"
                     /protein_id="XP_022676971.1"
                     /db_xref="GeneID:34717113"
                     /translation="MLSGVSRIAIRSGTRRVPMGLTHRFVSHTSANKSTVVPPSGIHN
                     PGVIHAEQQHVPAPDDYLRNLSKNELFSLGMIGMCTINKPILDLVIKLFPYVPLFLVK
                     IFVSPLYCGGDTPKEVIDTGKRLQKRGINNMMLSLTIEDAEGIKNIDINYIVEETIKS
                     VHSILKPVMLEQLESGKDVNSIPPGYIALKPSALVANPAEVLLNFNKPEWKTQRDELI
                     NNCSRITKEVFNLNQELLAKYPDRKSPFFVSTIDAEKYDLQKNGVYELQRILFSKFNP
                     ASSPIVSCIGTWQLYLADSAADLAKDYERAKKEGYKLGLKLVRGAYIHSEPDRSVIYA
                     TKEETDANYNKVLTTAVNDLLANGEKSYYGHLVVASHNYESQMLATKLLAGQKQSVGK
                     LNVTLAQLLGMADNITHDLITNHKVENIIKYVPWGPPLETKDYLLRRLQENGDAVRAD
                     NGLPLVKAVLKTALRM"
     gene            <1108290..>1110386
                     /locus_tag="KLMA_50514"
                     /db_xref="GeneID:34717114"
     mRNA            <1108290..>1110386
                     /locus_tag="KLMA_50514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820516.1"
                     /db_xref="GeneID:34717114"
     CDS             1108290..1110386
                     /locus_tag="KLMA_50514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676972.1"
                     /db_xref="GeneID:34717114"
                     /translation="MKFVALISGGKDSTYNILHCQKNGHELVAFANLHPENEEEQELD
                     SFMFQTVGHDLVNWYPKCSSIPLYKQAIQRNSSKNVALNYSKTKEDEIEDLYVLLDRV
                     KKDIPDLEAVSVGAILSSYQRTRVENVCSRLGLTALSYLWQRDQRELMEEICSMSKDI
                     SKQGSEAAQEFGKLDARIIKVAAVGLNQSHLGKSLPELLPTMIKLNSMYEVHICGEGG
                     EFETMVLDAPFFKNGHLELRSIEDVTDDKNDGVFNASFNVEFVPHELPAWHLQEQLDK
                     LLTPEVLSEKWQEVYSRMESENLEDLNTSELEPSWSNPNSFPISINEVGKLLYISNIA
                     SSNTDSLKANCLEVFSQLDSILKSRSIFPSQILSSSLLLSDMSNFQEVNSYYNDFFDV
                     EKNGPLPPARACVETSLLNHPLQLSVIVDLSSRCLPVDGGIILNTSKDGLHVQGRSYW
                     CPNNIGPYSQATWNNSDRNQVTYISGQIGLEPASMELWKGNDGGSKVPEIVLSLRNYF
                     TLSETINSNTPVSMVCYISDSTSLQIVTKAWSLLTETLPNESEHWFDQDPIEQNILII
                     VKVSKLPKGAICEWGGINCQQLVIEDDYDEDDLAAQIHKNLTLKSQTELQLPLDATDI
                     TISENGVNRHFITTFLDTDDELVKTLSECKDAQITLYYTPNRTVPEYTHVEYIPVSQV
                     YDHTSAVRTYGLIIKY"
     gene            <1110658..>1111818
                     /locus_tag="KLMA_50515"
                     /db_xref="GeneID:34717115"
     mRNA            <1110658..>1111818
                     /locus_tag="KLMA_50515"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820517.1"
                     /db_xref="GeneID:34717115"
     CDS             1110658..1111818
                     /locus_tag="KLMA_50515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676973.1"
                     /db_xref="GeneID:34717115"
                     /translation="MDASNELNALDKLLKQEETIVHTKHHLSLRYTLENSIEEEYKRD
                     KCFEKQLSKNILLQIPDSYLEKAVPDPQIASRAHLFYENHNQGDLLTGGSSCLDVLRH
                     KSTIENAIYDHTNMRIGNPLENSNHLENPSHHSSENHTSLPKHTLDFTPSSASEKSKQ
                     ESIITDEKMRNVMDNTALVKSLLDSFKNPSIPESQSLGPPPNAPVVASRYEGDKNSMQ
                     QNHQSREQDEINNNGNTDLLNKMENFSNVMQDLLSSMKPYLEQQKNAIDSPNMSSSSS
                     NAKIILPTERQYIPNNSSSGQSQKQFPKLKKQRSQSQTRQQPKSSRYQNTNELYQESY
                     NANKKNNNGKTHIQNVASAVSNRGHKRVIESNERGKPKALKRMQKIAKEHNL"
     gene            complement(<1111881..>1113977)
                     /gene="SEC1"
                     /locus_tag="KLMA_50516"
                     /db_xref="GeneID:34717116"
     mRNA            complement(<1111881..>1113977)
                     /gene="SEC1"
                     /locus_tag="KLMA_50516"
                     /product="protein transport protein SEC1"
                     /transcript_id="XM_022820519.1"
                     /db_xref="GeneID:34717116"
     CDS             complement(1111881..1113977)
                     /gene="SEC1"
                     /locus_tag="KLMA_50516"
                     /codon_start=1
                     /product="protein transport protein SEC1"
                     /protein_id="XP_022676974.1"
                     /db_xref="GeneID:34717116"
                     /translation="MSNLIELQKDFVIDVLQQVRTEHNIKFLVIDDEADRLLDSLFAE
                     RSELLNYVTAVDRIDSPKRKGQSSVAAIYLLRASKFNINCMDADFAHNNLKYKRAHIR
                     FLSDFLPDAVNHFKSRRYITSNVADLKVVNCSFIPKENQYFETVGIDKPLQVFFNPSC
                     RGLVDLNIHRTVQSLLNLCIITGEYPIIRYSEPTAEEYALNEATLLAKRIAMQFQQEL
                     DDYARDHEEFPPPNNRPRAIMLITDRTLDLFSPLLHEFTYQAMAYDVSKNINRLTDIY
                     SYEVENETGVMEPKTSKLSDLVDPDWTSLKHLHIADASEYLTSKVNELIAKNPLLVDR
                     ANVKDTSDLLNVVAHLKDFDEERRLIALHRTLLDECFEVSKNNNLAEHADIEQILAGY
                     GTDFDGEKCKHISDKLIENLADPKPSVTDKVRYIAEYALYRGGLIELDFVKLLSFIGV
                     DKTNNWFNHFMQLFKNFNYLGFKLMKEKPKDKPFQKEWTHETIVNDSTIYQTSRFVPS
                     AGNILSKVITNPLLLKEEQFPYVKDKPIELLDADVANSLKTKMATPSSLRNPRHKAAW
                     AKSTNHPKGNRQRFFYYVIGGITFSEIRACCEQSRSFNKDVYVGSDSVLTPLQFMSNV
                     EDLTKPRELLRLRDDAPVREEPPEFLLRNNLSAPAPTHVHTVQKPQNPQRNNVQQEPK
                     DVTKKHGKFSRFLKRK"
     gene            complement(<1114429..>1116822)
                     /gene="ACF2"
                     /locus_tag="KLMA_50517"
                     /db_xref="GeneID:34717117"
     mRNA            complement(<1114429..>1116822)
                     /gene="ACF2"
                     /locus_tag="KLMA_50517"
                     /product="endo-1,3-beta- glucanase"
                     /transcript_id="XM_022820520.1"
                     /db_xref="GeneID:34717117"
     CDS             complement(1114429..1116822)
                     /gene="ACF2"
                     /locus_tag="KLMA_50517"
                     /codon_start=1
                     /product="endo-1,3-beta- glucanase"
                     /protein_id="XP_022676975.1"
                     /db_xref="GeneID:34717117"
                     /translation="MSYERPPLPIPGPRPSRNSEDISPPPYSEYDPLTGSPPPLPPRR
                     SHNAAYSTIMREPPPPPLPPRRPKNTRLIDGVSNTLQSVSISDSNTTTGTSASSSNIF
                     DSAISTDPPSDIFFRVNHEVPLPPGIQNSGKPTETNKFYGNILLGSGTNPVWTHPYCV
                     WYSTDSFPGFAVNHVKASQRVFDTTKTPPQFFFGPNGIKSLIYSSTDFNSEADISLGF
                     SNITHLSIHVQLKKSDTEYIVFPLTQGMGFVTAIYYNLVPKLYSGVGFKSISRDASPR
                     ANIDKYSILLENNVKWVLYMTILPGQSLNMTLVDGNTIVGDKRVNGCILQVTADSNPE
                     LGHAAGCYADSAILEGSVSGSDGYYRIKYDTKGESESGTPLVYALPHHYENFDTTVMN
                     GKYMVSTLDTTTKGQAKGYLTDQLAMKVIVPLDLQFDPFTTIPNKTEPHYSAATLNSI
                     SAAAHNDVTGDVISESNLDSMYFSGKALAKYSWILYVCQYILKDSNLVQIILPKIKSA
                     LATFTANKQILPLRYDQTWYGLISSGDSAQDFGNSFYNDHHFHYSYHVIAAAIVAKID
                     KEIGTGTWFDENKAWVETLLRDYANPSSSDPYFPVFRSFDWFNGHSWAKGLFESGDGK
                     DQESTSEDINASYAIKLWGIVSGNKHLENIGNLMLGVQRTSVNHYFLYLDSNTTQPKQ
                     FIPNKVSGILFENKIDHTTYFGNNLEYIQMIHAIPITPASSFVRSPQFVQEEWDEVLT
                     PIVNDVNDGWKGIIMLNVALKDPQTSYDFFNDQNFQPAYLDGGQSKTWSLAYAGAFI"
     gene            <1117300..>1117947
                     /locus_tag="KLMA_50518"
                     /db_xref="GeneID:34717118"
     mRNA            <1117300..>1117947
                     /locus_tag="KLMA_50518"
                     /product="ribonuclease MRP protein subunit RMP1"
                     /transcript_id="XM_022820521.1"
                     /db_xref="GeneID:34717118"
     CDS             1117300..1117947
                     /locus_tag="KLMA_50518"
                     /codon_start=1
                     /product="ribonuclease MRP protein subunit RMP1"
                     /protein_id="XP_022676976.1"
                     /db_xref="GeneID:34717118"
                     /translation="MDVLDSKLVSLLRQELRIILLIYHRNKNQHGATIWWKQLNMLKR
                     NVSQVVVILERIVYKNIKNTKELIQLHYLLHRFLKLQVKKMYYDFNGIIALGQFVTLG
                     VVLIGNLSRVFNVYFQVYHALSDDFERLGVRVRNKNQNQNERLIKETLEEELGEEIGE
                     EILNATDLSTLPNDLPSKTGVEVKKLPVVSKKEKKSSKKKIKKRSKKSVIDDLFG"
     gene            complement(<1118066..>1118950)
                     /gene="SPE4"
                     /locus_tag="KLMA_50519"
                     /db_xref="GeneID:34717119"
     mRNA            complement(<1118066..>1118950)
                     /gene="SPE4"
                     /locus_tag="KLMA_50519"
                     /product="spermine synthase"
                     /transcript_id="XM_022820522.1"
                     /db_xref="GeneID:34717119"
     CDS             complement(1118066..1118950)
                     /gene="SPE4"
                     /locus_tag="KLMA_50519"
                     /codon_start=1
                     /product="spermine synthase"
                     /protein_id="XP_022676977.1"
                     /db_xref="GeneID:34717119"
                     /translation="MIEHPCIKDGWFREVSDKYFPGQAFTLRVEKVLYHEKTEFQDVL
                     VFKSTDYGNVLVLDGIIQVSERDEFAYQEMISHIPLYAHKSPKKILVIGGGDGGVLRE
                     VVKHSCVTDATLVEIDPTVIELSKKYLPNMACSFNNPKVNVKLCDGFKFLRDVAASGA
                     KYDVIITDSSDPEGPAEAFFQKEYFELLYKALNDDGIVIAQASENVWLNLNYLKTLLE
                     TARSVFPVSEYCYTMLPTYTSGQLGLIACCKNPNTNIVQPSRVPTESEQANMRYYNNK
                     IHSAAFVLPTWARKSLNP"
     gene            <1119535..>1120890
                     /gene="TRM82"
                     /locus_tag="KLMA_50520"
                     /db_xref="GeneID:34717120"
     mRNA            <1119535..>1120890
                     /gene="TRM82"
                     /locus_tag="KLMA_50520"
                     /product="tRNA (guanine-N(7)-)-methyltransferase subunit
                     TRM82"
                     /transcript_id="XM_022820523.1"
                     /db_xref="GeneID:34717120"
     CDS             1119535..1120890
                     /gene="TRM82"
                     /locus_tag="KLMA_50520"
                     /codon_start=1
                     /product="tRNA (guanine-N(7)-)-methyltransferase subunit
                     TRM82"
                     /protein_id="XP_022676978.1"
                     /db_xref="GeneID:34717120"
                     /translation="MLHPLQSVLLNSDASLLFCVIKNEIKAFKRTNEGYVLCGEWIDD
                     LDKTPLIKEKVLKEQVRQLSENASKKLKTNEGESVTQQHVVAVTQPKKEAKVPKPGPG
                     APPIYHYIRNLGLSRNEKLLIGCTDSDKAAVIFKIDLEDDKNILKLIKRQPYPKRPNA
                     ITTSMDDSDLILADKFGDIYSMPIAEEVLSSINDEKAPILGHVSMLTDVNMVKDSEGK
                     QYIITADRDEHIRISHYPQSYIVDKWLFGHEEFVSSICIPTWNDRLLFSAGGDHFVFS
                     WDWKSGKLLHKFDYSELIKNYLTNDHLAPERFQNEKGDVIEYSVLKIVSIKDVPLIVF
                     LVEATKVLFVLKVDTETGVLSLHQSLEFENNIISITSAPDSKTLGVSLDNRDNQDADI
                     IKLLFLENETFVEQKNVNKNLSDSIKLALESDKIANVEREDVYPLYHNASLRKHGEHF
                     S"
     gene            <1121210..>1121443
                     /locus_tag="KLMA_50521"
                     /db_xref="GeneID:34717121"
     mRNA            <1121210..>1121443
                     /locus_tag="KLMA_50521"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820524.1"
                     /db_xref="GeneID:34717121"
     CDS             1121210..1121443
                     /locus_tag="KLMA_50521"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022676979.1"
                     /db_xref="GeneID:34717121"
                     /translation="MDITLKRSSSRVTSTADSVKDTQTSENLQQLIQKSLALQNEIQQ
                     LFSEYEANNKDIRDDVDDFCEIYESSIGNLTVG"
     gene            complement(<1121530..>1124295)
                     /gene="SEC5"
                     /locus_tag="KLMA_50522"
                     /db_xref="GeneID:34717122"
     mRNA            complement(<1121530..>1124295)
                     /gene="SEC5"
                     /locus_tag="KLMA_50522"
                     /product="exocyst complex component SEC5"
                     /transcript_id="XM_022820525.1"
                     /db_xref="GeneID:34717122"
     CDS             complement(1121530..1124295)
                     /gene="SEC5"
                     /locus_tag="KLMA_50522"
                     /codon_start=1
                     /product="exocyst complex component SEC5"
                     /protein_id="XP_022676980.1"
                     /db_xref="GeneID:34717122"
                     /translation="MNGTFDVSEEQLLQFYHLKSLEPVTSWKEDSTLVYQLEDGQWEE
                     DNLETSYAVLNDLLQQEHEFNRTKGSGTTLEKEDVKDPLNPSIPAMELLRRLKIDPSS
                     KQSYEYLITSKNFKPKLYLKKVHAQDTFEQLTRSLDTLDRSLQEQSHELKQLIQTNFA
                     KYVRSKSNLDNIYSRFGTLMNSTNAENSQNYDEDELSVQKLNDNLNETMKQTSLKLQP
                     LLNNNEKVQKFQWAIQFVNDNRYFFDLPKLLKNLLVNKDYTNLMFEYERAKSTYKNLS
                     ARNSGELQIGSDNSVIEKIWNEVELIMDRYRKYSWAKLLMPPAIGSSDSQEVFLPLLS
                     KLIDLKVTENPIIMWIDTRMSNFQDQLKRTADQMMESIAQSSDNLLQNSSGNEIDLQF
                     YLSMNIYSEERSSKADDSSANHTLMVQRGLTDVPAVVETWLLILKFMTELNTISTSFV
                     EFWEHVERFLDNTYQTMLINERRQNRIIESNDELLEDGAAMLNLSDDEVNLLKQQGAS
                     FIKSVSNVLTSFFRSTQTKSNVKVTNNNSGNDPGSPSLYGFIPPRSNCLSCLRYLPKI
                     VDPVFRFTTELAQLAIDSDSIESLRKLNVFITDRCVSAISSTRLRDLSMLYTLEDWEV
                     YESLEDDRYSITLFPEMARSLQQYSIQTLRDILFSYEKLPVIKGISVVGYPSKQLLTG
                     IEIQQVVSMESVLESVLKNAAKDKDNPRNSHTVLTLNNLKHIKSQTFPKVLQHFDEAF
                     EMNLSTKKLELYNLLAKMESSIFGNYLSDLKFSLRDKLEDKFHDITWSTYTSNSFRVS
                     DYIIETLMILIGIHSECFRIGPQLIERILKETQVFIAKYLFEAFKPYIGNISSDGLLQ
                     VTVDLLFLEKVLKGLLVEDTKTIIIACLQNCFQNDVPRMQRIIKETEPIVNSNLERTK
                     IQFASLR"
     gene            complement(<1124567..>1124869)
                     /gene="SMD3"
                     /locus_tag="KLMA_50523"
                     /db_xref="GeneID:34717123"
     mRNA            complement(<1124567..>1124869)
                     /gene="SMD3"
                     /locus_tag="KLMA_50523"
                     /product="small nuclear ribonucleoprotein Sm D3"
                     /transcript_id="XM_022820526.1"
                     /db_xref="GeneID:34717123"
     CDS             complement(1124567..1124869)
                     /gene="SMD3"
                     /locus_tag="KLMA_50523"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein Sm D3"
                     /protein_id="XP_022676981.1"
                     /db_xref="GeneID:34717123"
                     /translation="MSAIPIKLLNESQGHEVTLELNNGDMYRGKLVENEDNMNCQLRD
                     VIYTQTNGKMTRMDDVFIRGSNIKFVVVPDMLKHAPLFKKSAVSKPPPPIRGPKRR"
     gene            <1125142..>1127907
                     /gene="PEP3"
                     /locus_tag="KLMA_50524"
                     /db_xref="GeneID:34717124"
     mRNA            <1125142..>1127907
                     /gene="PEP3"
                     /locus_tag="KLMA_50524"
                     /product="vacuolar membrane protein PEP3"
                     /transcript_id="XM_022820527.1"
                     /db_xref="GeneID:34717124"
     CDS             1125142..1127907
                     /gene="PEP3"
                     /locus_tag="KLMA_50524"
                     /codon_start=1
                     /product="vacuolar membrane protein PEP3"
                     /protein_id="XP_022676982.1"
                     /db_xref="GeneID:34717124"
                     /translation="MNGGKYRNDEMSCQVEHVSLKFIKEVRQNLCCLQVENNTMFIAL
                     KTGYLFIIDLDDPATVHSFMVPMLVNNQEKLLQIWVNKQASLVLFKTNFAKYYVGHVD
                     GIVNSSSKSGKISTLKKLNKKSCDIRTVDWGFSETRLLIGTKEGKGYHINLEPCVANA
                     SSDAQLTKVYNAVDNIDGIMFNKEYGALLVAGSQIMFWDKAQVADSDPIHVFSSVKPT
                     ASEQYEQSDKELGSRFYVSGSVFAWVTQSGIVLGDMRDKKPLLSAKVLLYMELPASTH
                     RVKDVKLTNYHIILLRGSELIVVNQLTMKIVFQESIFNSNDVEKLHSLAVDYSQSPPT
                     IWCHSSSNVYELVMKDENKSVVKLLCDNGRFQEALSLNDIPVAEKDYIHGLYGDFFYE
                     KKDWVNAAQQYSQIRLSNSCGLTALKFMKDASQAESLQKLLQINLENTKDVYQVKQVI
                     LSSWIVHNYMNQLNNIDEKISRDPSNEKLANVKRVLVKDFEDFARTNFNKFDRETIYQ
                     IISRQNRKKELLFFATLAEDYEYVLSYWIKLKNWYESLKLLSLLQDPDLIYKYSSILL
                     ISSPDTTINTWMQISSLDPVPLIPAILSYFTNYQKKKAEGVRSNSQNHGANYLKWCIR
                     DQHNSTPIIHNTFIYMMVVDKSNDKEQETIQFLTGYSKNYFDKDFILRLSLRYERYAV
                     AICIYSELSLFEDAVKLALSHDMLAAAKGVASMVEDKELKKALWLDIAAVVIKQDQDI
                     KSTLTMLIQESENILSIKELLPLFDEFVTIANLKEELVRSLEKHSMQVTKLSQNIRDS
                     LKIKNEIKNDILLFKDRYEALEPGVSCSYCSKPLQTRKFFVYPCGHSINTDCIIKIIM
                     SSNQFTLKVKIQNMQKQLSRDKNSVKPEELDELLSAQCPLCSEITLNSIDEPWDLDQN
                     AAAKWKL"
     gene            <1128187..>1128765
