GenomeNet

Database: RefSeq
Entry: NC_036030
LinkDB: NC_036030
Original site: NC_036030 
LOCUS       NC_036030            1197921 bp    DNA     linear   CON 23-OCT-2017
DEFINITION  Kluyveromyces marxianus DMKU3-1042 DNA, complete genome, chromosome
            6.
ACCESSION   NC_036030
VERSION     NC_036030.1
DBLINK      BioProject: PRJNA264644
            BioSample: SAMD00067077
            Assembly: GCF_001417885.1
KEYWORDS    RefSeq.
SOURCE      Kluyveromyces marxianus DMKU3-1042
  ORGANISM  Kluyveromyces marxianus DMKU3-1042
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1
  AUTHORS   Lertwattanasakul,N., Kosaka,T., Hosoyama,A., Suzuki,Y.,
            Rodrussamee,N., Matsutani,M., Murata,M., Fujimoto,N., Suprayogi,
            Tsuchikane,K., Limtong,S., Fujita,N. and Yamada,M.
  TITLE     Genetic basis of the highly efficient yeast Kluyveromyces
            marxianus: complete genome sequence and transcriptome analyses
  JOURNAL   Biotechnol Biofuels 8, 47 (2015)
   PUBMED   25834639
  REMARK    DOI:10.1186/s13068-015-0227-x
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1197921)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1197921)
  AUTHORS   Yamada,M. and Kosaka,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2011) Contact:Mamoru Yamada Yamaguchi University;
            1677-1 Yoshida, Yamaguchi, Yamaguchi 753-8515, Japan URL
            :http://ds22.cc.yamaguchi-u.ac.jp/~jo-sei08/index.html
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP012218.
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps and the
            genomic and proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: SPS phrap v. 0.990329
            Assembly Name         :: Kmar_1.0
            Genome Coverage       :: 8.4x
            Sequencing Technology :: Sanger ABI3730
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1197921
                     /organism="Kluyveromyces marxianus DMKU3-1042"
                     /mol_type="genomic DNA"
                     /strain="DMKU3-1042"
                     /db_xref="taxon:1003335"
                     /chromosome="6"
     gene            complement(<4386..>4967)
                     /locus_tag="KLMA_60001"
                     /db_xref="GeneID:34717229"
     mRNA            complement(<4386..>4967)
                     /locus_tag="KLMA_60001"
                     /product="DUP super family"
                     /transcript_id="XM_022820644.1"
                     /db_xref="GeneID:34717229"
     CDS             complement(4386..4967)
                     /locus_tag="KLMA_60001"
                     /codon_start=1
                     /product="DUP super family"
                     /protein_id="XP_022677086.1"
                     /db_xref="GeneID:34717229"
                     /translation="MKGESDNPPQLAYSKLGKDLHRGRFSHIIAEHPVIVCSFIGIIV
                     ILIILCTTLVHDVHYDERDNIWATYTLLIIACITFLVALTSLMFGPFSLMLISETGDV
                     LFFLKLIITGHSWEEIGRIMNSYLFQRGIWSTNSYFYDGQQCYDLFVLYSQKCTDPVI
                     QTFIEQAKNKLVEGITTEWDRTQVPNKSQSSNA"
     gene            <12515..>14089
                     /gene="PYD2"
                     /locus_tag="KLMA_60002"
                     /db_xref="GeneID:34717230"
     mRNA            <12515..>14089
                     /gene="PYD2"
                     /locus_tag="KLMA_60002"
                     /product="dihydropyrimidinase"
                     /transcript_id="XM_022820645.1"
                     /db_xref="GeneID:34717230"
     CDS             12515..14089
                     /gene="PYD2"
                     /locus_tag="KLMA_60002"
                     /codon_start=1
                     /product="dihydropyrimidinase"
                     /protein_id="XP_022677087.1"
                     /db_xref="GeneID:34717230"
                     /translation="MTMKLFDTLIKNGIIVTASDVYPADIAIKDGRIIQIGERISVDS
                     ARDVIDAEGAFITPGGIDAHVHVDEPLKLLGPVVDTMEDATKTAVTGGTTTIIAFATQ
                     NKEYVGEDALSKSVKADVDLYATQNLYCDYALHLILFSVTKPSIKGSSNLDKQLSKVY
                     DDFGVSSVKVFMTYPGLQISDYDILTVMSATRKNGFTTMVHAENGDMVKWMIENLEDQ
                     GLTEPYYHGISRPTIVEGEATNRAIVLAQSLDTPVLFVHVSSPEAIDTIRAAQTKGLK
                     VYAETCPQYALLSDSDTKCHHGTGHSESSDPFIGAKNICSPPLRPEQCQQAVWNGINN
                     GTFTLIGSDHCAYNYYDKTSGKIDAFKNDKNGEFRYIPNGIPGVCTRMPLMFHSVLTG
                     MISDMMTFVKLQCTNPAKLYGLYPKKGSILPGVSDADLVIWYPNSAEPKSYQKRPLTI
                     SNDILNQKCDYTPYEGLQIDNWPRYTLVKGKVVYREGEIVSDSGIGSYVKRSKSSMCS
                     PRNKWLTEWKPKYVNQ"
     gene            complement(<15153..>16679)
                     /gene="yxeK"
                     /locus_tag="KLMA_60003"
                     /db_xref="GeneID:34717231"
     mRNA            complement(<15153..>16679)
                     /gene="yxeK"
                     /locus_tag="KLMA_60003"
                     /product="putative monooxygenase yxeK"
                     /transcript_id="XM_022820646.1"
                     /db_xref="GeneID:34717231"
     CDS             complement(15153..16679)
                     /gene="yxeK"
                     /locus_tag="KLMA_60003"
                     /codon_start=1
                     /product="putative monooxygenase yxeK"
                     /protein_id="XP_022677088.1"
                     /db_xref="GeneID:34717231"
                     /translation="MTESNIIDEGASHLQEPLSKRQKYHDTPKKTLIINAFLMGSAGN
                     QTINSWRNEDDKSSDLFEDPSYWTDLAKLLEKGKFNAVFFADVLGPYDVFKGPGNLEP
                     VAIAGSQFPVSDPSYFIPLMASVTKNLAFGLTISTISEQPYHLARRLGTLDLITNGRV
                     GWNIVTSYLQSASRNLLGADLPSNSERYERAEEFVDVVYKLFLSSWRDGAVLKNKQLG
                     VFTDPKGLRHINHKGKHFTVPGPSFTQPSQQKLPVIIQAGASPKGKELAARNAEVIFF
                     SHLTKEALKAAVEDVKTIAKTKFNRDVSKIKFLCLATVIIGKTHEEAWEKYEEKKKLA
                     DNDDAAAAMFSGWTGVDLSVYGEDDVLDSKEHHAIASNIKKFKDADPSVKKWTKRAII
                     DKIKVSGSGVIFVGTAEEVADAIEDWVTHSDIDGFNFTATSIPTSFEEIINELLPVLR
                     KRGLIQQDYPTSPNGHLTFREQLFGSKFLDPTHTAYNLRWHENESKEEYESRIAESVK
                     "
     gene            complement(<17302..>18951)
                     /locus_tag="KLMA_60004"
                     /db_xref="GeneID:34717232"
     mRNA            complement(<17302..>18951)
                     /locus_tag="KLMA_60004"
                     /product="arylsulfotrans"
                     /transcript_id="XM_022820647.1"
                     /db_xref="GeneID:34717232"
     CDS             complement(17302..18951)
                     /locus_tag="KLMA_60004"
                     /codon_start=1
                     /product="arylsulfotrans"
                     /protein_id="XP_022677089.1"
                     /db_xref="GeneID:34717232"
                     /translation="MKFISTVFSLSAIVSTTVADWQFRSRPDLSAPILNITIPATEET
                     SPGYIFAAPFSGFADRNHHGPRQEGPYIFTDKGELVWSGFGYYSIWATNFQKARYKGE
                     DILFSFEGLHNPYYGHGHGHITLLNKNYETIKELRAGKHKVSDKHEFHIINEKTALIQ
                     IYQPVPADLTPYNATPEQQWIVDSIFQELDIETGEVLYEWSSLEHVSPNDSVLSVTEG
                     QAGAGFNSSDAWDYFHINSVDKDEDGNYLLSARNAASLYKIDGSSGEIIWKLGGLPNI
                     TSSSFDSNFNFSFQHHARWIEQDGSKEIISFYDNSAQGTENGVGNVVSYSPTSSGKVI
                     EVDFKKGNAYLLKYYLPPDNLLSKSQGSIQILPNGNAIVNWGSSGAVTEFNKEETPIF
                     HAYFDSGHLGEKVENYRAFKFNWTGVPHEDIAVFSEYTNDDETKIYVSWNGDTRTKTW
                     KFFTVEEDGSRILLGSTHRTGFETTFTAKKKIDDGILVEAFSADGTKLGSSESVYSQK
                     QVLPYKKSIVSPNSSENTSRAAFLNYFEWKVLAEFLGCPLS"
     gene            <20779..>22215
                     /locus_tag="KLMA_60005"
                     /db_xref="GeneID:34717233"
     mRNA            <20779..>22215
                     /locus_tag="KLMA_60005"
                     /product="UNC93-like protein"
                     /transcript_id="XM_022820648.1"
                     /db_xref="GeneID:34717233"
     CDS             20779..22215
                     /locus_tag="KLMA_60005"
                     /codon_start=1
                     /product="UNC93-like protein"
                     /protein_id="XP_022677090.1"
                     /db_xref="GeneID:34717233"
                     /translation="MLDKNSNLYRVYRSTLTQAFIIGFLSFTQPGVWSAISGLGAGGL
                     QTVKTANTSSAILFAVMFVFSPIFGILINKIGVRPVISIGTIGYVFWSAGLYKNSKDG
                     SQALVLAGAAICGVSAAAFWTGEASVAILYPEQNQRGLFIGIWQVINKIGGLIAGAVT
                     LSLNIKGNKSGSVGLNTYVGLMVIQCLGFPVSFLLSPPEKVIRKNGTVLKPSITNKTV
                     KEEIKNLFRVLRRKEIIGLTPIFLSVVWFNTWQSNYITHHFTVRVRALNSLLTALIPG
                     MTDVVAGLLLDTKFFRRSLKVKISWIVTVSLMTAFFIYSIIIQHQFDTNPEEGIDWTG
                     NARFSRSFIPFQLFKISGELFFNWIYWVVGTYQFSSEEIPHVSAIIRSFESLGQTFAF
                     VVGTTNDNDMTNLAVSAGAFFLSVVPATYVAFLATDDDIQSFAVDPVKSITESDEDSA
                     TGPEITPIQTKDKALLVETVRPLKDDSD"
     gene            <22948..>24639
                     /locus_tag="KLMA_60006"
                     /db_xref="GeneID:34717234"
     mRNA            <22948..>24639
                     /locus_tag="KLMA_60006"
                     /product="uncharacterized sulfatase PB10D8.02c"
                     /transcript_id="XM_022820649.1"
                     /db_xref="GeneID:34717234"
     CDS             22948..24639
                     /locus_tag="KLMA_60006"
                     /codon_start=1
                     /product="uncharacterized sulfatase PB10D8.02c"
                     /protein_id="XP_022677091.1"
                     /db_xref="GeneID:34717234"
                     /translation="MTISDSTIKIENTKPNFIIIVADDLGFSDLSSFGGEIETPNLDK
                     LAKNGFRFTGFHTASACSPTRSMLLSGTDNHLAGLGQMAEYARQFPDLFKDKPGYEGV
                     LNYRVASLAEILSPEYYSFISGKWHLGLEKPYWPSDRGFENSFTLLPDAGNHFKDKLE
                     NKIFLPWIYQENGQPIDPHTFPDNFYSSDYFTDKFLQYLDDTESRKDRPFLGLLTFTA
                     PHWPLQAPPETIQKYKGKYDDGPFALRKRRLQRAKELGILSEEVVPHLVETMREKTWE
                     SLDDEQRRYESKIMEVYAAMVDKLDQNVGRLLDRLEETGEIENTVILFLSDNGAEGML
                     MEALPFGGKTFRERICTDYDNSFENIGKGNSFVYYGDLWAQAATAPKYMYKMWITEGG
                     INCPLILHAPSLRQKWQEDAIIDEFTTVMDILPTILTLADIPHPGDTFKNRQVYRPKG
                     VSWVPYLTKQEDTVYGQNKVVGWELFGQRAIREGRFKAVYIPPPFGEGVWALFDVKDD
                     PGETNNISEQFPDVMERMLDHWSIYKSETGLVEMDDTYFKDVKYEKRVIPDSLEP"
     gene            complement(<25548..>29599)
                     /locus_tag="KLMA_60007"
                     /db_xref="GeneID:34717235"
     mRNA            complement(join(<25548..26305,26425..>29599))
                     /locus_tag="KLMA_60007"
                     /product="flocculation protein FLO9"
                     /transcript_id="XM_022820650.1"
                     /db_xref="GeneID:34717235"
     CDS             complement(join(25548..26305,26425..29599))
                     /locus_tag="KLMA_60007"
                     /codon_start=1
                     /product="flocculation protein FLO9"
                     /protein_id="XP_022677092.1"
                     /db_xref="GeneID:34717235"
                     /translation="MLHWHLLLFAIFANTILCVESEHQNSGTILGCSPDKNSLNGGFE
                     VTYYHYPMVPISGTDCYNWDPTYATKKYQQGGYVDFGGGEIARSSGVTDLSFMASYDD
                     SCYKPKKTKLPSNFNYDREITTTNFSMLITGYFYAPKTGSYEFILNYIDDLAYMNIGA
                     GRAFQCCEKQSSVSKPGAFDLSVMWPQTYNTATVTLLGGYYYPMRIFFVNRQGPAGLS
                     VSFKDADGKVHETFDGYIYNVQDGNACPVPVVTTTVPWTGTATSTFTTLNTVKDNNGN
                     PSTRNIIVVETPDARTATTVFTPWTGTTTATISTDITVTTGPDGSPTVKTIYHVETPE
                     VQQKTTVFTPWTGTTTATIATVLSTTTGADGIETVKTIYHVETPEVQQKTTVFTPWTG
                     TTTATIATVLSTTTGADGIETVKTIYHVETPEVQQKTTIFTPWTGTTTGTIATVLSTT
                     TGADGIETVKTIYHVETPEVQQKTTVFTPWTGTTTATIATELSTTTGADGIETVKTIY
                     HVETPEVQQKTTIFTPWTGTTTATIATVLSTTTGADGIETVKTIYHVETPEVQQKTTI
                     FTPWTGTTTATIATVLSTTTGADGIETVKTIYHVETPEVQQKTTIFTPWTGTTTGTIA
                     TELSTTTGADGIETVKTIYHVETPEVQQKTTIFTPWTGTTTGTIATVLSTTTGADGIE
                     TVKTIYHVETPEVQQKTTIFTPWTGTTTGTIATVLSTTTGADGIETVKTIYHVETPEV
                     QQKTTVFTPWTGTTTATIATELSTTTGADGIETVKTIYHVETPEVQQKTTIFTPWTGT
                     TTGTIATELSTTTGADGIETVKTIYHVETPEVQQKTTIFTPWTGTVTATIATDLSTIT
                     GANGIETVKTIYHVQTPEVEVATTVFTPWTGTVTATVATDISTSTGANGIETVVTIYH
                     VQTPEVEIATTVFTPWTGRFTSTYSTRVTSIVASNEEPQVNIIYYVETPVISASAFRY
                     SNSSSVVGSTIPSKSSPLTFTPGIVQTGTSTKFEDRIPSSSAGMSMESEYSTYSFDLS
                     SQTTEEDQQITTTVSLQPSNTYASTGFGSSSQTDSSTNSIGSFTLTSSTIAESSLTAY
                     SVDSSTLTDVKSESPEISEAQTSTSNYSSTDSTITLPGTTAFMEYTISTVVTTISGIA
                     TTYTTYCPLSSSSTSTVAETDIITSLAPSYSPNLDQYSQPTENSSSQPSQLQESSVLS
                     LMTNSITPEMSLTNSLQATPTTSISVQSSDSFTGKENVSKHTGYEQGNTSTIILPSAS
                     TLSSIASRSHVTLASIGGFSSDVQQTMYEGKSNKLLVSPLIAVVLALL"
     gene            complement(<32716..>35433)
                     /gene="HUL5"
                     /locus_tag="KLMA_60008"
                     /db_xref="GeneID:34717236"
     mRNA            complement(<32716..>35433)
                     /gene="HUL5"
                     /locus_tag="KLMA_60008"
                     /product="probable E3 ubiquitin-protein ligase HUL5"
                     /transcript_id="XM_022820652.1"
                     /db_xref="GeneID:34717236"
     CDS             complement(32716..35433)
                     /gene="HUL5"
                     /locus_tag="KLMA_60008"
                     /codon_start=1
                     /product="probable E3 ubiquitin-protein ligase HUL5"
                     /protein_id="XP_022677093.1"
                     /db_xref="GeneID:34717236"
                     /translation="MMNFTGQTNRRTVNMGSRVPRKTKDTILRNAELERIRRQREKAE
                     MVAILTIQRHMRKRISNKTTYHSLIKRNDNDGMMTAFLKVFAKRLYSYLEPDDFIYLV
                     KATNNQASVLPVLSDILGDVAARKSSQELDELLILSVKPLDIPNASEHHINNKIKFIQ
                     NCSYELSDRQVIDILTPYSNYKEYDLYWNDLYFIEKGTVLIVRNYELFVNTLFSSEYN
                     AHIESVLERHKQNLSNFLINFLNAFESINANHRRMLTLIFMTICSEMIEPLNEISSLI
                     TDSFQTDLLKCFEWLEDKAHMYWKGLHYLVSQMSSMQRNSVFMLLLTDSHIRNHLIDL
                     ICDHFSDASMEAFSIFAQTLNFYIPLSPDDHLFQTVISRERLQSVSINIAQFLVSDIL
                     SSGTFIPLQELETFIELMWNLIYLDSRAKFLNEGTSTFWGLVPEEIHNLNIRKEILEF
                     EQYYRDFLKNIEEMDLNEDELFDRKKMMDQTIKKQYLDDLRYKRRGASNKVKKLELLF
                     RFPFMLKFFERVDYFNDLIEADKERIYNKNNFFGIFPGENRLRATIRRDHALEDAYNA
                     YGSIGEGFKEKLSIQFINEFGPEAGIDGGGITKEFLQTLIQEAFIKGSFGLFEVTSFH
                     KLYPSKDVSPQNLKYISFMGKVLGKCLYENILVDVEFADFFLKKILNVENNMNVPFND
                     LYSLDPEYYKNLMKLLEMSEDELNYMDLYFEVPDMPNGRRIPLIKDGLSVKVTQKNVF
                     EYITRISHYKLNLQLYTVTSRFISGLSYMIPPHWLRMFTSYELKTLISGSEKDFDLED
                     LRKNTEYGGFTDDSITIQHFWMALSSFTPEERRKFLKFVFSVPTAPLKGFHSLNPLFG
                     IRNAGDETNRLPTASTCINLLKLPDYKDYNTLREKLLTAINSDSRFELS"
     gene            <35643..>37460
                     /gene="GPI10"
                     /locus_tag="KLMA_60009"
                     /db_xref="GeneID:34717237"
     mRNA            <35643..>37460
                     /gene="GPI10"
                     /locus_tag="KLMA_60009"
                     /product="GPI mannosyltransferase 3"
                     /transcript_id="XM_022820653.1"
                     /db_xref="GeneID:34717237"
     CDS             35643..37460
                     /gene="GPI10"
                     /locus_tag="KLMA_60009"
                     /codon_start=1
                     /product="GPI mannosyltransferase 3"
                     /protein_id="XP_022677094.1"
                     /db_xref="GeneID:34717237"
                     /translation="MAVKVPLKSLLPVLIAIRCLQSLLMRTFFQADEFWQSLEPAHYM
                     AFGYGELTWEWKFGLRSYAFPLIFQIGYTLVKYVAVLGCVVIQTAVDWFVLFVSTVIP
                     NSDLGWQMVKEMRSFPLEIKEFIEYHGVIYVPKLIMGLLAAIGEYYTILLADKLYKLA
                     MDKTGENTKDDKEHARVVNLTLIFTISNFFNCFFITRTFINSFEMIMTSVALYYWDWT
                     SGKNIQNADFMKSLIIGTFTSLQRPTNAFIWIILGSFMIFNLVKSGSWITLIMLFRKV
                     ILATGLSTTLNICCDYYFYGYITIPVLKFIKFNCTTPLSEFYGVAPWHFHLVQSLPIV
                     SGYLLPLLLHSILCPLTTKRFVSSFVNPFHQFKTIIIINIALYSMIPHKEFRFIYPLQ
                     PFIVLLSVFDAVWVWKKLESKVVNLRQAWLKNSVYRILWILPAISMVISLILSTFHEA
                     GSVSVIDYLHSLKRIDSLGFIMPCHSTPWQSHLHRNDIKDLWAITCDPPLHLLNDPDA
                     HLKLPYYMDESDYLYDDIPKFIHEHFPPLTWKGHKRTSKRYSHEWPEYLVVFEHMDYT
                     FMQEFLADSVYVESRRFFNTLSHWDNRRSGDIIVYHKIL"
     gene            complement(<37575..>38717)
                     /gene="MSS2"
                     /locus_tag="KLMA_60010"
                     /db_xref="GeneID:34717238"
     mRNA            complement(<37575..>38717)
                     /gene="MSS2"
                     /locus_tag="KLMA_60010"
                     /product="protein MSS2"
                     /transcript_id="XM_022820654.1"
                     /db_xref="GeneID:34717238"
     CDS             complement(37575..38717)
                     /gene="MSS2"
                     /locus_tag="KLMA_60010"
                     /codon_start=1
                     /product="protein MSS2"
                     /protein_id="XP_022677095.1"
                     /db_xref="GeneID:34717238"
                     /translation="MLKLRGVFPTLSTRFASSLIRQRPAFHEVFPQKKMVNRLLFELD
                     SRLTFNKLYPVYESIYESLDKSTDASIPNGFTGKDLMIMKKVIEKIRHKTKTINKNLL
                     ALENEILDLAAERGDNDAISLLCFDVLKDPSHNSDEDVAHAKRLIKELYKKEHPLTVK
                     LTADIALLNSDDTTAEKYYLKFLDLQNDTFLAGEVYGQLGQIHFRKPDLVKAEQCFLK
                     AIKLCPIDYSVRSYFLLGQIYINNDVFKARSLIESSATQGFRESFKTLGLLEMNYFKN
                     YPKAQEWFKLGMELYDIQCYIGYFDCAMFSDDLLLAKKCFESFTKLSESNQDIKKLFE
                     TFCAHRVDDIKRVNDYILPSSTLNPLPNVAASNAKTDVSKSNTWNL"
     gene            <38975..>40177
                     /locus_tag="KLMA_60011"
                     /db_xref="GeneID:34717239"
     mRNA            <38975..>40177
                     /locus_tag="KLMA_60011"
                     /product="L-2-hydroxyglutarate dehydrogenase"
                     /transcript_id="XM_022820655.1"
                     /db_xref="GeneID:34717239"
     CDS             38975..40177
                     /locus_tag="KLMA_60011"
                     /codon_start=1
                     /product="L-2-hydroxyglutarate dehydrogenase"
                     /protein_id="XP_022677096.1"
                     /db_xref="GeneID:34717239"
                     /translation="MTFHMHISRGLLNRPLFSRLYSKSVDYSHAVIGGGVVGLAIANE
                     LTKVEGNKVLVVEKNIAVGMETSSRNSEVIHAGLYYPVDSLKTKFCIEGNHIIYNELN
                     PRKTGVDWSKCGKWVVAQTDYDDAYVERMFLKAKYELGLPVSIIPNHQTKWYEPAVQV
                     ERSALVSPTTGIIDSHSLMDYLSTMIEEQGGEIAIGTQVVDIQYLGDKYAILCRETVN
                     DANEEVEIQVENVVNAAGLHADKVANMILPKERHVKQYYAKGNYFTLKTPTPAVRRLI
                     YPVPPRNNKSLGTHLTIDLNNQIRFGPDLEYVDSVDDLSPNNKNIDEAAKAILRYFPH
                     IQPQDLEASYAGIRPKLAAPGDKEFKDFYIKEEEGFPGFVNLLGIESPGLTSAIPIGR
                     YVKDMYHA"
     gene            complement(<40223..>41155)
                     /gene="KIN28"
                     /locus_tag="KLMA_60012"
                     /db_xref="GeneID:34717240"
     mRNA            complement(<40223..>41155)
                     /gene="KIN28"
                     /locus_tag="KLMA_60012"
                     /product="serine/threonine-protein kinase KIN28"
                     /transcript_id="XM_022820656.1"
                     /db_xref="GeneID:34717240"
     CDS             complement(40223..41155)
                     /gene="KIN28"
                     /locus_tag="KLMA_60012"
                     /codon_start=1
                     /product="serine/threonine-protein kinase KIN28"
                     /protein_id="XP_022677097.1"
                     /db_xref="GeneID:34717240"
                     /translation="MTLNPVADDYTKEKKAGEGTYAVVYLGTKKSTGRQIAVKEIKTS
                     QFKDGLDMSALREVKFLQELKHDNIIELIDVFMSNDNLNLVLEFLPADLEIIIKDTSI
                     MFTQADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPNGQLKIADFGLARLMASP
                     QEVLTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQIG
                     VTFRALGTPTDKDWPEVSSFSGYNKIQIYPPPSREELRKRFIAATENALDLLDGMMTM
                     NPIKRWDAIQCLQSQYFRELPEPTLPQDLPKLNK"
     gene            <41628..>42659
                     /gene="MRF1"
                     /locus_tag="KLMA_60013"
                     /db_xref="GeneID:34717241"
     mRNA            <41628..>42659
                     /gene="MRF1"
                     /locus_tag="KLMA_60013"
                     /product="peptide chain release factor 1"
                     /transcript_id="XM_022820657.1"
                     /db_xref="GeneID:34717241"
     CDS             41628..42659
                     /gene="MRF1"
                     /locus_tag="KLMA_60013"
                     /codon_start=1
                     /product="peptide chain release factor 1"
                     /protein_id="XP_022677098.1"
                     /db_xref="GeneID:34717241"
                     /translation="MLSQGGSFDLEKQKKFAKLSTIVDAYSKYQEDLKQYNELQEIVQ
                     LDPSLKEEAESDIAVLLPELDKTGKSLASKLLPPHPFAEKPSILELRPGVGGSEAMIF
                     TQDLLNMYINYANYHKWKWSLISKTENASGTGVLEAILNIDEPGSYDKLKFEAGVHRV
                     QRVPATETKGRTHTSTAAVVVLPKMGEESESDAYERTFKPDEIRIDVMRASGKGGQHV
                     NTTDSAVRLTHYPSGIVISMQEERSQHRNKAKAFAILRARLAEKERLEKEEKERNARK
                     DQVSSTDRSDKIRTYNYPQNRITDHRCGYTLYDIEGVMKGERLDDVIDALEMFDADQK
                     SKLLLEEMS"
     gene            <42856..>44904
                     /gene="ROG1"
                     /locus_tag="KLMA_60014"
                     /db_xref="GeneID:34717242"
     mRNA            <42856..>44904
                     /gene="ROG1"
                     /locus_tag="KLMA_60014"
                     /product="putative lipase ROG1"
                     /transcript_id="XM_022820658.1"
                     /db_xref="GeneID:34717242"
     CDS             42856..44904
                     /gene="ROG1"
                     /locus_tag="KLMA_60014"
                     /codon_start=1
                     /product="putative lipase ROG1"
                     /protein_id="XP_022677099.1"
                     /db_xref="GeneID:34717242"
                     /translation="MLKLNDDHDGQKDENNIVTLTSHQRAILGPIMTTSDHDVVYHYQ
                     SSLRIGELERYVISYELYMGDEIPTDLTLDSLWLKIKNMESMTLRAAYLMGPYVLYAD
                     VRCEDYHHGQRLFISADQPQFEPNIQPQQSFVAELSLHNLKKKYVWIVDVASQILFTK
                     QSAVHFSITVGGNRDSIKGDFAGNPKLGVQSPRVQVDRLTTTDLWNTSLLAANHRLNK
                     KEHLVILTHGLHSNLCADLFYLKEQIEKTQKQHDEELVVSGFTDNVCKTEKGVKWLGT
                     RLAEHIVHNLYNERTVKISFIAHSLGGLVQSFAIAYISYNYPWFFEKIEPVNFIVMAS
                     PMLGTVSDNAVYIQRLLAMGIVGKTGQDLSLQKYAGLEEPLLLLLSKSSALKRVLKYF
                     RNVTAYANACNDGIVPLYTAALLYLDYDDILEKLDIGAEELQTDFFQRNIVSPLNKAI
                     NILVPQRVSQNGAKIPVASILDSAYSVLIPPLPDRTYITDPTSRKEVIVHDKVYSEDN
                     IPQEKTKTQEDMMNSTNVLLKTFNKAFGGQYKNLEEEIARNWHDGVKWRKVIVNLKPD
                     AHNNIITRRRFPNAYGWPVIDHLKRTHFSGSPRTERTWKLDPIAEDEDFDWIIKPTVD
                     SVFDVGPTGMICTFGEMLENLKSSTLEGISDRMSSSTYSQEDLFKYEQDLEREGGIFP
                     "
     gene            complement(<44911..>46950)
                     /gene="TIP20"
                     /locus_tag="KLMA_60015"
                     /db_xref="GeneID:34717243"
     mRNA            complement(<44911..>46950)
                     /gene="TIP20"
                     /locus_tag="KLMA_60015"
                     /product="protein transport protein TIP20"
                     /transcript_id="XM_022820659.1"
                     /db_xref="GeneID:34717243"
     CDS             complement(44911..46950)
                     /gene="TIP20"
                     /locus_tag="KLMA_60015"
                     /codon_start=1
                     /product="protein transport protein TIP20"
                     /protein_id="XP_022677100.1"
                     /db_xref="GeneID:34717243"
                     /translation="MLKSVEDLIQIDVHINEVNSKRDALAEKIKQLKDAEDVFVDEMD
                     HIEKRLNDATLEISQIEKIEDIEPLRAKYGKLKILDQIETSFKEQQRALHEKEVLEGI
                     NSLNVEDFENGSFDSLINLKKIITTYDIGSGLVLNKYNAFIESLSTKLMSSFKQELLN
                     SKWDTEYFVKSKKIVLDLRRQSSALFNLQKHLLTDPSIQSKSESQVEQDKCAQQYWNL
                     QCISHNFFIKFMYHFSNPKFDDSGQQKQSIELYFKFLDRYLEANLFRCIDIFHDEEAG
                     LTKEFLHEQFINHTLNPIRNKVTQTLTNISENQNQENLRTMIILISQIFINDNALSKK
                     HFYSGVGLVSLLPNNILEAWLEFELDSTLRQYEKIISSPLSTNGTDLVKLLENMYGYF
                     EPCFNIEYGNLESYKLQIVSRIFLELISSYNKFIVSADPALAQLPEEKQLEVTFLKLH
                     NIILLEEYVSKLRFKPAFIELTFTFNKLSGSSYTSIFSESLGSLEETIVTIRESIVHR
                     WKKILKYSLNPYFRLSTWHDFSTNPNQCSTELINAIQKCTQLKNSFNELEFPNSISIS
                     IMTSLLSQWVSYLKDYVVKVNSFSDQGLKQVTIDYKELSNVFKIESLPPSVEEMEFEE
                     FLTVLGIKDEKKDIKLPFLTKSYMSHSDDYSEVRSALDLKYISKSELRYALYKIL"
     gene            47581..47653
                     /locus_tag="KLMA_R601"
                     /db_xref="GeneID:34718760"
     tRNA            47581..47653
                     /locus_tag="KLMA_R601"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718760"
     gene            complement(<47931..>48848)
                     /gene="ASF1"
                     /locus_tag="KLMA_60016"
                     /db_xref="GeneID:34717244"
     mRNA            complement(<47931..>48848)
                     /gene="ASF1"
                     /locus_tag="KLMA_60016"
                     /product="histone chaperone ASF1"
                     /transcript_id="XM_022820660.1"
                     /db_xref="GeneID:34717244"
     CDS             complement(47931..48848)
                     /gene="ASF1"
                     /locus_tag="KLMA_60016"
                     /codon_start=1
                     /product="histone chaperone ASF1"
                     /protein_id="XP_022677101.1"
                     /db_xref="GeneID:34717244"
                     /translation="MSIVSLLGIKVLNNPAKFTDPYEFEITFECLEPLKHDLEWKLTY
                     VGSSRSLDHDQELDSILVGPIPVGINKFKFVADAPSPDLIPASELVSVTVILLSCSYN
                     GKEFVRVGYYVNNEYDLEELRENPPQKVPIDHVVRNILAEKPRVTRFNIVWDNEGEEE
                     FYPPEQEEPEEEEDDEEEEEEEDEQDEQEQDEDEGEAIEEDIEEDIEEDIEEEEAEEE
                     EAEEAEEEAEEEAEEAEEDEEDEEAESEDEQSGPQKKKLKLKSDSSNQPKEDEIDSQS
                     KSTAQKESKDVEDENNVDLPTPQDTTQHK"
     gene            complement(<49305..>50390)
                     /locus_tag="KLMA_60017"
                     /db_xref="GeneID:34717245"
     mRNA            complement(<49305..>50390)
                     /locus_tag="KLMA_60017"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820661.1"
                     /db_xref="GeneID:34717245"
     CDS             complement(49305..50390)
                     /locus_tag="KLMA_60017"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677102.1"
                     /db_xref="GeneID:34717245"
                     /translation="MTGVVAIGVVAAILANALQALGLVFQRKAECIVLFQCAADDPHG
                     LITVPPRRLVYKNTTWRLGFCLFLVANLFGCVIQIATLPLLILAPLQASGLVFNSLFS
                     HLILYEPFPIFPTLLVCFGGTIMASMSCMFVNTPLTHTFQELLELAGSETFVRYFALT
                     NTLACLSLVIGFAARRKGIKGFSLVFASGIWSAHALLIAKCVSDVIVTEWAISLHFIA
                     LLMILVTFSLTQLYLLNVGLSHLSTSILYPFVFSIYNLTTILNSTMFYRDSLVPHTAE
                     ILYPGLAFGFLILTLGVATISKRIYNFEEALVPGSKHGFSSHSHSPSASSSSSTAAVL
                     SYGSLNSTRPLSQELTQEQSTYTSLAV"
     gene            <52793..>53938
                     /gene="UTH1"
                     /locus_tag="KLMA_60018"
                     /db_xref="GeneID:34717246"
     mRNA            <52793..>53938
                     /gene="UTH1"
                     /locus_tag="KLMA_60018"
                     /product="protein UTH1"
                     /transcript_id="XM_022820663.1"
                     /db_xref="GeneID:34717246"
     CDS             52793..53938
                     /gene="UTH1"
                     /locus_tag="KLMA_60018"
                     /codon_start=1
                     /product="protein UTH1"
                     /protein_id="XP_022677103.1"
                     /db_xref="GeneID:34717246"
                     /translation="MSIAASAVIAAPAQGSKHIHHKDKRAAVTVTQYMDQNGNVIADP
                     GAVATVADQVGEKNVVQATSSAGAQTTLSPTTTTSEESAPTSTSSSAPSSSSSSSGSS
                     SSSGSSGVDGDLSNFSGPTEEFQDGTISCSDFPSGQGVVAVDWIGMGGWASIMDMDGN
                     TSNSCKDGFYCSYACQAGMSKTQWPDQQPSDGKSVGGLLCKNGKLYRSNQNSKYLCEW
                     GRQSANAVNKKDSPIALCRTDYPGSENMVVPTVVQGNSNKPIAVVDEDSYYKWQGKAT
                     STQYYVNNAGVSVEDGCIWGTAGSGVGNWAPVVLGAGYINGITYLSIIPNPNNKDAPN
                     YSIKIEAADGASVNGECSYIDGNYSGGSGSDGCTVSVTSGTANFIFY"
     gene            complement(<54862..>55677)
                     /gene="SHB17"
                     /locus_tag="KLMA_60019"
                     /db_xref="GeneID:34717247"
     mRNA            complement(<54862..>55677)
                     /gene="SHB17"
                     /locus_tag="KLMA_60019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820664.1"
                     /db_xref="GeneID:34717247"
     CDS             complement(54862..55677)
                     /gene="SHB17"
                     /locus_tag="KLMA_60019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677104.1"
                     /db_xref="GeneID:34717247"
                     /translation="MSKVTPRCIIVRHGQTEWSKSGQFTGLTDIPLTPYGVAQMKRTG
                     QAIFGHKFINPDHITYIFTSPRQRARQTVGLVLESLTEEQRSKIRIVVDEDLREWEYG
                     DYEGLLTHEIVQLRKSRGLDQERPWKIWRDGCENGETTQQIGCRLSRVIARIQNLHRQ
                     HQKEGRESDIMVFAHGHALRYFAALWIKSGVEVAYDKSFDPAEPTYHDETVADVPLKT
                     FRHLVDNPNYLLDAGGIGVLSYSHHNIDEPALALAGPFVPPPEEQSEHEPVVE"
     gene            complement(<56303..>57190)
                     /gene="PHO86"
                     /locus_tag="KLMA_60020"
                     /db_xref="GeneID:34717248"
     mRNA            complement(<56303..>57190)
                     /gene="PHO86"
                     /locus_tag="KLMA_60020"
                     /product="inorganic phosphate transporter PHO86"
                     /transcript_id="XM_022820665.1"
                     /db_xref="GeneID:34717248"
     CDS             complement(56303..57190)
                     /gene="PHO86"
                     /locus_tag="KLMA_60020"
                     /codon_start=1
                     /product="inorganic phosphate transporter PHO86"
                     /protein_id="XP_022677105.1"
                     /db_xref="GeneID:34717248"
                     /translation="MPVVKQADARLNEPIDKDAPPTIYGTTLKPEYSNAALNLSVDFV
                     KQQCALLNKRLFWHPVTIFSTLVCGVIFLASQSHFPGHANHVTGWLYQYFLMNKKELV
                     TFFLVIIISASSVISLLSKVTEIVFKRKSKLIVDTKGQIIYGVDLMKLAQGEIQDKTA
                     LENTEIIVYRDTPIALVSILENKTLSKPDSLVMGVSTIGARRVYLKSGILEDLIDWAL
                     IRTKNYQKEHPKYKHGKSMKLLIDVYSFEKDTKKTLARKGFSMIESYKLPENKFLASM
                     FGIKKELWGIQFHFEAKKE"
     gene            complement(<57902..>59614)
                     /gene="CPS1"
                     /locus_tag="KLMA_60021"
                     /db_xref="GeneID:34717249"
     mRNA            complement(<57902..>59614)
                     /gene="CPS1"
                     /locus_tag="KLMA_60021"
                     /product="carboxypeptidase S"
                     /transcript_id="XM_022820666.1"
                     /db_xref="GeneID:34717249"
     CDS             complement(57902..59614)
                     /gene="CPS1"
                     /locus_tag="KLMA_60021"
                     /codon_start=1
                     /product="carboxypeptidase S"
                     /protein_id="XP_022677106.1"
                     /db_xref="GeneID:34717249"
                     /translation="MALKDGIHAPDGTHKVKFLVLAILALSVASFHLGYQHLTEAHQQ
                     SSSVLGPKCDNPASVQPPSYKNGNGNGTVEVITYDPEYRVQAVEKLLGSVRIPTESFD
                     THLDPSEYPEQYKNFTRLHEYFRKTYPEVYKVLKVEKTKYEYSMVYIWEGSEPSLKPL
                     VLAGHQDVVPVNAETLDQWEYPPYDGVYDGTNVYGRGVSDCKSVVNSVLESIELLIKE
                     GVTPKRTLVLAFGFDEEVGGGYGAQTINEFLLEKFGPDGIYAIVDEGGNAVEKLDDTY
                     FALPAVGEKGSINSVIQLNTKGGHSSAPPENTGIGIMADLIHTIESEPFEPYIDVSNP
                     FLKYLYCMVEHTTKDDIGLPRDDIAKFEHDKDANKNVVEWVNGNTKFKWLAKTTQAAD
                     IFHSGIKVNALPELSTLFINHRINIGSTCQQTQDKIKKQVTAIAQKYGLGLTIKDEVI
                     IQDNAGIGSFVYDTTECLEPAPITPTTGNPVWDTFAGTVRHILEDITYPGAKVVVAPS
                     ITTGNTDTAKYWNLTKNIFRYRFSIQNAVLEGHIHGVNETMPADSYLNMIAFYYEYIQ
                     NACQ"
     gene            complement(<60254..>61144)
                     /gene="PET10"
                     /locus_tag="KLMA_60022"
                     /db_xref="GeneID:34717250"
     mRNA            complement(<60254..>61144)
                     /gene="PET10"
                     /locus_tag="KLMA_60022"
                     /product="protein PET10"
                     /transcript_id="XM_022820667.1"
                     /db_xref="GeneID:34717250"
     CDS             complement(60254..61144)
                     /gene="PET10"
                     /locus_tag="KLMA_60022"
                     /codon_start=1
                     /product="protein PET10"
                     /protein_id="XP_022677107.1"
                     /db_xref="GeneID:34717250"
                     /translation="MSVPVKKQRSRSSSSVKLVVDKPVTDKFATQYASINHLNKYPVV
                     MRWINTILCLPLVSRVLSTISLIVFQFKTKVIDSGKTPAVVKKLFNYSVAGLKKLDEF
                     VNTMVFREGIDAFLNEYREHGSLGWWIAYFTVDYYANLVNYLVKEFILKPLSLIKDDA
                     SSRVSLAAASSSTALPHFKELTNTTKDVLEPTKEKVFAKYDTLVKPAKETYTHAISTA
                     KETYSTAYKTVSEKYDTNLKETDSVPRAILTTGSDLGSLTLERLKKYNDSEENSVVAD
                     GTTTTVDSDPPVNNIKELST"
     gene            complement(<62333..>63592)
                     /gene="NAP1"
                     /locus_tag="KLMA_60023"
                     /db_xref="GeneID:34717251"
     mRNA            complement(<62333..>63592)
                     /gene="NAP1"
                     /locus_tag="KLMA_60023"
                     /product="nucleosome assembly protein"
                     /transcript_id="XM_022820668.1"
                     /db_xref="GeneID:34717251"
     CDS             complement(62333..63592)
                     /gene="NAP1"
                     /locus_tag="KLMA_60023"
                     /codon_start=1
                     /product="nucleosome assembly protein"
                     /protein_id="XP_022677108.1"
                     /db_xref="GeneID:34717251"
                     /translation="MSRPIKTTRSSKIDNAPTPHNTPASVLKDSYLKKKQQEQDQEDE
                     SQYNESPSLSRINEKLEVLNIDEESEDAEFDEEHGFEKLPKAVNNRILALKAIQSDLF
                     ELEKNFQLEMLELEQKYLQKYEPLHQHRFELIAGLKDATEEEIKKGRSLGDAAEKGEG
                     EEAGDEADDEETGDYNLDIVGIPCFWLTAMENLPMVSQNLTERDCDVLTYLSNITLKY
                     LTEGKPGFQLIFTFDKDNEFFTNETLTKTYYYQSELGYSGDFIYDHAEGEVIQWVDND
                     HNVTVTVERRKQKNKTTKQIRTIEKLTPVESFFNFFDPPKALDPENDDEELDEEEVAE
                     LESRLAVDYAVGEEIKDKLIPRAVDWFTGAALEFEYGDVEEEDDEDVTSEFQDEDEDD
                     DEEEEEEDDFANKDALKKVQPPECEQS"
     gene            <64301..>65011
                     /gene="RPE1"
                     /locus_tag="KLMA_60024"
                     /db_xref="GeneID:34717252"
     mRNA            <64301..>65011
                     /gene="RPE1"
                     /locus_tag="KLMA_60024"
                     /product="ribulose-phosphate 3-epimerase"
                     /transcript_id="XM_022820669.1"
                     /db_xref="GeneID:34717252"
     CDS             64301..65011
                     /gene="RPE1"
                     /locus_tag="KLMA_60024"
                     /codon_start=1
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="XP_022677109.1"
                     /db_xref="GeneID:34717252"
                     /translation="MVQPIIAPSILASDFCNLGCECHKVINSGAEWLHIDIMDGHFVP
                     NMSLGQPVVESLRKVIGKYNDPDTKLPKAFFDCHMMVSEPEKWVEDFARIGCDQFTFH
                     YEATKDPKGLVELIKKHGMKAACAVKPGTPVDVLYELAPELDMALVMTVEPGFGGQKF
                     MSDMMSKVKDLRERFPTLNIQVDGGLGKQNVEQASEAGANVIVAGTSVFRSDDPADVI
                     GFMKSKVKDALVAKDLLA"
     gene            complement(<65197..>65682)
                     /gene="ALB1"
                     /locus_tag="KLMA_60025"
                     /db_xref="GeneID:34717253"
     mRNA            complement(<65197..>65682)
                     /gene="ALB1"
                     /locus_tag="KLMA_60025"
                     /product="ribosome biogenesis protein ALB1"
                     /transcript_id="XM_022820670.1"
                     /db_xref="GeneID:34717253"
     CDS             complement(65197..65682)
                     /gene="ALB1"
                     /locus_tag="KLMA_60025"
                     /codon_start=1
                     /product="ribosome biogenesis protein ALB1"
                     /protein_id="XP_022677110.1"
                     /db_xref="GeneID:34717253"
                     /translation="MPSKNSINRPKQKVNLNRKIHQRAAKRDAMERKGLLAPARSSEL
                     SKSGQLKSVPLDLYKGERLSQGPTTTHTLSKKRAKKIERNLKYVEQRKLLLDLQSQSE
                     QNGGMQIDAVSSTKKEKVVKKGQLEKMREAISGVLEDIQSQGLTLHTEAGTTLGGQYF
                     I"
     gene            <66463..>67659
                     /gene="MTC1"
                     /locus_tag="KLMA_60026"
                     /db_xref="GeneID:34717254"
     mRNA            <66463..>67659
                     /gene="MTC1"
                     /locus_tag="KLMA_60026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820671.1"
                     /db_xref="GeneID:34717254"
     CDS             66463..67659
                     /gene="MTC1"
                     /locus_tag="KLMA_60026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677111.1"
                     /db_xref="GeneID:34717254"
                     /translation="MTSDADDVLEFLDSLPTTNVKGKGKGTNAGGHDEDIMDFLDELE
                     NSNLDIKKKPSNKEASKPKEEAAKAAKQEENKAAAEVKTEEVAQPEPKEEQEKEKDGE
                     DDHEEAVQDPISSISNWWSSSGSATVSSFWNKTTEQANQIKERIATQDGNLKINDIGA
                     KLTALQGSQVISGLTSQLTKIVIGETDEVIRIHLVHDLQNLDQETITYQVEEKFERVL
                     SQQVQGGIRIFADEWDHGKAIDDKINMNIFQGKAADGEKLCLANLENATKTWETSRKQ
                     ARRASNPVSKVSDLFISILACEIPGKSEEEEASSPVIVDASKQNNFHFIIILKDISND
                     ILLIVRSQGYPSKWANWLQSGSVSDEELSDKIDPSDWVKPWISEGLELTFSILAQQYV
                     ISRMGL"
     gene            complement(<67751..>68146)
                     /gene="FMP46"
                     /locus_tag="KLMA_60027"
                     /db_xref="GeneID:34717255"
     mRNA            complement(<67751..>68146)
                     /gene="FMP46"
                     /locus_tag="KLMA_60027"
                     /product="putative redox protein FMP46"
                     /transcript_id="XM_022820672.1"
                     /db_xref="GeneID:34717255"
     CDS             complement(67751..68146)
                     /gene="FMP46"
                     /locus_tag="KLMA_60027"
                     /codon_start=1
                     /product="putative redox protein FMP46"
                     /protein_id="XP_022677112.1"
                     /db_xref="GeneID:34717255"
                     /translation="MSMFRTIQKQPRVVTLFTHNLESSHARSLLTVLRSDQSNKFDIE
                     ICQNFPTKDQLEYLSQIDKINLMKQIPRAETLLRKPAENPIFGSPLQKCVNKEGYWNK
                     SSSMWVDWEKAVLGTTAESLKSKLMQKLN"
     gene            <68854..>69390
                     /gene="LSM1"
                     /locus_tag="KLMA_60028"
                     /db_xref="GeneID:34717256"
     mRNA            <68854..>69390
                     /gene="LSM1"
                     /locus_tag="KLMA_60028"
                     /product="sm-like protein LSm1"
                     /transcript_id="XM_022820674.1"
                     /db_xref="GeneID:34717256"
     CDS             68854..69390
                     /gene="LSM1"
                     /locus_tag="KLMA_60028"
                     /codon_start=1
                     /product="sm-like protein LSm1"
                     /protein_id="XP_022677113.1"
                     /db_xref="GeneID:34717256"
                     /translation="MSTSSPSSERAVSAEIADTSSNSDENRPKSKLSEGEADLYLDQY
                     NFTTTAAIVGSVDRKIFVLLRDGRMFFGVLRTFDQYANLILQHTVERIYIEGENKYGE
                     CDRGVFMIRGENVVMLGEVDIDKEDIPLESMERVPFEVAQSHKEKMDELKYKQNTAKG
                     KKLAQLGLATDFNKGDLY"
     gene            complement(<69948..>71345)
                     /gene="ACAD11"
                     /locus_tag="KLMA_60029"
                     /db_xref="GeneID:34717257"
     mRNA            complement(<69948..>71345)
                     /gene="ACAD11"
                     /locus_tag="KLMA_60029"
                     /product="acyl-CoA dehydrogenase family member 11"
                     /transcript_id="XM_022820675.1"
                     /db_xref="GeneID:34717257"
     CDS             complement(69948..71345)
                     /gene="ACAD11"
                     /locus_tag="KLMA_60029"
                     /codon_start=1
                     /product="acyl-CoA dehydrogenase family member 11"
                     /protein_id="XP_022677114.1"
                     /db_xref="GeneID:34717257"
                     /translation="MPNVSDRPKTYKKPALEDVDPITNYIPASVLDKFDERQLARFKK
                     VRKFVEFECLPLDTIFLQESILFEYKNDWETCPVIITLRKKLESYGLHKMFVPMDHGG
                     YDNSLNENWEIVNMVEFAMIAFLVGRSVIASYLFHLDDLINMGTIQVLLRHGCTNHEI
                     WVRMINDLVSNNIKSCLMVSERDVAGSDALNTQTKCRIIEGKENEADSMMVLNGEKWF
                     IKDAHDSEVWLILCVTEPEEGNIYRKHSLCLVNRNDVPPYTTKIETIDTNEGIGNFYQ
                     VTFKDCKVPLNIVGERGEGYQILQTKSSITRLFQCLKLCGMGQESLRLSNKRAAERKV
                     FGSKLQKSECFKFELAHWRIKVETCKLLCFNAAIKCDYEGVKAAREEIGMVKAVTPKE
                     ISSLVDWSIQLHGCYGLCPTRTPLSHMWQVSRSSRINDAPDESLIAQLGRLEISNYNK
                     FQKTYDQELLALAGK"
     gene            <73246..>74883
                     /locus_tag="KLMA_60030"
                     /db_xref="GeneID:34717258"
     mRNA            <73246..>74883
                     /locus_tag="KLMA_60030"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820676.1"
                     /db_xref="GeneID:34717258"
     CDS             73246..74883
                     /locus_tag="KLMA_60030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677115.1"
                     /db_xref="GeneID:34717258"
                     /translation="MDIATAVDRYANPFEGKIDDIDDDDSSLEESIFDVDSFFLEARY
                     SLSLSSVNESHLTEEKWQSSYGIDKSKPDIGEETDSQEGDKVKKDLSNVPYQEWAVKY
                     INKYLVTDLLSKKSIAQWTHSSRLNEMQALPYEIRAMMKVKNYRLEPLLRLMIIRTIH
                     ERLEKVRAQLPINMKTDDKDEYLSTRLEKNFNDPKMWPKLLERTLEAGFVGKSEISCY
                     NPNKMSFDAKLELLQREGILYKKEDDSDSFMCPTIVINISNLKRYNGHYKLPNVKRHH
                     ADEVILFDPMVKQRMCDKLRNYRRKKAKLPRFTKQEFEQNINLSNPIISQLRNLRNPR
                     YSRQVAGENNSCLLFNIDQIPTLEESEVRGKKTMPVPIPSSTKLFENSVDRYSFSCAH
                     APESHLKSRRLSCFTGTYYLGYTMNMFNDEAYKKWVFENVHFKRIAAFMYAQELSRCK
                     KLQEEKKWPCIIYDLNILNLPFTVEGLDFIQTWLLKPRDESEKGYTNLPGLADQYKAL
                     VIEKISQDDYIRSQFLQQDLKEVEDDKDDRIVLNFIL"
     gene            <75225..>76448
                     /gene="TRM61"
                     /locus_tag="KLMA_60031"
                     /db_xref="GeneID:34717259"
     mRNA            <75225..>76448
                     /gene="TRM61"
                     /locus_tag="KLMA_60031"
                     /product="tRNA (adenine-N(1)-)-methyltransferase catalytic
                     subunit TRM61"
                     /transcript_id="XM_022820677.1"
                     /db_xref="GeneID:34717259"
     CDS             75225..76448
                     /gene="TRM61"
                     /locus_tag="KLMA_60031"
                     /codon_start=1
                     /product="tRNA (adenine-N(1)-)-methyltransferase catalytic
                     subunit TRM61"
                     /protein_id="XP_022677116.1"
                     /db_xref="GeneID:34717259"
                     /translation="MSHFYEYKDLIKEGDLVLAWLSRDNLKPIIVKAGEVFNTRYGAF
                     QHNDMIGMPFGSQIAIRTKGSNKFGFIHILQPTPELWSISLPHRTQIVYTPDSSYIMQ
                     RMQCSPYSRVIEAGTGSGSFSHAFARTVGHLFSYEFHEVRYEQAKQEFEDHGLLASGN
                     TTITHRDVCKEGFEIRKGDTTSHVFSEEDENEKVEIAADCVFLDLPAPWEAVLNLDSV
                     ISKGKKVNLCCFSPCIEQVDKTIEVLEENGWHDIETVEIQGRQYEARRQMVRKLDDAI
                     ERLKDVKRRKQNASERRQKNVEQNSETETSQEPKEGSDESKPTEKTNFNPFGKGTRVK
                     EGDPNYEWIQVSKIESEIKSHTSFLTFASKVVDLTRDDAQVQSYLSAFEEETKTLSKR
                     EQRRLKALANKEKKQ"
     gene            complement(<76491..>77393)
                     /gene="NIT2"
                     /locus_tag="KLMA_60032"
                     /db_xref="GeneID:34717260"
     mRNA            complement(<76491..>77393)
                     /gene="NIT2"
                     /locus_tag="KLMA_60032"
                     /product="probable hydrolase NIT2"
                     /transcript_id="XM_022820678.1"
                     /db_xref="GeneID:34717260"
     CDS             complement(76491..77393)
                     /gene="NIT2"
                     /locus_tag="KLMA_60032"
                     /codon_start=1
                     /product="probable hydrolase NIT2"
                     /protein_id="XP_022677117.1"
                     /db_xref="GeneID:34717260"
                     /translation="MARIGIGQLCSSSNLVHNLEIVKHLIEKALENDVKVLFFPEATD
                     YLSRNADHSKRLAKQTPSFVSELQSSIRSITKKVGKTIDVSIGVHLPPSNLDISKGDS
                     RVKNVLLYINSNGEIVQKYQKLHLFDVDVPNGPILKESKSVQPGSAIPSILETPAGKL
                     GSCICYDIRFPELSMKLRSEGAEILCFPSAFTMKTGEAHWELLGKARALDTQSFVVMP
                     AQQGEHDVYADGSDDSAPGVKRVSWGHSMIIDPWGTVIAAADPSSNEPQLITADLDLE
                     SQAKIRRDMPLWNQRRRDIFGDFI"
     gene            <77849..>79567
                     /gene="SPT10"
                     /locus_tag="KLMA_60033"
                     /db_xref="GeneID:34717261"
     mRNA            <77849..>79567
                     /gene="SPT10"
                     /locus_tag="KLMA_60033"
                     /product="protein SPT10"
                     /transcript_id="XM_022820679.1"
                     /db_xref="GeneID:34717261"
     CDS             77849..79567
                     /gene="SPT10"
                     /locus_tag="KLMA_60033"
                     /codon_start=1
                     /product="protein SPT10"
                     /protein_id="XP_022677118.1"
                     /db_xref="GeneID:34717261"
                     /translation="MFVNDDSSQVIDDPYSTPLQPQTILLRDGETVSTMYPIPANPGL
                     LPVGLVEFLLDEFNMEIENGQSFPYYESLSLEDFKKIWFNSHGVLCIMVLGELPELDY
                     SIPINRTEEIDEALGVKYSERFSSTYLKRKDRRNLNLNIQWERQCLGIFNLIPAYPGR
                     SSHVATGTFLVNAGIRGKGIGKTLVDCFLNWAPQLGFTSCYFPLVYGTNVGIRRIFES
                     TNFRRIGKLPESGILKGFDTPVDSFIYGKEFTHVRRHMDSLHSSVDDTIKAKYERLIY
                     YLDHGEYPPACNRNEKARLRVIAKKHSLVNGKLFFKGKEVVYDPQRQLKIAYETHIVD
                     HHGINRITSKLAEKYHWKGIKQTVIQVINSCSTCQENNKMSEEGAVIDTRNDPNGQPH
                     TIVHAILQDNISQSLENLEEITPVDSSNTPRLKTSFVQRINFGKDPRNEGVKRKSVTG
                     SEHSLDSFTSYNISHDEHKGRKKHKSNDSRGSEPGTVRLEDETPNSMVDDALLNLEDN
                     VMAAVEAVEKEHQRSSSNFKKGRGSVETNNYIEDDRRHQNTSDDNEISSKNIDEHFYE
                     SQMSDT"
     gene            complement(<79606..>81708)
                     /locus_tag="KLMA_60034"
                     /db_xref="GeneID:34717262"
     mRNA            complement(<79606..>81708)
                     /locus_tag="KLMA_60034"
                     /product="PNGaseA super family"
                     /transcript_id="XM_022820680.1"
                     /db_xref="GeneID:34717262"
     CDS             complement(79606..81708)
                     /locus_tag="KLMA_60034"
                     /codon_start=1
                     /product="PNGaseA super family"
                     /protein_id="XP_022677119.1"
                     /db_xref="GeneID:34717262"
                     /translation="MGTKGKEMSIWDQMVLATKKSKLKSQLKPIPRSTGESSEKQEKE
                     SYWQYDLEKDGFKPKTDASNVSLKKRCFSWALFAFRVVFVILALVRLLNYHLSDNKSI
                     SISDNDNIQDSFEITIAELPTENLVHTDQLLTYSFGNSWGHPARVPYTPYTGSPYNKV
                     MLELFTNVSGRQYDRLGHIFIDNITVWRTSTVEPYDNKTIISRSSKDITDYISLFQKG
                     DPLELTFQLDNIVTKLQDGIFNVDLRIHYFDSPTPHHGRDETAKDFFYHYATTPPNRV
                     IPLVVDPKKKTPLLYYPIASQSNPRWTRPLEDFGANLDGTLEHARLEVFLSGNAAEEF
                     WYGNVLDEYVSKFKNSFHEISGHGPVRVLKVYLYDGKNEYLVATMVPTPVIFTGGFSP
                     ALWRPCVGIDAFDLEHLSIDLTPFLSLLKDEKPWELQFEIVSSLNDKYKDTIGENWIL
                     SGNIKQWTNQESKMDYGEMIQNTFNSTFDVNVIDIDDPNELHQTVNATARNEVASVVY
                     LDDKPYVISRIYHNEFISSLKFVEDGDDEHHVVDLEKYNIISIYEEEAFRKSNPIVSL
                     IDKSSWHFVGNIKTLDIDVPKSEMTYSAAISRSVDRFKYIKDYTSGQEFEVKNSQDLV
                     DYANTHDSIPHIIVNALKGSQTGSSKYTLAPSGNYGSGDSVHHVRVFKDYPFKEHYNR
                     DVVVSKNSVVFDVIKRDL"
     gene            <83704..>86160
                     /gene="PBS2"
                     /locus_tag="KLMA_60035"
                     /db_xref="GeneID:34717263"
     mRNA            <83704..>86160
                     /gene="PBS2"
                     /locus_tag="KLMA_60035"
                     /product="serine/threonine-protein kinase ste20"
                     /transcript_id="XM_022820681.1"
                     /db_xref="GeneID:34717263"
     CDS             83704..86160
                     /gene="PBS2"
                     /locus_tag="KLMA_60035"
                     /codon_start=1
                     /product="serine/threonine-protein kinase ste20"
                     /protein_id="XP_022677120.1"
                     /db_xref="GeneID:34717263"
                     /translation="MANDMRRSSMSSSSSHGQGPNQGLAQGQGQPQGNVNVNGSYSQI
                     NSSLHARVKAFQEQRQLKRSGSIHSNQSQNSVQIQQIVNKPLPPLPPKIMVGEGEHLS
                     EDSQHHHHHHHQQQQQQQQQQQQQQLHKSDGSGESIQRGTELDHQQKVQQLPQLPQQP
                     QSQQPQQPQPQQPQQSTPPVTPSQQQQQQPQQIQQHHNQTQNQGQTQSQAQNQQHPQH
                     SAQVLSSRKGLPHGIQKDMHLQQTQQQAQQQQQQQQQRQRPLQAATMTQGRRDGLMKQ
                     TQEQLEKMRISASSAPPPGTFGNIPSISQDRELNPIRQAPRPPAGGIPTGNIPNYFMA
                     PGTGGMPPVSTSSSSATDPGQAPPRPSQGQPHLQKAKQSLSARRGLKLPPGGMSLKMK
                     PTSQPQQLAPQHTHQEFAGAPSNTAVPVVQGRRSNPGSLINGLQTTSTSSANTSHETA
                     GTEPKPGSNSNTNSGIGGLFANFSKYVNIKSGSLNFAGKLSLSSKGVDFSNGSSFRIT
                     LDELEFLEELGHGNYGNVSKVLHKPTHITMAMKEVRLELDESKFRQILMELEVLHNCQ
                     SPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKSYDDEQLGGIDEPQLARITSSVIKGLK
                     ELKDVHNIIHRDVKPTNILCSASQGTIKLCDFGVSGNLVASLAKTNIGCQSYMAPERI
                     KSLNPDKSTYSVQSDIWSLGLSILEMALGAYPYPPETFDNIFSQLSAIVDGPTPKLPE
                     GKFSADAQNFVSMCLQKIPERRPTYAALLEHPWLKRYENVDVKMSEYITTRLNKRKEW
                     LAETGEDLPKHIPALHMGGL"
     gene            <86941..>90030
                     /gene="TRK1"
                     /locus_tag="KLMA_60036"
                     /db_xref="GeneID:34717264"
     mRNA            <86941..>90030
                     /gene="TRK1"
                     /locus_tag="KLMA_60036"
                     /product="low-affinity potassium transport protein"
                     /transcript_id="XM_022820682.1"
                     /db_xref="GeneID:34717264"
     CDS             86941..90030
                     /gene="TRK1"
                     /locus_tag="KLMA_60036"
                     /codon_start=1
                     /product="low-affinity potassium transport protein"
                     /protein_id="XP_022677121.1"
                     /db_xref="GeneID:34717264"
                     /translation="MFLRKLVRKRTVQNIETYRKTLGHRIRDGIANIAHKLHPIASLI
                     CPNFIAFHYFYIIGFSILGSIIMYPVKNYPYIDILFLATGAATQGGLNTVNTNDLLLY
                     QQIVVYVVTTLTSSIFIHSGLAFVRLYWFERYFDGIRDWSKKDFEMRRTMTLRNREMS
                     RNYTSESASRSGTLMPSSRTKSFSRAERDSRNFQVKLFSGEMVNRDEDNNDESSLDNR
                     NNVESSNKSEKFLSRRKSRDINPADMYRSIAMLQDRHENKDNTTGPALVVKSPAERDI
                     EMDQEQGASQPTDQHGQSIQFKVEPRPVKPMKHHSESSGLRKSFTQRKRPSFFKGSQS
                     ARSIRNKLRRKSKGVEYHNIDDEDGHDADMEGSSDDDEEAIQSSNSFSSSVPDSASAH
                     NYATDDFAEHGSNVEMNSEPSSLDSHNISEDDDDDEGDHNSNAPDNLSYYGMQDGPSL
                     RNRLNRVMSSNYLSYQPAIGRNSTFVGLSDSQKVELGGVEYRATKILCLILTIYFVGF
                     HIMALIGLLGWIQPMEKYKKIIRADGINPTWWAFFTSMSSFNDLGLTLTPDSMYSFNK
                     SIFVLLWMSWFIVVGNTGFPILLRFIIWVLFKISPDLSLRRDSLGFLLDHPRRCFTML
                     FPKAATWWLLLILVGLNAIDLILFIVLDLDTSVVKSLSAGFKVLNGLFQAVNTRTAGF
                     SVLDLSQLHPSVQVSYMLMMYISVLPIAISIRRTNVYEEQSLGIYPNENAEPDDNNTK
                     SFIGAHLRRQLSFDLWYMFLGLFVICICEGGKLQDASKPQFNVFQVLFEIVSAYGTVG
                     LSLGYPGTNTSFSAQFTTISKLVIIAMLIRGRHRGLPYTLDRAIILPSEKLQENDMLH
                     EMSQNRRSPSGLSASTSYDNRASYVGDASSEGSHERFGGFKRQSRSIWHGIASAFSMG
                     HQPRLNRSLTSRSLDGRTMTLSHSDMWGQNEASHRYPNNSFPMERMNSRETFPRTLSS
                     PPASVSFRDRLNDSSESPLGGIHANTVEAFENSNSNNNSTNSKHTESSSSDPIIGTT"
     gene            <92106..>98792
                     /gene="URA2"
                     /locus_tag="KLMA_60037"
                     /db_xref="GeneID:34717265"
     mRNA            <92106..>98792
                     /gene="URA2"
                     /locus_tag="KLMA_60037"
                     /product="protein URA1"
                     /transcript_id="XM_022820683.1"
                     /db_xref="GeneID:34717265"
     CDS             92106..98792
                     /gene="URA2"
                     /locus_tag="KLMA_60037"
                     /codon_start=1
                     /product="protein URA1"
                     /protein_id="XP_022677122.1"
                     /db_xref="GeneID:34717265"
                     /translation="MSISIPTSPITPPMANVGDRMITLELKDGTTLQGYSFGAETTTA
                     GELVFQTGMVGYPESITDPSYEGQILVITYPLVGNYGVPDRKLMDEYVESLPRYFESN
                     RIHIAGLVVAHYTEEYSHWLAESSLSKWLKESNIPAVYGIDTRSLTKHLRECGSMLGR
                     FALQKENSSFEVANSAEWISHFDIPEWSDPNVQNLVEKVSLKEPKLFVPNHPDIDPVT
                     GPDGKTLRIVAVDVGMKYNQIRCFVKRGVELLVVPWNYDFTNEQYDGLFISNGPGNPA
                     ILEEVSARLSTVLEAKKTPVFGICLGHQLLARASGASTLKMKFGNRGHNIPCTSTISG
                     RCYITSQNHGFAVDESTLSNGWKPLFTNANDGSNEGIYHSELPYFSVQFHPESTPGPR
                     DTEFLFDVFIQSVLEFKQTGVLKQVEFPGGKIEDNLAAHPREDVKKVLVLGSGGLSIG
                     QAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVYFLPVTAEFVRKVIL
                     HERPDAIYVTFGGQTALSVGIEMKDEFETLGVKVLGTPIETVITTEDRELFANAMDEI
                     NEKCAKSKAASTVEEAVEAVKDIGYPVIVRAAYALGGLGSGFAKNDQELIELCNVAFA
                     SSPQVLVEKSMKGWKEIEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTLS
                     DEDYNMLRTTAVNVIRHLGVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKATG
                     YPLAYTAAKLGLNIPLNEVKNSVTRSTCACFEPSLDYCVVKMPRWDLKKFTRVSTLLS
                     SSMKSVGEVMSIGRTFEEAIQKAIRSTEYANLGFNETDLEIDIDYELSNPSDMRIFAI
                     ANAFSKLGYTVDQVWEKTNIDKWFLNKLYDLIKFADKIKSFGSKENLPVLVLKQAKQL
                     GFEDRQIAKFLNSNEVAIRRLRKEYGIIPFVKQIDTVAAEFPAFTNYLYLTYNAASHD
                     LDFNDHGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRKNNVKTIMVNYNPETVSTDYDE
                     ADRLYFETINLERIMDIYELENSAGVVVSMGGQTSNNIAMSLHRENVKILGTSPEMID
                     SAENRYKFSRMLDQIGVDQPAWKELTSIEEAEDFAEKVSYPVLVRPSYVLSGAAMNTV
                     YSRDDLESYLNQAVEVSRDYPVVITKYIENAKEIEMDAVALDGELIMHVVSEHVENAG
                     VHSGDATLIVPPQDLDPETVRRIVEATAKIGRALQITGPYNIQFIAKNNEIKVIECNV
                     RASRSFPFISKVVGVNLIEMATKAIMGLPVTPYPVEKLPEDYVAIKVPQFSFPRLAGA
                     DPVLGVEMASTGEVATFGHSKYEAYLKSLLATGFKLPKKNILLSIGSYKEKQELLPCV
                     KKLYNMGYKLFATAGTADFISEHGIPVQYLEVLNEENEEKSEYSLTQHLANNKIDLYI
                     NLPSANRFRRPASYVSKGYRTRRMAVDFSVPLVTNVKCAKLLIEALSRNLSLDVSERD
                     AQTSHRTVTIPGLINIAAYVPNISNVLLGPDELKEVTRLSVESGFTYSQIMPKSTSGP
                     VITDAASLKVANSVVKDSAYTNFGFTVAGTPNNCKEVSNVANEATSLYLPYRELTNNV
                     YAASEHLKHWPLDKPVIAEAKTSDLASIILLASLQNRSIHITGVSNKQDLSLIMAVKE
                     KQSNVTCDVNIHSLFVSQDDYPEARFLPTKSDQDFFWANLDSIDAFSIGSLPTSLAAI
                     TGNEIVTGLGIKEALPLLLSAVNDGRLTIDDIVLRLHTNPAKIFSIPEQNSAVEVDLD
                     FTFRHTKRWSPYQKGGLTGGIQRVLINDETIVLSGDLVATEAKGQPILPSKLAPATPA
                     VAKDIPLANVGTPQLTSAPTSRKRFSFSNERRLSINSFDGDDEEAIIDQPLEQRLMSS
                     RPPKELLAPGVLFNLIRTKNPFLRRNILSVNQFKRSDFHALFAVAQELRAGVEREGVL
                     DVMKGRVLTTLFYEPSTRTSSSFIAAMERLGGRTVNINTSASSVKKGETLQDTIRTLA
                     CYSDAIVLRHPDEMSAHIAAKFSPVPIINGGNGSREHPTQAFLDLFTIREELGTVNGI
                     TVTFMGDLKFGRPVHSLCRLLQHYQVRINLVAPKELRLPNALRKELEKSGLLGVESEE
                     LTPEIISKSDVLYCTRVQQERFENEEDYLKLKDTYIVDNKILSHAKQQMVIMHPLPRV
                     NEIREEVDYDHRAAYFRQMRYGLFVRMALLAMVMGVDM"
     gene            <99579..>100613
                     /gene="AIM23"
                     /locus_tag="KLMA_60038"
                     /db_xref="GeneID:34717266"
     mRNA            <99579..>100613
                     /gene="AIM23"
                     /locus_tag="KLMA_60038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820685.1"
                     /db_xref="GeneID:34717266"
     CDS             99579..100613
                     /gene="AIM23"
                     /locus_tag="KLMA_60038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677123.1"
                     /db_xref="GeneID:34717266"
                     /translation="MFRFTLKHSLAFTRSFSKSGVWHNDSRAVTDLLFKLPSFNHSTD
                     LQGKRVKENQRKNNDRNIQRNGKNHKFQRERKLVFRWNNGTEKQQAAANDVLEEILKV
                     NPKGDIKAISKDSNKVEETNVRIFLKGIDLGSSGIAMVSIDNSESSDVKLPVVKEIPT
                     RIALKNYSDKLSKRKEEELIQLGVSAHRAGRANDNKPDSSWKIIKVSWQISDYDLKKQ
                     KYSEIVSNLEKGSKVSLFINDKDSQNLSPIDDDELKTMNDAVISKRELKRREEVMEKI
                     YKILEEHSSQIVQAGSIKKRIILKVTPNPTNTKDSVDKRAIKEQKKRERQEKLQRRLE
                     KKKMREAEQT"
     gene            complement(<100724..>102796)
                     /locus_tag="KLMA_60039"
                     /db_xref="GeneID:34717267"
     mRNA            complement(<100724..>102796)
                     /locus_tag="KLMA_60039"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820686.1"
                     /db_xref="GeneID:34717267"
     CDS             complement(100724..102796)
                     /locus_tag="KLMA_60039"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677124.1"
                     /db_xref="GeneID:34717267"
                     /translation="MLVYIVFIWYAQVVFGFGVGFHLTQVGRVFSHYDSFTKAGSLFP
                     DSVLQYGKLNICWDKFLSDGVELWNRKYGSHSATVDDYGLRQFLLGVHCAKTINELQN
                     TSSHGLLTQLSDLEFEGNMDNALTYLRGSSDLIHLSRVLSSDSIELAFYMSTEVKLPM
                     KEDVLNLLSLQDISVDWGNIVDNMLGMIGVLHSELYLLRDKRFHALDIAYSLSPGGSI
                     AVREHHIGGEWAILGELQNSIPAFNSSFIDGTDQLARPEGRAGLNVSSQRYEAQDYNY
                     VSSLKENSLFGSTIVSGNFLDGDPCVAVGSPIEDGRGSVYVIPMKLLQPQSTSYTNKT
                     NYTISLYGSRVHKFTLLNDDYLIVSEPGRKSFHIYYGSEKILTILDLTSNFPELSYIA
                     DIDNDQIPDLIISCGTCRDKELGKVTIIPGMNLIPYLISGKKNQVELIESIGNIPLSG
                     PISLKYQHFGSNTIASRSFLFVAAENLGLVYVYKLEQLSTFSPPVFYIKEQDIVTPDE
                     GIPWKWEVMPSKKHGNFGCQMYTWTYNNVDYISISQPLFNKVYIYKDAGTSALEVWLV
                     LELDSLIDLNTIQYSIEFGKGIYFSNTDEKLYLSSPGSFNGAGVIWSVSMSEMKRVVE
                     FWKSHHLLVTALKHLHFINPQKNRKGWSNFGATLAGSESNELIISVPGYGYGDLYESP
                     LSGSILIK"
     gene            <103069..>104325
                     /locus_tag="KLMA_60040"
                     /db_xref="GeneID:34717268"
     mRNA            <103069..>104325
                     /locus_tag="KLMA_60040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820687.1"
                     /db_xref="GeneID:34717268"
     CDS             103069..104325
                     /locus_tag="KLMA_60040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677125.1"
                     /db_xref="GeneID:34717268"
                     /translation="MNNGESLPKWLVFICGVCTVLATSISIYSQCRQLWNYRIPSQQR
                     LILRIQMMVPIFSISCFVSILRPEFGERYVEPIREIYEALVIYQFFSYLTLVLGGERN
                     IIINIAPKYPPSKHAMPLLGYFLREIDLSDPYDFGMLKRGVLQYVWFKPFYCIGMALL
                     QTLHWDTLWLVVLYNLSVTWSLYCLAMFWKCLYQELSVFKPWPKFMCVKLIIFASYWQ
                     SLIIDVLTHFDIIDVNGADKYIASELGNSVLCVEMIGFAIAHLYAFSADEYGAEKYPN
                     SGRLKVYYALRDWLGFKDLCWDFKSVINGDYSNYRGFDSVESMLADRGTHSRTNRLAR
                     GLRYTNRGMSSYWVGSSSSSNSYGTIQRDMSNDDLSTPWTDITEGLGLPRYIPEDSNY
                     PVVWDAESHRYEERINALRQQLRSKA"
     gene            complement(<104544..>105584)
                     /gene="MRS4"
                     /locus_tag="KLMA_60041"
                     /db_xref="GeneID:34717269"
     mRNA            complement(<104544..>105584)
                     /gene="MRS4"
                     /locus_tag="KLMA_60041"
                     /product="mitochondrial RNA-splicing protein MRS4"
                     /transcript_id="XM_022820688.1"
                     /db_xref="GeneID:34717269"
     CDS             complement(104544..105584)
                     /gene="MRS4"
                     /locus_tag="KLMA_60041"
                     /codon_start=1
                     /product="mitochondrial RNA-splicing protein MRS4"
                     /protein_id="XP_022677126.1"
                     /db_xref="GeneID:34717269"
                     /translation="MSSSQPAALGAPEVPEVQEIEIDYEALPDTAPLSYQLLAGAFAG
                     IMEHSIMFPIDALKTRMQAVSEMKAAAASSGSAAAASAAVRGSSVARADTILQQISRI
                     SSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKENLIDAKDINTHQPLKTAMSGVA
                     ATVAADALMNPFDTIKQRLQLQSKSKDSSMWRMAANIYRNEGAKAFFYSYPTTLAMNI
                     PFAALNFVIYESSTKFFNPTNAYNPWIHCLCGGIAGATCAAVTTPLDCIKTVLQVRGS
                     DSVHIQSFKNADTFKKAATAIWQTYGWRGFWRGLQPRVISNIPATAISWTSYEFAKHL
                     LFDKHEPSLQNL"
     gene            <107532..>108512
                     /gene="PEX21"
                     /locus_tag="KLMA_60042"
                     /db_xref="GeneID:34717270"
     mRNA            <107532..>108512
                     /gene="PEX21"
                     /locus_tag="KLMA_60042"
                     /product="peroxisomal membrane protein PEX21"
                     /transcript_id="XM_022820689.1"
                     /db_xref="GeneID:34717270"
     CDS             107532..108512
                     /gene="PEX21"
                     /locus_tag="KLMA_60042"
                     /codon_start=1
                     /product="peroxisomal membrane protein PEX21"
                     /protein_id="XP_022677127.1"
                     /db_xref="GeneID:34717270"
                     /translation="MSVCQTNPLNTLVSKSSGYRFGAPQDLQPGQSRQDGRVSQLDRQ
                     FAGFTQDSMAAGAAAAVGAPSVVPVGSRAGAPGPGLQSQGQGHAGGPDAAWIDQFAKM
                     QVRDRAAFSDEYKRMYSQYESRGISRDPLAQASRFANLNTSGSNNMNMSVSMAVPRPL
                     AAAATARQLDEQLEDQLDEQLDEQLEAQFAEIERQEQQQQQQQQQQQQQEQQQQQLAL
                     DQDQLQLKEAAQSIYTTLSSNSTPNNAKFSNSKFLGLMRNISDGVVTIKKDREQDKYT
                     ELYSPSTGETFGEEYFPIQDDVTSDPLHSIDDLSNMSSSEAAAHVFRDAV"
     gene            complement(<108664..>110022)
                     /gene="TDA11"
                     /locus_tag="KLMA_60043"
                     /db_xref="GeneID:34717271"
     mRNA            complement(<108664..>110022)
                     /gene="TDA11"
                     /locus_tag="KLMA_60043"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820690.1"
                     /db_xref="GeneID:34717271"
     CDS             complement(108664..110022)
                     /gene="TDA11"
                     /locus_tag="KLMA_60043"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677128.1"
                     /db_xref="GeneID:34717271"
                     /translation="MMDRDAVEEFIETQDKANGLDTKVKMEASSDGGSMRSSKGIQLQ
                     VTPTKVNPSRSESHPLKEDAVISAGEREEKSKENRIRRSNTWKRRSLITPLMSPEQKQ
                     QQQQLQFQQLQQHQQQQSGKNGDMSWTPLGRNRRNTGECSDGQQSVRSSIGSINSAML
                     EKVDTDLALTLPFETSGQEVSGQETSNLNANNNSNNINNQGQGQGQGHGLDLNSNQSQ
                     SQNNISTGNRSPSNAEDVDALLQSLANKELEILERTRKMHDLFRQIKAEDRMIQQTAA
                     ELQQLKKKVSELVGTGHQYEKNYSMSRGNSTSSGNSGIAANQSKKPASLWSKSVSLLS
                     QFDQMIQGTMETKLRMMDAESGEQSETTSEASEVSGPGSGPGSGPGSGPKKREQESAV
                     APTSSIWSLVNEFKQGLGLVGIEEEEEADGTPTTASTTTDADSGSKHGQHVTGDVEMH
                     AL"
     gene            <110445..>113327
                     /gene="KEL1"
                     /locus_tag="KLMA_60044"
                     /db_xref="GeneID:34717272"
     mRNA            <110445..>113327
                     /gene="KEL1"
                     /locus_tag="KLMA_60044"
                     /product="kelch repeat-containing protein 1"
                     /transcript_id="XM_022820691.1"
                     /db_xref="GeneID:34717272"
     CDS             110445..113327
                     /gene="KEL1"
                     /locus_tag="KLMA_60044"
                     /codon_start=1
                     /product="kelch repeat-containing protein 1"
                     /protein_id="XP_022677129.1"
                     /db_xref="GeneID:34717272"
                     /translation="MAPHFKFGKKQKVKKEETLSASPVSNSTPSSSNTSQSEAWHPGQ
                     SITPTKGKQNYPRPNGERIMVDPVQKRSVSTQSTLQQHVYTPWNRVRLEKSPFPRYRH
                     VASSYATDQGELFVIGGLHDQSVYGDTWIIKSIDNGTRFRSVAIPISDSTPPPRVGHA
                     STLCGNAFVIFGGDTHKVNEAGLMDDDVYLFNINSHKWTIPKPQGPRPLGRYGHKISI
                     IAANPMKTKLYVFGGQFDDTYFNDLAVYDLSSFRRPDSHWEFIKPDTFMPPPLTNHTM
                     VSYDNKLWVFGGDTPQGLTNELFMFDPNVNDWTVVKTTGAQPPPVQEHAAVIYRDLMC
                     VFGGKDAQDNYSQSTYFLNLKSLKWFKFPAFNNMIPRARSGHSLTLLGNNKLLIMGGD
                     KFDYAFASQTDLRTSDVDMGAGTIVYTLDLTKLHELCPGIFHVEGLASQDNFTTPVLK
                     SNSRFDDIKNKEVSILSPDVSSSINSSNLITTPSTRKASESVPTSVSTNKPKSPVPAR
                     DINAEPPRVLSLQSHRSSDTQSDTDPDVGSVEVVQYGTSPERGDVKRYAVTDNKAVPE
                     IPTTPNTPVTPGLQTAAAIAAVVAGETKPKPTADSIGEPQVSELPHSQQREIKPAVHD
                     QRDILAPAGANNNMDSTPTITLSEPARVVSEKSDPINNSNSSSNNNNNNNNNLLKELL
                     SELKQLKEDTVISANRANQRITELELENAELKQFNQLSHLNDMIKYQAEVIAELQSDS
                     NYKEKYMELQSKYRLLDDKYQLASKELKSKETFINENIKKYSESIDSTIAQVKQRQAM
                     KSPSSPLNRRRDSLNELTSKLNQMMIENKELTNSKEQLFKEYSKLKNEHSQVSLDLSA
                     TNESLLDIENNYKSVMDSLRTSGNAIEKLQHEVLKLKKENARLESELEQRGSNSSGSS
                     NDTHYQLKIKDLRAELFIIKEERDSLKEDIMTLKKKLLDVAPSPSL"
     gene            complement(<113400..>113732)
                     /locus_tag="KLMA_60045"
                     /db_xref="GeneID:34717273"
     mRNA            complement(<113400..>113732)
                     /locus_tag="KLMA_60045"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022820692.1"
                     /db_xref="GeneID:34717273"
     CDS             complement(113400..113732)
                     /locus_tag="KLMA_60045"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022677130.1"
                     /db_xref="GeneID:34717273"
                     /translation="MYPFAFLGRKKPLLENNNNSPFFRREFPGELPINNSPASRASII
                     SAGPDVSKGSILDTDDIEPDPQNRTLPASRCSILQSEFTQTSILDSDIHMTTQSSPPP
                     VILSSTCD"
     gene            <115650..>118004
                     /locus_tag="KLMA_60046"
                     /db_xref="GeneID:34717274"
     mRNA            <115650..>118004
                     /locus_tag="KLMA_60046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820693.1"
                     /db_xref="GeneID:34717274"
     CDS             115650..118004
                     /locus_tag="KLMA_60046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677131.1"
                     /db_xref="GeneID:34717274"
                     /translation="MYIRHVSFQDLSPSLTDDQVRSLKLSDKPISHNNPFIHVPPEYK
                     LGCADSSLKSDGQSSSSVSNDSIAQAYQGYNNIKTSQLAYEPLTQQQQDSALRAVLGR
                     TLSGNGNSSGTGSTTTGIVDNNSDPVLLSGVGRSRSGFSSASSASTSLTRGATASSSS
                     SRIPPGPSVSILKHRTEDLPDEPSAEDIDLTLNDPEIDKHIDKVTTNNTLENSGNAFG
                     TGYTTSAFANLNELEDKIMKKKKNIKDTKKAEPQKKKKSYSEMTDEELAELEKQLQSG
                     GRQTHADFSNFDFSQQNRLFIGETRPSLIGKGSANTTKSSDIVLTYPSRPSVTHRAIS
                     LTREHVDYRKKFDMDTTTRTAVCFLNGRKHTWATADWFINQAARDGDHLVIVSNLPMY
                     EDLIDLLKKSGTSSSASEHANAQSKLEEFSFDGKIKNKSPSAIVELPFHQLGMIINEV
                     DELTRFKCESIMNYYTSMCEDKVMKITVELVKERSFKPFVTHVMNLYRPQLHIVSTIS
                     TNLSIKFRNGHVKLPNFLYRHFWVPTLVIPYEFIDPYLMGETKKPLRKSVKCKPRDKA
                     FALLDKCIKKSLIDSMGAEEQDIWRNNDQSDMVSIDSAPNNSVLDYFPTSPENIYKKQ
                     QIEKLGYIPPVPTRIKTNPIGPAASRVSSRSSRRSSRVYFADEPGMYKVKSLLADDDD
                     SANDVTRTRSDGHAHAYTHNRHLSPSFAISKPNHLNSNTTLKTSKRQETGTAVPMAML
                     TPFKSEPTSPTQTTGPGSTAGKGGYKPKTKFGVMLKKLWGKNKE"
     gene            <119670..>120362
                     /gene="MOS2"
                     /locus_tag="KLMA_60047"
                     /db_xref="GeneID:34717275"
     mRNA            <119670..>120362
                     /gene="MOS2"
                     /locus_tag="KLMA_60047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820694.1"
                     /db_xref="GeneID:34717275"
     CDS             119670..120362
                     /gene="MOS2"
                     /locus_tag="KLMA_60047"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677132.1"
                     /db_xref="GeneID:34717275"
                     /translation="MAPNFYREIDLVKEQVIPPQQEVVLSSSAKEAAPQNIGSKTLSY
                     ELQDILGENKLAYGISLRTPEPLMNFFGKLRTSLTKTINCVEQKIDSSSKLYYDKERK
                     ITSAVAELHSDPREKLLPGFTYVLVASMSGSILTRNRNIFLRFTTPLLFGVSCFAYVL
                     PTTFRNTKNLAYDVEKRNFPAFVQTQDNLYSGARKAVCSTAHYTSTFVSTVQKGYQKT
                     NTAIKEWTGLNV"
     gene            complement(<120441..>123125)
                     /gene="RTT107"
                     /locus_tag="KLMA_60048"
                     /db_xref="GeneID:34717276"
     mRNA            complement(<120441..>123125)
                     /gene="RTT107"
                     /locus_tag="KLMA_60048"
                     /product="Ty1 transposition protein 107 regulator"
                     /transcript_id="XM_022820697.1"
                     /db_xref="GeneID:34717276"
     CDS             complement(120441..123125)
                     /gene="RTT107"
                     /locus_tag="KLMA_60048"
                     /codon_start=1
                     /product="Ty1 transposition protein 107 regulator"
                     /protein_id="XP_022677133.1"
                     /db_xref="GeneID:34717276"
                     /translation="MADTKIFSNLRVLVIKTDDISSDELSNIKRTIEENGALDCVVHE
                     PIRQIDCALVEKERFISQFPEQIHCIITRTVEFSFYRVAAFDLLIPIVSPAWIEDCLK
                     FNRLMRTTCYSPNPIHFLKDCYVYVSKHALNEVEYPFYCSVITAFGGTCMDYLSTKAT
                     HIVTWDKNDVAIKAMQKFQKYRVQYVMPNWLIDCLAGLEYVKEDGYLIDVQWDDSQLK
                     RRSEELWEKTMSNLDNWKKTLNFRLEKKVVLGDDLALPGSCYKFFLNWIKQCLGCQIT
                     LVAEPSQLAQSNADIYVGHSASSESVSIAKANGLICANIAWFFYVWQMQEFVHPSSKL
                     LLSPLKKPVFTKEELRATFTNYYGEQRYYIQQLTEALGGICTTELTKKNSHLISAIAF
                     GKKFNAAKAWDCCIPVNHLWLEKCYKQGEKLDPMLPEFQQFPVRGGIKSSLGQMALED
                     IASVTSPLLEKPQKPTELYMDSQEAAIEEPIVIPDKLSDVEDASKGQSEQRKLEEVEA
                     EAEAEVEAEAETEAEAEAKVETIEEKTEQQEVVKESTPFQTNNGPKNIQDASDFSNNH
                     ENEFSADKSSIATPMASREATTQFSNESPDPTSQPLTPMSDSMRKAKAKAAEKLHTDI
                     ESLNEFQRINKRRRSPEILPEAIQELKKHKALDSKAEELVSYLNISHKPYRIKAVLTN
                     CHENISDLDILVLSKVGIMIYPEVESNTNTVIAPKKARTAKFLKSFSFKPLKYALTPM
                     FITQVLSNIKKEKPIELQMGKYFIPDIDPKVLEKTKLPTKVFERHGFTHVNISDDIPG
                     GCKLISSILKCHGMKEVNPLGKKFDMNDIVKNTGSKKSPDYVLIASKASMAKKFNKCV
                     KDTDKSNKVFVVEWNWCVKSIFNLDIDIEDHEYVIYNK"
     gene            123445..123517
                     /locus_tag="KLMA_R602"
                     /db_xref="GeneID:34718761"
     tRNA            123445..123517
                     /locus_tag="KLMA_R602"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718761"
     gene            <123696..>124253
                     /locus_tag="KLMA_60049"
                     /db_xref="GeneID:34717277"
     mRNA            <123696..>124253
                     /locus_tag="KLMA_60049"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820698.1"
                     /db_xref="GeneID:34717277"
     CDS             123696..124253
                     /locus_tag="KLMA_60049"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677134.1"
                     /db_xref="GeneID:34717277"
                     /translation="MRIVGHYNIQHIPRLVKVIVLDVTETENACNKVTQFSAKTTISR
                     READDIVDQLVVDFPDTKIFNFDLKHAAYPIWFYDKVFYQATAKESINYFISHRPSDI
                     TERIKFPLQNEAFLMSTSELPADSCLDSDLEVENPDYVEHYKKLLLRVLEYKRVDLDN
                     DAEVGAILTKYKSIQDYLQNCRVSE"
     gene            <125340..>128753
                     /gene="PHO81"
                     /locus_tag="KLMA_60050"
                     /db_xref="GeneID:34717278"
     mRNA            <125340..>128753
                     /gene="PHO81"
                     /locus_tag="KLMA_60050"
                     /product="phosphate system positive regulatory protein
                     PHO81"
                     /transcript_id="XM_022820699.1"
                     /db_xref="GeneID:34717278"
     CDS             125340..128753
                     /gene="PHO81"
                     /locus_tag="KLMA_60050"
                     /codon_start=1
                     /product="phosphate system positive regulatory protein
                     PHO81"
                     /protein_id="XP_022677135.1"
                     /db_xref="GeneID:34717278"
                     /translation="MKFGKHLEGRQLELPEYNGHFINYKALKKLIKQLSVPAVSSYSA
                     SHDNLTLDETDESIKYQTLQENKASFFFKLERELEKVNEFYLEKEADLRMKFDLLNSR
                     YYGYKTNGKLTSKRSIAYRTIRDGVKKFERDLAQLEQFVELNRTGFSKVLKKWDKRSH
                     SHAKDFYLATVVSVQPIFTRNEVSKWNDAVSALLVELDELNDSEELHTPNFYTSAGQV
                     SRTISRNSDNLDPVANAPTYSSNSVGSGNNSSGSQVKSFSMRQYSASGSNAGLLDIEL
                     EIESWYMEVLSISKLKDSEPRKTHIRNFVESKVQSFVDSHLLTTRIDRNLVIRDSITK
                     IFKLLLSSSIDDESLEVFWKYGNEFIDLTYSDPDDDLVFSRHSMLHEAALCPHQSRTF
                     VLIAALYQYQNSLIPKDVFRKLVNAQDINGRMPLHYCCELGKDDFVSLLINTKLIDDY
                     DLLDNTSKTPLVLSIINNHMDVTRTLITEGNVNLSPDLGEGTKPQFHPLNVACSYKNY
                     EAAKIILEKGNINLSKLRDSQGLCPLHIVAKTGGGSELIKLLVYHGANPNEIDGFNKW
                     PPIFYAIQEGHATTVQVLLELGADVHVTDQNNLSQVFYAIWEGHLSVLKVLLSYIGSN
                     NKQDSFSTEPLPGVLRATDLVDIMSDDQLSINDSLKDIPDFTLPPPIIPLRKYGHNFL
                     EKKIFVKLTFKPEKESIFLNKDDEMVLSSPGRITLTSSVSHIIPRNIILPLQEDDDRD
                     IVFQIDSLDTFDVDIEIYPSFGTRLIAKTYALSDIFHKAYESPCNNKHVSLPLFDTRL
                     RNVGKVDLDFEIIFPYGGNPLEVTKYETYWKSTSGGGLSGSSNVSSSIQSIVTASSLV
                     GEYCTIGVVQLNDGTLITSSSLICNVGAVPLLFTDMNVKQLNSMLEQPISDIPDNIST
                     NEELKDLLRNRHVLFESLLDKINPNIQLNINVLFPTESEILCIPVKISPRFTLNEFVE
                     KVLSGTFDHVRKLRQSDSTRSIVFSSTNPRVCSILNWKQPNFPVLFDMNVISETDQGD
                     LERITPNDLASMALDPKEVVYSDVGTKSIKDAVAFANNNNLLGMILPVHLLDITLQLA
                     DQVVAHGLLLIGSTKNSKRPCKRNELGVNGMQNKEALVIDATPDSEDRV"
     gene            complement(<128837..>129499)
                     /locus_tag="KLMA_60051"
                     /db_xref="GeneID:34717279"
     mRNA            complement(<128837..>129499)
                     /locus_tag="KLMA_60051"
                     /product="probable 26S proteasome regulatory subunit p28"
                     /transcript_id="XM_022820700.1"
                     /db_xref="GeneID:34717279"
     CDS             complement(128837..129499)
                     /locus_tag="KLMA_60051"
                     /codon_start=1
                     /product="probable 26S proteasome regulatory subunit p28"
                     /protein_id="XP_022677136.1"
                     /db_xref="GeneID:34717279"
                     /translation="MNGNSEKVHQLLAESPSLVKSVDDDSRYPLHWAVSFQHVDIVDI
                     LLGYMKKVDLDSVLDESGWSPLHIAASVGNVEIMEKLLEHSIEPNVDLQTKNGITALH
                     LACSKKHQDVVKLLLERGASVRVKDKNGQLPLHRAAAVGSMGIVSMLCDKNSPVNTKD
                     RLGWSPLFHALAEGHGDVAVELVNKYHAVWEGETDNQEQTAEKVCVDDKVRKFFLANV
                     SS"
     gene            <130114..>131037
                     /gene="PHB2"
                     /locus_tag="KLMA_60052"
                     /db_xref="GeneID:34717280"
     mRNA            <130114..>131037
                     /gene="PHB2"
                     /locus_tag="KLMA_60052"
                     /product="prohibitin-2"
                     /transcript_id="XM_022820701.1"
                     /db_xref="GeneID:34717280"
     CDS             130114..131037
                     /gene="PHB2"
                     /locus_tag="KLMA_60052"
                     /codon_start=1
                     /product="prohibitin-2"
                     /protein_id="XP_022677137.1"
                     /db_xref="GeneID:34717280"
                     /translation="MNRYPGDFGKFARSMQRQLARAQQSTGGSPGKAPRGAFAGLGGL
                     FLLLGGGFLVNESLFNVDGGKRAIVYSRIGGVQQKIYSEGTHFIIPWIETPVIYDVRA
                     KPRNVSSLTGTKDLQMVNITCRVLSRPNVENLPMIYRTLGTDYDERVLPSIVNEVLKA
                     VVAQFNASQLITQRERVSRLIRDNLVRRAKHFNITLDDVSITYMTFSPEFTMSVESKQ
                     IAQQDAQKAAFVVDRASQEKQGMIVKAQGEAKSAELIGEAIKKSKDYVELKRLDTARE
                     IATILSKSPNRVILDNEALLLNTVTDSRTKN"
     gene            complement(<131413..>131691)
                     /locus_tag="KLMA_60053"
                     /db_xref="GeneID:34717281"
     mRNA            complement(<131413..>131691)
                     /locus_tag="KLMA_60053"
                     /product="spo12 super family protein"
                     /transcript_id="XM_022820702.1"
                     /db_xref="GeneID:34717281"
     CDS             complement(131413..131691)
                     /locus_tag="KLMA_60053"
                     /codon_start=1
                     /product="spo12 super family protein"
                     /protein_id="XP_022677138.1"
                     /db_xref="GeneID:34717281"
                     /translation="MSTAEQFQPLHQKKQQETQFSSSVGASSLHKSMFKKPSPHQISE
                     LKNKFASPTDEMLSPCSQKLNDHRSKLFQVKSNPTKLNFQSKQLEEEF"
     gene            <132741..>134450
                     /locus_tag="KLMA_60054"
                     /db_xref="GeneID:34717282"
     mRNA            <132741..>134450
                     /locus_tag="KLMA_60054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820703.1"
                     /db_xref="GeneID:34717282"
     CDS             132741..134450
                     /locus_tag="KLMA_60054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677139.1"
                     /db_xref="GeneID:34717282"
                     /translation="MKAFKKKFQELVYSFSTEDRYADYDEEAAHPNVAAEVERSISHS
                     NHGSQIQLADYVDGSNPSGNEGISEALLAWRHIDNWTEEHNPDLAATLSDPCTRHDIN
                     NAEKDLDIIFPASVRASLRIHDGQEDLQSMTGTGGLLFGLQLMSLDQIVQMSRTWRNV
                     AENLQRKNEEMQLRIDKQQQLNGTTVDLPSQQQKGYGKLETQDYKAMDPNLQRNISQN
                     YSKQFKLPDIPNQHSVPPLAIQPVYAHSGWIPLVTDNAGNHIGIDLAPGPKGKYGQVI
                     LFGREFDTKFVVANNWGDFLLSFANDLELGNWLLVDEDNDQFAGEGELVFRDKKTNGP
                     IRDYLEVLVMRSRMKYNSYGEKKLPKTPNQQAQAQATSSQESQSTFDITQQETSLTVD
                     ETNRDSEAPSPTAVAAAAGTVVEQVNSIDNDADSSSSVKKAEHISAVESPSTDIQDAS
                     VSNLTKEESVVEPKTEVKDDTEVKDEPKTEVESKEDEPKPEANVNTDAKVDTDVNSEG
                     ENEGEATAKSNAAEKTPESVSNSKEDSAASDTKDGAENTGNEPSISNDVEDLKDDFEN
                     VAL"
     gene            complement(<134761..>136290)
                     /gene="ALG10"
                     /locus_tag="KLMA_60055"
                     /db_xref="GeneID:34717283"
     mRNA            complement(<134761..>136290)
                     /gene="ALG10"
                     /locus_tag="KLMA_60055"
                     /product="alpha-1,2 glucosyltransferase"
                     /transcript_id="XM_022820704.1"
                     /db_xref="GeneID:34717283"
     CDS             complement(134761..136290)
                     /gene="ALG10"
                     /locus_tag="KLMA_60055"
                     /codon_start=1
                     /product="alpha-1,2 glucosyltransferase"
                     /protein_id="XP_022677140.1"
                     /db_xref="GeneID:34717283"
                     /translation="MSDHECKDCHEKEQENVEAISFARDVENEVIQGIYANIIIWPIV
                     ACIFCYIAYKINTSLLPYVFIDEQFHVDQTLRYLRGEWREWNGKITTPPGLYIMGWIQ
                     YHITRFMTNWSTLTVLRLTNFIGGVVIWPWVVLRPLYLFNALGFWPVTLMCFPLMVSY
                     YFLYYTDVWSTIFIIESLTLAMVLPFGEKYSIWLSALCGLISCFFRQTNIVWNGMIMI
                     LVVERRAMIEKNFNTLSFNNYLKLLLQALENFKTLVLPYFINFVLFAMFLIYNRSITL
                     GDKENHVAGLHVVQFFYCLMFIAFFSVPVWFSKQLTISYLLRFIMNPVQYLLELLGIM
                     IIIRFFTIVHPFLLADNRHIPFYLFRKLIGRSRIFKYFGMAPIYHFCTYIYFEIMRPS
                     VMVFHPILPIEIKNPIDLPIQLSHISWTVLMMCTFMTVVPSPLFEPRYYILPFIFWRL
                     FITMPPEPFWGNPKGKLTGTKRHFAECAWFLFINLIMYIIFKKVEIKWPSENTLQHII
                     W"
     gene            <136512..>138035
                     /gene="MTC6"
                     /locus_tag="KLMA_60056"
                     /db_xref="GeneID:34717284"
     mRNA            <136512..>138035
                     /gene="MTC6"
                     /locus_tag="KLMA_60056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820705.1"
                     /db_xref="GeneID:34717284"
     CDS             136512..138035
                     /gene="MTC6"
                     /locus_tag="KLMA_60056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677141.1"
                     /db_xref="GeneID:34717284"
                     /translation="MVLTLLRYLCFWAFFGVSLAQEWPPFSNEMINALRSQRDLMTNV
                     SIDQIPFPGISIKPALSQSNTLNQTAYLETISELLNHGIQTFQIDLEFDTSSQDWFLE
                     DTGTRFVDVLSTINEYLGVSNTDLNANLISILIRFNNDTLKKSNLFKNSNFTSVLEEG
                     MSVGYIYSKNDLANDRALNQTWDINGYSKDGWVSLNRFLYVVKRRVVFGFLNGDDMFQ
                     QDDNPLVFPSETFHYVTEEGTLQCPLKTMDDIGEMSKKQWRFLEGNFTYRNFLQYIEC
                     GYSLILTNPVQRSNLSQENEFQRRLTSLLLWSWNATTPDDILDADEDDANSNSQYVAY
                     RCGVFTYTEHEYLAPFKIGNCYRSMPYLCRYSDRAYVWNISEEQGTYFDSEKDHVCPG
                     DHQFGIPRNPLQQRSIRIYLEEEGFDEKDFWIDINSISVKNCWISGGTYASCPYQRYG
                     STSNYLAMIIPSALIAFFLLLVMFYFNWAHIPIQDNRNNWKRIITAYSKEEVEGVPS"
     gene            complement(<138151..>139803)
                     /gene="PEX28"
                     /locus_tag="KLMA_60057"
                     /db_xref="GeneID:34717285"
     mRNA            complement(<138151..>139803)
                     /gene="PEX28"
                     /locus_tag="KLMA_60057"
                     /product="peroxisomal membrane protein PEX28"
                     /transcript_id="XM_022820706.1"
                     /db_xref="GeneID:34717285"
     CDS             complement(138151..139803)
                     /gene="PEX28"
                     /locus_tag="KLMA_60057"
                     /codon_start=1
                     /product="peroxisomal membrane protein PEX28"
                     /protein_id="XP_022677142.1"
                     /db_xref="GeneID:34717285"
                     /translation="METQVGAKRVSRRSLLGNYLLRKYENVFASIDHVSAPDENEKLL
                     SNRDLVQGIASSLFDATWERFKAMRDDDTKTIDDDFHEYMSGIDLESNDSFWKDENFR
                     QEYEARSASSEDPGPQGIRMERIQNGQFKNGRHLVEETKEHFVDMVIDRLILSLLPDE
                     LPEREQFSQRVSEPSRRKSQTVSVSIMSRNIRILTSKLGAIFEVQDELVRLATWRNPA
                     GTLLILVVFTKICFNPMLLLILPIVYIMFGLMIPGYLHRHPLHRGIYLSKRSYGQSLI
                     KDITTGGSRVKVQPHEPLREYSYEDVDLDALKKANAVRQSMEFVVNLRDLQNLMSIMV
                     FITDKVEKFVYGTAGFKNEQISTMVFLSGFFFLISLWVIAPFINWALMTSMLAWGVMF
                     VLHPRVRPVLLGLLKKQQLEKGKEVLEKTERYDILLDEPVETRWTEVFEIQIQGITET
                     EWSHYMYATHVFDKSDPYRKSQKPPPGVQTLEELKAPPTWVFDSNCEWITDTNVQQWA
                     AERGLENLRIDGDYLVDDQFKRKRLIRKVIRYANPARIPSYR"
     gene            complement(<140192..>141955)
                     /gene="AMA1"
                     /locus_tag="KLMA_60058"
                     /db_xref="GeneID:34717286"
     mRNA            complement(<140192..>141955)
                     /gene="AMA1"
                     /locus_tag="KLMA_60058"
                     /product="meiosis-specific APC/C activator protein AMA1"
                     /transcript_id="XM_022820708.1"
                     /db_xref="GeneID:34717286"
     CDS             complement(140192..141955)
                     /gene="AMA1"
                     /locus_tag="KLMA_60058"
                     /codon_start=1
                     /product="meiosis-specific APC/C activator protein AMA1"
                     /protein_id="XP_022677143.1"
                     /db_xref="GeneID:34717286"
                     /translation="MINKLRDTKWHGEAVGGGLGYCGQHKSKLSLKSTKGMGGNGNDR
                     FIPKNTSKKSYYSSSQLKSFLESLDQFVDPQLQSRSPSPEFFTGQDLPIDTLLTPEMS
                     SILESGGKKGKKKMPKHTKQHRKYMADALGFPDSNRVLHFSQAQSGGGQYSNGEIDTY
                     SIQTPTSSIKHAREQHYQQQQQQNQQRNSKRAESRVPYRVLEAPHLRKDFYSNLVDWS
                     PVSNNVAVALDTAVFLWSDKVGAFHVLRRDYLEKTSDTVQCISFSPNDLMLVGTKRGK
                     ILLFSQEAVESSVGNGPPKALAEITVKCQSGICCCQWYQDGNQFIVGTEVGVVYKFNV
                     KTELIVMSRSYRRSDALQAKINGTSPDISSKKIIRTVRISESWSLHVHSQQVCGAKIC
                     EDTKQIAIGGNDNCCTIWKYNEDDLDEEPEFQFKLKHASAVKAMAFCPWSKSLLVTGG
                     GSYDRHLRFWHSKSGTLLREFKTPGQITSIIWSKRQKQLLVTFGFTNQEVPVFIIMYK
                     YPSMEEIIRIKQPTQLRALTAATSPDARKICVASDDETVRFYSIWENSCEDMIETPAD
                     GIYGSEIIEHEEGVSLEYLLR"
     gene            <142957..>144009
                     /gene="HSV2"
                     /locus_tag="KLMA_60059"
                     /db_xref="GeneID:34717287"
     mRNA            <142957..>144009
                     /gene="HSV2"
                     /locus_tag="KLMA_60059"
                     /product="SVP1-like protein 2"
                     /transcript_id="XM_022820709.1"
                     /db_xref="GeneID:34717287"
     CDS             142957..144009
                     /gene="HSV2"
                     /locus_tag="KLMA_60059"
                     /codon_start=1
                     /product="SVP1-like protein 2"
                     /protein_id="XP_022677144.1"
                     /db_xref="GeneID:34717287"
                     /translation="MITRNPIVPENHVSNPVTDYEFNQDQSCLILSTLKSFEIYNVHP
                     VAHIMSQEMRHLSKVRMLHRTNYVAFVTGVKEVVHIWDDVKKQDVSRIKVDAPVKDLF
                     LSREFIVVSYGDVISVFKFGNPWKRITDDIRFGGVCEFSNGLLVYSNEFNLGQIHITK
                     LQSSGSATTQDQGVQQKAILGKGVLIKAHTNPIKMVRLNRKSDMVATCSQDGTIIRVF
                     KTEDGVLVREFRRGLDRADVVDMKWSTDGSKLAVVSDKWTLHVFEIFNDQDNKRHALK
                     GWINMKYFQSEWSLCNFKLSVDKHVRGCKIAWISESSLVVVWPHTRMIETFKVVFDDE
                     MERWLIQMDQREQLMI"
     gene            complement(<144065..>144892)
                     /gene="PET54"
                     /locus_tag="KLMA_60060"
                     /db_xref="GeneID:34717288"
     mRNA            complement(<144065..>144892)
                     /gene="PET54"
                     /locus_tag="KLMA_60060"
                     /product="protein PET54"
                     /transcript_id="XM_022820710.1"
                     /db_xref="GeneID:34717288"
     CDS             complement(144065..144892)
                     /gene="PET54"
                     /locus_tag="KLMA_60060"
                     /codon_start=1
                     /product="protein PET54"
                     /protein_id="XP_022677145.1"
                     /db_xref="GeneID:34717288"
                     /translation="MRIFTPLFQSAYKLPAKPTKSSNKLLKDVFAVVKENPVPAEASL
                     RLGSDDTFLVFRTYNPSLKKEDFQSIINPLSSALELQAIKNSFEITRFRDSRYFTFLD
                     KYVLRFPTQMELKQYLLSTKMSMLDDRKVRFGIKDTKGIQRDLCNYYVNLMNARESAE
                     AYKNGLVLDRSDDSSGNNINSNSSGAVSAIDWDALQETERKSVVVWNLPQEWDETTLQ
                     ERFWWYDIHHSFPLLVNQEKNTSLTFIYFNEIRDAYLFKNNFHGALVEGNRLMIEKL"
     gene            <146135..>148264
                     /gene="SKG6"
                     /locus_tag="KLMA_60061"
                     /db_xref="GeneID:34717289"
     mRNA            <146135..>148264
                     /gene="SKG6"
                     /locus_tag="KLMA_60061"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820711.1"
                     /db_xref="GeneID:34717289"
     CDS             146135..148264
                     /gene="SKG6"
                     /locus_tag="KLMA_60061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677146.1"
                     /db_xref="GeneID:34717289"
                     /translation="MGSSGSFGGIKATSSLSIVEKRASKCHGSAQECEKPADSTNTTV
                     VVVAVVVPVVVVIVLLGFILYKVYRRNKKEELEDNDPDFDGDAEYLPDFGQQFEMNGR
                     GGVVGDANPTKSSLPSSATQAMSQPNPFNDDSKSLAYSNNGGMGVANPFQLPSATDDS
                     ETLRNFARSFQNSGFDGYKLASHSASQVSISRPSSAAGGYVPPHQPQQMSHQPAPSSL
                     SAISAIGTGTAPASATASAAAASSTKQAPDSEQLKKNATILKYREIVTDDQEEDPDQD
                     SFDLETSPVKSSRGNVRQSHIDQYDEGFQPEVSMQESEKTAETELVHQQDQLPEHQPK
                     KQFLSTDDDVYIQRENEDSDEDVERMKSIYQVYLDRNGTVKTVKEGQPVPEGFQPAHT
                     LPEDASKIINAKDPHEYSFEVQDPEQYQEQYQGQEQGQEQGQEQGQEQGQGQGQGLYP
                     ENEAPRVASSIYEAQSQYGNQNQYYNDQQYYGQQQYDGNYPGAGYHGTGYPAAGYANR
                     IHIQHNQPPPNLESIEELPRPSNLPYSSSTHSLTSFKSKGSGIKSPTAALMSQNNRGY
                     NPIDHPQLYYHHMNGSDPALFSDQTSTNTTPTNMSSAGNGKILPHHLRQSVVMTNPHE
                     LSQNSVFKPAGSFSRAVSDSRSNSLMSNTNTYQQHVQNAYIKSRVSGLLDDNDFMHPP
                     SMGNILPHSGSQEDLRKQLGTSHNYNL"
     gene            complement(<148529..>149080)
                     /gene="IMP3"
                     /locus_tag="KLMA_60062"
                     /db_xref="GeneID:34717290"
     mRNA            complement(<148529..>149080)
                     /gene="IMP3"
                     /locus_tag="KLMA_60062"
                     /product="U3 small nucleolar ribonucleoprotein protein
                     IMP3"
                     /transcript_id="XM_022820712.1"
                     /db_xref="GeneID:34717290"
     CDS             complement(148529..149080)
                     /gene="IMP3"
                     /locus_tag="KLMA_60062"
                     /codon_start=1
                     /product="U3 small nucleolar ribonucleoprotein protein
                     IMP3"
                     /protein_id="XP_022677147.1"
                     /db_xref="GeneID:34717290"
                     /translation="MVRSLKYHEQKLLKKVDFYEWKQDQGHRDTQVMRTYHIQNREDY
                     HKYNKICGDIRRLAHKLSLLQPTDPFRVKHEQLLLEKLYHMGILSTKSKISALENKVT
                     VSAFCRRRLPVIMHRLKMAQTLKDAVQFIEQGHVRVGPNLITDPAYLVTRNLEDYVTW
                     TDSSKIKKTVLRYRNAVDDFDDA"
     gene            <149664..>150308
                     /gene="rplF"
                     /locus_tag="KLMA_60063"
                     /db_xref="GeneID:34717291"
     mRNA            <149664..>150308
                     /gene="rplF"
                     /locus_tag="KLMA_60063"
                     /product="54S ribosomal protein L6"
                     /transcript_id="XM_022820713.1"
                     /db_xref="GeneID:34717291"
     CDS             149664..150308
                     /gene="rplF"
                     /locus_tag="KLMA_60063"
                     /codon_start=1
                     /product="54S ribosomal protein L6"
                     /protein_id="XP_022677148.1"
                     /db_xref="GeneID:34717291"
                     /translation="MSVGFRRAFSVSSVIRSHIGSSPVFLTPETKFSVSAMKVPKIIR
                     KGNKSLKLSQNVVVSGPLGKIEMEVPEFVEIRHNDEKSKIEINVKDQEDKVQRSMWGT
                     VRSHISNHVTGVNEGHMAVLKFVGTGYRAQLEENNTFVNVKVGASVRQGLYIPEGITV
                     KSPVPTSLIVEGINKQQVLLFAANLRKFHPPEPYKGKGIYVNNETIKIKDKKIK"
     gene            <150693..>151514
                     /gene="rplC"
                     /locus_tag="KLMA_60064"
                     /db_xref="GeneID:34717292"
     mRNA            <150693..>151514
                     /gene="rplC"
                     /locus_tag="KLMA_60064"
                     /product="54S ribosomal protein L9"
                     /transcript_id="XM_022820714.1"
                     /db_xref="GeneID:34717292"
     CDS             150693..151514
                     /gene="rplC"
                     /locus_tag="KLMA_60064"
                     /codon_start=1
                     /product="54S ribosomal protein L9"
                     /protein_id="XP_022677149.1"
                     /db_xref="GeneID:34717292"
                     /translation="MSLNGGIASKAWIRLFSQSAVTNGAKLVAPSVVSSTNLEPVQLN
                     HSPESALKRRRLPLRCGALSKKVGMMPYFDKESGKRIAATVLQLDNNEVILHRTAQEN
                     NYWACQVGFGNKLPHKVSRQLLGHFAAHVVNPKEKVVEFRVKDESGLLPVGTLIKPSW
                     FKPGQYVDLKSTSKGKGFQGVMKRYGFKGLKASHGVSVSHRSGGSYGQNQTPGRVLPG
                     KKMPGHMGVDTVTIQNAQVLEVNDETGTVLVKGSVAGPKGAFVRIQDAIKKPAPV"
     gene            complement(<152057..>155320)
                     /gene="CRM1"
                     /locus_tag="KLMA_60065"
                     /db_xref="GeneID:34717293"
     mRNA            complement(<152057..>155320)
                     /gene="CRM1"
                     /locus_tag="KLMA_60065"
                     /product="exportin-1"
                     /transcript_id="XM_022820715.1"
                     /db_xref="GeneID:34717293"
     CDS             complement(152057..155320)
                     /gene="CRM1"
                     /locus_tag="KLMA_60065"
                     /codon_start=1
                     /product="exportin-1"
                     /protein_id="XP_022677150.1"
                     /db_xref="GeneID:34717293"
                     /translation="MEAVLDFSRELDIQLLDQVVDTFFKGSGASQKEAQEVLTKLKDH
                     PDAWQRADKILQYSNNPQTKFIGLSILDKLITTKWKMLPEDHRLGIRNFIVGMIISLC
                     QDDTVFQTQRNLIHKSDLTLVQILKQEWPENWPDFIPELVQSSQASVNVCENNMVILK
                     LLSEEVFDFSAEQMTQAKALHLKQSMDQQFEQIFKLCFQVLETGSSPSLMVATLQSLL
                     RYLHWIPYHYIYDTDILQLLSTKFLISADTRSVTLKCLTEVSQLDIPANDPKVASLTV
                     MFFQNALQQIALNVIPVNADLKNTYAAANGNDQSFLQDFAMFLTTYLARHRSLLEQEE
                     SLRELLITAHQYLIELSKIEERELFKTTLDYWNHLVSALYQEVQQIPQGQNNALLKLS
                     NGASMFSGHNGAPHPEFLKRFPLKKHIYDNICSQLRWVIIESMVRPEEVLIVENDEGE
                     IVREFVKESDTIQLYKSEREVLVYLTHLDVLDTEDIMLNKLAKQLDGSEWSWHNINTL
                     CWAIGSISGTMDEETEKKFVVTIIKDLLALTDKKRGKDNKAVVASNIMYVVGQYPRFL
                     KAHWKFLKTVILKLFEFMHETHEGVQDMACDTFIKIVQRCKHHFVIQQPNESEPFIHA
                     IIRNIQEHTSDLQPQQVHTFYKACGLIIADERNPAERQRLLSDLMQLPNMAWDTIVQQ
                     SATNPDLLLDPETVKIIANILKTNVAVCSAMGAEFVSQLGRNFTPMLSLYSAVSGMIS
                     NQVAKDGLVATKTPKVRGLRTIKKEILKLMEMYISNAKDLNNVANEMASPLFDAVLQD
                     YFNNVPDARDAEVLNCMTTVVNKVGHMIPDGVILILQSVFECTLDMINKDFTEYPEHR
                     VEFYKLLKAINSKSFKALSQLPPTAFKLFVDSICWAFKHNNRDVEVNGLQIALDLIHN
                     VDAISPSEFSNSFYKNYYFTFISETFYVLTDSDHKSGFSKQAHLLMSLISRVQENKIS
                     VPLYKEDEVPAGTTNQAYLANYLANMLSNAFPHLSSDQVMNFIQALIKQYHDPKLFTG
                     TLRDFLVQIKQYGGDPTDYLFAEDKEQALAEQHKLERERAAKVGGLLKPSELGDDDD"
     gene            complement(<155862..>161849)
                     /gene="CCH1"
                     /locus_tag="KLMA_60066"
                     /db_xref="GeneID:34717294"
     mRNA            complement(<155862..>161849)
                     /gene="CCH1"
                     /locus_tag="KLMA_60066"
                     /product="calcium-channel protein CCH1"
                     /transcript_id="XM_022820716.1"
                     /db_xref="GeneID:34717294"
     CDS             complement(155862..161849)
                     /gene="CCH1"
                     /locus_tag="KLMA_60066"
                     /codon_start=1
                     /product="calcium-channel protein CCH1"
                     /protein_id="XP_022677151.1"
                     /db_xref="GeneID:34717294"
                     /translation="MSERGSPSKSNNPRDGRAIQGKYGSHLRLPESTASFETNGSESK
                     ANDSLLINDESSISVDLMPSEDLSQGLMAHGDDDNILTIENEDLQDFKNLQSNVKNIL
                     ELDTSEWLRRPIADHCSERSPNHSPTRNSGYRSRSRSRSRSRNRSPRRSMASSSHGIV
                     FGQNIFERNDDSNVLNDEYELQDVFIGDDGSPAKSQASYNIDNRSTGTSGDLDDAQYG
                     FHGDEGEDRDDYSGDDSSDASEYSKPVEEHLQLYGKSLGIISPFNPWRLKCAKLLLHK
                     WYRPISMAVLLFYTIFLGHGVFHGAYGSSDLLFQSKYRTGVYIASIIFNWLFTFETIA
                     KIVAFGFWNDEQLMRATGRKYDSLWELTGILKFYRYLETTYSPEFIHKIMPIRALIEE
                     TPEQKKKAAMKSSVTVSDFRKVSDPVKLPRAYTRSSWGRLELLSTFSAWMALLLSINN
                     YDDKHGARLFRPLMAFRILKLVDLDQGLVSILRTLKYGVSELLNVGFMLLYFWVIFGV
                     LGIQTFKGSLKRQCVWSNPNDPSDTYQYDMQFCGGFWNTTNHKIENYIFADNTKGPMA
                     KGFICPPNSKCISNANPYNGRISFDNIINSMELIFVVMSANTFSDLMYYTMDSDNMGA
                     SLFFIFSIFFLTVWMVNLLIAVLYSSFEVAHEKYTNNGSDVKENILVSYGRRCRAFIQ
                     AKANESPLPKWAERAFRIYKRVEWVFVLTVLINICAFATLKHNGSASRTKNIYTINRV
                     TSVIMFVETVIRLIIFCKTPWKILSSPSYIYDSITSLIWLIMSISPIQEKLGKDFDWL
                     TVLPISRFYRVVILFSVTRNLWKKVLKNALVIWNLSAFYFLFVFLASLIVLLYFDGTL
                     NRDDMDDVPYGFYSLPNSFITLFKIGSTENWTDSLYAMQEHAPNLFAAFFGSTLIILW
                     FILANLVVLNVFVAVIASSFDVEEEDKRPLQIRHYLKVVYPEKIRNFTNVPLLDRIRR
                     KFSKRKVNNSEDFKQFLFRGTAILSIAQNYSNINTEGVMDNNESSELPNPELNYLKRV
                     LWRIRAYRSIKSNPFFKEPKVVFVESKDSNKQNTLKIQEWEDEKLTYLREHPSFNNTY
                     FLFPPNHGLRKFCQKLVSSSYGKRTNNKIFFDDTPNKVGNNEFFSHFGKDLVVVVTFI
                     STVLMVYYSCYATPIYRKTHHDKWSWIMYFEPIFVSLFTIEFLVKTIADGFIYSPNAY
                     LLNPWNRIDLLVLIALWIDFISWLTGDGTLTRIIKGVSALRALRFLTISSMARATFKQ
                     VMFDGITYIFGACAIAFSILFPYTVWGLVIFRGQLGVCNDGDLSYSQCYNEYSNTVFK
                     WNILMPRSYGDPVLHLNSFSSAFRSMYEIVSLEGWTDLLENMMSTTGVGQPAKLFASP
                     YNGFFLIMFNFLSMVFILNIFISFIIGNYSRLKGTAYLTVAEKSWLEVKRLLSQAKPE
                     PMPNFFNMGRIRRICYLLVVEKKNFYFSAFMQIILYIHIFGLLLSRDQPHGHLSTNQN
                     ALFMLTSSTLLMQECMHIYGLGVRLYVRKKWNVFRALVLLFAYLTNIYQFVAKHFIPY
                     ASNGRDILQLAVLLLIIPQNDTLNELINTATASLPSILSSVYLWFILFLVYAIALNQV
                     FGLTKLGPNTSRNINARTVTKALLLLFRCSFGEGWNYIMNDFTLEEPYCFYTEDGTYT
                     DCGTKAFAYTIMMSWNILSMYILSNMFISMIVEKFSYVYHREQKKDSPANQEEIRKFK
                     AAWKKYDPDGVGEFDIQYLPKFMHSFDGPLSFKIWEGRLTVKSLKENYMKVNPNDPYD
                     VKIDFDGLNKELSSIDYEKVKARLLEYRRFIHEIKLESKNHDCVQFQHLIRTVPLYTA
                     YDKTECLGIDDYVKAMYNINKIDRLIENENNYNALRMIATRWKFVVRRNKIVLPELKV
                     PLSSYPYAFASVDDIDSTKSPIIKTQETNLLWSPMQQKKSWFGEKDSERLGKDNNDYP
                     SSSAGPLMKDYPVVHFRGKPRSSSSSSVSSQASVVSD"
     gene            <162241..>164100
                     /gene="GPI1"
                     /locus_tag="KLMA_60067"
                     /db_xref="GeneID:34717295"
     mRNA            <162241..>164100
                     /gene="GPI1"
                     /locus_tag="KLMA_60067"
                     /product="phosphatidylinositol
                     N-acetylglucosaminyltransferase subunit GPI1"
                     /transcript_id="XM_022820717.1"
                     /db_xref="GeneID:34717295"
     CDS             162241..164100
                     /gene="GPI1"
                     /locus_tag="KLMA_60067"
                     /codon_start=1
                     /product="phosphatidylinositol
                     N-acetylglucosaminyltransferase subunit GPI1"
                     /protein_id="XP_022677152.1"
                     /db_xref="GeneID:34717295"
                     /translation="MSEHKYIYWPSALVKRCECSEEQLVVVVLKTSANDGLVVTVVEK
                     SRYSGVENPYSTFGTISNGSIDTIEVSEEWSHSKYGIVTFDPPKLKLMQFYSLEPISL
                     VLEDPYNDNGGRIEVPLRQNRKKYESRLRDNVSHINLYYQHLETFYQRNPLYRRKSML
                     PVSIQDLKTRIRGTAMYRFVRCVAFYLAIMTRVIAGSISQVLNSKVFPIVKILATAQQ
                     IDLRCQQLCYIPVQYLRINKNVILPDSEPRIEGKEGEEALSQDRYHRKRKKSISNLPK
                     ELPCETYPDYIRLYNTLWLIINDVSFGATFGAVLFENRNALSQVVSSSMRFLLYEVPL
                     HVTLTLERNPLGIKLNEELSRFLGSSFLLIIEFTYAGWVKQCTSPDTLRQCIVFVSHL
                     SSVIGLTFSLALIVDFLSVMTLHITLFYMISVKLYHVHLYVMRSLFYLFYGKKHNILR
                     RRIDDNRFELDQLLMGTLIFTVLIFLLPTLLSFYLVYTVLRFIDLTLKVTLELFLALL
                     NHFPLFALLLRIKDAKRLPGGIIFRLRGNHFHMSNNPIDFFMMFKPFTNVMKSIQRQV
                     LSISTLKRIANGDVLNVERDELYRVLYYNLPRQPMDSNLLWSKLKVIMEQEVT"
     gene            complement(<164189..>164515)
                     /gene="RSM27"
                     /locus_tag="KLMA_60068"
                     /db_xref="GeneID:34717296"
     mRNA            complement(<164189..>164515)
                     /gene="RSM27"
                     /locus_tag="KLMA_60068"
                     /product="mitochondral 37S ribosomal protein S27"
                     /transcript_id="XM_022820719.1"
                     /db_xref="GeneID:34717296"
     CDS             complement(164189..164515)
                     /gene="RSM27"
                     /locus_tag="KLMA_60068"
                     /codon_start=1
                     /product="mitochondral 37S ribosomal protein S27"
                     /protein_id="XP_022677153.1"
                     /db_xref="GeneID:34717296"
                     /translation="MSVPKARLLKLAELSAKIFDQNFNPTCARTGSKILSQRLKGPAI
                     ANYYGNPDFIKFKQLKKLYPGMNFVDEEEQYRLTMLELRKRRGKGAPTKKKEASGDAK
                     KTKKRK"
     gene            complement(<165115..>166614)
                     /locus_tag="KLMA_60069"
                     /db_xref="GeneID:34717297"
     mRNA            complement(join(<165115..165789,166525..>166614))
                     /locus_tag="KLMA_60069"
                     /product="40S ribosomal protein S0"
                     /transcript_id="XM_022820720.1"
                     /db_xref="GeneID:34717297"
     CDS             complement(join(165115..165789,166525..166614))
                     /locus_tag="KLMA_60069"
                     /codon_start=1
                     /product="40S ribosomal protein S0"
                     /protein_id="XP_022677154.1"
                     /db_xref="GeneID:34717297"
                     /translation="MSLPSTFDLTPEDAQLLLAARVHLGAKNVQVHQESYVYKARPDG
                     VNVINVGKTWEKIVLAARIIAAIPNPEDVVAISSRTYGQRAVLKYAAHTGATPIAGRF
                     TPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKESSYVNIPVIALTDLDSPSEYVDVAI
                     PCNNRGKHSIGLIWYLLAREVLRLRGALPDRTQPWAIMPDLYFYRNPEEIEQQTAEEE
                     AAASGEQTEEAVDVAEEQTEAAEWAEEGQAQEEEWN"
     gene            <167928..>170090
                     /gene="FRE8"
                     /locus_tag="KLMA_60070"
                     /db_xref="GeneID:34717298"
     mRNA            <167928..>170090
                     /gene="FRE8"
                     /locus_tag="KLMA_60070"
                     /product="probable ferric reductase transmembrane
                     component 8"
                     /transcript_id="XM_022820721.1"
                     /db_xref="GeneID:34717298"
     CDS             167928..170090
                     /gene="FRE8"
                     /locus_tag="KLMA_60070"
                     /codon_start=1
                     /product="probable ferric reductase transmembrane
                     component 8"
                     /protein_id="XP_022677155.1"
                     /db_xref="GeneID:34717298"
                     /translation="MHSWLFEFWEWLRDHCPSFDRGTPKPLRSWLVRRSGLTIMGISM
                     VIIFFVIPLSNYLKLKPFFFKVEHRLKHHTFKRTAWIHKSSIYHNESLQITVFWTVLM
                     FTLVLYDCNNDLLIITKRLGRIPVCMMPALLFLTTRPSPLPHVLYFSLLPLHKWISRI
                     VVLQSLLHTILYTIQYARKGTLAKLQKLANVWGIIAMALFLLIGITSLPKIRRVNFQL
                     FYCVHYAATWMSVVLLQYHARPNMNMVSIINVTLLVGQIVYRVWHTKVSTISVIPVSP
                     SISVVEFPMSDLCKKPILPSGHIRMNNYHRFWLKRWFYHLIPFQHPYTIASLPNEPTV
                     RLIVRTGRFPLRTNSKYYITGAFEPKVDFMSKKDARNNHRLLPFQSATPTLLLSPLSF
                     NINAKRVFMVVGGSAISFGLPMLRILNFNGVTVKLLWVTRDHRDMKILNVFKNNYSGL
                     EIYVTGTLGAEQDLQIDYVDYGPDTLGELENSSAQSHQLQSQSQSQSQSQEHQHLLQT
                     PIKRRRSHQSLQSPALPSSSDLNPTTSLNSDSQTHYGSLPTDKGGLFSAELGTSAKDN
                     EDEFDFTDLFSASATLKRKKSVPKIQEMPPSPFHKDEMFRKPKVVIPPNDENYKSDTE
                     SLEEDDMKLTIPAGVKLVFGRPKLSQLDYQWCLQKECAPPSEVDNCCVMSADNNVTHV
                     DDLAKVWVIAAGPRGLVDSTRRWAKDGGLHFHEESFSV"
     gene            complement(<170246..>171709)
                     /gene="ZPR1"
                     /locus_tag="KLMA_60071"
                     /db_xref="GeneID:34717299"
     mRNA            complement(<170246..>171709)
                     /gene="ZPR1"
                     /locus_tag="KLMA_60071"
                     /product="zinc finger protein ZPR1"
                     /transcript_id="XM_022820722.1"
                     /db_xref="GeneID:34717299"
     CDS             complement(170246..171709)
                     /gene="ZPR1"
                     /locus_tag="KLMA_60071"
                     /codon_start=1
                     /product="zinc finger protein ZPR1"
                     /protein_id="XP_022677156.1"
                     /db_xref="GeneID:34717299"
                     /translation="MGEDLFKPVGEIVEETEGNVNGNENENDNGLVQTGAFDAMGHPV
                     QEIQSLCMNCHKMGTTRMLLTRIPYFREVVLMSFECPECGFKNSEIQPASEIQEKGSK
                     YMLKVEGKEDFNRQVIKSETASCKFVELELEIPGKRGQLTTVEGLLSEMVDDLEGDQE
                     MRKKIDENLYEQIQKFIEKVRDTIACKEGTLPLTFVLDDPTGNSWIEYKPGEAAHKWS
                     HSEYARTDEQNVQIGLMSREQYEEKREQERERIAQRERNPSVAKEQEKEQGQGKEHKF
                     LSDATDIENFNSEVQSFSVSCPNCLQLCDTHMKPVNIPHFKEVIIMSTVCPNCGYKSN
                     EVKTGGAIPEKGRRIKLYCDDPEDLSRDILKGENCKMNIPELNLDIQEGTLGGRFTTL
                     EGLLRQVYDELESRVFTQTSDSMDEETKARWVAFFARLKDAINGKVKFTVIMEDPLAG
                     SYIQNVYAPDPDPNMTIEDYDRTPQQNDELGLTQMKV"
     gene            <172079..>173308
                     /locus_tag="KLMA_60072"
                     /db_xref="GeneID:34717300"
     mRNA            <172079..>173308
                     /locus_tag="KLMA_60072"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820723.1"
                     /db_xref="GeneID:34717300"
     CDS             172079..173308
                     /locus_tag="KLMA_60072"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677157.1"
                     /db_xref="GeneID:34717300"
                     /translation="MPRDPLIGIVGKPSSGKSTTLNSLTDASAQVGAFPFTTIEPNRA
                     TGYLQVNCACSRFGLEKLCKPNYGWCENGMRHIPIMLLDVAGLVPGAHSGRGLGNKFL
                     DDLRHADALIHVVDVSGTTDAEGKNTRGYDPLQDIEWLQDEIRLWIEGNLQKRWGSIV
                     RKHTATKSSAVDTLQAQFGGYGSHAPMIQRALARIPGLPPLEQWTNEWITEVVKSFMQ
                     EKFPTVLALNKIDHPDADKNVSKIMLKYPETKCVLTSAITEVFLRKLKKQGFIHYEEG
                     TEFVDTFEDDETLKPLDEKLMQRIETIRDLVLYRFGSTGVVQVLQAAASTLDLVPVYT
                     VRNIQTFTGGNGENVFRDCFLVKKGTTVGKVATYIMGDVTIASIEGVKGLRVSEDDKV
                     DEGVNDILTFKLAPRAK"
     gene            complement(<173720..>175534)
                     /gene="JEN1"
                     /locus_tag="KLMA_60073"
                     /db_xref="GeneID:34717301"
     mRNA            complement(<173720..>175534)
                     /gene="JEN1"
                     /locus_tag="KLMA_60073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820724.1"
                     /db_xref="GeneID:34717301"
     CDS             complement(173720..175534)
                     /gene="JEN1"
                     /locus_tag="KLMA_60073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677158.1"
                     /db_xref="GeneID:34717301"
                     /translation="MSEGNEEKGQGQGQGQDHGHFPEGRTFLHQVESKRSVHTHHSVP
                     MNSSDSQSNASDPEELAPFPSVVDESELDESELEEIQNEDVSIIYKDDEEKPDLSWAS
                     ICRYAGTRITSLFQIHKVSMDNINPFPELRKMTLSNWNYFFMGYLAWLCAAWAFFAVS
                     VSTAPLAKLYDKPTKDISWGLSLVLFVRSAGAIIFGLWTDNYSRKWPYITCLGLFLIC
                     QLCTPWAKTYTQFLGVRWISGIAMGGIYGCASATAIEDAPVKARSILSGLFFSAYAMG
                     FIFAIIFYRAFLHVNGENYWKVQFWFSIFLPALLMLWRLVWPETKYFTKVLKARELMK
                     QDAIASNGGNPIPKTTFKEKMANTKRIICKYWLLFGYLVLLLVGPNYLTHGSQDLFPT
                     MIRSQLNFSEDAVTVAIVVVNLGGICGGLFFGQLMEVTGRRLGLLIALTMAGCFTYPA
                     FMLKTSSAVLGAGFMLFFSVFGVWGVIPIHLSELSPPEARALVAGLAYQLGNLASAAS
                     VVIENDLADIYPLARDAAGKVIKKDYAKVMAILTGSVVIFTFVMVLIGHEKFHRDLSS
                     AVLKAYMEKVDRNEEDARLGVSSLSISSKSKEEQVENA"
     gene            <178087..>179832
                     /gene="DIP5"
                     /locus_tag="KLMA_60074"
                     /db_xref="GeneID:34717302"
     mRNA            <178087..>179832
                     /gene="DIP5"
                     /locus_tag="KLMA_60074"
                     /product="dicarboxylic amino acid permease"
                     /transcript_id="XM_022820725.1"
                     /db_xref="GeneID:34717302"
     CDS             178087..179832
                     /gene="DIP5"
                     /locus_tag="KLMA_60074"
                     /codon_start=1
                     /product="dicarboxylic amino acid permease"
                     /protein_id="XP_022677159.1"
                     /db_xref="GeneID:34717302"
                     /translation="MDLEKNTYLEKNMDLEKNTYLVETSSNLDQSHSHSPTDTHELSP
                     GFDGKHDGIRLKKALKARHVSMIAIGGSLGTGLLIGTGSSLSLAGPGSILIAYAFVGL
                     LVYIVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYSYLFKYWIIVPNQLTAGAL
                     VIQYWIDRDKVNPGVWITVFLAAIVLINFLGVRFFGEIEFYISAIKILVMLGLILLLL
                     ILACGGGPHGDARGFKNWSNPGAFKEYSKAITGDKGRFVAFVSVFVLALFAYLGTELC
                     GIVVSECKNPRKAVPKAIKLTMYRIIIFYLISIFLLGLVVPYDDKLLLNAKKAKTSAA
                     ASPFVVAIIKAGIPVLPSFMNACVLIFVFSAANSDLYVASRSLYGLAIDNKAPKIFAK
                     TNKNGVPYWSMLMGILFALLAYMNVSSGSAQVFNYFVNCVSIFGLMSWISILIIYIRF
                     DRAFRVQGVSKDALTYKSPFQPYSAWFALFFCCLIGLIKNFTAFLGDKFDYKSFITGY
                     IGIPVYIISYVGYKLWNKTKLIPSEEVDLVSFKEPVDLEEEEGKLLDEERAAYIKAHG
                     KDMKWYYEKIFGWIV"
     gene            complement(<180186..>181880)
                     /gene="PDC1"
                     /locus_tag="KLMA_60075"
                     /db_xref="GeneID:34717303"
     mRNA            complement(<180186..>181880)
                     /gene="PDC1"
                     /locus_tag="KLMA_60075"
                     /product="pyruvate decarboxylase"
                     /transcript_id="XM_022820726.1"
                     /db_xref="GeneID:34717303"
     CDS             complement(180186..181880)
                     /gene="PDC1"
                     /locus_tag="KLMA_60075"
                     /codon_start=1
                     /product="pyruvate decarboxylase"
                     /protein_id="XP_022677160.1"
                     /db_xref="GeneID:34717303"
                     /translation="MSEITLGRYLFERLKQVEVQTIFGLPGDFNLSLLDKIYEVPGMR
                     WAGNANELNAAYAADGYARLKGMACVITTFGVGELSALNGIAGSYAEHVGVLHVVGVP
                     SISSQAKQLLLHHTLGNGDFTVFHRMSSNISETTAMITDINSAPSEIDRCIRTTYISQ
                     RPVYLGLPANLVDLKVPASLLETPIDLSLKPNDPEAENEVLETVLELIKDAKNPVILA
                     DACCSRHNVKAETKKLIDITQFPAFVTPMGKGSIDEQHPRFGGVYVGTLSSPEVKEAV
                     ESADLVLSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKVRNATFPGVQMKFVLQKLL
                     TKVKDAAKGYKPVPVPHAPRDNKPVADSTPLKQEWVWTQVGKFLQEGDVVLTETGTSA
                     FGINQTHFPNDTYGISQVLWGSIGFTGGATLGAAFAAEEIDPKKRVILFIGDGSLQLT
                     VQEISTMIRWGLKPYLFVLNNDGYTIERLIHGETAQYNCIQSWKHLDLLPTFGAKDYE
                     AVRVATTGEWNKLTTDKKFQENSKIRLIEVMLPVMDAPSNLVKQAQLTASINAKQE"
     gene            complement(<183039..>185711)
                     /gene="STU2"
                     /locus_tag="KLMA_60076"
                     /db_xref="GeneID:34717304"
     mRNA            complement(<183039..>185711)
                     /gene="STU2"
                     /locus_tag="KLMA_60076"
                     /product="protein STU2"
                     /transcript_id="XM_022820727.1"
                     /db_xref="GeneID:34717304"
     CDS             complement(183039..185711)
                     /gene="STU2"
                     /locus_tag="KLMA_60076"
                     /codon_start=1
                     /product="protein STU2"
                     /protein_id="XP_022677161.1"
                     /db_xref="GeneID:34717304"
                     /translation="MEADDSASFLTLSLEERISHKLWKARQHAYNELETMFGQASVGR
                     ASDPAIAKYYKRPELFESYITDSNVVAQESAVKALLSFLKYMAEVPGIVDMCGPGELV
                     STWVPALVEKGCTASKAGTKEASMACILLVVSFDKNICNCITVLEPMWSKKLPKLLTA
                     ALSVCASTIEQYGFVNASQQEKMQVLQSLVQVLPKLCSHADKNVRNESMKVILQLYTW
                     FDKPVLQDLLLAKLKPIQQKDLDKMFQSYEGSIPPASTPSLFVWAAPVVAVGQQEENE
                     LTSDNHAHHGVDSDGDTMMMGNNVAIDPYEMYPVQTILDKLPNGFYSNLSSAKWKDRV
                     EALEEFYEKSLANGKCKKLSARDEDYSELVRKYCSIITSDANLQAVQLATSSIDVLVS
                     ALRSDFNPFALDTLNALLTRSKEKKANVADVIFSTLLNLSNYYKLEMCLDSILTHMKT
                     TKVPQVKIVTCKFLFELLTSWRPTEQLYKTMVFASLSEILSSLQPIVNDNQQATRNEA
                     FKCVAALIKIFGERELATYLEKLDNLKRKKILELVDGIEVKASASSSAQQGGLKPAAL
                     VPQTRSKTVPSTNSNSNSNSNSTIPSKRLATSPLKPRAASSVGRSATVGAAASATKSS
                     RLTSRSLATPQLPRLDSQPRSNASVVQQQQQQPEPFPSASSSSSSSSAAFQSSMSTRM
                     SHLNDEVNKLRQERQDWLKERNELLSNLNNSKLQISKLSKQLNDAEIAVSSLQRQLQD
                     SKVELNDKDIKIRELEARLSHGVISNGNAAAATAAAASPLSASSSASINRGRLTSTTL
                     SPLRSSTKAFNSTNTITTNTNTTTTTPPHRMRSPSESSDDLPRRVTSLNLNNHLMQEE
                     SWKRAAEVTNQLKARIERMRAKSRSGFKDAPPPA"
     gene            <186397..>186711
                     /gene="TRX2"
                     /locus_tag="KLMA_60077"
                     /db_xref="GeneID:34717305"
     mRNA            <186397..>186711
                     /gene="TRX2"
                     /locus_tag="KLMA_60077"
                     /product="thioredoxin-2"
                     /transcript_id="XM_022820728.1"
                     /db_xref="GeneID:34717305"
     CDS             186397..186711
                     /gene="TRX2"
                     /locus_tag="KLMA_60077"
                     /codon_start=1
                     /product="thioredoxin-2"
                     /protein_id="XP_022677162.1"
                     /db_xref="GeneID:34717305"
                     /translation="MVAQVSSAADFEKALSDDKLVVVDFFATWCGPCKMIAPMIEKFA
                     TEYAGKATFYKVDVDEVPDVAKNNDISAMPTLVFFKGGKEVARVLGANLAAIKQNIAS
                     NI"
     gene            complement(<186865..>187788)
                     /gene="SER2"
                     /locus_tag="KLMA_60078"
                     /db_xref="GeneID:34717306"
     mRNA            complement(<186865..>187788)
                     /gene="SER2"
                     /locus_tag="KLMA_60078"
                     /product="phosphoserine phosphatase"
                     /transcript_id="XM_022820730.1"
                     /db_xref="GeneID:34717306"
     CDS             complement(186865..187788)
                     /gene="SER2"
                     /locus_tag="KLMA_60078"
                     /codon_start=1
                     /product="phosphoserine phosphatase"
                     /protein_id="XP_022677163.1"
                     /db_xref="GeneID:34717306"
                     /translation="MKIVVTAISHQQGGLTEAKASELAKLIGDVNGTKWLCEGKACDL
                     YVVADDIAVLKQKVAAQVEPQFPGIDLIVQADNEFRKQKGLFVFDMDSTLIYQEVIEM
                     IAAYANVEAEVKKITDRAMNNELDFSQSLCERVKLLKGIETEHLYEEIKPRLQVTKGV
                     PELSRALKRAGCKLAVLSGGFIPFAKYIQEKLDFDYALANTLGVEQGPTGKTQLNGTT
                     LGDIVDGQRKADTLVSLAQEYGVPIEATVMVGDGGNDLKAMEAAGFGIAWNAKPKVQE
                     QAPCKLNSDTMVDVLYILGYTHQEIEQLVKL"
     gene            <188158..>188934
                     /gene="CIR1"
                     /locus_tag="KLMA_60079"
                     /db_xref="GeneID:34717307"
     mRNA            <188158..>188934
                     /gene="CIR1"
                     /locus_tag="KLMA_60079"
                     /product="probable electron transfer flavoprotein subunit
                     beta"
                     /transcript_id="XM_022820731.1"
                     /db_xref="GeneID:34717307"
     CDS             188158..188934
                     /gene="CIR1"
                     /locus_tag="KLMA_60079"
                     /codon_start=1
                     /product="probable electron transfer flavoprotein subunit
                     beta"
                     /protein_id="XP_022677164.1"
                     /db_xref="GeneID:34717307"
                     /translation="MNKLRILVPVKRVVDHAIRPRVNKQLTNIETKNLKFSINPFDDI
                     AVEESVKLKESHPDLVEQVHAVSIGPLKAQDVLRTALAKGCDSSTLVEHTSTELEPLV
                     ISKVLHKLVQQKNANLVVLGKQAIDDDCNNTGQMLAGLLNWPQATNACKVELLDNGES
                     VRVTKEIDGGEEVVVAKLPMVITTDLRLNTPRYATLPNLMKAKKKPLEKLKLAKDFEG
                     IDLTPQLKLVKVEEPPVKSPGIQLSSVDELVAKLKEDKLV"
     gene            complement(<189001..>189282)
                     /locus_tag="KLMA_60081"
                     /db_xref="GeneID:34717308"
     mRNA            complement(<189001..>189282)
                     /locus_tag="KLMA_60081"
                     /product="mvb12 super family protein"
                     /transcript_id="XM_022820732.1"
                     /db_xref="GeneID:34717308"
     CDS             complement(189001..189282)
                     /locus_tag="KLMA_60081"
                     /codon_start=1
                     /product="mvb12 super family protein"
                     /protein_id="XP_022677165.1"
                     /db_xref="GeneID:34717308"
                     /translation="MDQYLRKVVLYHSLESSEKWPKARRKLNLGSLQVMPDAGTQELA
                     QVAQICDGLSQELENRRKSEQQFDQWYQETYLASKPKGLLEQLAPKRRA"
     gene            <189512..>190135
                     /gene="MDE1"
                     /locus_tag="KLMA_60082"
                     /db_xref="GeneID:34717309"
     mRNA            <189512..>190135
                     /gene="MDE1"
                     /locus_tag="KLMA_60082"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820733.1"
                     /db_xref="GeneID:34717309"
     CDS             189512..190135
                     /gene="MDE1"
                     /locus_tag="KLMA_60082"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677166.1"
                     /db_xref="GeneID:34717309"
                     /translation="MSDPRDTICSLCRLAYANNWMPGTGGGIGICDGHTAYISPSGIE
                     KELTTKDQIVAYDMNNDTYECGAGGLRPSACTPLFLELFRRQDVDIGCVIHTHSLNAV
                     LCSMMYDAEFSISNMEQIKALPSGEGRNLRNVETLRIPIIENAPEEQDLMPELKRIIS
                     EYPAACAVLVRRHGLFVWGATAKKAKIYVESIDYLMEAAVKMRGLAL"
     gene            complement(<190178..>190468)
                     /locus_tag="KLMA_60083"
                     /db_xref="GeneID:34717310"
     mRNA            complement(<190178..>190468)
                     /locus_tag="KLMA_60083"
                     /product="Sm-like family protein"
                     /transcript_id="XM_022820734.1"
                     /db_xref="GeneID:34717310"
     CDS             complement(190178..190468)
                     /locus_tag="KLMA_60083"
                     /codon_start=1
                     /product="Sm-like family protein"
                     /protein_id="XP_022677167.1"
                     /db_xref="GeneID:34717310"
                     /translation="MSSLLKEYLDQRVMVVTVDGETHYGELTGFDKQGNLVILDDKKN
                     ILVIRSSEVVLCGQVEVGQQLPNTNDVVRLPRCKAKLSVQQEVEIWAKRWAK"
     gene            <190768..>191064
                     /locus_tag="KLMA_60084"
                     /db_xref="GeneID:34717311"
     mRNA            <190768..>191064
                     /locus_tag="KLMA_60084"
                     /product="mer2 super family protein"
                     /transcript_id="XM_022820735.1"
                     /db_xref="GeneID:34717311"
     CDS             190768..191064
                     /locus_tag="KLMA_60084"
                     /codon_start=1
                     /product="mer2 super family protein"
                     /protein_id="XP_022677168.1"
                     /db_xref="GeneID:34717311"
                     /translation="MSESETDYGSSPCKTVPDADKQILEWTSRLELETVQLRDTSESL
                     FKIIKENVGELAECRRLFQRQLEKEKEQERQKGLYDGYTLWAVCVAVHANNTGY"
     gene            complement(<191405..>192232)
                     /gene="TDA10"
                     /locus_tag="KLMA_60085"
                     /db_xref="GeneID:34717312"
     mRNA            complement(<191405..>192232)
                     /gene="TDA10"
                     /locus_tag="KLMA_60085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820736.1"
                     /db_xref="GeneID:34717312"
     CDS             complement(191405..192232)
                     /gene="TDA10"
                     /locus_tag="KLMA_60085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677169.1"
                     /db_xref="GeneID:34717312"
                     /translation="MSVFEECLKFVKESLEKRKETAEKGPLLVIVSGPQGSGKSYTSA
                     LLGKALESEGLRSTVLSIDDFYLTHADQLALQAKFPQNKLIQGRGLPGTHDLPLLKKV
                     METIVSNHTGSVEVPVYDKSKFNGQGDRAGTREVALPLDCVIMEGWFLGFGSGQTAST
                     DHMNPELTQVDQWLKEYASLLWESPHHPKVMIKFATDDIKNVYKWRLQQEHQLVKQQG
                     QGMSDEEVIKFVDRYMPCYELYYSSFCDVSHSEKGTLIIHIDESRQVQGIDNKMQQQ"
     gene            <192652..>193677
                     /gene="TES1"
                     /locus_tag="KLMA_60086"
                     /db_xref="GeneID:34717313"
     mRNA            <192652..>193677
                     /gene="TES1"
                     /locus_tag="KLMA_60086"
                     /product="peroxisomal acyl-coenzyme A thioester hydrolase
                     1"
                     /transcript_id="XM_022820737.1"
                     /db_xref="GeneID:34717313"
     CDS             192652..193677
                     /gene="TES1"
                     /locus_tag="KLMA_60086"
                     /codon_start=1
                     /product="peroxisomal acyl-coenzyme A thioester hydrolase
                     1"
                     /protein_id="XP_022677170.1"
                     /db_xref="GeneID:34717313"
                     /translation="MNSSTKLHALLKLERLNGAPSRFRTISKPKAPPGAKGTFGGILV
                     SQSLLASMQTVPIAFRPSSLHSYFLIGGNPNHHIEYDVESLRAGKNFIHKQVKAYQFN
                     KLIFISTILFYRKPKPDKLHALNKLGKLQELPPFDKFYPSTQLFEKDVLSNGNLPKFK
                     RISSVFQGSDEETEKVRERFEAGSVDYRFPNNFFVNQTDSDQLDYYLRVREDIGEEEL
                     EQDENEVSDVSENDARFNYIAFAYLSDSYVLLSLPYFHKLPLYSHKFSVSLDHTIYFH
                     QLPRVSKWMFAQLFNPRSYHDKHLILGHYYDRESKSLVATITQEGLVAYQEKDVIMSK
                     FHGDSKL"
     gene            complement(<193745..>196591)
                     /gene="ADE3"
                     /locus_tag="KLMA_60087"
                     /db_xref="GeneID:34717314"
     mRNA            complement(<193745..>196591)
                     /gene="ADE3"
                     /locus_tag="KLMA_60087"
                     /product="c-1-tetrahydrofolate synthase"
                     /transcript_id="XM_022820738.1"
                     /db_xref="GeneID:34717314"
     CDS             complement(193745..196591)
                     /gene="ADE3"
                     /locus_tag="KLMA_60087"
                     /codon_start=1
                     /product="c-1-tetrahydrofolate synthase"
                     /protein_id="XP_022677171.1"
                     /db_xref="GeneID:34717314"
                     /translation="MTIIDGKAIANGIRQEIKEGISGLKQKYAAFRPTLTIFQIGNRQ
                     DSNTYVRMKLKAAKEAGIEVRFIHLEESVSELEVLAKIDDENDDESVHGILVQLPLPK
                     HLNEDKITSRVAASKDVDGFGPFNIGELNKRNGKPFFEPCTPKGIIELLKRSGVTIAG
                     AEAVVIGRSDIVGSPVATLLTSLDATVTILHSKSKDLHKFLENADIVIVAIGQPEFIK
                     GEWFANNKRGAVVIDVGTNFVEDASKKSGYRNVGDVEFAAAEPYVKLITPVPGGVGPM
                     TVAMLMQNTFESAQRALDRQLNVGGNDFEPLPLNLVKPVPSDFEISRAQIHKPITQIA
                     KESGILPSELEPYGDTKAKVKLDILNRLKDRENGKYVLVTGITPTPLGEGKSTTTVGL
                     AQALGAHLKKKVFANVRQPSMGPTFGIKGGAAGGGYSQVIPMDEFNLHVTGDIHAISM
                     ANNLLAAAIDTRMFHESTQSNAALYKRLVPTKKGVRKFTPTMLRRLKKLGIDKTDPNE
                     LTEEESARFARLDIDPDTITWRRVVDCNDRFLRGITVGQAPTERGHTRSTGFDISVAS
                     ECMAVLALANSLEDMRERLGRIVIAASKSGEPITCEDIGCAGAMTALLKDAIKPNIMQ
                     TLEGTPVFVHAGPFANISIGANSVLADKMALKLAGVPQELPQDVKDSQKGYVITEAGF
                     DFTMGGERFINIKCRSSGLVPDVVVIVATVRALKVHGGGPEVKAGAPLPAEYLHEDVE
                     LLRKGCANLAKHISNARAYNLPVVVAINRMSSDTDKEHEVIREESIKAGAVDAIVSNH
                     WEEGGKGAVNLAEGIIKAANEESNKDFKFLYDVEGSSVEDKISAIAKEMYGAGEVEFL
                     PEAQAKIDLYTKQGFSNLPICIAKTQYSLSHDANLKGVPTGFKFPIRDVRASIGAGYL
                     YALAAEIQTIPGLPTHCGFMNIEVNEDGEIDGMF"
     gene            <197713..>198204
                     /gene="ESS1"
                     /locus_tag="KLMA_60088"
                     /db_xref="GeneID:34717315"
     mRNA            <197713..>198204
                     /gene="ESS1"
                     /locus_tag="KLMA_60088"
                     /product="peptidyl-prolyl cis-trans isomerase ESS1"
                     /transcript_id="XM_022820739.1"
                     /db_xref="GeneID:34717315"
     CDS             197713..198204
                     /gene="ESS1"
                     /locus_tag="KLMA_60088"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase ESS1"
                     /protein_id="XP_022677172.1"
                     /db_xref="GeneID:34717315"
                     /translation="MTSTGLPEPWVIKFSRSKKREYFFNPDTKESVWEAPAGTDEVQL
                     KQYLAENPLRVRALHLLIKHKDSRRPASHRNENITITKEEARKELESYIKRLKEDGEP
                     FEALAKERSDCSSAKRGGDLGFFGRGEMQPSFEKAAFALKVGEVSDIVESDSGLHIIK
                     RVA"
     gene            complement(<198232..>198675)
                     /gene="YCH1"
                     /locus_tag="KLMA_60089"
                     /db_xref="GeneID:34717316"
     mRNA            complement(<198232..>198675)
                     /gene="YCH1"
                     /locus_tag="KLMA_60089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820741.1"
                     /db_xref="GeneID:34717316"
     CDS             complement(198232..198675)
                     /gene="YCH1"
                     /locus_tag="KLMA_60089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677173.1"
                     /db_xref="GeneID:34717316"
                     /translation="MQSYSISSLKYLDAKDLYQWIKQGKTSLGEPFQVIDVRGSDHVG
                     GHIKGSWNYPYKKLKSDLAYVDTLRQELLNKTDSDSDVINCVFHCALSQQRGPSSALL
                     FLRSIPESQLSRFRIWVLKGGFNYWQSIYGLDETVTDNYKPDLWR"
     gene            complement(<198922..>200226)
                     /gene="PCT1"
                     /locus_tag="KLMA_60090"
                     /db_xref="GeneID:34717317"
     mRNA            complement(<198922..>200226)
                     /gene="PCT1"
                     /locus_tag="KLMA_60090"
                     /product="choline-phosphate cytidylyltransferase"
                     /transcript_id="XM_022820742.1"
                     /db_xref="GeneID:34717317"
     CDS             complement(198922..200226)
                     /gene="PCT1"
                     /locus_tag="KLMA_60090"
                     /codon_start=1
                     /product="choline-phosphate cytidylyltransferase"
                     /protein_id="XP_022677174.1"
                     /db_xref="GeneID:34717317"
                     /translation="MTPPLTRAPSLKERLSSTGASFTNLFKLGKKRTHDEMSLTSDDD
                     GRVDEEEDDDVEEEEQDEQQASSSSSSLKRKGSQKLDKKAQSKQKRKEKRAGSEGPSR
                     KRPHSEASDIQAREEELDSELPTEYRKFRPRGFKFNLPPKDRPVRIYADGVFDLFHLG
                     HMKQLEQCKKSFPNVTLICGVPSDKVTHKLKGLTVLTDKQRCETLTHCKWVDEVIPDA
                     PWVVTPEFLEEHKIDYVAHDDLPYASADNDDIYKPIKQMGKFLTTQRTEGVSTSDIIT
                     KIIRDYDKYLMRNFARGATRQELNVSWLKKNELEFKKHIQDFRSYFKKNQESVNNTSK
                     DLYFEVREMLLKKTLGKKLYSRLTGGQESARRNKRIAGGSPVTQFVKDFTGEEAESPV
                     SDSDADLQRASSASPNQLFSDDDDDDDDDDNDNELSSSAEPR"
     gene            complement(<200785..>201354)
                     /gene="GEP4"
                     /locus_tag="KLMA_60091"
                     /db_xref="GeneID:34717318"
     mRNA            complement(<200785..>201354)
                     /gene="GEP4"
                     /locus_tag="KLMA_60091"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820743.1"
                     /db_xref="GeneID:34717318"
     CDS             complement(200785..201354)
                     /gene="GEP4"
                     /locus_tag="KLMA_60091"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677175.1"
                     /db_xref="GeneID:34717318"
                     /translation="MVVGFNLSATLNVVRLFKDPKLCIPSVKYANFNEMKLPFPGHIK
                     AVVLDKDNCFAKPHDDKVWPEYSEQWERLKGMYPGARMLIVSNSAGTDDDVGHKQAKI
                     LEQQTGVPVLCHSVKKPGCHEEIMEYFRRNDVCEQASQVAVVGDRLFTDVVMANTMGA
                     YSVWLHDGVIKSSNPFVLLEQQVYRWISK"
     gene            <201616..>203550
                     /locus_tag="KLMA_60092"
                     /db_xref="GeneID:34717319"
     mRNA            <201616..>203550
                     /locus_tag="KLMA_60092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820744.1"
                     /db_xref="GeneID:34717319"
     CDS             201616..203550
                     /locus_tag="KLMA_60092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677176.1"
                     /db_xref="GeneID:34717319"
                     /translation="MSSNGESSRANGGVRRAQGPSTSNRGKRRTTGNGKKNGAAGSEW
                     RPVNGTGSAGDGDGDDGEEVCLICAGRLEVVALSPCNHPTCHKCCLRQRALYEKKQCL
                     FCRGEVENIILTDKLDETYGDLAGKLVESRELKNEKLGIQFTSEGVKNRAMKLLQYTC
                     PFGDVDRDLGSFKKMNEHLKQEHNRNICMLCAGHKRAFPSELEVMSVKQLKAHESRGD
                     PKDGFNGHPMCGFCTGKRFYSDDELYKHMKLSHERCHICDQLNPAQPQYFKNYDDLFE
                     HFRSAHYVCAVPSCLDSKFVVFADELDLKAHIIKDHPHLAGDNRRALSLVDSGPRRFR
                     SEITTFSNPTRVVDVQEDHSNPANSRDVKRKRMEQRARHYLGNSKSDFDAFMIINDLF
                     NKNEISAQELQSKYEDLFQNHKDDIHLLIYDFSELFHSTSEKHKQLRAIYDNIMKKKE
                     NATKFRPLASPDTSTAVNVVRGKWGQKASGSVKGSNVKFTSLPAVAEPIFSTRAPYTN
                     LRRNESTPTPVIKTGLASKSSSSSSLNYANNNNNSTMSGPAGSKQFVSSQPNVTAIKS
                     STPTSFPKLQPPKQKKFVAPPVKQHNIPNPSSWGKTSTSNSNSSDDLVDLNALGNTLP
                     TTGGNKKKSKQKQLLFHIGI"
     gene            complement(<203637..>204554)
                     /gene="PEX10"
                     /locus_tag="KLMA_60093"
                     /db_xref="GeneID:34717320"
     mRNA            complement(<203637..>204554)
                     /gene="PEX10"
                     /locus_tag="KLMA_60093"
                     /product="peroxisome biogenesis factor 10"
                     /transcript_id="XM_022820745.1"
                     /db_xref="GeneID:34717320"
     CDS             complement(203637..204554)
                     /gene="PEX10"
                     /locus_tag="KLMA_60093"
                     /codon_start=1
                     /product="peroxisome biogenesis factor 10"
                     /protein_id="XP_022677177.1"
                     /db_xref="GeneID:34717320"
                     /translation="MVSPMQFPFADTPSIVQAHQKDDSVEGLLLQKIQDVLKRVKGQQ
                     FTNRYVNEIAILSKLVYLSTTTLRYKRTLGEEYADLTYVNRRGRGIVRLLQRIGFVIS
                     YCGVPWLLSKLFYRYKLNERDHGVFKLFNGRSFKDVLDAALNLHMIAFYLSGKYYDIS
                     KRIFGMRYAIGHEMNKNEVEFKKKSSQNYKVLGFILGLQLASKVLPSIARHLSDLIGS
                     RSEGGHNDLKSMSKQHIPKDLSDPTVLPFIEEESRKCVLCLNYMIDPSATSCGHLFCW
                     DCIMEWTLERQECPLCRQRCLRQQVIPVR"
     gene            <204791..>206809
                     /gene="SHE4"
                     /locus_tag="KLMA_60094"
                     /db_xref="GeneID:34717321"
     mRNA            <204791..>206809
                     /gene="SHE4"
                     /locus_tag="KLMA_60094"
                     /product="SWI5-dependent HO expression protein 4"
                     /transcript_id="XM_022820746.1"
                     /db_xref="GeneID:34717321"
     CDS             204791..206809
                     /gene="SHE4"
                     /locus_tag="KLMA_60094"
                     /codon_start=1
                     /product="SWI5-dependent HO expression protein 4"
                     /protein_id="XP_022677178.1"
                     /db_xref="GeneID:34717321"
                     /translation="MDETWETIISKDIDVSSTLKENCTSIEDVKGLLKVAQGWISAGI
                     HDIEEEKRCWMCISTILGSVNVKDWSALEFVCRGILLRSKEKELRPTLQMTANALMCS
                     YPEKMEQKCGNILQELLIEAEEDSGTDSVLLLVQAMSLLFPICLSMCKDMLVSTDFQD
                     VLIGKLKLNETVNSELVLASLNLLSVACIDDSMRTFICEHYLKLLEQTFTVAKYKIGT
                     ALVLIKIWNFTKLQKQTLDECISIFIESFAKGEHVEESTESLAYLTLKPSVRVLLRNN
                     GDVSLKLIEMLKSEETAPSEAYAILCIIANLSSLPADSGEEDTINKLKQSLKSKQERE
                     QEAATVENLQEIQEFNRDYIIDLDLIGRLKSMKLSTSSFNQAIKIVYNVTRDKKLIPD
                     SVKQGAGVMLLVFLAQKREVAKDEYYFLAIRALSKILIHVNPQTAFNKFSPLSTVPFL
                     FEMLPSGEDAADESTTNALLSQPQFTPLDTYESLLALTNLATINQGSDLGKIIAGNPK
                     YWSTIENLLLDSRVQIQRSTLELISNLMAYPMNLAAKFFNSENPKSSQNFNTLVKLLE
                     LQDLQSQRAVAAIFANIVTTVPFICEELSHKENLSQTLIRVFKAQHNDTDLRQRLLVL
                     LLSIMGSNPDVVTSVKNDATLLTTIKQYKQSPDPLTSEITTDILKLVP"
     gene            <207160..>209415
                     /gene="AKR1"
                     /locus_tag="KLMA_60095"
                     /db_xref="GeneID:34717322"
     mRNA            <207160..>209415
                     /gene="AKR1"
                     /locus_tag="KLMA_60095"
                     /product="palmitoyltransferase AKR1"
                     /transcript_id="XM_022820747.1"
                     /db_xref="GeneID:34717322"
     CDS             207160..209415
                     /gene="AKR1"
                     /locus_tag="KLMA_60095"
                     /codon_start=1
                     /product="palmitoyltransferase AKR1"
                     /protein_id="XP_022677179.1"
                     /db_xref="GeneID:34717322"
                     /translation="MDTEGRGTPSMPKEEEQLLEEQASGQVEEIEEDDNQSLNSMKAV
                     VSRSSNKMEDESEEVIVKDPVLERYHGACKVGDLRTVREMVESKVIDLSKDYDENERI
                     SGLHWACINNRLSVVKYLASAGADVNFQGGDLDATPLHWASKSGLVYIVDALLQAGAD
                     PHITDSQGYNLLHTSVFSSNIMLVIYVLFFVVDGTDDVDQPDPHFRTALQWAAYQSDT
                     LTVENLLKFNANVKKADETGFTALHWGTVKGNMYVMDLLIKYGSDFFQTTNDGKNCFT
                     IGKELYSIKSLEDALYKNGFDKNGFPMKRYFTPTAGKLITFFLPYVLLPAVLFIFAHV
                     TFVVALLINTVILTLCGFALTRFVIPSFLLSKRNSVMKSPLLSGILSGTFTLCLFVWI
                     IKIAPLTFTEKPLTNLCMMVLMYVLSFTFGMLLRSNPGQIPATTDHDEIRKTIKELLS
                     LGKFDTKHFCVHTWTRIPLRCKYDRDTSSLISRFDHFCPWVNNRIGLLNHKIFYMFVV
                     LLEISIWVLIPLIKEYFDELEDYLEDKKGKHFSKEKCRLLGDDDLCFGMRNDPFTFLT
                     LCWITFQSVWVLFLIGVQTVQFLKGVTDYEFSQLNKKLRRHGAGSTTEEFFSSTPPEL
                     LSEELLAELDAPALDPRRVPQRTCFTLCSTVLGLDKAMIMFKSLLRLNRGEHSSMSST
                     GLQDSPLLIIPTDYGWKQNAKDFWLLCDTTLPLWRRILYPPKNSHALLNGKEVDYYTL
                     YNLPDAMERVA"
     gene            <209994..>211850
                     /gene="EXO1"
                     /locus_tag="KLMA_60096"
                     /db_xref="GeneID:34717323"
     mRNA            <209994..>211850
                     /gene="EXO1"
                     /locus_tag="KLMA_60096"
                     /product="exodeoxyribonuclease 1"
                     /transcript_id="XM_022820748.1"
                     /db_xref="GeneID:34717323"
     CDS             209994..211850
                     /gene="EXO1"
                     /locus_tag="KLMA_60096"
                     /codon_start=1
                     /product="exodeoxyribonuclease 1"
                     /protein_id="XP_022677180.1"
                     /db_xref="GeneID:34717323"
                     /translation="MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAM
                     ELALNQPTDKYLQFFIKRITMLKHFGITPFFVFDGDSIQVKKDTEQKRADKRHENREK
                     AHALYAAGDKRLAYDYFQKCVSITPEMAKCVIEYLQVNSIPYVVAPYEADAQMVYLEK
                     EGLVHGIISEDSDLLVFGCRRLITKLNDNAECIEIDRRNFSQLNSGKFPLGKLNEEQL
                     ISLVCLSGCDYTNGIPKVGLITAMKYVVKNRTMRQALAEIERDGKLAVPKTFWEEYEY
                     ASFAFRFQRVWCPKREKLWTLNDVPREYMANEKLFRCIGAAIRKGIREKEVIFSDDMI
                     DHELHRRISVGELDPFDFNKPLANRERKLRLQNGASSSSVSVTTATSTTTTIDSIATK
                     RASISSVRCKGKSDGGAGIMSKMERALRKRKMCGDVGAAEAAAGAAGAAAKRTVSSQF
                     FRRPETTPEVRPEVSPEAGPEDNLPDTQEDSTEVSQLLTPEEESEILSEVEEAPGQDQ
                     DQGPADPDDSDTNLLAQLRKKFMHEAATTRVPLKNVTNTSGQGPAHAKLPTKLPAKLP
                     ARTPQQRPAVRRTMSGAMTSNTVPSRDPSRTSASRSISRSISLSQFAYSRQS"
     gene            <213078..>216071
                     /gene="HMS1"
                     /locus_tag="KLMA_60097"
                     /db_xref="GeneID:34717324"
     mRNA            <213078..>216071
                     /gene="HMS1"
                     /locus_tag="KLMA_60097"
                     /product="probable transcription factor HMS1"
                     /transcript_id="XM_022820749.1"
                     /db_xref="GeneID:34717324"
     CDS             213078..216071
                     /gene="HMS1"
                     /locus_tag="KLMA_60097"
                     /codon_start=1
                     /product="probable transcription factor HMS1"
                     /protein_id="XP_022677181.1"
                     /db_xref="GeneID:34717324"
                     /translation="MPFTHSVNLGAPPSSFSEVDMFLQSLTSEDSSDADSYDFFSPDS
                     QGVRQASGSGSVSGRGGMGPGAFEPQYLHSQGQGFAQVQAQAQGQIQVPGQISQGHVM
                     SHVTGNGNGSNSNSNSTSSSAAAAAAAAAATVTGHTHANPNPGSFGSSSSSDPYNNYS
                     PFDLSDTELRPSITNDTDSMLHVMIKSESDPWANSNSNNKNNQGQGQGQGQGQGPISL
                     ASAGIPVAANSMVHSAPQSSVASGLPAGVQSLDAMVSPTDSLDSRPSPHGGLSLGQSL
                     GQTLNQGHNNMGQGLNQAQSLSQSLSQGQIQTHGSGSGLTSSVQGKVGKPKKERTSHN
                     VIEKKYRTNINNKIVQLKEIIPSLCVTMKREEGIPVTELDQIRLDGLQPAKKLNKASI
                     LVKTIEYIQHLEGKVEKLKAENDQLKQSETFSTPLSVRNNSTSESLHHSQQHQAARAQ
                     APIRSGSSTSSSTSTSASDVNISGDPTIFTNAYPTSNMNNNNHSFRNKMLLGGIAMSM
                     GANCFGGDSSDFSTVRGLMAMPVFHYSPMEGFTLSNSNGNINLFSSFISLFRLCAFFG
                     IIVQLMSQIMDDRKSAGSKGGNSSAMSDIVVNYVDSLRFTSNSEIVETLKKTLFLNRL
                     KYPENSMERIQNEILKCYAIKLWKSPFKILFSGHVEKTWDSLSSKVNKINSKPSTITE
                     NPDWKAISYILKSDVSEALGNEPLLAQIAENKDGFNLSSFVQFVYRYNVQQKVESAMN
                     ATFEASLNDTTSVPVPVSEAQAQAQATKLERIYLESIKDNKELQSLGVSTSLDCIFHP
                     NARTVKELTDKLKVDKSLLSEDERKDIIRILHSTIISAVVADKKFDEVSYWVSRFPTS
                     LVDQENMSLLSVTALFFTIKRILDNHKNIDDISKVSAKLEYISGKLRIWVGSKFGSCL
                     QLDTRGKLVDFFVDSALKFNSLVESDGEEEEYEGEDEEEDEADSLFDEDEEEEEEDDD
                     EEKKEEEKDQIKRETNNNVVEPSET"
     gene            complement(<217187..>218002)
                     /locus_tag="KLMA_60098"
                     /db_xref="GeneID:34717325"
     mRNA            complement(<217187..>218002)
                     /locus_tag="KLMA_60098"
                     /product="fasciclin domain-containing protein"
                     /transcript_id="XM_022820750.1"
                     /db_xref="GeneID:34717325"
     CDS             complement(217187..218002)
                     /locus_tag="KLMA_60098"
                     /codon_start=1
                     /product="fasciclin domain-containing protein"
                     /protein_id="XP_022677182.1"
                     /db_xref="GeneID:34717325"
                     /translation="MKISILSTLLLLGTFDKVISRRVVDLGSLDLSEGEEVIEKREPK
                     RLPLDIEGIVHDYDKNLKKREPKRVGLSFEKVSNDDAEVFDKSKVKRDMKRPQFVIDI
                     SDGKTEDRVNLDSRLTVLQDISIFSSYGRNVLDVESQWEDGSQELIVIAPTNAAISSL
                     PKKPWQFPKDIDAMEEADAAPKDIEDAINGNIAHFVKSHIISRSNDFNLQSTEVWLHS
                     EADSSEKGDIVLKKQDNEYYIASASDMDFKQVKTVDVAANGVILIIDACLIKP"
     gene            complement(218346..218416)
                     /locus_tag="KLMA_R603"
                     /db_xref="GeneID:34718762"
     tRNA            complement(218346..218416)
                     /locus_tag="KLMA_R603"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718762"
     gene            complement(218525..218595)
                     /locus_tag="KLMA_R604"
                     /db_xref="GeneID:34718763"
     tRNA            complement(218525..218595)
                     /locus_tag="KLMA_R604"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718763"
     gene            complement(218834..218904)
                     /locus_tag="KLMA_R605"
                     /db_xref="GeneID:34718764"
     tRNA            complement(218834..218904)
                     /locus_tag="KLMA_R605"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718764"
     gene            complement(<220585..>222024)
                     /gene="DFG16"
                     /locus_tag="KLMA_60099"
                     /db_xref="GeneID:34717326"
     mRNA            complement(<220585..>222024)
                     /gene="DFG16"
                     /locus_tag="KLMA_60099"
                     /product="protein DFG16"
                     /transcript_id="XM_022820752.1"
                     /db_xref="GeneID:34717326"
     CDS             complement(220585..222024)
                     /gene="DFG16"
                     /locus_tag="KLMA_60099"
                     /codon_start=1
                     /product="protein DFG16"
                     /protein_id="XP_022677183.1"
                     /db_xref="GeneID:34717326"
                     /translation="MDDTSWLKPLVSRFSCEGYLLNSGTFSQVVGTRHSHTVWNQTMS
                     YPAWYVNCTNANETVKFIKALADSSQKYNLKPQKNDFMNGNLVIAFVISGVCIGGWML
                     FLLLFLLPSTNHNRQHRMVHLNVLYFSIVQSVTWKMTNDQVFAVQYKHNSQNSNAFYY
                     VIFKSRWFRVLRFFQLLFCDINWVIVIYYLCQGSKVRSWRLKGWPVCLSNSTNVIVTL
                     SVSLSVFHVMFFGINLFYAHLKYLLWVQVPFRITQIALFTIFLLAIIRYAFYSLHSVS
                     SSMDSHVTSRSRKFMMFLQNYKETIPLLIYNITVYLLLYAAAIVQMVQNESRNHWIHS
                     LIAFLRILVFVNAWGLIGKLEKREREISKKSLLGRRIDNRDRFFVDPKIDYVGDKSSS
                     NKKNKKRRFFKPRVSLFHSKKSSSNRGDTESSTEYYGMQDMDDVGRAVESQSLDAIDS
                     ENDSLDTMLTRNVIYEHSSNWNGDTDLRM"
     gene            <222475..>222807
                     /locus_tag="KLMA_60100"
                     /db_xref="GeneID:34717327"
     mRNA            <222475..>222807
                     /locus_tag="KLMA_60100"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820753.1"
                     /db_xref="GeneID:34717327"
     CDS             222475..222807
                     /locus_tag="KLMA_60100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677184.1"
                     /db_xref="GeneID:34717327"
                     /translation="MNYLDSQTRHYHYARAQHMCWNWNDPTNEDGNRFPLPDQESVRQ
                     DAHAGLQVNVGEPNSYWDCYVDEDQWQVFQDLLMDCNGNLTRNDESEGNLFRHVIKAR
                     DLKLPLPL"
     gene            <226589..>229099
                     /gene="HSP78"
                     /locus_tag="KLMA_60101"
                     /db_xref="GeneID:34717328"
     mRNA            <226589..>229099
                     /gene="HSP78"
                     /locus_tag="KLMA_60101"
                     /product="heat shock protein 78"
                     /transcript_id="XM_022820754.1"
                     /db_xref="GeneID:34717328"
     CDS             226589..229099
                     /gene="HSP78"
                     /locus_tag="KLMA_60101"
                     /codon_start=1
                     /product="heat shock protein 78"
                     /protein_id="XP_022677185.1"
                     /db_xref="GeneID:34717328"
                     /translation="MLRTVGRLNSSIPRTKLLREASAPHVNGLDVLCGHRSISSVSFA
                     GGAVGGLKNDEISVNSGGNSYLSLRRRPSLAVPNGNARRFMGVGERSGILYNKLGVRS
                     YAKNYNLNLNNDQGGDSALSQFGTNLTELAKQGKLDPVIGRDQEISRAIQILSRRTKN
                     NPVLIGRAGVGKTALIDGLAQRIVANEVPDSLKDKELYALDLSSLVAGAKYRGEFEER
                     LKNVLDEIDKSNGKIIVFIDEVHMLLGLGKTDGSMDASNILKPRLARGLRCISATTLD
                     EFKIIEKDPALTRRFQPIILNEPSVPDTISILRGLKEKYEVHHGVRITDSALVSAAVL
                     SNRYINDRFLPDKAIDLVDEACAVLRLQHESKPDSIQAIDRAVMTMQIELESLKKETD
                     AVSVERREQLEKELDLKKKELKRLTDIWEKEKSELDSIKSAKEDLDKLRTELEICQRE
                     GDYAKASELRYAKIPELERKVALNEKKDKENSLLHDSVTADDISKVISKMTGIPMETV
                     LKGDKDRLLFMENSLRERVVGQDEAIDAISDAVRLQRAGLTSEKRPIASFMFLGPTGT
                     GKTELTKALAEFLFDDESNVIRFDMSEFQEKHTVSRLIGAPPGYVLSESGGQLTEAVR
                     RKPYAVVLFDEFEKAHPDVSKVLLQVLDEGKLTDSQGHQVDFRNTIIVMTSNIGQDIL
                     LSDSDVGESGKVSKKTKNSVIEAVKRRYPPEFINRIDDLIVFNRLSKEVLRSIVDIRL
                     KEIQERLNEKRMTLKLSDEAKNWLTDRGYDPLYGARPLNRLIHKQILNPMAMQLLRGQ
                     LRHEETVNVVVKDGELCVEPNHEAEVTGNTASPEENVD"
     gene            complement(<229444..>233625)
                     /gene="YSP2"
                     /locus_tag="KLMA_60102"
                     /db_xref="GeneID:34717329"
     mRNA            complement(<229444..>233625)
                     /gene="YSP2"
                     /locus_tag="KLMA_60102"
                     /product="GRAM domain-containing protein YSP2"
                     /transcript_id="XM_022820755.1"
                     /db_xref="GeneID:34717329"
     CDS             complement(229444..233625)
                     /gene="YSP2"
                     /locus_tag="KLMA_60102"
                     /codon_start=1
                     /product="GRAM domain-containing protein YSP2"
                     /protein_id="XP_022677186.1"
                     /db_xref="GeneID:34717329"
                     /translation="MTLGIHKENKSRLRSFSGNAGSLLGLNKRKNKRKEKERDKSSQL
                     QTGETPERIDEVSDDLSDGSSDKVFVTQGSDDDSDIAGTVRTVRTAQRQSPQKQTPHK
                     HKQRYSDGNINASTVSSEISKPSSRSLKISTSLAKLQRKELSLNDLTSHAQSNGERER
                     ERERDRNDRSRSTDAFNQTAISSGENTDPLGSRLRDTEGKSHSDVPSTTLFTKFKSSK
                     TEHLTPSKTRIEDTESGILSSLVSAAHNAANHLIPKNSLKSAGSLHDESPDASDKLHS
                     TTSSAGVETPLESFHHSSSFLNHLDFLLAASPNNELMLKRTTTLDTLHTSDSSNSSFS
                     QQLTSPSSAAPLNDDEELETYNSDELGSMGTSIEKVKFHSIKQDGASPAISTFGRGNL
                     TLDAFDNQNKSNGIEYNLPNVLINDHPAMNAKSPSQMSFQNFENGTDQNLGNTANNNN
                     NNNDNNNTNSNNINNNTTIAASNPPDSIPSEASSVDVRPRTPRTSKKRPEGLRELTMR
                     SLSPAAATRLIKAPFRNSFSGRNMTRGNSISRSNDNAQKRLSTSDIPTNKTFEQPELQ
                     GIEYASPKRNSEFHSIFKDTVVSPTERLIADYSCALSKDILIQGRLYISDKHLCFYSN
                     ILGWMKSVVVPFKEIAQIEQKNTAILFPNAISIQTLHDKYLFASFISRDATFDLIMDI
                     WNQTIINKQLKPNNGRAGSMEFSRDDIMSNSEASSMNFNDEDDVAGVSNDLVSTTTRD
                     YYSEDDEDDESDGLDDIDSQEMTSDSEEGSSNLGTSDQKRTGLSKTSSTQSANVIGPL
                     QHAPTTPDYTPKENEREMGEATFNAPLGTVINLLYGNDTKHFGRILKAQGNYDISPIE
                     EMLQAKKREYIYTKPISGSIGPGKTTCFIDENFDKFDLNKYVQVTQASKTPDIPSGNS
                     FVVKTVFLFSWAENNTTKMKVYAYVDWSAKSWIKAAVEKGTFDGVKSSTKVFISELEN
                     IIEENRGKSSPSSASQKLKDVEVEEVVSSLPSMSPKEHEPTACTFDKSSGYEIIDDKI
                     NLKAPVGTIFQLICGDDTSYVRRILERQKNFDISEIPPFKDKTRKYSYTKPLSGPIGP
                     KQAKCFIEEKIESDDINTCMVLEQISRTPGIPSGNSFEVHTKFYFSWGEKNSTNMLVA
                     TIVEWSGKSWIKSAVEKGSISGQKAGMQDMVAELKDILASATTVTKRRTTGPKKKVER
                     TKSKRKTITTPPVEEHEETGVMAIAEQIGNVLKDLVSDLPPGVFIIGASIIFIFLYVI
                     PRLYSGVFPAAQTPHFIDSNTISMDGQEYYIIPSVGNRAMMNRRFTNDKRDNKYVTDS
                     EYDIWKWIDSHSGKNANVANSSEEFSSYFKSNDEPNFDKATEHEKQFLNEIIRITEQR
                     LSKLKQEANMVDSEV"
     gene            complement(<234008..>234553)
                     /gene="SKP1"
                     /locus_tag="KLMA_60103"
                     /db_xref="GeneID:34717330"
     mRNA            complement(<234008..>234553)
                     /gene="SKP1"
                     /locus_tag="KLMA_60103"
                     /product="suppressor of kinetochore protein 1"
                     /transcript_id="XM_022820756.1"
                     /db_xref="GeneID:34717330"
     CDS             complement(234008..234553)
                     /gene="SKP1"
                     /locus_tag="KLMA_60103"
                     /codon_start=1
                     /product="suppressor of kinetochore protein 1"
                     /protein_id="XP_022677187.1"
                     /db_xref="GeneID:34717330"
                     /translation="MSKENQNVVLVSVEGERFVVDRKIAERSLLLKNYLQDLNSGDLQ
                     DADGDNDDDEDDDEDDEIVMPVPNVRSSVLQKVIEWAVHHKDSNFPDEDDDDSRKAAP
                     VDPWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRTPEEIRRTFNIV
                     NDFTPEEEAAIRRENEWAEDR"
     gene            complement(<234832..>236181)
                     /gene="PEX3"
                     /locus_tag="KLMA_60104"
                     /db_xref="GeneID:34717331"
     mRNA            complement(<234832..>236181)
                     /gene="PEX3"
                     /locus_tag="KLMA_60104"
                     /product="peroxisomal biogenesis factor 3"
                     /transcript_id="XM_022820757.1"
                     /db_xref="GeneID:34717331"
     CDS             complement(234832..236181)
                     /gene="PEX3"
                     /locus_tag="KLMA_60104"
                     /codon_start=1
                     /product="peroxisomal biogenesis factor 3"
                     /protein_id="XP_022677188.1"
                     /db_xref="GeneID:34717331"
                     /translation="MTEERFVKEQIKRRFVQTQQDSLYTLYELMPVMTLVLAKDFDLD
                     SLVEALKGKKLEKKLSKGGKVSGEEYAEGLSSGMSATTEVQNNGSSSVQTDVQSQAGL
                     PAQKSKAELWNELKLKSITKVIVLSYTASLLMLLTRLQLNILARREYLDTAINNALEK
                     EREKNANQYSVISWFSNWISPAAASAASAATSDKINNKDVSNADNASIVTNSTTHTTA
                     NPEKLRYVNEQAFLSLSWWLLNRGYLQYKGIIEQLVKEEFEHLNPRDTITMDEFSDKL
                     SKIFVATNKQFFQQQQSNEMFISCLLPEPNLERFVLQQTLEPDALKVLYEDNLLLKQL
                     VQETNKCLESPGTWIVLESLIDETFHCIMEQIETNVASKAKTTPPSTSTPGESLPTPQ
                     EENKAYQIALFAIATKDCTNEMLKAGLVSMNNTFLQKLHSIPALDDLSACVYSNFGL"
     gene            complement(<236761..>237201)
                     /locus_tag="KLMA_60105"
                     /db_xref="GeneID:34717332"
     mRNA            complement(<236761..>237201)
                     /locus_tag="KLMA_60105"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820758.1"
                     /db_xref="GeneID:34717332"
     CDS             complement(236761..237201)
                     /locus_tag="KLMA_60105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677189.1"
                     /db_xref="GeneID:34717332"
                     /translation="MSYDELTKVEELIHTVKQKYAEQSSTLSTSDQTLWSSMVSELNK
                     VALEMDQLLQRNQKQMNVSFLLNNETPKILPKLDRTAFYSENSPYQHQTDKSGSFRLC
                     PPLAHTTAAEYFRNDANVQLQLTDGQILENLSNLKRLADLHNRR"
     gene            <237881..>238438
                     /gene="LRP1"
                     /locus_tag="KLMA_60106"
                     /db_xref="GeneID:34717333"
     mRNA            <237881..>238438
                     /gene="LRP1"
                     /locus_tag="KLMA_60106"
                     /product="exosome complex protein LRP1"
                     /transcript_id="XM_022820759.1"
                     /db_xref="GeneID:34717333"
     CDS             237881..238438
                     /gene="LRP1"
                     /locus_tag="KLMA_60106"
                     /codon_start=1
                     /product="exosome complex protein LRP1"
                     /protein_id="XP_022677190.1"
                     /db_xref="GeneID:34717333"
                     /translation="MEDSKKIKPYILHLNKQIKQLTGEIDKLTSKSLDEQLLLLQDEK
                     QKLDLSNKYAYILSSLCFAYMKVLNVKDFSSIMAELGRCKSYMDKSKQLETKQQSQEQ
                     ETLEQEKQAKKVLQSALSGKSTEPAISSVHFQGKHTKFADESATSTKKDKDTSLVDQV
                     MDRMKKQKQTQKQSKTKASGRVSKK"
     gene            <238729..>240294
                     /gene="UBX5"
                     /locus_tag="KLMA_60107"
                     /db_xref="GeneID:34717334"
     mRNA            <238729..>240294
                     /gene="UBX5"
                     /locus_tag="KLMA_60107"
                     /product="UBX domain-containing protein 5"
                     /transcript_id="XM_022820760.1"
                     /db_xref="GeneID:34717334"
     CDS             238729..240294
                     /gene="UBX5"
                     /locus_tag="KLMA_60107"
                     /codon_start=1
                     /product="UBX domain-containing protein 5"
                     /protein_id="XP_022677191.1"
                     /db_xref="GeneID:34717334"
                     /translation="MISDEDISTFQSVCGTENEELSRHFLEMAGGNIETAISLFFEHG
                     GERQLNSAGSGGSGSNGGGNARIDSDLGDSGSAMRSDVELAEELQRQAYQEGSGQGSG
                     NGEDYGYRAPDQARHETLVDTNVFPGVYGGVGGSFGPLRGARDMFDHSRPSGIFNQQL
                     DVDMLQGRGNNDESSSDSAFTDEENYPSNEEQFEYVEENVVEIDDDGELREYTKWVRK
                     PKPMSKETRLALLFRPPFDMMAKYDLDAARQKARKKNKWIMINIQCSDIFQCQMLNRD
                     LWSDANLKAFIKKNFVFLQYQYESRLASVYIQRYGLHNRDDCPHIAILDPMTGERLKF
                     WSREVPKVDSFRQELETFLEEFSLDPKSTNPTVKEPTPEIDPTTLSEEKQMELAIKES
                     LGGAQATQNQPPSENEAEEESEETSETANLKLFNSIEPVNHPEPDNKPGITTRIQVRT
                     GDGKRLVRRFDAMNDTVKTIYEVIKSHWPEYASTPFQLTTHARENLIEKLHESINDAG
                     LKNSSILLEKIVD"
     gene            <240750..>241835
                     /gene="GPI8"
                     /locus_tag="KLMA_60108"
                     /db_xref="GeneID:34717335"
     mRNA            <240750..>241835
                     /gene="GPI8"
                     /locus_tag="KLMA_60108"
                     /product="GPI-anchor transamidase"
                     /transcript_id="XM_022820761.1"
                     /db_xref="GeneID:34717335"
     CDS             240750..241835
                     /gene="GPI8"
                     /locus_tag="KLMA_60108"
                     /codon_start=1
                     /product="GPI-anchor transamidase"
                     /protein_id="XP_022677192.1"
                     /db_xref="GeneID:34717335"
                     /translation="MANVLSMYRTVKRLGIPDSQIILMLSDDVACNPRNLFPGSVFNN
                     AERALDLYGESVEVDYRGYEVTVENFIRLLTDRWDENQPKSKRLMTDENSNVFIYLTG
                     HGGEDFLKFQDAEEIASHDIADALAQMHAKKRYNELLFMIDTCQANTMFSKFYSPNVI
                     AVGSSELDESSYSHHSDVEIGVAVVDRFTYYTLEFMEAIEKNSTLTLQDLFDSYTFEK
                     VHSHVGVRTDLYPRNQSEVLITEFFGNVQNLVPAESDVDARANEDVEYDNLLNDLAFL
                     KHTELQKQRNNSHGSLKVSKSKLINGDQAIYKGAVETYNIKLVKALGALVLMSIIGLF
                     RYLVLSADKNLSKLTNFYLYKEHPTNS"
     gene            complement(<242092..>244782)
                     /gene="KSP1"
                     /locus_tag="KLMA_60109"
                     /db_xref="GeneID:34717336"
     mRNA            complement(<242092..>244782)
                     /gene="KSP1"
                     /locus_tag="KLMA_60109"
                     /product="serine/threonine-protein kinase KSP1"
                     /transcript_id="XM_022820763.1"
                     /db_xref="GeneID:34717336"
     CDS             complement(242092..244782)
                     /gene="KSP1"
                     /locus_tag="KLMA_60109"
                     /codon_start=1
                     /product="serine/threonine-protein kinase KSP1"
                     /protein_id="XP_022677193.1"
                     /db_xref="GeneID:34717336"
                     /translation="MSLDYEIYKEGGLLRDRYKLIEDISEGSYGYVSLASDTKLKKLV
                     AVKYIFKSDSYENRDEDKKKDDTEGNKGEPDAKSKAVDVGQKNGDNDESSQAKHLEDG
                     NSSQKPSNNSSLEKQQRLMKHQKSLISDKVLSRFSNNVCFEALYEVDIQTKIGKHKNI
                     TELYDFFDSYIIMEYCSGGDLYEAIKDEMVPRKTKQITKIINQILDAVEYVHSRGIYH
                     RDIKPENILIAGNWNIKLTDWGLATTDKTSMDRNVGSERYMAPELFDSNLDREEKVEP
                     YNCAKVDIWALGIVMLNIVFHKNPFTVANQTDKAFCYFAANREALFDVFSTMSYDFFQ
                     VLRHALTIDPTNRNLENVRTEIKKLGEYTMDDEYYNSLDSDEELDFLSYPPPAAPPKS
                     APTSVSAPSVAPMSPLHSTAPATVATTMSDIISAKPVVAETVQVPEKVPTITVEQITP
                     EPSTVKQEEKEAVPRFTFTKRSHNRSKSNEYFYNNKNGNNNNNIKRNAPPRYDFNGAG
                     GYRNHKTNIKPIQINNEKIIKNSRKPLAIPTPNTHINNFFHEYKSRDDAHSFNTRDYF
                     TPPSVHNRYMEGVFSKKNKRYNQRPKSPKNNGNGYNHASGNRRGSFNHDNPNNNNNNY
                     GNGKYVPPHSRRSSEIGSPGTMSHLSPNYEDNPPIHTMTYHEQHALSVDNEPELDDVL
                     FTLEESDGFDGFVNDLSDLSLNTQHSAHSNNLNINGTNNQVPNGLPDLFKSPQVSHVN
                     LNDQLNNHASLAHSGRKPSTNMEKGTSGVYVPPHHRKSFNAAHEQTSVGQHATNGKRH
                     SFGHKKPFNGNGGNQDRFMFQSNNYHSTASTSLQKNDVFIDNDAIFFEEDDPHFFSNG
                     KANSPGKIRAGRKSSTKQDEMVGSLEQYKNNWLMLQQYQD"
     gene            <246061..>248067
                     /gene="IRC3"
                     /locus_tag="KLMA_60110"
                     /db_xref="GeneID:34717337"
     mRNA            <246061..>248067
                     /gene="IRC3"
                     /locus_tag="KLMA_60110"
                     /product="putative ATP-dependent helicase IRC3"
                     /transcript_id="XM_022820764.1"
                     /db_xref="GeneID:34717337"
     CDS             246061..248067
                     /gene="IRC3"
                     /locus_tag="KLMA_60110"
                     /codon_start=1
                     /product="putative ATP-dependent helicase IRC3"
                     /protein_id="XP_022677194.1"
                     /db_xref="GeneID:34717337"
                     /translation="MRMLWTTKFSHGLSRAVLGCCRYSSVPVLRDYQQECIDQCVDAV
                     TRQGKKRIGVSLATGGGKTVIFSNLLDRFRGLEGGNASRTALILVHRRELAMQAASTI
                     SKFMPDLKVHMEMGKMRANLEDADVVIGSVLTMVRRLEAYPRDSIDLIVIDEAHHAVA
                     DSYLKILAHFNADTADTKVPVIGFSATFERADKRALSAVMDEIIYHKGILEMIDDNWL
                     CEGKFTTVDIGADLSKVKSVNSDFQLEGLSKVMNTEEINKLVLQTYLHKRKIHDLKST
                     LLFAVDVAHCKALFETFQNAGIDAQYVTGKTRTSERDAIVSDFKSGKISVLINCGIFT
                     EGTDIPNVDCILLCRPTKSRSLLVQMIGRGLRKHHSKEHCQIIDFVSSSKVGVVSVPT
                     LMGVDGYDDNLDESTMEEINKMKEELEAKQLALDMEKQRKDDEERRLRDRYDKHLLET
                     DTIELTLTNFENFKSFCESMMEEDYSKLPPSVKEAKLFSQSKFPWVLVSKNSWCFPLL
                     TGRHIRVEKETTETKENIYKAKFYRRIYPDKTSGVAYAPYHVVDIFSSPDLMQVLNTV
                     ESFVSKISSSSSRAFTKFPQWRKEQATIKQKNIVKRYFENVIKDDDKYDAMKPFVDVY
                     VDNMTKGEASSLLFATKLAPKYPIKRILKLLSWRNSEQKQRKIG"
     gene            <248313..>249317
                     /gene="SAM35"
                     /locus_tag="KLMA_60111"
                     /db_xref="GeneID:34717338"
     mRNA            <248313..>249317
                     /gene="SAM35"
                     /locus_tag="KLMA_60111"
                     /product="sorting assembly machinery 35 kDa subunit"
                     /transcript_id="XM_022820765.1"
                     /db_xref="GeneID:34717338"
     CDS             248313..249317
                     /gene="SAM35"
                     /locus_tag="KLMA_60111"
                     /codon_start=1
                     /product="sorting assembly machinery 35 kDa subunit"
                     /protein_id="XP_022677195.1"
                     /db_xref="GeneID:34717338"
                     /translation="MASLLAIPGPLKSLFDMFPLKTYGSIKDNDQALDYDALTRTAYF
                     MGPNATKANKDDVFQLGVYQFVRDSKTGVLLASDPWGIFAELSLCKKNDLQLPTATPD
                     PLDPKTAQKPQHSMCILSARASVDKSLPILIESYTRRHIRSTKSINEILFSRIPAGEQ
                     TLYLKLLNTIVYDGYLADLLTNASPAKFCELYTYINERDVSVTNSITIQDVKRSLLAR
                     NNFNLRHQQLTKYLLEPMFPTNRTELAALAQTAIAETIRCLKKLQIHWRKNHQPQEHQ
                     NHASNTQRTDFQYIDLALASYVLAIAQLGPDSELYQWMHTDAQFLLEFSQQLLQTYSI
                     "
     gene            <250913..>253030
                     /gene="STE12"
                     /locus_tag="KLMA_60112"
                     /db_xref="GeneID:34717339"
     mRNA            <250913..>253030
                     /gene="STE12"
                     /locus_tag="KLMA_60112"
                     /product="protein STE12"
                     /transcript_id="XM_022820766.1"
                     /db_xref="GeneID:34717339"
     CDS             250913..253030
                     /gene="STE12"
                     /locus_tag="KLMA_60112"
                     /codon_start=1
                     /product="protein STE12"
                     /protein_id="XP_022677196.1"
                     /db_xref="GeneID:34717339"
                     /translation="MAISVVKTEDISSVSVRGDASQSPEEVEESLRLIEDLKFFLATA
                     PANWQENQVIRRYYLSNDEGFVSCVFWNNLYYITGTDIVRCCAYRMQKFGREIVERKK
                     FEEGIFSDLRNLKCGIDATLEKPKSDFLKFLYKNMCLKTQKKQKVFFWFSVPHDRLFA
                     DALERDLKRVASGGQPTTKAVAEPALSFKWEANSDVSLYDQITHHVDSQRIESRPVSA
                     EEEGQQQQQSQTQSHSQSQANQQLHNKQQLQHVADTPVSAAKEIEPYELGSVQEEEAE
                     VAIVDNDKLPYGLPSGQEVEQTNYEPQQLVVPHSEHGDEVPAEFDELNDDLKPSDILA
                     SNQEEDDFPLDYFPVEIEYSQTSMDSSLHVMPQGSKMSTQMMFYEDMDGMMAGPKYPI
                     SAGLYEDPFFRDEMAVPVPVPNSAKYMMPPPMSASRSQFMTNGEYYSKSKENKKPVAA
                     ASSLNSNNKTQTPELKRSGDEDINSPTSENDAPEEENDTSEQSQEQDSSHRMYQTETP
                     SNEEYLSAPYNNRRMQVNESMVHPYTGMLLNPYMFYNMLAVDPAMTMGVNPMTDPFYG
                     QAQAHNMDVVHDMYPPQEVVYPSNYRTTPKAAYFNMRSPYGRNFPPPSAMNPYYTPYH
                     RRQPSSGTRRYFNKAAIINKKMKSPPRKGMVSKPTQKSMKVNNGGKAEGAKSASMINK
                     DSDNAYVEFREEAAKDYSNDNMK"
     gene            <253364..>254617
                     /gene="GPI18"
                     /locus_tag="KLMA_60113"
                     /db_xref="GeneID:34717340"
     mRNA            <253364..>254617
                     /gene="GPI18"
                     /locus_tag="KLMA_60113"
                     /product="GPI mannosyltransferase 2"
                     /transcript_id="XM_022820767.1"
                     /db_xref="GeneID:34717340"
     CDS             253364..254617
                     /gene="GPI18"
                     /locus_tag="KLMA_60113"
                     /codon_start=1
                     /product="GPI mannosyltransferase 2"
                     /protein_id="XP_022677197.1"
                     /db_xref="GeneID:34717340"
                     /translation="MFKGSNYKPFHVVNATFVGVKLLQFILVWLAPSTFDTSTHLFLE
                     RFGITSDPWWSKLLAWDSVFFVKTSEWIRITGNWTPQYEHEWAFSPYWAQIITSSDVQ
                     HTVLRAVVLNILLHYVSTWILYFLTKVTFPPFGQKAQTEVALITSVLFILSSAAGFLI
                     SIYSEPIAFTLSLFGMLLRQLSVKFDVYGNIQLNHIKWIGYALSSFCFSMAFLNRSNC
                     LLLGIFYIYDCLNLWKQKMWITSIFYPIFSGAVLFATFVYSYYYVPYGVFCPERGEWC
                     TRKILDLPLTYQSLYSYIQSKHWNVGFLKYWTLNNIPNFLFGLPNILIIWNSVDYFSY
                     QYTLQNMKPYIWIARALLLIIVFFANVQIINRVSSFLPLPLWFIADILHKKYTDTRVV
                     KYYLIWLLIWIPLQTALFACFLPPA"
     gene            complement(<254833..>256098)
                     /gene="COQ1"
                     /locus_tag="KLMA_60114"
                     /db_xref="GeneID:34717341"
     mRNA            complement(<254833..>256098)
                     /gene="COQ1"
                     /locus_tag="KLMA_60114"
                     /product="hexaprenyl pyrophosphate synthetase"
                     /transcript_id="XM_022820768.1"
                     /db_xref="GeneID:34717341"
     CDS             complement(254833..256098)
                     /gene="COQ1"
                     /locus_tag="KLMA_60114"
                     /codon_start=1
                     /product="hexaprenyl pyrophosphate synthetase"
                     /protein_id="XP_022677198.1"
                     /db_xref="GeneID:34717341"
                     /translation="MNTLAKNIVSLIGSGHPLLNRVSGYYFEAEGKKVRPMLVLLLSR
                     ALSHIPIEERDRIKVDYSDVPEDPVYSKIPQSRLFENVPASISPLHILHGIKPLNPLT
                     KGPEPLPQEFDKERGILPKQRRLAEIVEMIHTASLLHDDVIDHSDTRRGRPSGNIAFS
                     NKMAVLAGDFMLGRATVSISRLRNPEVVELVSNSIANLVEGEFMQLKNTAIDNDHFTL