                     /gene="TAF10"
                     /locus_tag="KLMA_50525"
                     /db_xref="GeneID:34717125"
     mRNA            <1128187..>1128765
                     /gene="TAF10"
                     /locus_tag="KLMA_50525"
                     /product="transcription initiation factor TFIID subunit
                     10"
                     /transcript_id="XM_022820528.1"
                     /db_xref="GeneID:34717125"
     CDS             1128187..1128765
                     /gene="TAF10"
                     /locus_tag="KLMA_50525"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit
                     10"
                     /protein_id="XP_022676983.1"
                     /db_xref="GeneID:34717125"
                     /translation="MTDKPFEDVDIDDEMNEFDDNEEAPVDNEALFGRVEQEEAAEKT
                     RIEDGSKRLFDLPEFTRKDKTLQEILDLMEDNPPVIPDAVIDYYMTKNGFDCSDVKVK
                     RLLALATQKFVSDIASDAYEYSRIRSAITVHNSNNGQARARQLLIGQQLTQQQQQQNE
                     KTNANKVVLTVNDLSSAVAEYGLNISRPDFYR"
     gene            <1129061..>1130554
                     /gene="CDC37"
                     /locus_tag="KLMA_50526"
                     /db_xref="GeneID:34717126"
     mRNA            <1129061..>1130554
                     /gene="CDC37"
                     /locus_tag="KLMA_50526"
                     /product="hsp90 co-chaperone Cdc37"
                     /transcript_id="XM_022820530.1"
                     /db_xref="GeneID:34717126"
     CDS             1129061..1130554
                     /gene="CDC37"
                     /locus_tag="KLMA_50526"
                     /codon_start=1
                     /product="hsp90 co-chaperone Cdc37"
                     /protein_id="XP_022676984.1"
                     /db_xref="GeneID:34717126"
                     /translation="MAIDYSKWDKIEISDDSDIEVHPNVDKRSFIKWKQQSIHEQREK
                     RKRDISNLEFQLEMYSHLNKRVDKLMVHLKNEDLVNKETITKFLNENFDKTEKGSGEN
                     VDPDLPPYNEMVLDLFEQLERNAEKDNKDPKDGSVIRDELVKHRAKIAAVSKEAEEKL
                     KELYTEKANHISSEDIHTGFDKGFINHSKDDESSAAAPIPEYMKQAKTNDVPLPKLKL
                     QPIDYKDDILKLAPQTEAFGKITAGNFAESEKYLLNHPEIFSEQQKDALMMSAFELEM
                     AGKTKEAYQVIHQSELLSYVLELYAMRKLPEFNVPQLKEVIEMFFERLFSPRSNPMAK
                     KSFLESVQTKYEHVRTRSKAMQQESENDAEGVETIQLKSLDESSELQVNLPDFNSSDP
                     NEVAKVKAFNKLPPKMQEAVKSRNLDEINAVFAELPMETSEEILDIFQEGGIIGINAV
                     LEDENEFKELQEHYQNDQGIEKLSIEEENENDSQDNEIHVSSADIVD"
     gene            complement(<1130746..>1132806)
                     /locus_tag="KLMA_50527"
                     /db_xref="GeneID:34717127"
     mRNA            complement(<1130746..>1132806)
                     /locus_tag="KLMA_50527"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820531.1"
                     /db_xref="GeneID:34717127"
     CDS             complement(1130746..1132806)
                     /locus_tag="KLMA_50527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676985.1"
                     /db_xref="GeneID:34717127"
                     /translation="MTIDQRRNSSAYSNKPRVHQHYMMHSLKLFDAKVSINHWQLRNC
                     ITADTLNPGSVYYIFDHSIRSLNTGSVARDSSLRKRRHSTSVGGVQSKNDYHVASNSV
                     VEFPFKPRSFNEKSGLVVCGGHIGNDDNGYIPSRPMSSYDQSFISPDERSMDTECVKL
                     ANTNILSDHTAYSNTRSWKGIVSLYNTNTNVSMTCKLGQYINNCVELYESSENQFELY
                     TCNNDGHLYQCEINNSDVVLKRRYADLKFALNNAAISHDGKVMCVTGDSNKIALYKKN
                     ELTDVFSLSYDSLSGGPRNSTGNTATYTHKRIPRYALPDNSSYVDHIYELPGADNGFF
                     TSFSENDMMMATVFQNGNCYVYDIRNMEYPLTEIHTTRSQGSVPQSGAFRICKFSEGM
                     EDLLFISEHQQRVHVVDTRNFMNRQVIMVPYKYKGTDPSGIDSESNLIYESRNWHDRG
                     IASNGSSNNERRRNSEPAVENPYITMANKIPIQHLQPTILPYSSVSDSSYGTEGENSE
                     YEQSTEESLDSTESLNDEGIDNFVSEQSSRRASNFTVRRYSTANSVLDNVNEEPVNNI
                     DPTIMNTSSNPFEDSSPTYPTSSSVIQTLRQNYEEGPGATIPVMRPFQMPGRLVRRRP
                     RNFSVGRNPHDIASEWEECNISGIEWLRDQEGSSLVIGTDYGIIKWNINYWARRSFPS
                     YDFC"
     gene            complement(<1133372..>1135009)
                     /gene="STB3"
                     /locus_tag="KLMA_50528"
                     /db_xref="GeneID:34717128"
     mRNA            complement(<1133372..>1135009)
                     /gene="STB3"
                     /locus_tag="KLMA_50528"
                     /product="protein STB3"
                     /transcript_id="XM_022820532.1"
                     /db_xref="GeneID:34717128"
     CDS             complement(1133372..1135009)
                     /gene="STB3"
                     /locus_tag="KLMA_50528"
                     /codon_start=1
                     /product="protein STB3"
                     /protein_id="XP_022676986.1"
                     /db_xref="GeneID:34717128"
                     /translation="MTEQQQEQEQQQQQQLEDNNSVPAGIETKQTVQNDRGINSNYTL
                     KMKERNGEGTVLMSQQQAVKNDISIENGHSGLGSQITGTNESRNVSLNLSGAASPKGG
                     AIDSRSNSNKMGLLHKPISTSSPEAQQAAQQVTPEKLSQLLLENGPLAIRFITKALSK
                     EIPKFSDLSASKQRRLIMSALESGDETNSVVFAKIGWGQWSAVKVEDPTDFVKQRELT
                     NIANSKIKDQMASDRRRSSGGAGGGGGGGTATVPVALSPTSKNPLDKSFSTPVPPLDL
                     KATGKKAGNENDNNKSSNRESGSGKNKDAASTATFLDENVLVSDDDDDDHRYYDDDDD
                     EDELTSYGLNQDVFRRRQSSVISDNNNSPPNELEFVVRTKLKNGSRSGSRSIHRQRQP
                     QASNKRRSSSVNKPYRSSLSSLNHSNGSETLLSDPSLRRMSTHSDNRTKSIVHLSGSE
                     TDNEIISHITSSRRESRLSFTNESSIRSTLIPHLRKMNQSQEQVINDNDMDIHSDTDE
                     EDWQAIGAETLRKHGSSPPSASPRDQDAAIALMSLKS"
     gene            <1136162..>1137292
                     /locus_tag="KLMA_50529"
                     /db_xref="GeneID:34717129"
     mRNA            join(<1136162..1136167,1136552..>1137292)
                     /locus_tag="KLMA_50529"
                     /product="hyaluronic acid-binding protein 4"
                     /transcript_id="XM_022820533.1"
                     /db_xref="GeneID:34717129"
     CDS             join(1136162..1136167,1136552..1137292)
                     /locus_tag="KLMA_50529"
                     /codon_start=1
                     /product="hyaluronic acid-binding protein 4"
                     /protein_id="XP_022676987.1"
                     /db_xref="GeneID:34717129"
                     /translation="MSNPFDLLGNDVEEPTVVSPPKEIVKKNTSSKKADVPPPSADPS
                     KARHNKPKAVGNEAAIKDKNAGRSNNRNKDAPASTKPKRENRRATDRQNRSGKVDTSK
                     KVKQGWGDDEKELEQEQAAIADAAAELAEDAEEQPADNKKSLKEYLEEMKANSLDTPA
                     PKKEVEFEGTPLEAKEKEVFAPATKVKKVKSKQLKTKQFLDFDVTFSDSLPKPRADRN
                     TRGKRDSKKPNQKQQQGSKGPAVTHFPSLA"
     gene            complement(<1137785..>1138909)
                     /gene="PCD1"
                     /locus_tag="KLMA_50530"
                     /db_xref="GeneID:34717130"
     mRNA            complement(<1137785..>1138909)
                     /gene="PCD1"
                     /locus_tag="KLMA_50530"
                     /product="peroxisomal coenzyme A diphosphatase 1"
                     /transcript_id="XM_022820534.1"
                     /db_xref="GeneID:34717130"
     CDS             complement(1137785..1138909)
                     /gene="PCD1"
                     /locus_tag="KLMA_50530"
                     /codon_start=1
                     /product="peroxisomal coenzyme A diphosphatase 1"
                     /protein_id="XP_022676988.1"
                     /db_xref="GeneID:34717130"
                     /translation="MFQPQLIATSASRFRVIAKRVAIFGAKEMVKSAETRVTEAKESL
                     VGMSQISRIISNLSHFRSPSLALPTPCTWPSNRRSAVLVLLFVGAKGELRVLLTRRSR
                     KLRAFAGQVSLPGGKADSSSETFQEVALRETEEEIGLPRDPRVLKEEYGLQIDSVCET
                     LPHYLSKTFLSVKPLVCFMYNSNLASQNGRKFVEPLNISKVFAKLNTGETSSLFSIPL
                     SDLVCHEHKEWKGYKPEYIAREEHVYRWGGLRWPLRYYYYPMDNNGESQWVKDVIDES
                     SGDEQFGNVLCKNVWGLTAKILYDVARIGHGTVTDQDAEPQIGHEDLIYGLHEFGSQM
                     RERDRSDWEVGMIENSRHFKFSDVIPTFYLDRVKKSSANY"
     gene            complement(<1139777..>1141699)
                     /locus_tag="KLMA_50531"
                     /db_xref="GeneID:34717131"
     mRNA            complement(<1139777..>1141699)
                     /locus_tag="KLMA_50531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820535.1"
                     /db_xref="GeneID:34717131"
     CDS             complement(1139777..1141699)
                     /locus_tag="KLMA_50531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022676989.1"
                     /db_xref="GeneID:34717131"
                     /translation="MSIGLGEIVYFALKPVLKIYLILTVGYLLAKYNVVGVEAARSIS
                     NMVVNAILPCLVFNKIVANIQAKDIKEIAVIVLSACILFSLGALASIIIKYTLPVPKK
                     WVWGLIFAGLFPNISDLPIAYVQSMGTGIIFNSDSVDKGVAYCCIFLTTQSFLMMNFG
                     MFRLVGLDFREKLDDIESSSSTSSAEQTHPKEEENSSPFSNSIGNTETKNDVSSISSS
                     DSKDSSIAAPKPAMTIDHPVANTVANNTALNTGVTHVENDVDDEDENALESLSESDLG
                     STDQLEIHRPQLFRKGTSASSDVRNRNPNDPKPLTRAKTASSNGTYDGTNAALNRTTS
                     LSLTPTNPTSITSHSSQYNRSRRRRRSQTINDVISEYSVVERVRTGDLDLTRPLTLTA
                     DIGEENAALGDDDNSSVSSHPSANTAGSNERNSLSLARTATNKSLRKVDSWFHRHKLG
                     WLEYIAINCFRPASLGAMLGIICSMIPWVQALFVKTYVHVHNAPDQLPVLNFLMDATA
                     YIGNACVPLGLLLLGGTIARLQVNELPKGFLSVAFTMAGIRLAVIPIIGVLWANKIYS
                     MNWIESDIAKLVVIITFAMPSATAQVYFTAFFTPVDGPHLQMDCLSVLFLVQYIFLWI
                     TLPFVVSYALKVDIKV"
     gene            complement(<1143035..>1145089)
                     /gene="ACS2"
                     /locus_tag="KLMA_50533"
                     /db_xref="GeneID:34717132"
     mRNA            complement(<1143035..>1145089)
                     /gene="ACS2"
                     /locus_tag="KLMA_50533"
                     /product="acetyl-coenzyme A synthetase 2"
                     /transcript_id="XM_022820536.1"
                     /db_xref="GeneID:34717132"
     CDS             complement(1143035..1145089)
                     /gene="ACS2"
                     /locus_tag="KLMA_50533"
                     /codon_start=1
                     /product="acetyl-coenzyme A synthetase 2"
                     /protein_id="XP_022676990.1"
                     /db_xref="GeneID:34717132"
                     /translation="MVLGKAHKIVHEAHEVLARHAPEHFYKSQPGKSYCADEEQYRQM
                     YSQSINDPSGFFGPLAKEYLHWDRPFTQVQSGSLEHGDVAWFLNGELNASYNCVDRHA
                     FANPDKPALIYEADDESENKVITFGELLRQVSEVAGVLKSWGVKKGDTVAVYLPMIPA
                     AVVAMLAVARLGAIHSVIFAGFSAGSLKERVVDAGCKVVITCDEGKRGGKTVHTKKIV
                     DEGLAGVDSVAKILVFQRTGTVGIPMKPGRDFWWHEECVKQKGYLPPVPVNSEDPLFL
                     LYTSGSTGSPKGVVHSTAGYLLGSALTTRYVFDIHPEDVLFTAGDVGWITGHTYALYG
                     PLTLGTATIIFESTPAYPDYGRYWRIIERHRATHFYVAPTALRLIKRVGEQEIAKYDT
                     SSLRVLGSVGEPISPDLWEWYHEKVGNKNCVICDTMWQTESGSHLIAPLAGAVPTKPG
                     SATVPFFGINACIIDPVSGEELTGNDVEGVLAIKSPWPSMARSVWNNHSRYFETYLKP
                     YPGYYFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTAEIEAALVEHEGVSESAVVG
                     ITDELTGQAVIAFVSLKDGYLAEDAVEGDPAHISPDKLRRELILQVRGEIGPFAAPKT
                     VVIVNDLPKTRSGKIMRRVLRKIASKEADQLGDLSTLANPDVVPSIISSVETQFFNQQ
                     KK"
     gene            complement(<1146443..>1152034)
                     /gene="SEC7"
                     /locus_tag="KLMA_50534"
                     /db_xref="GeneID:34717133"
     mRNA            complement(<1146443..>1152034)
                     /gene="SEC7"
                     /locus_tag="KLMA_50534"
                     /product="protein transport protein SEC7"
                     /transcript_id="XM_022820537.1"
                     /db_xref="GeneID:34717133"
     CDS             complement(1146443..1152034)
                     /gene="SEC7"
                     /locus_tag="KLMA_50534"
                     /codon_start=1
                     /product="protein transport protein SEC7"
                     /protein_id="XP_022676991.1"
                     /db_xref="GeneID:34717133"
                     /translation="MPEEATESTGPVVSVEPDVQIPESPKTVAMKIDESHSENGSNRE
                     TKPPSVHNLAVNTSKTATNGHARSLSVVSNNVNNTNIKSVVLFVKSTLQEVTKAKEMK
                     KLTSCQKDIDRTLSSLDQSLESVGNATNVSIEMDSLLVFEALRSCCRSKVVDIQIKAL
                     DCLSKLFSFQALDESLLVNPPDAMASNDQNQETAGITPPPKLKLVDAVIDTICDCFEG
                     ENTDPRVELQVVRGLASCILTDEPTSSVHGASLLKAIRQIYNIFIFSLNSSNQGIAQA
                     TLTQIVSTVFDRIDIKGLNQQRSLSTISLRNGGSTNEESSTPASEHPLTLENLDTLNA
                     ETERLVDEEENTRKVDEYITDEQALTIKDAFLVFRAMAKISAKPLEDSLDMRSHAVRS
                     KLLSLHTLHSILKDHIEVFLSHNVRVPGNDQSTLVHAINQYLCLSLARNAASPIAPVY
                     EITLEIMWLIISNLRSEFKREIPVFLTDIYFPIADLKTSTNHQKRYFLSIIQRVCNDP
                     RTIIEFYLNYDCDTQMPNVVELIVNYLTNLALTRVDITSSQRAYYTESLSKPLATFTY
                     TQVPLLSISNIPSASDSSQLPFPVDYALKQTALTCMVAFLKSLSSWAHKALNAATMSS
                     VGSGQLKSLSQRADSTSFLSTNRPRSSSALSAVSNADTNSVSESTVNDETDDPQQFEN
                     AKLRKTELLNCVKLFNYKSKKGINEAIKKGFIKDDSNDAIATWLLNTDGLDLSVVGDY
                     LGEGDEKNIAIMHAFVDQFDFTGLTIVNALRQFLQKFRLPGEGQKIDRFMLKFAERYV
                     EQNPHVFSKADTAYVLSYSIIMLNTDLHSNQIKKKMTLEEFIENNAGIDNGKDLPREY
                     MEQLFDEIANNEIKILSEQHQAMVSGDASAVLPQPSSFGFFNGKDYEREAYIQVSKQI
                     SSKTELVFKNLSKNQDTVYYAASHVEHVKSIFETLWMSFLAALTPPFKEYNDIETSEL
                     CLKGITTSIKIAANFDIDYARASFVGALIQFANLQDLEEVKVKNIYAIRNLLEIAISE
                     GNYMKDSWKDILVIVSQVERLQLISKGVDRETVPDVAQARLANHRSSMDSTRSSANQS
                     FFDRWTRKATPVEIAQEKYQNQTLSPNIAKLITSSELVVLIDKIFTNSSALSGSAIID
                     FIKALTEVSLEEIDSSQNATTPRMFSLQKMVDVCYYNMDRIRLEWTPLWNVMGEAFNK
                     IGTESNLAVVFFAIDSLRQLSIRFLDIEELSGFEFQLDFLKPFEHIVENTKDIDVQEM
                     CIECFHNFILTKSGKIKSGWKPILKSLKFTAQSPNEKIVTRTYELVSQDIVKDHFYDV
                     LAIDDSFVDLVLVLKEITKNQKHQKLALHSLETLRKITGQVAELCFKDSENPILQGKD
                     EFEDIWLPLLFCFNDTIMTAVDLEVRSRALNYMFDALVANGSEFSVEFWNKICTQLLF
                     PIFGILSKHWEVNQFNSHDDMSVWLSTTLIQALRNMVALFTHYFDSLNGLLSGILGLM
                     VSCICQENDTIARIGRSCLQQLILQNMSEFTDTHWHQVTEAFGTLFQLTTANELFESD
                     PLKQGRRKSVPNTATTSASATTATAPSTNGTATGSTADTTSEAENSKAEEEMERAIAE
                     ENGQDVGNEQEGAMGSGEDIDVLPPQRLVVTKSSEALKQKVSVKNTIVVKCILQLLMI
                     ESLSELFEVEAFMNTIPFDDAIKLTKLLESSYEFARDFNDDYELRTRLVEARVSNKIP
                     NLAKQETSSAAVLINILFKLYLNRDPPESDAVAKHQALLERLVSICVTIVQRYVAMND
                     GVSERAVNNWRPVIVEIIQGYSEFDDSDYKVQCKTMYDLILQILEKPCPDDLRYAIRV
                     FLTRIRETFLEDDQSEETPVA"
     gene            <1153308..>1154609
                     /gene="URC1"
                     /locus_tag="KLMA_50535"
                     /db_xref="GeneID:34717134"
     mRNA            <1153308..>1154609
                     /gene="URC1"
                     /locus_tag="KLMA_50535"
                     /product="putative GTP cyclohydrolase URC1"
                     /transcript_id="XM_022820538.1"
                     /db_xref="GeneID:34717134"
     CDS             1153308..1154609
                     /gene="URC1"
                     /locus_tag="KLMA_50535"
                     /codon_start=1
                     /product="putative GTP cyclohydrolase URC1"
                     /protein_id="XP_022676992.1"
                     /db_xref="GeneID:34717134"
                     /translation="MISVTATGMKEVSQKIKATPVDDVLLTTYPEDSEPIPLKWGASD
                     YQERGPVVPSKFKNGVSKHNCIGAHAGPYCIYHALAIGSNQLKRDHIPDFTNSQPAFT
                     IPEQPSWFNDSDIVSMDPFGHLTPYLFDEVSKTEGVEIRPTIAITKATMQLLEMKEAV
                     EKGELKVDGQIVVNENGDLNVSKIAVEPVWYLPGVAQRFGISEETLRKCLFEDTNGMY
                     PELITRPDIKTYMPPIGGLTVYIFGDPQRISNPDKKIALRVHDECNGSDVFGSDICTC
                     RPYLMFGIQEAVKEAQNGGSGIVVYFRKEGRALGEVTKYLVYNARKRGGDTADAYFHR
                     TECIAGVRDMRFQQLMPDVLKWLGISKIDKMLSMSNMKYDAIVESGIEIVERVPIPDE
                     MIPPDSRVEIDAKINSGYFSTEKAPTIEELQSVRGRTWNDV"
     gene            <1155031..>1156089
                     /gene="ARG82"
                     /locus_tag="KLMA_50536"
                     /db_xref="GeneID:34717135"
     mRNA            <1155031..>1156089
                     /gene="ARG82"
                     /locus_tag="KLMA_50536"
                     /product="inositol polyphosphate multikinase"
                     /transcript_id="XM_022820539.1"
                     /db_xref="GeneID:34717135"