                     NNGKQQLPPPPVKFELKEHDYRVATTENNGAALSHDQLVDMAFEYYLHKTYLKTAALI
                     SKSCRAAAVLSGARDPVIEECYEFGKNLGICFQLVDDMLDFTVSAKDLGKPAGADLEL
                     GIATAPVLYAWREDPSLGPLIKRNFSQPGDVEKAALAVQKYDGVKKTQELAKVYCNKA
                     LQNLRNGLPDSASRSALEFLTNSVLTRSK"
     gene            <256966..>257796
                     /gene="RER2"
                     /locus_tag="KLMA_60115"
                     /db_xref="GeneID:34717342"
     mRNA            <256966..>257796
                     /gene="RER2"
                     /locus_tag="KLMA_60115"
                     /product="dehydrodolichyl diphosphate synthetase"
                     /transcript_id="XM_022820769.1"
                     /db_xref="GeneID:34717342"
     CDS             256966..257796
                     /gene="RER2"
                     /locus_tag="KLMA_60115"
                     /codon_start=1
                     /product="dehydrodolichyl diphosphate synthetase"
                     /protein_id="XP_022677199.1"
                     /db_xref="GeneID:34717342"
                     /translation="MADSGVFPGYNQVLEFVKTSLAKVIRSSDKVPQHVAFIMDGNRR
                     FAKKHNMELNEGHNAGFESMCRVLELCYESGMKVATVFAFSIENFKRSPLEVNWLMEL
                     AKDKIKQIAQHGELAEQYGIKVRVIGDRSLLPPDVLKEVELAEEVTKNNKRAVLNICF
                     PYTGREEIVHSIKEIMEETAEGIIDYREISEKTIEDHLYTKGQPPVELLIRTSGVTRL
                     SDFLLWQLSSKGCTVELVDCLWPEFTPFSMLKILLKFAFKKTFSPSNDEDDELKKKTT
                     "
     gene            complement(<258183..>258791)
                     /gene="YRB1"
                     /locus_tag="KLMA_60116"
                     /db_xref="GeneID:34717343"
     mRNA            complement(<258183..>258791)
                     /gene="YRB1"
                     /locus_tag="KLMA_60116"
                     /product="ran-specific GTPase-activating protein 1"
                     /transcript_id="XM_022820770.1"
                     /db_xref="GeneID:34717343"
     CDS             complement(258183..258791)
                     /gene="YRB1"
                     /locus_tag="KLMA_60116"
                     /codon_start=1
                     /product="ran-specific GTPase-activating protein 1"
                     /protein_id="XP_022677200.1"
                     /db_xref="GeneID:34717343"
                     /translation="MSEENKSTESVPKPPTASVFSMFGGKKPEVKKEESETKEETSEK
                     SEKAEKTEKDEEDAPESPDVHFEPVVTLEKVDVKTNEENEEVLFKVRAKLFRFDGEAK
                     EWKERGTGDVKFLQHKETKKVRLLMRRDKTLKVCANHIIAPEYVLKPNVGSDRSWVYA
                     CTADIAEGEPEAFTFAIRFGNKENADKFKEEFEKAQAINKKD"
     gene            <260185..>262446
                     /gene="NTH1"
                     /locus_tag="KLMA_60117"
                     /db_xref="GeneID:34717344"
     mRNA            <260185..>262446
                     /gene="NTH1"
                     /locus_tag="KLMA_60117"
                     /product="neutral trehalase"
                     /transcript_id="XM_022820771.1"
                     /db_xref="GeneID:34717344"
     CDS             260185..262446
                     /gene="NTH1"
                     /locus_tag="KLMA_60117"
                     /codon_start=1
                     /product="neutral trehalase"
                     /protein_id="XP_022677201.1"
                     /db_xref="GeneID:34717344"
                     /translation="MEIDGHSNKNGSTTKHRRKSSLGDFMDPFSSPDVYYGPKSDPSK
                     LLSKNRYTRTRTFSVVDNDLGSLKSNGSTFFDTQVPLRRRGSEDDSYRASTGERRFFI
                     EDVDKTLKELLAGEDTDGNYQITIEDTGPKVIKVGTANSNGYKHVHIRGTYMLSNLLQ
                     ELTLAKHFGRKQVILDEARLNENPVNRMTRLISGQFWTSLTRRIDSNNISQIAYDTKI
                     DTPKAKNPRIYVPHGCDKQYEQLVQWSEMDPSLRLEVNYLPKDITPEFVKSLNEVPGL
                     LSLAMESHMDPVTGEETLVGFPYAVPGGRFNELYGWDSYFMALGLIESNKLDVARGMV
                     EHFIFEINHYGKILNANRSYYLCRSQPPFLTDMALQVFHKMGGDKNPTAVDMLRRAFK
                     AAIKEYSTVWTAKPRLDEKTGLSCYHPDGIGIPPETEPGHFDSILKKYADKYNVSIEE
                     FTRLYNDQKVSEPELDVFFLHDRGVRESGHDTTYRFENVCAYLATIDLNALLYKYEVD
                     IAYVIKNYFDDCLESLPDGRKTSSDWETLAEIRKERVTKYLWDEETGFFYDYNVKTEQ
                     RTDYESVTTFWALWSGLASKEQAVKMVELALPKLEELGGLVACTEKSRGPLSVERPVR
                     QWDYPFGWAPHQILAWVGLTNYGYEPHARRLAYRWLFLMTKAFVDYNGIVVEKYDVTK
                     GTDPHRVDAEYGNQGADFKGVATEGFGWVNSSYLLGLKYMNSFARRALGTCIPPKVFF
                     GRLSAEEKKNYGL"
     gene            complement(<266180..>266578)
                     /gene="HTB1"
                     /locus_tag="KLMA_60118"
                     /db_xref="GeneID:34717345"
     mRNA            complement(<266180..>266578)
                     /gene="HTB1"
                     /locus_tag="KLMA_60118"
                     /product="histone H2B.2"
                     /transcript_id="XM_022820772.1"
                     /db_xref="GeneID:34717345"
     CDS             complement(266180..266578)
                     /gene="HTB1"
                     /locus_tag="KLMA_60118"
                     /codon_start=1
                     /product="histone H2B.2"
                     /protein_id="XP_022677202.1"
                     /db_xref="GeneID:34717345"
                     /translation="MAPKAEKKPASKAPAEKKPAAKKTASSIDPSKKRNKARKETYSS
                     YIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATESSKLAAYNKKSTISAREIQTA
                     VRLILPGELAKHAVSEGTRAVTKYSSSTQA"
     gene            <267552..>267944
                     /gene="HTA1"
                     /locus_tag="KLMA_60119"
                     /db_xref="GeneID:34717346"
     mRNA            <267552..>267944
                     /gene="HTA1"
                     /locus_tag="KLMA_60119"
                     /product="histone H2A"
                     /transcript_id="XM_022820774.1"
                     /db_xref="GeneID:34717346"
     CDS             267552..267944
                     /gene="HTA1"
                     /locus_tag="KLMA_60119"
                     /codon_start=1
                     /product="histone H2A"
                     /protein_id="XP_022677203.1"
                     /db_xref="GeneID:34717346"
                     /translation="MSGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRKGNYAQRI
                     GSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVT
                     IAQGGVLPNIHQNLLPKKSTKAKASQEL"
     gene            complement(<268264..>269631)
                     /gene="RMD1"
                     /locus_tag="KLMA_60120"
                     /db_xref="GeneID:34717347"
     mRNA            complement(<268264..>269631)
                     /gene="RMD1"
                     /locus_tag="KLMA_60120"
                     /product="sporulation protein RMD1"
                     /transcript_id="XM_022820775.1"
                     /db_xref="GeneID:34717347"
     CDS             complement(268264..269631)
                     /gene="RMD1"
                     /locus_tag="KLMA_60120"
                     /codon_start=1
                     /product="sporulation protein RMD1"
                     /protein_id="XP_022677204.1"
                     /db_xref="GeneID:34717347"
                     /translation="MSEENEPLLSVGDASDGKTTGVRDGSANTTATDSNKNSIKSNIN
                     TNKRPDIDVTAQKYVPKPNNGGSRGSSSDGKVNLEHVPLKGNSKVGAQRTSRKAQKLK
                     LLPDEPFERITEESDPPERDVYSQVNRITDKPARRDAEKLGKNQRHLLPRVTAYCTAS
                     LYKMKELIRWLKDCKRQNHTHPKLFDECLYTPFIYTDWRGDKRFEHEDVIRLDEEGGE
                     ISTSDKQPDLFIFEYGVIVMWGFTEREEKAFLRDLERFEKEKLAEEDVQVEEFNYYIT
                     QSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIA
                     CSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWSEPQLEPIYQATRGYLEI
                     NQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGVEVLVSVVNIVVDIIA
                     DRTQK"
     gene            <270097..>270903
                     /gene="NHP10"
                     /locus_tag="KLMA_60121"
                     /db_xref="GeneID:34717348"
     mRNA            <270097..>270903
                     /gene="NHP10"
                     /locus_tag="KLMA_60121"
                     /product="HMG-box containing protein"
                     /transcript_id="XM_022820776.1"
                     /db_xref="GeneID:34717348"
     CDS             270097..270903
                     /gene="NHP10"
                     /locus_tag="KLMA_60121"
                     /codon_start=1
                     /product="HMG-box containing protein"
                     /protein_id="XP_022677205.1"
                     /db_xref="GeneID:34717348"
                     /translation="MTDLPVSIEAEKGENSELAATVKRLSEENEALSLAVHRTRLSVK
                     RLRLEYGVLLERLESRVHADQSLKYESPLPNLESFKKSLLESMPARTRKKKGKSKDKR
                     DPNLPKRPTNAYILFCEMNKDKVKEMNENADMTRLMAEIWNGLDEEAKKPYYDLYNEG
                     RQKYEQEMSTYSKKKATQETENSESSNTNENENENENENENENENENDQENENENEND
                     QENDQENDQENDQDNDNDGMDIDSDVTQQELDIATDQLDEGMESETNSEA"
     gene            complement(<271141..>278631)
                     /gene="UTP20"
                     /locus_tag="KLMA_60122"
                     /db_xref="GeneID:34717349"
     mRNA            complement(<271141..>278631)
                     /gene="UTP20"
                     /locus_tag="KLMA_60122"
                     /product="U3 small nucleolar RNA-associated protein 20"
                     /transcript_id="XM_022820777.1"
                     /db_xref="GeneID:34717349"
     CDS             complement(271141..278631)
                     /gene="UTP20"
                     /locus_tag="KLMA_60122"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 20"
                     /protein_id="XP_022677206.1"
                     /db_xref="GeneID:34717349"
                     /translation="MAKQKSTTKSTKRYRYSSFKDKIDDLRIEPARNLDRRVHDDVET
                     SHFLASFEHWRDINMSGNFGGFMDSVEGLVQTLPQLLYHSDEVFGRLEEYIDKHDERS
                     LQPLCDILAQFCHDLGPDFMKYYERAMRCLIRLLEAATEFENSNVFEWGFNCLAYIFK
                     YLSRSLTQDLRPTFDLLFPLLSNRKEYLSRFSAEALSFLIRKSQQKNLELFVVFAFGK
                     LSSLENDNFYDGLQTLFGESLKSTSDALHSRSNIIFQTLLTVAFKSESDAVCVSLLSD
                     ILLDIIRHASTENIQSLYELIVQYLDGNLDSPACDVSKCLKIIAAISFAESGRKVPSW
                     EKLTGVLRKCTEHANLADSDVNLVSFTFAVVLRNADVKTLTSFHKYIFDFFLSGNTKG
                     FSKHFIEFFKVAIDIDKAKVLSFNGLKYLQKYINNCWQDSLPKIALFLLELEASEDSS
                     LKVQLSIPELTQQLLHDISSSDLTDQESIFSVYWRLIILRSLQAENEQILTTLLQRMF
                     DTHSNFSVFEKDFVGYLLQAMTFSDDASKYPVEVLNILVPRVIELQDSKYFIKGVLHV
                     LSHTDDDSIKSVIEPLNKILLPLTDNLLLPDKSIRYETFKLIINIIEKQGATVPQLYY
                     DLKILEEIPLDHHTSRDLPLRIRKLGSDFAKIEPQELLTNIFFKHMFGLLTVRFSPIW
                     EAIYEIIPDIYTKNQSLVWSLSMQFLTVLDKPNEINYYHIPNDSELQEAFWTVSVNRL
                     NDSILLSDKAFKKYTSADSSILDLLEERRNSMEYPSLIRSQIFKVLLSIPNLAERHSR
                     DIVPFLFNEEEFEEVFSADQQNTLEDSMLTASKWSESDRNLLLKLIGKFKNIKAIYKS
                     EEVHERMMALLSSRTTEVQRLALDALFCYKDPHITKYKDNLKNLLDDTLFKDEITKFL
                     ATDDSRTIQSQDEDVVMGLIVRILFGRVQTPNTSGLKKSRKTAVITILPSLKNHYIIQ
                     FLQLATSKFKYEYFFENGNKIDPSYATSLTLRKMLGFINVVNSCLAVLGSHYPDVMKT
                     VIRPLIYAITMSVYISSEKSEEQFMEKIASNLRPLGFKCLYNLFNQLGDVLDWSPYIS
                     DIFNNVISPRLEKFEDENLQQPSSVMKIITYWAEQKPLYNFLYYNELSAVVALMKTLK
                     NSNAKESVIGVILNFCNKIINAPDKDPRYVELIILVVTTSLQQLPYILQKCTDHNVIS
                     SAVDLLLNITELGYVEDNETRELLVNSLTHALQKDLSQFTVKDKVKILKTLASLINDY
                     DCSFSQIEPLYTAASKLYRSYSDKDLRQSLNSVFTSIGARFSEYEDVAKLLSDLNSYS
                     TTRMREYDFERRLPAFKTFTEVDCQQYNETQWLPVVYSCLFFVNDTEELAIRTNASYT
                     LCRFVDCMNSKESLEAAKGFIDIMQTVILPNVRSGLRKTIEEIQNEYISLISYIVTNS
                     QFLPEIEDMKVLLHNGDEEADFFININHIQLHRRQRAVRRLREHAPKLSDNTISHYLI
                     PMIERYVFSSEEKYRNIGNETVVTIGTLSNYMSWNQYKALFRRYASMLKKNSEHSKEL
                     VLLIVNISVSLKNTLQALRQNDDSLPMIRKFPKTYQDPESFIKNDVYPDLSKTLSTRD
                     DDTIVSRIHLSEALVNLVLGLDKEETTSLLPGILTSVCQVLRSRSEELREAVRKNLAN
                     LASILGPQYLSFIIKELKSALTRGSQIHVLSYSLHYVLMSISKNLEHGDLDESLAMIV
                     GVIMEDTFGAAGQEKDAEGYTSKMKEVKFNKSYDTAELVTSNIRLPMFGVLLRPITVL
                     LQERMALKSQNKLNELLRRYALGLNHNEESSSPDVLKLCYEIFNKSQSTDVRQRQPHR
                     PKTEKEEFFLIDLNAKSGIVSNDNTVYIHTLQRFSLDLLRTAITKNPNLMEVKYLQGF
                     IPLLKETLVSDSEGVVMSTLRLLTIIIKLEFEEESEAIFKNCARKVLELIKNSPSTSS
                     DLCQMGLKFLSVMIRHKDIQLKDTALGYILGRIQPDLMEPSKQGLAFNFVKALVSKHV
                     MLPELYDVVDNIAEIMVTNHSKEIRDVARGVYYHFLMEYDQSKGRLEKQFRFMVTNLQ
                     YPSQDGRQSVLELINLVINRSGVELVKKISASFFVSLANTCVQDDSPKCREMASVLLA
                     SLFEKLGEENMGEIEKFILAWLKQADNTLFIGLGLKIYKIYLNKLGPSTNEALDSLAL
                     TRVKSIISNTEVGSDSSWDLVYTTLGVFSVFVSKNEERAFTDEFRETWSQIMNCLLYP
                     HSWVRLSAVRLVNQLINNSDKLGTPLTDYEVQTIAYKLFRLLGAPNLPENLSSVAVKT
                     LLVIIMRWNENKTPYIDSTEENSAFKYADAIDFAIGRTGWIIRSEDNPNDSFNSKKAA
                     IQLAALIIQVLSSERLSKDADKFIMPLYMYLEPNTYGLDEDQQELHNLGSECIKILES
                     KISVSDYTAAYARVKQQVMQRRQERKAKRAVLAVRAPEVAANKKLRKHARSREKRKHE
                     KDENGFYQRKNKKRRN"
     gene            <279539..>280198
                     /locus_tag="KLMA_60123"
                     /db_xref="GeneID:34717350"
     mRNA            <279539..>280198
                     /locus_tag="KLMA_60123"
                     /product="RCR super family protein"
                     /transcript_id="XM_022820778.1"
                     /db_xref="GeneID:34717350"
     CDS             279539..280198
                     /locus_tag="KLMA_60123"
                     /codon_start=1
                     /product="RCR super family protein"
                     /protein_id="XP_022677207.1"
                     /db_xref="GeneID:34717350"
                     /translation="MSSSTSSINSGSSSATASATSSGDEITNSCFGVSCSNQWEWARW
                     VIFVLFMVVLSVFVLTTFRINYLRRRRGQQPLRYVSWLTPPTYRQAESSRNRTDVPLT
                     DYVPPYTEEANENDLGYYDRDGVFHVNSKADPPPPIDAYVLERRNDRDGNVDLEMQQT
                     ARTDPDTITPNTPLPAPPPPAFQPDAMGHPGTPGSSSSDVTFRSANPVPPTNNTNTNG
                     H"
     gene            <281817..>282332
                     /locus_tag="KLMA_60124"
                     /db_xref="GeneID:34717351"
     mRNA            <281817..>282332
                     /locus_tag="KLMA_60124"
                     /product="RCR super family protein"
                     /transcript_id="XM_022820779.1"
                     /db_xref="GeneID:34717351"
     CDS             281817..282332
                     /locus_tag="KLMA_60124"
                     /codon_start=1
                     /product="RCR super family protein"
                     /protein_id="XP_022677208.1"
                     /db_xref="GeneID:34717351"
                     /translation="MTVLPYLYVRDDTTTTTTDTQNNEKQSAYIQWGRYCIAPAIIIF
                     IAIVIFAINWSRARNGMRPMKGTAWLSPTVFCRYDINDGVQPIQQVPKTNYPTVVYSD
                     PPVDITPPAYTEATNPIDMGVGYYSEGGQFVQTAPNLYEARDVPVEKPKAAAAGLYDQ
                     QSSSVERSGKY"
     gene            <282756..>284252
                     /gene="gabD"
                     /locus_tag="KLMA_60125"
                     /db_xref="GeneID:34717352"
     mRNA            <282756..>284252
                     /gene="gabD"
                     /locus_tag="KLMA_60125"
                     /product="succinate-semialdehyde dehydrogenase [NADP+]"
                     /transcript_id="XM_022820780.1"
                     /db_xref="GeneID:34717352"
     CDS             282756..284252
                     /gene="gabD"
                     /locus_tag="KLMA_60125"
                     /codon_start=1
                     /product="succinate-semialdehyde dehydrogenase [NADP+]"
                     /protein_id="XP_022677209.1"
                     /db_xref="GeneID:34717352"
                     /translation="MVGSVKEVTPDFKNADLIRKGAYVNGKWIENAAETFEVTDPATL
                     KVIATLPDQPLEAVYEAIDAAETSFRSYKKTGPRQRAQLLRKLYDLMMENVDDLARII
                     TWENGKAFAEAQGEVKYAASYFEWYAEEAVRMYGTTIQPSNTANRAMTVRQPVGVCGI
                     ICPWNFPSAMITRKAGAALAAGCTVVIKPDAQTPLSALAMARLVEQAGFPAGAFNVVL
                     TATRTPEFGLALCESSKVKKVSFTGSTNVGKILMKQSASTMKKLSFELGGNAPVIVFE
                     DADLEQAVTQTMLSKFRGLGQTCVCANRIYVQRSVIDKFAESLAEKVNAFVIGHGLDP
                     KTTHGCLINENAIKKVEDHVKDALEKGAKTVVAGGRRTDLGPHFYAPTVLSYVPATAK
                     VNKEETFGPLCALIPFDTAEEVVGYANDTELGLASYVFSQNINTIYTVAEALETGMVS
                     CNTGLFTDCAIPFGGVKESGFGREGSLHGIEDYTVIKTITIGNLPSPL"
     gene            <284762..>286222
                     /gene="RAD57"
                     /locus_tag="KLMA_60126"
                     /db_xref="GeneID:34717353"
     mRNA            <284762..>286222
                     /gene="RAD57"
                     /locus_tag="KLMA_60126"
                     /product="DNA repair protein RAD57"
                     /transcript_id="XM_022820781.1"
                     /db_xref="GeneID:34717353"
     CDS             284762..286222
                     /gene="RAD57"
                     /locus_tag="KLMA_60126"
                     /codon_start=1
                     /product="DNA repair protein RAD57"
                     /protein_id="XP_022677210.1"
                     /db_xref="GeneID:34717353"
                     /translation="MDLYEQLPSSDIIYQPEYKFLLDAATSHGITCLDFLSQSPANLM
                     KVINRSINEIVKFQETLRTEFDKAITEIKIQKKVDIELEDRPMCFTSGDSEIDRLLGG
                     GIYTKGITEIFGESSTGKSQLLLQLALSVQLPEEMAGLRGQSVYITTEGDLPTKRLDG
                     IIQNSSLFKDEDGNPLVSQRRIFTVTCNDWANQEHVTTVQLPILLERHPSIRLVVIDS
                     ISHHLRVELQSKTFQESRDNRHIIDWMAEHLLGLAQKHNVAIVVANQVSDKLLQEKPV
                     QQDFKDYDYQLGWFIGWKNSTIYYRHQFNEQERTNEDLLSDDEDYSLIVEQVAKKVQQ
                     KNNGNGESAPVASTSNQHQPQQQIQQIQQQQQQQQQQQQQQQQQQQNQNQNQNQNQNK
                     TPGLNFISKRKRALDTKVPGLGLTWANHLMTRIKLEKWYQASPSIRSGNFDYDDTTDP
                     TKFWQVRRNLKVVFSTYAPKGEMRYNITSEGVVSVK"
     gene            complement(<286546..>287986)
                     /gene="MAF1"
                     /locus_tag="KLMA_60127"
                     /db_xref="GeneID:34717354"
     mRNA            complement(join(<286546..287853,287981..>287986))
                     /gene="MAF1"
                     /locus_tag="KLMA_60127"
                     /product="repressor of RNA polymerase III transcription
                     MAF1"
                     /transcript_id="XM_022820782.1"
                     /db_xref="GeneID:34717354"
     CDS             complement(join(286546..287853,287981..287986))
                     /gene="MAF1"
                     /locus_tag="KLMA_60127"
                     /codon_start=1
                     /product="repressor of RNA polymerase III transcription
                     MAF1"
                     /protein_id="XP_022677211.1"
                     /db_xref="GeneID:34717354"
                     /translation="MKFIDEFDLEVVNQALNFETSDCSITGGCDVFTTKPVASDKKLY
                     KTIDRHLESLIQESESLTAAAHRRQSVDEKNGVIEEKINEELHSPNPNSFWEQKRRMS
                     VSENPNGATVSPVIKSNKLNDQNLKEFVLSTDSMASPVVTSGTQSNSNNSHSNNNNNN
                     NLNNSNGYMSSSSVDSGSLGIGPHNSAFLRRSSSAGSIASNHTDSSKRRPSTSGSIHE
                     ASNSPLQRRRSSVQTRENVNIGPFGPINETASRRAFAYLIAILNASYPDHDFSSLEPT
                     DFVKCSKKSFISKFENTLISLGKPPQEWIWETINSHMDINECAFYQYVPQKSFLEDEP
                     GHLWSLMWFLFNKKRKRVAYVYLTAFRLKGTSSVGNSIILGEDEDDSSSKVGAERRRA
                     RKLTLDNDNDFEGEYDLTYEENAVIDDDDEDMDPNFNNNGVNNRN"
     gene            complement(<291236..>296164)
                     /gene="HHF1"
                     /locus_tag="KLMA_60128"
                     /db_xref="GeneID:34717355"
     mRNA            complement(join(<291236..294927,295882..>296164))
                     /gene="HHF1"
                     /locus_tag="KLMA_60128"
                     /product="histone H4"
                     /transcript_id="XM_022820783.1"
                     /db_xref="GeneID:34717355"
     CDS             complement(join(291236..294927,295882..296164))
                     /gene="HHF1"
                     /locus_tag="KLMA_60128"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_022677212.1"
                     /db_xref="GeneID:34717355"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRNVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQDISDTSLM
                     EQTRTQANTPPQESLQMQDAGSQNNSSSASASQAAAVAAAAAAAAAAAAAASVVISPP
                     SQGSSSSPHSGNLQPGANIGSGSGSGLDLGLGLVDGSATNDNGSTGTRGTRSTTGSAM
                     SQSNSDQSGSSSSSRPRDHGSREDQLVGVDLGSASMGPGSHLHLHLDEYVQDARQMGS
                     NGFVTPSHAKEQHQGPGHSQGHGSSTSPGPGPGPGHSQGPGHSLFPPSGPLENHSEKR
                     NVFQHNQDIHKNMQQSNANINRDGVGIEMDDVDMDGDTNMDVNMDINMDMDIDIQEGA
                     HRDTMDSSPSTSPSSSSSSSTSTSTSSLSSSGRSMATHSSNSNFNAERRPSSFNTAIS
                     HNNTTIFKPFDSQTGQFVAPPAVPSKRHNRKEQDMEQQQEQGHEHEHEHEQEQDDDDD
                     DEDEDEDDLMDSTRHNHSTATTIRPDESSPPSTSTSAVTSLMSTSSDPHSNPNSSSSL
                     NNTTMSRSAGKQTFGNVTTTTTTTNNNTNNSSAHQQRKMHNQIPQHTPQTQAPSFSRV
                     QRSKMRSLSVPTILHSSLRKMSNVAQHNGVNPTTSKHHHHHHHHHQQQQQLPPARLTL
                     KHSNNSSTSLAQANANSNSNSNSNSNSNSNASQNPVGLVRKKRSLKRDQFSLRNAILM
                     THRLHSSDSKDISLEERIKYIKTYPTPVPLPPINLQCLKEIDLSEIVKNPQLRHDIVF
                     DPMLQFRPNLDGERGIKKRQIADKYWNDVENEIFVYNQRPDVFDENRSRLVPLFNTLK
                     DVLVTIVPQKEVSTVANVLDTELLIQELLKGSLVMSSFSEWLSQLFKHHCAPMRDPWV
                     DKMSLKFKEAEENNSIPTLVEALRLVFQILEAMKLDIANHQIRILRPALLSNTVDFEK
                     QYFQSLLNSSRVDLKSSLKWFADKYKEACDDGLIDPSKPTSIPQLYKVCIRSVISLLS
                     CRKMVKEYPTALSFDHARLILLRADIRQIVCLMVCKLLFKQLVANNTELTRPMKEFII
                     KSYTTKRLKEEIVSIITDEHGNCRWTKNTLSIAVQLNKVIDQLKEEYLRQNPEENASS
                     NTGSESSSQKEQLPQPLPSSSSAKLSLDQKKIDFSTSWLSKQTQPLSDVYGVLEARVF
                     RSLEDVVFKFGECSKDGTVKQDFISMCGNTTNSASTAAGGVAATGDEPTATLSSSAFQ
                     SPSKANRTLTSKKELEIKESLAAIDMEEFENSYRHLYTVVNFHWSVFGCHYLEYMGDK
                     VEKV"
     gene            <297005..>297415
                     /gene="HHT1"
                     /locus_tag="KLMA_60129"
                     /db_xref="GeneID:34717356"
     mRNA            <297005..>297415
                     /gene="HHT1"
                     /locus_tag="KLMA_60129"
                     /product="histone H3"
                     /transcript_id="XM_022820785.1"
                     /db_xref="GeneID:34717356"
     CDS             297005..297415
                     /gene="HHT1"
                     /locus_tag="KLMA_60129"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_022677213.1"
                     /db_xref="GeneID:34717356"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <297635..>298300
                     /gene="TRP1"
                     /locus_tag="KLMA_60130"
                     /db_xref="GeneID:34717357"
     mRNA            <297635..>298300
                     /gene="TRP1"
                     /locus_tag="KLMA_60130"
                     /product="N-(5'-phosphoribosyl)anthranilate isomerase"
                     /transcript_id="XM_022820786.1"
                     /db_xref="GeneID:34717357"
     CDS             297635..298300
                     /gene="TRP1"
                     /locus_tag="KLMA_60130"
                     /codon_start=1
                     /product="N-(5'-phosphoribosyl)anthranilate isomerase"
                     /protein_id="XP_022677214.1"
                     /db_xref="GeneID:34717357"
                     /translation="MLVKICGLQSVEAAQTALDRGADLLGVICVPNRKRTVTPATAKQ
                     ISQLVHQGNHSQGNHQARLVGVFRNQPLEEVLALYHEYNLDVIQLHGNEDVVQWRKWI
                     PKDITLIKAFQFPGDCDVVTSPAVAQLQLENVLVLFDSGEGGTGQQLDWNGMASWCQN
                     QGNTTRFILAGGLTPDNVRHAITSLAPHAIGVDVSGGVETNGQKDMAKIAAFISQARG
                     LSI"
     gene            complement(<298372..>299235)
                     /gene="IPP1"
                     /locus_tag="KLMA_60131"
                     /db_xref="GeneID:34717358"
     mRNA            complement(<298372..>299235)
                     /gene="IPP1"
                     /locus_tag="KLMA_60131"
                     /product="inorganic pyrophosphatase"
                     /transcript_id="XM_022820787.1"
                     /db_xref="GeneID:34717358"
     CDS             complement(298372..299235)
                     /gene="IPP1"
                     /locus_tag="KLMA_60131"
                     /codon_start=1
                     /product="inorganic pyrophosphatase"
                     /protein_id="XP_022677215.1"
                     /db_xref="GeneID:34717358"
                     /translation="MSYTTRQIGAKNTLDYKVFIEKDGKPVSAFHDIPLYADEANGIF
                     NMVVEIPRWTNAKLEITKEEKLNPIIQDTKKGKLRFVRNCFPHHGYIHNYGAFPQTWE
                     DPNESHPETKAVGDNDPLDVLEIGEQVAYTGQVKQVKVLGVMALLDEGETDWKVIVID
                     INDPLAPKLNDIEDVEKHLPGLLRATNEWFRIYKIPDGKPENQFAFSGEAKNKKYALE
                     VIRECNEAWKKLISGKSADAKKIDLTNTTLVDTATYSAEAAAAVPPAHVLPDEPIDKS
                     IDKWFFISGSA"
     gene            299948..300020
                     /locus_tag="KLMA_R606"
                     /db_xref="GeneID:34718765"
     tRNA            299948..300020
                     /locus_tag="KLMA_R606"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:34718765"
     gene            complement(<300178..>300678)
                     /gene="APC11"
                     /locus_tag="KLMA_60132"
                     /db_xref="GeneID:34717359"
     mRNA            complement(<300178..>300678)
                     /gene="APC11"
                     /locus_tag="KLMA_60132"
                     /product="anaphase-promoting complex subunit 11"
                     /transcript_id="XM_022820788.1"
                     /db_xref="GeneID:34717359"
     CDS             complement(300178..300678)
                     /gene="APC11"
                     /locus_tag="KLMA_60132"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit 11"
                     /protein_id="XP_022677216.1"
                     /db_xref="GeneID:34717359"
                     /translation="MKIEVVDVSLVSTWAWDIPRERNVKDSKMRSNSMAQNDEECEDV
                     DIDNIDNTDTDTDEEDDVCGICRNRYDGTCPSCEYPGNGCPIVLGLCNHNFHVHCIKQ
                     WLSTETSKGLCPLCRQGFQLRPQVTINKPHYEDFRQLLMSARQHNIPMGGPDVDQEMM
                     DEGFIR"
     gene            complement(<300908..>301582)
                     /gene="GRX7"
                     /locus_tag="KLMA_60133"
                     /db_xref="GeneID:34717360"
     mRNA            complement(<300908..>301582)
                     /gene="GRX7"
                     /locus_tag="KLMA_60133"
                     /product="monothiol glutaredoxin-7"
                     /transcript_id="XM_022820789.1"
                     /db_xref="GeneID:34717360"
     CDS             complement(300908..301582)
                     /gene="GRX7"
                     /locus_tag="KLMA_60133"
                     /codon_start=1
                     /product="monothiol glutaredoxin-7"
                     /protein_id="XP_022677217.1"
                     /db_xref="GeneID:34717360"
                     /translation="MLSKRNIRLLGLTGMLLFVLFFITRNAQSATRSYLDPNSPTAAS
                     ALSNSEKVDSEINSIKQDISNTKGNSVSADTKDAVKSGNNGNGKGVVKTSEDGLDDED
                     KYNPEAEYKEILQKSPIVVFSKTYCPYSKRLKSILKEYTFDPEFVVVELDKHENGAEL
                     QKFIGGKTGRSTVPNVIINGISRGGCDDFAGLHDQNTLLDSLKQWGGSTLTVDKPKKG
                     GNSGVH"
     gene            complement(<302035..>303885)
                     /gene="MNN2"
                     /locus_tag="KLMA_60134"
                     /db_xref="GeneID:34717361"
     mRNA            complement(<302035..>303885)
                     /gene="MNN2"
                     /locus_tag="KLMA_60134"
                     /product="protein TTP1"
                     /transcript_id="XM_022820790.1"
                     /db_xref="GeneID:34717361"
     CDS             complement(302035..303885)
                     /gene="MNN2"
                     /locus_tag="KLMA_60134"
                     /codon_start=1
                     /product="protein TTP1"
                     /protein_id="XP_022677218.1"
                     /db_xref="GeneID:34717361"
                     /translation="MVVSRKRMQKLVKIVAIAGLLVFLLTHAGSYLSPDMSVDQYAGA
                     LKEYVDKYKEDHEKAVVDDKTVGSGEEVGAGIGSKPVSNGKTEGSGSSGKNSKVSSSS
                     GERELLKSFFGRAFQYVKEYGPEGVNTPNYDPNCNLKGDIGYRKDNVNEWWKLTGKEL
                     SNCLKLTKKQIAMLKDGHTNYVRAINEMKLPANAYSGDGIVTVGGGKFSIMAFLIIKT
                     VRNFGTTLPVEVFIPPNDEGDDEFCNVLLPKYNAKCIYLSDVLPDDVIQKTEFKGYQF
                     KSLAMIASSFRNLLLLDADNFPIKPLDNIFDEKVYKENGLVLWPDFWRRTTHPVYYDI
                     ANIPLSYQRVRNTMDDVTPPSVYTQDLSDLSKVPLHDLEGTIPDASTESGQMMINKVQ
                     HIRTVLLSLYYNAYGPSWYYSIFSQRSSGEGDKETFIAAANHYGLPFYQVRSEPTVDG
                     YHKANGEGFRGVCMLQHDFAQDYDRYLLAQKEIKQKYANKPASYDPDYKYQESYLEKY
                     FSVDSADVMFVHSHLPKFDPVGLALTKDLIENGKHIRSYRNLQRMHGYDLELEAFKTF
                     KEYVCKTRVHFKYFEKAVKSESEWTTICNYVDERLQYLKQSHADALEGKF"
     gene            complement(<304661..>307021)
                     /gene="MDM20"
                     /locus_tag="KLMA_60135"
                     /db_xref="GeneID:34717362"
     mRNA            complement(<304661..>307021)
                     /gene="MDM20"
                     /locus_tag="KLMA_60135"
                     /product="N-terminal acetyltransferase B complex subunit
                     MDM20"
                     /transcript_id="XM_022820791.1"
                     /db_xref="GeneID:34717362"
     CDS             complement(304661..307021)
                     /gene="MDM20"
                     /locus_tag="KLMA_60135"
                     /codon_start=1
                     /product="N-terminal acetyltransferase B complex subunit
                     MDM20"
                     /protein_id="XP_022677219.1"
                     /db_xref="GeneID:34717362"
                     /translation="MNSEDHQLFQLLDRELFKKAAQFVSSLQKRYPSATYYKILDQYV
                     KFRQSPTKYSFEKGLKQILDAKSPPSDAKSLSMCHRFLLELGFDTSRALEPYERAMMK
                     YANSETCYDWFLESLKDLNWRHLCKSSFQMSKVNEKSKSRLFQFWNSVATVVWIQLDK
                     GSLSEKELDIVPRLVYKLTSDLKPFENEQELIVYCKVCELFGDDKSREIVDEIIKFWK
                     EGTFLDLYLKNFLMDHLKKLEEHKLTWKYGISLLNNLDDYGILQNIIEAGHKMDKPFA
                     EVMEVLKQKSSRNYMLARVYAAKLYGSEQLDEVLFQFIEKYHDKPSCPVDLQSLDMDK
                     DKLRAMFEKLPSGLIHDKAMSELFGKGDHLQLFLKYKDSLSTKPKTDYSDCSYFVLEI
                     VKNLCADSNITLQNVVASISILEGYQNVDPFNYDTRVWLVLLYTYMGLPEKAYSHLQT
                     LNIKNVQNDLVYHWLYTRFSTILPNKNYSYCQNILAPQSIYASLKNMSGFLVAAFERK
                     SWCKVPGIIDFYERMFKSFTRWSIMAETLQLSRLLNEKKLDQYKPLIESLQTFGMENF
                     HEMSWSDNRDFQIFDQRGGEDVSSPTPTFHKIMAPIRVDNAWLKISIARELIFYSLAK
                     NEKNKFVDDTLAQEETLTKSLSTHELWTWRIIRLLYESLDSSDSIDYKRLAQLIEACP
                     PFVESTWEANHSYLITLATLKSLDQLKRIKDKDLRQLIKNKIKETRDSCTALFGAYKD
                     LVNAMAAPASPNPPHLHSLFEATAYQNLAPEIAQEIAQGLKAVRNI"
     gene            <307679..>308557
                     /gene="BRX1"
                     /locus_tag="KLMA_60136"
                     /db_xref="GeneID:34717363"
     mRNA            <307679..>308557
                     /gene="BRX1"
                     /locus_tag="KLMA_60136"
                     /product="ribosome biogenesis protein BRX1"
                     /transcript_id="XM_022820792.1"
                     /db_xref="GeneID:34717363"
     CDS             307679..308557
                     /gene="BRX1"
                     /locus_tag="KLMA_60136"
                     /codon_start=1
                     /product="ribosome biogenesis protein BRX1"
                     /protein_id="XP_022677220.1"
                     /db_xref="GeneID:34717363"
                     /translation="MSSIYKTLSRKEKDGKKSNSGNEKQFMNKQRTLLISSRGVTYRH
                     RHLIQDLNSLLPHSRKEPKLDTKKDLGQLNEIAELYNCNNIIFFEARKHQDLYLWLSK
                     PPNGPTIKFYLQNLHTMDELNFTGNCLKGSRPILSFDGRFDTQPHYRLIKELFIHNFG
                     VPPQARKMKPFIDHVMSFSIVDDKIWVRTYEISHEARNTVEYEEKEEDETSLVEIGPR
                     FVMTPILILEGSFGGPKIYENKQYVSPNVVRAQMKQQAANAARTRAEAAAERKLKKRE
                     NVLAVDPLSNDALFKD"
     gene            complement(<308858..>309067)
                     /locus_tag="KLMA_60137"
                     /db_xref="GeneID:34717364"
     mRNA            complement(<308858..>309067)
                     /locus_tag="KLMA_60137"
                     /product="ATP synthase subunit K"
                     /transcript_id="XM_022820793.1"
                     /db_xref="GeneID:34717364"
     CDS             complement(308858..309067)
                     /locus_tag="KLMA_60137"
                     /codon_start=1
                     /product="ATP synthase subunit K"
                     /protein_id="XP_022677221.1"
                     /db_xref="GeneID:34717364"
                     /translation="MSGAYTILGRTVQPHQLALGTLGAVLLLVVPNPFKGKPAAKPLF
                     TASSKEEEDFIKAYLDKHITNAEKH"
     gene            <309746..>311224
                     /locus_tag="KLMA_60138"
                     /db_xref="GeneID:34717365"
     mRNA            <309746..>311224
                     /locus_tag="KLMA_60138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820794.1"
                     /db_xref="GeneID:34717365"
     CDS             309746..311224
                     /locus_tag="KLMA_60138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677222.1"
                     /db_xref="GeneID:34717365"
                     /translation="MMVLTQLILCFCSWTIAVSAISLESIFPQRYINGLIQQDLALDG
                     SQKKTKETSDFSVFTSSIDDAYSLRIKPVDPKSLGIDTVNQWAGYLDYKDSKHFFYWF
                     FESRNDPVNDPVILWLNGGPGCSSLIGLFFELGPSSINVDLKPVYNPYSWNSNASVIF
                     LDQPVGVGFSYGDSKVTNTDAAAEDVYIFLELFFERFPHLRNNSFHISGESYAGHYLP
                     KIAHEIAVVHEDDSSFKLSSVLIGNGFTDPQTQYQYYEPMACGRGGYPSVLEPEDCKK
                     MNDSVPTCVTLSERCYKSNSLIPCTIADLYCEQQITGVYEKSGRSNYDIRSTCDAPEF
                     SGACFKEEVYITEYLNLEEVQEALGVEVNKFESCSRDVGIGFSFSGDSPKPFHQYVAE
                     LVDKDIDVLIYAGDKDYICNWLGNMAWTDKLEWKYHEEYEKQSLQKWINEETNEALGE
                     AKSYGSLTFLRVYDAGHMVPHDQPENSLQFLNSWIRAVDGKN"
     gene            complement(<311373..>314648)
                     /gene="AVO1"
                     /locus_tag="KLMA_60139"
                     /db_xref="GeneID:34717366"
     mRNA            complement(<311373..>314648)
                     /gene="AVO1"
                     /locus_tag="KLMA_60139"
                     /product="target of rapamycin complex 2 subunit AVO1"
                     /transcript_id="XM_022820796.1"
                     /db_xref="GeneID:34717366"
     CDS             complement(311373..314648)
                     /gene="AVO1"
                     /locus_tag="KLMA_60139"
                     /codon_start=1
                     /product="target of rapamycin complex 2 subunit AVO1"
                     /protein_id="XP_022677223.1"
                     /db_xref="GeneID:34717366"
                     /translation="MDVEVTINKLRARFLKQSSEKDQLNRIIKPYGEINDTVLQLYKG
                     DDGCNLLQSLDSPPIAGSYIKQSRATGNYISGTGSKLFSNSNNNTMVSLVEEEEEVLG
                     LRPNPSIMKVPSVKKNNSSPDISEKSRSRTQSIIADTSSLKNKMVHSLHRRGSDLSLQ
                     RSTSRASEKLKTVKKSGLRLSRLFRSSSNASKDSKGSGAGKAIFISGRSRAGSLKKPA
                     LNLYDHFLYTHEGLNNLEDDDDDDDDKYEYDKGAVVNFFGKEKRNNNSSSSLTLDEKA
                     KSAKRNTFLENFPLNPHNILQSSDTVGSNDSGEKRNKVNKVQNKKNKQNENTALTAAA
                     AAAAENDTTSSYIESYLNQPDLKPFDQPNEISTSSPSKLRGISSHLNDRVSVSNFNSP
                     NLLIDGDDESNGIHDDVSSYGESLLDSDFSGDDFESSQVPSSELSSMTFDSHDIPSNS
                     IPQSRTMAMYHSADESKLDNELDKATKLLHMANRAHREVLSQSVPKDAATNSSKRTLS
                     SSQSEQRANGSTHHRNSGSTTFSNRSRHLKPINGHRRTSSNLTETSIDEDDEVDDSKQ
                     EEPELVIEKVDVPSSKNKSESALSAMFNKDKVTQMNPLEYFSGVSAVKELPRNSLKLD
                     VYIQDSKAYKRKPFTIAVKKSATVFEVLGYSLYCYSTEFKPPDSTGELSPDEIVNPNY
                     FTLKIVDEDGEPFEDNFGVLERTQKIDTVFDNEVVICHVTSDEQFKMNEKETPLPAVM
                     KDTGVVQEPPDNSPHINQLSYYKSILPANSLQPSNTGSNIVTIKVFLYPNLNPQFNFT
                     NIKVPVSSKINEILVSYCKLKNLDPSDYVLKLENRDLILDLNDYITSLDGNYKLEVLK
                     KRDARTKKFDRMKATNQPVLQTIQSTELTPLTLTMANDNRFMQKNREDEEAKEAVKEE
                     TGEGKTTSTTKSLFNMSKHNHTSSASGFFKLKNTSKTSLKSGKLGVTSKRSSSISGNT
                     SYKDLFTGSYYKYKVWRRQQMSFINKHERTLVIDGDYVYISGPDGDLNWTHENVKTKS
                     FHVSQITLVKRSKRVPEYFKIFVHRPDRERRYYFEAVSAEECVEIITRLQNLIRVYRM
                     NQR"
     gene            <315276..>316145
                     /gene="REX4"
                     /locus_tag="KLMA_60140"
                     /db_xref="GeneID:34717367"
     mRNA            <315276..>316145
                     /gene="REX4"
                     /locus_tag="KLMA_60140"
                     /product="RNA exonuclease 4"
                     /transcript_id="XM_022820797.1"
                     /db_xref="GeneID:34717367"
     CDS             315276..316145
                     /gene="REX4"
                     /locus_tag="KLMA_60140"
                     /codon_start=1
                     /product="RNA exonuclease 4"
                     /protein_id="XP_022677224.1"
                     /db_xref="GeneID:34717367"
                     /translation="MVLSSNWLNLVKSDESVKSSKKKKNDVSKKKRSTKPSAKVKKGN
                     VEDRKGAAGVIKPKNSSKIMDMVATMNREIEKVEKERSTKRPSEASDGADSVLKQKLT
                     EDIATNKSSRTNEVGKYIAMDCEFVGVGPEGKENALARVSIVNYYGNVVLDLFVRPEE
                     PVTDWRTWVSGIKPHMMANAVTKQECQKQVANVLNGRILVGHSVHHDLAALMLSHPRK
                     MIRDTSRHMPFRQKYSEGKTPSLKKLTKEVLKLDIQEGEHSSIEDARATMLLYKSDKL
                     EFEKLHNKQFGGP"
     gene            complement(<316458..>325169)
                     /gene="IRA2"
                     /locus_tag="KLMA_60141"
                     /db_xref="GeneID:34717368"
     mRNA            complement(<316458..>325169)
                     /gene="IRA2"
                     /locus_tag="KLMA_60141"
                     /product="inhibitory regulator protein IRA2"
                     /transcript_id="XM_022820798.1"
                     /db_xref="GeneID:34717368"
     CDS             complement(316458..325169)
                     /gene="IRA2"
                     /locus_tag="KLMA_60141"
                     /codon_start=1
                     /product="inhibitory regulator protein IRA2"
                     /protein_id="XP_022677225.1"
                     /db_xref="GeneID:34717368"
                     /translation="MPTGQAMLNDVASFLLAQLDPLLPVNSHVKTFEEVERDQYFMNI
                     RLSLFNLVITHGYSAISPALIAKLEQVSSLPKDGTHDFDILLSLIVLLRMITDTNEVY
                     WRMLDPEYNISTSSDEKIAFSTYYNGFSVQTTTLHTVRPQPLTPQLASSFLQLLSKIK
                     SNKKVIKMLNSMLRSLHGNNTSYAHPPLKDNTIGLTESKKTKYNSYLIEVLDQHCAYL
                     FKYIAASNPQEFHMFIKTTVISPLLITHTHSESDIASFLCYFSYHYITLDTLPTFLEI
                     LQKMAARMKKSIYQEVLLYFASESIQSWIMARPKDYLRVIDSIQRNSADPGILTIQRI
                     STSLFEDVYSSFNIEKLLTEGAVSSSSSSSSTVGSQSTTMNSSQDSPIYVDPFDEQAL
                     IDEESNNNGYSGNSSESPRSPTSSTSSSRSAFNVPYYGPKFELIDDTEDMTRVSVLTF
                     STLMLMLSPDIFEEINNTSLKHIPEDVPTSDHDADASEDRTPTDSPFSNRYPTTTKSS
                     KSSKFGLKKLKHQLTSLNHVTNKKTKFLLTILKNINGNNIVSENAILDTLRVLILISK
                     LSTSNLLRERDAPVANFTRRLFYIMCDILQLGSEKDAKFNPVIAHCLAKYPQAHLKLQ
                     VDYFYVACSIDVDSFLEKLADYLKRKHTGIMHLRMITDGFCLYFNNITKETIKEKIMA
                     RIDKFLKDTAYEVSNILLASSSILEDSASEMVETIFEVSASSDNSESPKMYFNPSPLP
                     SSSPAFLNFFSRTGTSTPLSKSRSTSSSSSSLSPVDVPMIQNTGKNIRDIVAPTAGRP
                     SKSSMTTSRSSASPNENDRSINSIRTIIDKNIKSPLRVSSMLRKASQESVSSATVKNI
                     RETLERHEQENTQLARIILTNIFSIYKGMSNYYVLTYDDPDTSTPSTNYLKLVKPVFA
                     SFIDDNETLFDTAQGVISTVISQLKSAQQQHSAYRSICYTGSGYLLSLIGTTLFNLNL
                     SDAKREHLLKPLVDLWKARISIVKGYEMEGDLSELEESERLTFGLIRGSVGRALFCSL
                     YSNNTNIHKLLKSSFKLFTEEIRIHQLFHEDDGNDSELDMANLEFFNVMSRDNYVSTG
                     VVAFQRRLRTDILKYIKYPDKIIFDVSQLIYKKWYDLSVKPSLNATDLSHFRNYAGFL
                     AASCGIFSTINASIGHQFPLLDDMKQSVDSKIKYFVEKQCLWLNNEDLLTRENSKDII
                     ATELHPLAFSSVFSALQRRINELKDINVIEKENELSLILLEQVIMVIRMILERDDTSE
                     VLILVSVPLLNLIDDILKIVDNIDKSSPKYFKCVIHLSKMLKSFQHSESSICITGYMV
                     VKNRWLRLVTQWFQSAIFNDFDLQNLSKSHRDMDLEKRDLDYLYIDTTIESSKAITYL
                     TKDLVLEAPQSMSEIELQRSKSVVFGNYFNILLKALEKSTCIENFPTTLRHKIALLNE
                     NIIMSLTNLLIANVDVGLNHAIPIGYSNNRNIRLAFMNVFVNIVSSFDTSNNSVKKKR
                     DEIVEEVVLLSLKTPAMLSKACRVCPASDIDALASSIVYVFEVKNAAHIIVTELVREE
                     ISNATRHMEILRRNSCATRALSMLARIKGMDYLSKILKPILEELLETNECFEVEKIEP
                     DDPDAPRNLQLFKKYMTKVVDAITNSIDSFPPQFFVICQAIHSSASERFPEYADIAVG
                     SFLFLRFFCPALVSPDSEEIIDSLTPKARKSSMSLAKVIQNIANGSVNSIKWRLLESE
                     TEYLKNCSNKIFKFLSEVSDKKRVVKIKLRLENRVTPNEFSFLHKFLYYHGLEMRNVL
                     IDDVKSFDDISNIRRSAVIVDRLLSLMGQPRMEFKNEMPAYIRENAETNPQLYEFMSK
                     QALKFSESQENELVKFVQESVTAEGLPVVVFNWYEFQREGNNDVESMIYRTFQIYSKV
                     MTKKHFFVTDCTGFDDEHQVKKLFMKVMSLFFNLLPSEGLYNCETLYFYNATQVYLTW
                     WLEFQRSHLSIFQKLKVPVSFINTESDPKLIKTLGLSDYSREVFHDVRVTLHDVSLYD
                     ENIKRFSPVTLKVGNKFFQIVHDTPRKFKLQENSDMISIKPNYVYEIANVISTSVSRI
                     TGVSSEFCIELKDRKRLIMSSPKYLEILKMFYYAQAKIIEEFNDNEYTTDNISKHSKE
                     VIKMADIVSHLLLVALVGLGGDSEIRAVSYNLLSSMHSTFSLNMGHLLPYTPDIYVPE
                     DPNPMFEPLIKTLAETSPELTSYYLKYSIDMLENSEHDLHFVGNLLRTMKYWIGNLSK
                     HVFLADDQDGPERTNKLIRRLVRLTVQPGQPTSLYLDYIWPTLVQDQYLLQEIIDEVI
                     GHCMDRAAEGVDWHPACKILLRAPTIDITGAVIKRILEITHSFLPNLKEETNVNSWTE
                     LIILVHLASSLFCDSPLLVDIYMPEVLFIVSLLIDVGSTEMRSSLHKLLMNTCQSLLS
                     NTSLPKYSRKNLYEIQKIFSDQKTKIMFGFSQERGRLLQNFSASSFLTKFTTLEHFVN
                     NLISLMDNGSRMSVEQWKTRYLQYIMGTVFHVQSFLSARAMMILGIISKEGISDGLLR
                     NLLKQSMIILAIPEVSDEQIFFTISTFFTYTKAIRGVDPRSPLLPRMFWLASTIAFSF
                     NVMIYQSGLLFMSSAAQHLSLGNMQKIDSGKTPQPLIKQLISERAFAENILRQIEAMG
                     DLRVTEDNFSHVMVNLICKGLLVPYTRANSLSALIVFFKLFYFELMYGPNENYLIFMF
                     FIFVLQRPAVFLKCMEDVDMDNDVVHLDSRNKIHRGLLDWLVSFTPDAFMTLYQASLY
                     FASKATDEQSKVRFMLVYKYLMESNLEAAFKLYPFILGELRRLSKYSNNSSVMILAFE
                     IIKMAVKSKEYPRIPQIEEELFATLSERGLTGIQNIPFENDLLNDALNGVRENPVITY
                     ERKKLSVMLISKVISLP"
     gene            complement(<325822..>326412)
                     /gene="EOS1"
                     /locus_tag="KLMA_60142"
                     /db_xref="GeneID:34717369"
     mRNA            complement(<325822..>326412)
                     /gene="EOS1"
                     /locus_tag="KLMA_60142"
                     /product="N-glycosylation protein EOS1"
                     /transcript_id="XM_022820799.1"
                     /db_xref="GeneID:34717369"
     CDS             complement(325822..326412)
                     /gene="EOS1"
                     /locus_tag="KLMA_60142"
                     /codon_start=1
                     /product="N-glycosylation protein EOS1"
                     /protein_id="XP_022677226.1"
                     /db_xref="GeneID:34717369"
                     /translation="MVRWIIKYATVAAIFRMFSMSLVMVCSELLLTAAMSPSGEYHLH
                     TWILISCLLTGVYIWQSFITSNLIYGNGHGHDHDHADADLRSSKSQPDADSLQELANS
                     DESDGTNTAALSFTTASTTPSSKRKKGSSSSSSSLQHFQLRWSKRRRLDLYKVIVFCV
                     VPVGFTSFLTMIVLLRNLFIQRLDVEHMERLLRKSY"
     gene            complement(<327639..>328204)
                     /gene="TPM2"
                     /locus_tag="KLMA_60143"
                     /db_xref="GeneID:34717370"
     mRNA            complement(join(<327639..328106,328187..>328204))
                     /gene="TPM2"
                     /locus_tag="KLMA_60143"
                     /product="tropomyosin-2"
                     /transcript_id="XM_022820800.1"
                     /db_xref="GeneID:34717370"
     CDS             complement(join(327639..328106,328187..328204))
                     /gene="TPM2"
                     /locus_tag="KLMA_60143"
                     /codon_start=1
                     /product="tropomyosin-2"
                     /protein_id="XP_022677227.1"
                     /db_xref="GeneID:34717370"
                     /translation="MEKIREKLNSLKLESETWQDKCEELKEQVKQLEQEKTDNENLIK
                     SLTTKNQTLEEEVENLEAQVTEHKQLAEDSTNLKSHNESFSKKNQQLEEELEESDAKL
                     KETTEKLREADLKVEQLERKVTSLEQERDDLEKKYDDLQSKYEAAKAELDEISASLEN
                     L"
     gene            complement(<328575..>332276)
                     /gene="MGA2"
                     /locus_tag="KLMA_60144"
                     /db_xref="GeneID:34717371"
     mRNA            complement(<328575..>332276)
                     /gene="MGA2"
                     /locus_tag="KLMA_60144"
                     /product="protein MGA2"
                     /transcript_id="XM_022820801.1"
                     /db_xref="GeneID:34717371"
     CDS             complement(328575..332276)
                     /gene="MGA2"
                     /locus_tag="KLMA_60144"
                     /codon_start=1
                     /product="protein MGA2"
                     /protein_id="XP_022677228.1"
                     /db_xref="GeneID:34717371"
                     /translation="MAILQQEMLLKTGMMGNEVPRVEGLNELLLLDEKEASESQEAGQ
                     GERNTSSSSDAVDAADLFDQYINKDMLMESIEEDSSPGLLRFDSVSPLMKMEGDSGDK
                     SGEMSVSGGGGLEDMGGLDMDVSLHDDLTHENVESWAMENNENHAEQAGPAQAAVPAQ
                     AAAQTCVSAQAPAQAQAPSVGNTIVNSSTISNLVYYQQSESLLTNILEFGRTQPFKTV
                     YLNPQEFLPKEDDAQALPYKIHVDGVPPMSRVETQIKINIAISPAPRQYMIHLPTDSI
                     TRQKFYLTHDITEYPANVREQMLYLETFLLCSSTNKSTYVCSRCIRREQRRAARRKSG
                     ISDNLLWCNNENKRAIVFNSKQVILMKENENEENTKSFSLMTRIVCYCRHHKEPEGFK
                     ILVVLRDASNNILARTVTNNIVIMDKKTSSSSSGKGKFTSSDNRASDGSSTYVKDEYS
                     TTGGVASDYSNADLFSMVKADEPSVTVRLSVPKNMPSPTSITEDSSENVQTDHGPMNS
                     SATGFLHSSAAASARTNGYKRPRNSMDAKSERSFSNSSTSTPAVTNSASLSAGASSTL
                     LLHNVQHHQQQQQQPSQLPASNQHALPMIQRPHMLAQQLGASTIEGMNSSSNNSSNVP
                     QKPRPFIQRVIPAQGPIKGGIEVTLLGSNFKPNMVVKFGENRALSTQCWSDSTIVTYL
                     PPTSKPGQVLVSVFEREDANNEHLLSNMSNSRAIFTYVDDTDRQLIELALQIVGLKMN
                     GKLEDARNIAKKIVGSDGGSSNGSTPGSNISPSGNYGGASYSDSPGNFGYNDNNNNSA
                     GQVYYSDEMLIIKVVKLLNPSSNLSMCNSDGQTMLHLACLKGYFHLVSALVNKGARVD
                     VTDSFGFTPLHFACINGDVKAIQLLVGCKANVSAIADNGVNALDLYRSQHVSDSDRNT
                     NNTYTEDILRLLSDQTDAGDGNDDNDDDDFKAFGRKMSTSSFHSSVYCAESVDSVDYG
                     YQVHVSKMVQDTLSDDSEYESSGYDDDSSISGYDDSTEGLLLSERDTVAALEVSSGDE
                     NEPLAVAVAVASATTGDAATAATNNNNNNNTTAAAAVEPASPEGLPKYEDLFPVSANN
                     TDKSKTIEASTALVSAAAAVAAASATDPDAADSHDSQTSETSEDEEEALQVRLNRFFQ
                     QRQNFRNDKMLLFFWIPIMVILSSAFLAFHFGKDGNKIRHISEAVSETIRTWMAKTLL
                     GNDRMKAVFRESIHNLQNHRILGENNYAI"
     gene            <332921..>333868
                     /gene="RAM2"
                     /locus_tag="KLMA_60145"
                     /db_xref="GeneID:34717372"
     mRNA            <332921..>333868
                     /gene="RAM2"
                     /locus_tag="KLMA_60145"
                     /product="protein farnesyltransferase/
                     geranylgeranyltransferase type-1 subunit alpha"
                     /transcript_id="XM_022820802.1"
                     /db_xref="GeneID:34717372"
     CDS             332921..333868
                     /gene="RAM2"
                     /locus_tag="KLMA_60145"
                     /codon_start=1
                     /product="protein farnesyltransferase/
                     geranylgeranyltransferase type-1 subunit alpha"
                     /protein_id="XP_022677229.1"
                     /db_xref="GeneID:34717372"
                     /translation="MDKFDYSDVKRVPIEPDAETELCVILYSSEYKELIGLFLGLMKE
                     NELSERALAVTTAVIDVVPALYTAWNYRFEICVSLYSDQSELWEKELDWLDELTLNNP
                     KNYQIWSYRQALVQQHPCPNFVRELPILDLMIDDDTKNYHVWSYRKWSVQFFDVWSHE
                     LEFVNKYIDRDVYNNSAWTHRAFYFKNQVTKEEQHKGLVNTEIEYVKAKISLAPQNVS
                     PWNYLRFIYRTFKDDEYDSGIVEFASKFVQNVLVLDEGNDESAPGKARVDSTFALELL
                     ADAYAKNDPAKSKVAYTALADTWDPIRKNYWSLKANQLG"
     gene            <334220..>335290
                     /gene="YVH1"
                     /locus_tag="KLMA_60146"
                     /db_xref="GeneID:34717373"
     mRNA            <334220..>335290
                     /gene="YVH1"
                     /locus_tag="KLMA_60146"
                     /product="tyrosine-protein phosphatase YVH1"
                     /transcript_id="XM_022820803.1"
                     /db_xref="GeneID:34717373"
     CDS             334220..335290
                     /gene="YVH1"
                     /locus_tag="KLMA_60146"
                     /codon_start=1
                     /product="tyrosine-protein phosphatase YVH1"
                     /protein_id="XP_022677230.1"
                     /db_xref="GeneID:34717373"
                     /translation="MSSTGEPDITRILGGIYVGGIQPIAHHTPLKANYQITHILSVIR
                     FEIIPEYLVRKSYTLKNIPIDDNMNTDVLQYFNETNRFIDSCLFPDEVEYDPKKVDFR
                     KKPQKGAIYIHCQAGVSRSVTFAVAYLMYRYGFNLKTALHAVKRKRSVAEPNENFMEQ
                     LKLYEAMGSNVVDPENKEYKQWKLQNSIKIDPLGADIMAQNEMFRSEEAQTQEIAKLS
                     EKEAKEVSAIRCKKCRFRLAFSTSFLEHEPPSKESMEGHFIKRAAGSRRIIDIQESQD
                     HCSHYFVEPLEWMKKELQKQELEGKFMCPHCDSKVGGYNWKGSRCSCGKWMIPAIHLQ
                     TAKVDHVALTKKDLPNLVSFEE"
     gene            complement(<335354..>336184)
                     /locus_tag="KLMA_60147"
                     /db_xref="GeneID:34717374"
     mRNA            complement(<335354..>336184)
                     /locus_tag="KLMA_60147"
                     /product="apc15p super family protein"
                     /transcript_id="XM_022820804.1"
                     /db_xref="GeneID:34717374"
     CDS             complement(335354..336184)
                     /locus_tag="KLMA_60147"
                     /codon_start=1
                     /product="apc15p super family protein"
                     /protein_id="XP_022677231.1"
                     /db_xref="GeneID:34717374"
                     /translation="MALDEFLYGLRSFKQPSEQSSFRDLPLIDNLRQELVKSKTNKKG
                     KSSVFSVGKNNNRKRSKPEKSLIPLAAYTCHSEKPIIVGNSCADTNAINILNKTTLML
                     IGTLGHNSLRPIGIDKTLKELEDSDTHERDQPAGPRNGDHISGSVQRHNVYQQSSSFI
                     IQGDHSHLHNVLANDAGDPSEEEADQSYDYDAYEQENESMVERVRETYVENSQLIDAS
                     YVQRSRRADDAPPLMHDNDDSGHESPSLTISEAVEAGAQGSRISSLTERLTAAMNEEL
                     "
     gene            complement(<336422..>336759)
                     /locus_tag="KLMA_60148"
                     /db_xref="GeneID:34717375"
     mRNA            complement(join(<336422..336670,336754..>336759))
                     /locus_tag="KLMA_60148"
                     /product="DUF1748 super family protein"
                     /transcript_id="XM_022820805.1"
                     /db_xref="GeneID:34717375"
     CDS             complement(join(336422..336670,336754..336759))
                     /locus_tag="KLMA_60148"
                     /codon_start=1
                     /product="DUF1748 super family protein"
                     /protein_id="XP_022677232.1"
                     /db_xref="GeneID:34717375"
                     /translation="MGVKQIIHYGVDLALVSMILAGLRRSTSYVVAYEMSDLRNYIKQ
                     YLDWGEFLFDKLAQMAERSAYFRKQTPLDKFLADKRPGDA"
     gene            <336918..>337994
                     /gene="SWD2"
                     /locus_tag="KLMA_60149"
                     /db_xref="GeneID:34717376"
     mRNA            <336918..>337994
                     /gene="SWD2"
                     /locus_tag="KLMA_60149"
                     /product="COMPASS component SWD2"
                     /transcript_id="XM_022820808.1"
                     /db_xref="GeneID:34717376"
     CDS             336918..337994
                     /gene="SWD2"
                     /locus_tag="KLMA_60149"
                     /codon_start=1
                     /product="COMPASS component SWD2"
                     /protein_id="XP_022677233.1"
                     /db_xref="GeneID:34717376"
                     /translation="MFDGNNDIRKESRRKDIKAHLSGSVGIIELTKMTVNINKNNLLR
                     FEAVKSFRVSDKELAPITSVCFDDHGQYLLTASANDNMHLYDAVSCRFLNTIASKKYG
                     CHSAKFTHAQSECIYSSTMKSFDIRHLNLETNTYLRYFQGHGALVSDIQMSPIDDTFL
                     SASYDESVRLWDLRSSKAQALIPSLVPTCIAYDPSGLVFAIGNPENHEVGLYNVRHLK
                     AGPFLVIKVDPNFHQWNKLEFSNDGKYILLASSAGKHLIMDAFDGSQLFELAGTKPFP
                     LREFMDSGSATFTPDGRFTLGTDYSGKIAVWNHAEVVSGRTLKPQGFINAPPNACPRT
                     IAFNPKYSMFVTADETVEFYVYNE"
     gene            complement(<337976..>340051)
                     /gene="HCS1"
                     /locus_tag="KLMA_60150"
                     /db_xref="GeneID:34717377"
     mRNA            complement(<337976..>340051)
                     /gene="HCS1"
                     /locus_tag="KLMA_60150"
                     /product="DNA polymerase alpha-associated DNA helicase A"
                     /transcript_id="XM_022820809.1"
                     /db_xref="GeneID:34717377"
     CDS             complement(337976..340051)
                     /gene="HCS1"
                     /locus_tag="KLMA_60150"
                     /codon_start=1
                     /product="DNA polymerase alpha-associated DNA helicase A"
                     /protein_id="XP_022677234.1"
                     /db_xref="GeneID:34717377"
                     /translation="MSRSRPRSRSRYHASGRLPMNKDVAETFLEGIAHEQQQDVEQTA
                     KLLSTVSLPKLVSAGLAINHLQLDNVRTGIGGKLYLELSPDPAITKEFNSGSFKVGDI
                     VMVQPSGGKSSKKDDSEKLDAVVSKVTSTQIILAVDESKDQDAMKLYSYNRLTIVKTT
                     NTITYKRMESTMRKLGEFESLPDNVLIQYLLHQREFIKRDPEPNVVFHNDMLNESQQN
                     AIKNALFNEISIIHGPPGTGKTHTLVELIKQLYDRGERVLVCGPSNISVDTILERLNK
                     VIPGDELLRIGHPSRLLPQVLSHSLDVISKSGDSGAIIKDIMKEIDDTIGSVKKIKSS
                     RDRKKGWQEVKLLRKELRQREKNGLINIILKSKVIVCTLHGSSSRELLRAYDVQPKLF
                     DTLIIDEVSQSLEPQCWIPLISHIQSDMHRLIIAGDNKQLAPTIKTEDNDKVKKLLST
                     TVFDRLVEHYGDSFKYLLNIQYRMNEEIMEFSSKEQYDGKLLADKSVAKQTLADLPDV
                     ESNDDTKFPLIWYDTEGDEFPERSDEDDNDSDDSFHLMSSRYNENEAYLALYHVNRLI
                     ESGVTEESIGVISPYNSQVSLLKKLIQKKYPNIEISTVDGFQGREKECIVLSLVRSNP
                     NFEVGFLKDERRLNVAMTRPRRQLCVIGNIEMLSRSRVPFLQRWAQWSEANSEIIYPD
                     PSILYSLYT"
     gene            complement(<340501..>341025)
                     /gene="ATP7"
                     /locus_tag="KLMA_60151"
                     /db_xref="GeneID:34717378"
     mRNA            complement(<340501..>341025)
                     /gene="ATP7"
                     /locus_tag="KLMA_60151"
                     /product="ATP synthase subunit d"
                     /transcript_id="XM_022820810.1"
                     /db_xref="GeneID:34717378"
     CDS             complement(340501..341025)
                     /gene="ATP7"
                     /locus_tag="KLMA_60151"
                     /codon_start=1
                     /product="ATP synthase subunit d"
                     /protein_id="XP_022677235.1"
                     /db_xref="GeneID:34717378"
                     /translation="MSLAKSAANKIDWSKVISSLKLTGKTATQLSSFKKRNDEARRQL
                     LELQSQPTTVDFSHYRSVLKNTEVVDKIEQFYKSYKPVSVDVSKQLSTIEAFESQAIE
                     NAVETEKLVAQELKDLKETLSNIESARPFEQLTVDELAKARPEIDAKVEEMVKKGRWD
                     VPGYKEKFGDLTVM"
     gene            <342128..>344692
                     /gene="PUT3"
                     /locus_tag="KLMA_60152"
                     /db_xref="GeneID:34717379"
     mRNA            <342128..>344692
                     /gene="PUT3"
                     /locus_tag="KLMA_60152"
                     /product="proline utilization trans-activator"
                     /transcript_id="XM_022820811.1"
                     /db_xref="GeneID:34717379"
     CDS             342128..344692
                     /gene="PUT3"
                     /locus_tag="KLMA_60152"
                     /codon_start=1
                     /product="proline utilization trans-activator"
                     /protein_id="XP_022677236.1"
                     /db_xref="GeneID:34717379"
                     /translation="MSVELSRNRSEDAEVWDENENDEIIEELPAKKKSKRSSLACTRC
                     RRRHIKCPGGEPCSKCLNAGVACEYVEPNKKLIVSMSYLQRLQHDLTTMKKENVKLQA
                     SLSERNTRLQALELLKKQLRLASLQTKKSSSTSSDSSGFQPNQDMRTLPVAQRHDKDV
                     IFQKNSVQDNEDEIVPNFAERRGRLVESRTGQEYFVGSSSMTLFGMEILSLIPDSLKK
                     KQKQAKKGDSPSSGEHGRHSSMLHAQPANDTANYISNEPVDEVLKEEGNAYKIVLAKN
                     DGNNDISVNFTLPTYSYAMLLIDTFITYNDGCFYFFNEGVVKHNLKQTYDGINSFEDH
                     TLQTIWFCKVLLIFATGEMYLGTANHINGNKLSSKETPRLPGSGFFEQASEIFSCLFS
                     SGRVENVTKEGGIEVMLLYAFYLQVADCTVASYFYFGQALRACLILGWHVDAQRDSLT
                     RFELEHRRRIWWTVYMFERMLSSKAGLPLSFTDNTITTELPDDFDMSNPPPDCESYVF
                     PEAEYITNCVRITQINAQILNKMYQKQPDSNILPVLKDIVTQLLEWRTNLSDFLQVDF
                     TQKDLKISRLCTNVFTEYFQGMNLAIRPLLFHFASIQLKQFEINNAYIDLRNYSRTIS
                     SLLNCSLQASINTIRSLWALMDQNMVALFGYMDREYIFTSACTLILFNAAFGIHDQTY
                     QHLDHALKIFTKMRNLGNNPAGLRRAQLLKLMSTLDFHGHMSELILKHTDKLKPNFQY
                     DVHDDRNVKIVSHVSTGFSSAGGANNSISQSQSNESQSNIHAVETNATRLDSLNFDEN
                     SDIQKLLDILENVGKSDDKLWKEISDQAMWLGSTMDSIHPAQTETNLGDFKAEDFL"
     gene            complement(<344805..>349871)
                     /gene="URB1"
                     /locus_tag="KLMA_60153"
                     /db_xref="GeneID:34717380"
     mRNA            complement(<344805..>349871)
                     /gene="URB1"
                     /locus_tag="KLMA_60153"
                     /product="nucleolar pre-ribosomal-associated protein 1"
                     /transcript_id="XM_022820812.1"
                     /db_xref="GeneID:34717380"
     CDS             complement(344805..349871)
                     /gene="URB1"
                     /locus_tag="KLMA_60153"
                     /codon_start=1
                     /product="nucleolar pre-ribosomal-associated protein 1"
                     /protein_id="XP_022677237.1"
                     /db_xref="GeneID:34717380"
                     /translation="MTGEDVSTIETRKRKWKQNLPNVSNVNSGLFDDLQILINSIDLL
                     NEGVSNDYRPVADFFRKGLAVQCTQGWSYYAQVNEHTKFAETTVKLTKLIAILNSDAS
                     VLPYGSVIIRDILNNYCKVLYRGINNLRPSITNAVFRLMTEIVQFNKGQFVDEFLQYF
                     DLTLLSLLKVLNPRKVDNVEAEATKKSAHISMRTCFIKFWIALIKNAPSVLRKDIMTD
                     NQKIMTAWMRNLVKMDSSELIEESLHLLIDHVLKETSFKKMTKCKILNEFVASRLHEL
                     YYSPNKNIVSLVDEFFQIYGGDLELGVVFIDKSSWFEETQGLKPGVLVEIHQKSFKLH
                     NKLLYTALTFFKPWEDDTQCNTVIKILATVPELVAPYSTYISSMGSHYPKMTAYWFGM
                     TLFLGRLINLPIPEYVESIESDNLPSNSIVIESIIPASITKAALTKCLQHESNLIKQM
                     GCQLLVFSLKKLDSVVDLYHRKGWESSKAMLLNTFFSYMPDLPVLTNVLNTLYTTAPN
                     NKILALSLTLIFRLYSKIFPNFFNISLPSSNFYVDIMKGDKFSGIDLVMLDNFMKFQE
                     LNSSQIKWWHASNKEHSLFSSLLRLASSKNASSIVASKISQLLHNLLQFSIIFTMDNL
                     TSSPLSALINSLLVLGNSEEKPTTAVEYEAVWKLLDESIARCQKTPYKYVDMAKEYEN
                     ISPFLAALAEQWKFVKVDNLETSAVAKWLVVFFRNMIVLGTSKNGAKLLLSKLDNIPV
                     NLLDIYLSFEDSTLKETLKTDYLIVQNETTSFYDHLLLQSSAKLATVTRVPVNPFDVS
                     AIVFRLNEIQSNSSLTTQTRNIIDNLLSKIGNYALGDLQYAERLVTKQYFSKIITELP
                     SISNGKHFEVFCYVLNGIQQIFSQLGIQYNEFKDYAFDLFQTIVNEDKGSHRTMALQI
                     LSQIVSKNAVIKCLKSLDDYSDIICTLLLQRCLDDKIHVQNQLFVDILESADINCQQK
                     LQNILVNNLVDDMDVSRLVQSSLDKEPFFIQSCMHIPQLAIELSKHYEDIKSPISKLI
                     IATHLNKENDEHHILEALKYATDKLYVSSGHDLFTILTLLSKHHSFVSENEVGRAIDF
                     VIAHGEIKYTSEAASFVLAVNTFSKLEVKTWLNKLFLYITKYFAEKTALSEDFLNLLV
                     VVKDFMKSNNSVWKDVKYSILNAQLEVILSGNWIEKNEVLEYVTILLLCANKKFVNAN
                     SLFQVLLNNNSLALSNNAQSNYTKFLTSSALYQLYFMDVAQNSSTTLQKKLLELYHGY
                     TNTSDIMLLTMLESIESTIGQSWTNNVISWEFVDTLQEAELDLIGPINLITSEKEGLI
                     VTISKDKIIDTLNNFPSHRPALNLIAKDTVEVKWNKLQNFFFSESTSPGVNVSHVYDP
                     MFILLCAMNNEELVRKVSEEDATKTIFNVKRFIDTGLLQLAIASLGLDATTVFVSKSI
                     LEGILYSIKEANQFKDRRAFEVLVTRILYTLEKQKDVTVPTIIWIALSRLCDILIQPS
                     SDLYEKAYRWVLMSPMIKDNDIPLLQTVFFRDNDTFTDSENYYKYLSWLLQTISLGLK
                     TPSDVKLLKMCNCFEWLMNLENSSYLHIRLKTLIQEIFYNIQQIDNGEGLLISGYASI
                     AFSECERVSLSKNYEESKKQWLKNTKNNRNYRNMLVEEQQLLNNLELSTRRVIIAKSD
                     KRLSEWMNHDELNVAKRICR"
     gene            <350405..>351094
                     /locus_tag="KLMA_60154"
                     /db_xref="GeneID:34717381"
     mRNA            <350405..>351094
                     /locus_tag="KLMA_60154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820813.1"
                     /db_xref="GeneID:34717381"
     CDS             350405..351094
                     /locus_tag="KLMA_60154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677238.1"
                     /db_xref="GeneID:34717381"
                     /translation="MFALQQVLRTSRRGYAVAAQQGAKKSRFDNKALKPMILLLIFGS
                     VLTSVTAQQQKHADMVRRYEMKIGILEELIERSKKGDFNYNAEKELELVNKLFARHEK
                     GNSVSIDEEAKLIREQAEKEKLNREKVINSMNSKLEEESFESIFKDIMKEVDQPIDQV
                     SVAPKKLDAGSMKEGSDDIIVDKEWLEYENKREKKSLEFKPSTEKHVIVENAGDYSTA
                     AAQDTEVKRFL"
     gene            complement(<351232..>354753)
                     /gene="DAL81"
                     /locus_tag="KLMA_60155"
                     /db_xref="GeneID:34717382"
     mRNA            complement(<351232..>354753)
                     /gene="DAL81"
                     /locus_tag="KLMA_60155"
                     /product="transcriptional activator protein DAL81"
                     /transcript_id="XM_022820814.1"
                     /db_xref="GeneID:34717382"
     CDS             complement(351232..354753)
                     /gene="DAL81"
                     /locus_tag="KLMA_60155"
                     /codon_start=1
                     /product="transcriptional activator protein DAL81"
                     /protein_id="XP_022677239.1"
                     /db_xref="GeneID:34717382"
                     /translation="MSGHESSNDSNSLWNTDGNEVGNSEHAARAINEGADEERKNAGS
                     SASASVSPMTKANSNSSHTSANNDGIDKNISNNGNSNGGSNSDGAKVDGENTDVSKNN
                     DNNESDNNNNNSHNNNNNNNNNNNSSNNSNNGSGSTNVEVSGGAAAGNSNSNVEKDSN
                     HNNDNHSMLNFHDDYAGILNNLTNGNNRGNMQPQSQSQSRQNNDGANTDKNSSGMDKG
                     TLDMLLQHYQELLNKSNSAANSPQFAPSVGPSNTTPSPNISARPQAAEKPCDHCRRRQ
                     NKCIMTPGAQNCVPCDTKGIKCTFSEIPSGKTAADVLQKQMSKRDRVDENINVHELLK
                     RTKFGNVNYNNNNDVSHNVPNVKTNDMPSDSSQNLPMQFYNDAIQSWLKSQSSSSEQQ
                     QPAYPYPRNISEFNDSANNGNNTNNSSQKVSPSSVYDFNQFSYGQTPNFPVNSNDQNF
                     QSQINYAQPAIQYPRSSYFVGPTSIFDINLINHMKLDKIEQVQLSKNLALRKVSPTAQ
                     FILRDDFNQELYLKQEHDIDLVEKLVHPHGKILVEIFFKLIHPYFPILHERVFLEKYS
                     RSYRELTAPILASIYSLALQWWDFHPQLIGFPKPDVVKQLNDIALKTFYEVFERPKLS
                     IVQAGLLILHCRSECPNNWVLCSEIVALSEELGLGVDCQDWRLPRWERGLRRRLAWAV
                     WCVDKWCALLESRHSHLILGRNWMVKLLTEEDFPDKSPIISSSQRNKPASKRPLSPIG
                     NSSILDISPTDEDFNNGKLLFRQMVSLSIILGEIMDTFYTIGAMKTTTKIEHVLKLAK
                     PLQLKLREWYHSLPHRLSMNNYAPGNYNSNATLTLAYFAAEITLHRKIISTLSPESPE
                     ELIPVCRTAAKTRLIAAIEFIRDLKTEHINSFWYTCSTGNLALIGTFSALLYVTAPTK
                     DEALIFRDCLRNYVWILRMSSKSFERAGNALDRIHMLLTQIPGLLTDEPVTQPFVPPK
                     SQSPYNPSSSYNAPPPPPSNPQPPQQNQQGHSQQQFFGSGQSPYYSSPQANFEMLNNS
                     NFKQLKNLPPEVLQSLSNIQSNMPSIPSASFSELNEFLEMRSKTPKLPVSNQTSNSLP
                     PEPLSQDKSPHRIGPLAVNEKTKLSKNPITPSSATGTTNSNTSPAKFDKQNSPENEIN
                     TQIAGPTDFKTYMDDKKINSVREESHQ"
     gene            complement(<355682..>355981)
                     /gene="ARC19"
                     /locus_tag="KLMA_60156"
                     /db_xref="GeneID:34717383"
     mRNA            complement(<355682..>355981)
                     /gene="ARC19"
                     /locus_tag="KLMA_60156"
                     /product="actin-related protein 2/3 complex subunit 4"
                     /transcript_id="XM_022820815.1"
                     /db_xref="GeneID:34717383"
     CDS             complement(355682..355981)
                     /gene="ARC19"
                     /locus_tag="KLMA_60156"
                     /codon_start=1
                     /product="actin-related protein 2/3 complex subunit 4"
                     /protein_id="XP_022677240.1"
                     /db_xref="GeneID:34717383"
                     /translation="MSIKVKQADEIEQILVHKFTNFLEQRAESFYVLRRVPVPGYSIS
                     FLITNKHTETMITEKLIEFIIEFMEEVDKEISEMKLFLNARARFAAEAYLEQFVY"
     gene            <356799..>358511
                     /gene="PRP40"
                     /locus_tag="KLMA_60157"
                     /db_xref="GeneID:34717384"
     mRNA            <356799..>358511
                     /gene="PRP40"
                     /locus_tag="KLMA_60157"
                     /product="pre-mRNA-processing protein PRP40"
                     /transcript_id="XM_022820816.1"
                     /db_xref="GeneID:34717384"
     CDS             356799..358511
                     /gene="PRP40"
                     /locus_tag="KLMA_60157"
                     /codon_start=1
                     /product="pre-mRNA-processing protein PRP40"
                     /protein_id="XP_022677241.1"
                     /db_xref="GeneID:34717384"
                     /translation="MGWKEAKDPQGRVYYYNDEGQTTWEKPEELFTAFEKRLLSHGWK
                     SALTEDGKVYYYKPSTGETTWEAPIKDEVVAEEEQKQQQQQQQQQQQEQEQKDTQDSG
                     EVASHEFTGTLDDGDGKYSNNSKLLVARKASSKEEAEKAFLQMLADYQVDSTWSFDRI
                     ISEIGSKDARYWMVDDDPLWKQAMFDKFLSNRSESELINEHKHLERFEQAFVEMLSKL
                     PTIHYYSRWPTIKRQIMNEPIYKHSVVAEKQKRRTFLRYIAQLQQEHQEQNNKVRNEA
                     LKELTQYFVSISDDIEPVNVPWSKFATKYLWGSPRFDSNKNFKSLTKGDVFQKYTTFV
                     EEKMTDLKARIEEHRRLNYRSDRKARDAFKELLNELSPPIKYNTTWKDVYPLVKDDPR
                     FTAMLGRNGSSALDLFLDKVEESELVMRAKSSVANQVLISNNLDLETSSMEDISTALK
                     QSVHLNDLSSEDITSLINRLKESHYRKKQEARRRELEPQLATREAKIFEDKLINIFST
                     KDLTLGPTSSWDDVLNQIKDDPSYQVLSPDLGKLIFENLANKGITSRKRHLEAPKSIT
                     DLDY"
     gene            complement(<358594..>359103)
                     /gene="SEC11"
                     /locus_tag="KLMA_60158"
                     /db_xref="GeneID:34717385"
     mRNA            complement(<358594..>359103)
                     /gene="SEC11"
                     /locus_tag="KLMA_60158"
                     /product="signal peptidase complex catalytic subunit
                     SEC11"
                     /transcript_id="XM_022820817.1"
                     /db_xref="GeneID:34717385"
     CDS             complement(358594..359103)
                     /gene="SEC11"
                     /locus_tag="KLMA_60158"
                     /codon_start=1
                     /product="signal peptidase complex catalytic subunit
                     SEC11"
                     /protein_id="XP_022677242.1"
                     /db_xref="GeneID:34717385"
                     /translation="MNLRLELTRLLSLAYVLSSSFMFWMGLSLFTDCHSPIVVVLSGS
                     MEPAFQRGDILFLWNKNKVNNVGDVVVYEVSGKSIPIVHRVIKQHQDESSGEQLLLTK
                     GDNNHGDDVPLYTRGKYYLNKKKDVVGTVKGYLPQLGYVTIWISENKIAKFALLGVLM
                     LSSLISNES"
     gene            <359431..>360108
                     /locus_tag="KLMA_60159"
                     /db_xref="GeneID:34717386"
     mRNA            <359431..>360108
                     /locus_tag="KLMA_60159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820819.1"
                     /db_xref="GeneID:34717386"
     CDS             359431..360108
                     /locus_tag="KLMA_60159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677243.1"
                     /db_xref="GeneID:34717386"
                     /translation="MRVAVIGANGKVGRLVCDKLKKIKYGPIAFVRTEEQLNYFKNDV
                     GIEATLTSIEDVTVEKLSEKFKELKVDASVFCAGAGGKGIERIFTVDLDGCCKVADAC
                     TQSGVSRLVVVSAINAENRSFWYGTALRNYYIAKKAADHYVRGTDLDYTILQPGMLVL
                     GKATGKLCTLDLLETKKDEHYAIDRDDVAEVIVKILEHPKGTIRKTIPLANGGLPIDD
                     FLKTLYD"
     gene            complement(<360167..>361240)
                     /gene="CCE1"
                     /locus_tag="KLMA_60160"
                     /db_xref="GeneID:34717387"
     mRNA            complement(<360167..>361240)
                     /gene="CCE1"
                     /locus_tag="KLMA_60160"
                     /product="cruciform cutting endonuclease 1"
                     /transcript_id="XM_022820820.1"
                     /db_xref="GeneID:34717387"
     CDS             complement(360167..361240)
                     /gene="CCE1"
                     /locus_tag="KLMA_60160"
                     /codon_start=1
                     /product="cruciform cutting endonuclease 1"
                     /protein_id="XP_022677244.1"
                     /db_xref="GeneID:34717387"
                     /translation="MNKSKLALLNKYFDAIKSSELKSLGLMLGSAKTGTKKELRTALN
                     EQMGNLNTLWRLRESPTGLRVMGIDLGISNFAFTTFHWGKGMKRPVLKDMYKVQLAGD
                     FVHLNEGEISPPLRPEVMAMLGMNLANWLVKFDSNAYLIERQRSRSASSSSILENILK
                     VMILEYVLYSNLQNKIIRESLPVHLFPSLPKRMVDFTCSGLPIEQLLAGTKSGSNQKS
                     KALGSNLLSKKLRIALCRSLVFDQISGKQRRFFMFDLDPQFMERCLAYPGDKTAINFY
                     EISKGTSIDMDFKQRNKNDDLCDSLLHGLVWMRWLSNYDTLLAFASKHPIPDTDSQNQ
                     FKQLIEDFNESHNKFLLTVITHI"
     gene            <361603..>362238
                     /locus_tag="KLMA_60161"
                     /db_xref="GeneID:34717388"
     mRNA            <361603..>362238
                     /locus_tag="KLMA_60161"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820821.1"
                     /db_xref="GeneID:34717388"
     CDS             361603..362238
                     /locus_tag="KLMA_60161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677245.1"
                     /db_xref="GeneID:34717388"
                     /translation="MSIYKSVVNDHGTFRGMYSYSNDTLDVIETPSFEKPGRSSLRKI
                     LFCLSPRSRHHHHHRLSRSPGIHRFRIWLNNKPILAFPQLSTEDSKSTGQASDSFQYE
                     PFRTVQEQRQSKNSHLFTYSTSLRSTLRQWIHQKKGPVLKQPASSKDSQDSQNDLDHK
                     SDGYSTSTLTDYDDDASEGKIKRSKGSKSNLNLTDFYSPNVLFDGPTAIIQ"
     gene            <362549..>364150
                     /gene="CAB3"
                     /locus_tag="KLMA_60162"
                     /db_xref="GeneID:34717389"
     mRNA            <362549..>364150
                     /gene="CAB3"
                     /locus_tag="KLMA_60162"
                     /product="flavoprotein super family protein"
                     /transcript_id="XM_022820822.1"
                     /db_xref="GeneID:34717389"
     CDS             362549..364150
                     /gene="CAB3"
                     /locus_tag="KLMA_60162"
                     /codon_start=1
                     /product="flavoprotein super family protein"
                     /protein_id="XP_022677246.1"
                     /db_xref="GeneID:34717389"
                     /translation="MVEGVVRESGLKPVSILTNRSDSNVSLSNEKDKDEVGGRCGLPG
                     HPKFVPLETAVRDRENGHMKSMPKLHLVTKMNSEREADDLSGSARSALTGTSVSFTVP
                     QHQDKAAVHRRSISTKPQSSKVTSPMSATTPVSLGLTAALGGNSIDVSNGEPLPSITP
                     VDSYSNMDDVTSWSGSSRQNSIHIPGDFIYFDTQPRNGSNDVVPDGHSPHLNGHAFSG
                     RSPSAGSLVDSVHGVSNSNNNSESNLVAAGAKKPTTKKRISEEEPHVPFTELFLKEDD
                     EKIHILIGATGSVATIKVPMIIDKLYKIYGENKVSVQLVLTKHAEHFLKGAKINKEVK
                     IWRDEDEWYGFKRMGDPVLHTELRKWADIFLIAPMSANTLAKLANGVCDNLLTCLVRA
                     WKSVPIIIAPAMNTFMYIHPVTKKHLKILQEDYPYMEVLKPVEKVLVCGDIGMGGMRE
                     WNEIVDILTKRIQMYRDDIKAQEEEEDDDDDDDDEDDDDDDEDNDDDDDDDDDDEDDD
                     DDDDDDDDDDDDDEESTEIDTTTTK"
     gene            <364567..>364836
                     /gene="TIM10"
                     /locus_tag="KLMA_60163"
                     /db_xref="GeneID:34717390"
     mRNA            <364567..>364836
                     /gene="TIM10"
                     /locus_tag="KLMA_60163"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM10"
                     /transcript_id="XM_022820823.1"
                     /db_xref="GeneID:34717390"
     CDS             364567..364836
                     /gene="TIM10"
                     /locus_tag="KLMA_60163"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM10"
                     /protein_id="XP_022677247.1"
                     /db_xref="GeneID:34717390"
                     /translation="MFGLGGQPQLNSQQKLQAAEAELDLVTDMFNKLVDNCHKKCIEQ
                     SYNDGQLNKNESTCIDRCVAKYFETNVKVGENMQQLGQSFAPGKF"
     gene            complement(<365054..>365863)
                     /gene="CYT2"
                     /locus_tag="KLMA_60164"
                     /db_xref="GeneID:34717391"
     mRNA            complement(<365054..>365863)
                     /gene="CYT2"
                     /locus_tag="KLMA_60164"
                     /product="cytochrome c1 heme lyase"
                     /transcript_id="XM_022820824.1"
                     /db_xref="GeneID:34717391"
     CDS             complement(365054..365863)
                     /gene="CYT2"
                     /locus_tag="KLMA_60164"
                     /codon_start=1
                     /product="cytochrome c1 heme lyase"
                     /protein_id="XP_022677248.1"
                     /db_xref="GeneID:34717391"
                     /translation="MSDQPKCPVDDSTKEAWLKQANSNAQAKAQAQAQAQAQAPAAPA
                     GEGVCPVDHSSRDVWLKNHLQAVGETGAASKAVAPVIPIITQDIECSSDEIPEQVKYT
                     TDVNLPTEREKSSIPRTGTSDNWIYPSEKQFFEAMKRKNWDPNAIDMKAVVPIHNSVN
                     ERVWNYIKIWENGQGGDACGGIKLTSFKGDSKKLTPRAWFRSSILGMNKPFDRHDWVV
                     DRCGKQIDYVIDFYANDEPEKNGLPPIYLDVRPKVNTFEGCKLRLLKSLGF"
     gene            <366691..>368013
                     /gene="GPA1"
                     /locus_tag="KLMA_60165"
                     /db_xref="GeneID:34717392"
     mRNA            <366691..>368013
                     /gene="GPA1"
                     /locus_tag="KLMA_60165"
                     /product="guanine nucleotide-binding protein alpha-1
                     subunit"
                     /transcript_id="XM_022820825.1"
                     /db_xref="GeneID:34717392"
     CDS             366691..368013
                     /gene="GPA1"
                     /locus_tag="KLMA_60165"
                     /codon_start=1
                     /product="guanine nucleotide-binding protein alpha-1
                     subunit"
                     /protein_id="XP_022677249.1"
                     /db_xref="GeneID:34717392"
                     /translation="MGCVASTGGSSGDDESLMQSKRVNDLIEQNLQLERNKNKNEVKL
                     LLLGAGESGKSTVLKQMKLLHQGGFTHRERMQYGQVIWADAIESMRTLILQARKLGIE
                     LDSDQEKAGGELRKSKEIILRANTLDQVDARMAGGSEFLNEYVLKYSNGAAAGAHGKQ
                     RKQQQQQSDKDDEDGLLLTEKYGNEELEDMELELDMDLKPIDQTTNEEIAHAIKQLWT
                     HDRGIRQCFHRSSEFQLEGSASYYFDNIEKFARVDYVCDDMDILKGRIKTTGITESSF
                     KIGPSTVKVYDAGGQRSERRKWIHCFEGITAVIFVIAVSEYDQMLFEDERVNRMHESI
                     MLLDTLLNSRWFANTPFILFLNKVDLFQEKVKRSPIRTWFPNYPGRLGDSETGLKYFE
                     SLLLSLNRNNKPMYVHRTCATDTQSMRFVLGAVTDLVIQQNLKKSGML"
     gene            <368333..>368725
                     /gene="SRX1"
                     /locus_tag="KLMA_60166"
                     /db_xref="GeneID:34717393"
     mRNA            <368333..>368725
                     /gene="SRX1"
                     /locus_tag="KLMA_60166"
                     /product="sulfiredoxin"
                     /transcript_id="XM_022820826.1"
                     /db_xref="GeneID:34717393"
     CDS             368333..368725
                     /gene="SRX1"
                     /locus_tag="KLMA_60166"
                     /codon_start=1
                     /product="sulfiredoxin"
                     /protein_id="XP_022677250.1"
                     /db_xref="GeneID:34717393"
                     /translation="MSMQTSLCKEKSIPLSQIVRPIQPVLDHDKIAAMVSTFKGTARG
                     SATLSEAEAAERVRTLPASERLPPVDVAAVRYPDTGETRYFAFGGCHRLQAYDRLAAE
                     SPDHDVAVRCRLMPMTPKQLKLYIGGSA"
     gene            <369659..>370675
                     /gene="MDH1"
                     /locus_tag="KLMA_60167"
                     /db_xref="GeneID:34717394"
     mRNA            <369659..>370675
                     /gene="MDH1"
                     /locus_tag="KLMA_60167"
                     /product="malate dehydrogenase"
                     /transcript_id="XM_022820827.1"
                     /db_xref="GeneID:34717394"
     CDS             369659..370675
                     /gene="MDH1"
                     /locus_tag="KLMA_60167"
                     /codon_start=1
                     /product="malate dehydrogenase"
                     /protein_id="XP_022677251.1"
                     /db_xref="GeneID:34717394"
                     /translation="MLRALTRRQFSSTAFNPYKVTVLGAGGGIGQPLSLLLKLNHKVT
                     DLRLYDLKGAKGVAADLSHIPTNSTVTGYTPESKDSQEELAAALKDTEVVLIPAGVPR
                     KPGMTRDDLFAINAGIVRDLATSIAKNAPNAAILVISNPVNSTVPIVAEVLKQNGVYN
                     PKKLFGVTTLDVIRASRFISEVRGTDPTTEHVTVVGGHSGITILPLVSQTKHKSVIKG
                     EELDNLIHRIQFGGDEVVQAKNGAGSATLSMAQAGARFANSVLSGFEGERDVIEPTFV
                     DSPLFKDEGIEFFASPVTLGPEGVEKIHGLGVLSDKEEQMLATCKETLKKNIEKGQNF
                     VKQN"
     gene            <371030..>371371
                     /gene="HOT13"
                     /locus_tag="KLMA_60168"
                     /db_xref="GeneID:34717395"
     mRNA            <371030..>371371
                     /gene="HOT13"
                     /locus_tag="KLMA_60168"
                     /product="helper of Tim protein 13"
                     /transcript_id="XM_022820828.1"
                     /db_xref="GeneID:34717395"
     CDS             371030..371371
                     /gene="HOT13"
                     /locus_tag="KLMA_60168"
                     /codon_start=1
                     /product="helper of Tim protein 13"
                     /protein_id="XP_022677252.1"
                     /db_xref="GeneID:34717395"
                     /translation="MSIPPAAPTIHGKLVDKQSRCEHWHGPLDVIALKLKCCNKYYTC
                     YECHNELESHPISKYNIAEPHVNLIVCGVCNHEMSFDSYASELKCPRCSAPFNPGCKL
                     HYDMYFYKGDK"
     gene            complement(<371410..>372843)
                     /gene="AVO2"
                     /locus_tag="KLMA_60169"
                     /db_xref="GeneID:34717396"
     mRNA            complement(<371410..>372843)
                     /gene="AVO2"
                     /locus_tag="KLMA_60169"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820830.1"
                     /db_xref="GeneID:34717396"
     CDS             complement(371410..372843)
                     /gene="AVO2"
                     /locus_tag="KLMA_60169"
                     /note="ANK[cd00204] ankyrin repeats"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677253.1"
                     /db_xref="GeneID:34717396"
                     /translation="MIPDPRIRLREGIIQGKLGVVRRILKRWPELLENVDSRNGWSSL
                     HYAAFYGRYLTCLHLIQLGHDSHTLLRTYDGDTSIHLAIKNGDEQTVHLLLQHFLEEG
                     LNLRSSGHRKWAPIHIACRADHYRCLVLLLQCGADVMLQDDEGNTGLHVAMEYGSIHC
                     LPILVAAGGEKLVNVKNQMGLDAEQVGNSDETVRKYRHVKKKNNNKSDASFADNFGIV
                     GIPNTSSSASVSVSASGTGTGTGTVSPLSGSNSVSVSASASAPASALASALALTSASA
                     ATGTASEPVSVPVSAPGSILGSVPGPVPASISGSGSTPAEGGNGTSVKKDVEIAARGY
                     QTRPLSLTHSPMRNGNSMGQGYTFGPGYGTATTTNTATTTHKRTHSRGHNHGLGHGNG
                     HGHGHGHGQGNVLGQGQGNGQGNGHGIEDLNDYLADSISTSETSETSSTVGASKLLNV
                     AISRVRRDADSGTDEEIDSEPPRMTTV"
     gene            <373125..>373766
                     /locus_tag="KLMA_60170"
                     /db_xref="GeneID:34717397"
     mRNA            <373125..>373766
                     /locus_tag="KLMA_60170"
                     /product="UBX domain-containing protein 4"
                     /transcript_id="XM_022820831.1"
                     /db_xref="GeneID:34717397"
     CDS             373125..373766
                     /locus_tag="KLMA_60170"
                     /codon_start=1
                     /product="UBX domain-containing protein 4"
                     /protein_id="XP_022677254.1"
                     /db_xref="GeneID:34717397"
                     /translation="MSDNHHPQVLLPRDQTNSAATKDDEQYQLTVDHALRYQKLLANR
                     SGSNLANGPLMTKRLRENEKPQSKNPLQGLDYLYIRARLPDRTALDYQLSVSSTLHSL
                     YETVKGSLQEEASAHLVLSLSSPYTKLKDDDSITLIDAGFHKKTLVIAELPDVLPPYL
                     KPHLLANAKSIEQASSTETVSEAKDNETAPSQEEKKPAKKLTKAPKWLKISKK"
     gene            complement(<373863..>376403)
                     /gene="SOV1"
                     /locus_tag="KLMA_60171"
                     /db_xref="GeneID:34717398"
     mRNA            complement(<373863..>376403)
                     /gene="SOV1"
                     /locus_tag="KLMA_60171"
                     /product="protein SOV1"
                     /transcript_id="XM_022820832.1"
                     /db_xref="GeneID:34717398"
     CDS             complement(373863..376403)
                     /gene="SOV1"
                     /locus_tag="KLMA_60171"
                     /codon_start=1
                     /product="protein SOV1"
                     /protein_id="XP_022677255.1"
                     /db_xref="GeneID:34717398"
                     /translation="MLRSAVCRRNISAFSVSRHLRYIRTKSVPANVRSAVNPGHQVLT
                     LPGEEDVEMLKKSGFTEVDAQAGLNSWMMSYLTVTNPGFKRSKKNLAKLKNQKDQPIQ
                     DVLAYLLEESENEIKRLKSMTVEEVNQHLLEKKSTQPIEEEGVPLENLDNKILEQVIY
                     EQMKTDIHPLSNTEHLLQILEKILEDDTVKDKTTVISLDQMVEAFELVKLIPNKAYRL
                     KGQFLAGQLIYGLNKVRLDPGNESFYIDSLLYFRKMKTASKLFESYKSRVEERWWYEV
                     GLMVYLRSNKLQKFNVLYQETREKFGTDYIRPDVLILAIKKHLNARRLERAKELTQDI
                     SKMIEIYGWEDDTSSVHKGYLNFNSSEEANDFLNEVQRVSKRAYVKLLSSYFLYGYKE
                     EGFRLLGEFEQTNNLEKDLFEILSKKLKLQWLKEFSTFVREYTPYLSPLDSTDKIQRL
                     KGWYEESLREQEITEFRDSFRYLLYDSIDDLLQMKNLSGALEKSLLTYTSTTDADAEP
                     SEIKNKRLQMVMKVLLMGGREESALNILSELEKSKRERSGHDTANTGVSAYPPVTSHH
                     YLPFIQYYGMKSSKQGKKMLVEIIKRINYNNVEMDAFMFTTILKCLTRQQKYQDSILL
                     VNKILSSKQEAGKTIPVPLYKQIWKTYRVYYELLHRSVDENGNKNFFCATVHAREAIK
                     TGFTYNLLDVFYRMIEQDSTLLNSELVNAVLDAFAKNREWNNMLPVMLYIHDVQMLEI
                     PERRIEYYRRGLKRDFIDQLKYKIRKYERSKDSLQVSKYTTQLRDIEEKLILNNLMNN
                     QVSAEENFSTFLHELNEYLELIGYSRVDLNATMTRLGEGPEILRKYAL"
     gene            complement(<376835..>378154)
                     /gene="RRP14"
                     /locus_tag="KLMA_60172"
                     /db_xref="GeneID:34717399"
     mRNA            complement(<376835..>378154)
                     /gene="RRP14"
                     /locus_tag="KLMA_60172"
                     /product="ribosomal RNA-processing protein 14"
                     /transcript_id="XM_022820833.1"
                     /db_xref="GeneID:34717399"
     CDS             complement(376835..378154)
                     /gene="RRP14"
                     /locus_tag="KLMA_60172"
                     /codon_start=1
                     /product="ribosomal RNA-processing protein 14"
                     /protein_id="XP_022677256.1"
                     /db_xref="GeneID:34717399"
                     /translation="MSNSLEERLKSNSSAFEGLLSLIPAKYYYDEKTQEQWKAKKKSK
                     GQLKEDKKAKLDPEQQNEESGSALDVLKKKQASAKPVVLPGQRKMPVEEEVEEEEEEE
                     EEEEEEEEAEADQEASEVSEVASVGESESITVVFDDDGNPVDGNSSTTETPSKASNKE
                     LSKEQALKEEALKKKKMEELRSKLQEKIKALKEKRKAPGTKVDGAPSSREAILAQRKR
                     RQEARAAKKLDSENPGDVSSDDSGADSDSDSEVEDGHVSKKQRRGDDEISAKDVMFQS
                     IEFSDGTKATSDLSHVRKGERKKGPAKKDVKAHLRLLESKKQSIESKDELDQIKIKEK
                     EKWQKAMLQAEGIRLRDDEKLLKKALKRKEAKKRKSAIEWRERKQVVENTVAERQKRR
                     EENLQIRKDNKGKKRSKQQKMKRKFKGTAHLPKRAGFEGRLKSVKKK"
     gene            <379427..>381057
                     /gene="TEF4"
                     /locus_tag="KLMA_60173"
                     /db_xref="GeneID:34717400"
     mRNA            join(<379427..379640,380018..>381057)
                     /gene="TEF4"
                     /locus_tag="KLMA_60173"
                     /product="eukaryotic elongation factor 1Bgamma"
                     /transcript_id="XM_022820834.1"
                     /db_xref="GeneID:34717400"
     CDS             join(379427..379640,380018..381057)
                     /gene="TEF4"
                     /locus_tag="KLMA_60173"
                     /codon_start=1
                     /product="eukaryotic elongation factor 1Bgamma"
                     /protein_id="XP_022677257.1"
                     /db_xref="GeneID:34717400"
                     /translation="MAQNTLYVLPPSPRSVLILALAKYLKIDVDVVDITKSKDEKFTK
                     AFPLGKAPAFIGENGFKLHEVIAIAYYFVNLSEDEEFKAALLGKNAKEEAEILKWVSL
                     SNSDFPTSLFGAIMPITGRVPYNKKVVDTNLEKLASISAVYEARLKNYTYLVDERITL
                     ADLFAAGVFTAGFATLMDAKWRADHPAIVRWFKTVAASPIVAEYFSKTEFVEEAIKYT
                     PPKKEKKEQPKKEQPKKEAKPAAAADADAAPAEQPKKPKHPLELLGKSTFSLDEWKRT
                     YSNEDTRPVALPWFWEHYNPEEYSIYRVDYKYNDELTLTFMSNNLVGGFFNRLSASVK
                     YMFGCLVVYGENNNNGIVGAVMVRGQDYAPAFDVAPDWESYSYTKLDPTKEEDKEFIN
                     NMWAWDKPVVVNGENKEIVDGKVLK"
     gene            <381622..>382797
                     /gene="VMA5"
                     /locus_tag="KLMA_60175"
                     /db_xref="GeneID:34717401"
     mRNA            <381622..>382797
                     /gene="VMA5"
                     /locus_tag="KLMA_60175"
                     /product="v-type proton ATPase subunit C"
                     /transcript_id="XM_022820835.1"
                     /db_xref="GeneID:34717401"
     CDS             381622..382797
                     /gene="VMA5"
                     /locus_tag="KLMA_60175"
                     /codon_start=1
                     /product="v-type proton ATPase subunit C"
                     /protein_id="XP_022677258.1"
                     /db_xref="GeneID:34717401"
                     /translation="MSTALYTAKDFIIVSLPENARPSQNPETDVSTWLETGLINGRSY
                     VAEFPIPDFKIGSLDSLVLQSEELAKIDSQIYSSLQKIVEILHALTDTQVSSITINKQ
                     SIPEYLTHFQWDSRKFKLDKSMKELIHDLSIESFQLDADVRATYSNYNNAKSNLAAAE
                     RKKTGDLSVRSLHDIVKAEDFILDSEYLTTVLVAVPKNLKHDFEKSYESLAEKVVPGS
                     ASILKQDDEFILYNVHLFKKYQQDFQNACRERKYIPRDFAYSEEFIKKLKQEHDTAAS
                     EEQSLRVQLIRLVKTAFQDVFVNWLHIKALRVYVESVLRYGLPPFFLIKIIAVPPKQL
                     SACKTELIEQFSYLAGNAFSKDKRGKINRNDSSLHEYASLVDTEYEPFVLYPIQLPQ"
     gene            <383378..>384550
                     /gene="JLP1"
                     /locus_tag="KLMA_60176"
                     /db_xref="GeneID:34717402"
     mRNA            <383378..>384550
                     /gene="JLP1"
                     /locus_tag="KLMA_60176"
                     /product="alpha-ketoglutarate-dependent sulfonate
                     dioxygenase"
                     /transcript_id="XM_022820836.1"
                     /db_xref="GeneID:34717402"
     CDS             383378..384550
                     /gene="JLP1"
                     /locus_tag="KLMA_60176"
                     /codon_start=1
                     /product="alpha-ketoglutarate-dependent sulfonate
                     dioxygenase"
                     /protein_id="XP_022677259.1"
                     /db_xref="GeneID:34717402"
                     /translation="MPVDIAPVVYGNFDTHFYAGQDEVGSDGVLRIAKAYRQKAKHPE
                     FLPTWDPRQKYPPLEFFKYEDPALRADPSFPNLLNGKTSLKPITPKLGTEIRGLQLTK
                     LSDAAKDELALLVAQRGVVVLRDQDFVDQGPGYAEDYGRHFGKLHIHQTSGAPEGHPH
                     LHITFRRPDRKEFDRVFQDAASSVSFHTDVSYELQPPSYTFFAQLEGPESGGDTLFAD
                     TIEAYERLSPHFQEFLSTLHVIHSSKEQAFSSKANGSIQRRAPVTHIHPLVRVHPVLK
                     KKCLFVNRAFSRKIVELKSGESSHLLDFLYGIIESGHDLQLRAKWEPGTVAIWDNRRT
                     QHSAIVDWEDPVTRHNVRITPQAERPVEDLKYLNDPTYYPHTDEDDEYRGYPSRKY"
     gene            complement(<384840..>386243)
                     /gene="KAR5"
                     /locus_tag="KLMA_60177"
                     /db_xref="GeneID:34717403"
     mRNA            complement(<384840..>386243)
                     /gene="KAR5"
                     /locus_tag="KLMA_60177"
                     /product="nuclear fusion protein KAR5"
                     /transcript_id="XM_022820837.1"
                     /db_xref="GeneID:34717403"
     CDS             complement(384840..386243)
                     /gene="KAR5"
                     /locus_tag="KLMA_60177"
                     /codon_start=1
                     /product="nuclear fusion protein KAR5"
                     /protein_id="XP_022677260.1"
                     /db_xref="GeneID:34717403"
                     /translation="MHFLINILIIQLFPFVSAQLVAQISQLRQDAITYPHISAISQQY
                     IQNKFPIKSQSNCLRDALKPFLEICMVHGVESVETELRVKTAIQLSVCEFEASGLTSY
                     PPECSGILHDDSSGSSDTGIDVVQCVAELESSPQWWTTYSGNYQNLPQICMENSLPFE
                     KEQLLDLFLNITDMYAQFQSDVMKQWLLFSSNLEHESKNNLNNIHNMFDSFIDHLREA
                     ANQNEREMEQERKNFSASMSSDMSQLRSQILETFKDLESNYMEQYQEKTEQSILDLDS
                     VLSNLVRVTKEKHDIVHDELNQAQEESFHLVYQFNRLMHETVIPLLTEDLLPTVNEIS
                     SSITNNLEHANEEVSRKLDGWSRTLDDRFAQIDKSAAQSLERAEQMEASMEKLDSLLD
                     KSLRGLRSVFSVMNFVMKRQMLIVCAIQVVFRRYITLKMYLCAISVFATALVGSRAGK
                     MASIIFQSTRPPKWLQQ"
     gene            complement(<386581..>388056)
                     /gene="AEP1"
                     /locus_tag="KLMA_60178"
                     /db_xref="GeneID:34717404"
     mRNA            complement(<386581..>388056)
                     /gene="AEP1"
                     /locus_tag="KLMA_60178"
                     /product="nuclear control of ATPase messenger RNA
                     expression protein"
                     /transcript_id="XM_022820838.1"
                     /db_xref="GeneID:34717404"
     CDS             complement(386581..388056)
                     /gene="AEP1"
                     /locus_tag="KLMA_60178"
                     /codon_start=1
                     /product="nuclear control of ATPase messenger RNA
                     expression protein"
                     /protein_id="XP_022677261.1"
                     /db_xref="GeneID:34717404"
                     /translation="MLSKAANRLQPVKSVTIPKNKFRLDLNNEDGLQKWPEYIVPNAN
                     KLVHPFYRTPNPTERTILCIDEKSPQLFNGHAVLPAFMKDPITRELTLVESKISFGTV
                     KDVSKWVNKIYRQSQTNDQNKVLIFEDIPANTVRESRLDTKSPLVVELDRFLDSHPEI
                     SIESLDSELSRMFIFKKARQVVYLDEVLLHILQRDTLTSSQWNSVLKVLPKYAGKEID
                     DTSMITMLIAEWVLVGRKLFGDETVCNSSEMLWQEIQQISESLNKDICNKFTIKELNV
                     LLDLFLDAQNLELSRAMLDKLALRHNAMPSLPLAEKYMTFIDASLDTQVDRKTKLYYM
                     HILAPVFSSHLTSTMATILLPYCVHQAEVFALFDLALKSKYAEEILPIITTQFILRLS
                     QLKESQIDNSLNISTLYNRLKIHYNNAGKIPQSSVFALVVALVANSNFRAIITLLQEQ
                     TIEDISKAIELVEKQSVVLDTFGFREADKNDLLSYLQNSCQ"
     gene            <388840..>391050
                     /gene="DHR2"
                     /locus_tag="KLMA_60179"
                     /db_xref="GeneID:34717405"
     mRNA            <388840..>391050
                     /gene="DHR2"
                     /locus_tag="KLMA_60179"
                     /product="probable ATP-dependent RNA helicase DHR2"
                     /transcript_id="XM_022820839.1"
                     /db_xref="GeneID:34717405"
     CDS             388840..391050
                     /gene="DHR2"
                     /locus_tag="KLMA_60179"
                     /codon_start=1
                     /product="probable ATP-dependent RNA helicase DHR2"
                     /protein_id="XP_022677262.1"
                     /db_xref="GeneID:34717405"
                     /translation="MAKAKTTARTQGKEVKKRGFRAVDKTARQPAVVYFEEKGAKSGA
                     SDAADDDDDDDEVNQHVSRQELKTRAARLLKVRESLPVFQNRERIMSHIRSNPVTVLI
                     GETGSGKSTQIPQFLMDEVLGNGSGSGGKAGGAIAVTQPRRVAAINLATRVAQEHGVQ
                     LGQEVGYSVRFDNKSHKGRTRLKYLTDGMLIRELMLDKNLSGYKCVVIDEAHERTVLT
                     DLILGFLRELQRGKRPDLKVVVMSATLQADLFSRFFDEAPVLFVEGRKFPVERFYLPR
                     ACDDIVDAVVRAAVQLNSSEGIISGGSGSSGGDILCFLPGQEEIDKAVSILNKISPVL
                     DRTVPRIQAFPLYAALAPREQARVFEPLKGFRRKVVLATNIAETSVTIPGVKYVVDCG
                     LRKVKVWRHQLGLATLLTVPVSKASVAQRAGRAGRESAGKCFRLFTEKDYERLPAQSE
                     SEITRSEITSPILMLKQYGVQDVVNWSWLEHPGREAIVSALKELYELQALDDAGKITE
                     LGRKMALLPLAPHLSAVLLEAQERDVLDAVVDIVACLSVENLVLNPMPEERDEVNERR
                     RAVCPLGTRYGDLLMLKELYEAYESLASAGERQEWCKRLCLSQRGFKNVIKVRQQLLS
                     YVERLYKVKGNVSKEYDEDRTLDVAQVLKCFLRGFVKNTAIGMPDKSFRTTPTGETIA
                     IHPSSMLFMSDVTCSAILYIEHVFTTKGYARSVSRIELAWLQEVASGVLKQGTR"
     gene            <392215..>394056
                     /gene="STL1"
                     /locus_tag="KLMA_60180"
                     /db_xref="GeneID:34717406"
     mRNA            <392215..>394056
                     /gene="STL1"
                     /locus_tag="KLMA_60180"
                     /product="sugar transporter STL1"
                     /transcript_id="XM_022820841.1"
                     /db_xref="GeneID:34717406"
     CDS             392215..394056
                     /gene="STL1"
                     /locus_tag="KLMA_60180"
                     /codon_start=1
                     /product="sugar transporter STL1"
                     /protein_id="XP_022677263.1"
                     /db_xref="GeneID:34717406"
                     /translation="MLNKVSAKVTSRTDTAGLVGRSLRIAITVVAVTGFSLFGYDQGL
                     MSGIITGVKFNEEFPATREKSSNDRHATVVQGAVTSCYELGCFFGSLFVMFKGEKIGR
                     KPLIIIGSILTMVGALISTCAIGRHWGLGQFVIGRVITGLGTGMNTSTIPVWQSEMSK
                     PENRGLLVNLEGSVIALGTMIAYWIDFGLSYVDSSVQWRFPVAMQIFFAILLLIGVLQ
                     LPDSPRWLVSQGRREEAMYILGKLDNLDPNDDQVLAEISSIQDAVNRFKHQKRSLKEL
                     LHGGKGQNFQRAMIAASTQFFQQFTGCNAAIYYSTVLFKKSIGLEARLSLILGGVFST
                     IYTLSTIPSFFLIESLGRRKLFMVGALGQGISFTITFACLIDDTKSNAKGAAVGLFLF
                     IVFFGMSILSLPWIYPPEIASMRVRSVTNALSTCTNWLCNFAVVMFTPIFIEDAGWGC
                     YLFFACINFAYFPVIYFFYPETAGRSLEEIDIIFAKAHVDKTMPWRVAANLPKLSLAE
                     IEDHGNALGLYDDDLEKEDELEKDDEEQTSENNNSTSQKDYPSHPGFSLFQRKKSSRN
                     PQAEADAAAAAAPVDSQTSPEEEEDVSGTAEKDNGLTNTQQSSNSSE"
     gene            <394814..>396148
                     /locus_tag="KLMA_60181"
                     /db_xref="GeneID:34717407"
     mRNA            <394814..>396148
                     /locus_tag="KLMA_60181"
                     /product="arginine biosynthesis bifunctional protein ARG7"
                     /transcript_id="XM_022820842.1"
                     /db_xref="GeneID:34717407"
     CDS             394814..396148
                     /locus_tag="KLMA_60181"
                     /codon_start=1
                     /product="arginine biosynthesis bifunctional protein ARG7"
                     /protein_id="XP_022677264.1"
                     /db_xref="GeneID:34717407"
                     /translation="MKASISLLQRASKHIDKYALYVPKDGVFPKGFKVASHATGVKKN
                     GNLDLGIIRNVNTSRKASAAALFTTNKFKAAPVLVSKKVLQVTGGEGVDAIVVNSGCA
                     NAVTGDVGLKDAQEIADLVNAKLGKENATLVMSTGVIGQRLSMDKIVPAVSQQFEGAG
                     NSNFKDDFESWLNLAKSICTTDTFPKLITSRFALPNGTEYTLTGIAKGAGMICPNMAT
                     LLGFIVTDLPITPDALKKMLRSAADRSFNCISVDGDMSTNDTISMIANGAVDTAVIDE
                     AHEYFPQVQQQVTEFAQQLAQLVVRDGEGATKFVTVNVKNALHFADAKIIAESISNSM
                     LVKTALYGQDANWGRILCAIGYAKLDNLQSLDVKKINVSFVATDNSEPRELKLVVDGV
                     PQLDIDESRASEILALPDLEVLVDLGTGSEECQFWTCDISHEYVTINGDYRS"
     gene            complement(<396259..>398289)
                     /gene="RNA14"
                     /locus_tag="KLMA_60182"
                     /db_xref="GeneID:34717408"
     mRNA            complement(<396259..>398289)
                     /gene="RNA14"
                     /locus_tag="KLMA_60182"
                     /product="mRNA 3'-end-processing protein RNA14"
                     /transcript_id="XM_022820843.1"
                     /db_xref="GeneID:34717408"
     CDS             complement(396259..398289)
                     /gene="RNA14"
                     /locus_tag="KLMA_60182"
                     /codon_start=1
                     /product="mRNA 3'-end-processing protein RNA14"
                     /protein_id="XP_022677265.1"
                     /db_xref="GeneID:34717408"
                     /translation="MSESTATPDPPSNGHNGNSSSSSSSTVVRPTSRVRDETDLAGKL
                     EDQIEEQPTDIYLYIRLLKHHVSLKQWKQVNETFDKLLDRFPVMSNIWCMRLGLELDK
                     KEELDAAVIEPVLARCLSQELGNNDLSLWLSYITYVRRKNDIITGGEDARNVVLQAFQ
                     VVIDKCASFEPKSTQFWNEYLYFLEHWKPVNKFEEQQKVQYIRKLYKTLLCLPVDCLE
                     PMWERYTQWEQDTNQLTARRHIGELSAQYMNARSLYQDWSNITRGLKRNLPVTLNQAT
                     ESNLPKPNEYDISQLQIWLDWIQWEMENKMELSEELHKARVKYVYMQAIQHVCFSPEI
                     WFNFANYSGQQSGDSIAEVTRVLKLARQYIPNSVVLTLKLSEQFELSNNTAEIESTIL
                     SCIDRIHLDLVICMEDSPSNETAISHLKSKLTYVYCVYMNTMKRLQGLTSSRKIFSKC
                     RKLKQLVTPDIYLENAYIEYYSNKDTKTACKVLELGLKYFANNGEYINKYLEFLIFVN
                     EESQIKSLFENSIDKITNKTHLKLIFQKVISYETKFGNFNNVKSLEQRFFERFPEINQ
                     LEEFTKKYKVLDTNYLQRLELDYMVRDLVPESLAFDRNNNTALKRSIGEEQEGGAQKA
                     AAKRFRANEDPIPPEIVELLKVLPKRQYFKVAIFEPHSFADFLSDKVTIPEN"
     gene            <398809..>399738
                     /gene="SAM37"
                     /locus_tag="KLMA_60183"
                     /db_xref="GeneID:34717409"
     mRNA            <398809..>399738
                     /gene="SAM37"
                     /locus_tag="KLMA_60183"
                     /product="sorting assembly machinery 37 kDa subunit"
                     /transcript_id="XM_022820844.1"
                     /db_xref="GeneID:34717409"
     CDS             398809..399738
                     /gene="SAM37"
                     /locus_tag="KLMA_60183"
                     /codon_start=1
                     /product="sorting assembly machinery 37 kDa subunit"
                     /protein_id="XP_022677266.1"
                     /db_xref="GeneID:34717409"
                     /translation="MESKVKVLHLWGTQGQPSLVSPESIALCWMVNDSMFDSPVEVVF
                     SNNTDLSPTGELPLLIEEDGKKSTGVYTIVERLAGGSDRDAESSLLCDALLQFAADEL
                     KKCTMYQLFLNTVNYNEYTSKVYSYLLHWPFWYNTPLNGKACAQKLCQDMAISIPDDD
                     DDLDSGAKGSQNSHQDKAIEMAQSQVFKVARDNKKQQKKRLQDLKNNSRVISNLTQIL
                     THWTTARPAVDAKLIPADLLLAAHLKVQMDLPQGDIVNTHLLNNFPTLYSTVKEIQQR
                     NSDLQIPNIRDPSFTESGNVVMSTFNLIKTYTP"
     gene            complement(<399772..>400125)
                     /gene="SEN15"
                     /locus_tag="KLMA_60184"
                     /db_xref="GeneID:34717410"
     mRNA            complement(<399772..>400125)
                     /gene="SEN15"
                     /locus_tag="KLMA_60184"
                     /product="tRNA-splicing endonuclease subunit SEN15"
                     /transcript_id="XM_022820845.1"
                     /db_xref="GeneID:34717410"
     CDS             complement(399772..400125)
                     /gene="SEN15"
                     /locus_tag="KLMA_60184"
                     /codon_start=1
                     /product="tRNA-splicing endonuclease subunit SEN15"
                     /protein_id="XP_022677267.1"
                     /db_xref="GeneID:34717410"
                     /translation="MSSILCDEVYKNLLYQQLWTEVEVKRYGEVDIVCGKPSHRLTND
                     DADDEDMLLEGKEYVYPLQMHQYKGSGLTIEVLGRLFSQLPEKLKRLTLGIVNDDGTI
                     VYYFVYKGVRKPKKN"
     gene            <400405..>401580
                     /locus_tag="KLMA_60185"
                     /db_xref="GeneID:34717411"
     mRNA            <400405..>401580
                     /locus_tag="KLMA_60185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820846.1"
                     /db_xref="GeneID:34717411"
     CDS             400405..401580
                     /locus_tag="KLMA_60185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677268.1"
                     /db_xref="GeneID:34717411"
                     /translation="MLSSWVSFVLLLLFEFEFTAGYRNVINPKHKTTTSETPKPWMRT
                     VYSTKVEVVTPTVIAGVTFRAQPKPTPDPLEPWISLKKDGSPRTVRPQIKGGRTKNAS
                     PDYSTYFKTASVKTFSEEELLKMGVDTDEPYEEEVFTDEDKTYVSLNPVIRCTPDRYF
                     NKGAAKDVSSAPFCTPRENSNLKAGKTYFISWFTRFFENDEGVKEDKVRVHLSYVRQK
                     AHEKGYAKRGLEATFFSTEWLENLDGMYPLEVMEEWLQGQFERRVVIAVQPMSIPDDE
                     FDPLEHGVMVNIILGSKVFKTTKEQLTLQDQGITDEAWYYVAMIIPTVVLFSIVCMYF
                     FVQLNAKYRDFSDVRRAALNKKRRVIGKFKDMKRFKNMKNHKYEELPMHKLKSSKQS"
     gene            complement(<401888..>403374)
                     /locus_tag="KLMA_60186"
                     /db_xref="GeneID:34717412"
     mRNA            complement(join(<401888..402942,403344..>403374))
                     /locus_tag="KLMA_60186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820847.1"
                     /db_xref="GeneID:34717412"
     CDS             complement(join(401888..402942,403344..403374))
                     /locus_tag="KLMA_60186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677269.1"
                     /db_xref="GeneID:34717412"
                     /translation="MLSKKLVRQVDLRFQDTNYKTVTSMDYLSTNYGQRTARIIYSFI
                     SCIHRKINHDVSKISDEMISKVMRPMDKLKLFLLLVMLSQRGGPDYWMDKHGKSNELD
                     DEEEGEEGEEVEEGRLKGVKKKPKLFCTLLENVMRENIKKSFDESVYDENYVYSSIWA
                     NFMEGLINHYLERVIIPKSERKVCQQLYKPMMKIISLYNEYNDLIEKSESSGLMNGGE
                     SENLENKLANAQKLLWKARQDIPKTISKELTLLSDMYSTLSVDEQDYQLDQFVCCAEE
                     YIELVYLPSLIDVLFTNCGSLDFWKIMFVLEPFFYYIEDLPDETSSLDIEVLDIEDEL
                     EKEPSKPDPRVATLEKICEVAAKERWI"
     gene            complement(<403817..>405694)
                     /gene="FET3"
                     /locus_tag="KLMA_60187"
                     /db_xref="GeneID:34717413"
     mRNA            complement(<403817..>405694)
                     /gene="FET3"
                     /locus_tag="KLMA_60187"
                     /product="iron transport multicopper oxidase FET3"
                     /transcript_id="XM_022820848.1"
                     /db_xref="GeneID:34717413"
     CDS             complement(403817..405694)
                     /gene="FET3"
                     /locus_tag="KLMA_60187"
                     /codon_start=1
                     /product="iron transport multicopper oxidase FET3"
                     /protein_id="XP_022677270.1"
                     /db_xref="GeneID:34717413"
                     /translation="MVSSSSFVVALLAWVSLAQAATHTFNWTTGWGTHNVDGNKERPV
                     ITCNGEFPWPNIKVQKGDRIQVYLKNGFDDRNTSLHFHGLFQNGTSMMDGTEMITQCP
                     IAPGDTMLYNFTVDDNVGTYWYHSHTGGQYQDGMKGTLVIEDTKPYPYDYDEEVVVQL
                     AEWYHDVVDVLDKKFMSVYNPTGAEPIPQNLIINNTRNLTWEVKPDTTYLLRIVNTGG
                     FVSQYFWIEDHDLEVVEVDGIMVEKNTTSMIYITVAQRYTVLVHTKNDTSKNFAIMQK
                     FDDTMLDKIPKDLELNATSYMMYNKDADKPKENFVDSLDDFLDDYYLTPLDKVELYDD
                     PDYTLTVDVVMDNLKNGVNYAFFNNITYTAPKVPVLMTALSAGKDAVNSLVYGTNTNS
                     FVLKKDEIVEIILNNNDTGKHPFHLHGHAFQVINRDRPYDDAIGEGPTPFDPEHHAPF
                     PEYPMIRDTVYVNPQSNMVLRFKADNPGVWFFHCHIEWHLKQGLALVFVEAPEEIQKT
                     ASQQLTENHKNVCKNVGVEYVGNAAGNKDDFLNLKGENVQHKNVPKGFTKRGIVAMFF
                     TCLSGVLGLIVLSIYGLMGMGKDEEEFIKDLGLNPEVVEKVDVGEIVTDEESSEPSKH
                     N"
     gene            <407220..>408128
                     /gene="BUB2"
                     /locus_tag="KLMA_60189"
                     /db_xref="GeneID:34717414"
     mRNA            <407220..>408128
                     /gene="BUB2"
                     /locus_tag="KLMA_60189"
                     /product="mitotic check point protein BUB2"
                     /transcript_id="XM_022820849.1"
                     /db_xref="GeneID:34717414"
     CDS             407220..408128
                     /gene="BUB2"
                     /locus_tag="KLMA_60189"
                     /codon_start=1
                     /product="mitotic check point protein BUB2"
                     /protein_id="XP_022677271.1"
                     /db_xref="GeneID:34717414"
                     /translation="MSIEKFISQPPLIVHSSLSQLRYLVLSEGLSDQGHPRTRSHVWS
                     ILSRASLEKCTQDYLLLVQLGPPPANWISKIKNDTFRTLSTDEKFRAKVDESQLIRVL
                     SCFAWDVLHHNNRKTSLPQLSPYVQGMNVLLAPFLYVCPTEPIAYKLFHTICYQMIPT
                     YLNQSLSGVHVAAKLLDKCLKIIDPKLSKFLADNLLTAEIFGIPSILTLSACNKPLDQ
                     VIKLWDFMFAYGFHMNILFIVAQLVLNRQAIMVSDSPMNLLRDIPNINADEIITLGVG
                     FLAKLPDPLYKNLVDHLTDESTASRL"
     gene            complement(<408193..>409794)
                     /locus_tag="KLMA_60190"
                     /db_xref="GeneID:34717415"
     mRNA            complement(<408193..>409794)
                     /locus_tag="KLMA_60190"
                     /product="splicing factor MUD2"
                     /transcript_id="XM_022820850.1"
                     /db_xref="GeneID:34717415"
     CDS             complement(408193..409794)
                     /locus_tag="KLMA_60190"
                     /codon_start=1
                     /product="splicing factor MUD2"
                     /protein_id="XP_022677272.1"
                     /db_xref="GeneID:34717415"
                     /translation="MSGEDYMAALRNKILAEVGTTKGESKGGDAGKDARQGSQVGGSN
                     GGGNSSSNWGRSNSTSSSSSRFNDTRRGNYGGENRKQDSRRGPVPTGPSSGRQSRFQW
                     NSGGNNNNNTSSGSSNGSRFQPNRRPEKKPVHSRNNNGQDGSSVPPWSRPSGDMNANG
                     NVNSSNNNRSRFDRSRGRTFHRQSPSPDQAFADANRRRNASNRVTAVHSEESVFANVT
                     DVRFNKMVIISPMTPGFSEHVVVGSTIKKFVESLDYDVGATENKVENVSVEKNRIIIE
                     FNKVSLVPIVLACQKHLETILSSQFIWQRPSSYIVDTSNKDPILSENVHALMKLEPEC
                     EDESSTRQWLIDEKIEYTWIHFLKLKSGSNGDGNGNDAGNWVKALLYLPKSEDQVKLP
                     MTIRPNHGTRRQDFKQITFENFATIAKSYEKKPSKVVCILNCVDPMDLKNENFVTEIK
                     EAMMYGTPIQKCGEVESVQVPLPNPDFRNDIKHIHSSIGKVFIKFKDLVSAERAMILL
                     PGTQFCQRTILCTYYSEVDYDMGIL"
     gene            <410277..>412928
                     /gene="LHS1"
                     /locus_tag="KLMA_60191"
                     /db_xref="GeneID:34717416"
     mRNA            <410277..>412928
                     /gene="LHS1"
                     /locus_tag="KLMA_60191"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820852.1"
                     /db_xref="GeneID:34717416"
     CDS             410277..412928
                     /gene="LHS1"
                     /locus_tag="KLMA_60191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677273.1"
                     /db_xref="GeneID:34717416"
                     /translation="MRIIVLFLAFLQCFSGCLAAVVGLDFGTHYAKEMVVSLKAPLEI
                     VLNPESKRKDASALAIRPWADQDYLERYYGTSAMSLAARFPSMTFMHLKSLLGKHYED
                     NLFHYHKEHPGLHFVKDGSRNSIAFPIGDGESTLSVEELVGMSLRQYVERANHLLAEN
                     HDSDSVRSVSFAIPEYFNQAQRLSLLDAARLAKIRQPYLVNDAIAVAIDYASKKRSFE
                     PGKKHHYVIYDMGAGSTTASLVSILQPEDTSLPLNIEFLGYGHTEALSGSTLTLAIYD
                     ILENQFLQAHPEIRTHQFESDHSAKTRLVQAAEKAKLMLSANSEAPVSVESLFNDLDF
                     KTTVTRAAFEEYVADSRSLVIEPIFTALKTSFENDGQTEKLTVKDLDSVILTGGSTRV
                     PFVKEQLEEHFGSSLISKNVNSDESAVHGAAIRGVQLSAEFKTKPMNITDRTTHAFAV
                     TVQGTNEQQVVFNAGSVYPKTTTLQLPGSGSGSDSKTNTLHLELLEDEKAFKNIDIQV
                     DSKIQVAKLNNCSSEVNYNVTLSLDSNQIFDVDEVVAWCSAPKVQESNENKDNDTDSS
                     AATLPTEVVVKQVIPFTAEYTNVKPLTEEEKLERLNKLNKWDQKDKIRLERQRLLNDL
                     ESSLYAARELLDDASELEHPPNNYIKQLESIIEEYLETLNEPSAIKTKDIKDMKQNLA
                     KRQEKLETYIKYSNEALDDKQFEQLLKQGDALLEKITSIEKKKVEDLFPLAEKFESLG
                     LNVTSEYFRVKPPKSKVVPESLVDKVVDKLHSQLEQIKELLDGELSEYSREELLDNKL
                     NLDVIYTEVEKIINRITAEHKYRLKLLQSVYERRLLASKQAEEHVDEPQNIKPEDTHS
                     NKNSTDDTREEKEKKGSEQVEFEQDEL"
     gene            complement(<413028..>415640)
                     /gene="STV1"
                     /locus_tag="KLMA_60192"
                     /db_xref="GeneID:34717417"
     mRNA            complement(<413028..>415640)
                     /gene="STV1"
                     /locus_tag="KLMA_60192"
                     /product="v-type proton ATPase subunit a"
                     /transcript_id="XM_022820853.1"
                     /db_xref="GeneID:34717417"
     CDS             complement(413028..415640)
                     /gene="STV1"
                     /locus_tag="KLMA_60192"
                     /codon_start=1
                     /product="v-type proton ATPase subunit a"
                     /protein_id="XP_022677274.1"
                     /db_xref="GeneID:34717417"
                     /translation="MSASGYSELEPSGMPEEAIFRSADMTYVELYIPSEVSREIVCIL
                     GNLGAIMLKDMNSGVSAFQRSHVDQIRRYDEVDRLVQYLVSVSNRHADATWKYTYHPV
                     NGDDLLGANLETSTKNILRSLDRLTIESVDDMCDEIAQFETRVRQLDESLINLKQRLN
                     RLIEERHVVFETGRFLEVNPGIGGRVRPSVDQEASQLLDQVSDFSFELDDPEDSGRNS
                     SVEIAYHNKFMLTGSINRSKVATLNKILWRILRGNLFFHNIPIEEPLLEGDDMVEKDC
                     FIIFTHGEVLLNKVRKVVESLNGHIFPIETEHRAIQNLNDKISDLEQICNTTEQTLHT
                     ELLIVNDQLPTWNVMVKREKYLYATLNLFRQESQAVVAEGWVPTSELDAVRNALKDFG
                     EVSASASTAVLNVISTNKSPPTYHRTNKFTEAFQNIVDAYGVATYKEVNPGLATIVTF
                     PFMFAIMFGDLGHGFILMLCGLILVLREKKISQMKRGEIFDMAFSGRYVILLMGLFSI
                     YTGLLYNDVFSLSMTLFKSGWKWPSDFKEGDLIEAKQVGVYKFGLDYAWHGTDNALLF
                     SNSYKMKLSVLMGFIHMTYSFMFSLVNYRYKNSRIDIIGNFIPGLIFMQSIFGYLSWA
                     IVYKWSKDWIKDGKPAPGLLNMLINMFLSPGVVEEQLYRGQSFLQVILLLAALVCVPA
                     LLFYKPLMLKRQNQEAISKGYSDIHDQEIHERLQEAQESSEDNMIVADYSKEGEHSSF
                     NFGDIMIHQIIHTIEFCLNCISHTASYLRLWALSLAHAQLSTVLWTMTIANSFSSKDS
                     GSPLAVAKVVFLFGMWFVLTVAILVLMEGTSAMLHSLRLHWVEAMSKFFEGEGYAFEP
                     FSFDVVEKQIESDE"
     gene            <416044..>418245
                     /gene="STB2"
                     /locus_tag="KLMA_60193"
                     /db_xref="GeneID:34717418"
     mRNA            <416044..>418245
                     /gene="STB2"
                     /locus_tag="KLMA_60193"
                     /product="protein STB2"
                     /transcript_id="XM_022820854.1"
                     /db_xref="GeneID:34717418"
     CDS             416044..418245
                     /gene="STB2"
                     /locus_tag="KLMA_60193"
                     /codon_start=1
                     /product="protein STB2"
                     /protein_id="XP_022677275.1"
                     /db_xref="GeneID:34717418"
                     /translation="MSGNSHKNKVEHGRGKTNKQVLKTCKFLFPDYMGMFDLGILKHE
                     ELRYCEYMAKGLELYIVEQWVSGRKFSNVITSFTGNSSEVIYGILVRLPVDVQYWPKD
                     FKEYHDKIIDFSSVKEMDDGTRLYVTNLSFFPSTLNLLHVKNGSMKDSWQLFQVNFNL
                     KRLGCGSRSGNLLGEPSITSLEKFAQIYKMTTKDPEELLKNLIELVRVIQISLTYFRL
                     LDSKFKDGTFCQHTVNAIHEWWVSYGKLYLGIDRPKNEGVLGPTTVAGIISFVLTCYF
                     KFIVEDCISFKDPFIESSFYAGIYNFQKKHNLPKTSYLDMETMTKLFKVTSKVNGTDI
                     FKLKRRLKSTVQDIARKTNPIQLANEILTTDLDWLIENVQGGYLGLFWSKKRQFKVSL
                     QGTRFYDLDYNHGDPFKEDDEYLSILTNEADTTANDDESKEKHAEEQSDIEEDTPEAK
                     WSTKEHVDSEIYYCNNQGFRNELYRRATLPQISKDKNIFQTDHKSVAPTSSDDEQQPR
                     ILGGINETTNRRRYSFSDIQETMEIWTIPFQVSPVRLARDILHIEIALRQYDAAEEEE
                     EEEDDDDEQGCCKKNKEDCVKEASGMLDTCKRDCEALKDKDKELHFKRTAVEAELKEL
                     NSLEAKFNYDLRILDTRMRDVEQNLSQFGNRLNTLEEGLKLKSNQFKALIETDIISSA
                     LELDKYAFEFLENEQVWNEGVFLRSLRLYIWPIVKMSWDQAMGWWKPTANM"
     gene            complement(<418280..>418909)
                     /gene="FAR3"
                     /locus_tag="KLMA_60194"
                     /db_xref="GeneID:34717419"
     mRNA            complement(<418280..>418909)
                     /gene="FAR3"
                     /locus_tag="KLMA_60194"
                     /product="factor arrest protein 3"
                     /transcript_id="XM_022820855.1"
                     /db_xref="GeneID:34717419"
     CDS             complement(418280..418909)
                     /gene="FAR3"
                     /locus_tag="KLMA_60194"
                     /codon_start=1
                     /product="factor arrest protein 3"
                     /protein_id="XP_022677276.1"
                     /db_xref="GeneID:34717419"
                     /translation="MEGSGDSFEYLLQLTKTLSSQAWSARQQTDKVEQSLKRLAKQHY
                     IPYKEYSKPPTAEALDEFAQIKAKSPEELIVEENYRLMYQIQQQEYIHSKVCLLVQQI
                     NEMIVSIRDFIVEYKATAPHKHQEFVAANVANPVQSLSSAQTALEKGHNVANKKVAML
                     IEELVLACKNVPWNKIEKDDLAYQRFKSLVKDFEDKYNIQLVSESLLLT"
     gene            419103..419213
                     /locus_tag="KLMA_R607"
                     /db_xref="GeneID:34718766"
     tRNA            join(419103..419137,419175..419213)
                     /locus_tag="KLMA_R607"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718766"
     gene            complement(<419408..>420019)
                     /locus_tag="KLMA_60195"
                     /db_xref="GeneID:34717420"
     mRNA            complement(<419408..>420019)
                     /locus_tag="KLMA_60195"
                     /product="tRNA-binding domain-containing protein"
                     /transcript_id="XM_022820856.1"
                     /db_xref="GeneID:34717420"
     CDS             complement(419408..420019)
                     /locus_tag="KLMA_60195"
                     /codon_start=1
                     /product="tRNA-binding domain-containing protein"
                     /protein_id="XP_022677277.1"
                     /db_xref="GeneID:34717420"
                     /translation="MSCFRFFRSMSSEAKVVAKAKAKSAAGFSLLNLKVGRFVRVEAH
                     PNSDKMYVSQVQLAGDSVKQICSGLREHIAPEFLEGKLCVVVDNMKKCKLRGEFSEAM
                     VLCGEHAEPSGGKTRVELVSPEKESLELVGRQVVIDAEAEDATDRKIKPREWEAVSSC
                     LQVDGSRGVVYMDEGKAKPLFVKVGDEKVRVTVATLPEGSNVR"
     gene            <420671..>421501
                     /gene="RSR1"
                     /locus_tag="KLMA_60196"
                     /db_xref="GeneID:34717421"
     mRNA            <420671..>421501
                     /gene="RSR1"
                     /locus_tag="KLMA_60196"
                     /product="ras-related protein RSR1"
                     /transcript_id="XM_022820857.1"
                     /db_xref="GeneID:34717421"
     CDS             420671..421501
                     /gene="RSR1"
                     /locus_tag="KLMA_60196"
                     /codon_start=1
                     /product="ras-related protein RSR1"
                     /protein_id="XP_022677278.1"
                     /db_xref="GeneID:34717421"
                     /translation="MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDSYDPTIEDSYRKTM
                     EIDNKVFDLEILDTAGVAQFTAMRELYIKSGMGFLLVYSVSDRQSLNELLELREQVLR
                     IKDSDRVPIVLVGNKADLQEERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVD
                     LVRQIIRNELESASSSGAGAQSRNFSQAQRTIQQGGGISDGSNGNGDAGERPDEGLGV
                     GMNSGVGGGGAPLKKNDIAGPSQVPRQAGARNARPMESDRRGKKNKKNKKKSKSCVIL
                     "
     gene            <421575..>422558
                     /gene="RRP1"
                     /locus_tag="KLMA_60197"
                     /db_xref="GeneID:34717422"
     mRNA            <421575..>422558
                     /gene="RRP1"
                     /locus_tag="KLMA_60197"
                     /product="ribosomal RNA-processing protein 1"
                     /transcript_id="XM_022820858.1"
                     /db_xref="GeneID:34717422"
     CDS             421575..422558
                     /gene="RRP1"
                     /locus_tag="KLMA_60197"
                     /codon_start=1
                     /product="ribosomal RNA-processing protein 1"
                     /protein_id="XP_022677279.1"
                     /db_xref="GeneID:34717422"
                     /translation="MVLILDLITPFITAGTAKKKKKKKTHCNEKFGTFQSDEMGHLIS
                     SHLLQQNHQKDPPKHPTNIMEHALVKQLAGHKQETREQALESVRKYLTTKNFSNAKQS
                     QFDKLWKGLYYAMWHCDKPIPQQRLAQSLGELHLLYARTRQHVAFVRFSKAFWKVMCI
                     EWYRIDHHRLDKFLLLARRCLHFQLKYLAECDWEESVVDDYISKVLKKIPLSGDRKVY
                     NGIPFHIIDILLDEWVKVCYGEPEEEEDDDDEEKRNAQIKEAVSKTPLVKFIAIFQDL
                     SSNTDNIKILRDKIKEDLLKDERLREWDVLQPESTAQDDETYHEDDEWHGF"
     gene            <422793..>423005
                     /locus_tag="KLMA_60198"
                     /db_xref="GeneID:34717423"
     mRNA            <422793..>423005
                     /locus_tag="KLMA_60198"
                     /product="protein transport protein SSS1"
                     /transcript_id="XM_022820859.1"
                     /db_xref="GeneID:34717423"
     CDS             422793..423005
                     /locus_tag="KLMA_60198"
                     /codon_start=1
                     /product="protein transport protein SSS1"
                     /protein_id="XP_022677280.1"
                     /db_xref="GeneID:34717423"
                     /translation="MAKQNAQFEKLVEAPLEFVKDGNQFLQKCKKPTKKEYLKIVQAV
                     GIGFVAVGVIGYAIKLIHIPIRYLIV"
     gene            <423301..>423810
                     /gene="BUR6"
                     /locus_tag="KLMA_60199"
                     /db_xref="GeneID:34717424"
     mRNA            <423301..>423810
                     /gene="BUR6"
                     /locus_tag="KLMA_60199"
                     /product="H2A super family protein"
                     /transcript_id="XM_022820860.1"
                     /db_xref="GeneID:34717424"
     CDS             423301..423810
                     /gene="BUR6"
                     /locus_tag="KLMA_60199"
                     /codon_start=1
                     /product="H2A super family protein"
                     /protein_id="XP_022677281.1"
                     /db_xref="GeneID:34717424"
                     /translation="MELGQARAGEAIVKGLESSPGQRQEDLAMSEYETGGSSDERASS
                     LTPGGAVTEAASAAAATAPPVVEAASSSAQVFSKIKTHFPPAKIKKIMQTDEDIGKVS
                     QATPVITGRSLEFFIALLVDKSSKVARDQGSKRISADIMKKTILTDEKFDFLREVILP
                     QEQEQEQAP"
     gene            <425394..>427058
                     /locus_tag="KLMA_60200"
                     /db_xref="GeneID:34717425"
     mRNA            <425394..>427058
                     /locus_tag="KLMA_60200"
                     /product="SSF super family protein"
                     /transcript_id="XM_022820861.1"
                     /db_xref="GeneID:34717425"
     CDS             425394..427058
                     /locus_tag="KLMA_60200"
                     /codon_start=1
                     /product="SSF super family protein"
                     /protein_id="XP_022677282.1"
                     /db_xref="GeneID:34717425"
                     /translation="MGHLSDPAAHGIVWPTYIVLLVSALAIAYWKRMDKKESFLSANG
                     TQKALPLAFNFVASGLGCGVLSAYPQIANIDGLQGLLVYALSGGLPMFIFAFFGPLIK
                     KKCPNGFVLTEWVIKRYGMIAGWYLSVCTIITVFLFMVSEVSSLKYAIENLSSIKALP
                     VIIIECVVTTIYTTVGGFHISFLTDTIQVTIVFVLLVIVACAMGSYVHIDTSEIAKSG
                     LLKDSLLGWQLVYILPVAVFTNDFFMSGFWLRTFAARSDKDLLIGCSIAAFILVAFVT
                     VIGVTGMVAVWAGYMGVADEDNSGAAFFIVLSQLPSWVMGFVLAFVVILSTCTMDSLQ
                     SALVSTISNDIFRNRLPIMYVRGLVVLIMIPVVVVGLAADDVLTIYLIVDLLSSTVVP
                     VLMLGLSSHFDFLSAWEIIGGGLGGLIAVFIFGCVYYGDAKEGGRLLLIWNGLYVNDW
                     SAFGAFVAAPFGGLISAGIILAIRTCFMYFYCKKYNKPFDMYSKKFVYQDQAEVSSDA
                     AVADKKSVSTAEQELDADSQQETAPTSGYKYYYYRTKAFLDDLARG"
     gene            <427801..>429807
                     /locus_tag="KLMA_60202"
                     /db_xref="GeneID:34717426"
     mRNA            <427801..>429807
                     /locus_tag="KLMA_60202"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820863.1"
                     /db_xref="GeneID:34717426"
     CDS             427801..429807
                     /locus_tag="KLMA_60202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677283.1"
                     /db_xref="GeneID:34717426"
                     /translation="MDDQTSLRSVQHGQGNSRGNGNGLPRSTSTNDLFSFPSYGQKRF
                     TVGKDSGAHLHKSMSITNLDLIPEHKTNHRMTPYQIQRTHMKQSFQFPNGENFTPRKR
                     LPKSASCVSLDKNRYETSVSPGSMGMGMGMGPGDGRKMPRSSSMVSVSLPQSSGKIRQ
                     NNKYRPSNRSTSELVDSWTPLAKPQAKPQAKPVAKAPVKAPTTSTPVVVPQPQFHAPL
                     TASTLYASKLQERNSQLSINSLSQRQTTSSNESQSTDTSLKETCDPGSATSTDLSDED
                     LTKKFLAIRQKKSLSPEAQNNSNPSGDRTTSALNSGSAMPEIVPLGSSTSTIAQLKPS
                     SQDSDSILQNYTSSSSKVTPVKRSGSRLGSFFKRLLPSKKKAKKDESPQKTIPSHNLM
                     ASTIITPPQTSSSSKSFPSQSDTSGILLPDTEDDVDDERLQGLMDIDLVFDSILLKSE
                     QRPQHVVDNALIKQFNRSIKVSSPPTSTTSITNTTVITSSGNTNAANNTTTTTSATSA
                     TTATTTTTDSSTETVQPPKRSSRRPMMRRDSQGRIIHSSANYKRLSPDSRIMEHLRQN
                     WKAVHDDSVIPSTTANRNKESSTASSSSSSSLMKKCRFNDEIYVKDTFSALEYARSDK
                     GFLENRRQLLKSRFIDGIKMELNEFKKREMLVHPNSTQYTHFFL"
     gene            <430349..>430936
                     /gene="TVP23"
                     /locus_tag="KLMA_60203"
                     /db_xref="GeneID:34717427"
     mRNA            <430349..>430936
                     /gene="TVP23"
                     /locus_tag="KLMA_60203"
                     /product="Golgi apparatus membrane protein TVP23"
                     /transcript_id="XM_022820864.1"
                     /db_xref="GeneID:34717427"
     CDS             430349..430936
                     /gene="TVP23"
                     /locus_tag="KLMA_60203"
                     /codon_start=1
                     /product="Golgi apparatus membrane protein TVP23"
                     /protein_id="XP_022677284.1"
                     /db_xref="GeneID:34717427"
                     /translation="MESIQNFYQTILASSHPLILSVHLLGKAVPIVLYLLGSWFLSTT
                     VQFILVILALAADFYFTKNINGRKLIQERWWYDVTGEDTSTFRFESYKEYPDVQAPPI
                     NPIDSRLFWLALYLAPVIWVVFGFVCLIKFQFVYLILVIFAGGLSIWNAYAYRLCDGW
                     EPGKTSEAPLFQLPMLPSFANLDRVSRLQSFFTRT"
     gene            complement(<431089..>432261)
                     /gene="RRP8"
                     /locus_tag="KLMA_60204"
                     /db_xref="GeneID:34717428"
     mRNA            complement(<431089..>432261)
                     /gene="RRP8"
                     /locus_tag="KLMA_60204"
                     /product="ribosomal RNA-processing protein 8"
                     /transcript_id="XM_022820865.1"
                     /db_xref="GeneID:34717428"
     CDS             complement(431089..432261)
                     /gene="RRP8"
                     /locus_tag="KLMA_60204"
                     /codon_start=1
                     /product="ribosomal RNA-processing protein 8"
                     /protein_id="XP_022677285.1"
                     /db_xref="GeneID:34717428"
                     /translation="MALFKVEGWNIDSKEIRFDAARKDGKVKKSRKERKEYQQKLAEQ
                     RRNGGASEVAEKNKEEEKADFEVEDDGETETPAEEKKPVEKKQKKRKAEEVESTSQAV
                     TTTKKPLTALQQKMLAKLTGSRFRWINEQLYTISSDEALKLIKEQPQLFDEYHDGFRS
                     QVQSWPENPVDVFVEQIRFRANKPVNAPGGLPGLKDKTIVVADMGCGEAQLALDINNF
                     FKDYNKKAKKFNKRSCKVHSFDLKKANERVTVADIKNVPLADESCTIVVFCLALMGTN
                     FLDFVNEAYRILAPRGELWIAEIKSRFADGKGEEFVNALKLQGFFHKNTDDSNKMFTR
                     FEFFKPPQDIIEERKAKLERRQKFIEVETEKEELQKKRQKVPEGKWLLKPCIYKRR"
     gene            complement(<432623..>433873)
                     /locus_tag="KLMA_60205"
                     /db_xref="GeneID:34717429"
     mRNA            complement(<432623..>433873)
                     /locus_tag="KLMA_60205"
                     /product="conserved hypothetical phospatase and actin
                     regulator 2"
                     /transcript_id="XM_022820866.1"
                     /db_xref="GeneID:34717429"
     CDS             complement(432623..433873)
                     /locus_tag="KLMA_60205"
                     /codon_start=1
                     /product="conserved hypothetical phospatase and actin
                     regulator 2"
                     /protein_id="XP_022677286.1"
                     /db_xref="GeneID:34717429"
                     /translation="MEEHVIGYQETKNGVRYAIYSALVLTKSQWYDRPVALMADKLLE
                     HITVSRKWNQNPYVRLGTTSDLFLYHNHPLTSIRLCGLVMGWKWKLIGQEERAFWSLD
                     DCSSTILCQCSKSQLLALNLPSMDLSGWTIIVTGKLLQDRFEFKVSNIEVVLSLQQEI
                     AFWNLAFTNQKLLEQPWDVGESEISITPRRSREAFDDANNTNYIQQLQTLHFQENELL
                     LASPYTEADVSGLGAWNSDLLNSTLEHDLEDHQNQSSGNLSSKTIRQSTLAYLIEKSM
                     DEDECTIHEIANHVGVLVASASLQHYLNQLEDSEIVSQDDGVLELKNLQHCYRYIMFR
                     FQSLINVQIPHIKIKYEQIKQFCNLHKLPNKLILDICKYFFNNTHIGNLINWWIEPVS
                     EQSFQVHFTYASDPDPNHEGLRSA"
     gene            <434151..>434588
                     /locus_tag="KLMA_60206"
                     /db_xref="GeneID:34717430"
     mRNA            <434151..>434588
                     /locus_tag="KLMA_60206"
                     /product="probable 5-hydroxyisourate hydrolase"
                     /transcript_id="XM_022820867.1"
                     /db_xref="GeneID:34717430"
     CDS             434151..434588
                     /locus_tag="KLMA_60206"
                     /codon_start=1
                     /product="probable 5-hydroxyisourate hydrolase"
                     /protein_id="XP_022677287.1"
                     /db_xref="GeneID:34717430"
                     /translation="MPSPLTCHILDTVSGKPATNVVCAVYKLDLENDTNNAIIKGETQ
                     VALAKTNDDGRVTEWVFEPSPAMRSELRNLGILEKTPGKLEWDTLQKGFYKIRFHTGS
                     YFKQKNAKSFFPFVDIVFEVSDARHYHIPLLLSSYGYTTYRGS"
     gene            434808..434880
                     /locus_tag="KLMA_R608"
                     /db_xref="GeneID:34718767"
     tRNA            434808..434880
                     /locus_tag="KLMA_R608"
                     /product="tRNA-Met"
                     /db_xref="GeneID:34718767"
     gene            complement(<435108..>438125)
                     /gene="IOC3"
                     /locus_tag="KLMA_60207"
                     /db_xref="GeneID:34717431"
     mRNA            complement(<435108..>438125)
                     /gene="IOC3"
                     /locus_tag="KLMA_60207"
                     /product="ISWI one complex protein 3"
                     /transcript_id="XM_022820868.1"
                     /db_xref="GeneID:34717431"
     CDS             complement(435108..438125)
                     /gene="IOC3"
                     /locus_tag="KLMA_60207"
                     /codon_start=1
                     /product="ISWI one complex protein 3"
                     /protein_id="XP_022677288.1"
                     /db_xref="GeneID:34717431"
                     /translation="MELEEKEAKSGSDSIQQASVEQQQQQQQQQSGSEEVGVKKYGQM
                     SIVDFKNVKVHSPETSSGKSNGGIAEPISRRRSSRVVVKRKDDSDEEPEHSRKKRAYN
                     RKVVVKEDKSKKKSKAKKKTGESKAGVKDKDKSKENDKNKEMEKDNASSKKRTTTSKP
                     KASAGAKTGAKENAKENAKEDSKVKATGGASAPASKSSTPKKSSDTAKKNSPKPSGST
                     EKKKDGKVSPEEALKKSKTASKPAPSLSLAVNPILLENWAPQVPLSSSDFKTQNSVLS
                     RLKFPHMKKVHYAKDLIYVLSFINKFHKFLPKDLWPLSIQDLEIGLDVYAENMDEEQI
                     QQQYYADYISAKEIRRCQDHANLLYVILMELTLNRKSYSTLQTLQTSIKPYKSIIELR
                     QKSVEFGYPKEWKVASTLTAERTKVFEKDDVEPVDPSHPEILTPNVYKWQEQLIVPIE
                     EDPMHNPDLERLGLLALQPADRVVLLRTLTQWCISYSEKIHAEVYRLSHLRKDPSFGI
                     QTYQAPRHLVYGIDATKQHFKKLCTLVKERMELRRSKKHVKKHLENGTRQDLLAKFDL
                     LDQLKKKMVEYKQEHMQTTTDKKQKFDPLDVSIERDYEQWSKLVFEETHDNGPMDNPY
                     EDEIYKLRCLEFFIGRVPYIGDFYLPRLLTYQSPKSKYDIPTNYCDPITLLKTLRDFE
                     NGVITPFELFGKGGKLNSMQFKLYYHDTPAMIHDLLNNKSNDSSCYWYEMCHDSESLQ
                     DFIKLLEFKIYKEEDPNKSKKTATATNTAAANPNPVSSEQPSNDTATEPSAEKQDSNN
                     VTESPQPESKKETPISNTTKPPAKLEPIEGFNCNPLPKEYKYNKSRSKLLILKEYLQK
                     MASLLRTFEQLKAEYGDMSITDRNLRRSQRTKINYNERRQIYDDEEEEEEEEDNEAEH
                     MEIEPTPENVDDYDDPEELAASEHEDFTKNDDDHSDNYEDDEEEVEEEYEIESEVEEE
                     PVKKRRGRPPKKKRGRPPKNPSKVVKTKKRRTK"
     gene            <439227..>440849
                     /gene="VCX1"
                     /locus_tag="KLMA_60208"
                     /db_xref="GeneID:34717432"
     mRNA            <439227..>440849
                     /gene="VCX1"
                     /locus_tag="KLMA_60208"
                     /product="vacuolar calcium ion transporter"
                     /transcript_id="XM_022820869.1"
                     /db_xref="GeneID:34717432"
     CDS             439227..440849
                     /gene="VCX1"
                     /locus_tag="KLMA_60208"
                     /codon_start=1
                     /product="vacuolar calcium ion transporter"
                     /protein_id="XP_022677289.1"
                     /db_xref="GeneID:34717432"
                     /translation="MNEAEELKSLASGLSEASIIQRPHLEDDKEEIDPNDNGNGKHHI
                     TISPTNTTGNCVPSRRSPMRTLTTPGKYQQELALPERYLERKPTVEVEAKGFYYFVSF
                     MKQLRITLFDGTLNKLDAFYTNMWSWPVFKNMMTFYQEHKDTKGLGTCLQVLRCCVET
                     RTLVFLFLFPAGIVCYKQDKDVGSVICNLLALMYFAKLLSNATEYASEHFGPVFGALL
                     NATFGNLVELVISGTTVSKDDAVLTITSLIGSVLSNNMLVCGTCFFFGGLDGMQMHAK
                     NAIANHMLFLSCITLALSLTSVIAVIDSGKSLKFKENTSQIGATLIFVCYIVYLIASA
                     NQEFKTLSNEKSKEEERLLADTESSASDSQLQSLHTAEPGEEEEEEETKNLPPKLVCF
                     ITLAIATAGLGPTGNFFVESLKRLTDDKPISKVFIGLIVLPLAGSLPEHISSLIAAYH
                     GGMDLSVSLAVGSSNQILGMVLPIIQFISSRYPKTGFTLYFEPYVAGYLFVSTFVCCF
                     TLIHGLLFSVNVLHGTLLLVTYGIIVYLTFAN"
     gene            <441390..>446372
                     /gene="RPA190"
                     /locus_tag="KLMA_60209"
                     /db_xref="GeneID:34717433"
     mRNA            <441390..>446372
                     /gene="RPA190"
                     /locus_tag="KLMA_60209"
                     /product="DNA-directed RNA polymerase I subunit RPA1"
                     /transcript_id="XM_022820870.1"
                     /db_xref="GeneID:34717433"
     CDS             441390..446372
                     /gene="RPA190"
                     /locus_tag="KLMA_60209"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I subunit RPA1"
                     /protein_id="XP_022677290.1"
                     /db_xref="GeneID:34717433"
                     /translation="MDISKPVGAEITSIDFSVLASDEIRNLSAKQVTNPTVLDNLGHP
                     IQGGLYDLALGAFLKNLCTTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSC
                     LFCHHFRLKSSEVHLYACKLRLLQYGLIDERYQIDNIRLNQMVDVDEAEEGEEESYSD
                     NKTKNSSGTQHLLKELRIKRNEFVEMSIAKALSDGRTTEHGTFTATVNDERKALIHDF
                     HKRLLSRPKCDNCSMFSPKFRKDGFTKIFETALTEKQLTNNRVKGLVRADMIKKKMQM
                     KKLQTNGDSSSKGDNDEEEEEEFGTARSSINLKPKTGSTYILSTEVRNILRAVFRNEQ
                     EVLQYVFYSRPNHSNKKVTADMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQLLSKIL
                     TTSLLIRDLNDEMSRLQKDKVSADDRKVIFNRLMNAFVTIQNDVNAFIDSTKAQSGSG
                     NKVPIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLT
                     YPEPVTSYNAAELRQAVINGPDKWPGATQIQNEDGSFVSLVGMSLEQRKALANQLLTP
                     STHDVAHSINKKVYRHIKNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTG
                     AYNADFDGDEMNMHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWL
                     TNKDSFFTREQYQQYVYGCIRPEDGHATRNKLVTIPPAVMKPVPLWTGKQIITTVLLN
                     TCPADMPGINLSSKNKIKNDYWGKSSEENNVIFKDGQLLCGILDKSQYGASKFGIVHS
                     LHEVYGPEIAAKILSVLGRLFTNYISSTAFTCGMDDLRLTDEGNKWRKDILKKSVDIG
                     RVAAAEVTNLDKDVTSNDPELLKRLEEILRDDNKLGILDAITSSKVNAITSQVVSKCV
                     PDGTMKKFPYNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFK
                     PFETDARAGGYIKGRFYSGIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLE
                     GVHISYDNSVRDGDGTLIQFLYGGDAVDITKESHMTEFKFCVDNYDALLKKYNPSALV
                     DHLDVESALKYSKKALKNRKKNAKLPHYAQTPKYDPVLSKFNPAKYLGAVSENFQDKL
                     ESFINSNDELFKKDASVNEKKFRALMQLKYMRSLINPGEAVGIIASQSIGEPSTQMTL
                     NTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTMPIRDDVSDELADTFCKNITK
                     VMLSEVIDKVQVTETIGSQDSSSASSRSYVININFFDAAEYLEEYDVSKEELQSVISG
                     KFIKSLEAAIVKEIKKQKKTSLPDIGTALPKSQTALAGDERVVDIEEDNDEEQSRKKS
                     KESVSYDEPDDDELETMRQAEQTSDEEMNSDSEAESESDSESDSDEDLKKERNAKDMT
                     KEQRDRQSALISSTRFVTKYNFDDKHGRWCEFKLELSADTEKLLMVNIVEDICKKSII
                     RQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQDDFIDVNGIRSNDVAAVLKTYGVE
                     AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGNYLAFNRQGMESSTSSLMKMS
                     YETTCQFLTKAVLDNEHEELKSPSAKIVMGKLNGVGTGSFDILSKVPNVK"
     gene            complement(<446551..>449523)
                     /gene="FUN12"
                     /locus_tag="KLMA_60210"
                     /db_xref="GeneID:34717434"
     mRNA            complement(<446551..>449523)
                     /gene="FUN12"
                     /locus_tag="KLMA_60210"
                     /product="eukaryotic translation initiation factor 5B"
                     /transcript_id="XM_022820871.1"
                     /db_xref="GeneID:34717434"
     CDS             complement(446551..449523)
                     /gene="FUN12"
                     /locus_tag="KLMA_60210"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 5B"
                     /protein_id="XP_022677291.1"
                     /db_xref="GeneID:34717434"
                     /translation="MAKKSKKNQQNYWDEEYEQDAPQETTPAPEESPAVEGSVEPSEA
                     SASVEPEVADASAIEEDFMSTLKKSKKKLTKKEEEDAKKPILKSKKEKEKEKKELEKQ
                     KKKEQAAKKKAQQQAQKEANKKLHAEQSTKLKAEKEATKAPSSGSQPKAAPKKKVPAG
                     LAALKRQLELQKQLEEEERLAREEEERLEKEEEERLAREEQEKEEARRLKREKEQAKR
                     EKLKAEGKLLTKKQKEEKKLLEKRRAALLAAGNIKVAGLEKASGEQQKPKKVVYGKRV
                     RKSKEQIEAEKAAEEEKKRAEEAKKSGAAEEDEDEEALVDDWENLALDEDEGEEETEA
                     NAENGDNEESDGTSTAQPSTSATPAPESSSEVVKNYAPETKTFKKSAAAAAATKKDLR
                     SPICCILGHVDTGKTKLLDKIRQTNVQGGEAGGITQQIGATYFPIEAIEQKTAVMAKY
                     EEQTFDVPGLLVIDTPGHESFTNLRSRGSSLCNIAILVIDIMHGLEQQTLESIRLLRD
                     RKAPFIVALNKIDRLYDWKTTPNNSFRDSFEKQDRAVKQEFQTRLDNIKVALAEQGLN
                     SELYFQNKNLAKYVSIVPTSAVTGEGVPDLLWLLLELTQKRMSKQLKYLSHVEATILE
                     VKVVEGFGTTIDVILSNGYLREGDRIVLCGLNGPIVTNIRALLTPQPLRELRLKSEYQ
                     HHKEVKAALGVKIAANDLEKAVSGSRLLVVGPDDDEEDLMDDVMEDLTGLLDSVDTSG
                     KGVVVQASTLGSLEALLDFLKDMRIPVMSVGLGPVYKRDVMKACTMLEKAPELAVMLC
                     FDVKVDKEAEQYASEQNIKIFNADIIYHLFDAFTAYQKDLLEKRRAEFMGDAIFPCVL
                     NTLQIINKRGPMIIGVDVIEGSLRIGTPICAVKYDPTTKERTPLLLGKVVSLEINHQA
                     VTEVKKGQTNAGVAMRLEDPSGQQPIWGRHVDEKDTLYSYITRRSIDTLKDPAFRDQV
                     PKSDWMLLRKLKPVFNIE"
     gene            <450157..>451266
                     /gene="RBG1"
                     /locus_tag="KLMA_60212"
                     /db_xref="GeneID:34717435"
     mRNA            <450157..>451266
                     /gene="RBG1"
                     /locus_tag="KLMA_60212"
                     /product="GTP-binding protein RBG1"
                     /transcript_id="XM_022820872.1"
                     /db_xref="GeneID:34717435"
     CDS             450157..451266
                     /gene="RBG1"
                     /locus_tag="KLMA_60212"
                     /codon_start=1
                     /product="GTP-binding protein RBG1"
                     /protein_id="XP_022677292.1"
                     /db_xref="GeneID:34717435"
                     /translation="MSTTVEKIKAIEEEMARTQKNKATSFHLGQLKAKLAKLRREILQ
                     AASSGSGGGAGVGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVT
                     VPGVIRYKGAKIQMLDLPGIIDGAKDGRGRGKQVIAVARTCNLLFIVLDVNKPLHHKQ
                     IIEKELEGVGIRLNKQPPDILIKKKEKGGISITNTVPLTHLGHDEIRAVMSEYRINSA
                     EIAFRCDATVDDLIDVLEASSRRYMPAIYVLNKIDSLSLEELELLYRIPNAVPISSGK
                     EWNLDELLEVMWDRLNLVRVYTKPKGTMPDFTDPVVLRSDRCTVRDFCNQIHKSLVDD
                     FRNALVYGSSVKHQPQYVGLSHTLEDEDVVTILKK"
     gene            complement(<451610..>452554)
                     /locus_tag="KLMA_60214"
                     /db_xref="GeneID:34717436"
     mRNA            complement(<451610..>452554)
                     /locus_tag="KLMA_60214"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820874.1"
                     /db_xref="GeneID:34717436"
     CDS             complement(451610..452554)
                     /locus_tag="KLMA_60214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677293.1"
                     /db_xref="GeneID:34717436"
                     /translation="MSHHSNYALAHTLDQMKPQQLCNNVFFGPLNTLSQQEFLNENNI
                     RFFISVSIPVERVIEYAANIHLDRFLMCCFDQSFDRTRLSDEVMCRLLEFNGKHSADL
                     KALIHNASLSDECIARPLQSLFYRSVAEYTTNIFTADGVQKFEQFNDLITLFKLSQLG
                     NVLIFSSNGNDENLLTLLISQILKCNPKVSVRDAFTYVKNLRPTVENLHEDRIYWCSG
                     LIAYHERARSKELYWGPGSPSSVRKEVPSSATKRREKFEESVPPDSADSSASTPFSDG
                     DVYYSSDAQTSEPESIAAGSGSSRQFAVPRLKRMALNR"
     gene            <453775..>455238
                     /locus_tag="KLMA_60215"
                     /db_xref="GeneID:34717437"
     mRNA            <453775..>455238
                     /locus_tag="KLMA_60215"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820875.1"
                     /db_xref="GeneID:34717437"
     CDS             453775..455238
                     /locus_tag="KLMA_60215"
                     /note="intron including"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677294.1"
                     /db_xref="GeneID:34717437"
                     /translation="MIIRWESGIEKETSNSMKPPIENGASIVNPRVKNNSSSDNKSKS
                     KNKYNNNDNKSSSSNSDELPLADHRSNGFVNNPGLLHENEFYPMDPTNCWTHDPESAS
                     QLAYCSIVLHEENDPLLYKVVKHGMRHIQTLYHYDTWQKSTDFGSDDASAVVLSELNN
                     DEFFDMGDLTIIACGEVKEATETGSMAKRDIENVEAYVCKLNLQYNEEHFIRLLQVED
                     ILFSGLQWDFFTSEMRIGSYTSLQVVERLKRTNVAPWSQREFQLPWLDKEIMAEERVV
                     AMRPVPKAKQLPLQLLLKTSLAKSKQITKSRPITKPITKPSPMTKPNPMPKPMKMPMP
                     NPMAKATPMAITIPIEKPMETRMELPWMQPALAPPLPPPLQVPMQVPMPLPLPLPLPR
                     LTEHHESVDETLRFLDSMIELESQLNNSLNPILMGKGSNDIYISDSELSKIFDLHVSN
                     KSSLSMGDSRSSTRGSQSLGTPQLHQDNFYLYNNTNS"
     gene            complement(<455784..>456707)
                     /gene="TYE7"
                     /locus_tag="KLMA_60217"
                     /db_xref="GeneID:34717438"
     mRNA            complement(<455784..>456707)
                     /gene="TYE7"
                     /locus_tag="KLMA_60217"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820876.1"
                     /db_xref="GeneID:34717438"
     CDS             complement(455784..456707)
                     /gene="TYE7"
                     /locus_tag="KLMA_60217"
                     /note="Helix-loop-helix domain"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677295.1"
                     /db_xref="GeneID:34717438"
                     /translation="MASISQQQASYGSNSNGVYMGSGSGAGADDWFVAPATQDVWLDK
                     TGKELEGHAWTSDSSSVYSLSPSDQYRAMFDSDLLLNNTETLDSSTTFTMSNNVSTDN
                     SPLMTAINPDNGFDLIKNEFTQLPVAEAPVQVPAPAPAPAPAPVVSVKEEPQPESSSL
                     EAVAIEDKKTQKKRATATTTGQKTQNRKRCSRKRLTADQRETHNMIEKRYRININTKI
                     GKLQKIIPWVACEDTAFVVDNKVLNNGEENVPVKSMKLNKSMILEKAVDYILYLQNNE
                     RLFELEVQRLRKEINELKAGQAQAQGQVLEQ"
     gene            <458928..>461375
                     /gene="REV1"
                     /locus_tag="KLMA_60218"
                     /db_xref="GeneID:34717439"
     mRNA            <458928..>461375
                     /gene="REV1"
                     /locus_tag="KLMA_60218"
                     /product="DNA repair protein REV1"
                     /transcript_id="XM_022820877.1"
                     /db_xref="GeneID:34717439"
     CDS             458928..461375
                     /gene="REV1"
                     /locus_tag="KLMA_60218"
                     /codon_start=1
                     /product="DNA repair protein REV1"
                     /protein_id="XP_022677296.1"
                     /db_xref="GeneID:34717439"
                     /translation="MSTGAYSGYSEYFHNKELQQLESDLQFRSKYQRDHNIAHPTLFQ
                     NCIIYVNGRTVPSRLQLHKLVILHGGTFKHYLSAKSAVTHIIASELNASKKISLANAK
                     VVLPEWITESIARGKLLPWQDFRTIKTSRLQGQITDFATVQNCMDPNFIASFFKASRL
                     HHLSNWKAQLRDQFVKQLFDDQGTAVAPHNSKEYVYFHVDFDCFFAQVSAKVDGKYDI
                     HTTPIAISHGIKNSDISSCNYVARSFGVHNGMWVSSALKLCPDLKILDYEFDEYEVVS
                     SLFYNALRETNLFDMVLPISVDEAICCMALEPHITAEYLVKACDDIRSSVYKQTHGYT
                     VSIGCASSVLLARLALRKGKPNGSYVAWFDNDNDKTRTHSFIDQFSLKDLPGIGYSTN
                     EKIQQEFGSDIATVSDLRQCLQDVSGLSRLTKRIGSKNTKKLETYLNGNDDDETLSMV
                     KDPRAFFQKKSLSVEVNYAIRFKTIHEADTFLERLSQYLCDKLKDTRALTRQVTLKLM
                     KRAAGAPVEPPKFMGMGRCDAVSKSSTLGASTDKHGTIASECKTLFRLLSVPPTEVRG
                     VGIQFHRLTGDPAQQQQGATKNDIASDLLQKRRARSEEVVAAQFDVDPHTPPAKSIAN
                     SPIKNYWDRHLKRSVTPFEYDFPEELDPEFMSNLPKEVQEEVLLHHKVAKRAKKSLRS
                     KVNGDPQKQIKQTQDLHFIHDGRLVPPLSFQGLKSVKQVSKTLVDWVDATIEAGPHDK
                     DLQLFMDYLEKLADQGRSHIILQLIKTIKTRIEDHYSMAPATTNLENWEYLLLRKLVP
                     ILNRTRSDVDYNLVFDL"
     gene            complement(<461717..>463222)
                     /gene="PYK1"
                     /locus_tag="KLMA_60219"
                     /db_xref="GeneID:34717440"
     mRNA            complement(<461717..>463222)
                     /gene="PYK1"
                     /locus_tag="KLMA_60219"
                     /product="pyruvate kinase"
                     /transcript_id="XM_022820878.1"
                     /db_xref="GeneID:34717440"
     CDS             complement(461717..463222)
                     /gene="PYK1"
                     /locus_tag="KLMA_60219"
                     /codon_start=1
                     /product="pyruvate kinase"
                     /protein_id="XP_022677297.1"
                     /db_xref="GeneID:34717440"
                     /translation="MESRLGWLTNLSTDTGANLRRTSIICTIGPKTNNPETLVELRKA
                     GMNIVRMNFSHGSYEYHQTVLDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNDVDY
                     PIPPNHEMIFSTDEKYAKACDDKVMYVDYKNITKVIDVGRIIYVDDGVLSFEVLQIVD
                     DKTLKVKSLNAGKICSHKGVNLPGTDVDLPALSEKDKADLRFGVKNGVHMIFASFIRT
                     AQDVLTIREVLGEDGKDIKIIVKIENQQGVNNFDEILKVTDGVMVARGDLGIEIPAPQ
                     VFAVQKMLIAKCNLAGKPVICATQMLESMTYNPRPTRAEVSDVGNAVLDGADCVMLSG
                     ETAKGNYPINAVKTMAETALIAEQAIPYIPTYDDLRNLTPKPTSTTETIAAASVSAVF
                     EQKAKALIVLSTTGNTPRLVSKYKPNVPIVMVTRNPRAARFSHLYRGVFPFVYEEGTD
                     SEWTVDVEKRINFGIKKAKELGVLADGDTIVTIQGFAAGVGNSNTLRVLTA"
     gene            complement(<464524..>466245)
                     /gene="PUT4"
                     /locus_tag="KLMA_60221"
                     /db_xref="GeneID:34717441"
     mRNA            complement(<464524..>466245)
                     /gene="PUT4"
                     /locus_tag="KLMA_60221"
                     /product="proline-specific permease"
                     /transcript_id="XM_022820879.1"
                     /db_xref="GeneID:34717441"
     CDS             complement(464524..466245)
                     /gene="PUT4"
                     /locus_tag="KLMA_60221"
                     /codon_start=1
                     /product="proline-specific permease"
                     /protein_id="XP_022677298.1"
                     /db_xref="GeneID:34717441"
                     /translation="MSNLQDLKDAGESSVVDKQTGQVYELDLTAYSNDSEKQHEISEG
                     PEAGGHALKKGLKSSHIQLIAIGGCIGTGLFVGTSATLNKCGPAGLFISYCIMSTVIY
                     PVMNALAEMVCFLPGLPNNDETGGSISTLVTRYVDPSLGFAVGWNYVYCYIILVAAEC
                     TAASGVVTYWTTAVPKAVWITIFIGVIVLLNFTAVEFYGTSEAIFCSLKVLCILGIIL
                     VSIVLFFGGGPNHDRLGFRYWDHPGAWAYHLAKGNSGRFSDIVTGIIRAGFAFILGPE
                     LVVLTSTEAQDSRRNIEKAARRFIWRLIFFYCVSSLCAGVIVSRTDPVLVNALNQGKA
                     GAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATSRSLLSLAQDGYAPKV
                     FKRVNRFGVPYAGVACGTIVSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCAGVAY
                     LRFRKAVFYNDLYSRLPFKTPFQPYLTYFYVIFIGLICLVNGYESLVHWSYKDFIAAY
                     ITLPAFVALWVGHKAYTRTWSQWFIPVHQIDVTTGLREIEEETKELDAKRIPPRNLWE
                     KILNWLF"
     gene            <467799..>469103
                     /locus_tag="KLMA_60222"
                     /db_xref="GeneID:34717442"
     mRNA            <467799..>469103
                     /locus_tag="KLMA_60222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820880.1"
                     /db_xref="GeneID:34717442"
     CDS             467799..469103
                     /locus_tag="KLMA_60222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677299.1"
                     /db_xref="GeneID:34717442"
                     /translation="MSSIPFGHQFKDKYFGYLDPEVTLTNHGSFGTTPGIVVDAAKRA
                     LERHEKYPCRDALYTVTDEYKRQLKLVAGYLGLEYLNCAFVTNATTGVNTVLRSIPFD
                     FQKDKVLFHSTTYGACANTVKFLHDYFGLQYDVVEINYPCEDDSILEAFEAKLKTKEY
                     KLCLFDLITSHPGVTIPYKGIIELCHKYDTWSLIDGAHSAGQVDLKFINELKPDFFTT
                     NLHKWLYCPKSVALLYVDPKHHAMIQTMPISHNYSSPDCQYIEGDDEHNANLLINKFA
                     FVGTASYASYMACEVALTFRKEICGGEDKIRQYQFQLQEKAIPKVLEVFGDGSKLLEN
                     STNTLRPPGLFCVELPIPEDLKFLVTKMTADPVFFAKFKATCEKTAVFDHKCHAPFTL
                     NNNHIFVRFSVQVFNEVQDYEKAAAVVKGIIYENLRKEASSS"
     gene            <469434..>472475
                     /gene="CIN1"
                     /locus_tag="KLMA_60223"
                     /db_xref="GeneID:34717443"
     mRNA            <469434..>472475
                     /gene="CIN1"
                     /locus_tag="KLMA_60223"
                     /product="chromosome instability protein 1"
                     /transcript_id="XM_022820881.1"
                     /db_xref="GeneID:34717443"
     CDS             469434..472475
                     /gene="CIN1"
                     /locus_tag="KLMA_60223"
                     /codon_start=1
                     /product="chromosome instability protein 1"
                     /protein_id="XP_022677300.1"
                     /db_xref="GeneID:34717443"
                     /translation="MSETIRQSRDELIQSLHVGMSDFSVVDKTIQVIQFFEVDPLMLE
                     RELPALISKLSSHYLSAEEDTQLKISRIYYQFAKIFLNRRVRVHIPVNIYDLKPVLQL
                     LTRKDNWYCEYFLMSWLTMLVMSPFKFDNDTDIMKAVAKFDNVALIKPLQSMVKAELW
                     SRNERLYVLPDDLMQMDIIDLNYFLKMLKHKSKYPFTTEQLTGMTEHITSLTSFNNEL
                     EGLYLLKLLPKLTILLADSEETWQCIYDIIFWLTSSINLSFTDLRFKLAKTVSKIVLF
                     ISNSNPTSAEMIVEDCVEDTEKMIQTNTNDSMDAERLHTLLLVLAEFCRNKLLTVSQI
                     EAFTSNILPTVSKFQQKRMMSTQGHQIRDAGNFFCWSLSRDYTNIPLPCLEEMFLSLL
                     FTANFDHSPLIRKSAMAALQECLGRQGNKFLDNVVVVRLVEIHLGQLSNARLLYQLFK
                     DKYSQYCEKMVEWLVLFTIGKDYEFQLVKSTTDLLSTMISEFKDDEFNKLVNKFNLKL
                     AELGLRNRDTDICARSSYLNFKIGCQTLTIQKDILDVLHKYSIPKVWNEQVSFQALSE
                     LYGLLSLAKRGHPLSKDLAERVFMIVRNVKSNDYNHQDISNLFNELVFHISKHDECFL
                     DDETKQFFWKTFDNLFKFEQPLVCSAAPFLYEHQFISLFYDVVPKISCEFKGKMINSL
                     SEALPSYEINDDLKQFLKDVLLFLEDYTTTNQGDVGRITRLSTINLIAKHMELFQDAA
                     FSEILQVNLLRLMGEPATELREKSFELLCRFENVHFPDMPFDSKIIALYHNFYKWNRE
                     FWKGYFFSAGAIHSTDKQISSAVDQLMAYYITLDEEERLRTVNEFVRIIPSASELKEL
                     QENNSKKNLVGAIRKDGTKTILTFMNGWCRLLESGLELPNDFSSGGFFARVYNLQLAA
                     KSVSITTYSFKLLTSLVCNQLLNETQASKQLANSLIGIFLKGFTKMKHKTTFSNTQKV
                     ALELLIQIYMCSNKTESIALLKDNSESPQQLCTLDHTLLFL"
     gene            complement(<474767..>476236)
                     /gene="MEK1"
                     /locus_tag="KLMA_60225"
                     /db_xref="GeneID:34717444"
     mRNA            complement(<474767..>476236)
                     /gene="MEK1"
                     /locus_tag="KLMA_60225"
                     /product="meiosis-specific serine/threonine-protein kinase
                     MEK1"
                     /transcript_id="XM_022820882.1"
                     /db_xref="GeneID:34717444"
     CDS             complement(474767..476236)
                     /gene="MEK1"
                     /locus_tag="KLMA_60225"
                     /codon_start=1
                     /product="meiosis-specific serine/threonine-protein kinase
                     MEK1"
                     /protein_id="XP_022677301.1"
                     /db_xref="GeneID:34717444"
                     /translation="MDNVLGLLEVQYAEDGESCSEFILNHFPIETNSVLRLGRNTQEC
                     VYSVDHPSVSSVHCILWGIRFDPESIPLCYIKDVSLNGTTVNGEELERDVPYLLGNQD
                     LIELPNGVSFKFSSVKSETMSQFLAGLRVQMKWNTWEIVPRIVGSGTFGHVLVAKKKH
                     EQKKSSSATTKKPPSYAVKIINTSKTRMVKEASILEKLDHPNIIKIHQSCVDSVGNIY
                     IFQDLISGGDLFSYLAKGDCLVPISETESLIITYQILLALKFLHSNGIVHRDLKLDNI
                     LLHTPEPCTKVVLADFGIAKELSQCTKERMHTVVGTPEYCAPEVGFKADRNVYRSFSR
                     TATLDPENIGYDSKCDIWSLGVITHIMLTGISPFYGDGSEGSIVRSVRSGHLNFSAKQ
                     WIPITDSAKSFVRKCLQVSTQQRCNVKEALHQIWIEKHTSQLERIYRKKVLQGSSEPI
                     KVDENMDIFASTKHKLPKSVKLSPEKNPSKRLKLFSNKM"
     gene            <477230..>479059
                     /gene="LEU4"
                     /locus_tag="KLMA_60226"
                     /db_xref="GeneID:34717445"
     mRNA            <477230..>479059
                     /gene="LEU4"
                     /locus_tag="KLMA_60226"
                     /product="2-isopropylmalate synthase"
                     /transcript_id="XM_022820883.1"
                     /db_xref="GeneID:34717445"
     CDS             477230..479059
                     /gene="LEU4"
                     /locus_tag="KLMA_60226"
                     /codon_start=1
                     /product="2-isopropylmalate synthase"
                     /protein_id="XP_022677302.1"
                     /db_xref="GeneID:34717445"
                     /translation="MLFKNTVVRLAQAGNKVIPPVKLGYKNMLKDPSVKYRPYPQIEL
                     KNRQWPSKTITKAPRWLSTDLRDGNQSLPDPMSVEQKKEYFHKLVEIGFKEIEVSFPS
                     ASQTDFDFTRYAVENAPEDVSIQCLVQSREHLIRRTVEALSGAKRATIHTYLATSDMF
                     RDIVFNMSQEEAVKKAVEATKLVRSLTKDDPAQSATRWSYQFSPECFSDTPVEFAVEI
                     CEAVKAAWEPTEDNPIIFNLPATVEVATPNIYADQIEYFATHISEREKVCISTHTHND
                     RGCGVAASELGMLAGADRVEGCLFGNGERTGNVDLVTVALNMYTQGVSPNLDFSDINS
                     VIEVVERCNKIPVSPRAPYGGDLVVCAFSGSHQDAIKKGFNLQEKRRAEGDQRWRIPY
                     LPLDPKDIGRDYEAVIRVNSQSGKGGAAWIVLRSLGLDLPRNMQIEFSAMVQEKADSL
                     GRELKAEEIVDTFKHQYNFDGSASTISLLEYTVTKLAGDQRTLVGQVDINGQVVDIEG
                     FGNGPISSLVDALSNLLNVKLGVANYTEHSLGSGTSTQAASYVHIAYRREVDNERAFH
                     WGVGVSEDVSDASARAIVAAVNKLIQKGEISLPSFESSAKASA"
     gene            <479766..>483083
                     /gene="INP53"
                     /locus_tag="KLMA_60227"
                     /db_xref="GeneID:34717446"
     mRNA            <479766..>483083
                     /gene="INP53"
                     /locus_tag="KLMA_60227"
                     /product="inositol polyphosphate 5-phosphatase"
                     /transcript_id="XM_022820885.1"
                     /db_xref="GeneID:34717446"
     CDS             479766..483083
                     /gene="INP53"
                     /locus_tag="KLMA_60227"
                     /codon_start=1
                     /product="inositol polyphosphate 5-phosphatase"
                     /protein_id="XP_022677303.1"
                     /db_xref="GeneID:34717446"
                     /translation="MVPKSYLKQRSFDRLSKLDIHGFIGLIELEGSIFIGTITGKSKV
                     ASPIPGETVNKIYGVDFFCLDNGRWDFVDLDSNGFPIIPEDEFVSSSSIQQQQQQQHP
                     CHDIKKLLSNGSFYYSSDFDLTSLLQSRGLSEHSLSFDNYQEEYMWNSFLMQEIITFR
                     NHLDDKAKQIMDDEGFLTTVIRGFAETFPSYIGRMPVNLTMISKQSWKRAGTRYNVRG
                     IDDEANVANFCETEFVMYSEEYCFAVTEIRGSVPIFWEQDTALLNPKVTITRSVEATQ
                     ATFDEHFQKLIQKYGPVHVVNLLSTKSSEIELTKRYREHFQRSKRLKLNSDVFLTEFD
                     FHKETKEEGFAAASKIMPLIERSILENGYFSYDVKEKKQLSEQNGVFRTNCLDCLDRT
                     NLIQQFISRYTFILFLEDFNLIKPKLPMIEEYDWYQKHNNIWADHGDAVSQIYTGTNA
                     LKSSFSRKGKMSFAGALSDATKSVSRMYINNFMDKNKQMNIDALLGRLPHQHAVELYD
                     PINDYVNESLRKQEASFTTSSSIKILCGTFNVNGLTKTADLSAWLYPIGERYLPDIVV
                     LGLQEVIELNASSILNVDTTKSKFWKDLVSDCLNKHEKYIMLRAEQMSSLVILFFVKA
                     DKVGNVKRVEGSSKKTGLGGMTGNKGAVAIRFEYGSTSFCFVNAHLSAGVNNIEERKG
                     DYESITKGISFSRSKKIEHHHSIFWLGDLNYRIELPNEKVRSLLATPGDENLEKLLSR
                     DQLTAEMANESVFKGFMEPSIQFRPTYKYDHGTDRYDTSEKARIPSWTDRILYKGDNL
                     VPMAYSDAALNLSDHKPVYAAYKAKVKFIDEEAKLQMTKKLYMEYKQSHPQDSGSINS
                     ALLDIELDNAKDKPKPVISKDMNLLDLDLQFGSTGTNHSRAPVDRPMSPSSISSSSLS
                     SLSLNSPPVGPTSRRTETTKPLSPAPRVQSEPIRRVPPPLPPKKTATTVPTALPTAAA
                     AAAAAPSTAETVSRTSTPSQGSERKTTLAPPPPPSRKPHPPPGFSDVVLTPKGSSREA
                     TTSPVHAINSGNSLNSRNGSINNNIHGAAAHGPAAHGHARSDSNSSNHKKEKPAVPSK
                     KPELAMSLDSWKPLQPK"
     gene            complement(<483952..>484626)
                     /gene="YAF9"
                     /locus_tag="KLMA_60229"
                     /db_xref="GeneID:34717447"
     mRNA            complement(<483952..>484626)
                     /gene="YAF9"
                     /locus_tag="KLMA_60229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820886.1"
                     /db_xref="GeneID:34717447"
     CDS             complement(483952..484626)
                     /gene="YAF9"
                     /locus_tag="KLMA_60229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677304.1"
                     /db_xref="GeneID:34717447"
                     /translation="MPSQPLTKRIKTLSVTRPIIYGNTAKKMGDNIPANAPKDHTHVW
                     TIFVADPRGEDISYFVKKVVFKLHETYPNPVRVVESPPFELTETGWGEFEINIKIYFA
                     DISNEKTLSFYHHLRLHPYINTETKEIERTNDGSTVGEDEVKAVYFDEIVFNEPTEQF
                     FQVLMTKPGNMLPSNKTPQCVFSKQLEREEIDRIRIGQSKIEEEIQKYEKMIKDAIGN
                     NATSAT"
     gene            <484941..>486182
                     /gene="TFC7"
                     /locus_tag="KLMA_60230"
                     /db_xref="GeneID:34717448"
     mRNA            <484941..>486182
                     /gene="TFC7"
                     /locus_tag="KLMA_60230"
                     /product="transcription factor tau 55 kDa subunit"
                     /transcript_id="XM_022820887.1"
                     /db_xref="GeneID:34717448"
     CDS             484941..486182
                     /gene="TFC7"
                     /locus_tag="KLMA_60230"
                     /codon_start=1
                     /product="transcription factor tau 55 kDa subunit"
                     /protein_id="XP_022677305.1"
                     /db_xref="GeneID:34717448"
                     /translation="MTVKTIYIARHGYRSNWLPTPPAHPAPPTGVNSDVPLAPHGIEQ
                     ARELAHYLISIDNQPQLIVSSPLYRCLQTSEPIADLLELPIYFDRGLGEWYKPDRDVI
                     PEPASYDILNNFFPGKLKSEWPHSVIPSNKGETEEEIFERCKKFWPVFIKTVEERFPE
                     VETILLVTHAATKIALGMTLLKFNSVRDTLDEDGNVIHCGSCSLDKYELLEDEEDEEA
                     EDEEGSSVPPFEERQWKLTMNGNTEFLSGGEEMNWDFRYGFEAGSDDDIKQRRKLQEK
                     KNGASSSAPQSAGSDAGAASDSVAASGSGQEGGDSQEEYEHVYVSLDVENRNYREKQT
                     VQNQATLQHSGLESDKPLVKIGDNVYEGTWKKPLGTELAFASEGSKSDSKTDSNDSDS
                     KTTDRVYRVTDSIDLHPIQPM"
     gene            <486376..>487032
                     /locus_tag="KLMA_60231"
                     /db_xref="GeneID:34717449"
     mRNA            <486376..>487032
                     /locus_tag="KLMA_60231"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820888.1"
                     /db_xref="GeneID:34717449"
     CDS             486376..487032
                     /locus_tag="KLMA_60231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677306.1"
                     /db_xref="GeneID:34717449"
                     /translation="MNAVARTLSSKYEIILASSSPRRFEILTEQMGFKDVIVMKPSFE
                     EDLDKTLYHKKPLQYVQDTCLGKAHSIVHELKQQQNDQHSKPKLVICADTVVIDHTDE
                     IYEKPVYKETQLKNLLKFTQSGKPMRVATAVTIIRWTSAQDHQFESFYEVTEVFFDKE
                     IPRTLIEMYVESGDGLQVAGGFKVQGFSGCLISGINGDYYNVVGLPLNATWKRLLAFE
                     "
     gene            <487444..>488151
                     /gene="NOP15"
                     /locus_tag="KLMA_60232"
                     /db_xref="GeneID:34717450"
     mRNA            <487444..>488151
                     /gene="NOP15"
                     /locus_tag="KLMA_60232"
                     /product="ribosome biogenesis protein 15"
                     /transcript_id="XM_022820889.1"
                     /db_xref="GeneID:34717450"
     CDS             487444..488151
                     /gene="NOP15"
                     /locus_tag="KLMA_60232"
                     /codon_start=1
                     /product="ribosome biogenesis protein 15"
                     /protein_id="XP_022677307.1"
                     /db_xref="GeneID:34717450"
                     /translation="MAKSVRSTTQSKKSEPKAAKAVKEVVEKVEETLQGSGSESESES
                     DIEGFHSASENEDEDDSSDDEGEEVQVELKQGSHTIKKLDPKKQSEMDKQKAKKDKNA
                     DVSGILYVSRLPQGFKEREMSKYFSQFGDLKQVRLARNKKTGNSRHYGFIEYINKDDA
                     VIAQEAMNNYLIMGHLLKVKVLPSGSSIDKLFRYKKKPFIASKATKSATDLKKRASEK
                     HEDRIAKLNEAGIDFKF"
     gene            <488733..>489101
                     /gene="CYB5"
                     /locus_tag="KLMA_60233"
                     /db_xref="GeneID:34717451"
     mRNA            <488733..>489101
                     /gene="CYB5"
                     /locus_tag="KLMA_60233"
                     /product="cytochrome b5"
                     /transcript_id="XM_022820890.1"
                     /db_xref="GeneID:34717451"
     CDS             488733..489101
                     /gene="CYB5"
                     /locus_tag="KLMA_60233"
                     /codon_start=1
                     /product="cytochrome b5"
                     /protein_id="XP_022677308.1"
                     /db_xref="GeneID:34717451"
                     /translation="MAKLFTYKEVSEHKTGDDLWLIIHGKVYDCTKFVDEHPGGDEIL
                     IELGGQDATGPFDDIGHSEDAIKLLEPLYIGDIDTTSEKVVVESTESSAATTGGEGNG
                     VMIIALIVVFLAIAFYYFNQ"
     gene            <489888..>491747
                     /gene="CEX1"
                     /locus_tag="KLMA_60234"
                     /db_xref="GeneID:34717452"
     mRNA            <489888..>491747
                     /gene="CEX1"
                     /locus_tag="KLMA_60234"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820891.1"
                     /db_xref="GeneID:34717452"
     CDS             489888..491747
                     /gene="CEX1"
                     /locus_tag="KLMA_60234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677309.1"
                     /db_xref="GeneID:34717452"
                     /translation="MYQVAQTLTVLHEQAKCLFGALSIGNIYVNTKGEWVLYGLELST
                     SFNDPAHFSSNLQVYNGVVRGYDNWELLGNVSTPVGVDAAQLYTVYSTLFQGNIPTSW
                     KPTLAALAKGQQGSVQKFVAKLRDDNGNPLISIYDNLKEIYIKDPVEKVMMLSNVQQT
                     ISADDKPFKNPTPGFLENTLLPELTQCLQMISTTNQPTSNQVPFLGTIFHLTCSDSPI
                     IADENVFQTQVKPIIFQSFNVADRQVRFLLLLHFANFTQKLSASEVADKIFPPFIQGL
                     SDTDQTIRLQTLKNVSHLIGKITERQLNNDLLRVLAKTQVDKDIGIRTLTILIITKIA
                     HKLNKSSNRSTILATAFTKSLKDPDLKPRLATLYGLETTLDLFDAETIAQRILTVIGP
                     GLLDKNKQVRENAKKVFHMYWDKLEQESASFPDDDDSEDIPEEEFDRMMNDEEDGELI
                     NGFIQSVKLSTPTPTSTPADLVEPVQESDPWNAAFDDDVIADLDDSWDVDEPEEQSSN
                     NTQVKSFGFKVPVKKSWNDELDDTPLEHNSLTKNTSSNSLKIKKEESKPSILSKKPVK
                     RTSILSKSNKTSQQQHPRIASSIRTSHKHTSKVIAPTLAAEDDDVEDGWGDDW"
     gene            complement(<491937..>494746)
                     /gene="DBP2"
                     /locus_tag="KLMA_60235"
                     /db_xref="GeneID:34717453"
     mRNA            complement(join(<491937..492295,493471..>494746))
                     /gene="DBP2"
                     /locus_tag="KLMA_60235"
                     /product="ATP-dependent RNA helicase DBP2"
                     /transcript_id="XM_022820892.1"
                     /db_xref="GeneID:34717453"
     CDS             complement(join(491937..492295,493471..494746))
                     /gene="DBP2"
                     /locus_tag="KLMA_60235"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DBP2"
                     /protein_id="XP_022677310.1"
                     /db_xref="GeneID:34717453"
                     /translation="MSFTGGRDHQFNRNNMGNSHGDYRGQRGSDRNGYNRGGDFRGGR
                     GGFGRGGSRDSRIELVAPNWDEELPNLPVFEKNFYQEHPDVTKMSDAEVAQFRKENEM
                     TITGHDVPKPIRTFDEAGFPSYVLDEVKQEGFDKPTGIQCQGWPMALSGRDMVGVAAT
                     GSGKTLSYCLPGIVHINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGASSRIRN
                     TCVYGGVPKSQQIRDLQRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDM
                     GFEPQIRKIVDQIRPDRQTLMWSATWPKEVKQLAADYLNDPIQVQIGSLELAASHTIT
                     QIVEVVTDFEKRDRLAKHLETASQDQESKIIIFASTKRTCDEITSYLRAEGWPALAIH
                     GDKAQNERDWVLAEFRSGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIG
                     RTGRAGSTGTAISFFTEGNKSLGTALIKIMREAKQNIPEELRRFDRGSYGAHPRYGGG
                     RGGRGFGGGRGRGGYGGGRGYGGGRGRGGYGGNRSW"
     gene            complement(<495278..>495661)
                     /gene="RPC19"
                     /locus_tag="KLMA_60236"
                     /db_xref="GeneID:34717454"
     mRNA            complement(<495278..>495661)
                     /gene="RPC19"
                     /locus_tag="KLMA_60236"
                     /product="DNA-directed RNA polymerases I and III subunit
                     RPAC2"
                     /transcript_id="XM_022820893.1"
                     /db_xref="GeneID:34717454"
     CDS             complement(495278..495661)
                     /gene="RPC19"
                     /locus_tag="KLMA_60236"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases I and III subunit
                     RPAC2"
                     /protein_id="XP_022677311.1"
                     /db_xref="GeneID:34717454"
                     /translation="MAEIQKDTPIQEDAEIQKDVDMQEDELDREKIKLLSEATSEDGM
                     SASFRITDEDHTLGNALRYMIMKNPEVEFCGYSIPHPSENFLHIRIQTYGKMTAVEAL
                     HKGLADLMDLCDAVEDRFTQRVREM"
     gene            <496640..>499129
                     /gene="AZF1"
                     /locus_tag="KLMA_60237"
                     /db_xref="GeneID:34717455"
     mRNA            <496640..>499129
                     /gene="AZF1"
                     /locus_tag="KLMA_60237"
                     /product="zf-C2H2 super family protein"
                     /transcript_id="XM_022820894.1"
                     /db_xref="GeneID:34717455"
     CDS             496640..499129
                     /gene="AZF1"
                     /locus_tag="KLMA_60237"
                     /codon_start=1