     CDS             1155031..1156089
                     /gene="ARG82"
                     /locus_tag="KLMA_50536"
                     /codon_start=1
                     /product="inositol polyphosphate multikinase"
                     /protein_id="XP_022676993.1"
                     /db_xref="GeneID:34717135"
                     /translation="MMSIQDCKKLKHQAAGHDGPLTDQDEMLLFKPSNNQEIEFYEKL
                     STRVPSNVDSNDVPFHYWTPAFLGVLREDKSQTAINDREQLNFITEKSKPITLSKLPN
                     INTEKTYLVLENLLYGYVRPNILDIKLGRILWDESASEEKRIRLKEVSRTTTSGSLGF
                     RICGMKMCQNSLINRMLDPKYYASDDDEYILVNKFYGRELTQSNVTDAFDVFFGDDKL
                     SSERRASLIDTFLKRLQLFYNTLLNEEVRMISSSLLFIYECDPSRWDILENDHELLPS
                     HLGYEDEENEDDESDEENRSDKYDTYPQKPKTLSNMALIDFAHSKFTPGSGIDDNTIE
                     GVENLISIFEKLKTKYTV"
     gene            complement(<1156147..>1158282)
                     /gene="SUP35"
                     /locus_tag="KLMA_50537"
                     /db_xref="GeneID:34717136"
     mRNA            complement(<1156147..>1158282)
                     /gene="SUP35"
                     /locus_tag="KLMA_50537"
                     /product="eukaryotic peptide chain release factor
                     GTP-binding subunit"
                     /transcript_id="XM_022820541.1"
                     /db_xref="GeneID:34717136"
     CDS             complement(1156147..1158282)
                     /gene="SUP35"
                     /locus_tag="KLMA_50537"
                     /codon_start=1
                     /product="eukaryotic peptide chain release factor
                     GTP-binding subunit"
                     /protein_id="XP_022676994.1"
                     /db_xref="GeneID:34717136"
                     /translation="MSDQANQGQGQGQGQSQGQGYNQYNQYGQYNQYYNQQGYQGYNA
                     QQPQGYQAYQGYNAQQPQGYQAYQGYNAQQPQGYNAYQGYNPQQQGGYNPNYNKNYNN
                     RNNKQGYQNYQGYNAQQPQGYSAAAPAASQGMTLKDFQNQQSSSNTAAKPKPKLKLAS
                     SSGIKLVGAKKPVATKSEEPKEETKSSEVKEEKKEDAKVDAENEEKIDAKIADLKISE
                     KEEVKPKEDAKPKENEAPASSETSKDQSANTKTDSAAGVSSADVLIKEQEDEVDEEVV
                     KDMFGGKDHVSIIFMGHVDAGKSTMGGNLLYLTGSVDKRTVEKYEREAKDAGRQGWYL
                     SWVMDTNKEERNDGKTIEVGRAYFETEKRRYTILDAPGHKMYVSEMIGGASQADIGIL
                     VISARKGEYETGFEKGGQTREHALLAKTQGVNKMIVVINKMDDPTVGWDKERYDQCVN
                     NLTNFLKAVGYNVKEDVVFMPVSGYTGAGLKDRVDPKDCPWYTGPSLLEYLDNMKTTD
                     RRINAPFMLPIASKMKDMGTVVEGKIESGHIRKGNQTLLMPNKVNVEILTIYNETENE
                     VDMAVCGEQVRLRIKGVEEEDISAGFVLTSPKNPVKNVTRFVAQIAIVELKSIMSAGF
                     SCVMHIHTAIEEVVITRLLHKLERGTNRKSKKPPAFAKKGMKIIAVIETQEPVCVETY
                     DDYPQLGRFTLRDQGTTIAIGKIVKILDN"
     gene            1160829..1160900
                     /locus_tag="KLMA_R530"
                     /db_xref="GeneID:34718753"
     tRNA            1160829..1160900
                     /locus_tag="KLMA_R530"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:34718753"
     gene            complement(1163177..1164858)
                     /locus_tag="KLMA_R531"
                     /db_xref="GeneID:34718754"
     rRNA            complement(1163177..1164858)
                     /locus_tag="KLMA_R531"
                     /product="26S ribosomal RNA"
                     /transcript_id="XR_002675590.1"
                     /db_xref="GeneID:34718754"
     gene            complement(1165343..1165500)
                     /locus_tag="KLMA_R532"
                     /db_xref="GeneID:34718755"
     rRNA            complement(1165343..1165500)
                     /locus_tag="KLMA_R532"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_002675591.1"
                     /db_xref="GeneID:34718755"
     gene            complement(1165731..1167524)
                     /locus_tag="KLMA_R533"
                     /db_xref="GeneID:34718756"
     rRNA            complement(1165731..1167524)
                     /locus_tag="KLMA_R533"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_002675592.1"
                     /db_xref="GeneID:34718756"
     gene            complement(<1167672..>1168001)
                     /locus_tag="KLMA_50541"
                     /db_xref="GeneID:34717137"
     mRNA            complement(<1167672..>1168001)
                     /locus_tag="KLMA_50541"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022820542.1"
                     /db_xref="GeneID:34717137"
     CDS             complement(1167672..1168001)
                     /locus_tag="KLMA_50541"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022676995.1"
                     /db_xref="GeneID:34717137"
                     /translation="MGVCGIERCYKTPEQSRHGHLAIPLASSGGFGGLLANGNPNQRN
                     HTWGNASQNSRMTYVICDSVSVTSSLADDIERSVSAKHRSSVQWNSVRGNSKSAMAWR
                     GCDDLMA"
     gene            complement(1171919..1173600)
                     /locus_tag="KLMA_R534"
                     /db_xref="GeneID:34718757"
     rRNA            complement(1171919..1173600)
                     /locus_tag="KLMA_R534"
                     /product="26S ribosomal RNA"
                     /transcript_id="XR_002675593.1"
                     /db_xref="GeneID:34718757"
     gene            complement(1174085..1174242)
                     /locus_tag="KLMA_R535"
                     /db_xref="GeneID:34718758"
     rRNA            complement(1174085..1174242)
                     /locus_tag="KLMA_R535"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_002675594.1"
                     /db_xref="GeneID:34718758"
     gene            complement(1174473..1176266)
                     /locus_tag="KLMA_R536"
                     /db_xref="GeneID:34718759"
     rRNA            complement(1174473..1176266)
                     /locus_tag="KLMA_R536"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_002675595.1"
                     /db_xref="GeneID:34718759"
     gene            complement(<1176414..>1176743)
                     /locus_tag="KLMA_50545"
                     /db_xref="GeneID:34717138"
     mRNA            complement(<1176414..>1176743)
                     /locus_tag="KLMA_50545"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022820543.1"
                     /db_xref="GeneID:34717138"
     CDS             complement(1176414..1176743)
                     /locus_tag="KLMA_50545"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022676996.1"
                     /db_xref="GeneID:34717138"
                     /translation="MGVCGIERCYKTPEQSRHGHLAIPLASSGGFGGLLANGNPNQRN
                     HTWGNASQNSRMTYVICDSVSVTSSLADDIERSVSAKHRSSVQWNSVRGNSKSAMAWR
                     GCDDLMA"
     gene            <1178938..>1179856
                     /gene="HMO1"
                     /locus_tag="KLMA_50546"
                     /db_xref="GeneID:34717139"
     mRNA            join(<1178938..1178979,1179161..>1179856)
                     /gene="HMO1"
                     /locus_tag="KLMA_50546"
                     /product="high mobility group protein 1"
                     /transcript_id="XM_022820544.1"
                     /db_xref="GeneID:34717139"
     CDS             join(1178938..1178979,1179161..1179856)
                     /gene="HMO1"
                     /locus_tag="KLMA_50546"
                     /codon_start=1
                     /product="high mobility group protein 1"
                     /protein_id="XP_022676997.1"
                     /db_xref="GeneID:34717139"
                     /translation="MSEPSIKLRTAKDSLVSSLFELSKAANQTASCLVDFYHSIGDDE
                     DERLEAFTILTEALQKLTSSTNQLNSISTELTHSAEDEKDIPVAEAPAKLVKKKIPRD
                     PNAPKKPLTVFFAYSAYVRQALRDERQRAGLPPLSSTEITQEISKKWKDLGESEKDKW
                     KQAYNAELENYQREKQKYLEAKKNGTLTLNEGPNSAPVPIPEYLQSPEDFGISQIEKR
                     PYEEEIVSEKKKKKKKKDKKKDKSNKD"
     gene            complement(<1180376..>1181284)
                     /gene="RSM24"
                     /locus_tag="KLMA_50547"
                     /db_xref="GeneID:34717140"
     mRNA            complement(<1180376..>1181284)
                     /gene="RSM24"
                     /locus_tag="KLMA_50547"
                     /product="37S ribosomal protein S24"
                     /transcript_id="XM_022820545.1"
                     /db_xref="GeneID:34717140"
     CDS             complement(1180376..1181284)
                     /gene="RSM24"
                     /locus_tag="KLMA_50547"
                     /codon_start=1
                     /product="37S ribosomal protein S24"
                     /protein_id="XP_022676998.1"
                     /db_xref="GeneID:34717140"
                     /translation="MYGRTAQYSVFALSKRFNSTVVNKATTISPTLYKEPSKWVGLEN
                     SEIIRLHNERKARLGPLYKPCEEEMNVLLPTAEEQGIPAKVFKEYYYKSSEEVERELG
                     IAKGLDENVNMEPYNFDELPSQSQILVHQHREQRFYNRLAAYELPLLAKYRQEYKRPS
                     FKTHPVTYRYTTYLGEEHPNARKVVLSVKTADLGLNDKELHKLRLLAKTRYDPTTDIF
                     KMSSDRYETSAQNANYLNSIFQRLLKEAKDTTDDFSDVPLDNRHIIARQMRKKKRGYK
                     FPEQWKRPQDAPKKTIDLIDILHKQI"
     gene            <1181622..>1183550
                     /gene="NGG1"
                     /locus_tag="KLMA_50548"
                     /db_xref="GeneID:34717141"
     mRNA            <1181622..>1183550
                     /gene="NGG1"
                     /locus_tag="KLMA_50548"
                     /product="chromatin-remodeling complexes subunit NGG1"
                     /transcript_id="XM_022820546.1"
                     /db_xref="GeneID:34717141"
     CDS             1181622..1183550
                     /gene="NGG1"
                     /locus_tag="KLMA_50548"
                     /codon_start=1
                     /product="chromatin-remodeling complexes subunit NGG1"
                     /protein_id="XP_022676999.1"
                     /db_xref="GeneID:34717141"
                     /translation="MSRNTRRGKGVREQKRDEAVLHEPSNILNSMLKSLDLTFENDIG
                     LLNGKYVRSLPEKPILQTTKSQLESLGKCLEKIASNDQESINLIRQVREEIIRNEEEK
                     QRELEKAEKSLKLEAEASETNPNSSTQESDQAIPGKRLIKEEENAKKGNTEGSDDDPS
                     HFENNEGDESTQLFKKPRLDRDQIENDPSVKNPKSEFVVSQTLPAAAMKLGLFHEDKL
                     EATGEEYLKKKYGVVSYPTNDLKELLPGEIPDMDFSKPKPSNQIQFNTFLSSIDAFYR
                     EFTDDDIKFLQNKFIVPQSLQYVKSYDLDVTPYTIPKLGPLYTDVWLKEDNNQNIANL
                     TPPPVNDPTSILPKKSGKELTDSALDTEDISCGPLVSRLLSAILKDDDTIAPKEELQA
                     VSSLESSVSTPVSENDHMTPSSASSYGIFKKYGGISNTSNIDYVSFEERLKRELKYVG
                     IYMNLPKEEGKSKEDPDWLTGREDDEISAELRELQSTLRQVTTRNIKRKAALIPLLEK
                     QLAWQEYLTILENLDKQVDQAYIKRIRAPKNKKKKQHTPGPESLVSGSTSQAAIQAAH
                     QQAANSSLKSLLDKRQRWINKIGPLFDKPEVMKRIPKESVFKDIDQDEEEEEADVFSN
                     NINGKDEELNESIQSKEE"
     gene            complement(<1183732..>1185138)
                     /gene="MAS1"
                     /locus_tag="KLMA_50549"
                     /db_xref="GeneID:34717142"
     mRNA            complement(<1183732..>1185138)
                     /gene="MAS1"
                     /locus_tag="KLMA_50549"
                     /product="mitochondrial-processing peptidase subunit beta"
                     /transcript_id="XM_022820547.1"
                     /db_xref="GeneID:34717142"
     CDS             complement(1183732..1185138)
                     /gene="MAS1"
                     /locus_tag="KLMA_50549"
                     /codon_start=1
                     /product="mitochondrial-processing peptidase subunit beta"
                     /protein_id="XP_022677000.1"
                     /db_xref="GeneID:34717142"
                     /translation="MFRAIASSHRNSFLRKIPKVSYSTVSGNLSKTVTSILPNGLTVA
                     SETLPNTNTATVGIFVDTGSRAENEKNNGTAHFLEHLAFKGTKNRSQTGIELEIENVG
                     SHLNAYTSRENTVYYAKSLEQDIPKAVDILADILTRSVLDPKAIERERDVIIRESEEV
                     DKMYDEVVFDHLHTITYKDQPLGRTILGPIKNIKSIQRTDLQEFIETHYTGDRMVLVG
                     TGAVNHDKLVEYAGKYFGHVRKSETPVPLGSPRGPLPVFHGNELKIKEETLPTTHIAL
                     AVEGVSWSAPDYFTALCTQAIIGNWDRALGTGTNSPSPLAVAASENGTLANSYMSFST
                     SYADSGLWGMYIVTDSQQHNVKRIIDEILKEWKRIKAGNISEEEVNRAKARLKASLLL
                     SLDGTTAIAEDIGRQIVTTGRRLSPEEVFEQVNKITKNDIVMWANYRLLNKPVSMVAL
                     GNVTTVPSLSYVQNNMNN"
     gene            <1185922..>1186416
                     /gene="SDH4"
                     /locus_tag="KLMA_50550"
                     /db_xref="GeneID:34717143"
     mRNA            <1185922..>1186416
                     /gene="SDH4"
                     /locus_tag="KLMA_50550"
                     /product="succinate dehydrogenase [ubiquinone] cytochrome
                     b small subunit"
                     /transcript_id="XM_022820548.1"
                     /db_xref="GeneID:34717143"
     CDS             1185922..1186416
                     /gene="SDH4"
                     /locus_tag="KLMA_50550"
                     /codon_start=1
                     /product="succinate dehydrogenase [ubiquinone] cytochrome
                     b small subunit"
                     /protein_id="XP_022677001.1"
                     /db_xref="GeneID:34717143"
                     /translation="MLCRTIKLTQTRAFQTTAKKNLTIPFLSTLPQAPGGVTGQVNEA
                     YVAPPPEKLHGSLHWNFERALAISLVPLVTVPLATTGSISTALDATLASVLLAHCYVG
                     LQSCIIDYIPARVYGKNHNYAMYLLGIGSVFSAVGIYQIETKEGGIMGVVKNLWTKPA
                     EEKK"
     gene            complement(<1186868..>1187341)
                     /gene="CSN9"
                     /locus_tag="KLMA_50551"
                     /db_xref="GeneID:34717144"
     mRNA            complement(<1186868..>1187341)
                     /gene="CSN9"
                     /locus_tag="KLMA_50551"
                     /product="COP9 signalosome complex subunit 9"
                     /transcript_id="XM_022820549.1"
                     /db_xref="GeneID:34717144"
     CDS             complement(1186868..1187341)
                     /gene="CSN9"
                     /locus_tag="KLMA_50551"
                     /codon_start=1
                     /product="COP9 signalosome complex subunit 9"
                     /protein_id="XP_022677002.1"
                     /db_xref="GeneID:34717144"
                     /translation="MNSQVKDLIEDPSVINYKEWWLLSEDEEESILLAIFSFYDIGDV
                     PSDYLNRMNSSQVNKLQLLSLISLCETSSEITYDDVKRKCNVTSDDSVENLLIRAEQF
                     IDLKIDSVKRNITINKHKASRDIYCGEPNIPFHSPSRSKAHLLSMLKKWRDDISE"
     gene            <1187641..>1188948
                     /locus_tag="KLMA_50552"
                     /db_xref="GeneID:34717145"
     mRNA            <1187641..>1188948
                     /locus_tag="KLMA_50552"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820550.1"
                     /db_xref="GeneID:34717145"
     CDS             1187641..1188948
                     /locus_tag="KLMA_50552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677003.1"
                     /db_xref="GeneID:34717145"
                     /translation="MPTILYSSNSKHLSRFQRKAKLSSSSLDVRINRNDSPFLSDKKM
                     DSKEYLIDLCSSIYPKSVHSEVARYSETKLAIHAIVALICKNFICSWYGEKIATKDTE
                     LVSNIHQFFDDIIDNASKTTVDWEQIILDDLPMLIETHIVIMRKVINEKLCLEDFYQL
                     HLYKHTYPYSLTAAIIQNFDNGSKLQSAFMQDFVGDFLLDKLVEKLAEPFIVVDLIRS
                     ICNSIETRKEEKSNTSQTNNWFQKIYHLFANFQIHGNKVTKKEEKFLPSLPITNNFFD
                     HYIFGALSRCLQLESRKPLLFLSLKVLQVFSNNVEFINSRFTHIFHSKTSSIVSRKGW
                     MSALWLKMRHLLFPHDNKLGPPKEVPTVEEFEQMKKDASLGLQRVARLINANMILGIT
                     DVECDSFIAALTYDKNMNKFMLQRLIDYLVTSLPVVSTSSNTP"
     gene            complement(<1188875..>1189801)
                     /gene="PUS5"
                     /locus_tag="KLMA_50553"
                     /db_xref="GeneID:34717146"
     mRNA            complement(<1188875..>1189801)
                     /gene="PUS5"
                     /locus_tag="KLMA_50553"
                     /product="pseudouridylate synthase PUS5"
                     /transcript_id="XM_022820552.1"
                     /db_xref="GeneID:34717146"
     CDS             complement(1188875..1189801)
                     /gene="PUS5"
                     /locus_tag="KLMA_50553"
                     /codon_start=1
                     /product="pseudouridylate synthase PUS5"
                     /protein_id="XP_022677004.1"
                     /db_xref="GeneID:34717146"
                     /translation="MVTCVARKVNSLRKAHTPVEILKVVTPGLLKTPIKEFEIKIPQK