                     /product="zf-C2H2 super family protein"
                     /protein_id="XP_022677312.1"
                     /db_xref="GeneID:34717455"
                     /translation="MDSSNGQNNGGSQRPEDSGEKDKMPPPQGQPVNVGVPLQNQNQG
                     QNQGQNQGQNQNANNQGPGQSQRQDSISMYTNFNQPRLSTDSSISSFLNIDNQSDTRG
                     STSQMGVAGQELPYSRGFSIVNNLWNAPVPHPQNDVAFTTTRRQSEQLEPFMPKFNTS
                     SFTKGQGQGQGQGQGQGQLQGQQGGRQASGPGPGQGQGQGQSANQNANQGQGKQGKNQ
                     NQTSSGQNSGQNQNQVVGQNQGTGNGQGQVQGQVSGPSSKRNSIYFPPTDADLDFFTT
                     GKRNSIAMKPPLIKPNGNGTNHQAVGGPGGPTDDMEVPFFQGPLSRKNSIKFNPEDFA
                     DFQFKRRDSSVRATLDNSNYMPAPPKRLNDGSLSPIDHHMVDNDDEEDVETRLHKHLS
                     SLVDSVKMDKTPPKKKQKSSAKGKKKGGQGSKKDDGTDDSLDHHHQQQQHQQQQQQQQ
                     QQQQQQVGMQQPHMLNQAQLQAGAGAGAQMGGMTSLNPAINPSLNPSINPIEDSKPLL
                     GATKVDQLMLVIQARKNGVTDKVPRSADGSLLLESAPSIIPPLSQLVGGVEKPKSKGV
                     KQFQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCDFCGKRFTQGGNLRTHIRLHTGEKP
                     YECERCGRKFSRKGNLAAHKLTHDNLKPFQCKLDDCNKTFTQLGNMKAHQNRFHLQTL
                     NRLTQRLAEMDPNENISQKERELLDYFASIYRNSNRGIKGRGKGNQNIVPLNAFDKHR
                     QLDDPSVRVAAKALGSLTQSKQPSPMAYETASNSSIADKNNQFSFPEGEAQLDDAAYA
                     ATGTIALGSRNPNKEPSQKEKVQFKDVNFIR"
     gene            <499759..>500592
                     /locus_tag="KLMA_60238"
                     /db_xref="GeneID:34717456"
     mRNA            <499759..>500592
                     /locus_tag="KLMA_60238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820896.1"
                     /db_xref="GeneID:34717456"
     CDS             499759..500592
                     /locus_tag="KLMA_60238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677313.1"
                     /db_xref="GeneID:34717456"
                     /translation="MLKLFPTLTLPARFSVLQVSNKKSFQKLDQRPLDVFQYYLQLQI
                     DQLNVYGDVGDLKHNISFVKRIKNEWKSLSLTKKRVYHTLFFKFSAVDFNKLRNEELA
                     RYLTIPRPITSSYLLFRKRFKVRFYQMLEPKERCSQGSASSLDQRYQRTTYLAKNKPL
                     VRIQPRQPYPNNSTAFNAHFRYQEMCKSCKEEWRKSVTEEEKQLLHEEVQRRKRLFDL
                     RMQVERKELRTLTKLLDESVSEESFKTLSHSLSYHNLERKKVLDNGLLIPFLHMSHKK
                     D"
     gene            complement(<500752..>501564)
                     /gene="TRS33"
                     /locus_tag="KLMA_60239"
                     /db_xref="GeneID:34717457"
     mRNA            complement(<500752..>501564)
                     /gene="TRS33"
                     /locus_tag="KLMA_60239"
                     /product="transport protein particle 33 kDa subunit"
                     /transcript_id="XM_022820897.1"
                     /db_xref="GeneID:34717457"
     CDS             complement(500752..501564)
                     /gene="TRS33"
                     /locus_tag="KLMA_60239"
                     /codon_start=1
                     /product="transport protein particle 33 kDa subunit"
                     /protein_id="XP_022677314.1"
                     /db_xref="GeneID:34717457"
                     /translation="MSSANTHHDASESPEQIERRRIIEQFLLFQESLPKVNVLSYQWL
                     LNEMIPMSMAVEHNLGSMDDSSSTSSQEEEDRAEALADDVSKVSLNKVDYVPSHKLIQ
                     ELYNANDEQRERVYERLFKIGKGIGSKITELLIFSNNPNLSFSHMDTLGMVRFICKEV
                     WKLLYGKQIDNLKTNHRGVFYLFDYEFEPIQNFSIDDDEEKLLKMVAPYVQVPLGVIS
                     GILTSLGVPEDELSVSFSYTDIPDNKKKPLGQFPKGLNFNIQINQFQQNPDA"
     gene            <501852..>503744
                     /gene="BZZ1"
                     /locus_tag="KLMA_60240"
                     /db_xref="GeneID:34717458"
     mRNA            <501852..>503744
                     /gene="BZZ1"
                     /locus_tag="KLMA_60240"
                     /product="protein BZZ1"
                     /transcript_id="XM_022820898.1"
                     /db_xref="GeneID:34717458"
     CDS             501852..503744
                     /gene="BZZ1"
                     /locus_tag="KLMA_60240"
                     /codon_start=1
                     /product="protein BZZ1"
                     /protein_id="XP_022677315.1"
                     /db_xref="GeneID:34717458"
                     /translation="MSESISIGNEIKDGYEETQKWVQNNIKWLSTVGSFYRERAKLEK
                     EYSEKLSQLTKEYFSKKSAETVALSVGNTPAITPGSLESASQVTWNEVLTQSELMAKD
                     HDKFANDITIYICEQLRTLTVRCEMLFSKAERLNQEVVDRKDTCYNNLEKAKKKYYDA
                     CQAMETMRSKSAKYSSEKAQKKLSEKEHEMNICKNQYLVKINQANRVKDKYYFQDVPE
                     ILDILQDLNESRVAMINLIWKKAGDLERDFHKRVETRLDAVDSVIVKNKPHLDSSMFI
                     KHNIKNWNEPKDFLYEPSSVWHDDEHFVIKSQAELQDLRLRLAKAQQQLEESHSLTES
                     EKVALGKLHTAKSEMKSKDSFDPMKLQDTLKEYIIAVQKFTALENKKLESEVEVESIQ
                     NNVQDESVLDISDVDLSKTEKKNGLFGLFKKSTSNNIAAASDAASMVSEETHKSKNSN
                     RFSVFKRNGHGSTSHGGAGSASVVDNDDNVSTITTPSSSHSHSAGSGNAVKGKVLYTY
                     EKGDTDEVSVTSGAIVTVVNKDAGNGWSLIRLDSGEQGLVPQSYIEVQSGSSSRRAPP
                     KAPQPRKSSHKTMTAAYAYQSQGADELSLSVGDKVKVLKADEGNGWTYGELNGQRGLF
                     PTAYCT"
     gene            <504298..>506271
                     /locus_tag="KLMA_60241"
                     /db_xref="GeneID:34717459"
     mRNA            <504298..>506271
                     /locus_tag="KLMA_60241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820899.1"
                     /db_xref="GeneID:34717459"
     CDS             504298..506271
                     /locus_tag="KLMA_60241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677316.1"
                     /db_xref="GeneID:34717459"
                     /translation="MDKASECNNSVVTSNRSLKSSTKSGNIVMQGETDEAGTRAVTAT
                     REISPVPFPGKYSSNDESRESTENEPLLARGGGKSSHRTLGVVAPEPVNNVNGSRNDD
                     VHYSDDDSMLPRDPSDLLYSVRRDYRRFIHKSKTLLNIMVFINTLWLVTTFISDFFFN
                     MNFLRNRITSFQDLTLIFVSIIANSLTLWFNKVGLHSSLDKYLNVILCGLTLFNLGIN
                     LLVGYIRQRLGLLGICTFLWAAVSFGVSAIMDQYLCDFNKKFHPNNYADAEADNDDLN
                     DPAHKKETSRHTLTEWVSIGFRTTVKVILLLYFILFTLNNILFTLDCFLTSRQVTQAK
                     VSTEANAASYDAFHWAGPDHNYQIHLKCYGDVFGEGDDDENKQPIVLFEHGGADTAFL
                     SATWIQELYHLNRVQRYCTYERPGYGLSDSPPAPISISMMADALKHVLLKEANIKGPF
                     TTVGYDLGGLFTQVFTAKNIDLVDSMLLVESWHPDLLLKNYISRLLPGDDNDDPEDHG
                     RLPDEINRHNGFVIWWKGILSTFNIKLQTSWMLAHHGSKERIYGRDMIYQGKYLRIKF
                     LESVTSSLLSYKDVLNSLDNLKEVKMSVISSNELIKKSPQWGNWQRELSKISTKTQEW
                     KIVDGGHQIYKYGLGKQQAQDVLLRLIDEKDRY"
     gene            complement(<506598..>508232)
                     /gene="DMA2"
                     /locus_tag="KLMA_60242"
                     /db_xref="GeneID:34717460"
     mRNA            complement(<506598..>508232)
                     /gene="DMA2"
                     /locus_tag="KLMA_60242"
                     /product="E3 ubiquitin-protein ligase DMA2"
                     /transcript_id="XM_022820900.1"
                     /db_xref="GeneID:34717460"
     CDS             complement(506598..508232)
                     /gene="DMA2"
                     /locus_tag="KLMA_60242"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase DMA2"
                     /protein_id="XP_022677317.1"
                     /db_xref="GeneID:34717460"
                     /translation="MAGTGVNDNVNGAGWRRGSGLGTILSTFGIRQGASGSGGVSSGT
                     DNGMMEVSGRAMPIDIGRERSQARDINSDASMTVPGAAGGGVNNENNHNNNNNNNSNT
                     NTTHTNNTNTHTNNNVNINNNNTHISNNILGTTPLDYSEHPAHGGPSSVPGGPQNTEL
                     SSSHLPINLVLGQIDTNGSTSNSQLDQMPLTSPPIQASGMQNGHFLKNVHHFIYPAVR
                     PAAAPALHLDFPNDWPKPEPVEDETVRLRKDKNGLFTLRLTAFIDNPTAGVPGFYFDP
                     IVRTAGPGSQLVIGRYTEKVREAISTIPEAFHPAVFKSKVVSRTHGVFKVDDRGNWFV
                     KDVKSSSGTFLNHHRLSPASTMSKDYLLKDGDILQLGLNFRGGAEEIYRCVKMRVELN
                     KSWRKKANAFNKEAIQKLKELQKMATGTEFEDCSICLSKIKPFQAVFIAPCSHSWHYQ
                     CVRRLVSSTYPQFVCPNCRAICDLEADLDSEGEDDDEFVDDDVYIPNEPCDHSGGISS
                     GNDDSEASIPNGNHVRSATPGLDEDFLEEEDIQMMN"
     gene            complement(<508994..>510661)
                     /gene="MLS1"
                     /locus_tag="KLMA_60243"
                     /db_xref="GeneID:34717461"
     mRNA            complement(<508994..>510661)
                     /gene="MLS1"
                     /locus_tag="KLMA_60243"
                     /product="malate synthase 1"
                     /transcript_id="XM_022820901.1"
                     /db_xref="GeneID:34717461"
     CDS             complement(508994..510661)
                     /gene="MLS1"
                     /locus_tag="KLMA_60243"
                     /codon_start=1
                     /product="malate synthase 1"
                     /protein_id="XP_022677318.1"
                     /db_xref="GeneID:34717461"
                     /translation="MVKKTLENVEVLVDVDFTPQFTPSTTTVADILTKDALEFVVLLH
                     RTFNKTRLQLLENRQIVQKKIDAGEYEFGFLKETESIRNDPTWQGPVLAPGLIDRSTE
                     ITGPPLRNMLVNALNSDVKTYMTDFEDSASPTWENVIYGQVNLYDAIRDQIDFVTPRK
                     EYKLRAKIGELPTLIVRPRGWHMVDNHILVDGEPISASILDFGLYFFHNAHKLIEIGK
                     GPYFYLPKMEHHLEAKLWNDIFQVAQDYVALPRGTIRATVLIETLPAAFQMEEIIWQL
                     RQHSAGLNCGRWDYIFSTIKRLRNKPEHVLPNRDQVTMTSPFMDAYVKKLIRTCHSRG
                     VHAMGGMAAQIPIKNDEAANTAAMTKVRNDKIRELTNGHDGSWVAHPALAPICNEVFA
                     EMGTPNQIYKVPETTVAAADLLNTNIKDGEITTAGIKQNLDIGLQYMEAWLRGSGCVP
                     INNLMEDAATAEVSRCQLHQWVKHKIVLKDTGKPITPELAKEILYEQAKELAAKSPLG
                     DKNKFNLAAKYFEPEITGEKFSEFLTTLLYEEIVTVNSTPFDLSKLK"
     gene            <513502..>514824
                     /gene="RTM1"
                     /locus_tag="KLMA_60244"
                     /db_xref="GeneID:34717462"
     mRNA            <513502..>514824
                     /gene="RTM1"
                     /locus_tag="KLMA_60244"
                     /product="protein RTM1"
                     /transcript_id="XM_022820902.1"
                     /db_xref="GeneID:34717462"
     CDS             513502..514824
                     /gene="RTM1"
                     /locus_tag="KLMA_60244"
                     /codon_start=1
                     /product="protein RTM1"
                     /protein_id="XP_022677319.1"
                     /db_xref="GeneID:34717462"
                     /translation="MTVSATKLYGYYPNKAMSLVPGSTTSGWDFFNYTPTKGGAIAVA
                     AVFGVFLFVLLYQVIYYCHQAKRISSLRLNHIAYKYIPLLVGAVFEIIGYAGRASAAD
                     DVFSIGPYIIQAIFILVAPALSVLFIFDLIILIINEPLLSINPDNQGLSHKLKLTIGL
                     IGKLNSLSYSISNNCLYLDKPNNLPLINSNTLFLAFLLSKINLILIFLFILAATFSHC
                     EKVAAFVLILVLVLVFEYFITLPSAATIYMVFHAMLWQLKCERISFIPPRYATTTFVC
                     GDVLSFILQGAGGGLSSGDNTRDLGNDVILGGLAVQLVFFGFFIITEVKFLLMVSKRS
                     PMVSRISNHWKVLNWTLLLVSLLILGRSIVRFVEFAEGTDGVIISHEWYLYVFDALFM
                     LVCYLLFIVMFKYGNIFQVFVECGKADSEPILYGDTESYNNQKEMGFA"
     gene            <515550..>518024
                     /gene="DCP2"
                     /locus_tag="KLMA_60245"
                     /db_xref="GeneID:34717463"
     mRNA            <515550..>518024
                     /gene="DCP2"
                     /locus_tag="KLMA_60245"
                     /product="mRNA-decapping enzyme subunit 2"
                     /transcript_id="XM_022820903.1"
                     /db_xref="GeneID:34717463"
     CDS             515550..518024
                     /gene="DCP2"
                     /locus_tag="KLMA_60245"
                     /codon_start=1
                     /product="mRNA-decapping enzyme subunit 2"
                     /protein_id="XP_022677320.1"
                     /db_xref="GeneID:34717463"
                     /translation="MSLPLYRPLETVSLDNAIEDLVVRFILNVPPEDLATVERVLFHF
                     EEASWFYTDFVKLMNPYLPNLSIRSFSKTVKDICPLIWNWDITPENALVKFSMYKRSI
                     PVRGAAMFNENLSKILLLRGANSKHWSFPRGKIGKDEDDVSCCIREVKEETGFDLTGY
                     IDADQYVERNMNGKNFKIFLVKGVPEDFEFKPEHKNEIQAIEWKDFKKLSKAIFKNEG
                     SAKVFLVNSMIRPLSLYVKNEKRAKDEDKLKQYAEEHLKAILGLNKKENKIVLDAGRE
                     LMEMLQSSAKNAQHTSVGEQQPATESRTVDVNQARNLFPLISVQSLSTLGTTEDFSHS
                     SSELNGHLKSSPNNVNVSNNTSTQAQPGDLQASSKELLAFLHKASTVEEIEHNDKETD
                     TISSFPTANINSKDENYEEFESSSDESEYEDSQEVIDNANIEFDAKRNDENLLNVNKV
                     QTETPQQEIVKPTATTIASSGKPKMTILKRLDSQSKPNGQESQFVTAQKPKIRLLKRG
                     DKLEDLSSGGLSPKSQSVDRNSSSPAPVSLDTAPKTEPEYQSDNFNQDSAARSLLSIL
                     KKPSAKEKEDVTSSSPRFNNITENNEEHKVASSTASPVIQSENGTTKNIIHSLSESQQ
                     GSVSSPNNGSSELLDLLKKPQLTENFAHSPVSESSETNTKPSSELLSLLKKPKSTTAT
                     ASPTVNESVPAQTPYQMNQMNQMNPMNQGYQTQPQISHQAPQMQQMMPPQNYMPQNMP
                     FVPQMFPGQQQYVFQQPMNGYPIQNQPPMNPGQNMNGQTFNQSQELLNMLQKPNQNVN
                     SNPASPLPMQQEPQSASSELLSLLRR"
     gene            complement(<518183..>519571)
                     /gene="NCS2"
                     /locus_tag="KLMA_60246"
                     /db_xref="GeneID:34717464"
     mRNA            complement(<518183..>519571)
                     /gene="NCS2"
                     /locus_tag="KLMA_60246"
                     /product="cytoplasmic tRNA 2-thiolation protein 2"
                     /transcript_id="XM_022820904.1"
                     /db_xref="GeneID:34717464"
     CDS             complement(518183..519571)
                     /gene="NCS2"
                     /locus_tag="KLMA_60246"
                     /codon_start=1
                     /product="cytoplasmic tRNA 2-thiolation protein 2"
                     /protein_id="XP_022677321.1"
                     /db_xref="GeneID:34717464"
                     /translation="MTPCKRCTASEAVLVSRKEHFCNDCFIKFVSLKQRKQLMSDDYY
                     QDIFKMAYADKKRNQGEADLQNSKSNVLVALSLGSSSLSVLDVLNDTLCEQKKSHRGK
                     TGFQVEVLTLCHGSERDDVCEKIKGLKDKYHDNLDKIKFHVVERKEFFNGSSELQEFK
                     LFIDTYQTYVKDIPTDRKQELSVEDIILNAPNKTSREDLLNVIDTHLIKKFALQHGFK
                     AIVWGHSMTKLADEIISLTVKGRGAEIPHYLDNSSLDEEYNEGFRNLHPARDVLLSEL
                     DAYCHIKSLSSFCYQYTVQDTLFLDKFVDKSTKNVKLIKSMTMNELARQYFDNIEGDY
                     SNVISTVVRTGAKLAYPNMEMEHTNESKRCDVCNAIIYKNPVTWLDGITVNKAYEIQD
                     EEEQANYEAWRKANNSDSQLSLQELESEFPNKSNICYGCIATLTGMKNRKLEWIKRDE
                     TELSNILQEYEL"
     gene            <519862..>520269
                     /gene="COX23"
                     /locus_tag="KLMA_60247"
                     /db_xref="GeneID:34717465"
     mRNA            <519862..>520269
                     /gene="COX23"
                     /locus_tag="KLMA_60247"
                     /product="cytochrome c oxidase-assembly factor COX23"
                     /transcript_id="XM_022820905.1"
                     /db_xref="GeneID:34717465"
     CDS             519862..520269
                     /gene="COX23"
                     /locus_tag="KLMA_60247"
                     /codon_start=1
                     /product="cytochrome c oxidase-assembly factor COX23"
                     /protein_id="XP_022677322.1"
                     /db_xref="GeneID:34717465"
                     /translation="MADKSPESNKSPDAKTTANSTAEQQLQRDKRNLPENVDPSLQTN
                     KNQVDFAPEKADVNSFKFYPDDPESTLNRFRFSAKGASEYYDPCQESSKMSFKCLELN
                     NYDRDLCRDYFDAYRECKKQWLKARRQNREFWE"
     gene            <520861..>522702
                     /gene="TOM70"
                     /locus_tag="KLMA_60248"
                     /db_xref="GeneID:34717466"
     mRNA            <520861..>522702
                     /gene="TOM70"
                     /locus_tag="KLMA_60248"
                     /product="mitochondrial import receptor subunit TOM70"
                     /transcript_id="XM_022820907.1"
                     /db_xref="GeneID:34717466"
     CDS             520861..522702
                     /gene="TOM70"
                     /locus_tag="KLMA_60248"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit TOM70"
                     /protein_id="XP_022677323.1"
                     /db_xref="GeneID:34717466"
                     /translation="MSDNSISGFVSRNKKAILTAVAVSGVAAGAYYNYRKLQQEQKGS
                     SSGSGASKGSSKSGKKKNKKKKKDSSSSGSASPSGESKSSVPPYPVNAKGEPDLSNRE
                     SFTPEQIDSYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSIN
                     NFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGNFSEAMFDLSAVSLLGEYSGQSVE
                     QLLERNMNKQATKVLGEKLKENQGKESQLPSNTSLASFFGIFDPVTTFDDYDEENEAD
                     VVLKDALVNLFKSQTGCYEVADEKFTKAAELYRSQLEESPDNESLKKKAAIALEHVGI
                     FKFFKNDPITAHINLEESLSLHPRSSTYIYMALIMADKGEANQYKEYFDKALELDPNC
                     SAVYYHRGQMHFVVENFKEAGADFDKAKELNPDNIFAYIQSACLAYREDKFDDCETLF
                     SEARRKFPTAPEVPNFYAEILAAKNSLEAAIKQYDIAIKLEEALPGIHVGIAPMIGKA
                     TALSRNPTVENYVEATKLFEEACQIDPRSEQAKMGLAQLKLQQEEIDEAIQLFEDAAE
                     LSRSFEEKLQATTFAEATKVQKKIRADPFVKSKIDEALAAYRAQGLV"
     gene            <523549..>523782
                     /locus_tag="KLMA_60249"
                     /db_xref="GeneID:34717467"
     mRNA            <523549..>523782
                     /locus_tag="KLMA_60249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820908.1"
                     /db_xref="GeneID:34717467"
     CDS             523549..523782
                     /locus_tag="KLMA_60249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677324.1"
                     /db_xref="GeneID:34717467"
                     /translation="MGSRSPVTSLILSRNLMKTHKGAAKRWRKTANSFKRGKAGRNHG
                     NAGWSRNSLKSLSGRSLADASHIQRLKRLLPYH"
     gene            complement(<524010..>526949)
                     /gene="NMA111"
                     /locus_tag="KLMA_60250"
                     /db_xref="GeneID:34717468"
     mRNA            complement(<524010..>526949)
                     /gene="NMA111"
                     /locus_tag="KLMA_60250"
                     /product="pro-apoptotic serine protease NMA111"
                     /transcript_id="XM_022820909.1"
                     /db_xref="GeneID:34717468"
     CDS             complement(524010..526949)
                     /gene="NMA111"
                     /locus_tag="KLMA_60250"
                     /codon_start=1
                     /product="pro-apoptotic serine protease NMA111"
                     /protein_id="XP_022677325.1"
                     /db_xref="GeneID:34717468"
                     /translation="MTVELKRNLAETTGEVDGFDAKRAKLQDEDGDESMNSENSDNEP
                     NVGGIEMGSSLFNNNAKWQDTISKVVQSVVSIHFSQVAPFDSESAIVSEATGFVVDAK
                     LGIILTNRHVVGPGPFIGYAIFDNHEECDVIPIYRDPVHDFGFLKFDPAKLKYIKVQA
                     LELKPSLAKVGSEIRVVGNDAGEKLSILAGFISRVDRNAPDYGELTYNDFNTEYIQAA
                     AAASGGSSGSPVVNVDGYAVALQAGGSTEASTDFFLPLDRIVRALECIRQDKPITRGS
                     IQTQWMLKPFDECRRLGLSEEREKEARKMFPGKTGLLVAETLLREGPAYQKLQEGDTL
                     ISINDVPISSFIQVDDILDSNVGNEITITVQRGTKDVSVKCVVGDLHGITPSRYVEVC
                     GANFHELSYQMARFYALPVRGVFLASATGSFDLDPKEKTGWIIDSVDNKPTPTLDVFI
                     DVMKTIPDESRVIVKFHNLTDVQTQRITSVYIDRHWCSELRVYTRNDKTGIWDYEKIT
                     DRLPPVPIKTQKAKILDLPINGNEKLAKMSHSLCVVHSVIAITMDSMEPEPSSGCGLV
                     IDAEKGYVIVSRSFVPHDCLNTFISFAESVLVPAKVIFLHPTQNYAIVQYNPALVDAP
                     IHTPILADERLERGDETNFIGYMYSNTLVNSKTKVNGISSLSVPNDVIPRYRATNLEV
                     ISIDSSLSTKCKSGILADDDGTVRAIWLSCMGNKEKLYLMGLDVIDIKEVVDILKAGK
                     KPKVSIVDAGFDSISLLQARIRGVPDEWIRKMEEESKNRLQFISVTRNSYTTVEEKLE
                     PGDIILSVNGKLVKRMRDIGGVVASSEDSDIESVLSFKIVRDAKIMDLKIRTVQIEET
                     SRIVVFAGCVLQAPHHAVRQMKTSIPSQVYTVSRGTSSLALQYGIEVTNFITHVNDQE
                     TPDLDTFLKVVKEIPDNSYCKMRLVTFDDVPFAISLKTNYHYFPTVELKKNLTTGSWI
                     ENDISET"
     gene            complement(<527199..>528485)
                     /gene="ORC6"
                     /locus_tag="KLMA_60251"
                     /db_xref="GeneID:34717469"
     mRNA            complement(<527199..>528485)
                     /gene="ORC6"
                     /locus_tag="KLMA_60251"
                     /product="origin recognition complex subunit 6"
                     /transcript_id="XM_022820910.1"
                     /db_xref="GeneID:34717469"
     CDS             complement(527199..528485)
                     /gene="ORC6"
                     /locus_tag="KLMA_60251"
                     /codon_start=1
                     /product="origin recognition complex subunit 6"
                     /protein_id="XP_022677326.1"
                     /db_xref="GeneID:34717469"
                     /translation="MSTQQVRTCIKDLLGAKNESEVDWQEPNVKRLVSTTTTLYNVSA
                     GKVMLKSSEELARCHICALIACEKLVEKYDEGLVYTTDKIPLPPDQVTKLVGIFKRNI
                     WPNSPLKDDTGREVRFESGRSPSMKNSVVKNARFTGIDPKTLQEQLFETPTKSRKRKA
                     KSIEPLTQFDLSPTKGDQRSTTRRKLTFETESENTIDDKSSLPLPLLATPQNKSALIN
                     VRDVFGSTADFDPMSPTKQSPQRQSPVKDTPSPRKRRGKYNEWNMLYKKYHKPTTAEL
                     ITLCNEFELPSEVTHTIIREFSSHSTYLAYPTQLVCGLILLSAFVVFNHQRSQDPTID
                     IKLMKKMAAHMRTGNNEDIMEAIKITKELIDGEKWYRDLRVQHDYYDGSDFSNAIAIR
                     VGNMLQEEYEAVSEEQYANWKRKIMVDLSLRDGGSL"
     gene            <528745..>531708
                     /gene="SET1"
                     /locus_tag="KLMA_60252"
                     /db_xref="GeneID:34717470"
     mRNA            <528745..>531708
                     /gene="SET1"
                     /locus_tag="KLMA_60252"
                     /product="histone-lysine N-methyltransferase"
                     /transcript_id="XM_022820911.1"
                     /db_xref="GeneID:34717470"
     CDS             528745..531708
                     /gene="SET1"
                     /locus_tag="KLMA_60252"
                     /codon_start=1
                     /product="histone-lysine N-methyltransferase"
                     /protein_id="XP_022677327.1"
                     /db_xref="GeneID:34717470"
                     /translation="MSGYYRRGYSQYHGGGDRYRARYEYGPQHEYEYEYRETGARYDG
                     PMRREKRGNFTNGNYRRIPSKPRHESTAPKNPFGTRPLVAAKYDNPEFNEKYHYFEVT
                     EKRLRNQQSFNSWQTGKLPKDGYLVTLEGAEKPRAVLHAREPSQAAVDPRKSGATGGK
                     KSFRKLRTELVKTARVPYDSFYVGPEPPREIVVFPSSANQFPISVVLAETVIKNYFKT
                     FGEISHFEQFMDPNSALPLYVYLIRFTGPESQPDAPYKAAYLTAEKFKNHPYTVSGIK
                     FNVSLNHNKTLESIKEKFIKQNAARVSEVKKTKIAESQKQNMKKPPGTKTVPLDLTKL
                     VNNRPVLFVSSKITFVHRLNPADFKYQLRNYHWAKIIDHYSGIYIIFHNIENAKACLK
                     YESGSLRLTSRKTRAPVTIEFHLIEPKATTDTRQTFKQARDNQPKRIEYATKEDLLKV
                     ATRQILKDLRETLKRDILRRLVGPTIFETLNPTNYPEVVEKKMKLDEEKKKNREEIQR
                     RKTIKSAPTEFDIFSLYGPAYKTKKLKRDRPVDKDGSKDGAKDLHLRKKQKVEHLSHL
                     LNEDVTTSEDAADSLTAAEEAESSSESSGYESEDVLSDEAKKQSSVVTTPEQVESTNT
                     ATLSDERSKALLQYDSKYKPIVSEYPVPVYHPENFELDGTDKYSITMFQEILKDDEDI
                     SLLQNVIHERTDEKTSDVSPFLPYTMWKLYQQSEQLAVVRKTQLALNEGQLDSTLVSK
                     TGSFIAEGFRKIPDRLKKSYLPHRRKLTQPLNTVHNHQELNNTLNNGSESVTEEVETT
                     EQDNHNASSRLNRAFQRRFQQDIEAQRAAIGSESELLSLNQLTKRKKPVTFARSAIHN
                     WGLYALEPIAAKEMIIEYVGESIRQPVAEMREKRYIKSGIGSSYLFRIDENTVIDATK
                     KGGIARFINHCCEPSCTAKIIKVGGRKRIVIYALRDISANEELTYDYKFERETDEGER
                     LPCLCGAPSCKGFLN"
     gene            <531906..>534737
                     /gene="MSH1"
                     /locus_tag="KLMA_60253"
                     /db_xref="GeneID:34717471"
     mRNA            <531906..>534737
                     /gene="MSH1"
                     /locus_tag="KLMA_60253"
                     /product="DNA mismatch repair protein MSH1"
                     /transcript_id="XM_022820912.1"
                     /db_xref="GeneID:34717471"
     CDS             531906..534737
                     /gene="MSH1"
                     /locus_tag="KLMA_60253"
                     /codon_start=1
                     /product="DNA mismatch repair protein MSH1"
                     /protein_id="XP_022677328.1"
                     /db_xref="GeneID:34717471"
                     /translation="MLRRAAILLSGRQRPNLLRHYSTAKIPKVEKLSISLLNDAPIIE
                     TSSLPSETKRRTKKHDRGGMETKNSLPPALKYVRDVMDKYEGHVVITQIGSFYELYFE
                     HATNYAPKLNITLTSKETTNGRVPFAGFPVNQLNRHLKVLVKKHGLSVAVCDQFKTKS
                     SITNEGNLFSRRVTRIVTPGTFIDEACENFQENQFLLTIDFPENALKRSADLNTPVGL
                     CWCDISTGEIFVQQSYLKDLASSITRIKPMEILLDEDLLQFDLTSGEWYSELIELKKY
                     FVKYQKMPSKHRTIQSFEKLFANNYDDLGIVLSTFTQKEIAAFRNLLLYIEEHLPDMN
                     TNLELPQKQLITDIMQIDSRTSVALELHSTMREHHKKGSLLSTIRRTVTTSGTRLLTQ
                     WLSAPSMDIKEIKKRQALVEFFKNNISSTDILIRYLKETSDMSRILQRFSFGRGDSLE
                     LIQLSKSLQKCNEIATFLQQNMEHSSKTTEKVIQNISKELIFKDSIVDKVLSAINEDS
                     LIKQRNDKYEEGSIKNIQADVEESEKPLQDETWILLPNASKKLQKYHTNYRELLKEKD
                     KLLDWYKDWFTTRFKLKNVNLKQKNSGEFCIHISGGPANLAELDKYVDEQNQKLGVGE
                     KFHIIQRSKQTRWITHDKWESLSQQIEAIYLLIKTEEERTIKRFQKEYIDLSSQIRRL
                     SQTLDYIDVLSSFAKLAIEQRLVQPKITQGTDLDIKNGRHLVVESGMAQSSLESFTPN
                     DCRISSGELWVITGPNMGGKSTFLRQNAIIVILAQIGSYVPCESAVIGLVDKIFSRVG
                     SADDLYNEMSTFMVEMIETSYILKGASERSLAILDEIGRGTSRTEGVAVAYATLKYLV
                     EKNKCRALFATHFGSELSDTIKKTVDSKFIDSVSFYKTGIIGDDTNFFYDHKLKPGVC
                     YISDAVKVAKLAGFPKEALEIASEVLKQS"
     gene            complement(<534851..>536344)
                     /gene="NAF1"
                     /locus_tag="KLMA_60254"
                     /db_xref="GeneID:34717472"
     mRNA            complement(<534851..>536344)
                     /gene="NAF1"
                     /locus_tag="KLMA_60254"
                     /product="H/ACA ribonucleoprotein complex non-core subunit
                     NAF1"
                     /transcript_id="XM_022820913.1"
                     /db_xref="GeneID:34717472"
     CDS             complement(534851..536344)
                     /gene="NAF1"
                     /locus_tag="KLMA_60254"
                     /codon_start=1
                     /product="H/ACA ribonucleoprotein complex non-core subunit
                     NAF1"
                     /protein_id="XP_022677329.1"
                     /db_xref="GeneID:34717472"
                     /translation="MSDSREEVDLFEQALKDENAAQNEQTIPVQDVKETGDDAEKDAE
                     AKVGSGEGSSSAPGNESNGSSNSSSNSSSSDSDSGSSSGSSSESDSDSDSDSDSDSDS
                     DSDSDSKDAVEVEIEGEDEEPTASGPIRSVHEIAEEPVPALPEDFTIDEKATINEIGV
                     IKSAFEGNIIISATLSGEQRVLKEGSILCLQDKTLVGPLCEVFGPLQAPLYRVTFDRN
                     NEKSLQRFTDLKPKVGEKIYYVVPEARWVDTFELKQIKGTDASNGFDEELPEHEQEFS
                     DDEKEMEFKRKKKLAKKRKNDGSEATDESKKSSEHNQSKLRDPIPSSSKTTVTYKPRN
                     NRNNGYDNNNGNNGSNIPNKRQRNQRPHSEPPVPANPMQFPPNFPQMFNPQFPPPPMG
                     YMGHQQFPNMGLYQPPLQGFQGHPIPQQQPQQPQQPFNMYPYPGQQFQQGFPQQMGFQ
                     PQQFQQGFPQQPPAFPNYPQTSNNGQTQYPQNNNQGHQTGQYYNGNQ"
     gene            <537310..>539274
                     /gene="ESBP6"
                     /locus_tag="KLMA_60256"
                     /db_xref="GeneID:34717473"
     mRNA            <537310..>539274
                     /gene="ESBP6"
                     /locus_tag="KLMA_60256"
                     /product="uncharacterized transporter ESBP6"
                     /transcript_id="XM_022820914.1"
                     /db_xref="GeneID:34717473"
     CDS             537310..539274
                     /gene="ESBP6"
                     /locus_tag="KLMA_60256"
                     /codon_start=1
                     /product="uncharacterized transporter ESBP6"
                     /protein_id="XP_022677330.1"
                     /db_xref="GeneID:34717473"
                     /translation="MDPVYSGTPELDSSISASEISNISTDPQQLLPRSTRSMLEESNN
                     RRRMSEVSSIKTSDTTVSATASALSRNVTRTISAIKKAVEDDNKQSEVNENDLNKLLE
                     RNFDVDDALRLTETAQQQQADSMYQKYTVPLVKKNTSIKSSWSEDMSESDADHHHHTV
                     ANGPVEVTGEDENGATLNKVFTNKETNTLDLPPDGGYGWVCCLCVTLVMFSTWGSNSA
                     FGVFLAYYLNNSTFAGASKYDYALIAGMTVFFGQGLPPFVLLLMRIFGLKPVMFFGIV
                     VMCLGFVLASYSVSLWQLYLTQGFLSGVGISFIFAPATTVLPGWFLKKRSFAMGLSLV
                     GTGAGGVTYSLSVHKMLDNTGNQKLALRILAITCTVTCVVATILIRQRVPIKPTGIRN
                     WKANKQLFKDMFSGKIVRKWTVQLIAVWFTFALFGYNLMIFTLSPYAVASGLTAQQGS
                     SLTAILNGAQSVGRPLIGYSGDRFGRTNVTVFLTLLLSIFMFGFWIPAGTYSSLIGFS
                     ICVGLCVGVANVMNTVLVADIVGPTEFLPCWGYINLVGSPFMLVCEVIAQALTVSGSG
                     EPYLHTQIFAGCCFTAALFLVLCLREVTVKLRIEERRIANNKRLEEYDHTDEDDIDNQ
                     LLIERKLKYDYLLGPGIKKYFARMFYPMKV"
     gene            complement(<539352..>541877)
                     /gene="SPC98"
                     /locus_tag="KLMA_60257"
                     /db_xref="GeneID:34717474"
     mRNA            complement(<539352..>541877)
                     /gene="SPC98"
                     /locus_tag="KLMA_60257"
                     /product="spindle pole body component SPC98"
                     /transcript_id="XM_022820915.1"
                     /db_xref="GeneID:34717474"
     CDS             complement(539352..541877)
                     /gene="SPC98"
                     /locus_tag="KLMA_60257"
                     /codon_start=1
                     /product="spindle pole body component SPC98"
                     /protein_id="XP_022677331.1"
                     /db_xref="GeneID:34717474"
                     /translation="MEPNGHQIGENVRIMEPNFRTCVLHMIPSSIDENHSKQLIQDLY
                     YSIKTSSKDSVSKVLEYYRKLLIRNSNDIESWKHLEMFAGIMCQLSSPEEKEKYLMQC
                     LSLIDKSYQSDEREGVFLRPDIMSSQRKSNGSVYAESFENFEKISDRRSIMSYGGNVW
                     QATSSDTTLKSLSDPYFSTMVPKTDIIQSIPYLLLGTPSTLFELKDKTYYIPSNIPNG
                     ESQQLHNIIEAGLLYLNLRIKVELLKKSAVSGTLKVSFLTFIESRLREYNLFVNKFSS
                     HLHPNDPLCFVYQHICPEILKLRTCLSYVELLDKLRGEQLLTIFQSQKRNGDPILEKF
                     SSDAFAYLSQSYFEKLCNWVLSGRLDADNSDFFVQKTKSTEELDFTFIREKIPTFIPS
                     SCARKIYIIGKSLRFLEIYCNELEWVGNLSNKYAVQYQLLDLSTIDQRFIDIINQQYE
                     EINVRVNEVLKSKFYYFETIELLKDILLMGKSDFIYAIIQSSKSLFNQPSQLLESHYL
                     TRCLQVAVQQSSMRNRLNKSDHNTLINRLDARLLELAHGSSGWDVFTLDYLIDQPLSS
                     VININQHGSRREYLRIFNFLWRIKRNGYLYEQEWQRNSSLMKLFRKLNSRLPFLKDLL
                     NRMSMINVLKNQIQSFTKKIEIYCFENIIDKEYSQLITNLHQKESDNIKSMKVKVLKN
                     GVKVSSGILKPDLRYLKSLKEITADDMNDISSYDIEDLQRIHSTFLANILQHPLLYSG
                     TGAAIGTYTNQLYPTSLVLLMDMSYDYIRNYSELNNILHEICIQLNLDPNQHLYDSIG
                     RFNTVSKKLIEQWKDFENECNAYIKDLKSDQSTELNKLSRVLH"
     gene            complement(<542125..>544944)
                     /gene="FAR11"
                     /locus_tag="KLMA_60258"
                     /db_xref="GeneID:34717475"
     mRNA            complement(<542125..>544944)
                     /gene="FAR11"
                     /locus_tag="KLMA_60258"
                     /product="factor arrest protein 11"
                     /transcript_id="XM_022820916.1"
                     /db_xref="GeneID:34717475"
     CDS             complement(542125..544944)
                     /gene="FAR11"
                     /locus_tag="KLMA_60258"
                     /codon_start=1
                     /product="factor arrest protein 11"
                     /protein_id="XP_022677332.1"
                     /db_xref="GeneID:34717475"
                     /translation="MPDSQRSRSPLLKSLSSKDLRNKSQTRSAFTKQPSSDHQNFSAD
                     AALFHELDNLLSKKLHLADSNELHHEINGERHFGDSPNNDIDNNNGNSSNNNNNEPTD
                     LLDDASGSEEEEDSEFANVDEIDGPISPSSSSGSLKDYFHSHEPYNGTGSPKQQYSPK
                     SESTDSDKIITSDDMNNEEDNNLPVDDALKKLLQQKAEEIERGTSSHSFTKPTLDWEI
                     SDFYSLYHELSGWFIQKDYGSLKSTMVCFQKSYDTKKFVEEYSYAKNVVKELGAKLEI
                     NSMDIRSLLSLAYISFGTFQETSSYFHHLDILRRNNTLLMPISKILLECFKKHADCCR
                     TKNSNLQQYNALLFYSGSILFFMINIGIDQRKKQAKVVENFINSIEEADLMLFLTKYI
                     DHWRWKSRLSMRIRNIIILLHKLILLQFGDESYYDDTKEFVKKHHGIKKKDPNSCNLS
                     VSPLEYIAFREDITSRYPSSNIPKGDCPEIMDNPNSLSQFLEIPRPRSRSTSNQSLGE
                     PQVHISTPAPSPPASPTALNGMKTRKSFQANLSFPTFYPSSGDYDNGVMDELSHKLDI
                     AVDETVLPFSMQEAIEILSKSVHIKLSTKQLWHERELFMIQERGWCNNDSGLQNDPFD
                     YSLIHTQEASTMKRIEKYYADALPLFSSLVYVLLETIETCASNKVHFEKDYTEEEINE
                     LQPQLELIRSKEIAMESSCAILFLLLKWFKLSHCLKFEYLCSLIYDSKFIITGVNALY
                     KFTEEYQNKIFNKHLQPTHSFWSECSLFNIQYKDTLEISISGEQNKNLNIRMLNSEVY
                     ILRILSKITGKKTQRLKDLPLNISGIFKSLYYVFNLDIYHPILKIVHELAPFKNKRWR
                     ADHMDLVSGVFLHEKLSLTENWITGKDITGEINDAYGQEIALRAMLQFYNFYHYKKSM
                     KDCGYDDRTSNSFFSREAELISAPY"
     gene            <545377..>545934
                     /gene="LSM12"
                     /locus_tag="KLMA_60259"
                     /db_xref="GeneID:34717476"
     mRNA            <545377..>545934
                     /gene="LSM12"
                     /locus_tag="KLMA_60259"
                     /product="protein LSM12"
                     /transcript_id="XM_022820919.1"
                     /db_xref="GeneID:34717476"
     CDS             545377..545934
                     /gene="LSM12"
                     /locus_tag="KLMA_60259"
                     /codon_start=1
                     /product="protein LSM12"
                     /protein_id="XP_022677333.1"
                     /db_xref="GeneID:34717476"
                     /translation="MSISLENILGLKVKITNVLDNVTQGKVYSFNSSNNTITLIVSRK
                     NKTHTFKIIKTSFIKHLELVGEKHNPSSFKKDQIKPSYVNIDRVQNRLHHSIEEAKSK
                     EKLIGKNVTYEGQFIFDLINKTISDTRWKGKSIIVLDELEIAPPYQIKNVKPVPGKKD
                     VKSKDLIEKIVHTAWNRLENERKGG"
     gene            complement(<546100..>547404)
                     /gene="TEP1"
                     /locus_tag="KLMA_60260"
                     /db_xref="GeneID:34717477"
     mRNA            complement(<546100..>547404)
                     /gene="TEP1"
                     /locus_tag="KLMA_60260"
                     /product="probable phosphatidylinositol-3"
                     /transcript_id="XM_022820920.1"
                     /db_xref="GeneID:34717477"
     CDS             complement(546100..547404)
                     /gene="TEP1"
                     /locus_tag="KLMA_60260"
                     /codon_start=1
                     /product="probable phosphatidylinositol-3"
                     /protein_id="XP_022677334.1"
                     /db_xref="GeneID:34717477"
                     /translation="MTLTKFSPEHIIKSIYSSPFNQYKNGLGLVLDVSYITDNIIVCS
                     YPVMKYPKMFYRNSLVDLITYLDANHGRRNWKIYNLKSEVNDSDYTDDDFAMILETKR
                     LSEYSIPNDQGSASYRSRRMLEEHCKLSGIKEIFRATNDESKKPHQLIDPQLLRAGWL
                     DHAPPSFLHLQTLIEDIRSTILNGKVAVIHCKMGKGRSGTAVVAYLMTYLQLPRHEAQ
                     SLFLSTRFKTGISRGVTIPSQLRYLKYQEVFLRYDKSQRGQILQNLPSLQFKIISIEF
                     VNPIGQFSSEMLRKSNNTTVSMKIQTHSNEEEAHLKDLFSKECCTGKDSLRSFSTKQI
                     IVPNTVIDFSDIRLSFGLRSKKSQFINSISHLSSFSTFWMNLYWECVLQSKCLDNDSN
                     YVLPKNERFEFSILWEELDGFKGMSGKGLKLFDSVCVKWNTL"
     gene            complement(<547723..>548439)
                     /gene="NRK1"
                     /locus_tag="KLMA_60261"
                     /db_xref="GeneID:34717478"
     mRNA            complement(<547723..>548439)
                     /gene="NRK1"
                     /locus_tag="KLMA_60261"
                     /product="nicotinamide riboside kinase"
                     /transcript_id="XM_022820921.1"
                     /db_xref="GeneID:34717478"
     CDS             complement(547723..548439)
                     /gene="NRK1"
                     /locus_tag="KLMA_60261"
                     /codon_start=1
                     /product="nicotinamide riboside kinase"
                     /protein_id="XP_022677335.1"
                     /db_xref="GeneID:34717478"
                     /translation="MTTTKVKLIAISGCSSSGKTTLAKFLANAIPGCILIHEDDFYKP
                     DSEIPINEKYGVADWDCPEALDLDAFKRELDLIKTTGSIKTKLIHNENVDDIGKFNIK
                     QEDWDALRAKLSSVIESDLKVVLVDGFMIFNDEELMRKFDIRIFVRAPYEVLSRRRHA
                     RAGYKTLESFWVDPPYYFDEFVYRAYREEHKHLFVNEDVEGSLRSDAGLFELINDDET
                     EITTALNTIADYIVSHLDAN"
     gene            <548764..>549447
                     /locus_tag="KLMA_60262"
                     /db_xref="GeneID:34717479"
     mRNA            <548764..>549447
                     /locus_tag="KLMA_60262"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820922.1"
                     /db_xref="GeneID:34717479"
     CDS             548764..549447
                     /locus_tag="KLMA_60262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677336.1"
                     /db_xref="GeneID:34717479"
                     /translation="MSEFINENPDVIDETLLPSRKQDPLTNELLDNIPGSLDVNRKRQ
                     LLQIGSMESGVVQNIGLLEKLLHQQLSIKNSTSLPDLTESETDNESESENEVEDPIDS
                     QEIYDLIAHISDPEHPLTLGQLSVVNLADIEVHDNGDKTKMAEVIVRITPTITHCSLA
                     TLIGLGIRVRLERSLSPRFRITILLKKGTHQSENQVNKQLNDKERVAAACENDQLLGV
                     VSKMLSTCK"
     gene            <549726..>551013
                     /gene="CPT1"
                     /locus_tag="KLMA_60263"
                     /db_xref="GeneID:34717480"
     mRNA            join(<549726..549775,549888..>551013)
                     /gene="CPT1"
                     /locus_tag="KLMA_60263"
                     /product="cholinephosphotransferase 1"
                     /transcript_id="XM_022820923.1"
                     /db_xref="GeneID:34717480"
     CDS             join(549726..549775,549888..551013)
                     /gene="CPT1"
                     /locus_tag="KLMA_60263"
                     /codon_start=1
                     /product="cholinephosphotransferase 1"
                     /protein_id="XP_022677337.1"
                     /db_xref="GeneID:34717480"
                     /translation="MGVFIPHENLVKLKEYKYQSEDRSIISKHILKPFWSQFVKIFPL
                     WMAPNVVTLSGFGFIIINVLTVLYLNPTFDQEQPSWAYFSYALGLFMYQTFDACDGTH
                     ARRTGQSGPLGELFDHCIDALNTTLSMLVFCSAVGIGFDFMMLVCQFALLCNFYLSTW
                     EEYHTHKLFLSEFSGPVEGILMIVFGFILTGIFGPQAVWHRELFVLNFADTSFVVESI
                     HVMFFFSGLGLIFNILSARRNVVEYYRENSYSESEVKSNIRKSDKGLLPFFAYFSSVF
                     LVAFVQPSFIGLPYVLSVGLTMAFTVGRIIVAHLTKQEFPMNQPVMFVPSLQLIIYLV
                     FVKGFHLTSENIVHNLNWFGFGLTLGIHSMFITEIVYEFTNYLDIYTLSIKHPKKEE"
     gene            complement(<551280..>551738)
                     /locus_tag="KLMA_60264"
                     /db_xref="GeneID:34717481"
     mRNA            complement(<551280..>551738)
                     /locus_tag="KLMA_60264"
                     /product="mitochondrial import receptor subunit TOM22"
                     /transcript_id="XM_022820924.1"
                     /db_xref="GeneID:34717481"
     CDS             complement(551280..551738)
                     /locus_tag="KLMA_60264"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit TOM22"
                     /protein_id="XP_022677338.1"
                     /db_xref="GeneID:34717481"
                     /translation="MVELTELTEETPIHQTAGETAADPAVDTLQHLDESDEEEDYSSD
                     DEDFYEDETIYERLVALKDIIPPQKRKTISGFYNGTVSTFRSLFSKGGNLLWAVTTSA
                     LLLGVPLSLSILAEQQLIEMEKSFDLQKDANDILTAGEGTAAPVTPAVAA"
     gene            complement(<552069..>555242)
                     /gene="KRE33"
                     /locus_tag="KLMA_60265"
                     /db_xref="GeneID:34717482"
     mRNA            complement(<552069..>555242)
                     /gene="KRE33"
                     /locus_tag="KLMA_60265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820925.1"
                     /db_xref="GeneID:34717482"
     CDS             complement(552069..555242)
                     /gene="KRE33"
                     /locus_tag="KLMA_60265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677339.1"
                     /db_xref="GeneID:34717482"
                     /translation="MGKKAIDSRIPALIRNGVQTKQRSFFVIVGDNARNQLPNLHYLM
                     MSADLKMNKSVLWTYKKKLLGFTSHRKKREQKIKKEIKRGTREVNEQDPFETFISNQS
                     IRYCYYKETEKILGNTYGMCILQDFEALTPNLLARTIETVEGGGLVVIMLKSLSSLKQ
                     LYTMTMDIHSRYRTEAHNDVVARFNERFILSLGSNPNCLVVDSELNVLPISGGKNVKP
                     LPPKDDDELSPKALELKELKESLEDVQPAGSLVALSKTVNQAHAILTFIDAISEKTLN
                     STVALTAGRGRGKSAALGISIAAAVSHGYSNIFVTSPSPENLKTLFEFIFKGFDALGY
                     QEHIDYDIIQSTNPSFNKAIVRVDIKRDHRQTIQYIIPNDSHVLGQAELVVIDEAAAI
                     PLPVVKKLLGPYLVFMASTINGYEGTGRSLSLKLIQQLRNQANSTGREESETSIVSRD
                     SKMQEVQTSGRTLKEVVLDEPIRYAPGDPVEKWLNKLLCLDVQLIKNPRFAARGTPHP
                     SQCNLYIVNRDTLFSYHPVSENFLEKMMALYVASHYKNSPNDLQLMSDAPAHQLFVLL
                     PPIDPKDGGRIPDPLVVIQVALEGEISKDSVRNSLARGQRAGGDLIPWLISQQFQDEE
                     FAGLSGARVVRIATNPEYASMGYGSRAIELLKDHFEGKFTDLSEDAAPKDYTIKRVDD
                     KELKNANLLNDEIKLRDAKTLPPLLLKLSEQPPHFLHYLGVSYGLTKPLHKFWKNCGF
                     VPVYLRQTANDLTGEHTCVMLKVLEGRESKWLAEFSKDFHKRFLALLSFEFRKFTALE
                     ALNVIESAKKGEALQDSSEDRFNGSQSKSLTKDQLDALFSPFDLKRLESYANNLLDYH
                     VIVDLLPMLALLYFSGKLGNGVSLSSVQSCILLAIGLQHKSIDDITKELNLPSNQTIA
                     MFSKIIRKFTSYFREVLSESIEKTLPKIKDDVIAEMDGEVVETFNAAEVIDKMEDDLE
                     NAGNEAISAMKEKQKELINSLNLQKYTIDDTAEGWTESAKDLEKAVKSQGTVAIKSKK
                     KRKQETAEQIYNEEMNLNKKSKKSSKK"
     gene            <555912..>557672
                     /gene="NDT80"
                     /locus_tag="KLMA_60266"
                     /db_xref="GeneID:34717483"
     mRNA            <555912..>557672
                     /gene="NDT80"
                     /locus_tag="KLMA_60266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820926.1"
                     /db_xref="GeneID:34717483"
     CDS             555912..557672
                     /gene="NDT80"
                     /locus_tag="KLMA_60266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677340.1"
                     /db_xref="GeneID:34717483"
                     /translation="MISTLQQFIDENQDIDGEDILDDEEKQSADGEVIKTFRNADGSV
                     SSYFDKRKVRIAPRSTLQFKIGPGFTPVVPNHNIINEKGRIQDVKLEPRIDRGFDFID
                     DEWIGYKRNYFTVVTSFDTPGTGHLDFMKNVYYTDDGRNIEYFATKLAAKCLEDDKLI
                     NLVQHTAKRDKGPQFAPPVHAIAPAKLPKHQIIRDASNVRNESKMKKFDSYFFLHKEE
                     VGSDCSPDSLITNYPVNPIKKVARYERIQFASSIALKKTSQQNRRFLLLVVLGCYVKG
                     KHAMIDETSPYHELDHYDEETDMTFVPILMEKTPPLIIRGRSPSNYCQQIKVMHTKKT
                     DFEASSQKSTENHLETTIEKKERKKRTRKNKNECSNTSGAIQYENGTHNANKIPTLLT
                     NGLPSTFEISPNGGSMRIKNIQLHSSSTENSFPRGLQSESLSVAYLSNSATPIQDSIF
                     KKRKLNISKPAVLEPNLEEPLDDLTDNIFNTISFDENSLLKDSRDLLSTTSVFLLKHV
                     TYNVAEPPVVAIPRTMLPNKMEISYCLNDHSSSFAEYRPPSTAHRRVPGSRRLLTASG
                     NPSDLLNPADWSDGPSIFRH"
     gene            <558242..>558787
                     /gene="FYV6"
                     /locus_tag="KLMA_60267"
                     /db_xref="GeneID:34717484"
     mRNA            <558242..>558787
                     /gene="FYV6"
                     /locus_tag="KLMA_60267"
                     /product="protein FYV6"
                     /transcript_id="XM_022820927.1"
                     /db_xref="GeneID:34717484"
     CDS             558242..558787
                     /gene="FYV6"
                     /locus_tag="KLMA_60267"
                     /codon_start=1
                     /product="protein FYV6"
                     /protein_id="XP_022677341.1"
                     /db_xref="GeneID:34717484"
                     /translation="MADKKPPTFVKEGLADLDKQKRNEQINKEVGELVSRKSLADQLR
                     ENSKKKRHQFQKLTKEKNSFTRLSTEDLNHINTCKSKEIEEYRSFSNWADLEEKKRLR
                     RLEQIKQDTKTVGVSIDSDTTSSSLPSSSGTSIKKESIPTAIKVRKLKTKVANKKSLG
                     IVSLSRKPTLKPSPKPKPKEK"
     gene            <559211..>560326
                     /locus_tag="KLMA_60268"
                     /db_xref="GeneID:34717485"
     mRNA            <559211..>560326
                     /locus_tag="KLMA_60268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820928.1"
                     /db_xref="GeneID:34717485"
     CDS             559211..560326
                     /locus_tag="KLMA_60268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677342.1"
                     /db_xref="GeneID:34717485"
                     /translation="MSIPTTQKAVLIEGDAPVVKTGVPVPELTEGTVLIKVEAVAGNP
                     TDWKHIAYKIGPQGSILGCDVAGTIVKFGPNTSSDNLKVGDTVYTLLHGASVRHPENG
                     GFAEYARAFPDMLYKADLTHTSENEIPEGTVKHFETAASLGVSLTTAGVALSFHLGNK
                     LLWNPPTPQHDHPILIWGGAAAVGQQLIQVAKKLNAYTKIITVASKGKEELLKSYGAD
                     DVYDYKDPDVIKKIKSKYTNIRHAIDAISNQDTFVQAYRTLAEEGDVTLLHLTMLSMR
                     DIPEAERRDNVKIEGALLYLAFGTDVPFGAITIPAVPAYKPATTGFIKFIAPHVQDGS
                     IRHIPIKVFPNGLDDVPALTQGIKEGKNQGVKFVARL"
     gene            complement(<560913..>561719)
                     /locus_tag="KLMA_60269"
                     /db_xref="GeneID:34717486"
     mRNA            complement(<560913..>561719)
                     /locus_tag="KLMA_60269"
                     /product="lysine-rich arabinogalactan protein 19"
                     /transcript_id="XM_022820930.1"
                     /db_xref="GeneID:34717486"
     CDS             complement(560913..561719)
                     /locus_tag="KLMA_60269"
                     /codon_start=1
                     /product="lysine-rich arabinogalactan protein 19"
                     /protein_id="XP_022677343.1"
                     /db_xref="GeneID:34717486"
                     /translation="MKFSIITTIAVTSLSVVRAGNHTEVPPAPATDTSEIPCETTSEV
                     PPPAPPVQNTTAPPVVPKTETTEIPCETTSEVPPPPAPPIKNTTVPPIAPKTETTEIP
                     CETTVVPPAPKFNSTVPVPPPSKPTTPSVPGKPTPVIPKNTTVITATCSSCAPGSPGS
                     PSSPSSPGSPGSPGSPGSPGSPGSPGSPGSPGSPGSPGSPGSPGSPGSPITTHNNIPP
                     APTGPGGSPGKGCGPGSNCSTPLTYTENGAGKLGSNIVGAGLAVVGAMLL"
     gene            <563200..>563484
                     /locus_tag="KLMA_60270"
                     /db_xref="GeneID:34717487"
     mRNA            <563200..>563484
                     /locus_tag="KLMA_60270"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820931.1"
                     /db_xref="GeneID:34717487"
     CDS             563200..563484
                     /locus_tag="KLMA_60270"
                     /note="helix-loop-helix DNA-binding domain"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677344.1"
                     /db_xref="GeneID:34717487"
                     /translation="MSIGQNRLNTNVGKTKSERKSRTKFDPAEQRYKHVSCEKNRRSS
                     IRCSYDKLVDLVPGLTDKERRSEWKIYVKSMYILRLFTTRVIITKGYLLT"
     gene            complement(563829..563902)
                     /locus_tag="KLMA_R609"
                     /db_xref="GeneID:34718768"
     tRNA            complement(563829..563902)
                     /locus_tag="KLMA_R609"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:34718768"
     gene            complement(<564209..>565351)
                     /gene="ETR1"
                     /locus_tag="KLMA_60271"
                     /db_xref="GeneID:34717488"
     mRNA            complement(<564209..>565351)
                     /gene="ETR1"
                     /locus_tag="KLMA_60271"
                     /product="probable trans-2-enoyl-CoA reductase"
                     /transcript_id="XM_022820932.1"
                     /db_xref="GeneID:34717488"
     CDS             complement(564209..565351)
                     /gene="ETR1"
                     /locus_tag="KLMA_60271"
                     /codon_start=1
                     /product="probable trans-2-enoyl-CoA reductase"
                     /protein_id="XP_022677345.1"
                     /db_xref="GeneID:34717488"
                     /translation="MSSFLSKRFISTTQRAMSQLPKAKSLIYSSHDQDVSKILKVHTY
                     QPKGSAESSILLKTLAFPINPSDINQLEGVYPSKPEKVLDYSTEEPSAIAGNEGLFEV
                     VSVPSGVKNLKAGDRVIPLQANFGTWSTYRTCESENDLIKIEGVDLYTAATIAVNGCT
                     AYQMVNDYIEWDPSGNDWLVQNAGTSSVSKIVTQIAKDKGIKTLSVVRDRDNFDEVAE
                     KLEKKYGATKVISESQNGEREFGNEVLPKILGPNAQVKLALNSVGGKSCTNIARKLSP
                     NGLMLTYGGMSKQPVTLPTGLFIFNSIRSHGFWVTANSKRDPENKRKTVDAVVKLYRD
                     GKIISPKEDIRTLEWDVNNLSDEGVLDLVNRGIATKGAKNMVVLKW"
     gene            complement(<566178..>568283)
                     /gene="MNN2"
                     /locus_tag="KLMA_60272"
                     /db_xref="GeneID:34717489"
     mRNA            complement(<566178..>568283)
                     /gene="MNN2"
                     /locus_tag="KLMA_60272"
                     /product="protein TTP1"
                     /transcript_id="XM_022820933.1"
                     /db_xref="GeneID:34717489"
     CDS             complement(566178..568283)
                     /gene="MNN2"
                     /locus_tag="KLMA_60272"
                     /codon_start=1
                     /product="protein TTP1"
                     /protein_id="XP_022677346.1"
                     /db_xref="GeneID:34717489"
                     /translation="MNSSLGRTISSKWIQFLHYFTRRARLVKKHNCVILAIIIIVLIF
                     SLSRTDDIKDLFDLSESFGSDSYDSDLSSSDDITKLLPGSSDGHSDADWKSGAGSQTG
                     ATTVPAELKNFYNEVTRVLNTTVLAGEIDSHKPEGCDLKDTGVEDTDKEKLSHLTEEY
                     LLKCLSLPEDKIKELKEGHSTFKRYISEKLMPIADSIKEKGIGYKGQGITIVGGGKYT
                     LMALPTIKSIRMNSGVKLKNTLPIEIVIPPLDEGDRGVCETIIPSLDPTGLTKCVYLS
                     DYIDRDILKHVRGYQLKSLSLLISSFEKTLLLDADNYVVNSIDKFFDTSIFKDTGMIL
                     WPDYWRRVHSPRVYDIADIGIDRRRVRFSADYISNPKLFDPTDASKSPFHDLEGAIPD
                     GGTESGQLLVDKTMHLDTIILALYYNYNGPSYYYPLLGQHLAGEGDKDTFILAATALK
                     HRYYQVRTPVKPQGYWGLNTNEVRIHDDKIDKVDSSKKSFRGTAMIQHDYVQDKELDS
                     VAGDFLREVLQEKEKSFRLEWIKTHKDDFKDMNEQDALKKASENNEISNKFWESMKGK
                     YTVNDFFSFFKMNTPVFVHSHLPKYDPWELAMSQDFMYDGKKSEKNPEYHPEEKGHFR
                     IYSSTFKDMTNYDLELANWKVFETVLCKVEDNYKKFSYLSKVIDRTENPVQSVKEMCT
                     YISERVEYLKSSTWENSIS"
     gene            <569144..>569680
                     /locus_tag="KLMA_60273"
                     /db_xref="GeneID:34717490"
     mRNA            <569144..>569680
                     /locus_tag="KLMA_60273"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820934.1"
                     /db_xref="GeneID:34717490"
     CDS             569144..569680
                     /locus_tag="KLMA_60273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677347.1"
                     /db_xref="GeneID:34717490"
                     /translation="MNEQGLNKGKMLRYFSMIRKSLANSGELYILGEDLIDKFVPDNY
                     QLSCDSFYFKAHEKTISNLEPIDSLIERKLFTPAMSGWQWQVNKQKALESQVLREIKN
                     EKPEDHLKRFTRSSKKRRDTKAEIREDEVPSPVSLDGQEEDDDVFRQKQKHHAFISLS
                     RLRLAETVIPEQAAYKVL"
     gene            complement(<569771..>571444)
                     /gene="YPK3"
                     /locus_tag="KLMA_60274"
                     /db_xref="GeneID:34717491"
     mRNA            complement(<569771..>571444)
                     /gene="YPK3"
                     /locus_tag="KLMA_60274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820935.1"
                     /db_xref="GeneID:34717491"
     CDS             complement(569771..571444)
                     /gene="YPK3"
                     /locus_tag="KLMA_60274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677348.1"
                     /db_xref="GeneID:34717491"
                     /translation="MGIFNLDDDFKLLKVNDTCAIINSGLDEDDNNPLYNRAQSNTGV
                     TTDHVLWHKNLLRMDSSALPPKDLEASEDAAISDTEDISIPNILMPPSSNDTLQQSSI
                     SSRRRSSVYNKLVVNPAQNTVRLSLSMEQAVDNDCGGDVFSLSSVEENRHRRGSSFSR
                     NNEIRVLDDFVPIRCLGEGAYGRVLLVKDVITSKLYAMKQLKKAEILISEDSLEENQA
                     KTTVEKRVERTLAERTILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEL
                     GTLSEDTVSFYASELSCALKFLHSKGIVYRDLKPENCLLNEKGHLVLTDFGLSKKSVY
                     DEGGDLEKGENVTQLYSIIGTPEYCAPEILEGEPYSQNCDWYSLGCLVYDMLIGKPPF
                     TGANHKVILNKIKKEKNGAKIPSYLSDGMKDYLGALLKKDPAKRWDVDKYWSQDGPKT
                     KKKKAGSAKTTSYINHFIFRKIDWKSLMIGDLQRTSVGPILPVITDWELAENFDSEFT
                     EKRLDTDLHDNGIDINKPPGKKESVYGTSTDYFKGFSYVASKSYLERHF"
     gene            complement(<571992..>573335)
                     /gene="CDS1"
                     /locus_tag="KLMA_60275"
                     /db_xref="GeneID:34717492"
     mRNA            complement(<571992..>573335)
                     /gene="CDS1"
                     /locus_tag="KLMA_60275"
                     /product="phosphatidate cytidylyltransferase"
                     /transcript_id="XM_022820936.1"
                     /db_xref="GeneID:34717492"
     CDS             complement(571992..573335)
                     /gene="CDS1"
                     /locus_tag="KLMA_60275"
                     /codon_start=1
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="XP_022677349.1"
                     /db_xref="GeneID:34717492"
                     /translation="MAGKKKSHRTHPGSAASSPQKSRKDSELVNETHHRHQENEKAQE
                     KAVSKNEIKKDSKLYNFAVRTVWTFVMIAGFFFILASGHFWCIILILACQIATFKECI
                     AVTGRSGREKNLPLTRTLNWYFLFTTIYYLDGKSLFKFFDESFVKYSALNFIASNHKF
                     VSYCLYVLGFVMFVCSLRKGYLKFQFASLCITHMVLLLVVFQAHLIINNVINGLIWFL
                     LPCGLVIVNDIFAYLCGITFGRTKLIEISPKKTLEGFLGAWFFTAIASVLLTRLLTPY
                     YYMTCPVTDIKTNVFTPLTCELNPVFVPQDYRLPPIIFEKIGIEVVTLKPIYLHALNL
                     ATFASLFAPFGGFFASGLKRTFQVKDFGDSIPGHGGITDRVDCQFLMGSFMNLYYETF
                     ISENRITVGTVVSTILMNLDPAEIVQLIQTLNKALYDSDIMKKDVYDKITELYNS"
     gene            complement(<573604..>575181)
                     /gene="PRP9"
                     /locus_tag="KLMA_60276"
                     /db_xref="GeneID:34717493"
     mRNA            complement(<573604..>575181)
                     /gene="PRP9"
                     /locus_tag="KLMA_60276"
                     /product="pre-mRNA-splicing factor PRP9"
                     /transcript_id="XM_022820937.1"
                     /db_xref="GeneID:34717493"
     CDS             complement(573604..575181)
                     /gene="PRP9"
                     /locus_tag="KLMA_60276"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor PRP9"
                     /protein_id="XP_022677350.1"
                     /db_xref="GeneID:34717493"
                     /translation="MPNLCFEQKRGILEELEIIEDAISARLRRNPEIFYKFNDTLRTL
                     GESHLEVPKSDVTSNRIYKSKKSKRSRKQMKAQELEISLFLGRYRKLLKCLQQDSLNP
                     VLVDQFKDDDLTFEKFEKITSEIINNSSQESQSLEETKKKYQMFSSSIGNTKNILSSF
                     GQIIDVQKSFDRNEYFGMYLELSGLFSSWLNIIKKADYTMTMFIHLLQSFTTYDFLFN
                     PLIERNTKEYRLLITNVVKYYKSFFSKAYPLIDKEILSKKIQDDFTKYISIGIPVPQS
                     SEEGKLFCVVGDKEFDNQNALNDYLNSKAYADILSKNRKNLLGEFTFHFYSQFFSKEL
                     QNTLSFVERKLAFTDEELREEMDKLQEQYESSLYGPDEKEDKPAYQEADDEKKQTKEV
                     DPSNPFSLPLGPDGFPIPRWLYKVQGLDVKYTCEICGNQIYHGRREFEKHFQQKKHTE
                     GLRSLGITPSPAFKDISTISEAKTLWESMNSKNSSNKISATPGLSATAMALEEEDSEG
                     NVMSSQVYEELKKQGLL"
     gene            complement(<575487..>578432)
                     /gene="DBP10"
                     /locus_tag="KLMA_60277"
                     /db_xref="GeneID:34717494"
     mRNA            complement(<575487..>578432)
                     /gene="DBP10"
                     /locus_tag="KLMA_60277"
                     /product="ATP-dependent RNA helicase DBP10"
                     /transcript_id="XM_022820938.1"
                     /db_xref="GeneID:34717494"
     CDS             complement(575487..578432)
                     /gene="DBP10"
                     /locus_tag="KLMA_60277"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DBP10"
                     /protein_id="XP_022677351.1"
                     /db_xref="GeneID:34717494"
                     /translation="MVVSRKRTRTLEEVNSSDDEDAYDIAGDIALNVDSDEDDISGDE
                     SQEEGPIQDVIEFSSDEDENENENAHKNQKGKDKGKSKQAAKSSTLTANKKFPSLELS
                     DNEGGKDDESDDDMNDYFNTTSEAASKHKKGSFASFGLSKLVLVNISKKGFRQPTPIQ
                     RKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKVHSAKIGVRAVILSPSRELALQ
                     THRVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLK
                     SVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLTNPV
                     LVRLDAETKISENLEMLFVSIKKDEREASLLYLLQEAIKIPVATDEEIRKLRQQNELD
                     SDSDDSDSEKKKKAKKSKKLKRRLPSANEMPSEKATIVFVPTRHHVEYVTTLLKNCGY
                     LVSYIYGTLNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKI
                     FVHRVGRTARAGNRGWAFSIVSENELAYLLDLELFLGKKILLTPMYEASCQLLKKKAE
                     SEGNFNFTNPKISYTTRMVLGSCPRQELDNMGELYNNMLKSDFDLKTMKGVAMKAEKL
                     YFRTRTPASAESVKRSKEIMRSGWDEQNLYFGKNAEKEKLEFLAKLQNRAKKETVFEF
                     AGNQDDEMSLLMKKRRKQIAPIQRRAKERQELLEKERIAGLRHSIEDEILKGEENEVG
                     YSVSDEVLKEFEDADALLQEQENNKKAKKKSFRDPTFYLSHFAPANEIQDKQLQISSG
                     FTNDASNAAFDLGGDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYIIGESGQKIPA
                     SFRSGKFQEWSKARKIAPLKVGARESTIPSNLLADPTSSSTERTVRGKFKHKMQKAPK
                     LPDKHRDDYAIQKKKVEAALERGVRVKGYNGPGVKPELKSVDEIRKLREIKEKKKQKN
                     ARPSKKRKF"
     gene            <579120..>580367
                     /gene="SLM3"
                     /locus_tag="KLMA_60278"
                     /db_xref="GeneID:34717495"
     mRNA            <579120..>580367
                     /gene="SLM3"
                     /locus_tag="KLMA_60278"
                     /product="mitochondrial tRNA-specific 2-thiouridylase 1"
                     /transcript_id="XM_022820939.1"
                     /db_xref="GeneID:34717495"
     CDS             579120..580367
                     /gene="SLM3"
                     /locus_tag="KLMA_60278"
                     /codon_start=1
                     /product="mitochondrial tRNA-specific 2-thiouridylase 1"
                     /protein_id="XP_022677352.1"
                     /db_xref="GeneID:34717495"
                     /translation="MSKIGRKFVEICRNRTVPGYKLQKMPSKFDNIVVGISGGVDSSL
                     CAALFAGYPNLHGVYMQNWGKDQSLTKPEEEPCYERDWKDAQKVAKHLNIPIDFVNFE
                     KDYWLKVFEPMLEQYNLGYTPNPDVGCNKFVKFGSLMDHLDEKFGKDNYWLVMGHYAR
                     VLEYENSKEKDNNHLLRAFYGKKDQSYYLSQVPVSALKQIILPIGHLTKPEVRDMASE
                     LNLHTSTKPDSQGICFVNNSQHGKFKNFLQEYLPSEPGNIVTIDRETGEKKVWGQHSG
                     LWSYTIGQKIGLSLPQGDPRYQGAWYVSDKRRDTGEIVIVKGRDNEELYSDSVHVKHF
                     KILSQENLSDSLLNESIKNGTLYMQFRSLQKPVKAIAYQWVNHNEFSLKLASKERAMA
                     PGQYCCLYANDRVLGSGIIDSVN"
     gene            <580696..>581787
                     /gene="MET22"
                     /locus_tag="KLMA_60279"
                     /db_xref="GeneID:34717496"
     mRNA            <580696..>581787
                     /gene="MET22"
                     /locus_tag="KLMA_60279"
                     /product="3'(2')5'-bisphosphate nucleotidase"
                     /transcript_id="XM_022820941.1"
                     /db_xref="GeneID:34717496"
     CDS             580696..581787
                     /gene="MET22"
                     /locus_tag="KLMA_60279"
                     /codon_start=1
                     /product="3'(2')5'-bisphosphate nucleotidase"
                     /protein_id="XP_022677353.1"
                     /db_xref="GeneID:34717496"
                     /translation="MAVQFSKELAVATQAVRKASLLTKRVQSAVISDENSTITKSDNS
                     PVTIGDYSAQAVIINTIKANFPNDNVVGEESSTGLTDSFVDEILNTIRGNDEEYPKVF
                     GDIEQNGDEKVDFINKDFPLNSIDEVKRVIDFGNYAGGNKGRFWCLDPIDGTKGFLRG
                     EQFAVCLALVIDGKVVVGVIGCPNLKLSNFGAEDTSDNLPAGYIFRAVRGNGAEYSVT
                     TESNWTPIHVRSIEDTSDLVSLEGVEKSHSAHDEQAIIKNELGVTKSQHLDSQVKYCV
                     LAMGLGDLYLRLPIKMSYSEKIWDHAAGNVIVEEAGGIHTDALQNVPLDFGQGRTLKT
                     KGIIASCGPQALHTRVVTTSANILSNKST"
     gene            <582507..>585074
                     /gene="GPR1"
                     /locus_tag="KLMA_60280"
                     /db_xref="GeneID:34717497"
     mRNA            <582507..>585074
                     /gene="GPR1"
                     /locus_tag="KLMA_60280"
                     /product="G protein-coupled receptor GPR1"
                     /transcript_id="XM_022820942.1"
                     /db_xref="GeneID:34717497"
     CDS             582507..585074
                     /gene="GPR1"
                     /locus_tag="KLMA_60280"
                     /codon_start=1
                     /product="G protein-coupled receptor GPR1"
                     /protein_id="XP_022677354.1"
                     /db_xref="GeneID:34717497"
                     /translation="MNVSLSCDNSSLSPGTLEHTRIMRYSHLNTTTVNQVLGLPGLFS
                     TFTKHELRKLRIIAISASVSSIVACIVGLYLLGSIDRRRKVFRHHLILFLLICDFLKA
                     IVLLIYPVVILRDNKVYGKPGFYNTVGWLTAYATEGADIAIFIFAIHFAILIFKPNWK
                     WKNPNTGNVEGGFYRWRRFMYPLTALTPTVLASLAFINFEDYNETVIREDSNVILDNN
                     NYHFSFQAKMGGYKPLSAWCYLPPVPVWYKLVLSWGPRYFIFLTICTLYISIYTFVTR
                     QSRKIKAELREFQHSNQKPLLRKASLKGPLNLITRFSIATIRFLRKIAAAIAGFFFLQ
                     IYDDNESHEEELDREQSASRAGTPGLTTKNDLKDVFSNKFTYVPDDVDIEDGYNGDNN
                     NGLHIFNYPRQSETKKATIDNSGIAQPLPAHISSSSKNILSPESLSNQVPNLSNKSVK
                     TPINWDLSEPGPKDPSGMETSTFDMDPEKLEHVPEHEVTGVKHKFQTQTYIQFKNRRD
                     QIKRQLKSIFIYPVAYLLLWVFPFAVDCSQYRYEIYHGPIVWLAYIATFMQPLNGVVD
                     VAVFMFREMPWRYSWACIQSKELINTYRLKGELGETVITELASSELGRRGWYYRGRWL
                     REECWKHKPQVWKRACWYVFRFVKGLGKLDFDYEDHCLDRDFWNEYYGTHPDKNFSIS
                     TTNKPITDLKHNSSSSSGSTDCEYDPYFKKVKIPILWRIFHFLPLQEGIDLDELDRYL
                     RTKDQLDDFVIPGLENAMNLGKANDNQIFKPNYSLTNNASLNGSQNDKPSSKRSSITA
                     FHYSKSLDLSSIKNMDFSDVTNRSNLPGIGPGVERTNLNSTSSSREQELDLLSFLKD"
     gene            <585458..>586615
                     /gene="INP54"
                     /locus_tag="KLMA_60281"
                     /db_xref="GeneID:34717498"
     mRNA            <585458..>586615
                     /gene="INP54"
                     /locus_tag="KLMA_60281"
                     /product="inositol-1"
                     /transcript_id="XM_022820943.1"
                     /db_xref="GeneID:34717498"
     CDS             585458..586615
                     /gene="INP54"
                     /locus_tag="KLMA_60281"
                     /codon_start=1
                     /product="inositol-1"
                     /protein_id="XP_022677355.1"
                     /db_xref="GeneID:34717498"
                     /translation="MSDPIRVFASSFNCAKAFPVQDIEAQKSLIEQLIPHISHHDVYI
                     LGFQELVSIWEGSFPNVCLQYLRGVSKVVLERINTDESVFKCVDVNCLGGMGIMVFCR
                     NEYELSNVTKGNVRCGAFYSSLKGATATKFTIKRSGVVDTITCLSSHLAANEGLINLE
                     KRIQDYHAIMQSLREQFGDIDSTNFIFIGDLNFRLNKRFGDINYMDPDIISQLLEECD
                     ELKDVIKTGRAFENFKEAEILFPPTFKYNVADSKALPPIDPLTYNFKRQPSWCDRILY
                     SNNEKATTSLYKAIPRTPEFHFTDHQPVILSIELPHIEAVSDFEAEEITDTGEETNEL
                     EKLLPTSSVSSLSLSCGRIVDYIMGYSGWLYCKHPKWLLVIITLFSIYWLA"
     gene            <586798..>588582
                     /gene="RIB2"
                     /locus_tag="KLMA_60282"
                     /db_xref="GeneID:34717499"
     mRNA            <586798..>588582
                     /gene="RIB2"
                     /locus_tag="KLMA_60282"
                     /product="bifunctional protein RIB2"
                     /transcript_id="XM_022820944.1"
                     /db_xref="GeneID:34717499"
     CDS             586798..588582
                     /gene="RIB2"
                     /locus_tag="KLMA_60282"
                     /codon_start=1
                     /product="bifunctional protein RIB2"
                     /protein_id="XP_022677356.1"
                     /db_xref="GeneID:34717499"
                     /translation="MKIISPRNLKAASNTAQNMATPIINEMDLAKKRPVNPVSLEENK
                     KSKKNIKGIGKMRDSQGFQLKIQDVNHSRKKQMDPDYEVEIEGPLRKIKPYFFTYKTF
                     CKERWRDRKLIDIFIDEFRDRSPEYYRKTIAAGKVYLNENVANLDSIVRNGDLIVHEI
                     HRHEPPVTSRPVKTVFEDDDLLVIDKPSGIPVHPTGRYRFNTITKLLEKERGYSVHPC
                     NRLDRLTSGLMFLAKNPKGADKMADQMKAREVSKEYVARVVGEFPIGKIIVDKPLRTV
                     DPKVGLNVTCSIDEEGAKEARTSFERISYDGKTSIVRCKPLTGRTHQIRVHLQSLGHP
                     IANDPIYSNPNIWGPELGKSYTGDYSEIIDKLDKVGKTESAESWLHPDSQGEVLLNKQ
                     CDICDTELYTDPGPNDLDLWLHAYRYESTEIDENGNKLWSYRTDFPDWAIEPHRMYME
                     KALEEAKKCGETKTAFNVGALLVNGTEILSSGYSRELPGNTHAEQCALDKYSAQHDNA
                     PLPQGTVIYTTMEPCSLRLSGNLPCVDRIIDTNSAIKTVFVGVMEPDIFVKNNTSYQK
                     LAQHGIDYILIPGYEKEILEVACKGHDQ"
     gene            <588974..>590368
                     /gene="RNT1"
                     /locus_tag="KLMA_60283"
                     /db_xref="GeneID:34717500"
     mRNA            <588974..>590368
                     /gene="RNT1"
                     /locus_tag="KLMA_60283"
                     /product="ribonuclease 3"
                     /transcript_id="XM_022820945.1"
                     /db_xref="GeneID:34717500"
     CDS             588974..590368
                     /gene="RNT1"
                     /locus_tag="KLMA_60283"
                     /codon_start=1
                     /product="ribonuclease 3"
                     /protein_id="XP_022677357.1"
                     /db_xref="GeneID:34717500"
                     /translation="MEETSEKWDDSKKHLSSYTYSQILKLEHSVTDLLKQIRIITELS
                     PNIKQYEQALDKLSSMPMDMVPSFDRYNLKLAAELKSLHELGKLSLIDNIMKYSEKFK
                     SGVATPVLPELQGANLNDLSSKFSTSMDIKPSDGAKIDDDEDLDEDGEDGYEVIDDSA
                     TGEKKKDAWPPKLPKIKNPAIRARVFIHKSMINDKLYLSERDMIKSHNERLEFLGDSI
                     LNTTMTTIIYNKFPDFDEGQLSQLRMRLINNELLKKWSFLYKFPDQLKTHNVKPEDNK
                     DGKQKLYADVFEAYIGGLVEDDGKKNLPKIRKWLAKLAEPVISKGLHSDITLEDTKEV
                     DVNAKKTLYSLIGYAALNLHYYPVKKPSSSDPNATVECRIADGKVLGVGVGKNIKIAG
                     MRAAENVLKNKELIEKYVAIRASLPKTQSVIKPNSENSKKRKNNEDHSHRGKITLLDN
                     GTFALNGSSEGQDL"
     gene            complement(<590408..>593605)
                     /gene="ISW2"
                     /locus_tag="KLMA_60284"
                     /db_xref="GeneID:34717501"
     mRNA            complement(<590408..>593605)
                     /gene="ISW2"
                     /locus_tag="KLMA_60284"
                     /product="ISWI chromatin-remodeling complex ATPase ISW2"
                     /transcript_id="XM_022820946.1"
                     /db_xref="GeneID:34717501"
     CDS             complement(590408..593605)
                     /gene="ISW2"
                     /locus_tag="KLMA_60284"
                     /codon_start=1
                     /product="ISWI chromatin-remodeling complex ATPase ISW2"
                     /protein_id="XP_022677358.1"
                     /db_xref="GeneID:34717501"
                     /translation="MEESEKDSVHDEKYWAERRSKFLLDVDPKIAKQRNREDTYIRFK
                     HLLQITDLFRHFIGIRAKHDKNMQQLLKSIDNDNKQANSSKNRSNSGNKGRRQYRKTE
                     KEEDAELMEDEEVELEEDTTILTQSPSFIKAGQLRDYQIYGLNWLISLYENKLSGILA
                     DEMGLGKTLQSISFLGYLRYIKGIEGPYIVIVPKSTLDNWQREFAKWTPGVKTVILQG
                     DKDARRALIDSKILTCDFDVLITSYEMVLKEKLTLKKFAWEYILIDEAHRIKNEQSAL
                     SQVIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFGDSEVFDEWFQQNEKEEDQ
                     DVVVQQLHSVLQPFLLRRVKSEVEKSLLPKKEINLYVGMTDMQIQWYKSLLEKDIDAV
                     NGAVGKREGKTRLLNIVMQLRKCCNHPYLFEGAEPGPPYTTDEHLVYNSGKMIVLDKL
                     LKKKKEQGSRVLIFSQMSRLLDILEDYCYFRGYEYCRIDGSTTHDERVDAIDDFNKPD
                     SDKFIFLLTTRAGGLGINLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVYVYRF
                     VTENAIEEKVIERAAQKLRLDQLVIQQGTGKKTSGLANNKDDLIDMIQFGARDMLQSA
                     SGNISVNDDIDEILKKGERKTQELNAKYEALGLDDLQKFNGMADQSAYEWNGTVFEKK
                     KSDDQVVEWINPPKRERRREQTTYSVDDYYREVIGNGKNKTSGTNTPTLKHQKQPKIF
                     RMTYYQFAHPEFIRLQEMEQLWFKKSVGYKVTAYDVKEPSGDSDSDSDLGSESDLDES
                     PKGEDQETQDDLDKKIAEEQAKIDSAEEFTEEHAKLKQNYLEKSFYNWNKREFLAFIS
                     ACIKFGRENYKAISKAIHTKTPNEVKEYSKTFWERYKEVQGWEKYVANIEAGEKKVEK
                     LRIQEKILKLKLEQYKYPLVELKVLYPPNNTRRTYNSLEDRFLLVTVGKLGLFTSNLY
                     EKVKQEILKSPLFIFSWFIKTRTPLDISKRIATLLTLLQREHEGVERKRKRKPVTPSD
                     DNINSSTQSRADDSRLGSPSSKKQHIDKLQNEDHE"
     gene            complement(<594117..>597755)
                     /locus_tag="KLMA_60285"
                     /db_xref="GeneID:34717502"
     mRNA            complement(<594117..>597755)
                     /locus_tag="KLMA_60285"
                     /product="protein ATS1"
                     /transcript_id="XM_022820947.1"
                     /db_xref="GeneID:34717502"
     CDS             complement(594117..597755)
                     /locus_tag="KLMA_60285"
                     /codon_start=1
                     /product="protein ATS1"
                     /protein_id="XP_022677359.1"
                     /db_xref="GeneID:34717502"
                     /translation="MTDVRDCMGRTISYHLAMFPKATDSQLKKINLMDQDWESGYSAF
                     HLCVLSHQLHKCFKLYERCLKEPNDGGKSWQLTDKSGMTPLQLLESKIFQKSYLQSAN
                     YNLNGYRTGAFSRCHNFGSNVNMQLGTGDDNDRMGTWYEIDAWKMTNENLSFMKCCMN
                     KYYSLLLMTERNGHQFVYISGRSSKLNLLGKRDLFRYMKFTEESISDIQSSNHHFVAK
                     TNQGRILLWGSNKYGQLGTNPKNFDSTEQPHHLDFSVSEDDIIACSNVNTCVLLKSGS
                     LRSVGLDLGQFGATTKLEKDVCYLDHRGRITFQPVNTVLPSYMNNFLALVCTEFVTFI
                     LCGGNQLFALTNHKIIRVKSAPVLNDSFDKFFTREFHDHQIVDIKCKNSFGKFLMLLY
                     DDGTVACISDFKNSSKPQSLWKPKYVWDKCISFDTGANGQLIVATAKGDIYTSSAIGR
                     KFTKIRNGMSGYSTCKVSCDPLFASFNVITRDSFNDIKESDSIGEDPVCITNPQKNFD
                     LTISCNGKMTKLCHRAILLSSQEKFMNELIREKEIDWNSNNEPIKINLNTSNGKMWKI
                     NVEGPDEIADYLNNAIDSYYSLETKLLPVPNNITLQKFIDAYYFPSPFTSPPKYNKIM
                     KNLLNSTSDIVRNVEIQLADDMMIKTSSILLQTHSVFFEKLFSSPWSKSSHEYKLNWK
                     DVSLRACSALINYLIHLSNVDENENTCSEIPLNLGHQAYLDTVIEVLNIADKYMFLDL
                     CLKLENQLKCLIDSSNAVSLWILSYDRNLSELKLRCENFILHNPSIIFSEYTTELVRN
                     DVTKEMWKNLEMKFNTVLGFGSQLSWYYSKEASDMIEMFKTDILDFNSYFMANDREFE
                     LLLDSVSVTKARQKSVNESRKQSFSKNARNQSSMENLVNVRRPSVTSQNSFAWKSSFA
                     SSESAIDDDDTNSSFIEVSKKKKRRSSSVVPPGTSSSNSTTISKESVQTEFPLSLAST
                     NQIKRNSSEQLFPSLGELSQKTSSNSKIKIKKQTQKERIKQIAENESKIKEELETKKS
                     IWGQPIKKDTSIQSSSNNSKISVSLSETPLTPTTKPASTKFPTLNEAVKIGKKGTGIV
                     SVSGDGTKPTIPLYASKKNSLGWLGKETASTQIKSTQEALEEARFMKWWKEESERIQA
                     EQLLLETLAGVETEQSPPTRNDDVVKGKSQRARSTKIPHKSKQQYRNNGTKSQKKGKK
                     NSESKEEK"
     gene            complement(<598259..>599488)
                     /gene="CPA1"
                     /locus_tag="KLMA_60286"
                     /db_xref="GeneID:34717503"
     mRNA            complement(<598259..>599488)
                     /gene="CPA1"
                     /locus_tag="KLMA_60286"
                     /product="carbamoyl-phosphate synthase arginine-specific
                     small chain"
                     /transcript_id="XM_022820948.1"
                     /db_xref="GeneID:34717503"
     CDS             complement(598259..599488)
                     /gene="CPA1"
                     /locus_tag="KLMA_60286"
                     /codon_start=1
                     /product="carbamoyl-phosphate synthase arginine-specific
                     small chain"
                     /protein_id="XP_022677360.1"
                     /db_xref="GeneID:34717503"
                     /translation="MPSLKTAAPKAKFSIFNSSDSGPESVSAEFQGYSFGAPVSCNGE
                     AVFTTSLVGYPESMTDPSYKSQILVFTQPLIGNYGVPDTEARDEFNLLKYLESPHIHV
                     RGIVVAEYAWRYSHWTAVESLAAWCKRENVTAIGGVDTRAVVQILREQGSSPATIEIQ
                     GSFEPKPVKAETDLVKTVSTKEPFFVKALPSVKTPYNIALIDCGVKENIIRCLVERGA
                     NVTVFPYDYPITSVANQFDGIFISNGPGDPIQCMDSTVPELQNLLQTDSLRDIPIFGI
                     CLGHQLLALASGAKTVKLGYGNRAHNIPALDLTTGQCYITSQNHGYAVDADTLPSSEF
                     KPFFQNLNDKSNEGMIHVSRPVFSTQFHPEAKGGPRDSAVLFDRYFCNMASYKASRGS
                     KIKFTLDTTSMSTERVF"
     gene            complement(<600546..>601832)
                     /gene="RAX1"
                     /locus_tag="KLMA_60287"
                     /db_xref="GeneID:34717504"
     mRNA            complement(<600546..>601832)
                     /gene="RAX1"
                     /locus_tag="KLMA_60287"
                     /product="bud site selection protein RAX1"
                     /transcript_id="XM_022820949.1"
                     /db_xref="GeneID:34717504"
     CDS             complement(600546..601832)
                     /gene="RAX1"
                     /locus_tag="KLMA_60287"
                     /codon_start=1
                     /product="bud site selection protein RAX1"
                     /protein_id="XP_022677361.1"
                     /db_xref="GeneID:34717504"
                     /translation="MEESLNDAQRARLPTLYEVLNQQTAAPLDLWSFYTYLSQYPNAI
                     VYLDFWTDVMAYLRLCKDYVKGIRESVLDIHLTDTPNLADMGDVNDSVKRESVSSAML
                     LEALMNDGYLDYNDSKRVSQFLKGETDSPRLSQLLNDWKQMNNDQTDFNDFVDGLVQE
                     KVSKDMKPKLTIKQLISSAQDIVKTYLLSQEESDRFLYEIPQYLREDTIRLVMQERRH
                     DPEVFEPIQDIVYQFLEMDCFPRFLGCVALHNLHDEIVLFAPKTPNPFYGKTSSPFSH
                     WTTASRIAVGLAWWLAGLWIGYTLIFMGYARGIRVVCIVPFFLGSYYLVSGVYLVDIL
                     YAFSGVTQTLVSKRKIDDVELNKMSTHRSSSLHSRHDVPWWLIVFGGRSRLCKINHPF
                     VNSIMIRRAAWCLILVLIITGILTAIFAAVPSHKLQ"
     gene            complement(<602382..>603746)
                     /gene="DFG5"
                     /locus_tag="KLMA_60288"
                     /db_xref="GeneID:34717505"
     mRNA            complement(<602382..>603746)
                     /gene="DFG5"
                     /locus_tag="KLMA_60288"
                     /product="mannan endo-1"
                     /transcript_id="XM_022820950.1"
                     /db_xref="GeneID:34717505"
     CDS             complement(602382..603746)
                     /gene="DFG5"
                     /locus_tag="KLMA_60288"
                     /codon_start=1
                     /product="mannan endo-1"
                     /protein_id="XP_022677362.1"
                     /db_xref="GeneID:34717505"
                     /translation="MRLGIWSYLILSISSLVSAIDLDTSSKDSICSATSLIQQGIVDY
                     YDGYKYGGSVGMFTQPYYWWEAGLVFGGMIENWYLCQNNSYQNLLYDAMIAQTGSNYD
                     FMPNNQTMVEGNDDQGVWALTIMSAVERNFTNPKKAGAPDWLAMVQAVFNEMYSRWDP
                     AHCGGGLRWQIFTWNSGYNYKNTISNGCLFQLAARLGRYTGNQTYLDVAEKVFNWLTD
                     VNYVVLKDEANVYDGANIEENCTNIIKYEWSYNHGVVLGGCAYMYNATNGSEEWKSRT
                     SQILGGATSFFFDNNIMYESTCQSEKQMTCNTDQRVFKAIFSRMLGYTAVLAPFTLDT
                     VNPLIEASATAAAKSCSGGTDGHTCGLNWFKGSWDGQYGLGEQASALEIMNQLLIHER
                     PPPLTEKTGGSARGDPNAGLNVSTTNVLQKKLTITGSDKAGAGVITAVVIGVLVLGSV
                     WMIY"
     gene            complement(<604390..>606441)
                     /gene="BUD7"
                     /locus_tag="KLMA_60289"
                     /db_xref="GeneID:34717506"
     mRNA            complement(join(<604390..606304,606413..>606441))
                     /gene="BUD7"
                     /locus_tag="KLMA_60289"
                     /product="protein BCH1"
                     /transcript_id="XM_022820952.1"
                     /db_xref="GeneID:34717506"
     CDS             complement(join(604390..606304,606413..606441))
                     /gene="BUD7"
                     /locus_tag="KLMA_60289"
                     /codon_start=1
                     /product="protein BCH1"
                     /protein_id="XP_022677363.1"
                     /db_xref="GeneID:34717506"
                     /translation="MILAQDSIPEVVEETPGQALNERIAKLTDPEFVSTLGPQDLVTI
                     VKHDPQKKTVGSFFYVAGLDTSDPTTIAVWLKQLMEGIEEKPQLWFGKNVKFTVEYIS
                     LTTWNIFKQCDMTITVHLPGTIETTFIDKQGNKLTFDADEETDMAWVEAFISGRMRDL
                     MCMVENRDDGEVINVVETRIYNPLIMGQLDNVADMFLEVFPTFFPRGIEVGCPCIYGN
                     MPSTLTNNYLVETLCEIVRLTKSVDKALPMLFELKEAFGSLVDIIITRIYLTNDKELD
                     GVRLMHDAFKEITDPTYQCELLVLQAKYLLDHNDPELALEASQRGVDLTPNAFMPWFY
                     LVKSYIALGDNKNALLSLNSLPMNLASSAQKYQYRRVINTDGNNATVELHLPLPLDVV
                     LDEVTNLNSLLVMEEHKTVNPVLYNLKSSMLKNTFQWIYELLCEIVKTLGWEKLLEIR
                     AELFLMEEEYDNLDSTSETESEKGANRDIKGKRLCERWFDNLFMLLYDDLRVNSQWQA
                     NELKPQTTLEWELAGLCCFRLRQFRSAKSAFQNGLQKRFSSQSSRKLLQILLMERQSN
                     PSEELSIEIISICVKLCCWSHRWYAEFSMLLLDAMSKIVEDLGIIRVRNEVNARFPPA
                     VANLFNENVLNFFENFCNNYYDE"
     gene            complement(<606737..>607141)
                     /gene="TAF9"
                     /locus_tag="KLMA_60290"
                     /db_xref="GeneID:34717507"
     mRNA            complement(<606737..>607141)
                     /gene="TAF9"
                     /locus_tag="KLMA_60290"
                     /product="transcription initiation factor TFIID subunit 9"
                     /transcript_id="XM_022820953.1"
                     /db_xref="GeneID:34717507"
     CDS             complement(606737..607141)
                     /gene="TAF9"
                     /locus_tag="KLMA_60290"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 9"
                     /protein_id="XP_022677364.1"
                     /db_xref="GeneID:34717507"
                     /translation="MDDAEKNKDSLDTPRDVRLLHLLLASQSVLQYEDKVPLQLMDFA
                     HRYTKGVLKDAIAYREYVGGSASDVSIEDIRLAIGARTQYQFKPTAPKELMLQLAAER
                     NKKPLPNVVSSWGVRLPPEKYCLTAKEWSIDE"
     gene            <607512..>607964
                     /gene="MBF1"
                     /locus_tag="KLMA_60291"
                     /db_xref="GeneID:34717508"
     mRNA            <607512..>607964
                     /gene="MBF1"
                     /locus_tag="KLMA_60291"
                     /product="multiprotein-bridging factor 1"
                     /transcript_id="XM_022820954.1"
                     /db_xref="GeneID:34717508"
     CDS             607512..607964
                     /gene="MBF1"
                     /locus_tag="KLMA_60291"
                     /codon_start=1
                     /product="multiprotein-bridging factor 1"
                     /protein_id="XP_022677365.1"
                     /db_xref="GeneID:34717508"
                     /translation="MSDWEPSTVIGRKVRIGGGGPRQQVARTQAQINEARRSGMVLSV
                     DKKYGTTNSKASPEGQRLTKVDRETDIVKPKKIDLNVGKAIQKGRQAKNLTQKDLATK
                     INEKPTVVNDYESGRGIPNQQVLAKMERALGIKLRGKNIGEPLGGPKK"
     gene            <608430..>609599
                     /gene="RNA1"
                     /locus_tag="KLMA_60292"
                     /db_xref="GeneID:34717509"
     mRNA            <608430..>609599
                     /gene="RNA1"
                     /locus_tag="KLMA_60292"
                     /product="ran GTPase-activating protein 1"
                     /transcript_id="XM_022820955.1"
                     /db_xref="GeneID:34717509"
     CDS             608430..609599
                     /gene="RNA1"
                     /locus_tag="KLMA_60292"
                     /codon_start=1
                     /product="ran GTPase-activating protein 1"
                     /protein_id="XP_022677366.1"
                     /db_xref="GeneID:34717509"
                     /translation="MTSFSKAGLQQKWTTEDDIKSVLDELKAVDKVTSLDLSGNTIGV
                     EASKALAKVISEEKSIRDNVEEVNFADMYTSRLVDEVVESLQVLLPALQGCPKLAKVD
                     LSDNAFGLRTIDSLEKFISESTQLKHLILANNGMGPFAGERIGKALFKLAENKKKAGQ
                     SLLETFVCGRNRLENGSSRWLSQGLRAHGDDLHTVRLYQNGIRPQGCINLIKHGLAYN
                     KNLHVLDMQDNTFTTVASETLAQYLTNWTHLKELNLNDCLLKGPGSHAILKVLKENKF
                     DNLETLKLQYNELTQHSLEHLLIPALQSGNLPCLASLELNGNRFEEDSEPLELLPTLF
                     DGELDELDDLEEVDSEEEESEDEDAEEEDDWNPTEFVKDKEVDELASELEKAHIE"
     gene            complement(<609829..>610845)
                     /locus_tag="KLMA_60293"
                     /db_xref="GeneID:34717510"
     mRNA            complement(<609829..>610845)
                     /locus_tag="KLMA_60293"
                     /product="LPLAT super family protein"
                     /transcript_id="XM_022820956.1"
                     /db_xref="GeneID:34717510"
     CDS             complement(609829..610845)
                     /locus_tag="KLMA_60293"
                     /codon_start=1
                     /product="LPLAT super family protein"
                     /protein_id="XP_022677367.1"
                     /db_xref="GeneID:34717510"
                     /translation="MSILTTLQTTITGPWFDIGNKHIIKCIIYMSILVGLFATQLIVD
                     SWLWFLYKWTIVIKSKHYYRKIQQAQKMQSVVNIWINEFLLWTITREDIQIIFEGEDM
                     KVNEKSQVIICNHRSIIDYTMIQHLFGAENVVFASWRRLMKYPSLIHFWSIFRNNENA
                     AVSVSTFKKYKGLEKIVVFPEVNIFTPEVKLIERKLMKVKCKGLPVLHNVLYPRFGTF
                     VNLIKALTNETSKRGLRMLEHLILPSKSDYQESINLVSLTIIYYTISLKPSGEYKLEQ
                     TLPALWDIWSLESPLIICVHSTNHNLDKLGRKKQTQLESWLETQWCAKDRLIESMELN
                     VEVI"
     gene            <611375..>611920
                     /gene="TIM18"
                     /locus_tag="KLMA_60294"
                     /db_xref="GeneID:34717511"
     mRNA            <611375..>611920
                     /gene="TIM18"
                     /locus_tag="KLMA_60294"
                     /product="succinate dehydrogenase [ubiquinone] cytochrome
                     b small subunit"
                     /transcript_id="XM_022820957.1"
                     /db_xref="GeneID:34717511"
     CDS             611375..611920
                     /gene="TIM18"
                     /locus_tag="KLMA_60294"
                     /codon_start=1
                     /product="succinate dehydrogenase [ubiquinone] cytochrome
                     b small subunit"
                     /protein_id="XP_022677368.1"
                     /db_xref="GeneID:34717511"
                     /translation="MFRYRLISPQVRGIRLPSLPNKASLSKYKLIPPPPGGVTGTVND
                     TLPKSEPNWFHGSYHWDYERITAVSLIPLTMVPLYGAMSSATFAATFPVPIIDAVLAS
                     TILIHSYLGITSCIIDYIPLRKFGFWHKAAKFALALGSSISLYGIYVLETENNGLIDL
                     ITALWDKEKGDSRAYLFERRY"
     gene            <612610..>613911
                     /gene="STE2"
                     /locus_tag="KLMA_60295"
                     /db_xref="GeneID:34717512"
     mRNA            <612610..>613911
                     /gene="STE2"
                     /locus_tag="KLMA_60295"
                     /product="pheromone alpha factor receptor"
                     /transcript_id="XM_022820958.1"
                     /db_xref="GeneID:34717512"
     CDS             612610..613911
                     /gene="STE2"
                     /locus_tag="KLMA_60295"
                     /codon_start=1
                     /product="pheromone alpha factor receptor"
                     /protein_id="XP_022677369.1"
                     /db_xref="GeneID:34717512"
                     /translation="MSDGTTALNPLYYDSSYNPMESLLTYVSIYSNETTISFQNLQDQ
                     VRTTMNQAIVFGTRIGAAGLACIVLWMVSKNKKTPIFIINQTTLVLTIIQSSVYLGYL
                     LHNFAGVPFLLTLFPQLIHKSDIHLVGAANILQCLLVTSIETSLVFQVRVIFKSDNEK
                     RIGNILSGISAALGFTTVVMWFVTAIKYLVEFYVDPMKRIDKLYFNVSTILLASSINF
                     MTILLSVKLIMAIRARRFLGLKQFDSFHILFIMSTQTLIGPSIMYILSYALKTESTDI
                     LASIATLLTVLSMPLTSMWAAAANDAPAPSFNPQFSPHSRYSDGSSYLSYGRTTLQDK
                     YSFTKSPQKSEGYSSKDSDLSTDLDVDLESGRSIDKYHGTVTFLKEKGSNGMDNNIRH
                     SEIYTPETAIDEETRNFWANARFVQKDDNLMESKTVFKESR"
     gene            complement(<614064..>616991)
                     /gene="BST1"
                     /locus_tag="KLMA_60296"
                     /db_xref="GeneID:34717513"
     mRNA            complement(<614064..>616991)
                     /gene="BST1"
                     /locus_tag="KLMA_60296"
                     /product="GPI inositol-deacylase"
                     /transcript_id="XM_022820959.1"
                     /db_xref="GeneID:34717513"
     CDS             complement(614064..616991)
                     /gene="BST1"
                     /locus_tag="KLMA_60296"
                     /codon_start=1
                     /product="GPI inositol-deacylase"
                     /protein_id="XP_022677370.1"
                     /db_xref="GeneID:34717513"
                     /translation="MIVENGADSSATRVRYPLISKRLRKRSAVLTFIGLLLVCALGLS
                     HVFHKFTGADAPKCRSIYMYPSYARIDGFDTRYTKLAKKYHIYLYREQGKDNAPLHGD
                     EIQLDGIPVLFIPGNAGSFKQARSIAAASADMYFDSKSSIENSFTKNLDFFTADFNED
                     FTAFHGQTMIDQASFLNDAINYILSLYSQSNAYKNSNRTLPSSVIIVGHSMGGIVARL
                     MPTLPNHIKESINSIITLSSPHAAAPVTFDGDILRIYERINTYWRSSMDDTNSFFRNN
                     VSVISITGGILDGILPADYTDVKGIIPESNGFGTFTTTIPEVWTPIDHLAIVWCDQLR
                     HVIAKYLLETVNDELSTKTSDLDTRLRLARNLFLSGLEPVTHQDKLLDNNLLDMSSNF
                     KNPISINEDRTFWFNKSNPMKSDFIFDISGNDKLQFQLLTSLHDIELLFCRTKDNKDC
                     IQGSSSLSKIPRSSSATQYPTDSSWGSGFSPFRFISLNSTDLKGFETILLRNTITNDD
                     DFLIVTIGNENNIVISNINPWEISMSYFQKSLDFLTSFTKTVCFPKLWSSLISYRLNV
                     IFSEREDSSFNPLVRQYVNTQYESKWHLFPSSGSHDINMHNIRPFISVDDTSDKSLNL
                     MFFAPPGQELRIKLSINWLLTFKMLFIRFRLAIASIPISLIALTLSYQFYYFTSDTSK
                     FISFETALTNIVCRYSILILGFLSVTPLLSDCKILLRLLYLLDPTSLNNPVLNDHTIT
                     NSYMLGLREPFTWWIGPLFFTISVATLFLLTRIFNILELVAVKTAKLVSDYIPVPLHS
                     NSEAPSRKYMIFSTRQLVGICFLFLLVMYYVPYQFAFLIISLIQIWTCVRLAILNYYE
                     PSKYNNAHNFNMSFLILTIFMIPINAPIVVVFFRNIAIRWETAFRSHHNFLAIAPSLL
                     LILRNSQFKLPVIKSKQNWLIVVTLSAYLSFYSFTYGIRNLYWVYHLYNILNGVFFVL
                     TLM"
     gene            complement(<617317..>619752)
                     /gene="EPL1"
                     /locus_tag="KLMA_60297"
                     /db_xref="GeneID:34717514"
     mRNA            complement(<617317..>619752)
                     /gene="EPL1"
                     /locus_tag="KLMA_60297"
                     /product="enhancer of polycomb-like protein 1"
                     /transcript_id="XM_022820960.1"
                     /db_xref="GeneID:34717514"
     CDS             complement(617317..619752)
                     /gene="EPL1"
                     /locus_tag="KLMA_60297"
                     /codon_start=1
                     /product="enhancer of polycomb-like protein 1"
                     /protein_id="XP_022677371.1"
                     /db_xref="GeneID:34717514"
                     /translation="MPAPAIDTSRFRHRKISVKQRLRIYKSNEIKELEQEDATAANVQ
                     HQQRELMEIETGVEKNEEKEEHLYKILQSNQLRENKKDLFIPTPDASKTWDEFDKFYV
                     GEFQNPKSYIQFSAQLEDCCGTLYNMDEQDEEFLKKLNESLEDSVEPLTEDEFELIMA
                     NLESSIKEKQPFLSMDPESILSFADLRPTMLKNDVGDSGVKKSLAKEIGMPEDEPFLT
                     MFDPKRRIGKREKNMKALMDLFGEKVYDYWKKRKIAREGGEIFPQLKSERNHDKDDND
                     PYVCFRRRELRQPRKTRRIDVQNSKKLRLLHQQLQYTKDLALAVAKRERAALDILNND
                     KVVFETRSQLKALKRKLGITTDDEDLYSTKRPKLVSSVITIKQRQQMLLQQQQQQRLQ
                     QQQQQQQQAAIASDSSVKKSKSTKSSKANKDADTSFPEAKAAETKRKGHKSASQKLKE
                     QVKSGSQDPEKTATANTSSTAQQQQNQITSQVYVKLPSSKIPDIALEDVNKLLYSKEK
                     STKKFVEDRMKKRKQEDGDTFFNLIDDPYNPVFNLAIPEDVKAQDAPFSSVAGSKFEI
                     KKSYYSPDLQKYVSGNTNDITVLNKDGEVTNNNEHKKLELFNLFDDNLQTHSQEFPVA
                     FRIRRGRFNRKYIDQRKTDHNINDILSQCIDFDEVRKQERENDVINVYDSKLDDLSRS
                     YYRWKYDSNYNLYGSKFSDEPAKLNQISNDTQVVRFGTMLGSKAYEQLRDATIKYRQE
                     QINKRKRLNSIQQQHQQKQQAMFKGQQNSSSSNKSHSSSPTTSLQDQKKRMGTVSNQS
                     PTPKERITPNTVV"
     gene            <620837..>623074
                     /gene="BUD27"
                     /locus_tag="KLMA_60298"
                     /db_xref="GeneID:34717515"
     mRNA            <620837..>623074
                     /gene="BUD27"
                     /locus_tag="KLMA_60298"
                     /product="bud site selection protein 27"
                     /transcript_id="XM_022820961.1"
                     /db_xref="GeneID:34717515"
     CDS             620837..623074
                     /gene="BUD27"
                     /locus_tag="KLMA_60298"
                     /codon_start=1
                     /product="bud site selection protein 27"
                     /protein_id="XP_022677372.1"
                     /db_xref="GeneID:34717515"
                     /translation="METGNGNESLAELVDTIKGTIKNLENKRSFLEEQRPLYEQIFDR
                     INSADTSEDSEETWQFGEVIFQGGKFFQNIGYDYYVEKSREECLEFIVVRINLIKEAI
                     EQFEQKLKEARDTLKNMELLQKDADSLKGELLENEHGEQLMEIREELDEDGNVLNSSV
                     TAANGPRKEGKAAAEQSDTSTQSDAKSDAPDSLDTVEEQESDNTEAHTTENEYSEDQN
                     SFKISQEQMYTFDDLVEQLDKIDEDEDGEFDVNDVQYDYEAYEGMNDEYVDYEDEDGD
                     DDDDDDDYDYDTRNVSIVPEPAQKSFMDQINALRKKKMQEDDKQKQNSEATKSILKKT
                     SGKKKSVNFAPQLDVYEVENVKAETKSNTFNFPRYNNIVSSDISETTTEDADFDADLF
                     ARMIGAKDADVLHDKYQQNQTPATSEVPVEPTPRKKRVSRFKREKQGSAASPVLERNT
                     DSNPSPAVMDIVEHSDIQETVNDSSSAISDIVAREDIQPPSPVVSKQPSFFSKEMKSL
                     RKPKKSQPPKPSIDLSESESSDENEDDPAPTEQHNEDKESSEKQPITSAFPKQKDNNV
                     INQPKIDFSQLADTDDMARAYLLGLYDDDVEDPGMVLQEASDFNEYNKAVEDLKPELE
                     QFFKENPQPTEAAQVQTADSGPMMNDIIERDPLKDMETSPLQDVQEQIIYSEIQKEYI
                     EHRRRNIEKLAATNGMTGGHNDDDEEELGKEPIDEFGNPVTTSRFKEQTMAARKLHIK
                     PFTKN"
     gene            <624224..>625795
                     /locus_tag="KLMA_60299"
                     /db_xref="GeneID:34717516"
     mRNA            <624224..>625795
                     /locus_tag="KLMA_60299"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820963.1"
                     /db_xref="GeneID:34717516"
     CDS             624224..625795
                     /locus_tag="KLMA_60299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677373.1"
                     /db_xref="GeneID:34717516"
                     /translation="MNKLVIDPKLRALMDPDFAYDSDENRKAEQVEVVQDHDLLHDFD
                     INRRYNNSGASSPLNDAHGHVSAVSVTLDSHSIQEDIRAAAESKEQVRVLVQPDADER
                     YLYENEKFHYTSQFQARTHADRFDFYQGPKEHFRGAVDKSLDEKRDQEYGGDGFGRHV
                     AEEEHDRSNNLDSNQVHSHGARNMHTYGHASESGNLNQHSNDKWFLENQYNDEQDRQG
                     EGRKEEKYENGGDEENCGSDEYETTSDISEEYETQLQDLFLKINKFKQDFHQLIKKLD
                     EASLESAKARYHYLNDISARENMFMSTTTNMLLDTVAKLLPRKRLPNGNHSNEWASET
                     NLKTIMNDESKASESTKNGNSSRNADSLNTLYNATLESDPCSKLPNFGVILIKSPTNV
                     EQLWNEYTKLPSDSNMKALLKLMLQQQSKDTIKKSDIALMKQRKTTIQELEKKYGSSW
                     RNNDKNFSRQINRRKKIWGCIEQGLKDGLSLKTCFHILDKYVEERGKGLSWYYNGVPF
                     KLADVAPSYVTDGQF"
     gene            <626206..>628194
                     /gene="OSW2"
                     /locus_tag="KLMA_60300"
                     /db_xref="GeneID:34717517"
     mRNA            <626206..>628194
                     /gene="OSW2"
                     /locus_tag="KLMA_60300"
                     /product="outer spore wall protein 2"
                     /transcript_id="XM_022820964.1"
                     /db_xref="GeneID:34717517"
     CDS             626206..628194
                     /gene="OSW2"
                     /locus_tag="KLMA_60300"
                     /codon_start=1
                     /product="outer spore wall protein 2"
                     /protein_id="XP_022677374.1"
                     /db_xref="GeneID:34717517"
                     /translation="MEQLVCLIVGDTPSTQLLSWRLSLSNCFIVLVSNSLSSDGLISW
                     KSTKLGSNFYKPNLTSKDLKSLPSNSSVGKFDIIVLSCHSISEYITQLEALERFIHDD
                     TVIIIDSNFAVELELVSLARYPNVTTVSVIVDAEVRRLSIGSYLLINDSNSFKFGITY
                     SNKTKEPILKENITRFSTYLKKNNSKFKLMLQLLERTNIGSVEVIAPEDESFGLHVWE
                     WLLPRISLNVLSIVFEQVSYAELLNNESNTKVFRQLVKELMEICYKQTNGGVIDCFVF
                     NNDRTTPDYNSILQRLQDRQRDLERFTKSEYPEYLTLNYEAYCFYHRIEFPSSLMFNQ
                     CIDVAEKYGCANGNLTFLSGFYSRLLNLSGVQINNDESSDLKKPNLLWGKKSVLNVDK
                     KKSTNQSSQKKVKVKSKKFSLHSKVKTPHASQRVPATSGYKSPDLQLPPELQEMYLGC
                     DSLNFSSPLSPKIIDVEFDSTSDDNVESTESDEESNDESVYVEKVKKEVVSERSMVKL
                     SEQMEHHEDDDNIDPSLKLPLFKGFKNTTQRPMTTGRLQMTDLEWQIRNGYVDIPRQM
                     MLVTKNELREPDDKMHHTIVGQYWKLIKQQHMNNGQLIRPITSQEDILRFHCETLNKA
                     QVHLSTTTNRYGDLDFSDSVYEHWRHGKGCLYKLLSDR"
     gene            complement(<628285..>629784)
                     /gene="FRS2"
                     /locus_tag="KLMA_60301"
                     /db_xref="GeneID:34717518"
     mRNA            complement(<628285..>629784)
                     /gene="FRS2"
                     /locus_tag="KLMA_60301"
                     /product="phenylalanyl-tRNA synthetase alpha chain"
                     /transcript_id="XM_022820965.1"
                     /db_xref="GeneID:34717518"
     CDS             complement(628285..629784)
                     /gene="FRS2"
                     /locus_tag="KLMA_60301"
                     /codon_start=1
                     /product="phenylalanyl-tRNA synthetase alpha chain"
                     /protein_id="XP_022677375.1"
                     /db_xref="GeneID:34717518"
                     /translation="MSDIQLEILQKVDKLGQIDSTSEVYPDIDSQTMASYLNSLKSHD
                     KIDFSKQDTIFYTLTKEAEDIVANGSHEVKLLQLIDKFGQLKIKDVSTHMGADGKVGQ
                     ARAFKNGWIVKTPENELKVSDKVSDVAQVKDQTKEQLEKIKKNDLAGISDKDINDLKK
                     RKLITPRKETTFKVVKGKDFSTELAKLETDITSEMVATGSYKDLKFKEFNFNSQGIDP
                     QSGALHPLNKVREEFRQIFFSMGFTEMPSNQYVETGFWNFDTLFVPQQHPARDLQDTF
                     YLKDPIKSGMPDDREYINNIKAVHETGKFDSIGYRYNWKEEECQKLVLRTHTTAISAA
                     MLHKLAKDPKPTRLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDF
                     FAKMGVTGLRFKPTYNPYTEPSLEIYSWHEGLGKWVEIGNSGMFRPEMLESMGLPKDM
                     RVLGWGLSLERPTMIKYKVQNIRELLGHKVSLDFIESNPAARLDEDLYE"
     gene            complement(<630228..>630806)
                     /locus_tag="KLMA_60302"
                     /db_xref="GeneID:34717519"
     mRNA            complement(<630228..>630806)
                     /locus_tag="KLMA_60302"
                     /product="ino eighty subunit 3"
                     /transcript_id="XM_022820966.1"
                     /db_xref="GeneID:34717519"
     CDS             complement(630228..630806)
                     /locus_tag="KLMA_60302"
                     /codon_start=1
                     /product="ino eighty subunit 3"
                     /protein_id="XP_022677376.1"
                     /db_xref="GeneID:34717519"
                     /translation="MTSEEIPKNKPSAEELQNVPLEWSKRAVARYKVAPLHMSADDDR
                     KSGNKRHIVAIDDSLKINYEVIRHIPGQLAQGEEIEDINRLKLVHYKDSLNKMHEEFI
                     SIWQKADDDIEESDYTNLDEPTLLEHKKWLTELNEKLKSDYSEAIQLEKKWFLLKEIL
                     LEACTRLDLCSDSNPLLNKNQITLDESKGTLL"
     gene            <631341..>632030
                     /gene="FCF2"
                     /locus_tag="KLMA_60303"
                     /db_xref="GeneID:34717520"
     mRNA            <631341..>632030
                     /gene="FCF2"
                     /locus_tag="KLMA_60303"
                     /product="rRNA-processing protein FCF2"
                     /transcript_id="XM_022820967.1"
                     /db_xref="GeneID:34717520"
     CDS             631341..632030
                     /gene="FCF2"
                     /locus_tag="KLMA_60303"
                     /codon_start=1
                     /product="rRNA-processing protein FCF2"
                     /protein_id="XP_022677377.1"
                     /db_xref="GeneID:34717520"
                     /translation="MAELNVEGLSVDELFADLKKTIAQQKQEEVAKEESGDGFEDDKV
                     SVEIDDRTAQFQEIERNLHKLPKLQTGFDQLGTDGKKLQLEEQKKVVKVDDPIYILES
                     RKKSDKVKPPSETEKWFTLPKPEMTAEVKRDLMLIKHRAALDPKRHYKKDKWQVPERF
                     SVGTIVEGPTEFFSSRMKNKERKNTMLETLMADDTTNKYFKRKYTEVQQRKTSGKRAH
                     YKAVKDKRRRF"
     gene            complement(<636197..>640030)
                     /gene="CLU1"
                     /locus_tag="KLMA_60304"
                     /db_xref="GeneID:34717521"
     mRNA            complement(<636197..>640030)
                     /gene="CLU1"
                     /locus_tag="KLMA_60304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820968.1"
                     /db_xref="GeneID:34717521"
     CDS             complement(636197..640030)
                     /gene="CLU1"
                     /locus_tag="KLMA_60304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677378.1"
                     /db_xref="GeneID:34717521"
                     /translation="MSTDTIEVTVKGIPGQSKNKNSDLQYQLGKQSNVSHLKTYLSFE
                     DATKFYTSYDLIENQTVVQDDDILEDLAGKNSSLTFHFKPKAYNVASAVQHILSLRET
                     LGFSSELEDSISDFAISSGSQFKDMNLESKSENAKEDPEEKAKFLQVCSEILESSDVD
                     FNISSLKTGNLLVSPVLRSLHFSAYNPVPAFYKTKGHLLYLQVVTLENETFHITSSIS
                     GFYVNKSSSIKFDPSPKAEFESKFNLVDLLIQVSKKFLQHVTQLRNKLSSTDTAQYAK
                     PTSCFLSKPWLVSQVPTNNGDFMRTQLKNFTFDDERNFCDEFQAIKDLEINSPYDRVK
                     NEKITASSIHEFNTEAVKGAMAVFNNELTPIDPSTTGENAVYFYKSLVFSYVFDVSGL
                     YADIGGDEAAFAAANQDLQVINQLNRLGLKNIRHCLTAVIDYAGRRLLVQSPVPGLLT
                     PVGTNITVDENNNEIAEPMETSISVNYGYDELTATLKFDEKLHTKLDEFSKNFYLKQH
                     KVEEFDFKLSSKSKGIFGVDQRAYILDLANTNPLDVEFAKKHYDSVKEDRYPHRQTLI
                     RRELVEKWRSEKITASGKSLEDASEDVKFSYNPDAYVIDGVEDENVLEMSKFLNEEVL
                     PLFLEDILKGNTNLPYDGQHLTNLFHTNGINMRYLGRAIEIINAKYSELKEERVKYLA
                     KIEQENAEYKEWQAGYLKKVEQLIKERQDKINEYVQQQKPIPEELKKQIQLDKSDLKE
                     PVKNEGFTIETDQYEGLIAVCELEVIARSLKHVFREHSKKLSSPILVQHLVAFFLNLL
                     FGHSYNPNAFVEDLDPLFDIKDLEFAKITREQLLEEVRSQAKRRFRHELPENWLEIQE
                     ERFSKFAIIRAAAQKFGIQLINKEYFFTQEEYQTWKQAQDKKLRSRLVDPQQTFSIND
                     FSLRPIVKGSEFQSLISEELWIQGASLVNAVHAEEEEAERKKKEESEQKKNEESEQKD
                     EETNKETEEVDPEEVKQKEEREQKMNEALNLLGQSIVFREDVIGLVHPSLVSSYLLLS
                     NMYSRLGRVQQAVEFGNKAVLLSERCFGVDSFETVRILSNLAYLQYAQGSIYNAALVL
                     KKVHDLLKLLTPNVHAGRVNVFNLLFQIASNVKDSKIEVKILNKLSELLLKITDNEET
                     LPFGQNESRIANLYTSIDDMKNALAHISKARTVFIKELGLNDQTTLTSTQWKETIESI
                     ITKQQQQKKLAATQQQVKPAEVTQKKGKKASSQNPELANKSVDELLKFIEGDSANSSK
                     SSSKKSKKKSKNGKK"
     gene            complement(640507..640580)
                     /locus_tag="KLMA_R610"
                     /db_xref="GeneID:34718769"
     tRNA            complement(640507..640580)
                     /locus_tag="KLMA_R610"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:34718769"
     gene            <640952..>641644
                     /gene="VPS24"
                     /locus_tag="KLMA_60305"
                     /db_xref="GeneID:34717522"
     mRNA            <640952..>641644
                     /gene="VPS24"
                     /locus_tag="KLMA_60305"
                     /product="vacuolar protein-sorting-associated protein 24"
                     /transcript_id="XM_022820969.1"
                     /db_xref="GeneID:34717522"
     CDS             640952..641644
                     /gene="VPS24"
                     /locus_tag="KLMA_60305"
                     /codon_start=1
                     /product="vacuolar protein-sorting-associated protein 24"
                     /protein_id="XP_022677379.1"
                     /db_xref="GeneID:34717522"
                     /translation="MNYIKTTLWGPDPKEQHRKLKSILRKNDRQLNKSLNELSSLKSK
                     TQNLIKQAAKKNDIKTVRLYAKELYHVNKQYDRMYTSKAQLQSVGMKIEESFQMNKLQ
                     DKMAQSAVLMREVNSLVQLPQLRATMMDLEKELVKSGIITEMMDDTMEPYEDVEEEEE
                     VNEQVEQIVAQYTSEKLDKVEDAPNVVLSAPEPEQEISTENQEVVPESKIDSEADDMI
                     KAMKERLNALQG"
     gene            complement(<641879..>643156)
                     /locus_tag="KLMA_60306"
                     /db_xref="GeneID:34717523"
     mRNA            complement(<641879..>643156)
                     /locus_tag="KLMA_60306"
                     /product="opi1 super family protein"
                     /transcript_id="XM_022820970.1"
                     /db_xref="GeneID:34717523"
     CDS             complement(641879..643156)
                     /locus_tag="KLMA_60306"
                     /codon_start=1
                     /product="opi1 super family protein"
                     /protein_id="XP_022677380.1"
                     /db_xref="GeneID:34717523"
                     /translation="MEVASEESESEKREVEVEKELASEEIAVEALDKLRNGSSDRSGT
                     GSVVAGSIVAGSISGGKSERLLSKMKQSAIELYEQTRTSHPKLMSRADQLVKRIEKTS
                     EKWMNSGKRRRGQGQGDGSWDEEDDSGYSRSDIEESHGLDIEQIRVQDKASEFHPRIR
                     GLKRRRIKQNFKEYQLNLSIESKKRLITCLGLLKLANKQLAQRVTSLQEVVKKEQLRH
                     KPLPASGGTGTGASPKDEEEDDKQEADDEDEEFYDASSHLHEPASSSSSHAVEENQHQ
                     HQHQHQHQNELEIDPTANAIHLEVVGTLKKVYTVVSRFTGSSLPEPARSQVREVLLKL
                     PTKWLNDSEKPNSKNISSNKRALLLAQEALDMVGNVMNVVDDTLGKAETWVKNKQELK
                     QLLMEQFKHEQLKQKVKHQLTKENNNSSTQGSA"
     gene            <643482..>644957
                     /locus_tag="KLMA_60307"
                     /db_xref="GeneID:34717524"
     mRNA            <643482..>644957
                     /locus_tag="KLMA_60307"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820971.1"
                     /db_xref="GeneID:34717524"
     CDS             643482..644957
                     /locus_tag="KLMA_60307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677381.1"
                     /db_xref="GeneID:34717524"
                     /translation="MLVQMRGGILFRRSGLYLVQARRRFGHWDELYSKYYINGRAIGG
                     DEREVVGKLGLLTVPRVEEAQVRCGFKGKGVSRMLDVLLLDVYSGDKGWMEQFLQRDR
                     KQRSLIRYGVDFGVKSASGLDEVVTYELPSPWLEKAGCEILELGSESESEAESREGPS
                     GRPDGCHLYVSEKGFTPARWPTFSVVPRHGGSGSEAGTGTSHENEVDAETAFDVALRF
                     SKDKSLVSTYLDSLDSTNILAISKKLQARLNDKNQIFRDLERAVLTELYRVDESPQEY
                     EKLMKSRARVDDTIENWAREAHKELQGSIEKLLQDFASKQLSLWKVYSYSEPKLSLKL
                     HELCNISNDLEMVQNLSHIYGSLGIQQQRLSIISPDYAKNKVPYLHREINKCVYKNFF
                     QLQFPLIAVSVIGYVTELCSGYSMGALASLGIVLGLKRVKDTWYNLLLQFQQQIREEC
                     RVGIELNKQLLRKNWEDAYTQKESELSSKVALLEQISKELK"
     gene            complement(<645021..>646538)
                     /gene="APM2"
                     /locus_tag="KLMA_60308"
                     /db_xref="GeneID:34717525"
     mRNA            complement(<645021..>646538)
                     /gene="APM2"
                     /locus_tag="KLMA_60308"
                     /product="AP-1 complex subunit mu-1"
                     /transcript_id="XM_022820972.1"
                     /db_xref="GeneID:34717525"
     CDS             complement(645021..646538)
                     /gene="APM2"
                     /locus_tag="KLMA_60308"
                     /codon_start=1
                     /product="AP-1 complex subunit mu-1"
                     /protein_id="XP_022677382.1"
                     /db_xref="GeneID:34717525"
                     /translation="MSSCILLLDETFDLLLERVLRPLSHLDESIKQLQDELQRNNGRI
                     KPIFEINGLHYAVINRDNLYFAMIMQTNNHVSPLSVLNYLEDLYQLIKKFIGMSLNKL
                     NVRDNFHLIFELIDESSDYGIIQVTNYNIIHDFIKVEVIKSVETETLPASSSKAGEPE
                     DQDETYINSHILRTITSAVSWRPKGINYGKNEFFLDVVEKLEFVMDLDQGIVRDNAIN
                     GTVFCRCYLSGMPQLSIGFNKLIQKNVHFMKRLKFHECVDLDTLLSDDYPIVRFIPPD
                     GEFELCSYRLNRPMHDDPVIKLESATTTFKPRKDPLKQDRVLLRASISTHFKSQDSTK
                     DLCINIPVKHVIENWNVDLEQTPLFKSDIGEAFFNLTEGSLVWKIPHLKGGHGDKTYE
                     LKCKFEIWDEEIHRRQIEELHNSMDPPPLRSGPKLEKLWKDIHEKSASQAKSNVQEKR
                     QPCLVAMEFEIPYYAVSGLKVEYLKIEEPQLSYQSFPWVRYKTLNDREYTYQVSI"
     gene            <646843..>647160
                     /locus_tag="KLMA_60309"
                     /db_xref="GeneID:34717526"
     mRNA            <646843..>647160
                     /locus_tag="KLMA_60309"
                     /product="putative pterin-4-alpha-carbinolamine
                     dehydratase"
                     /transcript_id="XM_022820974.1"
                     /db_xref="GeneID:34717526"
     CDS             646843..647160
                     /locus_tag="KLMA_60309"
                     /codon_start=1
                     /product="putative pterin-4-alpha-carbinolamine
                     dehydratase"
                     /protein_id="XP_022677383.1"
                     /db_xref="GeneID:34717526"
                     /translation="MYNKIFKEAPLLLPKPILISKLEALPKWKLIDNELVREHKFRDF
                     EETWSVLTKVAMRSHLWGHHPTITTTYNKVQFRLTTHDVSGVSNIDLKLASKIEKYLT
                     TKA"
     gene            complement(<647274..>648041)
                     /gene="NFU1"
                     /locus_tag="KLMA_60310"
                     /db_xref="GeneID:34717527"
     mRNA            complement(<647274..>648041)
                     /gene="NFU1"
                     /locus_tag="KLMA_60310"
                     /product="nifU-like protein"
                     /transcript_id="XM_022820975.1"
                     /db_xref="GeneID:34717527"
     CDS             complement(647274..648041)
                     /gene="NFU1"
                     /locus_tag="KLMA_60310"
                     /codon_start=1
                     /product="nifU-like protein"
                     /protein_id="XP_022677384.1"
                     /db_xref="GeneID:34717527"
                     /translation="MLGRLLYHGNSGRSIQKFILSPVWRRSIHVKTLTTPNDNALKFV
                     STDGELLQEKGKQSVEIKNTDEELLKHAPFPAKIFQQCPGVESMMIGDDFVTINKDEM
                     MHWNQVTPTVIDLLVQHLASGKPTFLPDFYSVHQDGVGYDVNVPKFEYDEDEQEISEM
                     IDELIQTRIRPAIMDDGGDIQYRGWDPKTGTVYLKLQGACKSCSSSEDTLKHGIEAML
                     KHYIEEVEDVVQILDPEEQIALAEFEKLEKKLEGSRK"
     gene            <648421..>649926
                     /gene="PTM1"
                     /locus_tag="KLMA_60311"
                     /db_xref="GeneID:34717528"
     mRNA            <648421..>649926
                     /gene="PTM1"
                     /locus_tag="KLMA_60311"
                     /product="membrane protein PTM1"
                     /transcript_id="XM_022820976.1"
                     /db_xref="GeneID:34717528"
     CDS             648421..649926
                     /gene="PTM1"
                     /locus_tag="KLMA_60311"
                     /codon_start=1
                     /product="membrane protein PTM1"
                     /protein_id="XP_022677385.1"
                     /db_xref="GeneID:34717528"
                     /translation="MYIKFNWASVLCTLIWLQFAAANKGTITDKRNEICSGMYSKKDW
                     SGRVDPYISFNLQKLSDEGVSVVVFDFQDYIHIGATDAAGNTQYICTDEAIREELCTE
                     EQKDKFIIQKEVYDPETGKNRTLATNIQTFFVNQTGMVKDKYEVKKTGYYCIATYPKS
                     EGGSYKAEINFRNSFGNLAAAEINKLPLYGLLAIFYVVAMALYMFAFWKHKHELLPLQ
                     KYLLAAFVFLMIDSIFIWGYYDLKNTKGDTAGTKVYMVVVSILNSAKITMSLFLVLVV
                     CKGYGVVYPKLNKTTMRRVQFFAVFTFCLSVAALIQNYLTPADSTSLKPLFTFVPLGI
                     CFMVFYFLILESLQQTVKYLKQQKQAVKLGMYKKLIIIFYVAFFVIFGGVILSSFVLI
                     GMGTVEMIEQHWRTRFFFVDFWPSLVYFCVFVSIAFTWRPTSTSYMLAVSQQLPTDPE
                     NVADFDLDDLQSLEQEWNQEYEQPGGSIPQEADLNFSDDETDRKKTTQPPV"
     gene            complement(<650295..>651440)
                     /gene="URC4"
                     /locus_tag="KLMA_60312"
                     /db_xref="GeneID:34717529"
     mRNA            complement(<650295..>651440)
                     /gene="URC4"
                     /locus_tag="KLMA_60312"
                     /product="uracil catabolism protein 4"
                     /transcript_id="XM_022820977.1"
                     /db_xref="GeneID:34717529"
     CDS             complement(650295..651440)
                     /gene="URC4"
                     /locus_tag="KLMA_60312"
                     /codon_start=1
                     /product="uracil catabolism protein 4"
                     /protein_id="XP_022677386.1"
                     /db_xref="GeneID:34717529"
                     /translation="MDNMAKVRDNLIDIIGRDYKQLSDIPVHGRWQHLNCGGVDRIGQ
                     LLSAWEVEKVDSIEVCRRLVDLITFSVLIDAGAGSTWRFTEGETKIGRSEGLAVASFY
                     MFESGSLSADGTHKVHGSKLSEFTKQDFDEAFQISSKNTLQGYEGRIELIKSLGRSLL
                     SSSDIFGEDGRPGNMIDYLFKLNNSNELELPQVWNTLMSGYTQIWPAGRLSFNGEPLG
                     DCWEYKKEDNTSFIVCFHKLTQWLCYSLLRPLEEFGHKFIIKSKDLQTGLPEYRNGGL
                     FIDFGVLSLKEEYHKAGVNNSTEYGYDSSIPTFTPESGVIVEWRCLTIGLLDKLLPMV
                     NEKLDATLKLSQLIEAGTWKAGREIAAKLRPKTGGPPINLHSDGTVF"
     gene            <652169..>652522
                     /locus_tag="KLMA_60313"
                     /db_xref="GeneID:34717530"
     mRNA            <652169..>652522
                     /locus_tag="KLMA_60313"
                     /product="40S ribosomal protein S20"
                     /transcript_id="XM_022820978.1"
                     /db_xref="GeneID:34717530"
     CDS             652169..652522
                     /locus_tag="KLMA_60313"
                     /codon_start=1
                     /product="40S ribosomal protein S20"
                     /protein_id="XP_022677387.1"
                     /db_xref="GeneID:34717530"
                     /translation="MSHVEKKAEQQQEVQIHKIRINLTSTKVKQLENVSANIIKNAET
                     FKLVKKGPVRLPTKVLKISTRKTPNGEGSKTWDTYEMRIHKRYIDLEAPAHIVKRITQ
                     ITIEPGVDVEVIIAA"
     gene            complement(<653587..>654801)
                     /gene="engD"
                     /locus_tag="KLMA_60314"
                     /db_xref="GeneID:34717531"
     mRNA            complement(<653587..>654801)
                     /gene="engD"
                     /locus_tag="KLMA_60314"
                     /product="putative GTP-binding protein YLF2"
                     /transcript_id="XM_022820979.1"
                     /db_xref="GeneID:34717531"
     CDS             complement(653587..654801)
                     /gene="engD"
                     /locus_tag="KLMA_60314"
                     /codon_start=1
                     /product="putative GTP-binding protein YLF2"
                     /protein_id="XP_022677388.1"
                     /db_xref="GeneID:34717531"
                     /translation="MMLKRFYASLGRPSNNLTSGIVGLANVGKSTFFQAITKSKLGNP
                     ANYPFATIEPEESKVIVPSSKLDHLYRLYESQKKIPSTLTVFDIAGLTRGASSGEGLG
                     NKFLNDIRHVDGIFQVVRGFENDEITHIEGNVDPVRDLSLVQDELVLKDLEWLEGARE
                     RINKKINRAPKNSTEFLSMSTELKLLDEVEAHMYEGKKLSHWKKDWSEEEINILNKHN
                     FLTAKPTLILLNVTPKDYLLQENKFLDKINKWLDEFAPGDQVMLFSAELETKYNEFDD
                     DLQQFEKYCKEITNGQDLKAPLTALPAIIVKMRELLQLISFYTCGPIEARQWTILKGT
                     MAPQAAGVIHSDLEQTFISANIIKYEDVKEMEPPLQESALKSQGKIKRGGKQYIVEDG
                     DIIHFKAANGKK"
     gene            complement(<655072..>656070)
                     /gene="OTU2"
                     /locus_tag="KLMA_60315"
                     /db_xref="GeneID:34717532"
     mRNA            complement(<655072..>656070)
                     /gene="OTU2"
                     /locus_tag="KLMA_60315"
                     /product="OTU domain-containing protein 2"
                     /transcript_id="XM_022820980.1"
                     /db_xref="GeneID:34717532"
     CDS             complement(655072..656070)
                     /gene="OTU2"
                     /locus_tag="KLMA_60315"
                     /codon_start=1
                     /product="OTU domain-containing protein 2"
                     /protein_id="XP_022677389.1"
                     /db_xref="GeneID:34717532"
                     /translation="MSVEETQEQLLARHRKERKDLTNQITSLKKQASKKTRKQVNARC
                     LELEQELEARHKSELAQLNGEQVSDGSQENEITPEMLLQQLNLDNDNASASNPESTAT
                     VVPAGTTSTPNTEVSADTQPSGQGKKRRNRQKERLAKREAEIARIKEEALKEAAEQPN
                     LKEIEQTALDELCDVLKLKQIDIQPDGHCLFNSILDQLKVRHAGDVSYDYDFPEQYKG
                     AVNITEMDVSSLRSLSACYIREHRDDFIPYLFDENTMTIKDLDEYTKTMETTAEWGGE
                     VEILALSKVFGCPISILMSGRSTYKINEGAKNPELKLVYYKHSYTLGEHYNSLHDL"
     gene            complement(656322..656393)
                     /locus_tag="KLMA_R611"
                     /db_xref="GeneID:34718770"
     tRNA            complement(656322..656393)
                     /locus_tag="KLMA_R611"
                     /product="tRNA-Met"
                     /db_xref="GeneID:34718770"
     gene            <658402..>661674
                     /gene="RGT1"
                     /locus_tag="KLMA_60316"
                     /db_xref="GeneID:34717533"
     mRNA            <658402..>661674
                     /gene="RGT1"
                     /locus_tag="KLMA_60316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820981.1"
                     /db_xref="GeneID:34717533"
     CDS             658402..661674
                     /gene="RGT1"
                     /locus_tag="KLMA_60316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677390.1"
                     /db_xref="GeneID:34717533"
                     /translation="MLSVLSQSETSKPNGLTAQSDNIDHKKRQMDESNTNFTNSSGSS
                     LTPEQTTTTTAAAGANTNRSATTTEAATSTTLTTTEVAGSTPKPTNIQDSNETGFNGN
                     PESRRDSVSSTVSTTADGRRRSKVSRACDQCRKKKIKCDYIEGSENNPDQSCTGCRKI
                     GEKCSFERVPLKRGPSKGYTRSNSQSRERRSSQHRQSLSELSSMKSRIGSASNPIGGI
                     NDQQKQEGIEVVMHPGQSATPTGAVSLPPLLQYLPGMNQSTQHVSSPSGLQQPFWKVP
                     YHEYQYQRRPSLDSLASDSSQKGNGKPIPQQQPQLQSLNNVRSNTGPLQSQETMRNQR
                     YYYQSSQDSASEAGSDNRRSSSAIPPLLNPAMQIQQHQPYPYSQFTLAQQQQQQQQQQ
                     QQQQQQQQQQQQHPNMHALQSLQQNTMKPQGFLPGGPLGPYSANKALQQPQPQTQLQQ
                     PQPQSQSQSQLQSQLQSQAQQQSQQPQIQPDQGHVLKRTDSAASDAMSLNASPMAYNG
                     EPESAPQSPVQKKRKKSNKSSGSKKGKLGQHDLALTNSSLVNYGQVSDVELINTYYEY
                     IHLRFPIIPVNKETLTNEILLVNTQPVSELHEFNAYILLWFRNSLELLIRICRKDKQS
                     EEVLYQQTTFVGAINECFQKIVDVHPRFRDLESQISEKIALIYLVTFIILNYTLALVS
                     YNNSFVLGMSVIIFNELKLWKSFIFGNWDTASAQEKMYLRLYYELNVFDSLQSCSFGV
                     PKLMDLQLDENTVSKLFYDDVSAEGSDKEALKYCVDWDPENVAVIVDNMELGYFLTRL
                     CQSRRSRLNLPLPDVLEKDKNAQRKTIPGLFRTFLYLKRQFTDLLLGLPDSEGKFPEM
                     TSELVTKLSNMVCDLTSSIYDLLKLNLETNLTNCIQPQSQQQSPKDRLSSKNTISPRS
                     NAMSPKAADVGGPSNSGSASASPGPGTVPSHNAEIGTVSPYIIAIFREVSNVVELIKN
                     MPTSLIGCVIGTHTPNFDSQPLVLQLSQCMNNMLQIATFTSSLRPFKIFKYDPNDQTK
                     NNSLAAVPIYKSKIQDSLPTLQTAVTPQQIMMTQFIETAWRLADTEELGWFASNADQD
                     LV"
     gene            <662736..>664244
                     /gene="UGP1"
                     /locus_tag="KLMA_60317"
                     /db_xref="GeneID:34717534"
     mRNA            <662736..>664244
                     /gene="UGP1"
                     /locus_tag="KLMA_60317"
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /transcript_id="XM_022820982.1"
                     /db_xref="GeneID:34717534"
     CDS             662736..664244
                     /gene="UGP1"
                     /locus_tag="KLMA_60317"
                     /codon_start=1
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="XP_022677391.1"
                     /db_xref="GeneID:34717534"
                     /translation="MSTATVKKHTKTHSTYAFENNTNSVAASQMRNALNKLVDSVTDD
                     AVRSKFENEMDSFFSLFRRYLGEKASGNTLDWDKIKSPSADEVVDYKVIETSQAENVS
                     HLDKLAVLKLNGGLGTSMGCVGPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLL
                     MNSFNTDNDTAHLIKKYSANRIRIRSFNQSKFPRVLRDSLLPVPQSCNDQLDSWYPPG
                     HGDLFESLHSSGELDALLAQGREILFVSNGDNLGATVDLKILNHMIETGAEYIMELTD
                     KTRADVKGGTLISYDGQVRLLEVAQVPKEHVDEFKNIRKFKNFNTNNLWINVRAIKRL
                     IESQSLSMEIIPNQKTITRNGHEINVLQLETACGAAIRHFKGAHGVVVPRSRFLPVKT
                     CSDLLMVKSDLFYLEHGTLKIDPSRFGPNPLIKLGSHFKKVSGFNSHIPHIPRIIELD
                     HLTITGNVFLGKNVTLKGTVIIVCSEGQRIDIPNGSVLENVVITGNLQILEH"
     gene            <665079..>667352
                     /gene="TUL1"
                     /locus_tag="KLMA_60318"
                     /db_xref="GeneID:34717535"
     mRNA            <665079..>667352
                     /gene="TUL1"
                     /locus_tag="KLMA_60318"
                     /product="transmembrane E3 ubiquitin-protein ligase 1"
                     /transcript_id="XM_022820983.1"
                     /db_xref="GeneID:34717535"
     CDS             665079..667352
                     /gene="TUL1"
                     /locus_tag="KLMA_60318"
                     /codon_start=1
                     /product="transmembrane E3 ubiquitin-protein ligase 1"
                     /protein_id="XP_022677392.1"
                     /db_xref="GeneID:34717535"
                     /translation="MSADNNRIIFFIIILLFFLSSPSGDGVTSQYEFVQLQSLKAQFN
                     HEFELFKNLTYDSNFKNITGLKLSYYDSLQDPLINATYPIPGKDYTSWEPTEKYMMLP
                     QEIIDTVNQDVWNGKKLLFPPNITSNLYGKIDLLENNKYAKIRMPIANFYNPPESLQE
                     EEPAQGEYYLNTDDSGNAGNHGELHNVTWKHGIVDVSIQHLDSVENSLSLSPATVLNG
                     GTEFETDDGHWKILHLNVNFYNKEETEKHSISTKGIYDIWTGKILIMSQSAKFHSLFA
                     FPHYLANNEDEFKQVKRLIEKYWNATNFVDSLSMSNLQHWSDEATTKCEYFGFLQLES
                     WNQFTPDQIRMIDEELKWPLGRPINRSNLPPIRLKNALLYSPDCGVSLKMRDTFGPRY
                     ELQIQTIRIHLLLGVLLFLAQIYLLLCQMNHTNTPSSVNKISYWCLFMMNLVDGCLAM
                     LYFLASPLLQELYLPLCISAFACFILASVFEIRYMISVYASQVNEQGVGILTLLRGGS
                     EPHNTVNRIMPDEAAISSSLYGRFFFTLVVSIFILLSSLLWPKGIRMIFEYTVLALLN
                     SYWVPQIYRNAVKGSDPRRRRQNGYQSLQNADSNAIPLLWSFVIGTSVIRLVPIVYVF
                     TYPSNVFRHDKDVRFAVLLSLWMLFQILILYSQDLLGSRWFLPKHVMPDGYHYHKGVP
                     VSILMEYGSEDNTFACPICMVDVPVYVEEKEETHKVDIQSYMVTPCSHVFHTECLENW
                     MSYKLQCPVCRAALPPL"
     gene            <667684..>668355
                     /locus_tag="KLMA_60319"
                     /db_xref="GeneID:34717536"
     mRNA            <667684..>668355
                     /locus_tag="KLMA_60319"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820985.1"
                     /db_xref="GeneID:34717536"
     CDS             667684..668355
                     /locus_tag="KLMA_60319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677393.1"
                     /db_xref="GeneID:34717536"
                     /translation="MDGLLINTEDMYTIAVNNILALYGKGTLKWDLKIQLQGLPGPDA
                     SRKVIDYYNLPLTFEEFDKLNRKFQAELWPTSEFMPGTAELIAYLKSKSIPIAVCTSS
                     TSDKFHSKTSHLAEAFKKFDVIITGDDSRIPPGRGKPFPDIWNLGLKELNAKFNSHIT
                     PEECLVFEDGIPGVRAGKAFGAYVIWIPHVEAVPFISDPSGILEGKGEILSSMTEFEP
                     SKFGL"
     gene            complement(<668566..>669528)
                     /gene="PRS3"
                     /locus_tag="KLMA_60320"
                     /db_xref="GeneID:34717537"
     mRNA            complement(<668566..>669528)
                     /gene="PRS3"
                     /locus_tag="KLMA_60320"
                     /product="ribose-phosphate pyrophosphokinase 3"
                     /transcript_id="XM_022820986.1"
                     /db_xref="GeneID:34717537"
     CDS             complement(668566..669528)
                     /gene="PRS3"
                     /locus_tag="KLMA_60320"
                     /codon_start=1
                     /product="ribose-phosphate pyrophosphokinase 3"
                     /protein_id="XP_022677394.1"
                     /db_xref="GeneID:34717537"
                     /translation="MATNSIKLLAPDVHRNLAELVAKRLGLKLTDCKLKRDPSGEVSF
                     SIGESVRDQDIFIVTQIGSGDVNDRVLELLIMINASKTASARRITAVIPNFPYARQDR
                     KDKSRAPITAKLMADMLTTAGCDHVITMDLHASQIQGFFDVPVDNLYAEPSVVRYIRE
                     NVNHKEAIIISPDAGGAKRAAGLADRLDLNFALIHKERARANEVSRMVLVGDVTDKIC
                     IIVDDMADTCGTLAKAAEILLENKAKSVIAIVTHGILSGKAIENINNSKLDKVVCTNT
                     VPFEEKMLRCPKLDSIDISSVLAEAIRRLHNGESISYLFKNYPL"
     gene            complement(<669944..>671542)
                     /gene="ETP1"
                     /locus_tag="KLMA_60321"
                     /db_xref="GeneID:34717538"
     mRNA            complement(<669944..>671542)
                     /gene="ETP1"
                     /locus_tag="KLMA_60321"
                     /product="RING finger protein ETP1"
                     /transcript_id="XM_022820987.1"
                     /db_xref="GeneID:34717538"
     CDS             complement(669944..671542)
                     /gene="ETP1"
                     /locus_tag="KLMA_60321"
                     /codon_start=1
                     /product="RING finger protein ETP1"
                     /protein_id="XP_022677395.1"
                     /db_xref="GeneID:34717538"
                     /translation="MEYILLIEVAEGIEECYSFYKTGKKGIPESGDSKSLEAKSTWDY
                     LPMLSLQSTTGSNKVSIESEWSGHGIIRLFKSEHASLGSLDDDKLCRELGDGRMVAML
                     FIPNYLTINRLLSWFIGDEVTSQTTHLQMIKMNKEKGRFMLLMKFKEQSYARDFMKNF
                     NGKKFNEVDAETCHVVAIKELVFHQGMFSEDKDALPYMLKYPFTSSGTLGNGENKDTL
                     IELPICPVCLERLDSEITGLITTPCQHTFHCKCLDQWKNGNCPVCRYSQLKDTDNQPQ
                     PTCRKCNEKNNLWICLICGHLGCGRYNSQHAIRHYEETSHCFAMDLNTKRVWDYAGDN
                     YVHRIVQNEIDGKLVEVGDSSNSNVSKVNKDNHLEYVQVLLSQLESQREYYEALIYDM
                     QQRVEALESNVQENKHTEDTPNPQLIKKLVDEKVSKVQEKLDEEIMINTGLQQNLDHL
                     TQEIENLKLGKAKLLEENEELQSQVSDLMVHFETQAKFAENSELQNSTLVLKPTPGMP
                     SSSTASATEKKKKKKKKKLVKKPL"
     gene            <671858..>674944
                     /gene="TTI1"
                     /locus_tag="KLMA_60322"
                     /db_xref="GeneID:34717539"
     mRNA            <671858..>674944
                     /gene="TTI1"
                     /locus_tag="KLMA_60322"
                     /product="TEL2-interacting protein 1"
                     /transcript_id="XM_022820988.1"
                     /db_xref="GeneID:34717539"
     CDS             671858..674944
                     /gene="TTI1"
                     /locus_tag="KLMA_60322"
                     /codon_start=1
                     /product="TEL2-interacting protein 1"
                     /protein_id="XP_022677396.1"
                     /db_xref="GeneID:34717539"
                     /translation="MIDEPQNGVSASSGEKAAIFNKLKPICVGLSQITFRKEESSILN
                     DPQLKEHLEELVKQLDSFGNQNSLSAKLGDYVFVPISSMLKTCNSLPDPISVLVFNVL
                     ARVIRMCWSAPGAIGKSTFNQLLSVSTFLISPDLENKKLSEKSDEFKMAAIQLLYDLF
                     STSAFRKWDNGTLPTIAHSNTILLKLLEQGNMNIQLESSRCLQVLFHNINDGEMLSNV
                     VPGNVSTFSKVILKPGLTTHSQVVCEILRTLTVLLVLVYNDSALGVTVEETKDGQNLQ
                     VKVTKPGKHRTTKWLTATSLQLKRAFEPVLEKLVKRDNSTINEQLFNSCVTLVNECHN
                     AFFSLKDILLKTILSIPNRDLTTLDAHKDDIARFMRDNNVTINTELQMSSQFNIVNNA
                     LQILDGDQIYDLQISRIILNSINESLKSHTKKLDKSKPTDLIKINNVGVNSLISTKSS
                     FGYHGGSNIRNDKYVLPDVSYQTYQQVCDILLKLGSKMNARQLEEQITDLLSEESDVL
                     THSNHSIWIASNLLMGYQSSDLSACLEIESELTSCQFDVLELANERITTLSNRSEWTP
                     LQRNNICMNLYALKKMIILMGPDFKHEMLDYIYNIIECFANENENVSTLSNEILMHIA
                     DQFYHGSMVELISDNIDYIVDGISVRLDNCLFQRAYMVLHVLIKLSGYDLVERLNDIL
                     EKLFWMLGYYHGYDDLCVALLNLFAEISFKVQDTFLKSNDSTKQIEIKTWNHDSFKPW
                     GMSNIEQVFDVLDKEKSNPNVESELEPPEQTAEEFFKERLEADSDDEVDEEDYENEIS
                     QEEQGAKSDEMKWESPIPKKAYMLLLRFWSYSDRLLTHSSRRVRHKALDLLIILCPLL
                     STQQAVFLPNVSKVWAVVVQLSITEDLAQVARTYQLLASLVEYTDAFLMKKVLDMWKL
                     FLQRDTLVSRILDNYKRRTGASASASASAAQEQSRSVILNNVPSSNTLLTQAHQKCHV
                     LLVNCMNQFGLQFPDHTAVQMCMCLLPPMSVNGAPPESKHVTNIRLMLAHKRHHHH"
     gene            <675942..>677987
                     /locus_tag="KLMA_60323"
                     /db_xref="GeneID:34717540"
     mRNA            <675942..>677987
                     /locus_tag="KLMA_60323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820989.1"
                     /db_xref="GeneID:34717540"
     CDS             675942..677987
                     /locus_tag="KLMA_60323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677397.1"
                     /db_xref="GeneID:34717540"
                     /translation="MVDDSYYITPHETALAVVATSMKKARLRFDTLVINSLMGGVLFC
                     AGGLLFVMARSENPAIFEQNPGLTNFLGAFTFSIGLFYVVINGADLFNSNVLFFTVGL
                     LRGAVSIYDLVISWVVSLLGNLAGTLFVCYVICHLSGATTSDMVVTGSRSIAEQKASP
                     SFIQTFLKAIAGNFYVCVAVYLQLMCKPLHVKYIVMTLPIFTLVALGFTHVVADMSML
                     IIGMLNGANVSVAKYIWKVLIPGALGNIVGGCFFSGVVPYYLHLCVVERDRKQLSLPE
                     FEARDEQPELNMDSRVVRVDPREVEEAEEDSDVDTDDERYGLLEKQSSGTSDTNSSDQ
                     VLPYTGTPRDSRELNRINTANTMTSGRSHSSRVRNPPGVFPVRGMGKPLKRERTIVDS
                     EYSDEGKQSPKRAPSVTNSFDIISTHSDMDSNFDNPLGVSSLPPQERRNSILRTLSRI
                     PTAHHPPLTHHKTHEDSEEEREVEEYEREGHYNVLDHKLGTKLERALSRIATHKSDDN
                     QLPRTTQDVFPEQRHVDTLNPMTSRRSSTSVSGIFKTISRQLAPSKQPTDVEEIHRRL
                     SQAGVTTKAAQASDNIAGIDNYDGIELPPSHSPFYKRRPSSTSNFSSNSLYTAGSVNK
                     SKKTSPAVTPGPPSTASMSGGGALSVAGKRPQNPMKNIIHYDNDNFEEQSVMDMDMK"
     gene            <678562..>682302
                     /gene="PDS5"
                     /locus_tag="KLMA_60324"
                     /db_xref="GeneID:34717541"
     mRNA            <678562..>682302
                     /gene="PDS5"
                     /locus_tag="KLMA_60324"
                     /product="sister chromatid cohesion protein PDS5"
                     /transcript_id="XM_022820990.1"
                     /db_xref="GeneID:34717541"
     CDS             678562..682302
                     /gene="PDS5"
                     /locus_tag="KLMA_60324"
                     /codon_start=1
                     /product="sister chromatid cohesion protein PDS5"
                     /protein_id="XP_022677398.1"
                     /db_xref="GeneID:34717541"
                     /translation="MQELEFNKSIIPSLEEPFSSAEQIERLSELHEELSGLTQGSVKL
                     DSLESYKNDLINKKILKHKDPGIRALSACCLSDIMRLYAPDAPFTEKELCDIFKLFFS
                     QFRLLRDPDNGNFIQQTYLITRLLECRSIVLITDLPPSKRFVEELFQIFYEKDNNQFP
                     SKLWKIIGGLLTEVVSECETLSMDVLRLIFNAFLNHESKENNSLKGLALNKDSSFEFS
                     LIICESASNRLGRHFSKFYSEILYGITNENEGIQSVLDPSYRTLTKLHKLTSYVWQYS
                     PELVHSVIGFVYQELCSDNVPLRISATSLVTDILTHQSTINFVTTHNDTFQIWLSKMA
                     DISPKVRVQWAKSVSKIISCRDDISEDIAKGLAKTLLDTDDTVRLQSVRSLAQIPSDI
                     VWARLRVDTIFKELLHLIRDKIKEVREESLVYLCKFYDDSLKENLYPLNQSRKNSKEL
                     WDVIKQIPSHVFNLYYINDSNINMQVDLMIFNKLLSLELDENERNTRLIDLVIGLDNK
                     ALASFFAFNNRQVQVNKAMNKLFELNGEKLEKLISWLGSTLPSQLANDAIINKFLELK
                     DSRISHLIKVSINQETNYPTLKNSLQELKIRLEDPDLFKKRGIRFGTSFSRENFNTTI
                     LLLAYRASPFIYNVSGISFLLNSKKDDDEEYNKALTKIVQNISEVNPLLFKSEISSLT
                     TLVTDNSTESDVGKQEQLKTLYKIFKALPNEVKMEDGYLMAKLEDFALKGNVAESKYA
                     IKILALIPDKDKKEKILSSLRSSALPLEFPTHSKHLLCNSLVILSQLFKVDFNLLKDD
                     CNEITTFILRDLLVTNEFFKDIIEGEDTVEWIDDTQLLNKKEWAISTKLLCLELLTNR
                     MISEAQASETVDSSLETIFHKILKLFLYFVSNGGEVINPENETKYPTPVSYQRRIRCQ
                     AGLQILKLAKVAKFNKWIESKFIFKLINLVEDESFPVRYKFVNKLKNYISEEAISIKF
                     IPLPFFMPFEPDVKFKTDAKIWINFTFQKESATRGAIFERSLPRLLHCIAHHPDIEDN
                     VTTDANEEEFMTACNAAIDYVLFYLDTVLKPENINLLYYLTGRVKQYRDLLEDNPTCI
                     YVISELVQMILKELKQMKNLNLSEYPGRLNLPSDLFVPFENAKLAQANTFKTFIKDEF
                     AKKLEQRIKLKCSKMIHGSSTTIKQKRQQRQLTSEYQQPSPSKKRKHHVTESDSESDE
                     DSYSDKNVYPSPLKSGRQRKSSRTRNTVNYNEEDDENEEIVL"
     gene            complement(<682508..>684472)
                     /gene="RCO1"
                     /locus_tag="KLMA_60325"
                     /db_xref="GeneID:34717542"
     mRNA            complement(<682508..>684472)
                     /gene="RCO1"
                     /locus_tag="KLMA_60325"
                     /product="transcriptional regulatory protein RCO1"
                     /transcript_id="XM_022820991.1"
                     /db_xref="GeneID:34717542"
     CDS             complement(682508..684472)
                     /gene="RCO1"
                     /locus_tag="KLMA_60325"
                     /codon_start=1
                     /product="transcriptional regulatory protein RCO1"
                     /protein_id="XP_022677399.1"
                     /db_xref="GeneID:34717542"
                     /translation="MTNNMEVTRPKRSTTANVDYDLKKRRIIPSEDRPRRVVSNVSLN
                     SNDNTTSEFAGPVISKDENGNIRFQEPPVHDPVNGMTGSPLSQRPKRASNSDSNNTSA
                     TNITNTDTVETPDGNKPVEGSVEGNNGSSSGVEKPKKRKYTKKNKTDVYDALRSKMKD
                     MYEQNLQTNKSNELTKPSDIRSHAHSPSNDNDTASSPQKKNLNQEEGTDVDGLSSDTT
                     ARASESASSDFNKAVAMKIVKRMKSIKDKDTKLFGQNDKASHLHIPEIDPDNNKENDD
                     FCSTCHGSGVFLCCDTCPKSFHFACCNPPLDPSNLPEGDWSCDECKFKQLLKSKKNGM
                     LSEKKQRSKFLSEHSKDPGYQLFGALVFDLKRKNPSQFQLPSLIKSTFESVYSGPQGE
                     YRDEHFKENINEKQIFHSAYGQSVTRLDSYQPEHHMKPDTEELLLCYHCGESRMGTWD
                     HPDTQRLIMTCDYCSTPWHLDCLPYPRASLKNLGSKWKCPLHAPLPKSYKRRLARGKQ
                     KYILLPVGSKNYGDVEILLDRDSWVVPKVNEQNVALQFLDKVYQAKRVQKYNELYEHS
                     VILDKLMNGGDSNPLLKDLSNLLYFQSSGDLKRLWDFKELCKISEQQLQKEEPKDISE
                     DAEMELLKKLKKLLESKPKEEVIDFFKLDQ"
     gene            <684842..>685243
                     /locus_tag="KLMA_60326"
                     /db_xref="GeneID:34717543"
     mRNA            <684842..>685243
                     /locus_tag="KLMA_60326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820992.1"
                     /db_xref="GeneID:34717543"
     CDS             684842..685243
                     /locus_tag="KLMA_60326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677400.1"
                     /db_xref="GeneID:34717543"
                     /translation="MDEELRAIREARLRELKQGGSSSAQGQGGAQAQAQAQTQQILNQ
                     ILDANAQERLSRVALVRPERVKAVESYLMQAVRSGAIRNKLTENDIVGILESVGRDEQ
                     KRNTTRIIFDRREKSALPEDGQSDDDDDFFD"
     gene            <686528..>688561
                     /gene="AO-I"
                     /locus_tag="KLMA_60327"
                     /db_xref="GeneID:34717544"
     mRNA            <686528..>688561
                     /gene="AO-I"
                     /locus_tag="KLMA_60327"
                     /product="copper amine oxidase 1"
                     /transcript_id="XM_022820993.1"
                     /db_xref="GeneID:34717544"
     CDS             686528..688561
                     /gene="AO-I"
                     /locus_tag="KLMA_60327"
                     /codon_start=1
                     /product="copper amine oxidase 1"
                     /protein_id="XP_022677401.1"
                     /db_xref="GeneID:34717544"
                     /translation="MTKHIFDPISDDEIRTTTKLLKDLNGDAKVHFAQIDRLDPPKKQ
                     AIEYLNIERYGGGDLPYIPRRTYAYYYLNDKMPLFKAICNVSENHVICNVETPEGTVG
                     PLLPDDMAKAEEAIMKHPIVLAEIAKLKLDDLYYTHARLGKLKYKVVCEPWMYGTDGP
                     NDKIPLVQAYMYMKLDHPDANHYSIPLKFSPVFEYLSLKFVRMDYLPSGADELYVKDT
                     LPYKPVPTVEYHPDVIEDYKEREGLKPLLIQQPEGASFSIDGTKIEWQGWEFRIATNV
                     REGFALYDIHFKGRSICYRASLEEMTVPYLDPRAPYHRKQAFDLGDCGFGNTANSLAL
                     GCHCLGVVKYLDTRRADAEGNPVLIPSTICMHEQDYGLLFLHQNYRTGSSITTRRREF
                     VVQTIATVANYEYIINLIFDQAGAITVQVRATGILSTMPNDLGCVTDYATPVGPGVTA
                     AYHQHLLSFRFDMRLDGDKNTVVYDDYVPMEENTSLNPYNVGGVQKRTFVEKSGYIDQ
                     SPFTNRTYKVINENSINPVTNKPVGYKFEMPAKQMILASKDSYNVKRAHYATKQIWVT
                     KYADDRMYAAGEFTNQSTEDKGLKVWADGSESVRNTDIVVWPTLALTHPPVTEQFPVM
                     TSDFLQFLVTPASFFTHNPALDVPLANNNFNKSVYYEDATKNAEKPSSGCCKM"
     gene            <688974..>689408
                     /gene="IRC21"
                     /locus_tag="KLMA_60328"
                     /db_xref="GeneID:34717545"
     mRNA            <688974..>689408
                     /gene="IRC21"
                     /locus_tag="KLMA_60328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820994.1"
                     /db_xref="GeneID:34717545"
     CDS             688974..689408
                     /gene="IRC21"
                     /locus_tag="KLMA_60328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677402.1"
                     /db_xref="GeneID:34717545"
                     /translation="MLPPRQPGCSTLAPPPGSDAPNKRGRAKVVLKPGHGPLDWQHLQ
                     QTKGMKGELVHGVNSQIPPFRIQPPLRVNKEILLANKENFWCVLNRKVYCIKDYLSFH
                     PGGEVILKQCAGKDATALFNRYHRWVNYEKLLETCLIGIYVG"
     gene            complement(<690510..>691883)
                     /gene="IXR1"
                     /locus_tag="KLMA_60329"
                     /db_xref="GeneID:34717546"
     mRNA            complement(<690510..>691883)
                     /gene="IXR1"
                     /locus_tag="KLMA_60329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022820996.1"
                     /db_xref="GeneID:34717546"
     CDS             complement(690510..691883)
                     /gene="IXR1"
                     /locus_tag="KLMA_60329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677403.1"
                     /db_xref="GeneID:34717546"
                     /translation="MNLNNPGHNEHQDLIYSGDQEHAQSHHGVPVSMQVQSPQSYHML
                     NGQQSVSQGGAGAGGAVPSQQGMQSSQAGTGHPQSGYSQYQFHNYFAPQTSPMGVGAN
                     TNDQSVSSLPLQMQMQMQMPGHQVSDAMLNQILAQFNQRQQNQPGSQQTQGQSQTQAQ
                     VQAQAQAQAQAQAQAQAQAHMQAQAQAQAQAQMQAQVQQNHQANNPMQQHYKQTAGQL
                     SPRYYAQQQMMDPQVQIPSQFQFLGQSTSAGPQRRVDLVETTKQGKRGGANSSSPSTG
                     ASGNNKQNDPPVKKLSITQTRIAKRKELKKQGPKRPSSAYFLFSISIRSELLKQYPDA
                     KVPELSKLSSSKWKSMTDEEKKPYFDQFKTNWEEYRIARKKYEETLPPKRPSGPFLQF
                     TKDIRPLLVEEHPNKTLIEITKMIGEKWRSLDGPSKQKYTDSYKLKLKEWEASYAEHE
                     ATDEVEQ"
     gene            692977..693667
                     /locus_tag="KLMA_R612"
                     /db_xref="GeneID:34718771"
     tRNA            join(692977..693002,693604..693667)
                     /locus_tag="KLMA_R612"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:34718771"
     gene            complement(<693212..>695221)
                     /locus_tag="KLMA_60330"
                     /db_xref="GeneID:34717547"
     mRNA            complement(<693212..>695221)
                     /locus_tag="KLMA_60330"
                     /product="hypothetical protein"
                     /transcript_id="XM_022820997.1"
                     /db_xref="GeneID:34717547"
     CDS             complement(693212..695221)
                     /locus_tag="KLMA_60330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677404.1"
                     /db_xref="GeneID:34717547"
                     /translation="MSESSDEDSDWEALGRGFPDLSRLSLKFQWDTFMSELQQGTSLS
                     GALDRLQTLKAKWDTMVLNLPLYAERKSEDEEGGEALGEAQDGEGKEENKLRSGSTNS
                     GVSGAISRIWAGSRWNGGHVVETDPTVVTKIHANGHLLYTNDLVMPMDKEYTELTHWD
                     QRFNEDEDALRSRIIKIRSLTDLTDEQKASMIQTLMMKHSTVPGLAMGDHHEETAGAM
                     AESGAQQQLPSYNFEPPEPTEEDKRDVYQSPGVKGCPHYQRNCKLLCSQCNKWVPCRI
                     CHDEAIEDHQFQRNATQWVLCTNCFHHQSPSSHCEECGIEFAMYYCPICVLYDNDESK
                     DIYHCDKCGICRLGLGLGQDFFHCDQCNACLSIELLGNHKCIENSTKSDCPICHEYMF
                     TSTMAVVYMDPCGHAIHQHCFDEYVKHSYKCPNCSVSVINMEREFRILSQEIQEYRLP
                     EPYCYWKCKVHCNDCRKKSMVDYHILGLCCQHCGSYNTRQVDLIKPEDAPATSGTSGT
                     ATTTTTSTSTSTTTGTSTSTSTSSGADSHGSTPRDLRPRNSTVSSFHPDRNEELQQLR
                     DELLHSNFQRETVSSHWALDQNRLRHMDEYLRAMVESSSADADADAANGNGGDPDDNI
                     GFAARIKNFIATQTPDSSTLPQLSQAFAAFLGSTHQGLSSSDEDD"
     gene            <695785..>696300
                     /gene="TVP18"
                     /locus_tag="KLMA_60331"
                     /db_xref="GeneID:34717548"
     mRNA            <695785..>696300
                     /gene="TVP18"
                     /locus_tag="KLMA_60331"
                     /product="Golgi apparatus membrane protein TVP18"
                     /transcript_id="XM_022820998.1"
                     /db_xref="GeneID:34717548"
     CDS             695785..696300
                     /gene="TVP18"
                     /locus_tag="KLMA_60331"
                     /codon_start=1
                     /product="Golgi apparatus membrane protein TVP18"
                     /protein_id="XP_022677405.1"
                     /db_xref="GeneID:34717548"
                     /translation="MVSLDLAKSLFNVSGMIADLKSSNFSIYGQWFSYLNIFLCLVFG
                     FVNIFHISGVVVFSIIAVVQGFIILFIEVPFLLKICPLSENFIGFVSKFDTNWRRFLF
                     YLVMCVIQWCSLIVKTTSLIVVAIGLTITCLVYGIGAAAHQEFKNSSILSDRGKVAAS
                     LGNEAVVRDML"
     gene            complement(<696967..>698352)
                     /gene="MOT3"
                     /locus_tag="KLMA_60332"
                     /db_xref="GeneID:34717549"
     mRNA            complement(<696967..>698352)
                     /gene="MOT3"
                     /locus_tag="KLMA_60332"
                     /product="transcriptional activator/repressor MOT3"
                     /transcript_id="XM_022820999.1"
                     /db_xref="GeneID:34717549"
     CDS             complement(696967..698352)
                     /gene="MOT3"
                     /locus_tag="KLMA_60332"
                     /codon_start=1
                     /product="transcriptional activator/repressor MOT3"
                     /protein_id="XP_022677406.1"
                     /db_xref="GeneID:34717549"
                     /translation="MNMNVGTNSGIGFGNLMVKHEQELLQKQQLYQSNQYNTLNQPLL
                     PQQSQQSQPLQSYSGRYQQQLNQGSNSTPLVIHPVYYSNLGQQSQTNLQSQQQQQQQQ
                     PQAQTQQRSQHPFASNNSGYFSSNYSTTSANPNVRDASNVRLSQSFAKSEHGNVHQNG
                     LSRTLESIPASNNDVLNQSSIFGSTPSSTNLSSSQQNSYALPQINPSSGVFPSFNNPT
                     GASMYQYNNSSLPPSYQNSSSVSSTESNRATHANVNGNSNSDAQQYQQLQNFQQLQQT
                     KLQRQSIAVPPTHGQQSGHNNFQKNVAAPLQPLNIQPTSKSDIDNKHFRQNSTQDTHH
                     VYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLL
                     HEFTLYGILMNVNNGSGNTANLVTTNTGDKVWLINNEPSITIRDMLESNILPKDQAKR
                     CLNYIVDHKCK"
     gene            complement(<703029..>703679)
                     /locus_tag="KLMA_60333"
                     /db_xref="GeneID:34717550"
     mRNA            complement(<703029..>703679)
                     /locus_tag="KLMA_60333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821000.1"
                     /db_xref="GeneID:34717550"
     CDS             complement(703029..703679)
                     /locus_tag="KLMA_60333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677407.1"
                     /db_xref="GeneID:34717550"
                     /translation="MSNYNSRHLRLAAETLSTDLNGLSQLEVIFNVYSNRLNFSDVNY
                     VNKVLPRCLQILKGNLGSFYEAHGSSVYGYEKCGNRDEWVKYKWNAMLEKDLVYITVS
                     DRDNSEEICGFISFALSDSLSSEPEHRPALTRSTKPCLFLYEIHLEKSWQSRGLGSLI
                     FSKILEPLASEMNSPSLELCVFTSNQIALDWYRNMGFKTSITFSKDLIGMSKIIAG"
     gene            <704203..>705327
                     /gene="NEM1"
                     /locus_tag="KLMA_60334"
                     /db_xref="GeneID:34717551"
     mRNA            <704203..>705327
                     /gene="NEM1"
                     /locus_tag="KLMA_60334"
                     /product="nuclear envelope morphology protein 1"
                     /transcript_id="XM_022821001.1"
                     /db_xref="GeneID:34717551"
     CDS             704203..705327
                     /gene="NEM1"
                     /locus_tag="KLMA_60334"
                     /codon_start=1
                     /product="nuclear envelope morphology protein 1"
                     /protein_id="XP_022677408.1"
                     /db_xref="GeneID:34717551"
                     /translation="MNAIYFLSNALPVPEETQVKEEASVIEEEPVEKVDTDKDVSIST
                     NRILARWLWSILIFLPYYLLIKPISTIWYVITFPLNLMETNTKDKRRLKGDMNTESRG
                     HDGNEELSNTYKMKQKSSKYHIEDDLSPNDEIIINEDKMKPKPISETLGKFHFPKKLV
                     PQSMLLSSSRKLLILDLDETLIHSMSSSRSSSGPNSSTSLGDKNPGATTPIVHYVEVR
                     FPQTNITSLYNVAKRPYCDMFLQHTSQWYDIAIFTASMKEYADPVIDWLEQTCSIDIK
                     YRWYRDHCTLRPGVGYVKDIGTVVNQIETRELSQMIIIDNSPISYAMHLDNAIQVHGW
                     INDPSDCELLHLLPLLKAMRHVTDSRCILALKSGRASIST"
     gene            <706971..>708899
                     /gene="MAE1"
                     /locus_tag="KLMA_60335"
                     /db_xref="GeneID:34717552"
     mRNA            <706971..>708899
                     /gene="MAE1"
                     /locus_tag="KLMA_60335"
                     /product="NAD-dependent malic enzyme"
                     /transcript_id="XM_022821002.1"
                     /db_xref="GeneID:34717552"
     CDS             706971..708899
                     /gene="MAE1"
                     /locus_tag="KLMA_60335"
                     /codon_start=1
                     /product="NAD-dependent malic enzyme"
                     /protein_id="XP_022677409.1"
                     /db_xref="GeneID:34717552"
                     /translation="MLKLPKKLVVTKYYSSVTNKNLSSVTRDNTFMSTPQCDDTHYHK
                     IPIGKDAARLQKQKKITRLSVDGPIECPMEGFQLLNSPLFNKGSAFTLEERKAFGLEG
                     LLPPQVNTLDEQVERAYKQLCYLKTPLAQNDFMTSMRVQNKVLFFELVRRHIRQLVPI
                     IYTPTEGDAIAAYSHRFRKPEGVFLDITEPDSIDDRLAAYGEDKDVDYIVVSDGEGIL
                     GIGDQGIGGVRIAISKLALMTLCGGVHPGRVMPVALDVGTNNKELARDELYMGNRFSR
                     IRGKQYDEFVDKFIKALKKRFPSAVLHFEDFGVTTARPLLERYRNELACFNDDIQGTG
                     AVVMASFIAALKHTNRDLLESKVLVYGAGSAGLGIADQIVNHMVTHGLTPEEARSKIY
                     LMDRKGLILDNMQNDSNPAQFLFAKPSSEWSDVNTESLVDVVSRVEPTCLIGCSTQAG
                     AFNKAVVETMYKHNNRPIIFPLSNPTRLHEAVPEDLLKWTNYDALVATGSPFPPVNGY
                     RISENNNCFSFPGIGLGAVLSRAKVISDKMISAAVDQLADLSPLKPGDSKPGLLPPLE
                     EINDTSAKVATAVILQALEEGSARIEDETIPGSDEKVKVPRDFDSCLEWVRKQMWKPE
                     YRPLVKVEHDPEVHTHQI"
     gene            <709451..>710974
                     /gene="TFA1"
                     /locus_tag="KLMA_60336"
                     /db_xref="GeneID:34717553"
     mRNA            <709451..>710974
                     /gene="TFA1"
                     /locus_tag="KLMA_60336"
                     /product="transcription initiation factor IIE subunit
                     alpha"
                     /transcript_id="XM_022821003.1"
                     /db_xref="GeneID:34717553"
     CDS             709451..710974
                     /gene="TFA1"
                     /locus_tag="KLMA_60336"
                     /codon_start=1
                     /product="transcription initiation factor IIE subunit
                     alpha"
                     /protein_id="XP_022677410.1"
                     /db_xref="GeneID:34717553"
                     /translation="MDKPIEETIKALLSFVVRQFYSNSYVLVLDAIMFHSVLSEEDLA
                     HLLGIKRPELRSLITVLLEDRILARHSQQEFAVNSRSVKRYYYYIKYPQAIDAIKWKV
                     HQIVAKLKDDLDKNSTPQGYICPMCSTRYSQLEAIALLNYERTQFICSLCEEPLIEDD
                     SGKRSKEKQGRLNRLMDQVQPIIDYLKKIDDNMIEENTFETALARLIPPQNNSVAQYT
                     LNPRARKSRMFVPGDISMGNESSRKAGVKSQATLHVNITTQYDEMYQKDQQEKQAEER
                     RKQNALPTWHEKSTIGEEALGNLRDEYDMSSRVKIEEEDEEGETAGGANVDTGAGEED
                     QDMDQNGEDIGGQDYGQQQQQQYQQPVIRSTLTDEQMKEREAERTLAEYYAQLAKKNA
                     EEDEDIDDDDDDDLDVDDDDVDDFEDVQDDENEDGNDSEDASASDARNSKEESVSTAE
                     ALSSSVRPEKGDDDADDDMAELEDIELESVKADDEAKTAATENDANDDEEGQGFEDV"
     gene            <711128..>712627
                     /locus_tag="KLMA_60337"
                     /db_xref="GeneID:34717554"
     mRNA            <711128..>712627
                     /locus_tag="KLMA_60337"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821004.1"
                     /db_xref="GeneID:34717554"
     CDS             711128..712627
                     /locus_tag="KLMA_60337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677411.1"
                     /db_xref="GeneID:34717554"
                     /translation="MKSRKTFILDLNASSSHRLCLVITNSGESQNKTQLWTNKRRDFK
                     AYSINDMGNDSWKLVAVTVAATVTTLKVAELAINSWNSRSSSSSSSAVGTETEKDVRL
                     AKKLRESRGYDNSLYREQLARNYAFLGEEGMEKLKNQYFVVVGAGGVGSWVVTMLVRS
                     GAHRIKIIDFDQVSLSSLNRHSCADLYDVGLPKVEVLKEHLKKIAPWCNIETCNELWT
                     RENADRLIFGDGTPTFIIDCIDNIDTKVDLLEYAYKKDIPVIASMGAATKSDPTRINV
                     GDLTTTEEDPLARSVRRRLKQRGIIKGIPTVFSAEKPDPRKAKLLPLPEDEFQKGNVG
                     ELSALKDFRVRILPVLGTMPGVFGLTIATWVLCKISGYPMEPIEGKNRIKLYDGIYQS
                     LAGQMSRIGHPDQRVPVALSDVGYLVEEVWRGKSPISGYSTRLTLSKWDPKKPVSLQN
                     VVVMTKDEQREHENRILLGNESFADVYSEEALAMIEKRFGEERYYSQFR"
     gene            complement(<713217..>714341)
                     /gene="LEU5"
                     /locus_tag="KLMA_60338"
                     /db_xref="GeneID:34717555"
     mRNA            complement(<713217..>714341)
                     /gene="LEU5"
                     /locus_tag="KLMA_60338"
                     /product="mitochondrial carrier protein LEU5"
                     /transcript_id="XM_022821005.1"
                     /db_xref="GeneID:34717555"
     CDS             complement(713217..714341)
                     /gene="LEU5"
                     /locus_tag="KLMA_60338"
                     /codon_start=1
                     /product="mitochondrial carrier protein LEU5"
                     /protein_id="XP_022677412.1"
                     /db_xref="GeneID:34717555"
                     /translation="MSTNVGKKTAGSLDMKQQNTGDTSAKRILPRASEGAYTNKQNLD
                     YILKSGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRE
                     GMRGFFQGHSATLLRIFPYAAVKFIAYEQIRNIIIPSKEYETHFRRLCSGSLAGLCSV
                     FCTYPLDLIRVRLAYVTEHHKVRVWPLIKKIYQEPASQSLSSKSYIPNWFAHWCNFYR
                     GYIPTVIGMIPYAGVSFFAHDLFHDILRHPLIAPYSVLRVDDLDADDFEVEVQKTNSG
                     KKIPLNTWAELLAGGLAGMTSQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMPEMAKII
                     FHERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWYMNI"
     gene            <715729..>716625
                     /gene="CTP1"
                     /locus_tag="KLMA_60339"
                     /db_xref="GeneID:34717556"
     mRNA            <715729..>716625
                     /gene="CTP1"
                     /locus_tag="KLMA_60339"
                     /product="tricarboxylate transport protein"
                     /transcript_id="XM_022821007.1"
                     /db_xref="GeneID:34717556"
     CDS             715729..716625
                     /gene="CTP1"
                     /locus_tag="KLMA_60339"
                     /codon_start=1
                     /product="tricarboxylate transport protein"
                     /protein_id="XP_022677413.1"
                     /db_xref="GeneID:34717556"
                     /translation="MSSDTKPKVDPFHSFLAGAIAGAIEASITYPFEFAKTRLQLIDK
                     SSKASRNPLVLIYNTGKVHGISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDKKT
                     GELSGFRGVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYQNNGKGMLRNYAK
                     LISDQGFIGLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNVPKDKPLSSGLTFI
                     VGAFSGIVTVYTTMPIDTVKTRMQSLDSTKYTSTINCFATIFKEEGLKTFWKGATPRL
                     GRLILSGGIVFTIYEKVLTILA"
     gene            complement(<717010..>717930)
                     /gene="BSD2"
                     /locus_tag="KLMA_60340"
                     /db_xref="GeneID:34717557"
     mRNA            complement(<717010..>717930)
                     /gene="BSD2"
                     /locus_tag="KLMA_60340"
                     /product="metal homeostatis protein BSD2"
                     /transcript_id="XM_022821008.1"
                     /db_xref="GeneID:34717557"
     CDS             complement(717010..717930)
                     /gene="BSD2"
                     /locus_tag="KLMA_60340"
                     /codon_start=1
                     /product="metal homeostatis protein BSD2"
                     /protein_id="XP_022677414.1"
                     /db_xref="GeneID:34717557"
                     /translation="MSERSELVEGSSSVTLSPEDSVSQSQSQSQSQSLLRSDSETVGD
                     STEPGSRLVRMNENFQQHLNYVARKFNILDRLFRRGSSSEQAMRLQVGASSDGVFSNL
                     TAKPERNSGNVNVEQDKPPTYDEAAADMAPPYYGIDDDGVGLYYNEICIDGLPVGNIF
                     NFLWNVVVSFSFQFVGFLLTYILHTSHAARQGSRFGLGITFIGYGYSMIPNNVSGKIG
                     KDKDLDRLEFDNPDSYEEIRLYDSTPTQDEFQSGLSHGVVEKTRHTPALAVFVIILGG
                     FIVLKSVWDYIKVKRMESRFLQDANAAAEV"
     gene            complement(<718332..>720992)
                     /gene="SNF5"
                     /locus_tag="KLMA_60341"
                     /db_xref="GeneID:34717558"
     mRNA            complement(<718332..>720992)
                     /gene="SNF5"
                     /locus_tag="KLMA_60341"
                     /product="SWI/SNF chromatin-remodeling complex subunit
                     SNF5"
                     /transcript_id="XM_022821009.1"
                     /db_xref="GeneID:34717558"
     CDS             complement(718332..720992)
                     /gene="SNF5"
                     /locus_tag="KLMA_60341"
                     /codon_start=1
                     /product="SWI/SNF chromatin-remodeling complex subunit
                     SNF5"
                     /protein_id="XP_022677415.1"
                     /db_xref="GeneID:34717558"
                     /translation="MSNPTMNSSSGNSNGSGNTNPLSNIGTPSFSLSQVPQHILQSLT
                     PAQLQMIQQKHQQLLLQRQRQSQQMQQEQVSSPGNMNQLDATQRAQLMKLKQQQMQRS
                     QLQAQQQAQLQAQQQAQQQQQQQQQQQQQQQQQQHTPQQVPQQQQAPPQRTSLNLPPQ
                     IAQLSPALQMQWLQSIKQQAIARNNQNALMMITQLELKLQQQQQQAQRQQGAQESQQA
                     QRQPQPQPQRQAQTQAQTQAQAQAQAQAQAQARAQARAQAQAQAQAQAQAQARAQAQA
                     QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQRQSQHSPNNPAMSPNQQYQAQIQKPNV
                     PVQQRQRPSAEPVIQSMAGMQTTQHHSPPVQMHPSQASPPQASPPQQSPPQQPPQPSQ
                     ATLLQQVLRQFQKQLPEIPKFQTILQDPPETRLPHTRFWSEKEGKSFDTSLYEHVIER
                     DLIDKDHHLADTNGLEPISKFGFSQREIMLRLQQDLEYYKELKNSRMQSITNTTQGHK
                     SKSIWGDGYSGYGNGFSNDMTRIQVNDTNEIHLDEIHEWTANQDSEELVPIRLEFDAE
                     KDKFTFRDTFIWNRMDTLVSIREFVQTTLKDYKIASNPEMTQHIVNSITEQLQEFNRN
                     PFENVPRYGGDDLRIKINLDIVVGQHQLLDTIEWDISNPENNPESFAECLCAELSLPG
                     EFLTAIAHSIREQVHMYHKSLNMVGYKFDGSTVEEDDIRTRLLPVITLGEVMRPQKDT
                     LMYTPNLIQISPAELERLVKDKDRDTRRKRRQVRFNRRGNATDNHPSTGGTPQLPHDA
                     ELPDLGDIPKTYRQLLPSTTLPGGIDFGPSTLSFHPSTRVEYIERPKPVIHADLPQEP
                     GKSPACRIITHDYGNSLLVSIKLPVRKVPE"
     gene            <721341..>722909
                     /gene="APM3"
                     /locus_tag="KLMA_60342"
                     /db_xref="GeneID:34717559"
     mRNA            <721341..>722909
                     /gene="APM3"
                     /locus_tag="KLMA_60342"
                     /product="AP-3 complex subunit mu"
                     /transcript_id="XM_022821010.1"
                     /db_xref="GeneID:34717559"
     CDS             721341..722909
                     /gene="APM3"
                     /locus_tag="KLMA_60342"
                     /codon_start=1
                     /product="AP-3 complex subunit mu"
                     /protein_id="XP_022677416.1"
                     /db_xref="GeneID:34717559"
                     /translation="MIVSIYINDRRQDTLFQYSNVAECPTFRQLMNKLQSKDAEWEQR
                     YCSELNSELKVCKYTSPSSSIIYWCLSSTSESSMSVISLLEEIDLLLLQYFDKTQLSK
                     VKINNNLDRLAMVFHCIFDGGNPAILESNRLKAMVPAKNDLAKMIKNTTHSITKTLQQ
                     SEGTSSFFQGATNSRYPRSSSSSISSFNVAGAASGGSGTPAVQSVDESGIPWRMNAVN
                     YSNNELFIDMVEEVHASVKRGKLVTGYIKGQIDLNSHLSGQPLVEMDLDLLDHKLSHL
                     NSTFHRCILEDKANNLNDLIEGKFKRLSFVPPDGRTRLCDYTIPLNARNSSSLGLVNV
                     NLQTGLGRRSDEFEIRVTVGMSTKVSEVENINLTIKMNRNFKGSVRVMRNTHGGVETN
                     MSRSELHWHLDKNMVGGSMAVLRCIAEPEGAAGTTGNSGTLVPEHASPEDYRTNSSTP
                     HTTATTSAAIAGQNDTVPVSLLKPAYINCHYQHQSELLSGIKLKSIDVVNTSGAKPFK
                     GVKYTTKTGTLEYR"
     gene            <723228..>724562
                     /gene="CTI6"
                     /locus_tag="KLMA_60343"
                     /db_xref="GeneID:34717560"
     mRNA            <723228..>724562
                     /gene="CTI6"
                     /locus_tag="KLMA_60343"
                     /product="histone deacetylase complex subunit CTI6"
                     /transcript_id="XM_022821011.1"
                     /db_xref="GeneID:34717560"
     CDS             723228..724562
                     /gene="CTI6"
                     /locus_tag="KLMA_60343"
                     /codon_start=1
                     /product="histone deacetylase complex subunit CTI6"
                     /protein_id="XP_022677417.1"
                     /db_xref="GeneID:34717560"
                     /translation="MKRETRERNHRSGQEEEKYVEESEFEQEDEGETRCICGRIEPPD
                     DSGLYIQCEECHVWQHGYCVGITEEDTPDKYWCEQCKPDLHSLYSTDIGEKRSIYKPI
                     QQRRRKHRKTKRNSESESEGSVDAQSPSSSGLNGSVGSQRVSRQRRNSGNADVSNKRE
                     DPDEIVADDGTTEEKEVDEPKTELDEFEENQKHSDRKRATSSAREEKHYQLMLEKALR
                     ESRRSSKDGPEEQDGSDHLKDEASTGKMPSPKLSSRDTESLEVNEWETEDSTSQSRKR
                     GRAATKSTSPSESEEDSKSKRSRRGKTASSSQSNSRNAKAGGRGSRNGRSNGSKASGS
                     SGSSNSSKSNGSTTSEIGINKPLKPRIPSQRTTIHEMRRRVNAILEFISRTQLELSED
                     QLQKEQLCQFVENEEFLENINKIFSNYDESLKSMDDLTRKLLLWEQKFSTIH"
     gene            complement(<724642..>726375)
                     /gene="VPS45"
                     /locus_tag="KLMA_60344"
                     /db_xref="GeneID:34717561"
     mRNA            complement(<724642..>726375)
                     /gene="VPS45"
                     /locus_tag="KLMA_60344"
                     /product="vacuolar protein sorting-associated protein 45"
                     /transcript_id="XM_022821012.1"
                     /db_xref="GeneID:34717561"
     CDS             complement(724642..726375)
                     /gene="VPS45"
                     /locus_tag="KLMA_60344"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 45"
                     /protein_id="XP_022677418.1"
                     /db_xref="GeneID:34717561"
                     /translation="MNLFQVGDFYIDRLANFQGRTSDISIQEKSRVKALLLDNDTIST
                     ISMCTTQTELLKHEIYLVDKLGNFNRDPMPHLKCLCYLKPTEETISNLLRELQDPKYG
                     EYQIFFNNQVSKSQLERLAERDDMEVVTHIEEVFQDYLIVNKDVFTLELPLYNLLENQ
                     LLWNPKGLQETSSGLLSLLLSLKLNPTIAYDSQSKICHKLAKDLEYEIKTNERQLFDF
                     PVRDSNPLLIVLDRKSDPLTPLLQPWTYQSMINEYIGIKRNLVDLSAVPNIDPELKQV
                     VLSPKQDKFFQETMYMNFGDLADKVKNYVDQYKAKANITKQINTIEDIKAFIEKYPEF
                     KKLSGNISKHMAIVSELDRQLQVKNIWEVSELEQNLATHDDNNHDFNELKRLLGLTTV
                     ESYFKLKLCCIFVLRHGSNGGRVKEIENILRQQCDPAQVALYFQFKNRFKSSFKVRAD
                     PQDNDLISGLTKKFNKLGSSGAENVFMQHVPELTRILSDLDKNKFPQSGIKLLNERID
                     TKTYIPQDVVIFIVGGLTIEESRAVHQFNEKYRKGKDNCRIIIGGTSILTTEQFLTDV
                     SAINDKPEDLL"
     gene            <726702..>728996
                     /gene="TCO89"
                     /locus_tag="KLMA_60345"
                     /db_xref="GeneID:34717562"
     mRNA            <726702..>728996
                     /gene="TCO89"
                     /locus_tag="KLMA_60345"
                     /product="target of rapamycin complex 1 subunit TCO89"
                     /transcript_id="XM_022821013.1"
                     /db_xref="GeneID:34717562"
     CDS             726702..728996
                     /gene="TCO89"
                     /locus_tag="KLMA_60345"
                     /codon_start=1
                     /product="target of rapamycin complex 1 subunit TCO89"
                     /protein_id="XP_022677419.1"
                     /db_xref="GeneID:34717562"
                     /translation="MATSVRAKPLKTKSDTSLTQYTKAKKGSKQKQFSVSSRSKSNAS
                     FRNFQKLHRVSSQEAINKGLQDPMKKSRSSESLNKRRVHSGLSMTALVRTRSHPVVLH
                     PHSHSLKHKGLMSGKGNGGSNIILDFHDSGDNEDESATDEEVESFTDEGDAEYAYEID
                     DMNNGDEAQKKLSQKSSHHSLHGFQDKAATLRMDGNRPIQRALSYKPPSRLRNRVDTY
                     DDQISADATGSDSGDKIDNNPHNEHDDVIDSNNQDGSFNANSLRRQGQHIFNFPHEES
                     GAQQNQLQQKQQYRNQSGVSLHEDLIRNDALVKEEENNQDSHIQNINVERKGKEFEDT
                     IPEAVSPTQNGTKETPHDAENSNNTGNRNNRNETKDDDGYNDDNNNSKNGNNVSKNDD
                     DDDDDDVTLNPARATVEAQASEQYVPDMILSQSTGMEKRFDQLSRQSSLAWINTSDHP
                     AERGVKIQNDKSNTFNYINQDLAASIKEETIDESVQQQQQLIMLQKQKQQHKATKSDF
                     STSISSLTSHLTRPVSRDHMLRGGPSSQSRNGQPSLYKQPSFNENEVSNSMTDFSSFL
                     QYADVGGDSRTQQKLWLQRENSIQDLTSQNVFSDSIFLAANVEVRREFERISREYTNV
                     RRFSNPLVESISRISQQQSIEIHKHKKTTPSKLSGNFYNVDNGKTKITKLGESLPSGS
                     KMEVQRILTKLWNTSTQEFHKDENPLMNRGSELLASQTSGTYRSMRPSRIASSQHQRA
                     VNSLHPTTRAVNRRMEYVLGQQHS"
     gene            complement(<729225..>732665)
                     /gene="PAN2"
                     /locus_tag="KLMA_60346"
                     /db_xref="GeneID:34717563"
     mRNA            complement(<729225..>732665)
                     /gene="PAN2"
                     /locus_tag="KLMA_60346"
                     /product="PAB-dependent poly(A)-specific ribonuclease
                     subunit PAN2"
                     /transcript_id="XM_022821014.1"
                     /db_xref="GeneID:34717563"
     CDS             complement(729225..732665)
                     /gene="PAN2"
                     /locus_tag="KLMA_60346"
                     /codon_start=1
                     /product="PAB-dependent poly(A)-specific ribonuclease
                     subunit PAN2"
                     /protein_id="XP_022677420.1"
                     /db_xref="GeneID:34717563"
                     /translation="MNNWQLSYQSPENLTYHLKKPYLQYDKKEKQITKLVFDNETNLI
                     WVGDSYGRVSSYDPTYSLYTRHTAHIGSMPVIDLLSHRNGILSLSSDSLHFANRRGVT
                     QMSLTSADIAQLSDMKTMCYPSNNQHRVLCAGGNSASGIVSIDLVKGSLASSTYYSSK
                     VRHLTSNNKLVAIGKQTGSIDIFDPISNKVVQSFSGHSASITSMDFKDNTLVTAGKSK
                     TFNYMHSDQFINVYDVRIMKQLPPISFSKTPNFVGNHTSSNIPIGADFLQLHPVLPTV
                     VGVASTSGSFDFIDLVNPSLRTPYIHPCKSISQFKISPSGDYLAFIEEDTTLNMWNRS
                     NTMSGFTNTAAIVEYQDFPEDTVMPVRIDLDQESYPLSSVGMPYYSETLLSAWPHTVF
                     KTEGTINKLIEESSSSDVNITSSKPASRMASHLSSSKYSLQPYNKFRYGPRNVLTPYK
                     SLRERRKKMVSTTEENQDRRELMNYKPINNIEIPPAYSKLQMIYGKFGVIDFDFGGFN
                     TTKYSGLETDIDCVYVNEIIHLYRFVPEVYNFVVSCLKDEFFQDKSLLTELGFLFDMM
                     TRAEGNICRASNFVDVLESISTAKDLGLVTDQISCRSERAGRLSISPDNLSPHLKDLT
                     LTENADAEEVMKMSYEKYMTVAQKFNTFLLNRLISEEVQRKVYTTQNIVLEELFGFDV
                     DTEIRTLSTCGEYNHETRIMSSLVVLSPVNNNLKYSNKKLNNQTILPYIESSMSRFRQ
                     LSAKCSKCMKQQNHEYESTVRNLPPLLSLNMCLSPEEWTTAKTVTGWLSNHFYATISK
                     DRPILKLQATDLKTTNAIFKYELTSYVARITDDFGEEHLVTYAKIFDQKIQEFKWYMF
                     NDFLVEEIEEEEALRISYWWKTPEIVVYSDAEEIRKPFVPVSEYSIDDNILYRDYFSE
                     GIRKDVVRQYTLLTREEPPGPGTLVALDAEFVSLTEPRLEINCKGMKTLLKPAKKSLA
                     RVSLLRGEGELEGVPFIDDYIISECHIEDYLTQFSGIEPGDLDPKLSKKSLVKRQVFY
                     RKIWLLLQLGCVFVGHGLTNDFRQINIHVPASQIRDTSLYYLKGKRYLSLRYLAYAVL
                     HKQVQTGNHDSIEDAHTALLLYRKYLQLKEEGVFEMYLENIYDEGRKMGFRVPEQYPM
                     "
     gene            <733052..>736027
                     /gene="RTT10"
                     /locus_tag="KLMA_60347"
                     /db_xref="GeneID:34717564"
     mRNA            <733052..>736027
                     /gene="RTT10"
                     /locus_tag="KLMA_60347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821015.1"
                     /db_xref="GeneID:34717564"
     CDS             733052..736027
                     /gene="RTT10"
                     /locus_tag="KLMA_60347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677421.1"
                     /db_xref="GeneID:34717564"
                     /translation="MIQKLAHIGPVLAVKFYKEWCFCAQGPFIEVYEFKTGSKVGRYQ
                     IFHRNKVHGISICRNSKRVLVYGSRSVSIITIDELLSGKNLLGYEKMTAEWIVSGEFS
                     YNGDQVYLLTIYNKVIAVDPVTCDIVRTYLLEGERSILYSGSIKVLPTKVLVNAGTIM
                     NGIVIWDLTTQKKLWNLKGHEGAIFYVVANNSGSLLASCSDDRSIKIWDLHTGELLST
                     GWGHTARIWNLEFFNEDKQLISVSEDCTCRVWDLLNNEIRQKEMYETHLTKNAWCVDV
                     ENNSLIAVTGGNDGRIKLTEIRKPSFTNDITVTLEDISKSCKEFEPKKNEIIKGFHLF
                     SFGVVLITSEGNIIQHLTAQNKWVLIEHDERFFSFSITQGINNTVFFMNNKCILKSLT
                     FSTEGCLLNTTEIKLSDLTQTINCISVRPYDENFSLVIESANPNDPLLLLKFKERTNE
                     LLEKVVLNKPANLLTSCAEIYGDYLLVGGRFSMVFAFNLLDTTCHSLFVKLPASDAVT
                     SIKHIEDKGGNALFSMTNRDGAYFFVSFNFKMKTVKIVHTNKVNRGFLEGSFYDENDE
                     FIVYGFKSNLFHIYNETQQYEIFSQPCGGAHRQWKLFQPKNDNSVLCFVKNSTLNIVT
                     IPSYQFPKTLKNGSHGREIRDISFQPGNYDSNKNSLFITGSEDTTVKLASLNVETGDI
                     INHWSLKTHVSGLQKCKFISDNIFITCSAREELFVWELEMNFSLPYVSLRQKLIPSTN
                     IPDLRIMDFDVIFLEGTENDFIMVSVYSDSSIKLWHYIYDQNKFTKLAEGKYETCCLL
                     GVAFVPFKRSLKLLISTTGGFLVTMDITKNIPFTLNDGKLPNKSYTKDICKELPHWSD
                     RVRVHEAGIKSFELKLNPTAESFMVYTGGDDNAMAITEFSNKDDDTLDIKILCKDCYA
                     ASSTITSVNLLDNGNKLLSTSVDQIIRIRDISNNELRILDSQYTTVADTGSCDIRKLE
                     DGRHMALIGGLGLSCWQAT"
     gene            complement(<736231..>736464)
                     /locus_tag="KLMA_60348"
                     /db_xref="GeneID:34717565"
     mRNA            complement(<736231..>736464)
                     /locus_tag="KLMA_60348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821016.1"
                     /db_xref="GeneID:34717565"
     CDS             complement(736231..736464)
                     /locus_tag="KLMA_60348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677422.1"
                     /db_xref="GeneID:34717565"
                     /translation="MFGNSMLSSLTRISRPMMKNFNGLSFQTLGLINPPLSRGFKVRT
                     AIKKFCNDCYMVRRKGRVYVYCKSNKKHKQRQG"
     gene            <737050..>739590
                     /gene="SPC105"
                     /locus_tag="KLMA_60349"
                     /db_xref="GeneID:34717566"
     mRNA            <737050..>739590
                     /gene="SPC105"
                     /locus_tag="KLMA_60349"
                     /product="kinetochore-microtubule binding complex subunit
                     SPC105"
                     /transcript_id="XM_022821018.1"
                     /db_xref="GeneID:34717566"
     CDS             737050..739590
                     /gene="SPC105"
                     /locus_tag="KLMA_60349"
                     /codon_start=1
                     /product="kinetochore-microtubule binding complex subunit
                     SPC105"
                     /protein_id="XP_022677423.1"
                     /db_xref="GeneID:34717566"
                     /translation="MSDPRRLSLLPKSILKQKFKDDDTTGNSQNLTMSQIQFPTQGLS
                     KEEILDGNNTTSRINASFSKGNRRVSFAPDVTLHKFDFIPQSIQNVREPRRKSALTVE
                     VPINHDLSGERKDTSDSGETMEFTSPIGSIFQTTEPSDESKNDSYQPIFDKEVSMDIT
                     QLFAKHSAKPDDDTKDEENIENNIQKPKDTEEKIEYGNGNEDKNLNEKQNTNSVVTEI
                     SNVETKVLDETMDLTIPRRQLRTNEEESMEFTEQILVNTAEFGTQPSEATQTIKKSTP
                     PAPEETMEFTNLQAPLELRPSQVVSSTQLEAPLPSAKRRKLSNGSYQSPVKNQIASRE
                     EEKENFDSDFADMERLSPIPITTDAAPNQAKPLDHPTTLSTEKEYQAATQSQVEPIAL
                     ETFFEETGVKFDVENTIDELKIKFSSTEEIETVPSNILHQALYYNIPILEIQAFTAKE
                     LNRRIIQSKMLLKSLQDQIASNAPPRLIKEYFDSDKEIRNIADKKLQLVTIMSRLQSE
                     KVWFEWRSQHLKGIKTVLEENMAILLDENAQIMKYMNEINDIKMRVSDIKHVLLKEID
                     ILGKHNESFDETNEQVSVLLKVNKLKEDLKENMLKIADLSKLTAKKDQLTDRIQTIRE