                     VEVIHSSKHYIVVNKPPFVLSQQPDKKSWYKNHNYSPPIIVNLLPKVLESENAKDIHY
                     KLPVRYYTVQRLDSCVTGGIVLATDKYAAKMFSRNLREGGNAGFPLSRKYVAKVPHLT
                     NNERFHHGLFKLDGAISYLRRVDENHFIVQLITGKKHQVRKLFKEALDKPIYNDYKYG
                     GDMILNKGLQITLHCGYIKTQVGMQLQEHIIPIPEGFRLIWGESIDGNGIFGQNIIDM
                     LRQDWSSEIKVCLKKLKQQEEKSPNNRLIVVT"
     gene            <1190198..>1194619
                     /gene="SCC2"
                     /locus_tag="KLMA_50554"
                     /db_xref="GeneID:34717147"
     mRNA            <1190198..>1194619
                     /gene="SCC2"
                     /locus_tag="KLMA_50554"
                     /product="sister chromatid cohesion protein 2"
                     /transcript_id="XM_022820553.1"
                     /db_xref="GeneID:34717147"
     CDS             1190198..1194619
                     /gene="SCC2"
                     /locus_tag="KLMA_50554"
                     /codon_start=1
                     /product="sister chromatid cohesion protein 2"
                     /protein_id="XP_022677005.1"
                     /db_xref="GeneID:34717147"
                     /translation="MAKGYPGEGINSIPKRISETLKVQPLNNLIPKSGLSQLLNSSVT
                     QDLCIDYRAAFENPTSEYWSYPHPIDFDPLNESDRDPIIFKRPPNIPISSKSQDTDAE
                     DLKFLKRVPQLGIRCLTLTHLVDSKHIVSQVSEDKPSSSRKRSADITEGDISLTDTSH
                     KRTQISVQSNPMNDIETGSRYLEHLSTQLSDLGIGKEKYTHENSKLWVRIQENHLLTR
                     EAIERISITINKIHDYPMVYEDVDISSLKKLLNLCTQNIRTIMNIQTEIEEDEATDIH
                     DLKSLAFKSGFLIIEIMMIDLKKANLQLEEYYSAVFSVADSVMESFYEEKNLKNLNLY
                     VVDILNFIRLLERFISSQTYLDETFLIKSACISCGLLIHKSYQYLNTNVLMVQTDLIK
                     ECSLTILVSLFSRYPSQRQFILEELLSHVQDTPITKSSKKMKLIDDQQNKYASFFTVA
                     LVMMLQSVSLPPFPQIMESPSYEDLDTLVSENKSSYLELMEIVDKVTFFLLENALTNT
                     TRFRPIIELYAQDLLNMLRNPLWSFSHYLLETLLSKLFQIFNPTNPNGANFEVTALQI
                     VGHITASLSDVKMDLASINHQSNKKQILSDYVFCLDWLKMYEKSPYVYNVFWNEAIHF
                     ISTSMKSEEGTDENSLRQQYLWFVERTRNSTLVNSNKDHNPNQLHLNYTKILAESGLL
                     LLFEPAVKLILSLLDQQKVKLKSVAVKCLSQLISRDRQMLETPFVKDTIKVRLSDSSA
                     SVRDAILDLLEQSSFYVQFYKEINCHFDDDSVAVRKHVMRMNERIFDLANNNKVKTFV
                     MEKLLRRIEDEEDHIVENARNIVLEKLLMKHRDSNLGSNIQNENLSQTLDIMSRIVVN
                     GGKCAELLEFFFHFFVLNQTAHDQIAFQEIVDTIRILIDKLVDEITDNAARKEETTDI
                     EDKQHLELLLFFANCPGSFVTKNHLHSLFPYLLSNSKGRCFLVLLKVFKACMKKLNNF
                     KSKFLTELEKTLLSKLSKLNTKEIEEAIAICWEIATKTKDETRLLTVCTSCVDQLRPY
                     VLQAINSSKSLELDGKVQRLIYLSTGFARMCHFKKDEQRLKFLKGEEYLYQYVTKCLL
                     AFTNLELKAPLRKIAIKNLVKLACSFPKLFNSPPVLKVIDQEFNSGQVDIKLSIIECL
                     QEFFSREEKKALMRVGVNGTISSNSELRKLIKKQNTTEWINDGVCSALVTRYLENVMD
                     LCLLTDIKSATIPIKFLELTLNFNYMNPSHAVPTLIALTCSDSSSIKNLSTRLLSNIF
                     EQYESMVFNGLAAGFKRCVSYLKSLKSNNLSLHSTCMSDLQNMLSNSKKNSKKFLSTV
                     KKLTVTECFNTSSRDNNEMIFFLGNVSLIDFGDQYELYELLHSISLALDEIDEVIQDI
                     LCVRKDDEKNRKAFFFIKRRKIMSTFKEQMIITYNLSSEKLSYIGTPDETGLKGKPLS
                     VTSESYVILENIYPHDLTDEEINQECIAYQKEYDSIY"
     gene            complement(<1194692..>1195771)
                     /gene="SAS4"
                     /locus_tag="KLMA_50555"
                     /db_xref="GeneID:34717148"
     mRNA            complement(<1194692..>1195771)
                     /gene="SAS4"
                     /locus_tag="KLMA_50555"
                     /product="something about silencing protein 4"
                     /transcript_id="XM_022820554.1"
                     /db_xref="GeneID:34717148"
     CDS             complement(1194692..1195771)
                     /gene="SAS4"
                     /locus_tag="KLMA_50555"
                     /codon_start=1
                     /product="something about silencing protein 4"
                     /protein_id="XP_022677006.1"
                     /db_xref="GeneID:34717148"
                     /translation="MKRKSRSRSSSEEVKEDEKFNFDVLEYEIDPNKRFVLSVSRVKD
                     SGGGVEYSSNNGINNDYKNANVDADIDNVKRKRKEISNMILPIEHHQIGVNKDSNMRR
                     RQKQKPNFTTDELVDPLTEQVYSIYHKKMMKQETRMMNDEANYSELEADRLEGILDSL
                     EISSWRSILPKITVINNVTDEVELLHKRELTQQAIRSMLDKYKDMKHRISLHQRKQRH
                     IMIDPHKQLDKLYSNVDKSLIIGYHSSSDEEENDLDVYQIRTRRKMMKHRIFAPTLIV
                     PLSVPLAPTNFQYGIVADPLKSPFIVKFTKEERLKYLNKDKDFKERYRSIENFPNQEM
                     RFVSKSRAVCELGSNSKCQKKFIHD"
     gene            <1196300..>1197745
                     /gene="CDC1"
                     /locus_tag="KLMA_50556"
                     /db_xref="GeneID:34717149"
     mRNA            <1196300..>1197745
                     /gene="CDC1"
                     /locus_tag="KLMA_50556"
                     /product="cell division control protein 1"
                     /transcript_id="XM_022820555.1"
                     /db_xref="GeneID:34717149"
     CDS             1196300..1197745
                     /gene="CDC1"
                     /locus_tag="KLMA_50556"
                     /codon_start=1
                     /product="cell division control protein 1"
                     /protein_id="XP_022677007.1"
                     /db_xref="GeneID:34717149"
                     /translation="MHSRKAENASLGSKHQDVEEKNKHFKFKKRSLPSKLDIYWRYLF
                     MILVLWLLLIQYYERTVVKRAMKKCEWDKWEDWSKSSSTSSAHRVGLFADPQIMDAYS
                     YPSRPALVNWFTSQILDNYHARNWKFFHYYLKPDTVFFLGDLFDGGRNWETHEWMAEY
                     ERFNSIFPKKPGHLTVTSLPGNHDIGFGNTIIESSLKRFTAFFGDPNSQWTVGNHTFV
                     LLDTISLSDRQNVNISSVPREFMQNFAASSPKYPRILLTHVPLYRDPNQQQCGDRRES
                     KEPFPLMVGLQYQTVIDSDLSQEVLSTIQPKMVFSGDDHDFCHIKHSYTVNHTPKVAE
                     EITVKSCAMNMGISKPAIQLISLYNPENDGKSPTFKTTICYLPNPFKPLICYGISLAL
                     SAAFIFWMTIFPMSFNDVIVRRIPVKDLDTSSLLPIATKGRNFLNLESLRIKASRWKV
                     SQERSVPNFVLNMGVLLSSLFFMFAMFYKGK"
     gene            complement(<1197764..>1200217)
                     /gene="SEC10"
                     /locus_tag="KLMA_50557"
                     /db_xref="GeneID:34717150"
     mRNA            complement(<1197764..>1200217)
                     /gene="SEC10"
                     /locus_tag="KLMA_50557"
                     /product="exocyst complex component SEC10"
                     /transcript_id="XM_022820556.1"
                     /db_xref="GeneID:34717150"
     CDS             complement(1197764..1200217)
                     /gene="SEC10"
                     /locus_tag="KLMA_50557"
                     /codon_start=1
                     /product="exocyst complex component SEC10"
                     /protein_id="XP_022677008.1"
                     /db_xref="GeneID:34717150"
                     /translation="MNAIYELDSKWKKLLTSDNFLCGLTVNEFVTELSKDQAAKQNIS
                     TTQESLEISSRHLDAKPFIRTFESVLKELKKLQKETISKNDQLTHQVSTMEVQHAKSI
                     LKSRDDMKGIVHKYDQLDRKLSSVTQVVSPLGNKLEKSIKKRNAYIKSVELISYYASY
                     LENGECQELNNLLTSTDTKKCAQGALILKSLLILTRRLDTKSVPKTLEVTQKIEQIAS
                     EFEESILHGFNEAYRENDFARLHQLAWILDVFNNGINIIKNFTDKHAFFEESSGFTAK
                     ESALFTDNNFKARLMDPDSHVLKYDDKVVNYINSVFEVIKDESEVVAKVFGNKASNVM
                     CLFIQKVFQEKFQPLVQFILNSSLSLSPLAYLRSLHTYFSIINTCVKQQSENLMAVNM
                     EGYDKVSACLEKCFKNMFNDVLFDRSKYFEVEKRNLEVVLIQKASEFNVLFNAEIRQR
                     ALSNKLNEVSDFMTSPELKILTSRSSSRFSQLNLFIKNKFEKRPEHDNTLRTSTSLKK
                     KNNNYFTLSYIDLMLKCSVESLARVTDLVPTIASEFSYELVEISLVGLIDSYIESALE
                     VAYSQLISHEVYREINIDLSFLKYISTATEMISIVSAYIKSIVLPLLQSSPAMKQKVV
                     TLSNAYFRKCELLMNLLIVETAGMLNQKFTQVLGKQKRKDFLSKSQDFLDQDTETTTE
                     LVTVLSNIYSQSSLYLKNGNLHSFLAKTGDNLFYQLLNHYKKFQVSSTGGVIVTKDII
                     AYQTVVEEWGIDDLNEKFATLRELSNLFTVQPELLTSLTKEGRLANVDRSIIDEYISK
                     REDYNQDSFINKFKASLRN"
     gene            <1200518..>1201174
                     /gene="PLP1"
                     /locus_tag="KLMA_50558"
                     /db_xref="GeneID:34717151"
     mRNA            <1200518..>1201174
                     /gene="PLP1"
                     /locus_tag="KLMA_50558"
                     /product="phosducin-like protein 1"
                     /transcript_id="XM_022820557.1"
                     /db_xref="GeneID:34717151"
     CDS             1200518..1201174
                     /gene="PLP1"
                     /locus_tag="KLMA_50558"
                     /codon_start=1
                     /product="phosducin-like protein 1"
                     /protein_id="XP_022677009.1"
                     /db_xref="GeneID:34717151"
                     /translation="MDKVHGKGGTTSEEEDIDDLIKQLDDEEDEYLAKYRDHRLEELS
                     EQMKKVKKNVESGNYGTVNTFHDEQQLISASSSAERCVVHFFIDSFKKCQLMDSKLLS
                     VAESNLTTRFFRISVEECPFLVEKLSLKVLPVVIAYKNGIEQDRLIGFSKLGDNPDDF
                     SIQQLERWLIQSGVVPKKDAKLLLLSKHNEQVVKSAKRDVSNRHFEVGKDDDSDDYWD
                     "
     gene            <1201655..>1202110
                     /gene="ubi3"
                     /locus_tag="KLMA_50559"
                     /db_xref="GeneID:34717152"
     mRNA            <1201655..>1202110
                     /gene="ubi3"
                     /locus_tag="KLMA_50559"
                     /product="ubiquitin-40S ribosomal protein S27a"
                     /transcript_id="XM_022820558.1"
                     /db_xref="GeneID:34717152"
     CDS             1201655..1202110
                     /gene="ubi3"
                     /locus_tag="KLMA_50559"
                     /codon_start=1
                     /product="ubiquitin-40S ribosomal protein S27a"
                     /protein_id="XP_022677010.1"
                     /db_xref="GeneID:34717152"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKHKKVKLAV
                     LNYYKVDDEGKVTKLRKECPNCGAGIFLANHGGSRLYCGKCHSTFATQK"
     gene            complement(<1202528..>1203379)
                     /gene="ATC1"
                     /locus_tag="KLMA_50561"
                     /db_xref="GeneID:34717153"
     mRNA            complement(<1202528..>1203379)
                     /gene="ATC1"
                     /locus_tag="KLMA_50561"
                     /product="protein ATC1/LIC4"
                     /transcript_id="XM_022820559.1"
                     /db_xref="GeneID:34717153"
     CDS             complement(1202528..1203379)
                     /gene="ATC1"
                     /locus_tag="KLMA_50561"
                     /codon_start=1
                     /product="protein ATC1/LIC4"
                     /protein_id="XP_022677011.1"
                     /db_xref="GeneID:34717153"
                     /translation="MYQSMDLDNVRIHSEIVDENGGFDKAEADNTFALELQKIIQQET
                     GQSKDPNHDVLAEALATVDVDLPDVSNMSSPGLVYATEKRTEAPITDNKNSDLTVEHI
                     LGDLQVGNEEDDVFTKKLNSLLCDTNDMKRRYEEDTEHQRSSNKKQKSVYETLSPPES
                     VSPLSDKSETQQGKESNTEKDYLLLRRKVASPKFLKQAPLPPPLTNEFTMRQVSEMKK
                     RIINTHKLILNFNFLKDGYARTCEELSKTVIKLKDSEFDRARLVKENQDLKKLVLQLS
                     KQLAEGK"
     gene            complement(<1204189..>1204887)
                     /gene="UPS2"
                     /locus_tag="KLMA_50562"
                     /db_xref="GeneID:34717154"
     mRNA            complement(<1204189..>1204887)
                     /gene="UPS2"
                     /locus_tag="KLMA_50562"
                     /product="protein MSF1"
                     /transcript_id="XM_022820560.1"
                     /db_xref="GeneID:34717154"
     CDS             complement(1204189..1204887)
                     /gene="UPS2"
                     /locus_tag="KLMA_50562"
                     /codon_start=1
                     /product="protein MSF1"
                     /protein_id="XP_022677012.1"
                     /db_xref="GeneID:34717154"
                     /translation="MRLFENQHVFDYSWEYITAANWKKYPNEVSTHVIAVDVLRRELD
                     SSGKILTSERLITCKQSVPKWVMMLVGGSNVSYIREVSVVNLDKKSLTLRSCNLTGSN
                     LLKVYETVSYVPHPEDPQRRTLFKQEAQITAYATFTKLCNKIEEWSVNRFHENAEKGK
                     KGFDSVLQLLDESWKQTDKIMDDLVEKVDETVVDIKKTTDIIMKETEKKSSLLATYYG
                     YFSEAFKTPTDLNE"
     gene            complement(<1205578..>1206657)
                     /gene="ERF2"
                     /locus_tag="KLMA_50563"
                     /db_xref="GeneID:34717155"
     mRNA            complement(<1205578..>1206657)
                     /gene="ERF2"
                     /locus_tag="KLMA_50563"
                     /product="palmitoyltransferase ERF2"
                     /transcript_id="XM_022820561.1"
                     /db_xref="GeneID:34717155"
     CDS             complement(1205578..1206657)
                     /gene="ERF2"
                     /locus_tag="KLMA_50563"
                     /codon_start=1
                     /product="palmitoyltransferase ERF2"
                     /protein_id="XP_022677013.1"
                     /db_xref="GeneID:34717155"
                     /translation="MSDFIMKDTDQQMSDKCINENTAWQHKLLNSANKFLHWVITLDT
                     YDGSEKIYTHMTETSNYVFFFGGTLRTVTKSRLYSVFVFCSLIVPLALFSIFECRHLW
                     YHSHGLHLRTLIIVFYYFNLLTASSFFRAACSDPGVVSRNVHMPGMAIAYQIPREYYN
                     HVILPSENQSAVITMKYCQTCRIWRPPRSSHCPVCDVCVLTHDHHCIWLGNCIGQRNY
                     RFFIAFLISSIIACLLQVALSAIRLSNVTHPSKAPVSILLICYCGLGVQYPLILFLYH
                     IFLTGTQQTTHEYLRSIGSKNPIFHKITRDRNSPYDRGSFFKNLIHLMFQERGWILVD
                     PTKRQRYPRDVRFQRIPEAHTMENI"
     gene            complement(<1207128..>1209194)
                     /locus_tag="KLMA_50564"
                     /db_xref="GeneID:34717156"
     mRNA            complement(<1207128..>1209194)
                     /locus_tag="KLMA_50564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820563.1"
                     /db_xref="GeneID:34717156"
     CDS             complement(1207128..1209194)
                     /locus_tag="KLMA_50564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677014.1"
                     /db_xref="GeneID:34717156"
                     /translation="MDSSTNISSHLWNHRVHEPSKVRVQNVDSLYLISYCDRLTPIMG
                     NYNVYLYIDIPTIDYYNDELKDNRLYRINKKFKLHRLREKILKSIVGENDELWTLSKQ
                     LAGDFDFHLEISSSGSLRYVETVKFLIETVWQQLKETLGDRCHINYKIKVTPTSLKWF
                     TTFLSKDMLRSCVIHFDQIDNYNMISESTTPFKDYYRRLNDKFTHKVSPMNCDCIIVV
                     TNNTGVKALLTILSDKPLTAYLSEESLETLNNTSLKNKRSLASPNNVTPTDSEDETPL
                     TRNSSSILSFQNTILTSNKDKSVRVRSLSINRSSNRATKFQSSEAGGIFSESDKATDD
                     EDEVDEGDDDDYDDDEDEDDDEDDDGLSFYAPSKLSSYTSDNEAQLQDAARIGGGRVR
                     SISLIDSTLEAPFSNTKRNEPLSLEKMEDEMCSPTENSLQSGRYTNIYVHDGQFNEDG
                     ANNPTSQQKKKIGNSSSSGNISQGLIPPVFYSRLSSPSTSNNSSSSSLNNLSLLPGTF
                     SKLLAPKVEPQGQASADNTGASLFGKDLINKSFEEVRRKPTLLKYDPISDKFGLALSF
                     NPNRKIPALEADEEDMLMSGPPASQEDETVTGVSDAESSNTLLSSRNQILKDLGSVSQ
                     DKIYTHPLDKSSSEFQKREHGSKEPSNTKENKSTPYTKPKFTLDLYGDDDINNSGGWL
                     LGGNAR"
     gene            <1210089..>1210535
                     /gene="CDD1"
                     /locus_tag="KLMA_50565"
                     /db_xref="GeneID:34717157"
     mRNA            <1210089..>1210535
                     /gene="CDD1"
                     /locus_tag="KLMA_50565"
                     /product="cytidine deaminase"
                     /transcript_id="XM_022820564.1"
                     /db_xref="GeneID:34717157"
     CDS             1210089..1210535
                     /gene="CDD1"
                     /locus_tag="KLMA_50565"
                     /codon_start=1
                     /product="cytidine deaminase"
                     /protein_id="XP_022677015.1"
                     /db_xref="GeneID:34717157"
                     /translation="MGQFDSVLGEDPAILINKVIIESQGAKETSYSPYSKFRVGCCIL
                     TEDGTYITGSNVENATYGATVCAERTAIVKAVTSGHKNDWVCIAINSDIGNSCTPPCG
                     ICRQMIREFAKQDLPIIMTNGDASIKKVMTLQQLLPESFGPDHFNS"
     gene            <1210903..>1212018
                     /gene="MAP1"
                     /locus_tag="KLMA_50566"
                     /db_xref="GeneID:34717158"
     mRNA            <1210903..>1212018
                     /gene="MAP1"
                     /locus_tag="KLMA_50566"
                     /product="methionine aminopeptidase 1"
                     /transcript_id="XM_022820565.1"
                     /db_xref="GeneID:34717158"
     CDS             1210903..1212018
                     /gene="MAP1"