                     QINKVNEETHELQKELRHNKVCTSYEVEKLKRNFSLYQNISGIKFKSIRGSILTTSLY
                     NSKITVSIYLSKLDQPSCISFKIQEEGISESEMAFINCWIVSCKNNFSNGINSVCFLQ
                     KQLTNLLNVFSEFEKLKLMFSTFIKSEPENDKTIKIQPFDCKYHCKLSLSIPIEHFFD
                     VVCNSKKVTIKANILYGDDRTAREITDNFVKRYEKAFGWLSNCNLVVY"
     gene            <739921..>743913
                     /gene="NUP145"
                     /locus_tag="KLMA_60350"
                     /db_xref="GeneID:34717567"
     mRNA            <739921..>743913
                     /gene="NUP145"
                     /locus_tag="KLMA_60350"
                     /product="nucleoporin NUP145"
                     /transcript_id="XM_022821019.1"
                     /db_xref="GeneID:34717567"
     CDS             739921..743913
                     /gene="NUP145"
                     /locus_tag="KLMA_60350"
                     /codon_start=1
                     /product="nucleoporin NUP145"
                     /protein_id="XP_022677424.1"
                     /db_xref="GeneID:34717567"
                     /translation="MFGNNKPPGSLFGNLNTSTPTTSTPTSNGLLNNKPNTGSLFGGN
                     AVSTPSPGNPTGFNTTQTNNKPALNLFGNNNAAQNTPQANSLFQSSNTVSSTPKPLLF
                     SAPGNNNTQQSGGLFSNSNTQQPSQNNALGTSTTNGFKLGEQTSSTNQVGGLFGNKIT
                     TNSNATGTAGTGTGSLFGNNSGQSNILSSNSNTLNNSNTAPKTSLFGNSSSQGTGSLF
                     STNKPTGLSNTFMNNPQSMQPNSQQVTSNPYGLQLNSTTVLTMPESITSSLASQPKPA
                     SEMKPSRKFSTASSSTSTLNTSSNSTLIGKLTSRLKNLKSRETTQGLFSPSNKFLVRQ
                     DGIAQPTKEDSNIKSKQINGKNALLTSLYQKDFSNIKKLTIDTNRSAAKKMRLLSGES
                     STTKIKSLEEKESSNNNATKNDKLLFSSNPLEMSPVQKTSVASNEELNPSSSSTTDYW
                     CSPTVEQLKKLSKKQLANVSNFVIGRKNIGSISFEYDVDLTAFSEDFNDLFGKTVIFN
                     ENKTVEVYPDPDNKPQVGYGLNVPAVITLQNVYPIDKKTKKPITDNSKIAEVQYFIKR
                     LRNMKEMEFISYNPFGGVWTFKVKHFSVWGIVNEEDIEVDTEEAINESAKEIKNRHLA
                     FPKGYYGGKMFAPINEDSEEEDQNLTGNETVAIRKDVLGLDNEIPVSSSIENDYNDAD
                     MSLIIKEKPYEPSEVNEEDLDLLNSSPELMTSRNWKEQLELAGDSKNSIFSKPFMLKN
                     TTTDSLDDILFPNFQEQLAAYKSIKAERRMNSAISLAKFNNNGKLLVKDPSHPSGCKQ
                     IIFRSNVQINKSAFDRVFTSYLNTSIISTRKNGYPAVEECSLNFNNIASAYSNVPNED
                     KILKLASILFDPISLSYDVHNKQVYDTLVKKQRYMNLCQWLVEETADEVDSKLSTAEP
                     LESIFLYLAKNDIVNASKTAISSNNKHLAVLISLLGSNDPIVSETASAQIAKWKSLGS
                     KVNPVIISIYQLLTGSPFNSGSLINESNNYSWLVNFGLQLYYGDIDSFSLQELTLKAL
                     TNPFIDTASLTSFEKMSMNIMKLFACSNLQVEVLLDELRTYSKTFDVRLCWFFTQMLK
                     RDDMSNLLRDRITLEFIEQLKIDAMYKEALFVACFISNDFVAQQMIDQILSSEIIYFT
                     SAENETILERLSISSAIIHRHLALHDKYCGDYLSEVRNLLKAGQYKEAEIVVITTVAP
                     KLILNAKSNKDHLLLLDQLLKKFPAHTISTWDKGLAVYEKYIKLILNDSVDENTIHSI
                     ITALPPLRNEYSQHELVNVACSFISETVSELFLINFESLSKKIPKESLLSLPLGQPES
                     KYLSKVLSSM"
     gene            complement(<744006..>744998)
                     /gene="NBP35"
                     /locus_tag="KLMA_60351"
                     /db_xref="GeneID:34717568"
     mRNA            complement(<744006..>744998)
                     /gene="NBP35"
                     /locus_tag="KLMA_60351"
                     /product="cytosolic Fe-S cluster assembly factor NBP35"
                     /transcript_id="XM_022821020.1"
                     /db_xref="GeneID:34717568"
     CDS             complement(744006..744998)
                     /gene="NBP35"
                     /locus_tag="KLMA_60351"
                     /codon_start=1
                     /product="cytosolic Fe-S cluster assembly factor NBP35"
                     /protein_id="XP_022677425.1"
                     /db_xref="GeneID:34717568"
                     /translation="MAEVDQNSVTQQQILPPDYSLKEPEPEHCPGPESENAGKGDSCQ
                     GCANKEICESLPKGPDPDLPLIRDNLANIKHKVLILSGKGGVGKSTFTTMLSWALSAD
                     EDLQVGAMDLDICGPSLPHMLGCRDENIHESNTGWTPVYVTDNLATMSIQYMLPDTDS
                     AIIWRGSKKNALIKKFLKDVDWDYLDYLLIDTPPGTSDEHISINNYLKESKIDGALIV
                     TTPQEVALLDVRKEINFCKKAGINILGLVENMSGFVCPNCKGESQIFRATTGGGKALC
                     KELNIPFLGSVPLDPRIGKCCETGESFLDEYPDSPASAAILEVIESLRDAVGDV"
     gene            <745285..>746061
                     /locus_tag="KLMA_60352"
                     /db_xref="GeneID:34717569"
     mRNA            <745285..>746061
                     /locus_tag="KLMA_60352"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821021.1"
                     /db_xref="GeneID:34717569"
     CDS             745285..746061
                     /locus_tag="KLMA_60352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677426.1"
                     /db_xref="GeneID:34717569"
                     /translation="MGELDSQTDSKAGDGWFYVEKIGDETHQFFLGYCSWGLGDELEI
                     WVHIDGYDYGYDYGRSDGQLSDEGLRQVKEWCAKVCEPQAQAQTTIREDGSQWVLGCK
                     DVALELDLTEHRLDMEEIYGRAMELFGCKMRVWESLASEAQEQALQLVEETRRKVKEE
                     LGEEPMEQGRTVSGGLRGPNVQRSPVKREREEDEELGDHGGASAGPHAYPFMGINISR
                     TSVSEASAPAKPEPGPEPQGETETETEAEAEADTDTDTDT"
     gene            <747127..>749169
                     /gene="MRN1"
                     /locus_tag="KLMA_60354"
                     /db_xref="GeneID:34717570"
     mRNA            <747127..>749169
                     /gene="MRN1"
                     /locus_tag="KLMA_60354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821022.1"
                     /db_xref="GeneID:34717570"
     CDS             747127..749169
                     /gene="MRN1"
                     /locus_tag="KLMA_60354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677427.1"
                     /db_xref="GeneID:34717570"
                     /translation="MTYSPFSQPQPSSQGHEAGHGHVHGHLHGQSSSSSGSNANGGLE
                     MRQMAASPVGESLSPVSDLSYQASSRQNTMWSDQGSQWEVQQQHPGQHNHQNQQQQQQ
                     QHLQYQHHHHHHQQQQQQQQQGLQYQQQGLPYQQGMQPGMQYQQHQQHQHPHQGSQGH
                     QFSFSNHIISPVMGSTGMGMSDMSLIRLPSQEYMEYPPLSSGSSEFLSPRPISVVAAQ
                     PEREEKPSSVNLLAQFTAEANMPLSLQSGQLNNPRDFTTAPSRTVYLGNIPSTITYKA
                     LLDYVRTGVVEEVKILPEKMCAFVSFVDENDALLFHSDAILKRLNIDGRDIKIGWGKP
                     QPIDPIVRAGISNDGATRNVYIGKLNTNKDLCEKWGADPKEVVITKEKLLEDLSQFGE
                     IESIKLVEDRGIAFVHFTSVFSAIKAVANIGSIDPYYSNKKVFYGKDRCAFITKTQQH
                     NVAQFLGIQPGMEALMENNRELISQTLLQQSAAAAAIATSAGGANNLGNRTVYLGNLP
                     KNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSLHGLTIHNKRC
                     KIGWGKHSGPLPNLIALAVSRGASRNIYLGNINFEEDSKLEEPIFTEDALRSIFEEFG
                     TVEQINFLYEKNCCFINFANISNAILAIDKIKSNPHFKNLKINFGKDRCGNVPRQL"
     gene            <750478..>751227
                     /locus_tag="KLMA_60355"
                     /db_xref="GeneID:34717571"
     mRNA            <750478..>751227
                     /locus_tag="KLMA_60355"
                     /product="ULP1-interacting protein 4"
                     /transcript_id="XM_022821023.1"
                     /db_xref="GeneID:34717571"
     CDS             750478..751227
                     /locus_tag="KLMA_60355"
                     /codon_start=1
                     /product="ULP1-interacting protein 4"
                     /protein_id="XP_022677428.1"
                     /db_xref="GeneID:34717571"
                     /translation="MKIISKHDPKGGLQVALDIESWAIKPMTYNESEGQWEYVVDTGD
                     KEVEKVHFKFIDGNGTWFTDNDFPKEFDDIGNENNVIYSNSNGPELKNYVTNTNDAND
                     SPTNTPKEQNLASLPETKTVNNNDTKKEEKDKNVEAEKAKGENNDKGVKDEPKPTNFE
                     NNKLGSTTQNKTGEEHSQPQEEVQEPAAKAETATKKEVSKERPTTAETSVTHRSDPIT
                     EYSSFLDRIILFLKRTISKWFSFQGSSSTNS"
     gene            complement(<751901..>752452)
                     /gene="MF(ALPHA)1"
                     /locus_tag="KLMA_60356"
                     /db_xref="GeneID:34717572"
     mRNA            complement(<751901..>752452)
                     /gene="MF(ALPHA)1"
                     /locus_tag="KLMA_60356"
                     /product="mating factor alpha-1"
                     /transcript_id="XM_022821024.1"
                     /db_xref="GeneID:34717572"
     CDS             complement(751901..752452)
                     /gene="MF(ALPHA)1"
                     /locus_tag="KLMA_60356"
                     /codon_start=1
                     /product="mating factor alpha-1"
                     /protein_id="XP_022677429.1"
                     /db_xref="GeneID:34717572"
                     /translation="MRLSAVFVSAIALLSTVIAAPITEKESDDSSIKVPSEAILGFLD
                     LTADDDVGLVKINNGTHSGILFLNTTIASIAYANETILSKREASVEADPWKWLSLRVG
                     QPIYKREASPEAEAEPWEWLSLRVGQPLYKREASPEAEAEAEPWKWLSFRVGQPIYKR
                     EASPEAEADPWKWLSFRIGQPIY"
     gene            complement(<754001..>755236)
                     /gene="POS5"
                     /locus_tag="KLMA_60357"
                     /db_xref="GeneID:34717573"
     mRNA            complement(<754001..>755236)
                     /gene="POS5"
                     /locus_tag="KLMA_60357"
                     /product="NADH kinase POS5"
                     /transcript_id="XM_022821025.1"
                     /db_xref="GeneID:34717573"
     CDS             complement(754001..755236)
                     /gene="POS5"
                     /locus_tag="KLMA_60357"
                     /codon_start=1
                     /product="NADH kinase POS5"
                     /protein_id="XP_022677430.1"
                     /db_xref="GeneID:34717573"
                     /translation="MIHFWRKECNAFSQHIGLLQRRFYTEVKLRDSSRFVTLKDVGNL
                     RATSLPDFISSPSSKLQSLIWHRPMQNVFLMKKPWTNTTRKAMVEFITHLHDSYPEIN
                     VIVQPDVAEEISQDFRSMPKSNPNQPHVLYTGPNSEIIKKTDLLVTLGGDGTILRSVS
                     LFSHTQVPPVLAFSLGTLGFLLPFDFKDHKEVFERVLTSRAKCLHRTRLECHLVRNGQ
                     TKQTKSLHAMNDIFLHRGDSSHLTNLDIYIDGEFLTRTTADGVTLATPTGSTAYSLSA
                     GGSIVSPLVPSILLTPICPRSLSFRPLILPETSHIKIKIGSKNNGGPDSSVVKLSIDG
                     IPQDDVYVNDEIHIVNEIGTIYVNGTKLPLPQEALKSAKPSVKNAGIYCVAKTENDWT
                     KGINELLGFNSSFRFASKP"
     gene            complement(<755845..>756464)
                     /gene="MMS2"
                     /locus_tag="KLMA_60358"
                     /db_xref="GeneID:34717574"
     mRNA            complement(join(<755845..756244,756454..>756464))
                     /gene="MMS2"
                     /locus_tag="KLMA_60358"
                     /product="ubiquitin-conjugating enzyme variant MMS2"
                     /transcript_id="XM_022821026.1"
                     /db_xref="GeneID:34717574"
     CDS             complement(join(755845..756244,756454..756464))
                     /gene="MMS2"
                     /locus_tag="KLMA_60358"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme variant MMS2"
                     /protein_id="XP_022677431.1"
                     /db_xref="GeneID:34717574"
                     /translation="MSKVSFRLLEELEKGEKGLGPESCSYGLADSDDITMTKWNGTIL
                     GPPHSNHENRIYSLLIECGPSYPDQPPKVKFVSKVNLPCVDSQTGEVIREKFHTLRDW
                     KRSYTMETVLLELRKEMATPANKKLLQPQEGTIF"
     gene            <756850..>758814
                     /gene="MAD1"
                     /locus_tag="KLMA_60359"
                     /db_xref="GeneID:34717575"
     mRNA            <756850..>758814
                     /gene="MAD1"
                     /locus_tag="KLMA_60359"
                     /product="spindle assembly checkpoint component MAD1"
                     /transcript_id="XM_022821027.1"
                     /db_xref="GeneID:34717575"
     CDS             756850..758814
                     /gene="MAD1"
                     /locus_tag="KLMA_60359"
                     /codon_start=1
                     /product="spindle assembly checkpoint component MAD1"
                     /protein_id="XP_022677432.1"
                     /db_xref="GeneID:34717575"
                     /translation="MSGKEGSSPYQERPLEALDADQLRHELLTLRYQYTTLQNEYEIF
                     KLSSERETNSLQNKYDKSMNELDRALSDTKLLYEENMKLKDSLKSKSDNSSEESKLVT
                     SLQRQVGELKDELDKRDQKIEQLKHETASIRKEAESSVKSLELELETSQKLLNKHKAH
                     VDEQYKEIQELKLDIEAKDAQISKLQNGQLSDAHQNFSTQDLHEITILNKTLKEQLSY
                     TKELEDMNLKQATELKKLKQLKDVQTFSKHENHGSQPSFNDVEQLKQKIESLEIENLS
                     LQEKMTEWGIDKLDPRFDGPNAVIEEISLLQRENTFLIDTNAKLQKDFNQMCMLNDEM
                     AIERNQLLDLNKDYETSILNLKRLNHELEQQKLLSFEECKILRQELEQLEFIGEGNSE
                     KRTNPENIKTHDIIDGYKNQTEDLTNELKRLNEEFSKSDDRLKKRRKLTHNLSVTYSQ
                     RLNDLVLKNKELEKQLQIVKNHANTLEQKLADLSNIKEKKIRILQLRNNPLLKEHYIR
                     KEKLKLLEQENAELLSKLKPTESVPKSVYDRISFDMKQLENDIYNSNKKTTRLKEMFN
                     KKSLEFIEAVNSLLGFKLEFLSHGKVKLICCYQPTKYLIADLKSNTLKSDLANIIPDW
                     DELFQTYVAEKGEIPLFLSYVKIRLWELAY"
     gene            <759037..>759849
                     /gene="LCL3"
                     /locus_tag="KLMA_60360"
                     /db_xref="GeneID:34717576"
     mRNA            <759037..>759849
                     /gene="LCL3"
                     /locus_tag="KLMA_60360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821030.1"
                     /db_xref="GeneID:34717576"
     CDS             759037..759849
                     /gene="LCL3"
                     /locus_tag="KLMA_60360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677433.1"
                     /db_xref="GeneID:34717576"
                     /translation="MAEHRTVTNNNIQSLYPTVLILSILLTGGFITASSLFNKHFKQY
                     KSAKDIPQSVFRKEWLYGKVTSVGDGDNFHFFHTPSGILGGWGWLRSVPELQKVTIQP
                     SKKATQSLSLWDKIFNSNVKSYKEHFMNLHVPVKGRRNLPTISVRLCGVDAPERSHFG
                     KEAQPFSDEALNWLRYKILGKNVWIKPLSVDQYGRCVAKVQLWSWYKGWQNISIEMLR
                     EGLGVVYEGKTGAEFDGDEKKFRYEETIAKKNKRGLWSQRKFETPGSFKKRI"
     gene            complement(<759937..>761706)
                     /gene="GUP1"
                     /locus_tag="KLMA_60361"
                     /db_xref="GeneID:34717577"
     mRNA            complement(<759937..>761706)
                     /gene="GUP1"
                     /locus_tag="KLMA_60361"
                     /product="glycerol uptake protein 1"
                     /transcript_id="XM_022821031.1"
                     /db_xref="GeneID:34717577"
     CDS             complement(759937..761706)
                     /gene="GUP1"
                     /locus_tag="KLMA_60361"
                     /codon_start=1
                     /product="glycerol uptake protein 1"
                     /protein_id="XP_022677434.1"
                     /db_xref="GeneID:34717577"
                     /translation="MQSVLSRVQDFFSLDTLDERLSSPGNDSRRKAKTSPEPPSRWSS
                     MEYKIYWGILIVVLPLLLKGGMDATNSWNPNYYKFEHLLSKGWMFGRKVDNSDAQYRF
                     FRDNIPLLMGLMSLHLIIKKLVLRFTNVEKVKFDFWFGLIFLVGAHGVNSLRVLFHMM
                     VMFSLAKIFKRQRPLASACVWIYGVGSLFINNSYRNLPFGQILPILKPLDGSYTGIIA
                     RWDVFYNFTLLRAISFDMDFLERWTNIHVSPSATPPPTSSVSPERFELKRASSTQVLE
                     TIEENASKPVLLDDRARLSAPHHIQEYSLARYIAYVTYTPLFIAGPILTFNDYLYQTY
                     HELPSINYKRIGKYAFRLLFCLFVMEFLLHFVYVVAVSKTKAWTNDTPFQISMIGLFN
                     LNLIWLKLLIPWRFFRLWALLDGIDAPENMIRCMDNNYSPVSFWRAWHRSYNKWIVRY
                     IYIPLGGSSNRILTSLAVFSFVAVWHDIELRLLFWGWLVVLFLIPEVVLSKYFNTYSK
                     EPWYRYACGCGAILNIWMMITANLYGFCLGSDGMYLFFKEMFGTFDGLVFFVVANCAL
                     FVHVQLMFELRAEEMRHGIYVKC"
     gene            <762546..>764927
                     /gene="SCY1"
                     /locus_tag="KLMA_60362"
                     /db_xref="GeneID:34717578"
     mRNA            <762546..>764927
                     /gene="SCY1"
                     /locus_tag="KLMA_60362"
                     /product="protein kinase-like protein SCY1"
                     /transcript_id="XM_022821032.1"
                     /db_xref="GeneID:34717578"
     CDS             762546..764927
                     /gene="SCY1"
                     /locus_tag="KLMA_60362"
                     /codon_start=1
                     /product="protein kinase-like protein SCY1"
                     /protein_id="XP_022677435.1"
                     /db_xref="GeneID:34717578"
                     /translation="MMFWGSKNGISSKYQYSSTPTFMAEPWSVYTAKPKSSSSSSSNT
                     VDKVSVFIFDKKQFENYLLHYGIIKSKHSSQDKLFLSEAYSVLKNQVNNLAKFKHPNI
                     LQLVEPLEEHSKNFIFVTEYVSGSLFNLFQDQEPSSSFGEELLQPNETDSLTIQRGIL
                     QVCQALDFIHNKTSSVHLDIQPKSIFVNGNADWKLSGLGHLVKLPQGTNVSDYTIPHY
                     DPRVPSFLYIELDFAAPELVLDETISPKSDLFSLGLLIYYLYYGKSYFSCENSSESYR
                     VQFAKFEKKIATLSWDTVFQRVPPTLRFCLPRLMNRDIYSRYDNIVEFLDNDFFKDPL
                     IQTLLFLDDLPTKTIEEKSIFLKGLVELLPKYPLQLLQKKFLPILISNLDQLCTMKEI
                     PDDCLRINLQVILLIGQNISQLTFQEKISSHILEAPNGEIIMEHATNELIENLHILQT
                     KIKKEVFDKMLLKPLFEYVCEKQENTAVQENLLKQLQIALDTFDFATAKNFLSPLIQK
                     LFTKTTSVTVKNACINCFQLMTMSNFMDAYMIQETLLPLIVSMKTRDARILMKFLEFF
                     PHLYTAIEDKEELVTNSLIPVIFSFSMATTLNATQFRNYCECFNNIVGKVQKRHIQQL
                     QREHSKTQEMESKDFTKIIDTPIVPSRKDTDNEISKSINIPVMQPKQTKPSIANTQTK
                     SILQPRGAPRPNTQKSPISTPTMKPTSSLTENTSGNIASSFNMAKNMPTSNNRTANMN
                     MNMNNTRPLDTHTNSGMRTKLTSPPTPPNAQNSSQSIKLPPGFGIALQPSKKA"
     gene            <765505..>765654
                     /locus_tag="KLMA_60363"
                     /db_xref="GeneID:34717579"
     mRNA            <765505..>765654
                     /locus_tag="KLMA_60363"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821033.1"
                     /db_xref="GeneID:34717579"
     CDS             765505..765654
                     /locus_tag="KLMA_60363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677436.1"
                     /db_xref="GeneID:34717579"
                     /translation="MTTFLVAFSSVALSSALPCPSHALDSDSPVVEQQDPQLQNKKNE
                     KLSKQ"
     gene            <766604..>768889
                     /gene="NAB3"
                     /locus_tag="KLMA_60364"
                     /db_xref="GeneID:34717580"
     mRNA            <766604..>768889
                     /gene="NAB3"
                     /locus_tag="KLMA_60364"
                     /product="nuclear polyadenylated RNA-binding protein 3"
                     /transcript_id="XM_022821034.1"
                     /db_xref="GeneID:34717580"
     CDS             766604..768889
                     /gene="NAB3"
                     /locus_tag="KLMA_60364"
                     /codon_start=1
                     /product="nuclear polyadenylated RNA-binding protein 3"
                     /protein_id="XP_022677437.1"
                     /db_xref="GeneID:34717580"
                     /translation="MSAEAVHNVADEPVQEEQIVHNNNAPESESALAVDGVQQPEEQP
                     GLVGEEATASCTSGKAEEDVSSSEKEAAAESHGDTDAMEEQSQEAALVEQKENTEPQD
                     QEVSHEEVSQQKEQQEQQDQQEQQEQQEQQEQQEQQEQQEQQEQQEQTEQSSEGSENE
                     NSTTSADSKSNENTLNEEDHAVDKQTNESETGSNPIDENLVEKQCKLINESGILQSPT
                     FKNVSEEEKVSAIIALLNTDPQTAMPNALPLAPEKPSEAQSDSKNKKRRFPRPDMSQP
                     MSAEERARYAEYLNGETKITEIQSFPPKSRLFIGNLPLKNVKKEDLFRIFSRYGHIFQ
                     INIKNAFGFIQYDNPTSVLDAIECESEELNFGKKLILEVSSSNARPQFDHGDHGSNTS
                     STYATSSKRIYDNDDNEDDDMYSDNHYKKSKKRTPQCLIYVKKAADRTYAYSVFTNIS
                     KKTGLETDMVILKPRMELRKLVNDAAYDGVWGVVLVNKNKNVDVQTFYLGPSGETKSD
                     EYVSVSMDEAVSIFNNIKATRMGPPSISPVMSAQPYGMPPHQGVMPQQPYNYMPPQQH
                     YPGNMPMMPQQQMYGNMPPASNYGIPPQMQQHSYQGYPQQSQMMPPQQGGLDQNQLLA
                     ALQNLPPNIVSNLLQLAQQPNQQQQQQALGVIQQIQAGIPLQQQQQQQLQQPQLQQHP
                     QQQQQPQQQQQPPQNHQQQQQPQQQQQQQSYGNYMMPQGINSQEKRASDQAGSQQQAQ
                     TQAQNNNNVQSLLDSLAKLQK"
     gene            <769353..>771245
                     /locus_tag="KLMA_60365"
                     /db_xref="GeneID:34717581"
     mRNA            <769353..>771245
                     /locus_tag="KLMA_60365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821035.1"
                     /db_xref="GeneID:34717581"
     CDS             769353..771245
                     /locus_tag="KLMA_60365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677438.1"
                     /db_xref="GeneID:34717581"
                     /translation="MRSEFFSTLKSQPNDILTKLLVAGILINACYFYYLTFPLKKTEL
                     KPLLVSNSYGGSGVPELEESLTPENFREYVRPLDKYNSSAIFNTINDAMKQKNCDIHS
                     VGVSFIPAVIPQGTLLYHAGKGEVPSSFEWVAFDHEFSLIFGSRAQPRGRESLNNSYH
                     RVKKDEVPVKKTRNRRNRRTWSLASLMTFQTTRDLNKVIYIDGGSAAKTTTGELDTQE
                     LWSNVVGGPANKNDTFYRIPERIYARQICEWGKPLGLDGFIRVELGFEMVVCDFTNGL
                     KLVSNTTIIGNDQTAGLPPAVPLTKENGWPINENGELIEDELTEEQQKILDQEDVYHK
                     YLTNANVGGRYDHVRAGNFHDSGERRVKLDFRYMVTGINRTWLDPNTNARRLVSDSVP
                     ESVHTDLVNELKQSLSMESGFNAALSNDWQNIVREIIGKFSPMLQNIRDSINKNYGSP
                     EERATNASFYYINFIKRFQDVNTTLEQNKELAVYQYSAPVLPLKTDSDFLIFSAVVNV
                     VREVVDAIFDIHAELNPLVLSYLKEETHKNAQQAIRSVDSSIRELIQYLQWVELNYRC
                     EENCGTGGVCYTPSWGPSAFGWVTPNDKDSPNFGLKWQDSINRYEIDKNQKCVNLDTM
                     LSAKWN"
     gene            <771640..>772674
                     /locus_tag="KLMA_60366"
                     /db_xref="GeneID:34717582"
     mRNA            <771640..>772674
                     /locus_tag="KLMA_60366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821036.1"
                     /db_xref="GeneID:34717582"
     CDS             771640..772674
                     /locus_tag="KLMA_60366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677439.1"
                     /db_xref="GeneID:34717582"
                     /translation="MEFETKTIKVDGLTRNILVQNENGPCALVALTNVLVLSPQHKID
                     AEELIHLINSNRKVTLQDLITTLANIGVMMDNGQSEDVNELLQLLPQLHTGLNVNPAF
                     NGTFHDDQALALFRLFQVPLVHGWIVDPSQNQQQYQSVSHYSYDDAQNVLVQAYDIQK
                     NGTQVENADQILQDAQYLKSFLARSATQLTEYGIQHLHQLLQENSYSVFFRNDHFSTM
                     RKKNNELYILVTDLGFKNASNIVWQSLKTVKGNHDSFFTSEFLPTSIDNITSTDPDSN
                     ANANANEGETDLTDEQLARILQEEEDARAVRDLSSRQERRAESAPTTSSKKSKDRKLR
                     LKKKMKCTIL"
     gene            <773263..>774246
                     /locus_tag="KLMA_60367"
                     /db_xref="GeneID:34717583"
     mRNA            <773263..>774246
                     /locus_tag="KLMA_60367"
                     /product="hypothetical membrane protein"
                     /transcript_id="XM_022821037.1"
                     /db_xref="GeneID:34717583"
     CDS             773263..774246
                     /locus_tag="KLMA_60367"
                     /codon_start=1
                     /product="hypothetical membrane protein"
                     /protein_id="XP_022677440.1"
                     /db_xref="GeneID:34717583"
                     /translation="MDFSVNMVFHNRRILELRGSEGLETIIGKGRPTGSNLLFEDDDL
                     FEQHAKLVVKRLFPADADTSVPPNFDSFRVYVESLGDADRIVDLESADCNKDARIIDL
                     KDGDRFGLMRLNEPVVEGQQRPAKLKLLLNLDMGSEPDLYRLTLTDVTYESSPCASRS
                     SNFLDSFVKEETEESDMDADMMDQKMADWNQDTQMHPLDPDDIDDVGVEPTAPNVVIV
                     DPPVENNFGSFLHKIESYVPPKDYVVLLDSDEDDCTSITKSKPTEKRYRKNRLRTSKF
                     KVHKSVTIRDDVPLKNDKKKKFDIYSGSLGFVIGSLGTLGILTAVANMVEP"
     gene            <774677..>775111
                     /locus_tag="KLMA_60368"
                     /db_xref="GeneID:34717584"
     mRNA            <774677..>775111
                     /locus_tag="KLMA_60368"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821038.1"
                     /db_xref="GeneID:34717584"
     CDS             774677..775111
                     /locus_tag="KLMA_60368"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677441.1"
                     /db_xref="GeneID:34717584"
                     /translation="MDSFYQDLEERDDDKTVIPQASTPKEDRIDISEKDLEIDYLKDK
                     VSADRGGRSVSGTITKVKKRNNRKKKKKKKEKRSTSKRHREYKYDRLLHDQYITQNET
                     PLIGQQSERNPNDNTRIFFPGLLLGTFLGSMVTKFFLETTSL"
     gene            complement(<775133..>776200)
                     /gene="RSA1"
                     /locus_tag="KLMA_60369"
                     /db_xref="GeneID:34717585"
     mRNA            complement(<775133..>776200)
                     /gene="RSA1"
                     /locus_tag="KLMA_60369"
                     /product="ribosome assembly 1 protein"
                     /transcript_id="XM_022821039.1"
                     /db_xref="GeneID:34717585"
     CDS             complement(775133..776200)
                     /gene="RSA1"
                     /locus_tag="KLMA_60369"
                     /codon_start=1
                     /product="ribosome assembly 1 protein"
                     /protein_id="XP_022677442.1"
                     /db_xref="GeneID:34717585"
                     /translation="MKEQYRGVKRPLNDSGVGNYGNIGYYANQTPNVPYMPPGMGYSY
                     GTQPQFLPPQPTYPQMWFGYNQGQPVAPPVYVDVTKSSKINYDDDDDDDDDDDDEGEE
                     EKEAQQQQQEQEQEQLGEPKLTRNSDPEEKSICIDEVEGISAHGDQAESPTKNYVDET
                     EDTNEEEQEDEPKIIDGAAKTEDKAICIPGTSIVLKTDDDIAKWKEERRKMWLIKISN
                     NKETYRQKFNIKEEELHSNTLQESKKERNFIQNIQNQVKRFHPKPSLTIGLHQRILKE
                     ENSKILDFIKELGDANYLKYELTEEEKGVLFGNKERRNDNNKRFHGRYDHQANGRGHN
                     NNNNNNYNYNQNRKKRPTTEG"
     gene            <776817..>777185
                     /gene="FMP37"
                     /locus_tag="KLMA_60370"
                     /db_xref="GeneID:34717586"
     mRNA            <776817..>777185
                     /gene="FMP37"
                     /locus_tag="KLMA_60370"
                     /product="UPF0041 protein FMP37"
                     /transcript_id="XM_022821041.1"
                     /db_xref="GeneID:34717586"
     CDS             776817..777185
                     /gene="FMP37"
                     /locus_tag="KLMA_60370"
                     /codon_start=1
                     /product="UPF0041 protein FMP37"
                     /protein_id="XP_022677443.1"
                     /db_xref="GeneID:34717586"
                     /translation="MSQPAQRAATQSLISKYINKETLKYVFTTHFWGPVSNFGIPIAA
                     IYDLKKDPEMISGPMTGALVIYSAVFMRYALAVQPKNFLLFGCHVVNEAAQLGQAYRY
                     LDYHHLGLLNKKSDAETKTA"
     gene            complement(<777460..>779151)
                     /gene="DDC1"
                     /locus_tag="KLMA_60371"
                     /db_xref="GeneID:34717587"
     mRNA            complement(<777460..>779151)
                     /gene="DDC1"
                     /locus_tag="KLMA_60371"
                     /product="DNA damage checkpoint protein 1"
                     /transcript_id="XM_022821042.1"
                     /db_xref="GeneID:34717587"
     CDS             complement(777460..779151)
                     /gene="DDC1"
                     /locus_tag="KLMA_60371"
                     /codon_start=1
                     /product="DNA damage checkpoint protein 1"
                     /protein_id="XP_022677444.1"
                     /db_xref="GeneID:34717587"
                     /translation="MSFKATINDNNNQLIWGKSLSTLSQINVDVFVTITKNGIILSSM
                     NNTDTTMAKVRFPKDFFTEFFFDPKKIVFGEAGVQQIYDCSDQLHTIYSFKINGKYLS
                     LLSLKQEDQIKEYVLSIDNSDGCSESLANKLILKMRTNSLLNKEYQVIFDPLESIQII
                     LSLKYKQKFLSVYNNSKETKSVDPRLMEYFKTLQNELQEDMFNKGIANEHNIVTTVKN
                     TPLTISDEINFLSFDQSILKNFVESIMSNVIEEIKLELTRNSLNIIGFTKAIYNMKSE
                     GYLKQAVTVTNTCSAHDLEHYCIFSIENKENGSRPSSRSSNLKKSITFKLRDFKIFLN
                     GLNCWKTNDMIRIWFCQPGDPILFEIIKDGVILELVQVTDTDGRVEDSTPQETPTPTH
                     TSVSPEKHISPIKKDNLVKLEKLNKPLTRQPIYPHAKRSLFVQDLDNDDEAEDEAEGH
                     EKKFKFKRWSNQQKTPEPDSNTESQSSESTSNTHQSEPAKRMRTTVEWAGTYDKDIAE
                     RKGSYIKQIDKAAYLAGLKRQALEEPRKQTEDALELENEEMGPTQVDQPKGLFDD"
     gene            complement(<779380..>782088)
                     /gene="APL5"
                     /locus_tag="KLMA_60372"
                     /db_xref="GeneID:34717588"
     mRNA            complement(<779380..>782088)
                     /gene="APL5"
                     /locus_tag="KLMA_60372"
                     /product="AP-3 complex subunit delta"
                     /transcript_id="XM_022821043.1"
                     /db_xref="GeneID:34717588"
     CDS             complement(779380..782088)
                     /gene="APL5"
                     /locus_tag="KLMA_60372"
                     /codon_start=1
                     /product="AP-3 complex subunit delta"
                     /protein_id="XP_022677445.1"
                     /db_xref="GeneID:34717588"
                     /translation="MSGVYTTSAEDVKKRLRPFGIFFEKSLKDLIKGIRSNNETPEQL
                     QEFLNHEIVECREEVKSPDFNIKSNAVLKLTYLEMYGFDMSWANFHILEVMSSNKFQQ
                     KRVGYLAASQSFYKDTDILMLATNLLKKDLKYDLSNETVKMGVALSGLSMIVTPDLAR
                     DICDDLFLMLNSGKPYIRKKAIAALFKVFLQYPESLRDGLEKFISRLEDEDTSVVSAT
                     VSVICELAKHNPYPFIQFSPLFYELLIQIDNNWIIIRLLKLFTNLSKVEPKLRYKILP
                     KVLELMEKTTAISVIYESINCIVKGQMLEADDYDTAERCMKHLDPSILCSDPNLRYIS
                     CVLFYHIGKINYEFIVPYDALVIKLLKDVDISIRTKALELCPNIASTKNLHNMVKMLI
                     KQFVDIDTVQVNDQGIQIDIPIDYKIKVAKTIISICCINNYENICGDFAWYLKILTDL
                     SVVSQDLNDSELSALLGENFRNIMVKVPSMRDETLEKLTELLTNDDIVMKLPDLLREI
                     IWCFGEYSELIDNCDTLIHLLLSKAEAHTYSDNVTQILIPALVKLFTTFANSESTPKP
                     KISEVLAEIIKFLENNYTSTNFDIQERSVEFYEILKLCEDALENEDNDNLPLLITDVL
                     PSLFNHYELGPLLLGQQHQLVKSLTVDLTTPYLTSEELDELLKEEDNYDNGKDLFSDE
                     ESIHTFKEDDHFENDENESLSSLDANSITEEELAELKERRRQEQLDNPFYLNDNEIDS
                     PSDTKLIDLSDKEESQEKLKDPIIKISSKKKQTSKLPSVQVLSDIVVAPQFDNNDDIK
                     KSNTHQNPNAIRLSTSNKLKSFDFNKPNDHTDNDEYTIDQEELEQLRKKLSKQQLNSS
                     VVSAENEQEEIVVIKKKKKKSKSKDSKEKSEKKKTKKKKKKDDIPA"
     gene            <782397..>782930
                     /gene="KXD1"
                     /locus_tag="KLMA_60373"
                     /db_xref="GeneID:34717589"
     mRNA            <782397..>782930
                     /gene="KXD1"
                     /locus_tag="KLMA_60373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821044.1"
                     /db_xref="GeneID:34717589"
     CDS             782397..782930
                     /gene="KXD1"
                     /locus_tag="KLMA_60373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677446.1"
                     /db_xref="GeneID:34717589"
                     /translation="MEESRSCTPSVDSRNYAIPEGDYVSSDSHSEVSESESDQSSHVD
                     SEDSLLPTESSGTLWMNQIQETPMFDSSKFLFESLNNTINSIDFSESLATQAKTSALI
                     NSKSRELKSLMKQLQERLQYYTDRFKRGAAVSSELKVNLQMLSKRIATLDALISKQFP
                     IEYNQSRDKIIERRLDD"
     gene            complement(<783027..>783827)
                     /gene="OXR1"
                     /locus_tag="KLMA_60374"
                     /db_xref="GeneID:34717590"
     mRNA            complement(<783027..>783827)
                     /gene="OXR1"
                     /locus_tag="KLMA_60374"
                     /product="oxidation resistance protein 1"
                     /transcript_id="XM_022821045.1"
                     /db_xref="GeneID:34717590"
     CDS             complement(783027..783827)
                     /gene="OXR1"
                     /locus_tag="KLMA_60374"
                     /codon_start=1
                     /product="oxidation resistance protein 1"
                     /protein_id="XP_022677447.1"
                     /db_xref="GeneID:34717590"
                     /translation="MDGFRSRLHSWGKSLGNASFDSDKDSMRNTYKGKRNDDSFMENE
                     SFSQHASLEDEDKLPEVELLGYSAKTKNKLLTKEMCEELRQLMPTRIQLYTEWTLLYS
                     LEQHGASLHSLYDNIKYDTNTNARVGYILVIRDKKGGIFGGYANEPFHPTDSRRYYGN
                     GECFLWKLEKVPDLQLHGNEKVEASGNKLHNWQLRGFPYTGINEFSIYCTSKFLSMGA
                     GDGHYGLWIDDGLFKGVTSPSLTFGNDVLSREGSKFHIIGLEVWRVGR"
     gene            complement(<784191..>785930)
                     /locus_tag="KLMA_60375"
                     /db_xref="GeneID:34717591"
     mRNA            complement(<784191..>785930)
                     /locus_tag="KLMA_60375"
                     /product="delta6-FADS-like protein"
                     /transcript_id="XM_022821046.1"
                     /db_xref="GeneID:34717591"
     CDS             complement(784191..785930)
                     /locus_tag="KLMA_60375"
                     /codon_start=1
                     /product="delta6-FADS-like protein"
                     /protein_id="XP_022677448.1"
                     /db_xref="GeneID:34717591"
                     /translation="MSKILTRRQIEDRIARGQSIVIFENLVLNLDKWVQFHPGGDKAI
                     YHMIGRDATDEMRAYHDDETTATFKLWRVGKIDYKWENMVPPIQGGTYRLLDQDSPSY
                     EDTEADESVLSTTWKKVDKSDEYTKSLSTGKMAGETEYKLYPKIPQGVIPSLDLKEAY
                     EKKVVVDPAVVSENFDNERVQNDLESFPALDVETQNYIAEEYRKLHEEITDMGLYQCK
                     YSRYLKEFLRISTLFGFAFYLLSKKWYVASALSLGFGWQQLVFIAHDAGHISITHNYQ
                     IDNIIGMLIASFVGGLSLGWWKRNHNVHHLVTNDPVHDPDIQHLPFFAVSTRLFHNVY
                     STYYEKFLWFDGFAKKLIPIQHYMYYPILCFGRFNLYRLSWVHVLLGQGPRKGKAAWF
                     RYFELCGLIFFNYWFFYLVCYRQLPTISERVKYILISHVATMIVHVQITLSHFAMSTS
                     DLGVTESFPMRQLRTSMDVDCPRWLDFFHGGLQFQVIHHLFPRLPRHNLRDAQPLTIK
                     FCEKVGIKYSIYGFSAGNEIVISHLQQLAQQAHTMLECAKTMNKEATATKNSIEKSKP
                     TLAENVSSIRKQE"
     gene            <786563..>790216
                     /gene="SWI1"
                     /locus_tag="KLMA_60376"
                     /db_xref="GeneID:34717592"
     mRNA            <786563..>790216
                     /gene="SWI1"
                     /locus_tag="KLMA_60376"
                     /product="SWI/SNF chromatin-remodeling complex subunit
                     SWI1"
                     /transcript_id="XM_022821047.1"
                     /db_xref="GeneID:34717592"
     CDS             786563..790216
                     /gene="SWI1"
                     /locus_tag="KLMA_60376"
                     /codon_start=1
                     /product="SWI/SNF chromatin-remodeling complex subunit
                     SWI1"
                     /protein_id="XP_022677449.1"
                     /db_xref="GeneID:34717592"
                     /translation="MDDQFLFPDESDPLNTGSGQMFGQGVSNGDEYLSFLDGNQLQDK
                     NGVSGVAGVPDQTFIGPGMDAGNMRSESASGLEEANTGVTPQAILARNSFSNIDSPPM
                     KNGAASISPQSMFSPAGRAASLNGGNAGLAQSPGTTSLQQMLSQRGTPHNIAGGSPQL
                     VEEQLAQSNRQNSQYMDRAAIIAAHQQRQQQQQQQQQQQQQQQQRLQMLQQQQAYNQL
                     QQQKLRQQQAQAQAEAQARAQAQAQARAQAEAQARVQAQAQAEAQARAQAQAQAQARA
                     QAQAEAQARAQAQARAQAEAQARAQAQAQAQAEAQARAQAQMRMQQQSPQASNQPPIQ
                     NQNNNQKNVLQNLDPAIQRKVGQELNTKQFELFRKSFMEHCRRKNLSADIAHMINGVQ
                     VNLFILYMYVQKLNGGENVTKAQQWGMLAQRMNIPGPNGGEELAKTYYRFLLPYEKYL
                     MTPEGIKETQTNRIMLQQLLQDIIRNIRSSSEQFQPPNQNQTFIQGQNVIQPHMQMQM
                     KQQQVPKAQTKNKPVIPKQPKPKAPRKPRVKKKTKKELEQERKQMEALQRQQQLEAEQ
                     QMQQQKLRFEKQLKQQQELILKRRKEQIKQLPKVYKRTMARHYTPSQRPITTQNGYDI
                     SKISELGEMIHNFKPIFLFAPEFGVVNVNALAMQLQSANNSEVNTALNSLLVISSDNT
                     LSIPINRCRELLDNLCILACQLLNKLLKKDYSRISSSYANYGESNSLLTPPTHPFDAD
                     SRINQIFNENVKNFSQESSEETVTVDSLTGIDYSQLPITPADPSIELDSKLSNYSIPE
                     RVEKDIDNDENYTDYLPDLLREEKLTDISKINLVSYTESLIRVRDEVSTIFSKCHESG
                     AENPHLLIVDQLSSISMIIRNLSFNEQNSEVLANNPYMEKYISDMLWMIFIHKDEFIF
                     ERRVLNFKKDIIFVLTNIAHMLKIESTVTCFFIILLAFSFADPKDHLENNSVFTYPEY
                     AIDVEKYQTYGVDVLAKAFSLGYPNRSHFRSVLTGVFTEENDDDDICQHLLQLYNGEE
                     KFKIFNDTFSFIMSTIPFQQINRLPNLIESSLPSISQALTVAVAIVKFIDKKDDHCNF
                     VDYNLPCKWLTSTENIGTNLRRISEVLANIATQNSNLREIKDILSLISGSAIQLLRML
                     LEKSLEIASLSDDSNCERKRTIEELSKVPNLLANDNAAITIIMNPSTNVFMSSEMKSF
                     YHVCKNIYSELAS"
     gene            complement(<790400..>793573)
                     /gene="RAD1"
                     /locus_tag="KLMA_60377"
                     /db_xref="GeneID:34717593"
     mRNA            complement(<790400..>793573)
                     /gene="RAD1"
                     /locus_tag="KLMA_60377"
                     /product="DNA repair protein RAD1"
                     /transcript_id="XM_022821048.1"
                     /db_xref="GeneID:34717593"
     CDS             complement(790400..793573)
                     /gene="RAD1"
                     /locus_tag="KLMA_60377"
                     /codon_start=1
                     /product="DNA repair protein RAD1"
                     /protein_id="XP_022677450.1"
                     /db_xref="GeneID:34717593"
                     /translation="MSLFLRDESEDEDLVIELSNLSRNEESENTSEGIIRESEEKSSG
                     NEVINNGDAIDTDKNNEEKVLYPLVPVDPKTGTLKPNIEEIRPVDVQVSLPLPFQHLI
                     LENMLVSENALLVIGKGLSVLLIVTNLLYTLCTPTRINGQDKRSLVLLLNATSEDEAI
                     ISEELMELQWSCNEDDEQGKPGDRPFTIISSDSFTVDQRSKRYQHGGIISVTSRILIV
                     DLLSGIVHPKNITGLLILHAEKLNSLSTEAFIVEIYRNSNKWGFIKAVTDSAESMVSD
                     FSPLSKKMKDLLLKKALLWPRFHADISSCLNTTSGTKVVEIRVTLTDSMSKIQFGLYE
                     CLKKCIEELTRKNPELATEYWSFENALDSNFLRIINGTLSPKWHRISYESKQLVKDIS
                     TLKMLLNSLISYDALDFYELIQLILDANKPSVTRKYSESPWLLADESQLVISFAKKRV
                     IYDGEYNLEPLPKWEQLCALLEDIEHESLKYPAGSQGPVLILCNDDRTSNQLRQVVRY
                     MKHKDKGFKKIMLDKLDMYMKRMDMMKNTSSDIMEENDKIQNGTEINVSRAFHKQEIN
                     TKRRRTRGASYVAAVEKLKSAQVGPGEDINAAITSERINEEREKSLVNVDTPNDETMV
                     KEDFDSQDEISVIEEKLKDVSYDDINVMQNWEEVWERRKVDYSYIDNDSKIIIETFSA
                     TSDEQILYENSPSYIIIYEPNLAFIRKLEVYKAIYRHNSPKVYFMYYGDSVEEQKHLS
                     SIKREKEAFTKLIREHSSMAQHFDTDEDLSRFKNLAHRKMQLNRMKSSRIAGGQDFLN
                     PMTHDVVVVDMREFRAALPGLLYRYGVRVVPCMLTIGDYVITPDICIERKSIADLIGS
                     FKNGRLDKQIKSLSKYYKYPTLLIEFDDSQSFSLEPFTERGVYNTTTSSTVHPISGKL
                     MKEEIQRELSHLVMKYPSLKIIWSSSPLQTVNIFLDLKANREQPDPIKCVEYGATRKT
                     KEKNKALADSNTKFKMLLSIPGLSNIDYYNIKKRFKRYKDLAVSNIEDLQNILSDSDL
                     CERIHTFINQQEILDSVLSDEDDDISS"
     gene            <794001..>795929
                     /gene="MET12"
                     /locus_tag="KLMA_60378"
                     /db_xref="GeneID:34717594"
     mRNA            <794001..>795929
                     /gene="MET12"
                     /locus_tag="KLMA_60378"
                     /product="methylenetetrahydrofolate reductase 1"
                     /transcript_id="XM_022821049.1"
                     /db_xref="GeneID:34717594"
     CDS             794001..795929
                     /gene="MET12"
                     /locus_tag="KLMA_60378"
                     /codon_start=1
                     /product="methylenetetrahydrofolate reductase 1"
                     /protein_id="XP_022677451.1"
                     /db_xref="GeneID:34717594"
                     /translation="MSTVKQRFDALTGPCVSLEFFPPKTEPGKTNLLARMERMCALNP
                     LFVTVTWAAGGTTSGKTLELATIAQRELNVPVCMHLTCTNMDKSIIDEALKAARDVDI
                     RNILALRGDPPIGEEWDGNTSQNPSEFKYAVDLVRYIKKNYGDDFCVGVAAYPEGHCE
                     GEADESMQDPLRDLPYLKEKVDAGADFIITQLFYDVDKFLSFESLVRENISSDIPIFP
                     GLMPINSFLLFNRAAKLSHASIPQAILDRFPPDVQNDDNRVKEIGVEIMIDIVEQIYK
                     RTDGRIKAFHFYTLNLEKAIAKIVANSPTLSKILEDDEDEADDEWGSEAVLQDVDHLT
                     LEDDNMKKRKRQSSASAEFPLNTSIINKLNGTSGNKLPSMPSRKVMISISQGTGTLGR
                     NVTWDEFPNGRFGDSRSPAYGEIDGYGPSLKVCNKTAYELWGHPVCLEDIKNIFIRYL
                     EGSMKALPWSDLGLSPETAFIQEELIELNQRGYLSLASQPATNGSPSTDNIFGWGPAN
                     GLIYQKAFVEIFVHKDEWKNVLKPKIEASDGEFSYYLGDYTGEFETNLQPNSSNAVTW
                     GVFPNSEVVQTTIVEEDSFKAWRDEAFSIWIEWSKLFPKNTPENTFLKKMHRDYCLVS
                     IVHHDFHNADGLWEMLLN"
     gene            complement(<795993..>796981)
                     /gene="RMI1"
                     /locus_tag="KLMA_60379"
                     /db_xref="GeneID:34717595"
     mRNA            complement(join(<795993..796729,796966..>796981))
                     /gene="RMI1"
                     /locus_tag="KLMA_60379"
                     /product="recQ-mediated genome instability protein 1"
                     /transcript_id="XM_022821050.1"
                     /db_xref="GeneID:34717595"
     CDS             complement(join(795993..796729,796966..796981))
                     /gene="RMI1"
                     /locus_tag="KLMA_60379"
                     /codon_start=1
                     /product="recQ-mediated genome instability protein 1"
                     /protein_id="XP_022677452.1"
                     /db_xref="GeneID:34717595"
                     /translation="MPKKVVSSKGTQLIEYEPISRDPMTSDLRKADITTVTRVLEDPN
                     SLLVQAFNSEPWPAKDVFEQKLKILDRPLLFQVCMIDNVSRSKLTQVDELQVMIDPRR
                     QKVDRLSTSRDRQELISEVNIDEDDDNNGVTSSNANNNQTTSAAKETGNLNQHVYKLT
                     LQDKYGNLFYAINLESIPGLKTCFFGSKLILLPGAVFNRGMFTFTNSTVKLMYGLIQQ
                     WNEGKLQKVSDYLQNELNAQNPTLNANGKRTA"
     gene            <797066..>797638
                     /gene="TRS23"
                     /locus_tag="KLMA_60380"
                     /db_xref="GeneID:34717596"
     mRNA            <797066..>797638
                     /gene="TRS23"
                     /locus_tag="KLMA_60380"
                     /product="transport protein particle 23 kDa subunit"
                     /transcript_id="XM_022821052.1"
                     /db_xref="GeneID:34717596"
     CDS             797066..797638
                     /gene="TRS23"
                     /locus_tag="KLMA_60380"
                     /codon_start=1
                     /product="transport protein particle 23 kDa subunit"
                     /protein_id="XP_022677453.1"
                     /db_xref="GeneID:34717596"
                     /translation="MAIQSIMIINKSGGLIYNHNFIEPRGQMNSNDYLIIAGTLHSVF
                     AIATQLTPLAVQINNKAAQNAESDVPYIAGIGVNTESKGGPRELGSFMGPDYFQESFT
                     NWNKSGLRHMVTDDFSMFVFQSLTGLKFVLVSTNNFRSNTSVSIAENLLRKVYCVYSD
                     YVMKDPFYSLDMPIRSELFESKVKELIDNL"
     gene            <799398..>800834
                     /gene="SKS1"
                     /locus_tag="KLMA_60381"
                     /db_xref="GeneID:34717597"
     mRNA            <799398..>800834
                     /gene="SKS1"
                     /locus_tag="KLMA_60381"
                     /product="serine/threonine-protein kinase SKS1"
                     /transcript_id="XM_022821053.1"
                     /db_xref="GeneID:34717597"
     CDS             799398..800834
                     /gene="SKS1"
                     /locus_tag="KLMA_60381"
                     /codon_start=1
                     /product="serine/threonine-protein kinase SKS1"
                     /protein_id="XP_022677454.1"
                     /db_xref="GeneID:34717597"
                     /translation="MLNNCQLNNFQITKQIGSGAYGVVFHAIDLVTENEYAIKAIMKS
                     SDDPLRPKASMGGSSSSLKKSAVLQTQLYHYFKSFQNKLFLPTVDLDSVLAITEEQLC
                     HAPHYREIQLQLRCHMHENVVTIHQILESSLATFVVMDYYPMDLFTSIVENQHFSNDG
                     LLIKKAFLQLCSVIHHCHTVGVYHCDIKPENILLDANDNVKLCDFGLATTAPYINANV
                     CVGSSYYMAPERVSCPSSILHSAETQNNEGHQMFPTASGDVWSLGIILINLTCIRNPW
                     LKAHQKHDNTFKYFINDARVLTKILPLSEDLFNILNSILQVDPTKRTDLISLIKAVSK
                     CEHFTTSGPLSVVPSLTPRQLNHFICGDYSMKIKNMVSKFDSLNADLEEDLSESSDEL
                     YRDYDIGINTNFPGYSSEEDLELMQEKSNTKQTPFPNTTITPDGYLSQESPSKLWLTM
                     QYSQFNLSTNDSQNTLANSTLESWLPRY"
     gene            complement(<801150..>801698)
                     /locus_tag="KLMA_60382"
                     /db_xref="GeneID:34717598"
     mRNA            complement(<801150..>801698)
                     /locus_tag="KLMA_60382"
                     /product="probable gluconokinase"
                     /transcript_id="XM_022821054.1"
                     /db_xref="GeneID:34717598"
     CDS             complement(801150..801698)
                     /locus_tag="KLMA_60382"
                     /codon_start=1
                     /product="probable gluconokinase"
                     /protein_id="XP_022677455.1"
                     /db_xref="GeneID:34717598"
                     /translation="MSDNKKVFVIGGTCGTGKSTIAERLCEILRQEDPTQPGYEFVEG
                     DLLHPIENIKKMTSSIPLTDDDRWGWLEKVSDKGYSKADQFGSCIITCSSLKKKYRDF
                     IRERHPDCRFIFFILYGTKEEIIKRVVHRESHFMKSDMVDSQFRDLELPQEDEADSII
                     VNVTGRTPEEVTQEVFHHVKGL"
     gene            complement(<802201..>803397)
                     /gene="ERG10"
                     /locus_tag="KLMA_60383"
                     /db_xref="GeneID:34717599"
     mRNA            complement(<802201..>803397)
                     /gene="ERG10"
                     /locus_tag="KLMA_60383"
                     /product="acetyl-CoA acetyltransferase"
                     /transcript_id="XM_022821055.1"
                     /db_xref="GeneID:34717599"
     CDS             complement(802201..803397)
                     /gene="ERG10"
                     /locus_tag="KLMA_60383"
                     /codon_start=1
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="XP_022677456.1"
                     /db_xref="GeneID:34717599"
                     /translation="MSDNVYIVAAARTPIGSFQGSLASKTYVDLGSTAVKGALAQVPE
                     LDPNSVEEIFFGNVLPANVGQAPARQVALASGLGKHIVATTVNKVCASGMKAIILGAQ
                     TIKTGTADIVVAGGAESMTNTPYYLPALRAGARFGESKTIDGIVRDGLNDAYDHQAMG
                     VHAEKCASDFNFTREAQDDFAIKSYQKAQLAQSQGKFNAEIVPVTIKGFRGKPDTQVT
                     SDEEPSKLNVDKLRSARAVFASNGKGTVTAPNASPINDGGAAVILVSEKKLKELSLKP
                     LALIRGWGEAAHEPADFTWAPSLAVPKALKHAGIASIDEVDFVELNEAFSVVGLVNTQ
                     KLGLDPAKVNVYGGAVALGHPLGCSGARVVVTLASVLRQENGKIGVAGICNGGGGASS
                     IVIERV"
     gene            complement(<803926..>806172)
                     /gene="SUV3"
                     /locus_tag="KLMA_60385"
                     /db_xref="GeneID:34717600"
     mRNA            complement(<803926..>806172)
                     /gene="SUV3"
                     /locus_tag="KLMA_60385"
                     /product="ATP-dependent RNA helicase SUV3"
                     /transcript_id="XM_022821056.1"
                     /db_xref="GeneID:34717600"
     CDS             complement(803926..806172)
                     /gene="SUV3"
                     /locus_tag="KLMA_60385"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase SUV3"
                     /protein_id="XP_022677457.1"
                     /db_xref="GeneID:34717600"
                     /translation="MLKLYLRTVRNRSLQVVFRRQIHKNYSGKNLPFSSRNWLVHPQK
                     FKYLPKSEQNTTASTVIPLQFEKSDNKANNGNIYLEDKEFRENLDKALTQAHSNLLIG
                     YTNYDIFSANATWMRLRELLYYQLSHISELKPLSSFQLTAPELLKPTNPGDLLNQLLS
                     VNQIPDHIWKSVLEKEEYSVAEQYYFILKNFYYFIRNQEIEPQTRPSWSDVDSGLDIS
                     NPSEWFPEARKLKRTIIMHIGPTNSGKTYNALQKLKQCQRGYYAGPLRLLAREVYDKF
                     QSDGIRCNLLTGEEVIEDLDSMGNRAGLTSGTVEMIPLNEEFDVCVLDEVQMVGDKER
                     GWAWTNAILGVQASEIHLCGEESVLPLMNKIVKLTGDTLVVNKYKRLGTLEIEHQPLA
                     GKFKGLKAGDCVIAFSKKTILDLKLTIERQTDLKVAVIYGSLPPETRVKQAKLFNSGE
                     YDVLVASDAIGMGLNLSINRVIFTSAEKFNGVEVLPLTFSNIKQIGGRAGRYKPPGRD
                     NSGDGPSVGHITALDYDTLRAVRRGINAPVQFLEKAVVWPTDDLINNLISYYPPGTKV
                     SVLLKKFQENISSCSNKMFELSNIVDRVEALSTFEDMRGLTLWDKLKLSNAPIRLSPL
                     VSRTFNSFCKTIAERSTTSLLNYNLPFVLLHRKFIKDESVSLQFYEEFHQVINLYCWL
                     HIRYPQLFVDYESAIDLKNLCEMIIFKKLEFLKQNPYRKTLNSNQTRNSCFQQEKRRH
                     NLPFPKRI"
     gene            complement(<806564..>808174)
                     /gene="TRM44"
                     /locus_tag="KLMA_60386"
                     /db_xref="GeneID:34717601"
     mRNA            complement(<806564..>808174)
                     /gene="TRM44"
                     /locus_tag="KLMA_60386"
                     /product="tRNA (uracil-O(2)-)-methyltransferase"
                     /transcript_id="XM_022821057.1"
                     /db_xref="GeneID:34717601"
     CDS             complement(806564..808174)
                     /gene="TRM44"
                     /locus_tag="KLMA_60386"
                     /codon_start=1
                     /product="tRNA (uracil-O(2)-)-methyltransferase"
                     /protein_id="XP_022677458.1"
                     /db_xref="GeneID:34717601"
                     /translation="MTSNNIQYCTEQDSSLGPDWRCLYSTNDPIEFDKTHFEQAMLNV
                     IRQPNVNSTVILRADMIVDNEYDMDGKLTKSERSTIPLANDEGILTVNIDDLEPRSVP
                     VELSGIEKKSELVRRIVPRNPFKDCIINQTCLVMNSKNDDSTSLVIYIPHFEDPDLCP
                     FYIPQVAAVAILLHEDKLSVHYIPFKGQEELLLDPKQRVVRTAFRLLQTAYKHSKGVK
                     EGYAKRVTHDVVVDKVLFQDQYIHLKKKYSKFLVDNWAESTDPKKHVFEDIAIAAFLI
                     ELWKKIYGKDDTNTKMQFRDLGCGNGILCYILIEEGFKGLGIDARQRKSWSIYPTEVR
                     RCLKEQVIIPSVLLRPHPSMKLHAPHIQHNGRFFPVQLFSPDLIAPATIMYSSADLIQ
                     SPQVNTAEFPPDTFIIGNHSDELTCWIPLLGYPFMVIPCCSHNLSGNRTRYAVRDAAR
                     AKKQGNSTYQGLVDRVEYLATRVGWKIEKEMLRIPSTRNAAIIGYEKNHPSDPKIDEI
                     YSILMEEGGADGWIANTMNLMKSHPRNH"
     gene            <808838..>809882
                     /gene="PHO85"
                     /locus_tag="KLMA_60387"
                     /db_xref="GeneID:34717602"
     mRNA            join(<808838..808854,808985..>809882)
                     /gene="PHO85"
                     /locus_tag="KLMA_60387"
                     /product="negative regulator of the PHO system"
                     /transcript_id="XM_022821058.1"
                     /db_xref="GeneID:34717602"
     CDS             join(808838..808854,808985..809882)
                     /gene="PHO85"
                     /locus_tag="KLMA_60387"
                     /codon_start=1
                     /product="negative regulator of the PHO system"
                     /protein_id="XP_022677459.1"
                     /db_xref="GeneID:34717602"
                     /translation="MVAPSQFKQLEKVGNGTYATVYKGLNKTTGVYVALKEVKLDSEE
                     GTPSTAIREISLMKELKHENIVRLFDVIHTENKLTLVFEFMDNDLKKFMDNRNKGNAH
                     KGLEMDLVKYFQWQLLQGVAFCHENRILHRDLKPQNLLINNRGQLKLGDFGLARAFGI
                     PVNTFSSEVVTLWYRAPDVLMGSRNYCTSIDIWSCGCILAEMIMGKPLFPGSNDEEQL
                     KLIFDIMGTPVERTWPQVTQLAKYNPLLPPRAPRDLKQLLQSNTDEVVDDKTVDLLKG
                     LLQLNPDARLSAKDALNHPWFAEYNHAN"
     gene            complement(<809975..>811096)
                     /locus_tag="KLMA_60388"
                     /db_xref="GeneID:34717603"
     mRNA            complement(<809975..>811096)
                     /locus_tag="KLMA_60388"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821059.1"
                     /db_xref="GeneID:34717603"
     CDS             complement(809975..811096)
                     /locus_tag="KLMA_60388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677460.1"
                     /db_xref="GeneID:34717603"
                     /translation="MGFIAAGYCSRDFKDRFVEREKLQICKRVGSWQHNSSATGKRRH
                     KRHKAAHKHKPATITDLPSELIQRIFVFSGNYELYVVSKFFYMNLKPTSFLLHHYMLE
                     NFYHDLNENFSMADPDKDGEDVPCFHGLNGQIFDIPVFRSFLNENPHLLQDIGHIGHH
                     DELEQVTKERQEMYAQGNLKGTSLMERHKEVQKQDYPAAFYADVELFFQNDIQLEKPI
                     YNQFILELFAHYEIKQPYYLMENMIHWFFHVNNGEYNINHLFHAVILVTHISTVPSSS
                     LESNGPLIELMNELYLASAGQKLNILLLMSDHSDEEAINNRRIRIINKFISKFYKDQD
                     ARTKLLSQDILWNTLRNLKNESLMKLMMEYGGQPSFSVI"
     gene            <813511..>815889
                     /gene="SVL3"
                     /locus_tag="KLMA_60389"
                     /db_xref="GeneID:34717604"
     mRNA            <813511..>815889
                     /gene="SVL3"
                     /locus_tag="KLMA_60389"
                     /product="styryl dye vacuolar localization protein 3"
                     /transcript_id="XM_022821060.1"
                     /db_xref="GeneID:34717604"
     CDS             813511..815889
                     /gene="SVL3"
                     /locus_tag="KLMA_60389"
                     /codon_start=1
                     /product="styryl dye vacuolar localization protein 3"
                     /protein_id="XP_022677461.1"
                     /db_xref="GeneID:34717604"
                     /translation="MSNTKIFIESTGFVQLEPFIRMSISSPQVKVFSLMSDYDIREVS
                     PENYVQFNPNSSGKQTIYIGETGSLKSQPGSSSYPKPITSLLTTFHSLFLKLFPDDAI
                     DTCNFLPLDFLTQQWKLAIPRVCFDPLLILFEEFSPSLLHQQILAKPLISGLITEIIT
                     LTRTMGIKLPSGYDTESDLLKRWVAGNGQGYPSLLYHFEHKTAPLDIDLLLLQPILLA
                     DDFTIKTPYLEFLYSMMCQFKKLNNDESKLFTRATTVSKLQEEVSKLSLLNSSFQEKE
                     ASFAEELNQTKENLQRDIVTRDTQLSVLREQLKQEQSQNGSLRRQLSVVQAELNALKQ
                     ARPVEHSVAGANAVAATLQTQSAPHTPVDSVSSRAIAGDSSSQPAEQYTDTGTPVLRD
                     IEDIAVYGIEYNDSPAEDNAELNADKLEEKPMTAAVEQDQATVALDEHALRERELKLR
                     RKELELQERELRLQKKQSQTMLNQKFNNVQNKSAMAANEYPAQYSSQMQMPNRKAHSQ
                     SAYMGKPSQGMPGQYIPPASQPPQMRPHVNTALPAMGHAPMNNNGARPLNGVGLPHLG
                     LDGAAQIGGNGYAPKTFQKTSRKNRRSNMPMLRNPSNTMLNDYSMPTGPQSLQPGQQR
                     YNSMSSNIPQLSTHYHGGSMPRLNNPNPNAMRASSQGQISSLPTQPQQQYQPVPNGMR
                     QISTSTMIDEGVSTSSVVQRPPNGIPQQNQIQTQNQDQQERSNSNSNSNEHSTSPPLL
                     DSDVSSNNHPSSSELNTSSVDLQDKQLAESNEKKNKEEIKKSKFSFFHSKKK"
     gene            <816425..>816898
                     /gene="EGD1"
                     /locus_tag="KLMA_60390"
                     /db_xref="GeneID:34717605"
     mRNA            <816425..>816898
                     /gene="EGD1"
                     /locus_tag="KLMA_60390"
                     /product="nascent polypeptide-associated complex subunit
                     beta"
                     /transcript_id="XM_022821061.1"
                     /db_xref="GeneID:34717605"
     CDS             816425..816898
                     /gene="EGD1"
                     /locus_tag="KLMA_60390"
                     /codon_start=1
                     /product="nascent polypeptide-associated complex subunit
                     beta"
                     /protein_id="XP_022677462.1"
                     /db_xref="GeneID:34717605"
                     /translation="MPIDQEKLAKLQKLSANNKVGGTRRKLAKKTGTSSKDDTKLQAQ
                     LQKLRAVTIDNVAEANFFKDDGTVLHFNKVGVQVAPQHNTSVFYGIPQTKGLQELFPG
                     IISQMGAEAISALTQMASQLQSAEAQKAAAPEADEGKDIDIPNLVEGQTFEEDVE"
     gene            complement(<817166..>818008)
                     /gene="MET32"
                     /locus_tag="KLMA_60391"
                     /db_xref="GeneID:34717606"
     mRNA            complement(<817166..>818008)
                     /gene="MET32"
                     /locus_tag="KLMA_60391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821063.1"
                     /db_xref="GeneID:34717606"
     CDS             complement(817166..818008)
                     /gene="MET32"
                     /locus_tag="KLMA_60391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677463.1"
                     /db_xref="GeneID:34717606"
                     /translation="MNEDGLFFQKAAEAIMVTSLNSEKVDPTIRELLNRVKYVSTPAN
                     TPQQPQQSRKNVAFSDLSTYNNGDGQYGASHIQSHNQVNPSSNHSNNVSAGLIAPENK
                     TILNYFDRLLSNPVDFNNQKSGTYNGNLHHNPMTSASSSGDQLRLGEGKTKRRKLDSQ
                     TSSDMSDAQSDNYKSNHKSTENGDSEDKGFPCQQCHMIFRRSSDLRRHERQHLSILPN
                     ICTLCGKGFARKDALKRHFDTQTCKRNRQKLLSIGGDINEILERARQSGANIYSGPAK
                     QTSP"
     gene            complement(<818840..>819760)
                     /locus_tag="KLMA_60392"
                     /db_xref="GeneID:34717607"
     mRNA            complement(<818840..>819760)
                     /locus_tag="KLMA_60392"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821064.1"
                     /db_xref="GeneID:34717607"
     CDS             complement(818840..819760)
                     /locus_tag="KLMA_60392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677464.1"
                     /db_xref="GeneID:34717607"
                     /translation="MLELRKSVDHLTQEEVSMIQREMQKNTSHSLNVNMNVNINTRKS
                     PEPSPAVHDIKKRYRYKQEMETLSNFMLRNFCAAVLIKHSKLLVPTDDGESQAQQQHV
                     ITLAELLKFLRTLLARVRATRQQFNKMCVMSIKFLGICSKSQENYMRFLKYDVRKLVV
                     TCLLFTFPHNSISLEQNSPTWDQQLLLLSRATGLPKEQLRHCCEIVGPILKSQYLKTQ
                     RAVFRHAHAQAQAHSFDPNDRTQNRRNKMKSGDSVDIRSTNFGTFTNYYTNTEDLDPD
                     NDQELYCLPSDYESFNEMGRKLVNKNFLVK"
     gene            <820501..>823479
                     /gene="ISM1"
                     /locus_tag="KLMA_60393"
                     /db_xref="GeneID:34717608"
     mRNA            <820501..>823479
                     /gene="ISM1"
                     /locus_tag="KLMA_60393"
                     /product="isoleucyl-tRNA synthetase"
                     /transcript_id="XM_022821065.1"
                     /db_xref="GeneID:34717608"
     CDS             820501..823479
                     /gene="ISM1"
                     /locus_tag="KLMA_60393"
                     /codon_start=1
                     /product="isoleucyl-tRNA synthetase"
                     /protein_id="XP_022677465.1"
                     /db_xref="GeneID:34717608"
                     /translation="MFRAFISIRNASSHSYQKTLRLPKTKFPNRSNLQKAFDQLIPQS
                     SQQIYTQQYDELIVKLSKISECPDSMKLDFLRDNVFILHDGPPYANGDLHLGHALNKI
                     LKDIINRHQLLNGKHVVYIPGWDCHGLPIELKALNKLNDKLDTISPMKIRSIARAHAQ
                     KTIKAQKEQFEQFGILTDWKTRYLTMDPKFEINQLNVFQELFKRNLIKRQRKPVYWGT
                     ETKTALAEGELEYKEDHVSTSAYVKFPLTEKSKESLDVGAIPTYLLIWTSTPWTLLSN
                     RAICFNESLQYVLLRFNNEYLILEKNLAENLSFISGYEVVKSLDPKILSGLSYTNPLV
                     KDDIARPLFHGDHVTSTTGTGLVHTAPGHGHEDYTIGIQNSLEVYSPVDHEGRYDLNE
                     LPFHLQTYFKEEESGKGCKVLDTHTTKKIIDLLDKENMLAHHHEYIHSYPYDWRSKKP
                     IVIRATPQWFADLHDIKSAALRALEDVKFFPERGMNRLTSFIKNRNEWCISRQRYWGV
                     PIPSLHKRDDPDTVLMNEETLSHIIKTIESKGIDAWFAESTEESMYEWLPEKYHAIAK
                     DYYRGTDTVDVWFDSGTSWHVIADWYKNIAGLKSQLPEPLADVYLEGSDQHRGWFQSS
                     LLTKVGSTGIDEAPYKKVITHGFTLDENGIKMSKSIGNTISPLAIIKGDDKRKLPALG
                     VDGLRLLVAQSNFTSDIVAGPTVMKHVADALKKFRLTFKFILGNLQESTEFELLPFSE
                     LRRIDQYTLLNLKILCEETQKLYNQHNFSNVLTQVQYHMNNDLSALYFSVIKDSLYSD
                     SLTSSKRRSIQTTLFHIFDAYRSIMAPVIPLMVQEAWNYIPKEWFGKSPRNSLSGVET
                     AFTRQWCNSLREIPDSNENLLHSFSNNELKLLSSFTQKFNTLDNVTKPLQLKVTLYCQ
                     EPELLPFTREEIEDLLQVGELVIETGSQSDLPYLELSSTTVQLKLEESVLHKCPRCWK
                     HNSPNEDTLCHRCEEVINDS"
     gene            <823713..>824315
                     /locus_tag="KLMA_60394"
                     /db_xref="GeneID:34717609"
     mRNA            <823713..>824315
                     /locus_tag="KLMA_60394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821066.1"
                     /db_xref="GeneID:34717609"
     CDS             823713..824315
                     /locus_tag="KLMA_60394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677466.1"
                     /db_xref="GeneID:34717609"
                     /translation="MRLSQSYIGLGLKNGSSLLQSNRRILLKTPQVSTYVFKGKRFKT
                     DSVQSTNANDKLHRIIKRSSFLTKLNSNPKYKHYFDKLSEAGAVSTVTSFLILHEITA
                     IIPLFALWGILYNLDISDQYEMPVYFKDLFNKCGESISKLVGEYDNGWDRDRLVVSGA
                     ISYAIVKFLYPVRVLFSLWAAPYMGMLVVAPFKKLRALFR"
     gene            <824760..>826502
                     /gene="SSN3"
                     /locus_tag="KLMA_60395"
                     /db_xref="GeneID:34717610"
     mRNA            <824760..>826502
                     /gene="SSN3"
                     /locus_tag="KLMA_60395"
                     /product="serine/threonine-protein kinase SSN3"
                     /transcript_id="XM_022821067.1"
                     /db_xref="GeneID:34717610"
     CDS             824760..826502
                     /gene="SSN3"
                     /locus_tag="KLMA_60395"
                     /codon_start=1
                     /product="serine/threonine-protein kinase SSN3"
                     /protein_id="XP_022677467.1"
                     /db_xref="GeneID:34717610"
                     /translation="MSYYRLNNGQGGNNNRWPQQLSHQEMLANHSKLILDKNKPAGTQ
                     SKPPIVMASNNVFSIGPYRQRKDSSRVSVLQKYEIIGYIAAGTYGKVYKAKSRDYDNN
                     RNGNDVIVLDSPDPISADSNLDINSINRSTRQHEANENLTTTDFRKPFNKRFTPNERN
                     NSTQIRFNSGSEQNTGMNSSNLTNNSRKPSQIQFYAIKKFKTEREGVEHYTGISQSAC
                     REMSLCRELDNNHLTKLVEIFLEKKSIYMVSEFAEHDLLQIIHFHSHPEKRLIPSRML
                     KSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKIGDLGLARKFNNMIQTLYTG
                     DKVVVTIWYRAPELILGARHYTPAIDLWAVGCIFAELIGLRPIFKGEEAKMESKKSVL
                     FQANQFQRILEVMGTPDHKIWPNISSYPEYPQLAKMPKYRESLTTWYQTAGGKDKAAL
                     DILYRLLTYDPIRRIDAIDALDHPYFTNGDPPVCENVFEGLNYKYPPRRIHTNDNDIT
                     NVGNDNNPNHSQKQTIHSNNNNKNGSINGLGVNKRVLAAAAAAAAAAAVSGNGNNPSN
                     NNMAAGGSVRKKRK"
     gene            complement(<826552..>828600)
                     /gene="NOP4"
                     /locus_tag="KLMA_60396"
                     /db_xref="GeneID:34717611"
     mRNA            complement(<826552..>828600)
                     /gene="NOP4"
                     /locus_tag="KLMA_60396"
                     /product="nucleolar protein 4"
                     /transcript_id="XM_022821068.1"
                     /db_xref="GeneID:34717611"
     CDS             complement(826552..828600)
                     /gene="NOP4"
                     /locus_tag="KLMA_60396"
                     /codon_start=1
                     /product="nucleolar protein 4"
                     /protein_id="XP_022677468.1"
                     /db_xref="GeneID:34717611"
                     /translation="MSGNMEKKDEGLDLKTLFVRGVPFEATDEEFGNFFSQFSPIKHA
                     VIVKDSEGASRGFGFVSFAVEDDTKEALSQARKTKFLGRLLRVDIAKRRDRNRKGDAK
                     EASNESEDTKSEAEKKIESDNDLMKGKPKLIIRNMPWSCRDPTKLKKIFGQYGTVVEA
                     SIPRKRDGRLCGFAFVTMNRISNCKLAIENTKDLTIDGRKVAVDFAIQKSRWEEYKTE
                     HKELEAPQENTESDSESESGSEDAAEEEQDDDSEEDDVELQSDEQLSEDEEEEDEEEE
                     QEEEKPQKKNRKEDFSIFVRNVPYDATQESLADHFNVFGPVKYALPVIDKETGLAKGT
                     AFVAFKTEQAYENCLSNAPATGSTSLLISDDVSPEYVYQGRVLAISPTLDRESAGRMF
                     ERNAEKRKEVLGKAPGEKDRRNLYLLNEGRIVEGSKLAQLLTPADMEVREKSYKLRVE
                     QLKKNPSLHLSMTRLAIRNIPRAMTEKSLKALARKAVVEFAKEVKEGKRHALNKEEIV
                     RSTKEKYKFMSEEEIEAVKKKDKKHGIVRQSKIIMEVKGSTVGRSRGYGFVEFRDHKT
                     ALMCLRWLNAHEVTKEEIIEGLTEEEQKLLDPDSFKKRRLVVEFAIENANVVKRRREK
                     VQESRIQSLKRKRAEESSAEKAKEAQANAPEVPTKSGLSNDIKTIIGAKRRRKNKGRS
                     "
     gene            complement(<830205..>832586)
                     /gene="VPS16"
                     /locus_tag="KLMA_60397"
                     /db_xref="GeneID:34717612"
     mRNA            complement(<830205..>832586)
                     /gene="VPS16"
                     /locus_tag="KLMA_60397"
                     /product="vacuolar protein sorting-associated protein 16"
                     /transcript_id="XM_022821069.1"
                     /db_xref="GeneID:34717612"
     CDS             complement(830205..832586)
                     /gene="VPS16"
                     /locus_tag="KLMA_60397"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 16"
                     /protein_id="XP_022677469.1"
                     /db_xref="GeneID:34717612"
                     /translation="MDLSSSLSWERLQSVFYRSQPLQSVKNKTSSLGISTYLTVGPSN
                     TSVYTYSEELLISVNHENLPSTHLKSVLEDDHLVVVMKDRVRVYSSFITQEYKDHTIM
                     GKDRLPLSIWDYKNGIAMTTEFHMHQIFLNQPVFPNLNISLLLKDHWFANKSKIVVLD
                     SSGKVLVCNLETSNLLEFEGWTGWYKGCISENGYICLVNGKLDTLVVFDDNLNKPLIS
                     ANLDELPKSIAWCGDDLVCCVFGDEEVRLIGSKTEYASFWFSNNIVLLQSTSNGLKIA
                     TDDQIEFISKVPTCTSNIFSIGSTSPGAILLDSLNLLHNEQNSPKAIENLKIINVKKA
                     VDECVSAVYDELDPLWQKRLLAAASFGKDSLSSTEFDADHFAKTCSYLRVLNFLKSIG
                     IHLTLRMFLAIGLENIIKKLIDIRKIYESLEIVKFLKYPELIPAIFEEWAKGLILTSS
                     DSSDDELYQIMTDRATSLDTRLHLSNTANVAFLDGRHSLARKLVMDDKDVLPKIDLLL
                     KMDEIDLALQEATQSMSIPLILYLLLYSKRKMSNVQFTKTLMITMKENNIYQYFQRHD
                     FSLLYDYLRQTDDYLTLARLLWDHGTVEGQETVALLDQASELYGKLATNSSVKRDRSM
                     LDRAKKLATYQNELTNRYGISFHRQTMDETLATLIKINQNSEVKKMVNAFKISDRKYY
                     FLKCTQLAKEHRLKELLAFAKEKKSPIGYLPFFKAVCKYANKKEAAVYIGMLSSASYA
                     EKLSLYIDCSAYDEAITLASYEKDAIGLKQVLNKIPPNETQLRSKAMQHLHTL"
     gene            <832830..>833120
                     /locus_tag="KLMA_60398"
                     /db_xref="GeneID:34717613"
     mRNA            <832830..>833120
                     /locus_tag="KLMA_60398"
                     /product="elongin-C"
                     /transcript_id="XM_022821070.1"
                     /db_xref="GeneID:34717613"
     CDS             832830..833120
                     /locus_tag="KLMA_60398"
                     /codon_start=1
                     /product="elongin-C"
                     /protein_id="XP_022677470.1"
                     /db_xref="GeneID:34717613"
                     /translation="MDEVSLVSGTGDVRVVKREIAMQSETLKRMLESSFLESQGTIKL
                     AEFDTKILDKVIEYMEYAYKYKDADEDIEVPEFEVSPEISLDLLLAADYLGI"
     gene            complement(<833191..>834381)
                     /gene="RMD5"
                     /locus_tag="KLMA_60399"
                     /db_xref="GeneID:34717614"
     mRNA            complement(<833191..>834381)
                     /gene="RMD5"
                     /locus_tag="KLMA_60399"
                     /product="sporulation protein RMD5"
                     /transcript_id="XM_022821071.1"
                     /db_xref="GeneID:34717614"
     CDS             complement(833191..834381)
                     /gene="RMD5"
                     /locus_tag="KLMA_60399"
                     /codon_start=1
                     /product="sporulation protein RMD5"
                     /protein_id="XP_022677471.1"
                     /db_xref="GeneID:34717614"
                     /translation="MSTLLENLDQQWVQSKLYADPEDRVTHLGKCVEEVHDFKIQLKK
                     LKAHLIKHGSSPQKRQIIKEKLSKTHKHWDSSMKKSLSSSISTYKKFSKTCVKPLNEF
                     QLDSVYVNRINPQRLQYLDRAIYTHIARYYTTSANGDSPEEMLSYLNSAYNIPRNIAA
                     DYIEMAIIIKEMRSGSLNSCIRWCQENGLEMLNFQLHYLHAMSLLSENKPMDCYSYIQ
                     KNLAPTVSKSSHLRMAKPVSALLAKIIIGDTISSNKVHNYLEICVECFSKQYCLRNRL
                     PLHSALFLVVLSGVIGFQVFTKYEAIRKVSHVDWSTADELPFQVKLPSFLSNYHPIFI
                     CPVLKEETTKDNPPYSLPCHHILSKKSLDKLSKNGTCNFKCPYCPVMSTKAKTKRVNF
                     IKLP"
     gene            complement(<834711..>835004)
                     /gene="SGF11"
                     /locus_tag="KLMA_60400"
                     /db_xref="GeneID:34717615"
     mRNA            complement(<834711..>835004)
                     /gene="SGF11"
                     /locus_tag="KLMA_60400"
                     /product="SAGA-associated factor 11"
                     /transcript_id="XM_022821072.1"
                     /db_xref="GeneID:34717615"
     CDS             complement(834711..835004)
                     /gene="SGF11"
                     /locus_tag="KLMA_60400"
                     /codon_start=1
                     /product="SAGA-associated factor 11"
                     /protein_id="XP_022677472.1"
                     /db_xref="GeneID:34717615"
                     /translation="MTASLTTDSVANSIYHNLITSIIQDIVSRQTVKQKLIKQQFPDA
                     KPYHYDPSGTYDIHGKPKQADSAVYIECNVCGREVSGNRFAAHLVRCLSRGKR"
     gene            complement(<835422..>836957)
                     /gene="CTA1"
                     /locus_tag="KLMA_60401"
                     /db_xref="GeneID:34717616"
     mRNA            complement(<835422..>836957)
                     /gene="CTA1"
                     /locus_tag="KLMA_60401"
                     /product="peroxisomal catalase A"
                     /transcript_id="XM_022821074.1"
                     /db_xref="GeneID:34717616"
     CDS             complement(835422..836957)
                     /gene="CTA1"
                     /locus_tag="KLMA_60401"
                     /codon_start=1
                     /product="peroxisomal catalase A"
                     /protein_id="XP_022677473.1"
                     /db_xref="GeneID:34717616"
                     /translation="MGHPTNSSDVRKDRVVTNSQGAPINEPFATQRVGQHGPLLLQDF
                     NLIDSLAHFNRERIPERNPHAHGSGAFGYLEITDDITDVCGSAMFDGIGKRTRCLVRF
                     STVGGEKGSADTARDPRGFAIKFYTEEGNVDWVNNNTPVFFIRDPSKFPHFIHTQKRN
                     PETNMKDADMFWDFLTTEENQVAIHQLMILFSDRGTPASYRHMNSYSGHTYKWSNKKG
                     EWRYVQVHLKTDQGIKNLTNEEAIELAGKNPDYCQQDLFENIAKGNYPSWTLYIQTMT
                     EAEAQKLPFSVFDLTKVWPHDQFPLRRVGKMVLNENPENYFAQVEQAAFSPSHTVPYQ
                     EPSADPVLQARLFSYPDAHRYRLGPNYSQIPVNCPYASKVFNPAIRDGPMNVNGNLGK
                     EPNYLSSSKKYQFIQQSKPIQQHQEVWSGPATPVHWATSPGDIDFVQARDLYNKVLSK
                     QPGQQKALAHNIAVHVAGACPEIQDRVFAMFAKVDKGLASNIRKEALSLSPRKDDALN
                     AKL"
     gene            complement(<837764..>839440)
                     /gene="PDAT9"
                     /locus_tag="KLMA_60402"
                     /db_xref="GeneID:34717617"
     mRNA            complement(<837764..>839440)
                     /gene="PDAT9"
                     /locus_tag="KLMA_60402"
                     /product="pisatin demethylase"
                     /transcript_id="XM_022821075.1"
                     /db_xref="GeneID:34717617"
     CDS             complement(837764..839440)
                     /gene="PDAT9"
                     /locus_tag="KLMA_60402"
                     /codon_start=1
                     /product="pisatin demethylase"
                     /protein_id="XP_022677474.1"
                     /db_xref="GeneID:34717617"
                     /translation="MFVTVTVVIIVLLHYFVIHPLFFSPLSKLPGPLHLKLSKWFILN
                     KARTESRNVYLQKLHEKYGDVVQIGPNEVAFNSLEYMKQIYMGNFPKEFKSNGIGFYA
                     QFGNFGSKNLFSTGDSQVHLEKKRNIAKVYSKTNVLQSGDYIKQKVEQLWAPLDARLQ
                     HPVNVYPMFLALAMDVVSGFEYGGQFSTNFVSKINAGAAGLSSTEKAPEDISQESSLE
                     RNPTELFEGFQESSSMWFYTTLAPQLWNIVARIYGIGKKSSRAQQWIYSRFQQALKSK
                     QLYQGPAPVSNVLQTMFQEMQTKPKHNLNEIASEIADHIAAGHETTGITLTYICWELS
                     RPCNQHWQQKLHEECSGITDLQELDQLPILHSVVQEACRIHSAIPGSEPRYVPEEAKF
                     AAVLHDSTHTRVPIPPGTIVSCQPWSLHQLENTFGSHTAQFRPERWLQDVENNESAQE
                     YERRLKRMNNSMFTFGQGNRMCLGMHLALIEMKYCIAQMYSRYETKISPEWCRNVYKG
                     DDANVLMGTAPSRSTTDLDMMRMADTYTTRPIRDECWLEFKSRDTINASG"
     gene            complement(<839743..>840414)
                     /gene="CAM1"
                     /locus_tag="KLMA_60403"
                     /db_xref="GeneID:34717618"
     mRNA            complement(<839743..>840414)
                     /gene="CAM1"
                     /locus_tag="KLMA_60403"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821076.1"
                     /db_xref="GeneID:34717618"
     CDS             complement(839743..840414)
                     /gene="CAM1"
                     /locus_tag="KLMA_60403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677475.1"
                     /db_xref="GeneID:34717618"
                     /translation="MSQGTLYANFRIRTWLPRALVKSLKLDVKVLEPEKNEEEWARLF
                     PLKLVPCFVGPDGFKLTEQLAILRYLVSLSDDESEKSRLLGKDFVERAKVLQWMSLAN
                     MDLCVTFTRANFGLTGKEPYNKKKVDAAYEDLEKIVQDYELRLKDHKYLVNDEYATLG
                     DYLSAMIFTRVFQFLLGREWREAHPELMAWFTRVTEDPLVSFLYTDVTLCEEAVQPPT
                     KKNSH"
     gene            <840884..>842014
                     /locus_tag="KLMA_60404"
                     /db_xref="GeneID:34717619"
     mRNA            <840884..>842014
                     /locus_tag="KLMA_60404"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821077.1"
                     /db_xref="GeneID:34717619"
     CDS             840884..842014
                     /locus_tag="KLMA_60404"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677476.1"
                     /db_xref="GeneID:34717619"
                     /translation="MGEHIPSPPAIEVSDSQYQKIGLQCISPGIATSSLDTERLQTFN
                     KSKYIALQQQKQIRRMNLDSLGESGTQEGQENHEKEDEDGEQDHEKEDDDDGDEDRDR
                     EKEDGPDQEHVSTPDTSTSLSMNASSSKSLRRNNIPKPLSLKSQGSGAGSASASASAS
                     ASGSGPYPNIRSAPPMVTKHTIPALGPHSSHQGSINTASGYRIAKPRVIYRGRSTNRG
                     YPLLPPGSLGAPLPMFQTSSPIAARAMATPASLRSHAQGPGPRQAPMTAYPGGYPQTQ
                     RSFEQFMANPVRASNSVTRDVFKDETTRIAPLSVQPKSTKREFFDAIEIEDHSNNVVI
                     EGDIRLMGENFQFQFDSIDPSMDKKMFLSICSKIWTDVVSRN"
     gene            <842820..>843203
                     /locus_tag="KLMA_60405"
                     /db_xref="GeneID:34717620"
     mRNA            <842820..>843203
                     /locus_tag="KLMA_60405"
                     /product="37S ribosomal protein YMR-31"
                     /transcript_id="XM_022821078.1"
                     /db_xref="GeneID:34717620"
     CDS             842820..843203
                     /locus_tag="KLMA_60405"
                     /codon_start=1
                     /product="37S ribosomal protein YMR-31"
                     /protein_id="XP_022677477.1"
                     /db_xref="GeneID:34717620"
                     /translation="MRASTVKLAKAAQYVPTIKFVGGRHPVVAHSASEAGLHPCTVDS
                     LRPGAPGCSSVDEVMKKWLPFKVVPYVNPKKSAASSGSASSKYIFKNRPLEENEVASI
                     SQLPARFKLRPLEESEIEIINGGGV"
     gene            complement(<843477..>844595)
                     /gene="PDE1"
                     /locus_tag="KLMA_60406"
                     /db_xref="GeneID:34717621"
     mRNA            complement(<843477..>844595)
                     /gene="PDE1"
                     /locus_tag="KLMA_60406"
                     /product="low-affinity cyclic AMP phosphodiesterase"
                     /transcript_id="XM_022821079.1"
                     /db_xref="GeneID:34717621"
     CDS             complement(843477..844595)
                     /gene="PDE1"
                     /locus_tag="KLMA_60406"
                     /codon_start=1
                     /product="low-affinity cyclic AMP phosphodiesterase"
                     /protein_id="XP_022677478.1"
                     /db_xref="GeneID:34717621"
                     /translation="MFSNESGSFELTFLGCAGGPLNDHTQSFLLKQAGCDAPGYICID
                     AGSGLSEIADMIYNTGESGSGVVKSLYRNRTEDVSTLVAPGISCKSGFGTLSKRFAEK
                     TDNRGSNVIERAYEIYGEITEYFITHPHLDHLVGLILNSPAIYERPGCYKKIYGTEQT
                     VTAIRENLFNDKIWPDFTADRAIRLKSLDCFKAMKLSTIKDIECIPFTLRHGYSVRNT
                     DPVFSTAYLFRDCTTNDHILIFGDTESDEVSKSDSLMKIWEHLSKNVPIRNLKAIVIE
                     CSNPEEVETEKLYGHMSPRFIIWELLRLVQLYGAGDSMDPSEFELHVILTHIKDGFTD
                     EDPRTKVLRQLRNLYQKSELNKFNIDFSIAVPGFTLTL"
     gene            complement(<845093..>845890)
                     /gene="PRE4"
                     /locus_tag="KLMA_60407"
                     /db_xref="GeneID:34717622"
     mRNA            complement(<845093..>845890)
                     /gene="PRE4"
                     /locus_tag="KLMA_60407"
                     /product="proteasome component PRE4"
                     /transcript_id="XM_022821080.1"
                     /db_xref="GeneID:34717622"
     CDS             complement(845093..845890)
                     /gene="PRE4"
                     /locus_tag="KLMA_60407"
                     /codon_start=1
                     /product="proteasome component PRE4"
                     /protein_id="XP_022677479.1"
                     /db_xref="GeneID:34717622"
                     /translation="MNHDPFAWGRPSDEHYGAYNHAIAQASNNPKMNTQNPIITGTSV
                     ISIKYNNGVIIAADNLGAYGSLLRFTNEERLIKVGPNTVVGVSGDISDMQYIQHLLDD
                     LEIENNYDSAYAENEEQLKPSYVFEYLSSVMYQRRSKLDPLWNAIIVGGTEDGKPFLR
                     YVNLLGVTYSSPTLATGFGAHLALPLLRKLVDDEKDVKNVTLDTAKKAILEAMKILYY
                     RDARSSRKFSLAIIDNDLGLNIEKNLQVENMSWEFAKDIKGYGTQKV"
     gene            complement(<846339..>848120)
                     /gene="RTG2"
                     /locus_tag="KLMA_60408"
                     /db_xref="GeneID:34717623"
     mRNA            complement(<846339..>848120)
                     /gene="RTG2"
                     /locus_tag="KLMA_60408"
                     /product="retrograde regulation protein 2"
                     /transcript_id="XM_022821081.1"
                     /db_xref="GeneID:34717623"
     CDS             complement(846339..848120)
                     /gene="RTG2"
                     /locus_tag="KLMA_60408"
                     /codon_start=1
                     /product="retrograde regulation protein 2"
                     /protein_id="XP_022677480.1"
                     /db_xref="GeneID:34717623"
                     /translation="MSLMSDSDNETEVVSRNLCGVVDIGSNGIRFSISSKATHHARIM
                     PCVFKDRVGISLYEVQYAANSLQKAPIPSSVINEVCAAMKRFKLICEDFGVPETGVRV
                     VATEATREALNSQEFIDAIYESTGWEVEILAKEDEGKIGAYGVISSFNTVSGLYIDLG
                     GGSTQISWIKCVNGEITQSSSPVSLPFGAGALSRRLQNESKHDLFQEIVEAYKTAVEK
                     IDIPKEMYHEAELNGGFDLYTCGGGLRGMGHVLLSQIKEYPIQTIINGFSCSFKEFSN
                     MCDYLFLKERVPGDSGRKIFKVSDRRAKQLPAVGLLMSAATESLPKIKNVHFCEGGVR
                     EGTLYSILPREIRAQDPLVIATRPYAPLLAYKYLELLRTAIPTKEIPKIVYERIAPAL
                     CNLAFVHASYPKELQPTAALRVGTSGIIAGCHGLSHRSRALVGIALCNRWGGDIPEPE
                     EEYKKLLEEVVLRDGDKLERERTIWWTKYIGTIMYVICGVHPGGNIGDGVFHFSTSEK
                     EELVNETQALSIDENLANGDKPITTSTTNTTGNSNKRVFEVVVKINRNDLKTIASVRQ
                     RIITLQKKIRKLSRGSSDKVKINVEFY"
     gene            <853538..>855574
                     /gene="ZIP2"
                     /locus_tag="KLMA_60409"
                     /db_xref="GeneID:34717624"
     mRNA            <853538..>855574
                     /gene="ZIP2"
                     /locus_tag="KLMA_60409"
                     /product="protein ZIP2"
                     /transcript_id="XM_022821082.1"
                     /db_xref="GeneID:34717624"
     CDS             853538..855574
                     /gene="ZIP2"
                     /locus_tag="KLMA_60409"
                     /codon_start=1
                     /product="protein ZIP2"
                     /protein_id="XP_022677481.1"
                     /db_xref="GeneID:34717624"
                     /translation="MTSGIWDNSSLNLKHFLEEGFGAYSLRNLKESLSLDKKSKKLLK
                     YISNSNIELNFWLFEKNRSPKSKLAKYLFEYDRDVFSIKKGKLVMRSPQWNNSSLTLS
                     RSVLDRNIIIKEKLAVSNDVKGLLGEVLVKLDLSSGLSKYPKENLGRFKIESCFLKGS
                     RIKKRPTITPKMVNRLDIQINELIDETIISEVPLFQDLDLKALFPKKNTNHLQNYMLH
                     LISPCAQLKKKRIISCYNKGPKWVQTPETSTSQRFRNLRFRSQDEDFHAFELFKLESP
                     VEKLKRSRLHRCQKKITKVKWRVREEVLQRLNWNPFEGIEFPDNSDLVETIKQVEYMV
                     KPPTVTFKRLYSSRLDLITEIPMIFAPFEPIEQFEHETSPKLSSPAREETIASSGTNS
                     SNDEVTDIENVSHKRLINQSKRSFIDDDLISIIAAKRKRLSSSNLNCINATEDSLNLT
                     TSTILSPKISFEVDEIFFESARKKTVIFNSIHLHKNHPIIRFMSQNHFSILELELGDA
                     CDILVDTSTCIVIRDLQMVSQKRDDSFPIIDLIQTLKLKYKRVCLLLSYTENVLQLDQ
                     NLAYKSQLLLNSCYEINTHLIEEHNIKIIADWISVYSSQSNPTEQQLDSISPAKKLLQ
                     SFDINPFAIENILTLSSLDAFLSMSYGKRALLYGKYLTDYQLSRIDEFVTMSWN"
     gene            <855864..>857492
                     /gene="RET2"
                     /locus_tag="KLMA_60410"
                     /db_xref="GeneID:34717625"
     mRNA            <855864..>857492
                     /gene="RET2"
                     /locus_tag="KLMA_60410"
                     /product="coatomer subunit delta"
                     /transcript_id="XM_022821083.1"
                     /db_xref="GeneID:34717625"
     CDS             855864..857492
                     /gene="RET2"
                     /locus_tag="KLMA_60410"
                     /codon_start=1
                     /product="coatomer subunit delta"
                     /protein_id="XP_022677482.1"
                     /db_xref="GeneID:34717625"
                     /translation="MVVLAVSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVANSS
                     KQHTFVEDEHVRYVYKPFDDYYIILLTNLHSNIIQDMNTLNTFVQTVDSTLKGLSEED
                     IFHSAFDILNSFDEIITMGYKENLSLTQIKTFLAMESHEERIQEIIERNKEFEAAEER
                     KRRAKEISRKEQARKLGIPDTQEFTGIHGGVMNKAYDSYYSHASSAAQQSYMHTQSNQ
                     GSQSAQNQGAAPQMMQQPTYGSGSREPLGGKGLQLNGPRRGGVERPAKSFERQSLPVQ
                     ASLEPEEEKPTNNGILISVKETINAEISRDGAILGSELKGVLELRVNNPDLAHAKLCL
                     GDDVNVKDKTYQFKTHPNVDKAGFLNNRMIGLKDPNKPFPSNDQSLGVLRWRKVKGAD
                     EHDLIPLEVSTWLSPSDESQGSMDVTFEYEVNSDYEGTIDELRFLIPVFTESVFIKDD
                     SNEVNAKIEAIDESQGVIIKVDPISSGESGVFSITIEAAYEDALFPINIALKNSNALP
                     LSKLNIASVISAVEETELPFDTISTLKSEQYVVV"
     gene            <857924..>858721
                     /gene="RPN12"
                     /locus_tag="KLMA_60411"
                     /db_xref="GeneID:34717626"
     mRNA            <857924..>858721
                     /gene="RPN12"
                     /locus_tag="KLMA_60411"
                     /product="26S proteasome regulatory subunit RPN12"
                     /transcript_id="XM_022821085.1"
                     /db_xref="GeneID:34717626"
     CDS             857924..858721
                     /gene="RPN12"
                     /locus_tag="KLMA_60411"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN12"
                     /protein_id="XP_022677483.1"
                     /db_xref="GeneID:34717626"
                     /translation="MPSLPELTKGLKSAFESKQYDICLKLLVPIKLELIKANLLIPDI
                     KKSQENTDYLQDLNIAKKILEIGALSSVYCEDFDAFMSYYSQLSSFFFSDVKELSESD
                     SKYKLISLYLLILLAQNDYTKLHSEFEFLSRYVTNLEESQYLSYPVKLERLLMEGSYQ
                     KAWDLLQSGTKVEEFNVFTKTLKDAIREEIALNSEQAYKSLPLFNAKTLLFFENEKEM
                     EAFAKERGWNVNHGVITFGTDAGPEKVETGNIVDMAVDYAVHLESIV"