                     /locus_tag="KLMA_50566"
                     /codon_start=1
                     /product="methionine aminopeptidase 1"
                     /protein_id="XP_022677016.1"
                     /db_xref="GeneID:34717158"
                     /translation="MSTVRCASLQCGKITDSSLKCPICLKQGIESVFCNESCYKDGYK
                     QHKAIHYAKEGDSSAYDPFPKFKYAGDLRAQYPLSPKRVVPEDIVRPDWAENGLPITE
                     QKNYRTSKISVYNKEQIKRIRKACTLGREVLDAGAAHIKPGITTDELDEIIHNEIIKR
                     GAYPSPLNYYNFPKSVCTSVNEVICHGVPDKYVLKEGDIVNLDVSLYYQGMHADLNET
                     YYVGENIRKEVVNTVETARECLKLAIKLCKPGTTFQSLGDAIEKHATNNKCSVVKTYC
                     GHGVGEYFHCPPDIPHYANNRTPGVMKPGMVFTIEPMINEGVFQDVTWPDDWTSSTKD
                     GKVSAQFEHTLLVTENGVDILTARYKKSPGGPRNRIK"
     gene            <1212583..>1214217
                     /gene="CCT6"
                     /locus_tag="KLMA_50567"
                     /db_xref="GeneID:34717159"
     mRNA            <1212583..>1214217
                     /gene="CCT6"
                     /locus_tag="KLMA_50567"
                     /product="T-complex protein 1 subunit zeta"
                     /transcript_id="XM_022820566.1"
                     /db_xref="GeneID:34717159"
     CDS             1212583..1214217
                     /gene="CCT6"
                     /locus_tag="KLMA_50567"
                     /codon_start=1
                     /product="T-complex protein 1 subunit zeta"
                     /protein_id="XP_022677017.1"
                     /db_xref="GeneID:34717159"
                     /translation="MSVQLLNPKAESLRRDAALKVNVTSAEGLQSVLETNLGPKGTLK
                     MLVDGAGNIKLTKDGKVLLTEMQIQSPTAVMIARAATAQDEITGDGTTTVVCLVGELM
                     KQAYRFIQEGVHPRTITDGFEIARKETLSFLDSFKIDTDDKTELDREFLLQVARSSLC
                     TKVNAELTEVLSPIVTDAVLAVQDPNNKNLDLHMIEIMQMQHLSPKDTTFVKGLILDH
                     GGRHPDMPTRVPNAYVLILNVSLEYEKTEVNSGFFYSSAEQRDKLAASERKFVDEKLK
                     KIVDLKNEVCGLDSDKGFVIINQKGIDPMSLDVLAKHNILALRRAKRRNMERLQLVTG
                     GEAQNSVDDLSPKILGYSGLVYQETIGEEKFTYVTENRDPKSCTILIKGSTHHALMQT
                     KDAVRDGLRAVANVIKDNAVVPGAGAFFISASQHLKKANLNKLGAKGKTKTGVQAFSE
                     ALLSIPKTLIKNSGYDALDVLALCQDELEEDPSRVVGVDLNIGDSCDPTIEGIWDSYR
                     VIRNAVTGATGIASNLLLCDELLRAGRSTLKEGPPQ"
     gene            <1214535..>1216463
                     /gene="SLY1"
                     /locus_tag="KLMA_50568"
                     /db_xref="GeneID:34717160"
     mRNA            <1214535..>1216463
                     /gene="SLY1"
                     /locus_tag="KLMA_50568"
                     /product="protein SLY1"
                     /transcript_id="XM_022820567.1"
                     /db_xref="GeneID:34717160"
     CDS             1214535..1216463
                     /gene="SLY1"
                     /locus_tag="KLMA_50568"
                     /codon_start=1
                     /product="protein SLY1"
                     /protein_id="XP_022677018.1"
                     /db_xref="GeneID:34717160"
                     /translation="MSNTEYSLRDRQIMSIQRMLSFNSDKGTEMVADNLDEQEITWKV
                     LIMDARSTAIVSSVMRVNDLLKSNVTVHSVITQQRSPLPDVPAVYFVEPTEVNIDLIV
                     QDLKEDKYSEFYINFTTTLKRDLLESFASKASATGKSDRIKQVYDQYLDFVVTEPEMF
                     SLEIPDSYKIVNSPQSSEDAITELCDSIASGIFNAIVTIGTIPIIRAQRGGAAEMVAQ
                     KLEAKLRDYVNGTRSSSNTTTSFERLVLVLVDRNIDIASMFAHSWIYQCLVFDIFKLS
                     RNTITMTTTNEQNEDVTKKMDIDPHDFFWTANSHLPFPDAVENVETELSNYKREAEEI
                     TKKTGVSNLTDLDPSGQNDTLQIQEAVKKLPELTAKKATIDTHMTVLAGLLKQLESKG
                     LDSFFELEQSPDSSKTRQEFLTALKDGRTNNIEDKVRTYIIMYLTAQETLPSDFVQQV
                     EKYFESVEYDTTALKYIYDLRHMFKLSSMALQNKSLETNTSANKNSQDGNASQLLSGL
                     SNRLYGLTEGKIQGVGSLLSGIKKLLPEKKTIPITNIVEAIMDPLNSSKKNLNITNEY
                     LYFDPRITRGSHEKLPKSQTYNKSLVFIIGGGNYFEYQNLQEWVHQHENNNKKVIYGS
                     TDIVTPNDFLKEISGLKK"
     gene            complement(<1216576..>1217949)
                     /gene="RVB1"
                     /locus_tag="KLMA_50569"
                     /db_xref="GeneID:34717161"
     mRNA            complement(<1216576..>1217949)
                     /gene="RVB1"
                     /locus_tag="KLMA_50569"
                     /product="ruvB-like helicase 1"
                     /transcript_id="XM_022820568.1"
                     /db_xref="GeneID:34717161"
     CDS             complement(1216576..1217949)
                     /gene="RVB1"
                     /locus_tag="KLMA_50569"
                     /codon_start=1
                     /product="ruvB-like helicase 1"
                     /protein_id="XP_022677019.1"
                     /db_xref="GeneID:34717161"
                     /translation="MVQINEAQEQSTAAYNRTAAHTHIKGLGLDESGAAKHVEGGFVG
                     QAEAREACGVIVDLIKAKKMSGKAILLAGGPSTGKTALALAISQELGPKVPFCPLVGS
                     ELYSVEVKKTEALMENFRRAIGLRIKETKEVYEGEVTELTPEEAENPLGGYGKTISHV
                     IIGLKSAKGTKTLRLDPTIYESIQREKVSVGDVIYIESNTGAVKRVGRSDAFATEFDL
                     EAEEYVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDVISMMGQLMKPKKTEITE
                     KLRHEVNKVVAKYIDQGVAELVPGVLFIDEVNMLDIEIFTYLNRALESDIAPVVVLAS
                     NRGMITVRGTEDVISPHGVPPDLIDRLLIVRTLPYNREEIKSIISKRATVESLQVEDE
                     ALEFLATLGTETSLRYVLQLLSPSGIIAKLANRSEIKVTDVEEAKLLFLDAKRSTKIL
                     EESEKYL"
     gene            <1218649..>1219815
                     /gene="HST4"
                     /locus_tag="KLMA_50570"
                     /db_xref="GeneID:34717162"
     mRNA            <1218649..>1219815
                     /gene="HST4"
                     /locus_tag="KLMA_50570"
                     /product="NAD-dependent histone deacetylase HST4"
                     /transcript_id="XM_022820569.1"
                     /db_xref="GeneID:34717162"
     CDS             1218649..1219815
                     /gene="HST4"
                     /locus_tag="KLMA_50570"
                     /codon_start=1
                     /product="NAD-dependent histone deacetylase HST4"
                     /protein_id="XP_022677020.1"
                     /db_xref="GeneID:34717162"
                     /translation="MESPIRKDYNPLLTPPPSSVKNHDVSTDVLKEPSVKPKRLINEL
                     QKVKKVSCCAKTKTRCRRSKVKYRPELDSLFPLDAYLEGSAKNMYKDAEYLISVLTNS
                     KKIIVVQGAGVSVAAGIPDFRSSDGLFTTLKSTSPQIKSGKDLFDFNNVYSSNSMSIS
                     FNNLMSQLYHLSSNCKPTSYHKFINNLVENKQVKRIYTQNIDGLETKFPSTAMTSKNE
                     NDSIIVQLHGSIKHMSCLKCKKVYDMDPSMFKISEEAETGEIVPQCPECKEFESARSI
                     CGKRLQGIGKLKPNVILYNEYHPEGDIISDIMNKDLKSNPDTLLIVGTSLQIPGVRQM
                     VKQFAAKVRSKKGSVIWINCEKPSPNIKKLIKGCDLIVLGDCQNIPLLIEKGLH"
     gene            complement(<1220018..>1220833)
                     /locus_tag="KLMA_50571"
                     /db_xref="GeneID:34717163"
     mRNA            complement(<1220018..>1220833)
                     /locus_tag="KLMA_50571"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820570.1"
                     /db_xref="GeneID:34717163"
     CDS             complement(1220018..1220833)
                     /locus_tag="KLMA_50571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677021.1"
                     /db_xref="GeneID:34717163"
                     /translation="MSRVGVLVLGPAGAGKSTFCNSIITHMQSIGRRAHIVNLDPAAE
                     ATKYEFTIDIRDLISLEDVMEEFGLGPNGSLIYCFEYLLNNLDWLDEEIGDYNDEYLI
                     FDCPGQIELYTHIPVLPTIVRHLQNQLNFNLCATYLLEAPFVIDTSKFFSGALSAMSA
                     MILLELPHINILSKLDLVKDSHNKKTLKKFLNPDPLLLTDKVNEETNPRFHKLNEAIA
                     NLVDDFGMVQFLPLEAKNTESVATILSYIDDVTQWAEAQEPKEPNDQIEIDDM"
     gene            complement(<1221087..>1222808)
                     /locus_tag="KLMA_50572"
                     /db_xref="GeneID:34717164"
     mRNA            complement(<1221087..>1222808)
                     /locus_tag="KLMA_50572"
                     /product="nucleoporin NUP42"
                     /transcript_id="XM_022820571.1"
                     /db_xref="GeneID:34717164"
     CDS             complement(1221087..1222808)
                     /locus_tag="KLMA_50572"
                     /codon_start=1
                     /product="nucleoporin NUP42"
                     /protein_id="XP_022677022.1"
                     /db_xref="GeneID:34717164"
                     /translation="MAYSRNQTPCKYFQAGKCLKGNNCNFAHVYTNGNNGGNNKTTGL
                     QKSTEEKYLDLTNDRNLDRYTREIELDMDDYMTFAWAPNGSSYGLAAPCPLNVIANRD
                     FSSDESRFQYWQSIKQGKQGQYEMEITARRKDMEKCVNFVKSEAKKAARYVQLSARTY
                     RSNGTLPSKPFIDHPLDLTGQSYNTNSPFGSVRSNPFANVGPFSSMSSNGAPPFGQSV
                     ASTNIVSSNSNSTIGQSPFGNMGAQIGNSTSVFGKPAFGSTAAATPSSPFGQNSNGNS
                     INSNNNGSSNTPGSFGSQNLASNTFGKSTFGAQPFGNPSSSTGFGRPQQTTDSSSAFR
                     KPAFGHGAFGQPSFGQSAARQPAFEQPAFGTSSFGQAATGQLTANQPAFGQSAFGTSP
                     FGQAAIGTSPFGNTPSSQTAFGTSAFGQAASGQSPFGKPLSGQNTFGTSVFGQAAATK
                     SASSQIGSTGSPFSQSNASSNPNSATQVSNNQNNTNTNFNSTVQPFQSINNGFSNSPF
                     NMQSNSENSAAGIQGSISSFVQGLENKSELTAISDLSEKTIALFKAPKFELGNIPEVP
                     PPRELIS"
     gene            <1223140..>1224051
                     /gene="ARV1"
                     /locus_tag="KLMA_50573"
                     /db_xref="GeneID:34717165"
     mRNA            <1223140..>1224051
                     /gene="ARV1"
                     /locus_tag="KLMA_50573"
                     /product="protein ARV1"
                     /transcript_id="XM_022820572.1"
                     /db_xref="GeneID:34717165"
     CDS             1223140..1224051
                     /gene="ARV1"
                     /locus_tag="KLMA_50573"
                     /codon_start=1
                     /product="protein ARV1"
                     /protein_id="XP_022677023.1"
                     /db_xref="GeneID:34717165"
                     /translation="MICIQCGCSIDSLYVIYPGNHIRLTDCPQCSHIVDKYVEFDAVL
                     LFIDLLLLKQGAFLHTAVNRLELHLAKFHKWDRSTASGSTLSQRIKILWNNMQNWLMK
                     YDQLNRLQIFIVTFEVYLHWMAAETQMLKYQSVFHVADKLMIREILNSSIWRQYTFFF
                     LQVIIEMLVLHFVFCHLLIKYWKWNATYKIRHDIIHYTITIANSAKIFPILMLIWPYD
                     TLLSTTIIQMLANIYIIEAVHIVTRISYIKITSFLAATLILQYCLIQILLIAMVSGFD
                     TSLTKSYLTWEYKLMLFKMNAKKSLYL"
     gene            complement(<1224088..>1226424)
                     /locus_tag="KLMA_50574"
                     /db_xref="GeneID:34717166"
     mRNA            complement(<1224088..>1226424)
                     /locus_tag="KLMA_50574"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820574.1"
                     /db_xref="GeneID:34717166"
     CDS             complement(1224088..1226424)
                     /locus_tag="KLMA_50574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677024.1"
                     /db_xref="GeneID:34717166"
                     /translation="MKMDSFFFGSFLTNNSDPRAPDFRKPTTRVATTQLLVASLLGFF
                     AFLSFSVLLKKFPRLYASRKYKIGNLPTWDETKLFSWIGVLYKIDDSHVLEFSGLDAF
                     VFLGFFKMCIKLLSIYCVISMTVISPIRYHYTGKYDDGNDEGVIYKRIFSRKSSEFDE
                     PNNSPETAEMYLWMYVIFTFFFTFLALYMLVKQTKMVVNTRQKYLGRQNTVTDRTIRI
                     TGIPIQLRDEKELKKKIEDLKIGKVSSVTICREWGSLNNLFHYRKMILKQLELKISEC
                     PYEFRNAIYNDEHYTLGRQRNDIENGMETQNVDNQTEVISNSEPDNNELFGEIQLNKR
                     PVIRTGLWGLFGEKVDAIKYLQQQLEFIDEEIKEARRKNYSPTPTAFVTMDSVANAQM
                     AAQTVLDPRVLYLITRLAPAPHDINWDNISLSRRERLFKVYSVTVFIGICSAFLVIPV
                     SYLATLLNLKTISKFWPSLGEFLKNNDWAQNVVTGLLPTYIFTLFNVVIPYFYEFLTK
                     RQGLLSYSDEELSLVSKNFFYILVNLFLVFTLAGTASNYWGYLSDTTKIAYQLATSVK
                     EFSLFYVDLIIFQGIGMFPFKLLLVGSLIGFPFVKIQSKTPRQRKELYNPPVFNFGLQ
                     LPQSILIFIITLIYSVMSTKILASGLAYFIIGYYVYKYQLIFAMDHLPHSTGKVWPLV
                     YRRVILGLLLFQLTMAGTLAGFQGGWVLSSCLFPLPLITLSFWIDFERNYLPLSKFIA
                     LSSIREHERDNSMVCSTNDVESYEYPLLVAPLEGPMME"
     gene            complement(<1226729..>1229329)
                     /gene="VPS34"
                     /locus_tag="KLMA_50575"
                     /db_xref="GeneID:34717167"
     mRNA            complement(<1226729..>1229329)
                     /gene="VPS34"
                     /locus_tag="KLMA_50575"
                     /product="phosphatidylinositol 3-kinase VPS34"
                     /transcript_id="XM_022820575.1"
                     /db_xref="GeneID:34717167"
     CDS             complement(1226729..1229329)
                     /gene="VPS34"
                     /locus_tag="KLMA_50575"
                     /codon_start=1
                     /product="phosphatidylinositol 3-kinase VPS34"
                     /protein_id="XP_022677025.1"
                     /db_xref="GeneID:34717167"
                     /translation="MAVKSVTFFASHECDARLSIKVINLEGSNSLLKQSQKYTEPELS
                     KRASNVIPNSDMFASLQIYDKESGRDLTIPICTKYVPFKNGRVWEQWLTLPVKIHQLN
                     MSSMLRIKLWEFNGDTKILFGLMETPLFRSEDSTLKRGKEVFKFIKDSSEYASPYNDE
                     HIKLINDYDTGELKTSQWLNSPVLEALQEKLNKGKLPIGTFKFTIEHAVTQIPIVYTS
                     SEVANPQINIPTFHNLERSDINETSGKTETEIKISLGNSHDSTLFFYDPDQYNTDLVE
                     EKFRRLERSSRETDIEKYIKPDAKKRDLLNAIIASPPGTKLNGHEKGLIWKYRYYLSN
                     NKKALTKLLQSTNLSEESEIKEVLDLMDIWAEIDLDDTIELLGSQYTNLSVRSYAVNR
                     LRKASDKELELYLLQLVQSVCFECTSTLSDKSSSEFTIVDIDRSKNEQDHLEGNSGAI
                     SDTSQFLADTFDKNSIMISPLAEFLIRRAIKNFRLGNFFYWFLRSESERNTFLVHILE
                     SFRSRLSERSSKIIDDQITLVDMLHQFCEEIKQSKETTAKKQELLLHLISSRMKPLFR
                     NKSITLPLDPDVIAVDVIPSSCKVFKSSLSPLKITFLTTKGTQYSLMFKVGDDLIQDQ
                     LVVQIIKLMDQLLKNENVDLKLTPYNILATGKNEGAIEFIPNETMSSILSVHHGILKY
                     LQKTYPSETEVDGVEPWVMDNFVKSCAGYCVITYILGVGDRHLDNLLIQPDGKFFHAD
                     FGYILGYDPKPFPPLMKLPPQIIEAFGGTDSANYDKFRSYCFVAYSILRRNAGLIINL
                     FELMKTSDVPNIKMDPDGAVLKVIEKFAFDLSEEDATIHFQNLITSSVNALIPLVIDH
                     LHNLAQYWRV"
     gene            complement(<1229844..>1231856)
                     /gene="MSS116"
                     /locus_tag="KLMA_50576"
                     /db_xref="GeneID:34717168"
     mRNA            complement(<1229844..>1231856)
                     /gene="MSS116"
                     /locus_tag="KLMA_50576"
                     /product="ATP-dependent RNA helicase MSS116"
                     /transcript_id="XM_022820576.1"
                     /db_xref="GeneID:34717168"
     CDS             complement(1229844..1231856)
                     /gene="MSS116"
                     /locus_tag="KLMA_50576"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase MSS116"
                     /protein_id="XP_022677026.1"
                     /db_xref="GeneID:34717168"
                     /translation="MLYLNRVSRYASGVKGLAIQFASLRSIHTTSVIGIQHSSVLCEE
                     RGYRAHNKKSFKPNDRGFRDSGNRKNYRDRGRPQSSRYNGSKSKYDREESDVSSVFKG
                     TDFNVTTLGPESFKETVTIDSLLKENLLDESIHRAISSMNFESLTPVQQRTIKPILES
                     SNDIAAKAKTGTGKTLAFLIPIFQHLVKTKLEAPTAVKAVIIAPTRDLAIQISAEIKL
                     LQDSNNALKSYHYSTLIGGTNLDKSLMDLSTNKPNIIVGTPGRINDIVDRVGPRFFKN
                     VDFKVVDEADTLLQIGFLKELSMISKNLNELNVHAPDHIRTLLFSATMDKSVKELART
                     IFNKKECTFIDTVDKNASEAHERIEQKLVITETFGDSMVALIGSIQAQLEKKKNFKAI
                     LFLPTVRFVDFFGGVLNRSLPKDMDIIKFHGKIDQKKRTKLVGRFKRSNHGLFVCTDV
                     GARGMHFPDVEHVYQLCVPTQLPNYIHRIGRTARAGNEGAATIFLFKDELKFVDQLKR
                     STNVVIKNQSDYHRKDDERWETIASCITSNRDFPEALKTIVGFYKGAQSEYGFSSKAV
                     ENILRSYSELHGDPSVLLQFTRHQLNNYFSNRDLGNVADLITVKKSYSHDNNRGFDDD
                     FSSYNSRQNSHKPDRFTKSNRFEDRNVRSDSRRRNNYSKSNFSFDN"
     gene            <1232759..>1234177
                     /gene="REF2"
                     /locus_tag="KLMA_50577"
                     /db_xref="GeneID:34717169"
     mRNA            <1232759..>1234177
                     /gene="REF2"
                     /locus_tag="KLMA_50577"
                     /product="RNA end formation protein 2"
                     /transcript_id="XM_022820577.1"
                     /db_xref="GeneID:34717169"
     CDS             1232759..1234177
                     /gene="REF2"
                     /locus_tag="KLMA_50577"
                     /codon_start=1
                     /product="RNA end formation protein 2"
                     /protein_id="XP_022677027.1"
                     /db_xref="GeneID:34717169"
                     /translation="MLATSTMNNLIPQKVNITHALQSSVIEKMKLDIKQFQSMPELKQ
                     DQMEVVDNYIDSLDSAFTQFCMDNDHVEKRKDGVTDADVELYEGLKRMYLSYMSQLAE
                     IKKERIQKDQEVSKDKPLEYIQQELPYLQPSDRSAFIKELLEKPSLSLTKADDLLKAV
                     QNLAIIDGTLKDNLKLYHDLLLKVGYEEFQINDILPHVENNSEAIIPPEKNLIQENLI
                     QDFDTNEDKKKISFSKYLKKDGKDGRDSKDINGSLKRSLTPEPTEEHHIEKKVKKDST
                     NTSGLVSILKNENKKRNRIFTGIRFVDDSKLVTIFGDGLPNDGLIASPKQLKKILKPF
                     KDGEPAEFILEGWNGHGARPLIIEIKGVKNSDISEIKNGPVKLSTQAPSSLMKNFTSF
                     SPDLNKPALEPVHIEEEEDSSKSKKKQRAPIVARAFGKNSLLLRKDRGGLPYKRVPEV
                     NPNTYPIRPNTSENDDTYELFE"
     gene            complement(<1234364..>1235335)
                     /gene="CAB5"
                     /locus_tag="KLMA_50578"
                     /db_xref="GeneID:34717170"
     mRNA            complement(<1234364..>1235335)
                     /gene="CAB5"
                     /locus_tag="KLMA_50578"
                     /product="dephospho-CoA kinase CAB5"
                     /transcript_id="XM_022820578.1"
                     /db_xref="GeneID:34717170"
     CDS             complement(1234364..1235335)
                     /gene="CAB5"
                     /locus_tag="KLMA_50578"
                     /codon_start=1
                     /product="dephospho-CoA kinase CAB5"
                     /protein_id="XP_022677028.1"
                     /db_xref="GeneID:34717170"
                     /translation="MLVIGLTGGIACGKSTVSSRFRDHYRIPVVDADAIARQILDPGE
                     NAYKRVVRYFSNKVNNLVLPDGSINRPALGAYIFSNPEERKVLNGITHPEVRHTILLK
                     ILTHYLKFHSMCILDVPLLFEANLDIICGLTVSVVCSREIQLKRLLERNPELTKEQAL
                     ARIDSQMNIDDRIARSDYIIDNNGDIRELYGNIEGLLAYIKPSSVTVWLEYFPPYGFI
                     AALSVILSRYLKQRWPAKFVNNRSNNNDNKGKNEDNKEEDRNVPEHSHREMELNPNDS
                     TAKLVSIKQENVKPKTTTSVLNGNSDSTELNTRKRRGSNIKVLHHSK"
     gene            <1235884..>1236996
                     /gene="CBS2"
                     /locus_tag="KLMA_50579"
                     /db_xref="GeneID:34717171"
     mRNA            <1235884..>1236996
                     /gene="CBS2"
                     /locus_tag="KLMA_50579"
                     /product="cytochrome B translational activator protein
                     CBS2"
                     /transcript_id="XM_022820579.1"
                     /db_xref="GeneID:34717171"
     CDS             1235884..1236996
                     /gene="CBS2"
                     /locus_tag="KLMA_50579"
                     /codon_start=1
                     /product="cytochrome B translational activator protein
                     CBS2"
                     /protein_id="XP_022677029.1"
                     /db_xref="GeneID:34717171"
                     /translation="MLLPRVYATGSSVVTSALVFDIAKIPYQPTVPNIVFLLQDPAHL
                     ANFTDQNSKLTVFGKIPDTKQFMASCAPPKLATGKLSSIDNLIVGEVSNKSFSITLQK
                     YKCSLRKDSNVLLINPGFGLLELINKNIWTKEDERPNIFLGNIDNELDIIKPADDFAL
                     RIDRVPIPLSITKVPSRIESYSYLSESPKEWVNNSPLMQLIKKLNWNQNDNHIFKPSF
                     FQYGDFMLIKFERLLVESCVEPLAMLLECELYGELLNSPFFFQMVDDLLAEQMHVLNI
                     TYPYLRNVKHYDTVFHRPTLKKVIQKHLHDRRFLTPSMLKKHRLLNKTNINQLTGYFV
                     GLATYKRISIPQNELILRLVRGKVQTLKDKPLTWDL"
     gene            complement(<1237074..>1238435)
                     /gene="RKM2"
                     /locus_tag="KLMA_50580"
                     /db_xref="GeneID:34717172"
     mRNA            complement(<1237074..>1238435)
                     /gene="RKM2"
                     /locus_tag="KLMA_50580"
                     /product="ribosomal N-lysine methyltransferase 2"
                     /transcript_id="XM_022820580.1"
                     /db_xref="GeneID:34717172"
     CDS             complement(1237074..1238435)
                     /gene="RKM2"
                     /locus_tag="KLMA_50580"
                     /codon_start=1
                     /product="ribosomal N-lysine methyltransferase 2"
                     /protein_id="XP_022677030.1"
                     /db_xref="GeneID:34717172"
                     /translation="MGSTSNNNVQALLKWLGDSDGFYLNPNVEVYEDRVTGRGIRLKN
                     GTLHKNDTVVSVPSSHQLNFITVLHWIRKFTDNETVDPDIEAKQEVKTGSKDPRYRAY
                     RLLKQDTIQEMNSFQLLCLFIIAEWLLLPRWSNNMVFSWWKPFFDIFPSDEEMSAIPT
                     KWALLHPEGLRGSFLKYLPTASMRHTERLSELLKNDWVILKPILQQWKEEFVEVETPS
                     LEELWSQFVYIYFVINSRCLYMEIPMKTDIKDHFTMVPFVDYLNHTNEVDVHCFPRVN
                     NMKKHEYGIGEFSIHTGNHEYSIKFEELLLNYGAHSNDFLLNEYGFTTLKNRWDYIDL
                     TPEISTLFDDSRDIDFLNEIGYWGDFTISEGDISYRILVALSLLCCKDRRKTEKFALG
                     YISEELFEPKTSLIIKKILTNVKQKYLKILDDLKTIEAEDWCRWNLINLYESYKSIIE
                     SNL"
     gene            <1238563..>1239726
                     /gene="LIPB"
                     /locus_tag="KLMA_50581"
                     /db_xref="GeneID:34717173"
     mRNA            <1238563..>1239726
                     /gene="LIPB"
                     /locus_tag="KLMA_50581"
                     /product="octanoyltransferase"
                     /transcript_id="XM_022820581.1"
                     /db_xref="GeneID:34717173"
     CDS             1238563..1239726
                     /gene="LIPB"
                     /locus_tag="KLMA_50581"
                     /note="mitochondrial;
                     Octanoyl-[acyl-carrier-protein]-protein
                     N-octanoyltransferase"
                     /codon_start=1
                     /product="octanoyltransferase"
                     /protein_id="XP_022677031.1"
                     /db_xref="GeneID:34717173"
                     /translation="MFCIIKILEYRNSLIVIVKIAKEGFSFERANIYKPLNCRTLKYL
                     SKISILMLKRGVIYECSAHAFCRVKSACQVTLTGTRYHSTLNCRSNVKTQPIDKSSQK
                     IRHLQFVKQIPFEDGVRLQEKFVRAHLDIKQLQSKIKNRIAKLQQEHGMEIQLNPHEQ
                     SIIDSIAEMKPNPIILTFEFEPTYSGGKRIKKHITQQEIDKYENFVPSQQTENKKPKF
                     VQVERGGQITFHGPGQMVAYIILDLKTFKDFPAKCLVSTIEDAAINTLKNVKKYKDSD
                     EQLNLVAKKTGDTGVWVSADEKIGSIGIHVRRSITSHGVCINVDPDLSYMNSFTMCGL
                     PDKIATSIRDQFPESTTSVNEVAVKFVNEFAKLVGVNTVERVQLDELPIDENE"
     gene            complement(<1239785..>1241215)
                     /gene="VPS64"
                     /locus_tag="KLMA_50582"
                     /db_xref="GeneID:34717174"
     mRNA            complement(<1239785..>1241215)
                     /gene="VPS64"
                     /locus_tag="KLMA_50582"
                     /product="factor arrest protein 10"
                     /transcript_id="XM_022820582.1"
                     /db_xref="GeneID:34717174"
     CDS             complement(1239785..1241215)
                     /gene="VPS64"
                     /locus_tag="KLMA_50582"
                     /codon_start=1
                     /product="factor arrest protein 10"
                     /protein_id="XP_022677032.1"
                     /db_xref="GeneID:34717174"
                     /translation="MVEKPGSTGKGRRLRSNSSSNGSSSDDIVSDSINITEKEQKPVV
                     RNKYTHVLVLKSLNNTFETKFLVIPFKPNGLKLGRPVIGAQNSGGNNGVGGKGDPQVK
                     ADNGNFDSRVLSRNHASLSCDAKTGKICIHDLKSSNGTFVNGTRIGQTDVEIKVGDVI
                     DLGADIDTKLEHRKISALVEDISVIPLISENQKLLSSGKRDVSKSRPIDCSSDDSLVT
                     ITTAQKAAFEAAMFGDVNNLDLEDAVLGSETEILSGIFINNSIGTSPNLINIIKTLVT
                     DLTLEKLEYEKLKSIDNFMVNYTNKLDYLSKVRIEQADSQLIKLQKTIKQKLSNQRSE
                     FEKTHNEEVKALVTENSNLKTRMNEILEMKDNEIKQLKNEIEELKTRLEVEVFKNTQL
                     LHPKSKPGKVKSKGMEKSKNLAERKDEDYDDIDSESDITIKQNDPVQLKRANSGKKSI
                     QSKTNLVLLSSISAGALAAIIKYAAK"
     gene            <1241610..>1242077
                     /gene="SPC19"
                     /locus_tag="KLMA_50583"
                     /db_xref="GeneID:34717175"
     mRNA            <1241610..>1242077
                     /gene="SPC19"
                     /locus_tag="KLMA_50583"
                     /product="DASH complex subunit SPC19"
                     /transcript_id="XM_022820583.1"
                     /db_xref="GeneID:34717175"
     CDS             1241610..1242077
                     /gene="SPC19"
                     /locus_tag="KLMA_50583"
                     /codon_start=1
                     /product="DASH complex subunit SPC19"
                     /protein_id="XP_022677033.1"
                     /db_xref="GeneID:34717175"
                     /translation="MDQSLLDGVEALTASVDNMETCLRNTKTTTESSTKLATNMLQCN
                     RVFQLVSEYDMQRARLDLMEEIEPLLQKLYSKLEKGLGKLERERATLSQTFELNKLRL
                     NNHGAAPLTDGIVNDRSDPVVIVSSTHEELERLKELKNRKEELLDKIRQLNNN"
     gene            complement(<1242120..>1243244)
                     /gene="RAV2"
                     /locus_tag="KLMA_50584"
                     /db_xref="GeneID:34717176"
     mRNA            complement(<1242120..>1243244)
                     /gene="RAV2"
                     /locus_tag="KLMA_50584"
                     /product="regulator of V-ATPase in vacuolar membrane
                     protein 2"
                     /transcript_id="XM_022820586.1"
                     /db_xref="GeneID:34717176"
     CDS             complement(1242120..1243244)
                     /gene="RAV2"
                     /locus_tag="KLMA_50584"
                     /codon_start=1
                     /product="regulator of V-ATPase in vacuolar membrane
                     protein 2"
                     /protein_id="XP_022677034.1"
                     /db_xref="GeneID:34717176"
                     /translation="MTTALYDDGTHENVLTSAESSVLQKKWLITEIIKPELPNLIDHV
                     EKCLELLSSEERFVMPLSNGSNIPNGTNSNISSPSSASNSNSSSTTNTTNSSTSIKGT
                     ITRQSGYIVDFHAVVKLPDFNKGRPIMLKMETGKKYPLVQIQSIISNLARSLNLFDEL
                     QQISESKTLEFDETQLFEKKIGKILELLTQSITLLQNPPRELIFPHNNNNFLKNNFGE
                     SYEACESTHHLVNMELVLFKNEVCLDIRNLTKVVKRPWCEVDPNTGLSFADKVRDRLK
                     QDRNGRILEILKEHGLQVDDASVLNNLLSSFSVTERITLPQANNLLARCVTFDGRVVT
                     ECEKVSINTSDPTLISVSAKLTGLENKISNQYVNIQNLNY"
     gene            <1243519..>1244532
                     /gene="COQ4"
                     /locus_tag="KLMA_50585"
                     /db_xref="GeneID:34717177"
     mRNA            <1243519..>1244532
                     /gene="COQ4"
                     /locus_tag="KLMA_50585"
                     /product="ubiquinone biosynthesis protein COQ4"
                     /transcript_id="XM_022820587.1"
                     /db_xref="GeneID:34717177"
     CDS             1243519..1244532
                     /gene="COQ4"
                     /locus_tag="KLMA_50585"
                     /codon_start=1
                     /product="ubiquinone biosynthesis protein COQ4"
                     /protein_id="XP_022677035.1"
                     /db_xref="GeneID:34717177"
                     /translation="MFTGYRRSTSITKKMLQQQQLQIQHPIKRTIVLAAVASLTNLLV
                     GKDVRLANAMENDNLHDKTGEYQRKTQEDVEQRLKALRNTRPMKPNYEGHVPLWPHEK
                     LILFAVSGLRSYFHPENGENIVQLGEATALPCFLESLKRTMLLDKVGRRILRETPDIT
                     SESLNMERLSKMGKNTLGYTYYQWLKKEGVSPDTRAPVAYIDDPVHAFIFKRYRQCHD
                     FYHAINGLPIIIEGEIAVKAFEAANLGVPMAALGALLAPLKLKPVQRERLFTIYLPWA
                     VKSGLKCKPLINVYWEELLEKDIEELRRELNITPPPDLRALRKERARQRMSFKLKYES
                     YEK"
     gene            <1244984..>1247245
                     /gene="PSY2"
                     /locus_tag="KLMA_50586"
                     /db_xref="GeneID:34717178"
     mRNA            <1244984..>1247245
                     /gene="PSY2"
                     /locus_tag="KLMA_50586"
                     /product="serine/threonine-protein phosphatase 4
                     regulatory subunit 3"
                     /transcript_id="XM_022820588.1"
                     /db_xref="GeneID:34717178"
     CDS             1244984..1247245
                     /gene="PSY2"
                     /locus_tag="KLMA_50586"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 4
                     regulatory subunit 3"
                     /protein_id="XP_022677036.1"
                     /db_xref="GeneID:34717178"
                     /translation="MEFSAENKKKQLVYTEKKRVKVYVLENNEWKDTGTGFCQGIIEE
                     PIVPDTDDVTADANTNNTEKLAFLLVIDEDNNHQVLLKSRLEQNIEYQRQEETLIVWK
                     DLNGQDIALSFEESVGCDSLCEYICFVQKNIESRISLVAVRSTEDGIGSVHEIITGPV
                     NLPSNDPQQTEESLLEALRILNENTSFDYLRNGTINFIINDNYIQTLIKAFNEAENLH
                     LYRNLLLLSSIIKTLILFNSKEIVEEMINNENFLSICGILEYDTEFPNSKLNHRQYLK
                     DQEPKFKEMIPISDPAIKLMITQNFRLQFLKDVVLVRFLDDQSFSFISDLMLVYQNAI
                     IDFLQEDSNGFINQVISLYQVSEDSKVSPDKRRDGIKLLHECIQLSQNLSALEKTLFY
                     KFLIKKGLFQVIQFAFNMETDSDVRILATDIVVGLIEHDIQLIQSIQNDEVVLRNNEN
                     AEVTSTDMSLLLILTKILLTDKSPGLKEQSFQALVSLLDPEDYILDDFQNQDDNVDVR
                     IENLLQIHNGNTDNETDSEKNPERFQLADYLQRFYKQVAPSLFHCFIDKGIDLSQYDE
                     QLLIRLVKLLNLMIQGHDASISRRFILENGILIKLVSLTSNNFILQLRLAAVRCFKNV
                     IFLNDDFYLRYVIGKNLFDPIFEMFKDNLKDDNMANSTMLDFFKTLLAKLNTNEDNDM
                     SGSGSKSSRNFMLLNKYLCGRYFDILSEVDAVPFTKEMLRVYKEEAQRLASTSNVDTS
                     FDENDNTTLEVEV"
     gene            complement(<1247397..>1248275)
                     /gene="SPS19"
                     /locus_tag="KLMA_50587"
                     /db_xref="GeneID:34717179"
     mRNA            complement(<1247397..>1248275)
                     /gene="SPS19"
                     /locus_tag="KLMA_50587"
                     /product="peroxisomal 2"
                     /transcript_id="XM_022820589.1"
                     /db_xref="GeneID:34717179"
     CDS             complement(1247397..1248275)
                     /gene="SPS19"
                     /locus_tag="KLMA_50587"
                     /codon_start=1
                     /product="peroxisomal 2"
                     /protein_id="XP_022677037.1"
                     /db_xref="GeneID:34717179"
                     /translation="MPNTIDKSFVENGPWKPNMFFGKVVFVTGGAGTICRVQTEAMVI
                     LGCKAAIVGRNLEKTKKTAAEIASLVNDDHAVLPISGVDVRNVEQLHEAVKLTVQRFG
                     RVDYVIAGAAGNFLADFTHLSANAFKSVVSIDLLGSFNTVKACFPELVKTKGAVLFVS
                     ATLHYYGVPFQSHVGAAKAGIDALSNSLAVEMGPLGIRFNVVAPGAIANTEGLSRLTK
                     KGSESSSDLTKMIPLQRLGTTVDIANTTVFLFSPAASYVTGATHVVDGGAWHVGSQIT
                     KDLYPQELHYNFSAKL"
     gene            <1249248..>1250321
                     /gene="GCS1"
                     /locus_tag="KLMA_50588"
                     /db_xref="GeneID:34717180"
     mRNA            <1249248..>1250321
                     /gene="GCS1"
                     /locus_tag="KLMA_50588"
                     /product="ADP-ribosylation factor GTPase-activating
                     protein GCS1"
                     /transcript_id="XM_022820590.1"
                     /db_xref="GeneID:34717180"
     CDS             1249248..1250321
                     /gene="GCS1"
                     /locus_tag="KLMA_50588"
                     /codon_start=1
                     /product="ADP-ribosylation factor GTPase-activating
                     protein GCS1"
                     /protein_id="XP_022677038.1"
                     /db_xref="GeneID:34717180"
                     /translation="MSEWKVDPDNRRRLLQLQKVGANKKCVDCAAPNPQWASPKFGIF
                     ICLECAGVHRGLGVHISFVRSITMDQFKPEELIRMENGGNDKFNEYMSAHNVDSKLPP
                     KIKYDNVIASDYKDKLTALCEGTEWQEPDRSDFDASQLGTDLSSSSGSLKESDAKKSA
                     SAEPVDQKEKNESYFASLGEKNQQRPDHIPPSKGGKYQGFGNTPIIQHKKTNQAQAGS
                     TTLTLENFQKDPLGTFTKGWGLFSSAVSKSMEEVQETLIKPNVEQLSQKDLSEEALRA
                     AKQFGQKFQESSSYGLQALNSFTKGLQQQLQDPQNGSESSQYSKLFDGVDTPSHASSE
                     QLSSEKKVTPAKKDTNDDEWDDF"
     gene            complement(<1250598..>1251632)
                     /gene="dpp1"
                     /locus_tag="KLMA_50589"
                     /db_xref="GeneID:34717181"
     mRNA            complement(<1250598..>1251632)
                     /gene="dpp1"
                     /locus_tag="KLMA_50589"
                     /product="probable diacylglycerol pyrophosphate
                     phosphatase 1"
                     /transcript_id="XM_022820591.1"
                     /db_xref="GeneID:34717181"
     CDS             complement(1250598..1251632)
                     /gene="dpp1"
                     /locus_tag="KLMA_50589"
                     /codon_start=1
                     /product="probable diacylglycerol pyrophosphate
                     phosphatase 1"
                     /protein_id="XP_022677039.1"
                     /db_xref="GeneID:34717181"
                     /translation="MTLSRFLPKIGLDRDVFMNLKGKSVSLLTVGFYSMEWVLYFAIF
                     IFAQMFRRLVHPRFSDFSLMDSQISHVTYNQRQLLFPRLFILLTTGGLTTLTAGALNA
                     FSPTYTMSRRWWNSHSSFLTILGTNAMQSVIVAILKNVTGKPRPDLVSRCQPSLQNVG
                     QLQFNIDISSCTTTDLRALSDGFRSFPSGTSATAFSNLALLTFFILSRLNIYQYPTTS
                     NSLSLSVVGFPLVLASVISLSTLADNRHFLSDSIFGALVGIGSAMLVYRQYFPAIWRS
                     PQSLVMPNGKVAEEDLSLAYEPKRFFSDQSAKWKVDPIESKSEEAVSGTISANNLTRR
                     SFPTRSQVTV"
     gene            <1252219..>1253631
                     /gene="RTT106"
                     /locus_tag="KLMA_50590"
                     /db_xref="GeneID:34717182"
     mRNA            <1252219..>1253631
                     /gene="RTT106"
                     /locus_tag="KLMA_50590"
                     /product="histone chaperone RTT106"
                     /transcript_id="XM_022820592.1"
                     /db_xref="GeneID:34717182"
     CDS             1252219..1253631
                     /gene="RTT106"
                     /locus_tag="KLMA_50590"
                     /codon_start=1
                     /product="histone chaperone RTT106"
                     /protein_id="XP_022677040.1"
                     /db_xref="GeneID:34717182"
                     /translation="MSDFLERFSANLQAKIREIIAKVPESENVFREVFHFGQINVNDF
                     ADNNKKRKVSSDNSLAVSAGDLIFELQDVSVLSPLRKKLTLTISIEENSQLPMIAFKK
                     NDTIEHIVRDIKNSIKFAAFLPFPEKKNLEYLYIYYEEREGNNNDPILITLNKDQTLK
                     QFKERSILTEEESNFQVVIDYMRRQAILTGFRISDPFSPSVMESHHSFFVDCHRGSKE
                     GSLFFLPEHILFGFKKPILLFESKDIDAITYSSITRLTFNVTLILKNGEKFEFSMIDQ
                     NKFSEIDDYVKRKQVQDKSMSDELKAKVTKSSQVVDQSALKEALEESGALDGMNADSD
                     DENDKNFEDESDLSDGSNSSNEEEEEEEEEEEEDDEEEEGEEGEDKDEESNDDDQWNS
                     KEKGSGQSSVKDPEQQNIEIDHDLESQQGKSTSTTSPRNNFSMEMDEFPSLLNENELI
                     QDIPISMDDDEEEDSGVEYN"
     gene            complement(<1253685..>1254935)
                     /gene="RIO2"
                     /locus_tag="KLMA_50591"
                     /db_xref="GeneID:34717183"
     mRNA            complement(<1253685..>1254935)
                     /gene="RIO2"
                     /locus_tag="KLMA_50591"
                     /product="serine/threonine-protein kinase RIO2"
                     /transcript_id="XM_022820593.1"
                     /db_xref="GeneID:34717183"
     CDS             complement(1253685..1254935)
                     /gene="RIO2"
                     /locus_tag="KLMA_50591"
                     /codon_start=1
                     /product="serine/threonine-protein kinase RIO2"
                     /protein_id="XP_022677041.1"
                     /db_xref="GeneID:34717183"
                     /translation="MKLDTSHMRYLTAEDFRVLQAVEQGSRNHEVVPTHLIHTLSGMR
                     SMSGTNRSISDLAKLSLISKLRNSKYDGYRLTYNGFDYLALRAMLNRDTVYSVGTKIG
                     VGKESDIYQVSDRNGEPKVLKMHRLGRTSFHTVKNNREYLRSGQSASWMHLSKLAANK
                     EYQFMTLLYNKDFEVPQPFDNSRHCVLMELIKGYPMRRLGKHKNLPKLYSDLMSFIVR
                     LANHGLIHCDFNEFNIMIKDEVENENDPGYVVIDFPQCISIQHQDAAYYFKRDVDCIR
                     RFFKKKLKYEPKEDATFLDTDGFGDGFKYPYPVFERDVKRCDNLDELVMASGFTKKHP
                     GDRDLELAVQSMRDEEYTEERENEENSDYTSTSESEYSDFSDEESSENESEEDDENER
                     IIQAISSGVENLKIDKFGNYILED"
     gene            complement(<1255517..>1257358)
                     /gene="SSB"
                     /locus_tag="KLMA_50592"
                     /db_xref="GeneID:34717184"
     mRNA            complement(<1255517..>1257358)
                     /gene="SSB"
                     /locus_tag="KLMA_50592"
                     /product="heat shock protein SSB"
                     /transcript_id="XM_022820594.1"
                     /db_xref="GeneID:34717184"
     CDS             complement(1255517..1257358)
                     /gene="SSB"
                     /locus_tag="KLMA_50592"
                     /codon_start=1
                     /product="heat shock protein SSB"
                     /protein_id="XP_022677042.1"
                     /db_xref="GeneID:34717184"
                     /translation="MAEGVFPGAIGIDLGTTYSCVATYENSVEIIANEQGNRVTPSFV
                     AFTPEERLIGDAAKNQAALNPKNTVFDAKRLIGRRFDEESVQSDMKTWPFKVIDSNGA
                     PLIEVEYLGETKTFSPQEISSMVLTKMKEIAEAKIGKKVEKAVVTVPAYFNDAQRQAT
                     KDAGAIAGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGG
                     VYTVKSTSGNTHLGGQDFDTNLLEHFKTEFKKKTGADISGDARALRRLRTAAERAKRT
                     LSSVAQTTVEVDSLFDGEDFEATITRARFEDINAALFKSTLEPVEQVLKDAKISKSQI
                     DEVVLVGGSTRIPKVQKLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDET
                     KDLLLLDVAPLSLGVGMAGDVFGVVVPRNTTVPTIKRRTFTTVADHQTTVTFPVYQGE
                     RVNCKENTLLGEFDLKGVPPMPAGEPVLEAIFEVDANGILKVTAVEKSTGKSANITIS
                     NAIGRLSSEEIEQMVNQAEEFKAADEAFAKKHEARQRLESYISSVEQTVTDPVLSAKI
                     KRNAKAKVEAALADAFSTLQIEDASADDLRKAEVGLKRAVTKAMSTR"
     gene            complement(<1258005..>1258823)
                     /locus_tag="KLMA_50594"
                     /db_xref="GeneID:34717185"
     mRNA            complement(<1258005..>1258823)
                     /locus_tag="KLMA_50594"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820595.1"
                     /db_xref="GeneID:34717185"
     CDS             complement(1258005..1258823)
                     /locus_tag="KLMA_50594"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677043.1"
                     /db_xref="GeneID:34717185"
                     /translation="MTSRREILKDISNHQEQHLLATNSVSKSNSDLKVSFQKRIPLIA
                     GRWFIDIKNKSRTPTSFLHFEGFDESNYVIWYLGEAEVLSFLLASQKFVLVKLCQSAD
                     LPQTLQELKSNYRLNHTDICLEGCIQDVNNDLILLQSLIECPLKVNKMICCTEKEEKR
                     EEDWTSFIENESNTEKLNTMQEFPLNLNRLEVSFLIGYKGCRIEYLKQECEVDIKIMP
                     ISYKLTHAELQDPTRVAQDIRLYGNLQNLQKSLIMIEQFLRIAPLSSKTKIQRF"
     gene            complement(<1259242..>1260240)
                     /gene="PTP1"
                     /locus_tag="KLMA_50595"
                     /db_xref="GeneID:34717186"
     mRNA            complement(<1259242..>1260240)
                     /gene="PTP1"
                     /locus_tag="KLMA_50595"
                     /product="tyrosine-protein phosphatase 1"
                     /transcript_id="XM_022820597.1"
                     /db_xref="GeneID:34717186"
     CDS             complement(1259242..1260240)
                     /gene="PTP1"
                     /locus_tag="KLMA_50595"
                     /codon_start=1
                     /product="tyrosine-protein phosphatase 1"
                     /protein_id="XP_022677044.1"
                     /db_xref="GeneID:34717186"
                     /translation="MGLLKKSDRMSRPRYLDQDDRDLLLKFKYIRQQEEARIRDGALH
                     PRDSEWAFGVSEASYNSTRNRYSNIKTFEKTRVKLQVKNGNDYINASHIKVEIPEQST
                     AATFYIASQGPTISTWPQFWQMIYQQSPEENISVVMVTPLVEGGREKCYPYWPRQVHQ
                     TMVSPAIQTTGPTSQDVSEFAFSIEIENVLTQSFHHYTLSKILLKPSDPSFPVKTVNH
                     FYYDQWSDFDKPDEIGPLHHLIKHVRTATNALNPIFVHCSAGVGRSGTYIALDHLIAR
                     TVDFKADEFIHNYDKDLIEQIVKQLRTQRLKTVESPQQYLFLYHAAKLIFRYNKGL"
     gene            <1261279..>1264410
                     /gene="BRE4"
                     /locus_tag="KLMA_50596"
                     /db_xref="GeneID:34717187"
     mRNA            <1261279..>1264410
                     /gene="BRE4"
                     /locus_tag="KLMA_50596"
                     /product="protein BRE4"
                     /transcript_id="XM_022820598.1"
                     /db_xref="GeneID:34717187"
     CDS             1261279..1264410
                     /gene="BRE4"
                     /locus_tag="KLMA_50596"
                     /codon_start=1
                     /product="protein BRE4"
                     /protein_id="XP_022677045.1"
                     /db_xref="GeneID:34717187"
                     /translation="MTNLQGSYDKKSYLSVTGLRAAKYGRDSKTSCSRVNLSQMKLDK
                     LMEGKKWEELETFGLEELRNGFFDPVYTGYERIIPSDPLNKEKVHQKSLFPSTDIKEI
                     RKFWKPIMKYCIAIFIANVLCLIEPAGSWFGGDYRYFLPLALLIHHPVRTVGVQCELT
                     IQSIIGGAVGMGYSALIWYVSTATEPAAKEQGGILFLGLFLGAILAHWVRSTYQRLFY
                     LSTSFGIAVLFFCGSSLSLNKKNLSWKLYWDFGISYLFGLLLSLLVCCSVFPHSCHST
                     VKNTLVSALEDIKILLTSLVDSNHCDDTDRIREAQHSMIQNINISLSEGLREFSNQAT
                     ITIFDPECLKELRNIITFTTSPLRVLPLKNVILTRSELDRFLHEGAGLESPSPREGSA
                     DSPMVISGAVTPLPSAISPTTPIDIDAAIYSNILRSSFAKAIFQLIREMLLVLENTQY
                     CMEVCSTFFVNKNDIEEAKSKLEKLQKRLRRKIYKLDVTYKEFTKTDFFCKDLLQDPN
                     SIDAFLFLRYIRQSAKSMIALTERTVDLINNRHFRICLPNYPLKRSLTRLPNQCALDQ
                     GGDTVLHYFETKRDVDEAFEKIYNSYTSKHKYNDGKGKNFETYTRAIDHNDFNFHTTT
                     NPIRFKLWQLTTVLTGPELKSSLKVAFILTFLLLPSWLKESHVWYDSYHCWWGPAIFF
                     ILTNRRNVATWKGILRRFLYGVFSIVWAFCGCVSRHNSPYVIATFGAILSVPLAINFF
                     VNKNTKSSFTALACFDIIALGIYAKGDGKRLHTSMIWKNTWITGIALLIGVLLSIPTT
                     WLIWSFKTRRELRLAMSSLLSHISQSYQSVTDRYLYRDIDDDPTDLTLRLSNIREVRL
                     FQSLIAARNLLERAKQEPNYISNFKPYLYEDLIDNCMVLLEKVIEARISGQYFEVWEN
                     DADEEITHALLSLRRDSVSSVIFVFYILSNCFRSKNKIPKYLPNPMLSRKKLYDFINK
                     FESLRKSQLENSTSPFKKSYLKSNYAVTKDIEKTHWTEVHGMAFSRAYTDFTFHLDRV
                     VKLSREILGEETI"
     gene            complement(<1264693..>1264809)
                     /locus_tag="KLMA_50597"
                     /db_xref="GeneID:34717188"
     mRNA            complement(<1264693..>1264809)
                     /locus_tag="KLMA_50597"
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase"
                     /transcript_id="XM_022820599.1"
                     /db_xref="GeneID:34717188"
     CDS             complement(1264693..1264809)
                     /locus_tag="KLMA_50597"
                     /codon_start=1
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase"
                     /protein_id="XP_022677046.1"
                     /db_xref="GeneID:34717188"
                     /translation="MISDAQLNTLVLSFGVVMVALITLYHGIQSTIVNHKKQ"
     gene            <1265248..>1265388
                     /locus_tag="KLMA_50598"
                     /db_xref="GeneID:34717189"
     mRNA            <1265248..>1265388
                     /locus_tag="KLMA_50598"
                     /product="subunit OST4"
                     /transcript_id="XM_022820600.1"
                     /db_xref="GeneID:34717189"
     CDS             1265248..1265388
                     /locus_tag="KLMA_50598"
                     /codon_start=1
                     /product="subunit OST4"
                     /protein_id="XP_022677047.1"
                     /db_xref="GeneID:34717189"
                     /translation="MEPMSKTDRLFHPTAFQKFKAYRMLFWDEMRSTVGLPRLTDKYF
                     KK"
     gene            complement(<1265817..>1266776)
                     /gene="VID27"
                     /locus_tag="KLMA_50599"
                     /db_xref="GeneID:34717190"
     mRNA            complement(<1265817..>1266776)
                     /gene="VID27"
                     /locus_tag="KLMA_50599"
                     /product="vacuolar import and degradation protein 27"
                     /transcript_id="XM_022820601.1"
                     /db_xref="GeneID:34717190"
     CDS             complement(1265817..1266776)
                     /gene="VID27"
                     /locus_tag="KLMA_50599"
                     /codon_start=1
                     /product="vacuolar import and degradation protein 27"
                     /protein_id="XP_022677048.1"
                     /db_xref="GeneID:34717190"
                     /translation="MNLIRTLFDSGSNEELMSLSSGEFLLLRSFKSPKSSVEYIFSDA
                     MICVKRCGQYEYLLCVERQDIESEDISDGDSEDILPDEMSLLSATSKKDDTWSFRIEK
                     GLQLVKSWNAERRPVIIWNNTRGDDGDQFEYIIEDTIPLSEIDKFYKLIKLCTYEVEY
                     RKPSEQATRDELLLFMKPEELDVSDSYSFAFDDSKLIHSHIGIPTDRDSTLHSESSKD
                     TSLSVGRFAELRGSKHSLLGDTYRSYIRPDSIGRETEDGSDYFEGYDNDDNNEDILQY
                     ANSLKKYKYGEADENGYESYDDDEDDEEDAEGIFVDAKEYITD"
     gene            <1267760..>1268470
                     /gene="RRG9"
                     /locus_tag="KLMA_50600"
                     /db_xref="GeneID:34717191"
     mRNA            <1267760..>1268470
                     /gene="RRG9"
                     /locus_tag="KLMA_50600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820602.1"
                     /db_xref="GeneID:34717191"
     CDS             1267760..1268470
                     /gene="RRG9"
                     /locus_tag="KLMA_50600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677049.1"
                     /db_xref="GeneID:34717191"
                     /translation="MILRSILQRSKFANTLNCFRRFHTFPLLFNSNNGDANSSVKIPE
                     LPRKGKAKQLIQVVNDTEEHTIKKSWRDDKNLPDWKRQKLALKEKLKGEKWNPSKKLS
                     REQMESVRLLKRQLPNLNAGDIAAQMKVSPEVIRRILKSKWEPSEKELEDIQRRWKKR
                     SERIIDLYEKGLIGDKMGTLPIARKVIIKGGNSTGTFRVRRTKDSVMSISSTKKGKHS
                     EDKDILKAKNKLHLLMKK"
     gene            complement(<1268647..>1269234)
                     /locus_tag="KLMA_50601"
                     /db_xref="GeneID:34717192"
     mRNA            complement(<1268647..>1269234)
                     /locus_tag="KLMA_50601"
                     /product="peroxisomal membrane protein PEX17"
                     /transcript_id="XM_022820603.1"
                     /db_xref="GeneID:34717192"
     CDS             complement(1268647..1269234)
                     /locus_tag="KLMA_50601"
                     /codon_start=1
                     /product="peroxisomal membrane protein PEX17"
                     /protein_id="XP_022677050.1"
                     /db_xref="GeneID:34717192"
                     /translation="MDTLWPSDKDILPYKKPTTAAQIERLFYHVGLSVSGLYVLLHLV
                     VSRVIYQAYQQRLELNHEALMRLRRLVNKLRSKVKTTSITSLGENRRLTKDSKVYIDR
                     CQQTSEGIKTPGDDYGWAHLNRKLDSLTKSLEEYNKIIGETSYLESLTFESKLFTDQC
                     KGVGLRLRSQEKGTKLINSVREMKGWFIHGRIPRD"
     gene            complement(<1271914..>1272843)
                     /locus_tag="KLMA_50602"
                     /db_xref="GeneID:34717193"
     mRNA            complement(<1271914..>1272843)
                     /locus_tag="KLMA_50602"
                     /product="PAPA-1-like domain-containing protein"
                     /transcript_id="XM_022820604.1"
                     /db_xref="GeneID:34717193"
     CDS             complement(1271914..1272843)
                     /locus_tag="KLMA_50602"
                     /codon_start=1
                     /product="PAPA-1-like domain-containing protein"
                     /protein_id="XP_022677051.1"
                     /db_xref="GeneID:34717193"
                     /translation="MDSELSSVEEFEDSVLVESSDSGQVDASAEAEPEAYDEFEDEYD
                     QDLDAFPEEPEDDYYDDEEDEYTPENKKPVAKATKSKKQHKQTTQKEKDSKITTGSRQ
                     SSRVRKHVDYDQTIDDEEFLFEEEERPEPPKKKKSKIELVEMENTDSEDELAVQNDSE
                     AEDGNSSDMKSNVDSVTGDQQTEENQQRRSKMLENLIGLQAKKHGNRKEFTDEEVQLR
                     KAETARKRKNFIEKRLEEEKQDVLNKLLKRRAAKTKSSNKPAAAGSDKNASAQYEQEL
                     DTETGFVKQRRPYIATGMTRTIINKSEVSYSLP"
     gene            <1273138..>1275378
                     /gene="GYP7"
                     /locus_tag="KLMA_50603"
                     /db_xref="GeneID:34717194"
     mRNA            <1273138..>1275378
                     /gene="GYP7"
                     /locus_tag="KLMA_50603"
                     /product="GTPase-activating protein GYP7"
                     /transcript_id="XM_022820605.1"
                     /db_xref="GeneID:34717194"
     CDS             1273138..1275378
                     /gene="GYP7"
                     /locus_tag="KLMA_50603"
                     /codon_start=1
                     /product="GTPase-activating protein GYP7"
                     /protein_id="XP_022677052.1"
                     /db_xref="GeneID:34717194"
                     /translation="MSEILFCKGKVFVNTFSNKADGIPGFLLITKELQTTQLQDCKLS
                     WIAERDLEQDYAKTLGNIETKLIDLPSVRSPNNINIDFMYSTCSFNVALSEIYSIQFK
                     PPHPNKLWWGSCIIHCKGGINTDVPVLSFHDDICSSTIAKQKKLNQNFDPFSNEGEVY
                     WGGDDLRTCLQSLVDLQKVDSFSYIYLVNASLEDLRNFSLNGFKNVKSQQSSSVKGKS
                     VWDTLETNRWTIMSKFADATTSASNLFTNLVKRHPIVKIIDKNQDNIYVKQLMKNTRV
                     KEVQDEFDSARIYLAKWAMGVRQEAERYQKEHHLDDIYKQILKNELGISNDVEITPEE
                     LNMAVQRSFSLTKQKWDSLFDSQGRLSITVHEVKDFIFHGGIADDELRKEVWLFLLGV
                     YPWDSSSEERQVLKQALEEDYYANYKSKWIHREPLLNDPQEEEYWNDQVFRISKDVRR
                     NDRDHPLYKYNTFDALPANEETEENNDNEEGWEIKNPHLLALKNILISYNIYNTNLGY
                     VQGMTDLLSPIYSVIQDESLSFWCFVHFMIRMERNFLRDQSGIRDQMLTLVDLCQFML
                     PKFTKHLKKCESSDLFFCFRMLIVWFKREFEFQDVCSIWEIFWTDFYSSQFQLFFMLA
                     ILQKHSDVVMGQLTEFDDVLKYFNDLRNTMDWSDIMTRSELLFIKFQKMIDVLEREEE
                     LIKKSTTTSGFQVHEPLEEKEDRDNDLQDPPLHHPRLISDNLKKLLSKSLVIQKESTR
                     NKDSVK"
     gene            complement(<1275544..>1277601)
                     /gene="RAP1"
                     /locus_tag="KLMA_50604"
                     /db_xref="GeneID:34717195"
     mRNA            complement(<1275544..>1277601)
                     /gene="RAP1"
                     /locus_tag="KLMA_50604"
                     /product="DNA-binding protein RAP1"
                     /transcript_id="XM_022820606.1"
                     /db_xref="GeneID:34717195"
     CDS             complement(1275544..1277601)
                     /gene="RAP1"
                     /locus_tag="KLMA_50604"
                     /codon_start=1
                     /product="DNA-binding protein RAP1"
                     /protein_id="XP_022677053.1"
                     /db_xref="GeneID:34717195"
                     /translation="MSNVDEFDTALDSPSVQIKEDCGVFNNVLFFIDPLINDIDALMN
                     AVRNNGGQVLMEVPRNNSREWEVAYFVSKRYDENYRIFVHPSYILDCIDAGTLLNVRD
                     YLGKPEPSGYVRFDSNAISDEYNISSQLSDLPSSDVTRTAVKIATRHDESINQDNNHN
                     QTGLVDGNDRAIKISAKDETRNQQKDTQRQEVEQVQQMVQNSDDQQQQLTHAQGNDAD
                     ELILHDPVGSSHNKSSFTKEEDEFILDVVRKNPTKRTTHTLYDEISHYVPNHTGNSIR
                     HRFRVYLSKKLEFVYQVDEEGKLVRDSDGNLIKTDILPSGLKRKFTSEEDYNLALAVK
                     KQFYRDAFQRDPDTGESLITEDDEPNVVAKRQLVMNTEIDPSDIPPFDKYMVNDRRGP
                     LSREFFKNFATEVPTHSENAWRDRFRKFILPYGIDSYISYYEKCIEEGIEPESIKNMT
                     NRPKREGPSPGNYNTTLKKSKRMAEGSSQQATDASLNDFFLESDAFDLIDGIRRDLHA
                     AEAQQEEQARSLYAEDVAERIRHQVALEHEEYDNYDMDSIKFPPKLAENDDYFDHTFF
                     NFRSTKEFIQKLEEIITREYDESQADVLVHDLDVECGIRKKYATSVLTALTGDISLFP
                     RYFLTSFKYGIHPPQNVPGIWTKEDDLVLRSKNPEGMKMLEKKHGFARMQMRIRFQEN
                     NLV"
     gene            complement(<1278220..>1279155)
                     /locus_tag="KLMA_50605"
                     /db_xref="GeneID:34717196"
     mRNA            complement(<1278220..>1279155)
                     /locus_tag="KLMA_50605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820608.1"
                     /db_xref="GeneID:34717196"
     CDS             complement(1278220..1279155)
                     /locus_tag="KLMA_50605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677054.1"
                     /db_xref="GeneID:34717196"
                     /translation="MAFFKGLTAFSVALFFMFVTFVLWHEKEYTNFPIIETIKYSTID
                     RFHDRIVFVGDIHGMYDQYRELIEDKVKPDANTTVVLLGDFISKGPDSNLIVNEVILN
                     DNIDYRVECVLGNNELRTIYALLNPLTLGKHNIKSIQFTTDSFLPDKDTVNKRHKQLA
                     KELGWSSLTKVAFKCSAMWQFHDNEKDKLTLVGVHAGVLPEHLPNPMIEELTEMKYVD
                     INDHTRTSKKKIDHGIKWYKLWNHLNKEKYQIGGNVNVLYGHDSKKGLNIRRYTKGLD
                     SGCVNGKSLTALEYVWNRKTKVYDNILHSVSCDRS"
     gene            <1281177..>1281584
                     /gene="YPD1"
                     /locus_tag="KLMA_50606"
                     /db_xref="GeneID:34717197"
     mRNA            <1281177..>1281584
                     /gene="YPD1"
                     /locus_tag="KLMA_50606"
                     /product="phosphorelay intermediate protein YPD1"
                     /transcript_id="XM_022820609.1"
                     /db_xref="GeneID:34717197"
     CDS             1281177..1281584
                     /gene="YPD1"
                     /locus_tag="KLMA_50606"
                     /codon_start=1
                     /product="phosphorelay intermediate protein YPD1"
                     /protein_id="XP_022677055.1"
                     /db_xref="GeneID:34717197"
                     /translation="MAQNTRIPDHIINWDILNEIVSMDEDDAGFSQSLLIQFFEQAQS
                     TFEKMEEHINTDKNLDQLGQLGHFLKGSSASLGLQRIAWVCERIQNYGQKKEGPGISD
                     EQYLQLIKQCLALSQTEFALAKEELGKFYNTKF"
     gene            complement(<1281938..>1283617)
                     /gene="MGS1"
                     /locus_tag="KLMA_50607"
                     /db_xref="GeneID:34717198"
     mRNA            complement(<1281938..>1283617)
                     /gene="MGS1"
                     /locus_tag="KLMA_50607"
                     /product="DNA-dependent ATPase MGS1"
                     /transcript_id="XM_022820610.1"
                     /db_xref="GeneID:34717198"
     CDS             complement(1281938..1283617)
                     /gene="MGS1"
                     /locus_tag="KLMA_50607"
                     /codon_start=1
                     /product="DNA-dependent ATPase MGS1"
                     /protein_id="XP_022677056.1"
                     /db_xref="GeneID:34717198"
                     /translation="MSRTEQTITCPICGKKVAFLKINAHLDECTEEPKKTIHQPTLQT
                     FLGSKRKHEEITILDDPDSSSESCKTRTSETNEASSPNSSIKRQRILNQRKPIMDGAD
                     FETKQLLKIQYLPLSEKLRPKSLNDYIGQQHILNRETGSLYLYIEKGIIPSMILWGPP
                     GVGKTSLARLLASTINQDLNATSKYILVETSATKVNTTELRNIFERSKKEYHLTKRMT
                     VLFIDEIHRFSKSQQDVLLPHVENGDIILIGATTENPSFQLNNALLSRCQLFVLEKLN
                     DKELKVVLTRAIAMLNKFRSLVWNCTTPLKFDDQCFSYIHNLAMGDTRRAINLLELLE
                     ISTRFKIDGPVSMEKVKELIQSSGELRTYYDTHGENHYDTISAFHKSVRGGDENAALY
                     YLARMLQGGEDPLFIARRMIRIASEDIGLADPSQLPFTVAAHDAVIKVGLPEAELALA
                     QCAVSLCRANKSVELYRGWNKLKAMLKSNAYGSADCPIPLHIRNAPTKMMEELGYGKG
                     YKYNPNYKGGKVSQEYFPQELIDQCGRKELLFLNGEALGDMEDPDLLKDKP"
     gene            complement(<1283857..>1284792)
                     /gene="PHO13"
                     /locus_tag="KLMA_50608"
                     /db_xref="GeneID:34717199"
     mRNA            complement(<1283857..>1284792)
                     /gene="PHO13"
                     /locus_tag="KLMA_50608"
                     /product="4-nitrophenylphosphatase"
                     /transcript_id="XM_022820611.1"
                     /db_xref="GeneID:34717199"
     CDS             complement(1283857..1284792)
                     /gene="PHO13"
                     /locus_tag="KLMA_50608"
                     /codon_start=1
                     /product="4-nitrophenylphosphatase"
                     /protein_id="XP_022677057.1"
                     /db_xref="GeneID:34717199"
                     /translation="MTGTKANTPIKIQDKTSSLEFLKKFDTFLFDCDGVLWLGSHLLP
                     DVVETLDYLKSLGKQLIFVTNNSTKSRPQYVKKFAGFGITVTEDQIFTSGYASALYVR
                     DFLKLQPGKDKVWVFGESGIIDELTLMGFEALGAGDPRLDEPFDTNTSPFLKDGLDED
                     VKCVVAGLDTKVNYHRLAISLQYLRKPDVHFVATNIDSTFPQKGIILPGAGSTIQSLA
                     YASDRTPEACGKPNLNMLNAIVKAKNLDRSRCCMVGDRLNTDIKFGETGGLGGTLLVL
                     TGIETEERALDTAHEHPNPKYYASKLGDLYEFTHQ"
     gene            <1285470..>1287122
                     /gene="ALG9"
                     /locus_tag="KLMA_50609"
                     /db_xref="GeneID:34717200"
     mRNA            <1285470..>1287122
                     /gene="ALG9"
                     /locus_tag="KLMA_50609"
                     /product="probable mannosyltransferase ALG9"
                     /transcript_id="XM_022820612.1"
                     /db_xref="GeneID:34717200"
     CDS             1285470..1287122
                     /gene="ALG9"
                     /locus_tag="KLMA_50609"
                     /codon_start=1
                     /product="probable mannosyltransferase ALG9"
                     /protein_id="XP_022677058.1"
                     /db_xref="GeneID:34717200"
                     /translation="MVLRDEKCKLYGPLLLAFLFVSRVFIQPYYSLISDCDETFNYWE
                     PLNLLVRGFGKQTWEYSPEYSIRSWAFLLPLFSILKPLNELIEKKVLLFYAARSVLGI
                     VSFIFEYALSKELQTSMSIQVSNMWLLFQLFNPGWFHSSVELLPSSFAMITTLGYLKY
                     TLRYLSNGTESAFVKSIFFVLLGGILGWPFSLVLSVTSCIHYAVTHRFIDTLRASFSS
                     FFVFCLVSSIVTTIDSIFYGKFTVVPLNIVTYNVFAAGEKSGPNIFGVEPWHYYVQNL
                     LLNFPITTLIFAIIGFTHLSIWPISGSLFIWFNVFFAQPHKEERFLYPIYGIISLLSA
                     VGLYHVSSTIRWNRIKKLLKFVIFGLTLLQSMARIIALVNNYTAPIQIYAALPNCASE
                     TVVCTGREWYHFPTSLLLPDNYRLEFVQSGFDGLLPGNFKETGSIEDRIRYIPEGMNN
                     ENIFDSSKLVDITTCDYYVDLNLPSNNPRDIVNPTETNDWHPLLCRNFVDVSSSKFLG
                     RAFQVPEKLLSILPQPVLSVISKYYGVKYVDYCIFSRVEQEV"
     gene            complement(<1287246..>1288550)
                     /locus_tag="KLMA_50610"
                     /db_xref="GeneID:34717201"
     mRNA            complement(<1287246..>1288550)
                     /locus_tag="KLMA_50610"
                     /product="adenylosuccinate synthetase"
                     /transcript_id="XM_022820613.1"
                     /db_xref="GeneID:34717201"
     CDS             complement(1287246..1288550)
                     /locus_tag="KLMA_50610"
                     /codon_start=1
                     /product="adenylosuccinate synthetase"
                     /protein_id="XP_022677059.1"
                     /db_xref="GeneID:34717201"
                     /translation="MVNVVLGSQWGDEGKGKLVDLLVGKYDIVARSAGGNNAGHTIVV
                     DGVKYDFHMLPSGLVNPNCQNLIGNGVVIHIPSFFEELENLEKKGLKNARSRLFISSR
                     AHLVFDFHQRTDKLRELELSGASKDGKNIGTTGKGIGPTYSTKASRSGIRVHHLVNDD
                     PNAWEVFETRYRRLLETRQKRYGPFEYDADEELRRYKVYKEQLKPFVVDSIPFLHNAI
                     KLNKKILVEGANALMLDIDFGTYPYVTSSNTGIGGVITGLGLPPRTIEKIFGVVKAYT
                     TRVGEGPFPTEQLNEYGDMLQTIGAEYGVTTGRKRRCGWLDLVVLKYSTLINGFTSLN
                     ITKLDVLDTFKEIKIAVSYSYKGKKLESFPEDLLILANVDVEYVTLPGWEQDITKITE
                     YEDLPENAKKYLKFIEDFLEVPIEWVGTGPSRDSMLHKDVQV"
     gene            <1289602..>1292061
                     /gene="POP1"
                     /locus_tag="KLMA_50611"
                     /db_xref="GeneID:34717202"
     mRNA            <1289602..>1292061
                     /gene="POP1"
                     /locus_tag="KLMA_50611"
                     /product="ribonucleases P/MRP protein subunit POP1"
                     /transcript_id="XM_022820614.1"
                     /db_xref="GeneID:34717202"
     CDS             1289602..1292061
                     /gene="POP1"
                     /locus_tag="KLMA_50611"
                     /codon_start=1
                     /product="ribonucleases P/MRP protein subunit POP1"
                     /protein_id="XP_022677060.1"
                     /db_xref="GeneID:34717202"
                     /translation="MPPKSLTKSQQFKRDKVRNARQIRSEASSVNPEEFSESGSILNI
                     PSFVSSRKYEIKQLQQAVHNSKQSSSTRIFQVLPRKLRRRTASHNVKRIPKRLRHRAL
                     KEMKKSQQQFTQGTRHLFDKRKHGLSSRKLYRARMMVNLLRLASKTQSMKLGIPQDLP
                     TTNGTLRSRIRLLQKEIKAARSINSRKLNNKLGSYDSTGFNTLAEKPLGRVKYMKRQK
                     VFTWLPTHIWNAKRSHMFKRWGFHLPWSPTQKIFRLTHRLAGNVATSDGAMMCDTSFM
                     CDMIIQCKDHNKLKKLVQQLTKGRASLPKYINRQLFTGLMYLDSECVGPCSLLWCTPN
                     SILIRLHPSIYVQVFGHLNSELDSNEFCVQDCRFSLGSITITGGKSLYALSHILRSAS
                     TSESYRQFKLVSSVTDTTVLPQKIMFAFDAIDPRFLVNPKACSKKSQLTEDDILSLEN
                     QSVEEEISETLNKLVDAEGRNESYRGQSTLKQLAARRAAMKSSTGHSNLIPSNNNDSR
                     IPILLLKEHESQQWTLIIPWFWVLPFWYQLNKVNRVYHMGIKQFQQLAFEQRRLNFPI
                     DYPFTQVGYDEDVVYKKDVLQKLWNRKPPSKRLNYMKLGSLHKESLVKGELGSPFCCD
                     WNFLRILQNGLKFLGKEKLDYMNPSRTSTFDVDSGTISVRHVIDIFKLYEKNRESTSL
                     PVHIFQGTVETIVEHSIISKSLPIIPVSCSLIGRGHPKDHARIYAIPEEDKSYWTNVL
                     KGTLKSNGKIKHDNIQPVPHCFNLIGYLTSGSFNLSQGRGSGVGFVSAYALQDKNENL
                     FLIRNCGETVYRLVKLYQLQI"
     gene            complement(<1293265..>1294491)
                     /gene="AIM6"
                     /locus_tag="KLMA_50612"
                     /db_xref="GeneID:34717203"
     mRNA            complement(<1293265..>1294491)
                     /gene="AIM6"
                     /locus_tag="KLMA_50612"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820615.1"
                     /db_xref="GeneID:34717203"
     CDS             complement(1293265..1294491)
                     /gene="AIM6"
                     /locus_tag="KLMA_50612"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677061.1"
                     /db_xref="GeneID:34717203"
                     /translation="MISPIIATGLLSGYILIMALMLSQISHVSNMKSNGKSDIALDFV
                     RVKRDLIGLYGKDLFEYFKTTLPRLPPTSDFGNSNQPLRRTNISRLYDSFHNYLFFES
                     GTSVVQKLTQDVTIVPNAHSHNDYWRSLPLFEALVYGITSVEADVWLTENDTSLSVSH
                     DRRHIDPKHKTLDLLYTSPILKMLDEVNDKSKDFSGDNDKQSLHGVFYGASSQSLQLL
                     IDFKSEDNSKTYFVLMNKYLRPFVEKNYLSYVDLITNEVVKGPMTIVLTGNYPNETNI
                     LDNSEQGISDEKEGLGFFADNKRYVFLDLPLHDKEAQDKLPTSVLASASLSQLLTSCH
                     SSPYIAKFHGHLSDNEVKCIRTFIEHAKENNLTTRIWGVPEWPVSRRNTLWNQQYYDI
                     QVDYINTDDLKAISEF"
     gene            <1296073..>1297575
                     /gene="GUD1"
                     /locus_tag="KLMA_50613"
                     /db_xref="GeneID:34717204"
     mRNA            <1296073..>1297575
                     /gene="GUD1"
                     /locus_tag="KLMA_50613"
                     /product="probable guanine deaminase"
                     /transcript_id="XM_022820616.1"
                     /db_xref="GeneID:34717204"
     CDS             1296073..1297575
                     /gene="GUD1"
                     /locus_tag="KLMA_50613"
                     /codon_start=1
                     /product="probable guanine deaminase"
                     /protein_id="XP_022677062.1"
                     /db_xref="GeneID:34717204"
                     /translation="MAPITITKNDYYNKQNDISTLESHRPTAHRLIVHYGNFIDTPKL
                     GDLRIRFKCAVGVCSKTGVIKFIVEECEDPISTALQYDECLKESEIFIVSSFENGNTD
                     SFDTFYFPGFIDTHIHASQYPNCGIFGNSTLLDWLETYTFPLESSLTDTALSNLTYDA
                     VISQTLKHGTTCAAYYTTIDSESSKIMAKICKEKGQRAFIGKVCMDQNSPSYYCETLD
                     TCKESSEDVIEYILNELNSPLIKPIITPRFAVACSAELMTFLGQISEKYQLPIQTHLS
                     ENINEIEFVRKLFNDCNSYTDVYHKFGLLTDKSVFAHCIHLSDSEIDLLAANNSGISH
                     CPISNSSITSGECRVKHLLKKGLKVGLGSDVSGGYSVSILENARQALLVSRHLAMSID
                     DPIKKEESKLSVADVLYLATQGGANVLNVNSKIGSFDVGKEFDAQLINLCVHNSNVAI
                     FPWQQVNRSSNFLRKERLKVENIIAKWLFNGDDRNIKSVWIQGKLCHSKT"
     gene            complement(<1297690..>1298325)
                     /gene="SSU72"
                     /locus_tag="KLMA_50614"
                     /db_xref="GeneID:34717205"
     mRNA            complement(<1297690..>1298325)
                     /gene="SSU72"
                     /locus_tag="KLMA_50614"
                     /product="RNA polymerase II subunit A C-terminal domain
                     phosphatase SSU72"
                     /transcript_id="XM_022820617.1"
                     /db_xref="GeneID:34717205"
     CDS             complement(1297690..1298325)
                     /gene="SSU72"
                     /locus_tag="KLMA_50614"
                     /codon_start=1
                     /product="RNA polymerase II subunit A C-terminal domain
                     phosphatase SSU72"
                     /protein_id="XP_022677063.1"
                     /db_xref="GeneID:34717205"
                     /translation="MSSDMSKTKSSSKLKFCTVCASNNNRSMESHKVLKEAGYDVSSY
                     GTGSAVRLPGLSIDKPNVYPFGTPYNDIYNDLLSQSEDRYKQNGLLEMLDRNRKLKKA
                     PEKWHEGKKVFDFVFTCEERCFDSVCEDLMNRGGVMNLIVHVINVDIKDDNENAKIGG
                     RAILRLADMLNAKVSECERNGTQFEDHMMDVFTEWQQEHPKLPLTYSAAYY"
     gene            complement(<1298764..>1300119)
                     /gene="ATG4"
                     /locus_tag="KLMA_50615"
                     /db_xref="GeneID:34717206"
     mRNA            complement(<1298764..>1300119)
                     /gene="ATG4"
                     /locus_tag="KLMA_50615"
                     /product="