     gene            complement(<859334..>860791)
                     /gene="RAG5"
                     /locus_tag="KLMA_60412"
                     /db_xref="GeneID:34717627"
     mRNA            complement(<859334..>860791)
                     /gene="RAG5"
                     /locus_tag="KLMA_60412"
                     /product="hexokinase"
                     /transcript_id="XM_022821086.1"
                     /db_xref="GeneID:34717627"
     CDS             complement(859334..860791)
                     /gene="RAG5"
                     /locus_tag="KLMA_60412"
                     /codon_start=1
                     /product="hexokinase"
                     /protein_id="XP_022677484.1"
                     /db_xref="GeneID:34717627"
                     /translation="MVHLGPKKPPARKGSMADVPADLMEQIHGLETLFTVKTEKMRAI
                     VKHFVSELDKGLSKKGGNIPMIPGWVVESPTGKETGDFLALDLGGTNLRVVLVKLGGN
                     HDFDTTQNKYRLPDHLRTGTSEQLWSFIAKCLKDFIEEWYPEGVSEPLPLGFTFSYPA
                     SQNKINEGVLQRWTKGFDIEGVEGHDVVPMLQEQIKKLNIPINVVALINDTTGTLVAS
                     LYTDPETKMGIIIGTGVNGAYYESVKNIEKLEGKLPSDITTDMLMAINCEYGSFDNEH
                     LVLPRTKYDVMIDEQSPRPNQQAFEKMTSGYYLGEIMRLVLLDLHSSGFIFKDQDISK
                     LEVPYVMDTTYPAKIEEDPFENLEDTYELFKTTLNIETTVIERKLIRKLAELVGTRAA
                     RLTVCGVSAICNKRGYTEAHIAADGSVFNKYPGYKEKAAQALKDIYDWKVEKMEDHPI
                     KLVAAEDGSGVGAAIIAALTQKRLAAGKSVGIEGA"
     gene            <864213..>865847
                     /locus_tag="KLMA_60413"
                     /db_xref="GeneID:34717628"
     mRNA            <864213..>865847
                     /locus_tag="KLMA_60413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821087.1"
                     /db_xref="GeneID:34717628"
     CDS             864213..865847
                     /locus_tag="KLMA_60413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677485.1"
                     /db_xref="GeneID:34717628"
                     /translation="MGQVLSTEGTTPHKVTIPGQGTLTGYTFSSSRTNNATTHRFAKV
                     PYAQPFTKETRFKKPVPLGDDYDYTGDYKEFGLKCPQPSVPNPMFGWKKSPSDENINY
                     LNIWVPASDKYKGKDGWPVLVYIHGGWLQYSSPSNEFFNTIEMFDDEEFDQKYILVTP
                     GYRLNMFGFLSGKELLEEDESSSNFGFWDQRLAIEWTYKYIKHFGGNPEKISVGGISA
                     GAYSTFFQLAYELYHPEDTQIIKQVLFFSNLVYVQPKRIDECQGQFDEIMDKLGLDSN
                     TPNEVKLATLRELDPEFIEDFIPTLKNHTFRAVTDGKFISSTLIQDLDSGEYTRRLLT
                     IKGNDFRILCGEVNNEPFIYSLLNTPQTLDDLPVQLGNYYPKNVVDSLLDLYKVEKLN
                     PESPTFKEDLRVAYGDIIGDGQVYASSRGYLAKLVEHGFPAQNVFRYRVSYRAKWLDS
                     HIKPEIRVPHAGDFSVWFYCLREGYTETERQTINRWLQPYLQFLNFKKIQDWDSADIK
                     KYRLFKEDGSFEYIDDIHWDWGVKVATTAYKAQLPA"
     gene            complement(<866409..>867986)
                     /gene="DAL5"
                     /locus_tag="KLMA_60414"
                     /db_xref="GeneID:34717629"
     mRNA            complement(<866409..>867986)
                     /gene="DAL5"
                     /locus_tag="KLMA_60414"
                     /product="allantoate permease"
                     /transcript_id="XM_022821088.1"
                     /db_xref="GeneID:34717629"
     CDS             complement(866409..867986)
                     /gene="DAL5"
                     /locus_tag="KLMA_60414"
                     /codon_start=1
                     /product="allantoate permease"
                     /protein_id="XP_022677486.1"
                     /db_xref="GeneID:34717629"
                     /translation="MVSSSVSLDAKDLTINKVESIEEASVTDAQLLSVISPSGKVVVI
                     DDVVDEAMEFAKHHEHITLTKEEDRAVKRKLDMIVMPLFSFLYMIQFMDKTCISFAAV
                     MGIQKDYHMVKDMYSWTTSCFYLGYLCASPLAAVLLQKLPSMRTSAACIVIWGVIQCL
                     HVTSKSYATFILLRTLLGVLEAFVSPIFVIMMNQYYKKSEHFGYIGVLYGCNGLGTVI
                     LALVSFGLYKHLHAYSMEAYKVLFLIVGCFTILNGLMILAIMPNTPAGAKFLSEREKL
                     VVLERIRGNNQGFGSKKFKFHQMKECFMDVRTWLYFFIGISVAIPNGGISSFGSIILK
                     GLGYSTSKSLLMKAPIGACELVGLVVLPFISIFVKKRMIVSEIYLLLCVMSSAMLAFA
                     KNKNAALAGYYITGIAPVGIITVTSCVASNTAGHTKKLTANAISLIGYSAGNIIGPQT
                     FRSSDAPNYPKAKAAIVGCYCAAIVLMAAMTWLNVRENNKRDRLQAELGDKYVEIENQ
                     EFADLTDFENPAFRYSI"
     gene            <869162..>870796
                     /locus_tag="KLMA_60415"
                     /db_xref="GeneID:34717630"
     mRNA            <869162..>870796
                     /locus_tag="KLMA_60415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821089.1"
                     /db_xref="GeneID:34717630"
     CDS             869162..870796
                     /locus_tag="KLMA_60415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677487.1"
                     /db_xref="GeneID:34717630"
                     /translation="MGQVISTEGATPHKVTIPGQGTLTGYTFSSSRTNNATTHRFAKV
                     PYAQPFTKETRFKKPVPLGDDYDYTGDYKEFGLKCPQPSVPNPAFRYTKSPSDENINY
                     LNIWVPASDKYKGKDGWPVLVYIHGGWLQYSSPSTEFFNTNEMFDDEEFDQKYILVTP
                     GYRLNMFGFLSCKELLEEDESSSNFGFWDQRLAIEWTYKYIKHFGGNPEKISVGGISA
                     GAYSTFFQLAYELYHPEDTQIIKQVLFFSNLVYVQPKRIDECQEQFDEIMEKLGLDSS
                     TPNEVKLATLRKLDPEFIEDFIPTLKNHTFRAVTDDKFISSTLIQDLDSGEYTRKLLA
                     IKGNGFRILCGEVDNEPVKYSLLNTPQTLDELPVQVGNYYPKNVVDSLLDLYKVEKLN
                     PESSTFKEDLRVAYGDIIGDGQVYASARGYLHKLVEHGFPAQNVFRYRVSFRAKWLDN
                     HIKPELRVPHAGDFSVWFYCLREGYTETERVAINKWLQPYLQFLNFKEVQNWDSDDIK
                     KYRLFKEDGSFEYIDDIHWDWGVKVATTAYKAQLPA"
     gene            <871178..>873205
                     /locus_tag="KLMA_60416"
                     /db_xref="GeneID:34717631"
     mRNA            <871178..>873205
                     /locus_tag="KLMA_60416"
                     /product="cd12148 family transcription factor"
                     /transcript_id="XM_022821090.1"
                     /db_xref="GeneID:34717631"
     CDS             871178..873205
                     /locus_tag="KLMA_60416"
                     /codon_start=1
                     /product="cd12148 family transcription factor"
                     /protein_id="XP_022677488.1"
                     /db_xref="GeneID:34717631"
                     /translation="MSNGRVSAAGSRGKQQIVRKRKPKSCIRCYSIKRKCDHQKPSCS
                     RCIKKGLPCEYFTEEHVLERCLERQKKGRVSNAGSTGSLTTPSGDDVSVNDENMPDTE
                     LNPIPRETESRNFKLIVNSTGEYSKYLSLSLFPFSDPSQNVSYIVDRMPRDADHYVVY
                     DFSYVPSRLSGKEEIKKLIPNKMHCDVLVSYYFANISPFIPIIDVEEFELKYNELWKN
                     VQAYDDLNMLMILFAVIFASCVSIQVSKIYFTGKHYSDDEVINYEELKYSCFQCVENI
                     KHMTNANISPSMSGITALTIMYYVGSLNCYGVSGEVSALLRYCQIAGLHRSLSQNTNS
                     SSVRAFLYSYVVHLDSLVAYYNGLTSYVNKDLFETVRNFPKHETKIETLFSLAKLYNG
                     LVWIDLLNQLNKIESSTEEDFQRLNREYLTSMEKVNSLNAEILTMFQDAPQDYLKLLV
                     AEGRLGIRKSALLVHFLRLSVSGSNINKVREGTSLNQDLVIQALLLINESLAKIYLGV
                     KHNPNLLWFVRNSYPFQAMSIVLTHIQKNPTKGINFSHLQRDVEYTTHPEINYDSFDI
                     RSDLILKTTEALRSIKPLWPTVFQRRFERICELKNYVFAQNPIQYSNSNQDNDNNKTN
                     NNQAQNEGQNQNQNQGNSPTGSLSFDELLSNLFDGDSELQSLFFQTFPNSH"
     gene            <876433..>878040
                     /gene="cyp524A1"
                     /locus_tag="KLMA_60417"
                     /db_xref="GeneID:34717632"
     mRNA            <876433..>878040
                     /gene="cyp524A1"
                     /locus_tag="KLMA_60417"
                     /product="cytochrome P450 61"
                     /transcript_id="XM_022821091.1"
                     /db_xref="GeneID:34717632"
     CDS             876433..878040
                     /gene="cyp524A1"
                     /locus_tag="KLMA_60417"
                     /codon_start=1
                     /product="cytochrome P450 61"
                     /protein_id="XP_022677489.1"
                     /db_xref="GeneID:34717632"
                     /translation="MESVVVSQASNVTETIAAASKDKIISMATVKHVLDVVQHMSYFK
                     LFCTLIAIVLVYDQVSYQIQKGNIAGPKWKMWPIIGPFLESLDPKFEEYMDKWNSGPL
                     SCVSIFHKFVVIASTRDLARKIFQSPQYVKPCVVDVAVKILRPSNWVFLDGKAHVDYR
                     KSLNGLFTKQALAQYIPSQELLMDKYIEKFVQLSKDNNYEATVFFGEMREIMCALSLK
                     AFCGSYITEDQIRKVADDYYLVTAALELVNFPIIIPFTKTWYGKRTADMTMKIFEQCA
                     QMAKDHIAAGGESVCVLDAWCKLMHDAKNKNDDDSKLYHREFSNREMSEAIFTFLFAS
                     QDASSSLACWIFQIIADRPDVMEKIREEQLRVRNNDPTVRLTMDLIDKMEYTNMVVKE
                     TLRYRPPVLMVPYYVKKNFPVAPTYSAPKGSMLIPTLYPALHDPEVYENPDDFIPERW
                     VEGSPANEAKKNWLVFGCGPHVCLGQTYVMQTFTGMIGKFAMYTNWEHKVTPLSEKIK
                     VFATIFPEDDLLLSFKKRDPLTGEIKS"
     gene            complement(<878358..>879788)
                     /gene="BUD22"
                     /locus_tag="KLMA_60418"
                     /db_xref="GeneID:34717633"
     mRNA            complement(<878358..>879788)
                     /gene="BUD22"
                     /locus_tag="KLMA_60418"
                     /product="bud site selection protein 22"
                     /transcript_id="XM_022821092.1"
                     /db_xref="GeneID:34717633"
     CDS             complement(878358..879788)
                     /gene="BUD22"
                     /locus_tag="KLMA_60418"
                     /codon_start=1
                     /product="bud site selection protein 22"
                     /protein_id="XP_022677490.1"
                     /db_xref="GeneID:34717633"
                     /translation="MGKENLIFKLDSLEYQLHYINQETDKFQPRFKQTLQFFNSKSKK
                     VNKKVNKLVENSDRDAILEEIKSIRLRILDQKIHHVLQRLHTHWIKNAIITKDPEVSK
                     IGIETFIKYVSYSKLIKLTVSLLGGIKGCPDWFHEHEFYRIANDKTNELNPSLIYNDV
                     FVKRKLNPLVSKLMNNKIVKEQLLTYENALHVLLNEKDKVKKTEDPASNNKQKSTNDN
                     SSSKETKQSKSGKEESASESEAESESESEPEEDLTDGREAPELDSETEELLAKEYDGL
                     LVGSDEESDDEVHLDPNVDYNQVTDEEPDYEDSNSEEEEDSDSEPSGPKAKKPKYELP
                     ELMHGYISGEEDEDIDDKVAKRQSSNVPAKKNRRGQRARQKIWEKKYGSQAKHVQRQL
                     EKERQEREKRQREYEERQAKREAKAAQNPQYQRIITPQHSSGSVDNQKKNNIVEKPIH
                     PSWEAKKIAEEKQKNVKFQGKKITFD"
     gene            <882135..>883718
                     /gene="SEC59"
                     /locus_tag="KLMA_60419"
                     /db_xref="GeneID:34717634"
     mRNA            <882135..>883718
                     /gene="SEC59"
                     /locus_tag="KLMA_60419"
                     /product="dolichol kinase"
                     /transcript_id="XM_022821093.1"
                     /db_xref="GeneID:34717634"
     CDS             882135..883718
                     /gene="SEC59"
                     /locus_tag="KLMA_60419"
                     /codon_start=1
                     /product="dolichol kinase"
                     /protein_id="XP_022677491.1"
                     /db_xref="GeneID:34717634"
                     /translation="MPTSTLSKGVPTDAANDSSELPEQFRPKVRVVNNKSRDAEISKP
                     TPMPAPFKVALALFDGFMEPDKFVQLVVLGLSSHLIYLKYGSEQSSIEQGPMMLSVVA
                     AYFVNVFLTASSSGIGEEALPPFNTIYLFYLQAALSILFAPEYILLNTVLAFSISDLT
                     LILKIPLQMVFLLLTNNESSFVEISAKALVLNYFFIYGLYRASELKSLDKMECHMFAI
                     LCTNIVLLFKSDSIHFQVMRVCFTSFVIIVVITTALRLVLKNLSLHQSARTIILLPII
                     IIGFPYFIQKNLAIDGIAPFTWLLDYIGSSETRMSIMKTWLGSALLLFPSVFTLKSNW
                     SLNTSRKVWHFAVLPLLIPAIVLDTNFVKIALAGTVNLFLIVEYIRFLHIFPIGDYLD
                     KHLRSFADFRDEKGPIIISYLYFIIGISLPFLLNGSVIGIVSLGVGDSLASIVGKKFG
                     KRYWPNMSKTLEGTTAFILSTVATTLSLKMYLNFFPDISSPNLVIVCFLAGILEGNST
                     LNDNLLVPTFMLIALEALK"
     gene            884105..884177
                     /locus_tag="KLMA_R613"
                     /db_xref="GeneID:34718772"
     tRNA            884105..884177
                     /locus_tag="KLMA_R613"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718772"
     gene            complement(<884610..>886091)
                     /gene="LPD1"
                     /locus_tag="KLMA_60420"
                     /db_xref="GeneID:34717635"
     mRNA            complement(<884610..>886091)
                     /gene="LPD1"
                     /locus_tag="KLMA_60420"
                     /product="dihydrolipoyl dehydrogenase"
                     /transcript_id="XM_022821094.1"
                     /db_xref="GeneID:34717635"
     CDS             complement(884610..886091)
                     /gene="LPD1"
                     /locus_tag="KLMA_60420"
                     /codon_start=1
                     /product="dihydrolipoyl dehydrogenase"
                     /protein_id="XP_022677492.1"
                     /db_xref="GeneID:34717635"
                     /translation="MLRIGSTRSFSSSALLKTVTKKHDLVVIGGGPGGYVAAIKAAQL
                     GYDVACVEKRGRLGGTCLNVGCIPSKALLNNSHLYHQMKTDAKARGIDVNGDISVNVA
                     QFQKAKDTVVKQLTGGIEMLFKKNGVTYYKGLGAFENEKAIKVLPVEGLEGSVTEDHL
                     LETEKIIVATGSEVTPFPGITIDEERIVSSTGALSLKEIPKRLAIIGGGIIGLEMGSV
                     YSRLGSKVTVIEFQPQIGASMDGEVAKTTQKILKKQGLDFKLSTKVMSATRNGDVVDI
                     EVEGAKDGKKESLQADVLLVAVGRRPYIAGLDAEKIGLEVDKRGRLVIDEQFSTKYPH
                     IKVIGDVTFGPMLAHKAEEEGIAAAEYFKLGHGHVNYGNIPSVMYSHPEVAWVGKTEE
                     QLKEAGIQYKVGKFPFIANSRAKTNMDTEGFVKILIDAESERLLGAHIIGPNAGEMIA
                     EAGLALEYGASAEDIARVCHAHPTLSEAFKEANLDAYSKPINF"
     gene            <887308..>887604
                     /locus_tag="KLMA_60421"
                     /db_xref="GeneID:34717636"
     mRNA            <887308..>887604
                     /locus_tag="KLMA_60421"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022821096.1"
                     /db_xref="GeneID:34717636"
     CDS             887308..887604
                     /locus_tag="KLMA_60421"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022677493.1"
                     /db_xref="GeneID:34717636"
                     /translation="MKVALILALASTALATSLSSFMITYPDEFPYYDKLVQTVHDLQG
                     TITHEYTLFNGFSVDLPQDTVNTLKSLNDKYKWGLEIEEDQEVHALGGQQPHLL"
     gene            complement(<887889..>888278)
                     /gene="GIM3"
                     /locus_tag="KLMA_60422"
                     /db_xref="GeneID:34717637"
     mRNA            complement(<887889..>888278)
                     /gene="GIM3"
                     /locus_tag="KLMA_60422"
                     /product="prefoldin subunit 4"
                     /transcript_id="XM_022821097.1"
                     /db_xref="GeneID:34717637"
     CDS             complement(887889..888278)
                     /gene="GIM3"
                     /locus_tag="KLMA_60422"
                     /codon_start=1
                     /product="prefoldin subunit 4"
                     /protein_id="XP_022677494.1"
                     /db_xref="GeneID:34717637"
                     /translation="MELLPEGQKNSVTVAYEDQQRINEFSKLIMRKDAIDQELTQQRT
                     EKEYLDDVSLEIELIDEDEKVQYKVGDVFVYLKQKEVVDKLTKDASRIDEAIEKLEND
                     EAELSSRIKDLKSILYAKFGDNINLER"
     gene            complement(<888629..>890221)
                     /gene="ARO9"
                     /locus_tag="KLMA_60423"
                     /db_xref="GeneID:34717638"
     mRNA            complement(<888629..>890221)
                     /gene="ARO9"
                     /locus_tag="KLMA_60423"
                     /product="aromatic amino acid aminotransferase 2"
                     /transcript_id="XM_022821098.1"
                     /db_xref="GeneID:34717638"
     CDS             complement(888629..890221)
                     /gene="ARO9"
                     /locus_tag="KLMA_60423"
                     /codon_start=1
                     /product="aromatic amino acid aminotransferase 2"
                     /protein_id="XP_022677495.1"
                     /db_xref="GeneID:34717638"
                     /translation="MVVKIDDKTLEEHYSKFLNRQTDRRVLLQFWDDFLPEGVKPHPK
                     PCILAAGMPNEGLFPIESVHLNVVDRPFQHNDYPFKSGKLHRNGDDGEGTFDEKEYVK
                     SKVDEGTMVDIWRYEPSNPENIPIARALQYGDTKGLPQILKFTKELVTYLNKPAYDNW
                     DIMMANGSSDSLSKVFTILSDEDVTVLMEEFTFTPTISNVTSCGGIPIPLKCDITDDP
                     KEQGINVAYMTELLDNWTTGPYSHLSKPKLLYTIPTGQNPTGMTQCVEKRKQIYALCE
                     KHDIIIVEDDPYGYLTFLPYDQTNPMKNLYTDGTITYDKYCKEILTPSYLTIDTSGRV
                     IRLETFSKVFAPGIRLSFIVANSFILDKISKYADISVRGACGISQAMTANIIEKWSHA
                     FEGDHVKAWLSWVMKIAGEYTRRRNVLFQALESTPAFKDGLFDLVEPSAGMFVSVVVN
                     IDKLNVTDRLKAMDAVNYTLIEEGCIVILGYRMAVDRKFSYDRSNFLRITFAMAPDDE
                     HLQTAAERLGKGIERFFKEYKN"
     gene            <895970..>897604
                     /gene="RAG8"
                     /locus_tag="KLMA_60424"
                     /db_xref="GeneID:34717639"
     mRNA            <895970..>897604
                     /gene="RAG8"
                     /locus_tag="KLMA_60424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821099.1"
                     /db_xref="GeneID:34717639"
     CDS             895970..897604
                     /gene="RAG8"
                     /locus_tag="KLMA_60424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677496.1"
                     /db_xref="GeneID:34717639"
                     /translation="MSQQHPSAAAAAAATTVLAVNNLTNTKMNNHHSSTQVLHGSTQH
                     GIPSAGGNNLINGGAGNGATGLQSSASSTSTRDDSTIVGLHYRIGKKIGEGSFGVLFE
                     GINMINNVPVAIKFEPRKTDAPQLKDEYRTYKILNGSEGIPQAYYFGQEGLHNILVID
                     LLGPSLEDLFDWCGRRFSIKTVVQVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQ
                     PDANMVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDME
                     ALGHVFFYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLSQGLPVQFGRYLEIV
                     RNLAFEETPDYEGYRKLLLSVLDELGQKCDGDYDWMKLNGGRGWDLAINKKPNLHGYG
                     HPTPPNDKSKRHRNKFNQVPAAVNNMNGSNVPLQSQSPLPGGTDLTQGANNAPQQPQQ
                     IMTQQQYQQHTQQRLDPTSYEAYKQQVQQRYAQQPQSSQQKAQRLPNTTSQQQFSQSR
                     QQQPQYQFQQNQPQNNQNQATSSGSEKGFFSKLGCC"
     gene            complement(<898707..>899786)
                     /gene="GRE2"
                     /locus_tag="KLMA_60425"
                     /db_xref="GeneID:34717640"
     mRNA            complement(<898707..>899786)
                     /gene="GRE2"
                     /locus_tag="KLMA_60425"
                     /product="NADPH-dependent methylglyoxal reductase GRE2"
                     /transcript_id="XM_022821100.1"
                     /db_xref="GeneID:34717640"
     CDS             complement(898707..899786)
                     /gene="GRE2"
                     /locus_tag="KLMA_60425"
                     /codon_start=1
                     /product="NADPH-dependent methylglyoxal reductase GRE2"
                     /protein_id="XP_022677497.1"
                     /db_xref="GeneID:34717640"
                     /translation="MSDKVLLTGSSGFIALHILDQLLSAGYEVVGTVRSESKAEPIKK
                     ELARDHPNAKYTFEIVPDISAPNAFDHVFQKHTDLKYVLHTASPFSFGLDKTNEENYL
                     IPATHGTKSALEGVQKYGKNVEHVVITSSFAAIVHREKGGDPTFIHTEKTWNPVTWEQ
                     AREDAITSYVASKKLAEELAWNFVKEHNSTFKLTTVNPPYVFGPQRYSFGLARASLNT
                     SADFVNKALKTTPDFEGPFDQPSGLSCDVRDVAKLHILPLGKPEFNGQRLFPVSGTGY
                     GLDNYEDGKFNFERILRTLNEKIPELKGKISPGGIKDNSVEMAKNTYYNNSITTNLTK
                     LKFYTFDQTVVDAAKQILDFEASQK"
     gene            complement(<904944..>906113)
                     /locus_tag="KLMA_60426"
                     /db_xref="GeneID:34717641"
     mRNA            complement(<904944..>906113)
                     /locus_tag="KLMA_60426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821101.1"
                     /db_xref="GeneID:34717641"
     CDS             complement(904944..906113)
                     /locus_tag="KLMA_60426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677498.1"
                     /db_xref="GeneID:34717641"
                     /translation="MKLFKQRQVSQQPHLISLTAIMVLIQLFAWISAIWIVLVASLES
                     NTVIHLGQQLAADVGKLGNSDVEISQDSYEKMLYFSKICALTYCISTGQLEANKTFLD
                     GGCPEELDFCSNVEENPSINRTRVELVLVAEKEELGTGFVAVDHEREVVMLAFRGSST
                     RQDWFSDFEIYPTEYRPVSEKHYDKLVESGKIEICENCMIHKGFNRFIETLSKDFLNR
                     VERIFKRYPGYKMVVTGHSLGAALASICGIELKLRGFNPLILTYATPKMFNDEMRDWV
                     DSLFKTKKIHDKSVKNGELDMFHGYFRVIHLQDYIPMVPPGYKAAGLEIFISKPELPH
                     EKEDLEYRAIGSGATWNQLPTNELTRSALRNGMSNLFHMDEHRKYFIMINNCSGF"
     gene            complement(<908798..>909997)
                     /gene="ADO1"
                     /locus_tag="KLMA_60427"
                     /db_xref="GeneID:34717642"
     mRNA            complement(<908798..>909997)
                     /gene="ADO1"
                     /locus_tag="KLMA_60427"
                     /product="adenosine kinase"
                     /transcript_id="XM_022821102.1"
                     /db_xref="GeneID:34717642"
     CDS             complement(908798..909997)
                     /gene="ADO1"
                     /locus_tag="KLMA_60427"
                     /codon_start=1
                     /product="adenosine kinase"
                     /protein_id="XP_022677499.1"
                     /db_xref="GeneID:34717642"
                     /translation="MCKRSGIRKENEYKKKVKDEMNEKTNCLQRRFIGGSSNSIRSAY
                     DISPAKQQSILKKNMTQHPKVICLGNPLLDIQIDVQPSYLEKYNLKSNDAILVEQSSN
                     KSILNIFDEIVEMEGVKFVAGGAAQNTARGVAYVLGPGQVGYFGSVGEDKFSARLLKE
                     NEAAGVASFYQVQKDISTGKCAALITGHDRSLVTDLAAANHFTPDHLDKHWDLVEAAS
                     LFYIGGFHLTVSPEAIVKLGKHAQEKGKPFILNLSAPFIPAFFKAALEQVLPYTTYVI
                     GNESEAASYAESFGLDCDKEDLEAIAKHIVGDSKTRTVIITHGLKPTVVVSAEGSKTF
                     DVVPLDSSKIKDTNGAGDAFAGGFVAALAEGKSLEFAIAQGQWLASLSIQEVGPSYPT
                     ERKQFNL"
     gene            <910730..>911581
                     /gene="TDA4"
                     /locus_tag="KLMA_60428"
                     /db_xref="GeneID:34717643"
     mRNA            <910730..>911581
                     /gene="TDA4"
                     /locus_tag="KLMA_60428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821103.1"
                     /db_xref="GeneID:34717643"
     CDS             910730..911581
                     /gene="TDA4"
                     /locus_tag="KLMA_60428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677500.1"
                     /db_xref="GeneID:34717643"
                     /translation="MLEKLAGYFNQEELADPFLKWSLDPTAENLYYRHGHEIVASFLM
                     YQFVLYPLVAPFLNRVIFGKHYTEKDEADKVNFDIHTVSMIQSIVSCYLIWPLLWIPF
                     GYNVITYYNSYASMVSSVSIGYFLWDLYVCLKYYRLFGIGFLFHAVAALSVIGITLRP
                     VCQAWVGRFLSFEASTPFVNINWYIIQVSRGSTKPVVPTWLNVLNGLLLISVFFFVRL
                     VWGFIAISILTYEMYQIWDQIPLYISAIILGINISLDFLNIHWFSKMIKIAKKMANGS
                     KRVSKID"
     gene            <912021..>913388
                     /gene="STE24"
                     /locus_tag="KLMA_60429"
                     /db_xref="GeneID:34717644"
     mRNA            <912021..>913388
                     /gene="STE24"
                     /locus_tag="KLMA_60429"
                     /product="CAAX prenyl protease 1"
                     /transcript_id="XM_022821104.1"
                     /db_xref="GeneID:34717644"
     CDS             912021..913388
                     /gene="STE24"
                     /locus_tag="KLMA_60429"
                     /codon_start=1
                     /product="CAAX prenyl protease 1"
                     /protein_id="XP_022677501.1"
                     /db_xref="GeneID:34717644"
                     /translation="MGFVDVLQGAFDKPSIPWKTIITGFTVAQFAFETYLTYRQYVAL
                     SKKTLPPVLEGEIDDETFQKSEAYARAKSKFSIVSNISSLVQNLIFIKFDVLPTLWNL
                     GNVLASYLPSKLIATSTIAQSLYFLNVLTALSTFTSLPLSYYQHFVLEEKFGFNKLTI
                     KLWITDMIKSNLLGLLIGTPVLYLFLKIFEVFPSNFLWYICLFVLVVQILALTIIPVL
                     IMPLFNKFTPLDDGELKTAIEQLAKKVGFPLDKIFVVDGSKRSSHSNAYFTGLPFTSK
                     RIVLYDTLVNDSTTDEIVAVLAHEIGHWQKSHLLRMLAFSETHIFLVFSLFTAAYQNN
                     SLYNAFHFFVGSSTSTDFSKVITPQFPVIIGFLLFNDLLQPLDCLSTFLTNLVSRAHE
                     YQSDAYAKELGYANHLARALINLQIKNLSTMNVDPLYSSYHYSHPTLAERLIAIEYKN
                     EKKAQ"
     gene            <913828..>915351
                     /gene="RPN3"
                     /locus_tag="KLMA_60430"
                     /db_xref="GeneID:34717645"
     mRNA            <913828..>915351
                     /gene="RPN3"
                     /locus_tag="KLMA_60430"
                     /product="26S proteasome regulatory subunit RPN3"
                     /transcript_id="XM_022821105.1"
                     /db_xref="GeneID:34717645"
     CDS             913828..915351
                     /gene="RPN3"
                     /locus_tag="KLMA_60430"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN3"
                     /protein_id="XP_022677502.1"
                     /db_xref="GeneID:34717645"
                     /translation="MSDDAMDVDVSPNVADEKKTNEDIVDKLLEVLKQVSKSTLSMDS
                     RYVWKSLKDLSAFRHELNVENVSILVNLLYPDESPYKKYLLKTIHPTSKPKVEDAVSF
                     RDRYPASLYQLQQDGTSLDVSSEVNTFVHYILQLLLLDSQRVDELQHFNTEYVVPKIL
                     KHYNNRNLDLVNAKIWFYINRANELTSSPEDAALLFEMMQYMKTATLKHDNETKATLI
                     TSILRHYLRLGEIELAADFVTKIEFPSGDNVSSPLEARYYFYLSKIHAIQLDYSQSHE
                     YVISALRKAPHTKNSLGFLQQANKLQCCIQLLMGDIPELTFFHQRGLEKSLLPYYHIT
                     KAVKLGDLNLFTQSLSKYKNQLTKDANYQLCVRLRSNVIKTGIRMISLTYKKISLKDI
                     CLKLHLDSEQTVEYMVSRAIRDGVIEAKINHEEGYIETSELLNVYSTKQPQQVFDERI
                     RFVNHLHSDYVTGMRFPDSRDKKGKDADQLTTESLETSLDLDSMNLSDFDSDLDDIL"
     gene            <915733..>917742
                     /gene="SRB4"
                     /locus_tag="KLMA_60431"
                     /db_xref="GeneID:34717646"
     mRNA            <915733..>917742
                     /gene="SRB4"
                     /locus_tag="KLMA_60431"
                     /product="mediator of RNA polymerase II transcription
                     subunit 17"
                     /transcript_id="XM_022821107.1"
                     /db_xref="GeneID:34717646"
     CDS             915733..917742
                     /gene="SRB4"
                     /locus_tag="KLMA_60431"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 17"
                     /protein_id="XP_022677503.1"
                     /db_xref="GeneID:34717646"
                     /translation="MTLQMNGISEYDPEKGIPLAIDPNLIDIPSITAPLGANGIVHDD
                     TASKDSDSTSVEDQTSKKSQRSLIQNPYELFGQMSLEQFIPLMLKQRGPGTKFADIHE
                     DVLQQEIEQEQNQGQMSSEDKSVQLGEVTVDGLEQNTSGMEQEQNVKKKDGDGDIEMT
                     DSVTHPEKPEVSNEIPDEHLNTIPNSDETISHEEFINIKKSVLEHVTMALNESSLSLE
                     FISLLLSSTRTSAGISSMSPYLKKIAPPASLNADKVPLEMLNEHDKLIYDITQKGWNL
                     RSLEDCKRLLKQHYQILLKSVDSESTYWNQISDNISNKDVLFKMKDRNTGRRTLGIKY
                     GFDDSGSSYTADKGIALLRATSEGSELELVPVLDSEANMGITKSSPEQFVRVRIFTKI
                     EQEDDYLLSGQSSLNEILLNNNKDIKSQIARLRFFIFEKELMHHLKVEAGQLLPYGVS
                     VENENKVVLELPNEKIEFELVNLDEEVISNYQQEAAKINNKRANLILVMLNMLQVVMY
                     KKQLWKRMNPSPNASKGHITYGKDLVLLRAILGKIRHKRYKQLIEKIIHNTILNKKEG
                     LMMTVKEDIISNDNEFSKNKELATLQREIALFDKVLSMPRTDFTITIPEKGKVDLSLR
                     STNHCNAVVFMKYVNEEEVVKFDTKFSEFTEFEEFMNFVYNEFFI"
     gene            complement(<917808..>918326)
                     /gene="ILM1"
                     /locus_tag="KLMA_60432"
                     /db_xref="GeneID:34717647"
     mRNA            complement(<917808..>918326)
                     /gene="ILM1"
                     /locus_tag="KLMA_60432"
                     /product="protein ILM1"
                     /transcript_id="XM_022821108.1"
                     /db_xref="GeneID:34717647"
     CDS             complement(917808..918326)
                     /gene="ILM1"
                     /locus_tag="KLMA_60432"
                     /codon_start=1
                     /product="protein ILM1"
                     /protein_id="XP_022677504.1"
                     /db_xref="GeneID:34717647"
                     /translation="MGLLSSVNVTYFRIVFLFGLAYLSVANVDAILSNNLLMVLTQAM
                     DLPALQISPYSAQLGLISLLFALSAIHDLIPLLENNKKHFQSVVPFRLMIFFIMSSLS
                     ILLTNNLYLHNNVMFVYGFCEIWMNFLIFVALRDERNNDFAKENNFYRPIESDDEDPF
                     PSTEREIQEMED"
     gene            complement(<918699..>921179)
                     /gene="JHD2"
                     /locus_tag="KLMA_60433"
                     /db_xref="GeneID:34717648"
     mRNA            complement(<918699..>921179)
                     /gene="JHD2"
                     /locus_tag="KLMA_60433"
                     /product="histone demethylase JHD2"
                     /transcript_id="XM_022821109.1"
                     /db_xref="GeneID:34717648"
     CDS             complement(918699..921179)
                     /gene="JHD2"
                     /locus_tag="KLMA_60433"
                     /codon_start=1
                     /product="histone demethylase JHD2"
                     /protein_id="XP_022677505.1"
                     /db_xref="GeneID:34717648"
                     /translation="MQEIPTLRPSEEEFKDPIAYLSSPTVKKLGIKYGMVKMIPPAGF
                     KPHFGIDEEHFTFKCRLQTLMELDIENRSRLLFWKQLNNLKRSRGDSKLLASAEVSIK
                     GQSEPLYYYDIYKTVVRYFQTSATGGYPNHEQEDNSDGYRKSNNRSRSRRKRQRNGTP
                     FADEGQGSFFPLVNPRDMMKDQKAWDAIAKQLAPSNPLELKRVFTAHILPYYRFLYNQ
                     ILAKGEANNTHISRLLYRYDYPKSLLEEENSTERSEDENEEVLPGEELDYLDSDTDVQ
                     EEEDADDDDDDEDDKCPICSRMVSKSSSHKTCNSCESKFHNKCVDHINNSNVKPSSVK
                     EWICNTCIIGNGYYGFKEPSSLFTLKSFKEYCSQFDEKLFDGNKPTDIQSLEKMFWKH
                     VESMDSNPLTVRYGADIHNNKPGQTSGFPTTEYVPSSIKNEESEEYKNYLEISAHPWN
                     LMNLPRAKGSLLSIINRKISGMTIPWIYVGSTFSTFCWHLEDQYTLSANYQHAGSQKV
                     WYSIPERDTATFDEMMKSISPDLFERQPDLLHQLITLISPYSKRFTDSGISCYKAIQN
                     PGEYIITFPKCYHAGFNCGFNFNEAVNFTLDLWLPYGQESINDYKLAKRTAVVNIFDL
                     MSNVLNAYLRSPESFDASFVSTCAVELKEWFNREFKNMAKVKDIVGETLFSDGCKETY
                     INSRLDSSHKEIKSEKVSDFKLADNDDEEDDLDVFCSKCKTICPIGFVAHSKTKRLRS
                     KRRNLTAMTPNEWNQLSAEGVIDIYCLEDYLSYVTEIDEQEESEDDSENQTSNDHFQN
                     DILFYFREDDEIRKLIIQVERALEKRLR"
     gene            <922239..>923099
                     /gene="PRO3"
                     /locus_tag="KLMA_60434"
                     /db_xref="GeneID:34717649"
     mRNA            <922239..>923099
                     /gene="PRO3"
                     /locus_tag="KLMA_60434"
                     /product="pyrroline-5-carboxylate reductase"
                     /transcript_id="XM_022821110.1"
                     /db_xref="GeneID:34717649"
     CDS             922239..923099
                     /gene="PRO3"
                     /locus_tag="KLMA_60434"
                     /codon_start=1
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="XP_022677506.1"
                     /db_xref="GeneID:34717649"
                     /translation="MGYTLAIVGCGVMGQALLSAIYNAPKAEESLAEHYPSKIIACNE
                     SALSSSSVEKLVKGFGKSPNAIEVEIFTARNVEAVKQSSVVILAVKPYLAEKVMEEIK
                     PEGTGPVLISLAAGVTLSQLTAYFPNSVRVMTNTPAKFGYGTAVVSYAEAVSESNKTR
                     VKELVRHVGTCLELPEKNMDAATALVGSGPAFALLIIESMMEAGLKMGIPLKESRECA
                     IKVLEGTAKMVEITGESPGALKHQVCTPGGTTIAGLCVMEDKGVKSGIIRGIEEAARV
                     ATELGQGKKK"
     gene            <924043..>925560
                     /gene="ATP2"
                     /locus_tag="KLMA_60435"
                     /db_xref="GeneID:34717650"
     mRNA            <924043..>925560
                     /gene="ATP2"
                     /locus_tag="KLMA_60435"
                     /product="ATP synthase subunit beta"
                     /transcript_id="XM_022821111.1"
                     /db_xref="GeneID:34717650"
     CDS             924043..925560
                     /gene="ATP2"
                     /locus_tag="KLMA_60435"
                     /codon_start=1
                     /product="ATP synthase subunit beta"
                     /protein_id="XP_022677507.1"
                     /db_xref="GeneID:34717650"
                     /translation="MVLPRLYAASSRAAFQAARRAVPFTGVRGYAAAAASEGKVRAVI
                     GAIVDVQFEQGQLPEILNALEIETPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEK
                     VLDTGAPISVPVGRETLGRIINVIGEPIDERGPIKSKMRKPIHADPPSFVEQSTAAEV
                     LETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERT
                     REGNDLYREMKETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQ
                     DVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSV
                     QAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQ
                     EHYDVATQVQQTLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEV
                     FTGIPGRLVRLKDTIASFKAVLEGKYDHLPENAFYMVGGIEDVVAKAEKLAAEAN"
     gene            <926512..>927876
                     /gene="CAF17"
                     /locus_tag="KLMA_60437"
                     /db_xref="GeneID:34717651"
     mRNA            <926512..>927876
                     /gene="CAF17"
                     /locus_tag="KLMA_60437"
                     /product="putative transferase CAF17"
                     /transcript_id="XM_022821112.1"
                     /db_xref="GeneID:34717651"
     CDS             926512..927876
                     /gene="CAF17"
                     /locus_tag="KLMA_60437"
                     /codon_start=1
                     /product="putative transferase CAF17"
                     /protein_id="XP_022677508.1"
                     /db_xref="GeneID:34717651"
                     /translation="MQCIRRYFSSLNPNQLFRFESCQLKNKSYIKLIGPDSVKFLNGL
                     ITSKLQPNFVKKNLTTLSLDEPQRDEEISSLDFSKYNWGIYKECSSMKNHISRFGTYT
                     GFLNMKGKLLTDSIIYPYPFTIGSIKDKKFPEYILEFDSHIASRMEKSLINHKLLSKV
                     KIKPLSSEQLKTWDTFIIMPEEYELLDNLLNPMMEMKDGEQALSFAKFFSSMFFQGNE
                     DKIKAVYFDTRLINELYEGRLKPMFRIVTDSSVDDINDIFNCTAFENISFAKLKVNPE
                     EIQRDRFKFGLLDGCHEYIPESLLPLEVNFDYFEDTINSDKGCYVGQELTARTFATGV
                     LKKRTVGIELKEHEKLANWDRSKYLNIFSKLELEASKQESDAAPNPFGSSNKPIKKRT
                     RPAGQLINISGDIGLAVFRKEYIYHALQHNHDIDAYIELPNNESVPCSIKLEWLDRFR
                     ESED"
     gene            <928852..>929535
                     /gene="RPS5"
                     /locus_tag="KLMA_60438"
                     /db_xref="GeneID:34717652"
     mRNA            <928852..>929535
                     /gene="RPS5"
                     /locus_tag="KLMA_60438"
                     /product="40S ribosomal protein S5"
                     /transcript_id="XM_022821113.1"
                     /db_xref="GeneID:34717652"
     CDS             928852..929535
                     /gene="RPS5"
                     /locus_tag="KLMA_60438"
                     /codon_start=1
                     /product="40S ribosomal protein S5"
                     /protein_id="XP_022677509.1"
                     /db_xref="GeneID:34717652"
                     /translation="MSEHEAAVEVEVQEDFEVVQEFVPVELATAIPEDIQQAQTEIKL
                     FNKWSFEDVEVKDPSLVDYIQITKPIYVAHTAGRYANKRFRKAQCPIVERLTNSLMMN
                     GRNNGKKLKAVRIIKHTMEIINVLTDQNPLQVIVDAIINSGPREDTTRVGGGGAARRQ
                     AVDVSPLRRVNQAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDE
                     LERVAKSNR"
     gene            <930987..>933569
                     /gene="YAT2"
                     /locus_tag="KLMA_60439"
                     /db_xref="GeneID:34717653"
     mRNA            <930987..>933569
                     /gene="YAT2"
                     /locus_tag="KLMA_60439"
                     /product="carnitine O-acetyltransferase YAT2"
                     /transcript_id="XM_022821114.1"
                     /db_xref="GeneID:34717653"
     CDS             930987..933569
                     /gene="YAT2"
                     /locus_tag="KLMA_60439"
                     /codon_start=1
                     /product="carnitine O-acetyltransferase YAT2"
                     /protein_id="XP_022677510.1"
                     /db_xref="GeneID:34717653"
                     /translation="MTSTFINEKDLPKLPLPDLHQSLVEMEESLKPLYYADGYYKHPL
                     HPEESNELHENIKTFMSSKAAAKLQDKLAIFDRFNGCYLDRLHLDINNHTSTKEIQDD
                     VLPRNPFLVLAEDADTSISQAARCGVLCSSALRFVSAFRQNVLPPDYGKNGKPMSMLP
                     YVNLFGTTRCPVFEHGEVESFDLNKPYDESDLEAELNNLSAQRRPSTASSEASASDDE
                     VEFFNVHGITKKQYPDSKHILIISRGQYYTLDVLDEKNDVLFTDSQLSQAFQHIIDDS
                     TTSRGLKRATALGSLTSYSFKNWKYARKRLQKRYPQELNTIDSALFVVVLDESTSTSD
                     INEDCKRLYYGTSVIDDVTGFQVGSCTSRWYDKLQLIVTADSKAAVIWDSFTCDGSVV
                     LRFTSDIYAESILRLAREVHGGDPHFSLWPQIPKASSKDPWPKKLSKISWSFSHILNT
                     HVHLSETKLTDLISKHDIVHTSIPFGYRTAQKLGVRADSLIQVALQIAHYALYGKMIF
                     SFEPISTRFFKNSRSAFIPIQTQELLELCQLFISNSLNEKGKLEKFISACNDHSEKIR
                     QAQNGLGFEKHFNAIKYLFKFHEHFDIGLSEEELETASKVFNNPMMEPFSAPELIASN
                     CGNSAMSAFGVTPAVPQGFGIGYIIKSDQCDITLTSQYRQGRRLAFMLKWVLTEINNY
                     WELNSTNSVRISPKVDQLYEIDNAINQLKLNVAQHKVDNTKAPGQTADRPNLGGYHQS
                     STSSIFNGGHGFLELKGHLESRTSSRPISRSGSNLKLSSMSLSNASQPTLTNELEDTA
                     TSRIRIASELEKQNAGYEILVIDASNATKETPKTNKKKNVVSSKFEINFDRSIVGRKV
                     NTRG"
     gene            complement(<933805..>935157)
                     /locus_tag="KLMA_60440"
                     /db_xref="GeneID:34717654"
     mRNA            complement(<933805..>935157)
                     /locus_tag="KLMA_60440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821115.1"
                     /db_xref="GeneID:34717654"
     CDS             complement(933805..935157)
                     /locus_tag="KLMA_60440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677511.1"
                     /db_xref="GeneID:34717654"
                     /translation="MHVGKVWSEAPRDVKLLWWAVLLRMMAYGMTNQILTLYFNEIGI
                     TDEQMGLFMSLTLVGDVCISYVLTWYADSWGRRLVLTYGSAMMGLSGVVFAVSENIYV
                     LLVFAIIGVISPSSEEVGPFKSIEESMIAHLTPHNKRPEVYSMHSMLGTFGSAVGSLF
                     CGVIIDILISFKVFETKRACYKAIFGIYAIIALIKLFISISLSAESELDGDFDDQCES
                     AEATTETSTETQIEDAEVQAEDTPLVIKSLRKDRLSKKTVSLMFRLLLIFMTDSLGSG
                     FMTSSWMVYYYKKVFDMSNTSLGLLFFSSKYVMAASAIPSAIIARLYGPVKATLLVQV
                     PSGIFSILVPFADAHVWLSVLLLMLFFFTTAMDVTPRQIILTNTIPAKDLTKVMGMVN
                     IGKTFSRCIGPFFTGKLANDGYLWVCYIISGSLVILADIFLAILFGDIDEQILAKTNS
                     "
     gene            <935732..>938536
                     /gene="LEU3"
                     /locus_tag="KLMA_60441"
                     /db_xref="GeneID:34717655"
     mRNA            <935732..>938536
                     /gene="LEU3"
                     /locus_tag="KLMA_60441"
                     /product="regulatory protein LEU3"
                     /transcript_id="XM_022821116.1"
                     /db_xref="GeneID:34717655"
     CDS             935732..938536
                     /gene="LEU3"
                     /locus_tag="KLMA_60441"
                     /codon_start=1
                     /product="regulatory protein LEU3"
                     /protein_id="XP_022677512.1"
                     /db_xref="GeneID:34717655"
                     /translation="MTDRGFDKAEFVKSVESEDFSRNTSSASTPGSIRSTSKKRPMQK
                     KKLACVECRQQKSKCDAHERAPEPCTRCLKKGVPCVLQKDFRRTCKRARNEVIAKKFQ
                     ELTQSLSSLGSEELLKKLDADSLNIPKSLGVTGDMNSNGSGQWTEKLSSNSNSNPDIN
                     IDISKNDDALKTLRSVLSTKDVVSMVTSSGSLDTGAKLDGAINLSREQLECQPKSLGD
                     VTLSSADIADLFNEFNTKYHPFLPVVDVTKGPEKIYSLSPCLFWVIILVGLRRKFEAI
                     ETMNKLSNMVKSILAEITISPIIRYSPSETDEPVLNVSSVYSVQAFLIYTYWPPLTSS
                     LSADTSWNTIGSAMFQALRVGLNSAQFSTEYATANSQLIHEQIRTWICCNIVSQTISA
                     SFGFPAYVAFDHTVISTCKISTAGNDKNDFVPFTIKQMLQIAHFENQVVDTMNSNPRN
                     MNGLASDEERLPLLHVLNRQLKELELQLDNVKLDDIRRFLLLVTKVHLLTYYFTEAKE
                     TDIGANKQKISVKDMETSFATKRGLVIAYNSAVQLLQHAKDMWKRDPLIVKYLPGVYI
                     LNIWQSASIISKLVHSSLGSIIDVNTGKEVYQDAVSLISNASVLKYDMAYRSAGIMRS
                     IWSMFNNMFEEWKSKEHQSGGVSKGEKDFNLTITIKSRMSVSVFFDCLYILRQKCGMA
                     KLKREKERAISSDEENHNELSNGDASTKELLTEDKNPEENARKIISTIPLDPEPINAQ
                     QSSGSSITSPSGSHTGDVLSLKSILNKNSPRDDLMARNKHSALKGSSSVTPTTTIIKS
                     PSVTPVGAQNIEQQNAISYPNSLDMLSGINDNRLAKNIANKKQASSPRVKAPSPLSQN
                     YKNNENPTSTTQTFNELLEQPIPYTSSRDSNPVQAENRKEQSQSMSPSLTERWDNWES
                     DLVWKDVDILMNEFAFNPTL"
     gene            <938977..>940551
                     /gene="GCD11"
                     /locus_tag="KLMA_60442"
                     /db_xref="GeneID:34717656"
     mRNA            <938977..>940551
                     /gene="GCD11"
                     /locus_tag="KLMA_60442"
                     /product="eukaryotic translation initiation factor 2
                     subunit gamma"
                     /transcript_id="XM_022821118.1"
                     /db_xref="GeneID:34717656"
     CDS             938977..940551
                     /gene="GCD11"
                     /locus_tag="KLMA_60442"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 2
                     subunit gamma"
                     /protein_id="XP_022677513.1"
                     /db_xref="GeneID:34717656"
                     /translation="MSDLQSQEPSIVINGDIQEEPMDNYEQEFGNEGEDQITDEVKPK
                     KTVTFSGVDDAEAEEERRKKEFEEGGGLPEQPTNPDFSKLNPLSPEIINRQATINIGT
                     IGHVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKLDDPNCPEPDCYKS
                     FRSDKEVEPKCDLPGYSGRYKLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGN
                     ESCPQPQTSEHLAAIEIMKLKHVIILQNKVDLMREDSALEHQKSILKFIRGTIADGAP
                     IVPISAQLKYNIDAVNEFIVKSIPVPQRDFLASPRLIVIRSFDVNKPGAEIDDLKGGV
                     AGGSILTGVFKLGDEIEIRPGIVTKDDQGKIQCKPIFSNIVSLFAEHNDLKFAVPGGL
                     IGVGTKVDPTLCRADRLVGQVVGAKGHLPSIYADIEINYFLLRRLLGVKTDGQKQAKV
                     RKLEPNEVLMVNIGSTATGARVIAVKADMARLQLTSPACTEVNEKIALSRRIEKHWRL
                     IGWATIKKGTTLEPIA"
     gene            complement(<940696..>942801)
                     /gene="SST2"
                     /locus_tag="KLMA_60443"
                     /db_xref="GeneID:34717657"
     mRNA            complement(<940696..>942801)
                     /gene="SST2"
                     /locus_tag="KLMA_60443"
                     /product="protein SST2"
                     /transcript_id="XM_022821119.1"
                     /db_xref="GeneID:34717657"
     CDS             complement(940696..942801)
                     /gene="SST2"
                     /locus_tag="KLMA_60443"
                     /codon_start=1
                     /product="protein SST2"
                     /protein_id="XP_022677514.1"
                     /db_xref="GeneID:34717657"
                     /translation="MTRNEKGDNTLHEMFSNSFTRSPDGYIVAHELKTVFSIMIICLS
                     LEEKPKVNNNKLISLGKKTFPYTFSISRAVELLQNLELEVEMNSTNIYISYSIKPELG
                     YRLLDTFMEAKLLHTPADKTRSRPKEGILLQPTPKGVAVTCEYARKVALKKLPPILTS
                     NFNSMDLFKFERNSVDDTLIQSEYFINLLFSKVMGPKPNVWSPKRTGDKVPKLSTLLE
                     QRTSALFSFENVSLNEILKGVDANSNNFGNSLSHKSGILGTSDMIDPAQLEDETRESP
                     FAHRFFSNPDSDSHTQYYVSDCGLRLFENKSFGKEGTVIDYCFTTKALWQWLMECTDI
                     MNPKEAVSVAALFLKYGLITPILLPPSENSKKKFIISKSAYYTFTQSGWDVIQWKKDS
                     ERGNHRHLNEGSKLNLSLNSRNVIKKDELSYACKSTKEALSDSEVDLGENLFPSPAAY
                     SDSGSSSGTETEIFVSKDSKSWTLKQILADPGMRYLFKIHLSNDLCVENLEVYYEITK
                     FMRQMSVLRKLIECKNPKGEKKANVSDWKSGGSKKLKDALHSALLKQTNECLSLVYQI
                     YSAYIAPGAPYQLNIDHNVRESITSIIFNPRSPSKKSFDISCREYELEQGSKSEDVKD
                     SVQAGVHAACGKKTSDSTNKVDVTQMIDDAMYTLKEIYPHFEKVRRSVYKMMKTDSLP
                     KFLVSESYLEATSLLSSTE"
     gene            complement(<944120..>946129)
                     /gene="BUR1"
                     /locus_tag="KLMA_60444"
                     /db_xref="GeneID:34717658"
     mRNA            complement(<944120..>946129)
                     /gene="BUR1"
                     /locus_tag="KLMA_60444"
                     /product="serine/threonine-protein kinase BUR1"
                     /transcript_id="XM_022821120.1"
                     /db_xref="GeneID:34717658"
     CDS             complement(944120..946129)
                     /gene="BUR1"
                     /locus_tag="KLMA_60444"
                     /codon_start=1
                     /product="serine/threonine-protein kinase BUR1"
                     /protein_id="XP_022677515.1"
                     /db_xref="GeneID:34717658"
                     /translation="MSTADRKPTSLKYRIGKVKQIPTVVKDEKSGLESIQIPSRENEP
                     VYGVTNFLNNYREEEKLGQGTFGEVFKGIHLGTNRKVAIKRILVRAEKDLFPITAQRE
                     ITILKRMNHKNIVKLIEIVYDESPTPKTDTNGPHPVGNYNNNNTNPPKLITGKHFFMI
                     LPYMVSDLTGLLHNPRVQFDMGDVKNIMLQLFEGINYIHCNKFLHRDIKTANILIDHK
                     GVVKIADFGLARNYFGSPPNLKFPGGAGSGAKYTSVVVTRWYRAPEIVLGDRYYTTAV
                     DIWGIGCVFAEFFEKKPILQGQTDIDQGHVIFKLMGTPSMEEWALAYHLPGSELTKTN
                     YKRTLNDRFSRHLNETGLDLLSKLLALDPYKRITAMMAKRHPFFTEEPLPSSMIKLPN
                     EESHESDIKRYKNELNEAMTQRPPSAPAGHNSTDNSIRSVSGTVFPKEGTTPKVIRAD
                     LPKPSIPVQPGPSRYNASVTVPPTVPMPVPSRSVPKQPAGITLPKGPKNGAPSGPHRL
                     PPNPRGTFPSKYPVESRFGPNTRITTESYNAGKRYQSRWDGGAEREKGYRSKPYGSSN
                     ERGHYQSEQIPSGPRPNSYPNRYHNRDYNQMHHTGSSHNTYNEYKPHSSSNTNNSYGI
                     KRRYNRTSDADTAQDPNQQNTRANQSHTDASNSEDVKPKDVADYY"
     gene            <947993..>950036
                     /gene="ERG13"
                     /locus_tag="KLMA_60445"
                     /db_xref="GeneID:34717659"
     mRNA            join(<947993..948094,948744..>950036)
                     /gene="ERG13"
                     /locus_tag="KLMA_60445"
                     /product="hydroxymethylglutaryl-CoA synthase"
                     /transcript_id="XM_022821121.1"
                     /db_xref="GeneID:34717659"
     CDS             join(947993..948094,948744..950036)
                     /gene="ERG13"
                     /locus_tag="KLMA_60445"
                     /codon_start=1
                     /product="hydroxymethylglutaryl-CoA synthase"
                     /protein_id="XP_022677516.1"
                     /db_xref="GeneID:34717659"
                     /translation="MTEQDQVKKQKTVDQPPRPQNIGIKGIEIYIPSQCVNQEELEKF
                     DGVSTGKYTIGLGQTNMGFVNDREDIYSMSLTVLSKLLKNYNIDTNNIGRIEVGTETL
                     LDKSKSVKSVLTQLFPGNSDTEGIDTVNACYGGTNALFNSLNWIESSAWDGRDAVVVC
                     GDIAIYEKGSARPTGGAGTVALWIGPDAPIVFDPVRGSFMEHAYDFYKPDFTSEYPYV
                     DGHFSLACYVRALDKAYEAYSKKAIAKGLAAAPAGENAINVTKHFDYNVFHVPTCKLV
                     TKSYGRLLYNDFRANPSLYPEVDASLATMDYDASLADKTLEKTFVNVAKPFHKERVAP
                     SLVVPTNTGNMYTASVYAALSSLLCYVGSDALQNKRIGLFSYGSGLAASLFSCKVVGD
                     IKHIVDVLDVDNKLKSRKTETPEDYEKAILLREKAHLQKSFEPTGSIEHLAPGTYYLS
                     KVDDRFRRSYAIKE"
     gene            <951958..>955596
                     /gene="RPM2"
                     /locus_tag="KLMA_60446"
                     /db_xref="GeneID:34717660"
     mRNA            <951958..>955596
                     /gene="RPM2"
                     /locus_tag="KLMA_60446"
                     /product="ribonuclease P protein component"
                     /transcript_id="XM_022821122.1"
                     /db_xref="GeneID:34717660"
     CDS             951958..955596
                     /gene="RPM2"
                     /locus_tag="KLMA_60446"
                     /codon_start=1
                     /product="ribonuclease P protein component"
                     /protein_id="XP_022677517.1"
                     /db_xref="GeneID:34717660"
                     /translation="MHFKSLKYKFYCKGYHSAAHKSATSFFDSSYQYLRQNQGLVNLD
                     SSIPPHNILSATPHPVVGANVNYNNVERALQKNDRELQQIEQYDIEKDDEFFSHHERR
                     LSNQMGTGVNINKGQKQRSKSFTYAANEKTDLINGKLSTRYYSTTTTTTQPPPNQGPN
                     VSPTQIQSEALDVDPSKHNRKELEEQGGLEGLLQRLKDTRLDDSIPAWEPDYEVTLNK
                     DAFLATQSKLIDDCMKSRNYNQVNAIYQSLKRNEIVPPLPVFEQVLTSICKRDMDQNN
                     IDNKMFELLNCYQDIIQNKLKPSFEIYHLVVGALLSGSIKAFKLHNTNGLDFFKIAID
                     LFFVSSLNRNKSFDSQFLNDFLLAVNLYPGHVKFNYIKNFIDSNVNYTKDEVYYITLF
                     SYAKMLNEHEAVKDLYQDFRSELLKNPKLAEHQYEVYAVILAAFTETGSLGIATKLLD
                     KLLIDLQSKNGHNKNTYLVLSNFLISVGKINSDKAYSLLTEFSKLKWVPEFSYEFYLV
                     MIANSLNTNWPLVKKIYNYIFAMETSFSSEKDPNMIKNFLLYPSGLESMPSTILTYAF
                     RQKDDEFIMKILEESVIKEYTFQKGLYPYIFNYFKGIKCPEPYLFRFIRSHGVKLHSI
                     NKNSTFDFLNAIVEEYQSQPVLKKVTEMPFFKSACESFNLENAATINFAGLIVCFQTL
                     WKTPQLIQEYASNLDLHGLIVSRLYDLDTYYLNIQNEMLLEFKKQMAEKFQKLCINYK
                     RMHLDATKVSPITVQAMKMVDMSADTLDYFQHPGDWDKSYPLSLGPLLRNSRTGIQQF
                     ERLSDDGYLFDYDTYSQLIFLKYITTDIITNAISLCPDKATLKYICNTMVVKCPRNSL
                     EDCIVNHPLFSETIVKQLTDKSLSRLSLYSTDIKSLIKSIDFPNRFKSIASQAEYSNT
                     ISSIFKTLFRNKDYDAVLDFNKTVPCLDVCLVLKSLIRLGNYSTYLSELKKFKNTLPP
                     GMFPVIHSEYLINRGNFADAMSLLKSSPDIVSHQTYDKYSFAMFLLSFNGNPPRIDFD
                     IENTLQLANVLTSFNSFSNIIDCYKRVTKSGYFSRNSQNNHSVRKEILQQMLNNIEDS
                     MSFVDLEDASILRIYETKLQNYVRFRVSLRMNLFNSDEMLQMINIWKKINPILIDDLF
                     NDIVSSFYLNHEIKTITFMKSGVLELNKETLLQLLDSISNVYQQENLVEHQTKVQQFR
                     DIVLSSLP"
     gene            complement(<955942..>957636)
                     /gene="RSC9"
                     /locus_tag="KLMA_60447"
                     /db_xref="GeneID:34717661"
     mRNA            complement(<955942..>957636)
                     /gene="RSC9"
                     /locus_tag="KLMA_60447"
                     /product="chromatin structure-remodeling complex subunit
                     RSC9"
                     /transcript_id="XM_022821123.1"
                     /db_xref="GeneID:34717661"
     CDS             complement(955942..957636)
                     /gene="RSC9"
                     /locus_tag="KLMA_60447"
                     /codon_start=1
                     /product="chromatin structure-remodeling complex subunit
                     RSC9"
                     /protein_id="XP_022677518.1"
                     /db_xref="GeneID:34717661"
                     /translation="MSSNSATPVISTEAESVIPGLHSLPATQLNITREQTNGITPKPG
                     AGLQHTLGSLQIFQHLPVNAKLGVDDLTRTKMGLLSGVDEEVKFALKRCLKYSVSAPY
                     VLRLSENHDLLSIIIPFVTACREYIPQLVGPVSNQALEALQKGSTTMLLLRNLAQDSD
                     NTSILANDIELKSFVLFILEWANTFNSEKSPIFQSHTSYFSELLIYTLDLMEAISSYI
                     APAKKDDLYFQNLCLIFRYTKDRYCVISILRSLSRLLVRSKSDEESAADNLDDGILNK
                     IVQNLLIDRDEELIIASLDFLYQYILPGSERIRRLLSQRERYDILTTMLPVLLVYRVQ
                     TPDYQSLANTHIKLIKRVKPTPPAHAPELPKGLLKELFELNEPMRATSWLKCCFERSP
                     NAEVTQILLWKTYEQTFSEQVKQTDRKLITAVDFIKNVSNALPGASALVVVDEATSKK
                     KFVIRGIQPRRKALTIDEANKDISQTRIVQSDSESDGYESTTEASQIKLPDIQFPNKL
                     SEVSKASASFLSLLSNDTTESVLQFIRDTKPAILHRTADVPPLNEVLADFIHSTSI"
     gene            <958717..>959544
                     /gene="KNH1"
                     /locus_tag="KLMA_60448"
                     /db_xref="GeneID:34717662"
     mRNA            <958717..>959544
                     /gene="KNH1"
                     /locus_tag="KLMA_60448"
                     /product="cell wall synthesis protein KNH1"
                     /transcript_id="XM_022821124.1"
                     /db_xref="GeneID:34717662"
     CDS             958717..959544
                     /gene="KNH1"
                     /locus_tag="KLMA_60448"
                     /codon_start=1
                     /product="cell wall synthesis protein KNH1"
                     /protein_id="XP_022677519.1"
                     /db_xref="GeneID:34717662"
                     /translation="MRVLLLLFLYVFGVIADVSIVSPEGGETITASGGKVTFNVKWED
                     DDANPPLSEVISYKFLLCTGTDDDIVGVKELGPVKASDISGNSYNAVFSEDVAPEGTY
                     FIQVFANFPDDGFTIHYSGRVKLKGVDGTLTTKVPTVTDTAGPPPQINVAAASINSAS
                     FSIPYTKQTGISRFAPMQLQPGSTVTMRTWSRKYPTSSISYYATLLNSLQQKTTITPG
                     WSYIITSDFNYATPAAFPSDNGGWYDPKKRQTMSVRKLNVKRALATRASPTATATAA"
     gene            complement(<959923..>960786)
                     /gene="LHP1"
                     /locus_tag="KLMA_60449"
                     /db_xref="GeneID:34717663"
     mRNA            complement(<959923..>960786)
                     /gene="LHP1"
                     /locus_tag="KLMA_60449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821125.1"
                     /db_xref="GeneID:34717663"
     CDS             complement(959923..960786)
                     /gene="LHP1"
                     /locus_tag="KLMA_60449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677520.1"
                     /db_xref="GeneID:34717663"
                     /translation="MSFSQEIRRRGSYAPIDFTAEVSKACRKQVEFYFSEYNLPYDKF
                     LRSLCEQNDGWIPITTLASFNRMKKYRPVDKVVECLKESSILEVSADGENVRRKTPLE
                     TVDFKDRNERVLVFMNWKKIEDEDKDKFLVLQEELEEFFNKMLPVNQVRLKKDHKKKF
                     NGVVEVEFKTKEECAKFLEDHKTDFSYQGQPLEVVTKKQYSLAKNATRSKNFGGSGQK
                     TRSLTGYRKNIPKNGEESKTEESKTEESKTEEAKPEEAKPEEAKPEEAKTEEAKTEET
                     TSQETKTEETN"
     gene            complement(<961143..>961742)
                     /locus_tag="KLMA_60450"
                     /db_xref="GeneID:34717664"
     mRNA            complement(<961143..>961742)
                     /locus_tag="KLMA_60450"
                     /product="platinum sensitivity protein 3"
                     /transcript_id="XM_022821126.1"
                     /db_xref="GeneID:34717664"
     CDS             complement(961143..961742)
                     /locus_tag="KLMA_60450"
                     /codon_start=1
                     /product="platinum sensitivity protein 3"
                     /protein_id="XP_022677521.1"
                     /db_xref="GeneID:34717664"
                     /translation="MNVVQRCKVYSLNQFTQPFQYTCEVNGKPCSRIHVVQETLSDND
                     KTRVIVEKVRTHCSGNGLILNISSLPWELERTYHQSNPSMLEFDSFVQFVSQLCSDPV
                     TAFSRCQTDSEQTTTKSPLAWILIDNLSHLAMDPKFNAKVLSKLMKTVQQTFGSVIIS
                     TSLPLSFHGGIESTFKHHSTKYQSGDQLVPYFDDSDVIL"
     gene            <962342..>963130
                     /gene="SLC1"
                     /locus_tag="KLMA_60451"
                     /db_xref="GeneID:34717665"
     mRNA            <962342..>963130
                     /gene="SLC1"
                     /locus_tag="KLMA_60451"
                     /product="probable 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase"
                     /transcript_id="XM_022821127.1"
                     /db_xref="GeneID:34717665"
     CDS             962342..963130
                     /gene="SLC1"
                     /locus_tag="KLMA_60451"
                     /codon_start=1
                     /product="probable 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase"
                     /protein_id="XP_022677522.1"
                     /db_xref="GeneID:34717665"
                     /translation="MGIKVKLINGERLNDLPAIFISNHQSEMDILMLGRTFPPGCTVT
                     AKKQLKWVPFLGWFMSLSGTLFLDRSNREKAIKVLNDSLATLKKEKRAIWIFPEGTRS
                     YSTKLEMKDFKKGAFHLAQQGKIQIVPVVVSNTSSIYHPRSRVFNRGTITVKVLEPIN
                     TDNLKKEDVPELCEKVFKMMNEELKKNVGYSEPIVDTVLPADVIAYNASKSLSQDGQE
                     QETQPLEAAAHDVEETADDHESIHSAETDATNPEPTERTSLLKA"
     gene            complement(<963303..>964358)
                     /gene="FBP1"
                     /locus_tag="KLMA_60452"
                     /db_xref="GeneID:34717666"
     mRNA            complement(<963303..>964358)
                     /gene="FBP1"
                     /locus_tag="KLMA_60452"
                     /product="fructose-1,6-bisphosphatase"
                     /transcript_id="XM_022821129.1"
                     /db_xref="GeneID:34717666"
     CDS             complement(963303..964358)
                     /gene="FBP1"
                     /locus_tag="KLMA_60452"
                     /codon_start=1
                     /product="fructose-1,6-bisphosphatase"
                     /protein_id="XP_022677523.1"
                     /db_xref="GeneID:34717666"
                     /translation="MAVGTKTRRDSAESINTDIITLSRFILEQQQVSAKNATGEFSML
                     LNSLQFAFKFISQTIRRAELVNLIGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNV
                     KVLVSEEQEDLIVFRNSPGKYAVCCDPIDGSSNLDAGVSVGTIVSLFKIHESGEKDSE
                     GTINDVARCGREMVAACYTMYGASTHLMLTTGAGVNGFTLDNNLGEFILTYPDLRLPS
                     HRSIYSINEGNTCYWEPLIASFIAKLKEKSEENGGKPYSARYVGSMVADVHRTLLYGG
                     LFSYPGDQKNPNGKLRLLYEAFPMAFLVEQAGGKAVNDRGERILDLVPEHIHDRSSIW
                     LGSVDEVNRYLKHIGKL"
     gene            <965679..>966140
                     /locus_tag="KLMA_60453"
                     /db_xref="GeneID:34717667"
     mRNA            <965679..>966140
                     /locus_tag="KLMA_60453"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821130.1"
                     /db_xref="GeneID:34717667"
     CDS             965679..966140
                     /locus_tag="KLMA_60453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677524.1"
                     /db_xref="GeneID:34717667"
                     /translation="MANVWQAKKLGAWGSDSSLLKKKGITSASPASNSNSNSNSNSNS
                     SSTIASTKSSVVAEPHGETKNGKKKHNHGHSNNHSNGHGNGHNNGESPVTRPAFNTSE
                     VKRFLASQFEQQSKSSVTLVIEDSKDWNTAQSKARKSKKYGCLSELERVLK"
     gene            complement(<966284..>967210)
                     /gene="ATG3"
                     /locus_tag="KLMA_60454"
                     /db_xref="GeneID:34717668"
     mRNA            complement(<966284..>967210)
                     /gene="ATG3"
                     /locus_tag="KLMA_60454"
                     /product="autophagy-related protein 3"
                     /transcript_id="XM_022821131.1"
                     /db_xref="GeneID:34717668"
     CDS             complement(966284..967210)
                     /gene="ATG3"
                     /locus_tag="KLMA_60454"
                     /codon_start=1
                     /product="autophagy-related protein 3"
                     /protein_id="XP_022677525.1"
                     /db_xref="GeneID:34717668"
                     /translation="MLRSTLSNWREYLTPITHTSTFETTGQLTPEEFVKAGDYLVHMF
                     PTWRWNGTDYNNVSYKDFLPKEKQFLITRKVPCKLRASNFVETQTTETRDVGDGWELE
                     GQSEGERESGREDTKSNEEALASNIEDLQIVDDDESEGGGDEEQLLQNELADDDDDIV
                     DIKPSTLRYYDLYITYSTSYRVPKMYLCGFANEGTPLSPDQMFEDIAPDYRSKTATIE
                     PLPFFKGNQISVSIHPCKHANVMKVLMEKVRASRHRARDTEAQKNAEEDWEDLQSDID
                     DGLRVDQYLVVFLKFITSVTPGIEHDYTMEGW"
     gene            <968087..>970009
                     /gene="LRO1"
                     /locus_tag="KLMA_60455"
                     /db_xref="GeneID:34717669"
     mRNA            <968087..>970009
                     /gene="LRO1"
                     /locus_tag="KLMA_60455"
                     /product="phospholipid:diacylglycerol acyltransferase"
                     /transcript_id="XM_022821132.1"
                     /db_xref="GeneID:34717669"
     CDS             968087..970009
                     /gene="LRO1"
                     /locus_tag="KLMA_60455"
                     /codon_start=1
                     /product="phospholipid:diacylglycerol acyltransferase"
                     /protein_id="XP_022677526.1"
                     /db_xref="GeneID:34717669"
                     /translation="MVKNRNRSDSIHSVKSTQDDSVTEEKVEEKKELEKRDSHSQTYK
                     DSDKTWKDSRRLIFVFGALLGLVLALWFGSSGDKYSNDMFDNFYVFESVQNYVGDWKE
                     LLPQSVSNLIGDFQFDNTQADLTESFAVGKQLRRDLNLTDKHPLIIVPGVISTGIESW
                     GLYKDEECDSEPHFRKRLWGSFYMLKAMVLDKTCWLRHVKLDPETGLDPPHYKLRAAQ
                     GFESADFFMAGYWLWNKVLQNLGAIGYDSNKMMTASYDWRLSYLDLEIRDRYFTKLKL
                     QIELGLEHSGEKTVLVGHSMGSQVVFYFLKWVEASGKNYGNGGPGWVDKHIEAFIDVA
                     GTLLGAPKCVPALISGEMKDTIQLNTLAMYGLEKFFSRKERLEMLQTWGGIPSMLPKG
                     GDLIWGDLDYSVEDSSNDSNNTDTFGNFIRFANLNEDIIPEEDTTWNNLTMSSAIQYV
                     YDTSPDWLQKRITDQYSFGYATTEKEMKQNELHHSHWSNPLEVPLPNAPNMKIYCLYG
                     VNNPTERAYTYKKDTDSSYLNLTIAYDSPQPVFFTDGDGTVPLVTHSMCHKWKEGVTP
                     YNPAGIEVKIVEMMHQPDRFDIRGGAKSAEHVDILGSAELNEYILKIAGGRGNLIEDR
                     LHTNLTNWVNEMSFPM"
     gene            <970872..>971654
                     /gene="NRM1"
                     /locus_tag="KLMA_60456"
                     /db_xref="GeneID:34717670"
     mRNA            <970872..>971654
                     /gene="NRM1"
                     /locus_tag="KLMA_60456"
                     /product="transcription factor NRM1"
                     /transcript_id="XM_022821133.1"
                     /db_xref="GeneID:34717670"
     CDS             970872..971654
                     /gene="NRM1"
                     /locus_tag="KLMA_60456"
                     /codon_start=1
                     /product="transcription factor NRM1"
                     /protein_id="XP_022677527.1"
                     /db_xref="GeneID:34717670"
                     /translation="MNSRQPLGQITGSQLNVISHEYNKHDKKHMEQHPNVTRTQLNTP
                     SNSPMTDSFSGSDIPIASVLNAKNSNIPFYNTPPTVLSDVHNNSMNTSVNASFEVHPT
                     TRNAKKNPVVSEQQINKLRSRVQLAYYKYKTKQVHLKFSDIIKEQSKKHRVQKGKRQT
                     SSDAKRKFRKLAGLTRIEESQSTTASASASASASASNSASASSQPQLKNITAGPGPDT
                     IASRTQCITPEKNNSTKPYSSRYTPVSVKAARSLLQMFSTGA"
     gene            <972334..>973005
                     /gene="ERG2"
                     /locus_tag="KLMA_60457"
                     /db_xref="GeneID:34717671"
     mRNA            <972334..>973005
                     /gene="ERG2"
                     /locus_tag="KLMA_60457"
                     /product="c-8 sterol isomerase"
                     /transcript_id="XM_022821134.1"
                     /db_xref="GeneID:34717671"
     CDS             972334..973005
                     /gene="ERG2"
                     /locus_tag="KLMA_60457"
                     /codon_start=1
                     /product="c-8 sterol isomerase"
                     /protein_id="XP_022677528.1"
                     /db_xref="GeneID:34717671"
                     /translation="MKLLKLGLFFAAAYYVMNSLLYTWLPRNYIFDPKDLNQIVNTAL
                     AEYDLESESFDLKVMLQDIRDRLANHYGEEYINKYVEEEWVFNNAGGAMGQMIILHAS
                     ISEYLIFFGSAVGTEGHTGVHFADDYFTILYGEQRASLPHNLVPEVYKPGDTHHLQKG
                     YAKQYSMPTGSFALELAQGWIPAMLPFGFLDTFSSTLDWYTLIKTVYLTGRDMIKNLV
                     QNAKF"
     gene            <973276..>973830
                     /gene="CSE2"
                     /locus_tag="KLMA_60458"
                     /db_xref="GeneID:34717672"
     mRNA            <973276..>973830
                     /gene="CSE2"
                     /locus_tag="KLMA_60458"
                     /product="mediator of RNA polymerase II transcription
                     subunit"
                     /transcript_id="XM_022821135.1"
                     /db_xref="GeneID:34717672"
     CDS             973276..973830
                     /gene="CSE2"
                     /locus_tag="KLMA_60458"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit"
                     /protein_id="XP_022677529.1"
                     /db_xref="GeneID:34717672"
                     /translation="MEIENETKPLSEQPAVQDAELPPVTKEEQGQEPEQDKVQVQEKE
                     EQPDLEKVEQPALEKDEQQSPGETQKSQDLQEIQDNVLYKIHEILTKHSSTQSEFIPQ
                     LYHSLKLISKQPNNSSNSLDAATSSIRHRLKTAKALLQQDPQAIELLSKTPEQWQAHI
                     LEKRAELEKKKQHLQRLRENVQKQ"
     gene            <974524..>975687
                     /gene="TOM40"
                     /locus_tag="KLMA_60459"
                     /db_xref="GeneID:34717673"
     mRNA            <974524..>975687
                     /gene="TOM40"
                     /locus_tag="KLMA_60459"
                     /product="mitochondrial import receptor subunit TOM40"
                     /transcript_id="XM_022821136.1"
                     /db_xref="GeneID:34717673"
     CDS             974524..975687
                     /gene="TOM40"
                     /locus_tag="KLMA_60459"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit TOM40"
                     /protein_id="XP_022677530.1"
                     /db_xref="GeneID:34717673"
                     /translation="MSNSPVPLGDFSKISGLPGIAPVTTEQRNESFWSSNPISSYLID
                     TYNNIHAHRQTLSLVNPGTIENLSKEVSRDVFLTQYFFTGLRADLNKTFAFNPAFQTS
                     HTFSMGSESLPNYAFSALFANDNLFMQGNVDNQMSLSGRLQYGWDKNNVTKLTLQISE
                     GQPTMCQLEQDYQASDFSVNFKTLNPSAASDGSFTGVAVGSILQSITPQLALGLEAIY
                     SKGQAAAPADAAVSYMTRYVSAKQDWIFSGQLQANGAAVASFWRKVSPHMEAGLETSL
                     QASMLPIMDPVIGQPIGFQPAIEGATTLGCKYEYRQSVFRGSIDSNGKVGCFLERKIL
                     PTLSVLFCGEIDHFKNESKLGAGLQFETAGSEELLMMQQGLDVNGNPLQAPPA"
     gene            complement(<976345..>977403)
                     /gene="INP1"
                     /locus_tag="KLMA_60460"
                     /db_xref="GeneID:34717674"
     mRNA            complement(<976345..>977403)
                     /gene="INP1"
                     /locus_tag="KLMA_60460"
                     /product="inheritance of peroxisomes protein 1"
                     /transcript_id="XM_022821137.1"
                     /db_xref="GeneID:34717674"
     CDS             complement(976345..977403)
                     /gene="INP1"
                     /locus_tag="KLMA_60460"
                     /codon_start=1
                     /product="inheritance of peroxisomes protein 1"
                     /protein_id="XP_022677531.1"
                     /db_xref="GeneID:34717674"
                     /translation="MVVMGSPKKKSGGPFKTLKNSFLRNKGQNIQLQSTEINNIGRSS
                     KRKSVQRTTLFQHDYVKVRSWPSDNPKSINVISNKATFEIYEINMVHSKQRMNYLSIG
                     KKDQFVHPILPKLKVKRLITNPTELKVIISLFNPQRFWEVTFLANGNEPLPSQTLINF
                     ENVMSKICQYEDGTQVVLPSTNTITEPANTTSAETFDDIEEEVDDLEFLLWDHVSDQG
                     GFSEIGSLEPDESSTMSTTSVEHSIVPPGDVINKTFKQALGRIKPFDSGSRENNLRYK
                     RFSSFHTTFVDGNDWRLEFKNSYHDNRRSISVPMSTKFHNDMRINHNSSDSDNTSNVV
                     DYNSISWMNISCEDIGDA"
     gene            complement(<977907..>980723)
                     /gene="PFK2"
                     /locus_tag="KLMA_60461"
                     /db_xref="GeneID:34717675"
     mRNA            complement(<977907..>980723)
                     /gene="PFK2"
                     /locus_tag="KLMA_60461"
                     /product="6-phosphofructokinase subunit beta"
                     /transcript_id="XM_022821138.1"
                     /db_xref="GeneID:34717675"
     CDS             complement(977907..980723)
                     /gene="PFK2"
                     /locus_tag="KLMA_60461"
                     /codon_start=1
                     /product="6-phosphofructokinase subunit beta"
                     /protein_id="XP_022677532.1"
                     /db_xref="GeneID:34717675"
                     /translation="MTYSLPLLNGTESYDLVTNKQLYDETVEFYQKYLQLAFNSKTDT
                     LSNGFISVKIKVDDSFKPLNVADDKDWRAVVSSSLVFSCTNIQAFKDLVSDKVTQSYP
                     NETSPLEVYLKDPSGYIIGITQTKNAISVKPTLPAKPVGSAMISSRSSKIDIASTNVA
                     TDSSYPAIPKAVKTQKAIAVMTSGGDAPGMNANVRAIVRTAIFKGCKAFVVMEGYSGL
                     VRGGPEYIKEVYWESVRNWSCEGGTNIGTARCMEFRERAGRLLGAQHLIEAGVDALIV
                     CGGDGSLTGADLFRAEWPSLIKELLETNRISKEQFQRYQHLNICGTVGSIDNDMSTTD
                     ATIGAYSALDRICQAVDYIEATANSHSRAFVVEVMGRNCGWLALMAGIATSADYILIP
                     EKPASSREWHDQMCDIVSKHRARGKRTTIVIVAEGAIAADLTPISAKDVHKVLVDQLG
                     LDTRITTLGHVQRGGTAVAYDRILATLQGVEAVNAVLESTPETPSPLIAINENKITRK
                     SLVESVALTKSVADAIHSKDFKKAMALRDSEFVEHLNNFMAINSADHIGPKLAEKNHL
                     KIAIVNVGAPAGGMNSASYSMATYCMSQGHKPYAIYNGWTGLTRHESVRSMNWKDLIG
                     WQSRGGSEIGTNRTTPEEADIGLIAYYFQKYGFDGLVIVGGFEAFVSLHQLERARENY
                     TAFRIPMVLIPATLSNNVPGTEYSLGSDTALNSLMQYCDVVKQSAASTRGRVFVVDTQ
                     GGNSGYLATHAALAVGAQVSYVPEEGISLDQLTQDIENLKESFSKAEGRGKFGQLILK
                     STNASKVLTPEVLAEVITQEAEGHFDAKCAIPGHVQQGGLPSPIDRTRGTRFAIRAVS
                     FIESQQDVLKEARTLDDEDFAFDDDKIVSTASVLGVKGSDIVFTSIRQLYDYETHLKR
                     RTPKKIHWAATRAIADHLVGRKKL"
     gene            complement(<981785..>982801)
                     /gene="GLO1"
                     /locus_tag="KLMA_60462"
                     /db_xref="GeneID:34717676"
     mRNA            complement(<981785..>982801)
                     /gene="GLO1"
                     /locus_tag="KLMA_60462"
                     /product="lactoylglutathione lyase"
                     /transcript_id="XM_022821142.1"
                     /db_xref="GeneID:34717676"
     CDS             complement(981785..982801)
                     /gene="GLO1"
                     /locus_tag="KLMA_60462"
                     /codon_start=1
                     /product="lactoylglutathione lyase"
                     /protein_id="XP_022677533.1"
                     /db_xref="GeneID:34717676"
                     /translation="MLRNRLLNIYRHLRPMSTEASAKYFPKKVGIAQNDKSLKLNHTC
                     LRVKDPNVSVAFYEEKFGMKLMEHKKFPEMKFDLYFLSFPNKKFDTNAQGGANVFKEN
                     GILELTHNYGTESDPEYKINNGNEEPHRGFGHICFSVPKIEAECERLESLGVKFKKRL
                     TDGRQKDIAFALDPDGYWIELIQNDQTGEGCNYKFNHSMIRVKDAAKSLEFYQNVLGM
                     KLLDVSEHANAKFTLYFLGYENGQEGIARRSRESILELTHNWGTENDPDFAYHNGNAQ
                     PQGYGHICISNDDPAALCAEIESLYPDLQWAPKFNKGKMANIAFIKDPDGYSIEVVPS
                     LLEV"
     gene            complement(<983313..>985865)
                     /gene="PRP2"
                     /locus_tag="KLMA_60463"
                     /db_xref="GeneID:34717677"
     mRNA            complement(<983313..>985865)
                     /gene="PRP2"
                     /locus_tag="KLMA_60463"
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase-like protein PRP2"
                     /transcript_id="XM_022821143.1"
                     /db_xref="GeneID:34717677"
     CDS             complement(983313..985865)
                     /gene="PRP2"
                     /locus_tag="KLMA_60463"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase-like protein PRP2"
                     /protein_id="XP_022677534.1"
                     /db_xref="GeneID:34717677"
                     /translation="MDRHGLKRRYENTELSDGRENHGPNGPDDVKGLKSMAEQKMLTP
                     KQRSQLQWLVSDLEIWEEDVKRYGWENLSADEREKITLKRKLFKLLNETDKYRSTEEE
                     GVNKLDSQRDNITKRPTSKAKLREHNDRMRWEEEQLKKSVIGHDVDEIKVRDSDKYDF
                     VFDPESMIDFTEDSVDVLEPKEEDEEQNKLLEVLDQEIQKVDQSKQSRKLLPVYKYRD
                     ELLKSIREHQVLIIIGETGSGKTTQLPQFLVEDGYVKDGKAVACTQPRRVAATSVAAR
                     VADEMEKVLGKEVGYSIRFDDKTTPGKTILKYMTDGMLLREFLNDPQLSGYSAIMIDE
                     AHERTLATDILLGLLRGIIQERKDLRLIISSATMNATKFSKFFFDCPIFNVPGRKYPV
                     DIHYTLQPEGNYINAAITTVFQIHTTQRLPGDILVFLTGQEEIESMKAKLLEILSKLD
                     NTKFPDLLIVPIYANLPQEQQAKIFEPTPKNCRKVVLATNIAETSLTINGIKYVVDPG
                     FVKEQSYSGGISKLVTVPCSRASVDQRAGRAGRLGPGKCFRLFTKWSYYNELPRSPTP
                     EILRTKLNQVVLLLLSLGINDLIHFPMLDKPNTRQLSEALENLYAIGALNSKGLITKV
                     GKLMCDFPCEPEFAKVIYSSAFGENCKGVLPQTVTIVSMLQESNSIFLPGLNHEEKSK
                     LFGSLMQSSDHMLYLWIFEQWEENGYSMRWCQDYKLQYKSMKRVLSIRKQLWNYCEKL
                     GFAKAHEEYAHISKNLNASAIEANIIKCFISGFPTNIAKLSKQGYTNVKHDLPVSIHP
                     SSVIFNRMKLEGKPKKFILYQTLMLTSKEFIRDCVTFDKYEWLQETMPHLYK"
     gene            <986165..>987541
                     /gene="URK1"
                     /locus_tag="KLMA_60464"
                     /db_xref="GeneID:34717678"
     mRNA            <986165..>987541
                     /gene="URK1"
                     /locus_tag="KLMA_60464"
                     /product="uridine kinase"
                     /transcript_id="XM_022821144.1"
                     /db_xref="GeneID:34717678"
     CDS             986165..987541
                     /gene="URK1"
                     /locus_tag="KLMA_60464"
                     /codon_start=1
                     /product="uridine kinase"
                     /protein_id="XP_022677535.1"
                     /db_xref="GeneID:34717678"
                     /translation="MNHSGYIPPWTTPYIIGVAGSSGSGKTSVASKIVSEINTPWTVL
                     ISLDNFYKPLSPADKERAFNNDYDFDKPEAIDLDLAYECILSLKEGKKVKIPTYSFTD
                     HDRIPNKHLTIYGASVVILEGIYALYDQRLLDLMDLKVYVDADLDVCLARRLSRDIVS
                     RGRDLQGCIRQWEKFVKPNAELYLKPTMKVADAIIPSISDNTIATEILLNHIQSKLQD
                     KSQQHLAELKKLGTHAISIDNLDTVIRLPQTNQVKALQTMLLDKTISRDDFVFYFDRL
                     ASILLSFALDDIPEVESDKKVITPTNVQLKNPVFVDFDKVTAINIVRSGDCFMSSLRK
                     TIPSVAVGKLLIQSDSRTGEPQLHCLFIPPKIESFNQVLLMDAQIISGSAIIMALQVL
                     VDHHIELKNIKVIVYLATETGIRRIVDATNNQVKIYAGEIISDERIRSNQCNWGRRHF
                     VDTCYFGC"
     gene            complement(<987874..>990450)
                     /gene="PHO91"
                     /locus_tag="KLMA_60465"
                     /db_xref="GeneID:34717679"
     mRNA            complement(<987874..>990450)
                     /gene="PHO91"
                     /locus_tag="KLMA_60465"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821145.1"
                     /db_xref="GeneID:34717679"
     CDS             complement(987874..990450)
                     /gene="PHO91"
                     /locus_tag="KLMA_60465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677536.1"
                     /db_xref="GeneID:34717679"
                     /translation="MKFSHSLQFNAVPEWSTKYIAYSQLKKLIYTLQKEKLYKSSSGS
                     PDLESTPLTGGSATDSYEQRFIEALDKELEKIDTFYTAQEASILANYSELYEDANAFQ
                     NELMNRSLHNPSVSESGRRNTRRSSSVSDINAQTDGGMYSEDDDEEDDVHSLPGQLQG
                     QTQGQPQIRSRTASIGSRIMQSMTAEMMPTYSRVTDFTTTDPLIEQQITLKKRIVACF
                     TQLSELKSFIELNQTGFAKICKKFDKSLDTHIKPEYVKSLAKKSHVFNEHTIENLSHS
                     INEVIVMYAKAVGYMDSQNEIINFQEAERELSLHLREHVVWERNTVWKDMMNLERKAQ
                     NVKAEKVGKKSSSMTFKSISKDTEGIVDLIESSEVQAPKTLSDLFKLSFSQYVKLFFS
                     SNGLIKFILISLIFAFFLVVSPMKDPLQKNCLAILIFASLLWATETIPLFVTSLLVPL
                     LIVVLPVLKDGSDGHIMTPSESSQYILSTMWSSVIMLLLGGFTLAAALSKYNIAKVLS
                     THILSSAGTNPKIILLTNMGVALFASMWVSNVAAPVLCYSIIQPLLRTLPRGTTFAKS
                     LILGIALASNIGGIASPIASPQNIISIGMMDPQPSWGQWFVVSLPVCAICIIAIWVLL
                     LLTFPPDSNLKILKYHPISDPFTVQQWYVTVVTIMTIVLWCMANQLKGIFGEMGIISI
                     IPMFLFFGTGILTSDDFNNFMWTIVILAMGGTTLGKAVTSSGLLSTIASVIKESIESK
                     PVFQIVLIFGIVILTMATFVSHTVAAMIIVPLMKEIGANLPGGDHSRLLIMVSAFLCS
                     AAMGLPTSGFPNVTAISMIDDVGDRYLSVNNFITRGVPASIIAYTVIVTVGYALMKLI
                     GY"
     gene            complement(991259..991334)
                     /locus_tag="KLMA_R614"
                     /db_xref="GeneID:34718773"
     tRNA            complement(991259..991334)
                     /locus_tag="KLMA_R614"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:34718773"
     gene            <992403..>993443
                     /locus_tag="KLMA_60466"
                     /db_xref="GeneID:34717680"
     mRNA            <992403..>993443
                     /locus_tag="KLMA_60466"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821146.1"
                     /db_xref="GeneID:34717680"
     CDS             992403..993443
                     /locus_tag="KLMA_60466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677537.1"
                     /db_xref="GeneID:34717680"
                     /translation="MAYHVNRPITAQLEVHYAQNKESGNSKIVGTLLRVHQGSQGSDS
                     DSTSVNNYNHSNSSNRHEYERKALDLYNGAEGSQGAFAEGSAPRSDRDENGSLDTHGH
                     RGGHQIHSLETSLSNSMKVCDFYQCVHSHHYHHHDDWFVHIPACARRFSESNLARLPI
                     HFQQLKNQEALDAQGTQSSQGSHVNPDHVDESRQATYSTPRRVVSCSTEHADLAHANV
                     QLTSVPESEQAQFNLVNPFRKHYNLASTEKSPNPPSIEGHSDEDSYERLSPMDSDPME
                     SDNGSISNNYNSSTPPESIHACRIDNSSNPGSLDDETNQASLDLSSPCTKHHHRRNSL
                     AVIFKKPRFKSV"
     gene            complement(<993791..>997588)
                     /locus_tag="KLMA_60467"
                     /db_xref="GeneID:34717681"
     mRNA            complement(<993791..>997588)
                     /locus_tag="KLMA_60467"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821147.1"
                     /db_xref="GeneID:34717681"
     CDS             complement(993791..997588)
                     /locus_tag="KLMA_60467"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677538.1"
                     /db_xref="GeneID:34717681"
                     /translation="MLKVLRKISGHSNDGDHEKNVPPRRKDVNKDLRKPYNAKTAQYP
                     PQVSGTTPVPDGKQHPFAPSKPAATLSSTQLNESRSVSSGMSSGADSTAHMTPHEIHE
                     SLIRQNQINRKKSEQYYIYDFDNYRGPTNESVSADPNYNIFNVRDGINASSARYVVHY
                     LTKEFKRQLMERLSTKNSGLDTDVLRASMEIFKPNLSHFSNSEINICKRILRSFFPWK
                     GCSLTGTAIENAISENYGDFSNPKHWTRLILSLRIIWSQLSNGIIPWKSYQNFCKLEL
                     QKNYPIMSFYNLLPQCLPNHDYTCTAFEFLEILVAIISKVDLVVDKNVQMDLIFTAGQ
                     VCFTNDKYLQKHIQDDFKGEPDIIALGKLYTTRGNALLHLFVAYLRSLAEEGKIKDFY
                     LVDNFHIDNYPPHPYKPVTQTALTLTVPSLEPGKNDFNTLLRLAAKSQSRIYSSNHTF
                     SKQENAFLDKFEEDPYKVFDTIFSKSSKRYLYKFDKNFDPNALKKLSESSIQKALGSI
                     SENDQYAVATWIDHIKGQDFNDFLSVLDDSGHGEGTLAFDSSAINFGKKSNNEKENIS
                     PVRVSKMNLSEWFISSWKYETFLQKVQNTLLIKLTKRIGDCDWLVLSTDERVGKSCYL
                     TPPSSSDSAKMFEGKKLPRSDSDDVSIKSRPPPPNLLGEKSYSPLLETSSSSIYSGIS
                     KFQNKPSPIHETSNNIHSSRKSKMSITTSGMPPVPQVLESRTDRNEIMTPIERNGNNS
                     FQMAIPNPANIPPVMAKVNNPSMLDVRAPENKSMAGKRRSVEIPATPESRAVGDRFDS
                     IITDQQHFAKPLDFGAKVRAVVSDIPVAETTQDEISYERKTNPVETSITNSSESQKTT
                     LSDIKEDEGGTNEEATKDHDSLDMSASLNDTLENIEKEVGSLKSLKNSKEVNEDLSHR
                     ARIVSSNITGVSTTVNGEDNSLDKETHVHTRREVRSSDITVIVERKRDSTELDAEGKD
                     ISSTDDFEDASSLKSDEVDEDEKEEEEEMNDVHEYNNASSVATTAYSEALEKNGICGS
                     LKSEKDVPSLVEQSGDSTDPAEKSISLTPSKKLLRASALIETESSPNDILNDLIDNYN
                     SESLVAPNNEGATLFEVIKSQMERLSHGKDLPPVPNKGKPVLEKLKMDVLKESEDGEN
                     NEDLPLVTPTKSTTYVNGFSYNATPPMKQNEFQNTTKLPYTHDPNTNFYRTLKKSNES
                     ERKIDEPVVTSGGEEDEEMVHSLQSIQAEISSSAADNKSFRNVMLKTRRSFRNLKSKS
                     LKT"
     gene            <998622..>999758
                     /gene="SMM1"
                     /locus_tag="KLMA_60468"
                     /db_xref="GeneID:34717682"
     mRNA            <998622..>999758
                     /gene="SMM1"
                     /locus_tag="KLMA_60468"
                     /product="tRNA-dihydrouridine synthase 2"
                     /transcript_id="XM_022821148.1"
                     /db_xref="GeneID:34717682"
     CDS             998622..999758
                     /gene="SMM1"
                     /locus_tag="KLMA_60468"
                     /codon_start=1
                     /product="tRNA-dihydrouridine synthase 2"
                     /protein_id="XP_022677539.1"
                     /db_xref="GeneID:34717682"
                     /translation="MVQYAGKLVLAPMVRAGELPTRLLALKYGADLVWSPEIVDKKLI
                     QCQRQVNDALNTIDFVAPATREGMEPGVVFRTVPELERGKLIFQIGTSTPSLAVEAAL
                     KVIKDVDGIDVNAGCPKHFSIHSGMGAALLKTPEKLCSILTELVAKVGNVYNKPISVK
                     IRILDNEADTLNLVENICKTGVSNLTVHCRTTPMRNRESPIRDYIPKIYEICTSHNVS
                     LIMNGAIKDKNDFLQLRKELKLSDSIGGMMADCAEKNPTVFSSNPLPWFKAVKEYLDI
                     AVQYNHHPSNVKYMLNRMTPGKSPFYQYFTQCRKLPDFLYVCKQLDEEGKPIEDPLPF
                     LKEEHEKEKKQKKKQNDIKSLEKSNAKRSAENTTDTSSKKAKSA"
     gene            complement(<1000058..>1006756)
                     /gene="ACC1"
                     /locus_tag="KLMA_60469"
                     /db_xref="GeneID:34717683"
     mRNA            complement(<1000058..>1006756)
                     /gene="ACC1"
                     /locus_tag="KLMA_60469"
                     /product="acetyl-CoA carboxylase"
                     /transcript_id="XM_022821149.1"
                     /db_xref="GeneID:34717683"
     CDS             complement(1000058..1006756)
                     /gene="ACC1"
                     /locus_tag="KLMA_60469"
                     /codon_start=1
                     /product="acetyl-CoA carboxylase"
                     /protein_id="XP_022677540.1"
                     /db_xref="GeneID:34717683"
                     /translation="MSEENLSEVSISQSQQYEVTDFSHRHSKLAPHFIGLNTVDKVED
                     SPLKEFVKSHGGHTVISKILIANNGIAAVKEIRSVRKWSYEIFGDERTVQFVAMATPE
                     DLEANAEYIRMADQYIEVPGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLL
                     PERLAASKRKIIFIGPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHIDKET
                     NLVSVDEEVYQKGCCSSPEDGLKKAKQIGFPVMIKASEGGGGKGIRKVENEEEFLSLY
                     QQAANEIPGSPIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAP
                     VTIAKPQTFTEMEKAAVRLGQLVGYVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTT
                     EMVTGVNLPAAQLQIAMGIPMHRIRDIRLLYGVDPKSASEIDFEFSTPESSKTQRKPI
                     PKGHCTACRITSEDPNEGFKPSGGALHELNFRSSSNVWGYFSVGNNGGIHSFSDSQFG
                     HIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDDL
                     ISQKMTAEKPDPTLSVICGAATKAHIASEQARQEYIASLKRGQVPNKSLLQTMYPIEF
                     IHDGMRYKFTVAKSADDRYTLFINGSKCEVGARKLSDGGLLIAVGGKSHTIYWKEEVS
                     ATRLSIDSKTTLLEVENDPTQLRTPSPGKLVKFLVENGDHVIAGQPYAEVEVMKMQMP
                     LISQENGIVQLLKQPGSTLAAGDILAILSLDDPSKVKHAKPYEGMLPEMGSPIVEGTK
                     PAYKFKSLVTTLENILKGYDNQVIMKTSLQQLIEVLRQPELPYSEWKLQVSALHSRLP
                     PHLDEQQEQLVSRSFKRGADFPARQLGKMFEAALNDPNVDPLFHTTIEPLLDITNRYS
                     NGLASHEHFVFATFLENYYNVEKLFSGSNVREEDVILRLRDENPDDLDKVVLTVLAHS
                     RVSARNNLILAILKHYQPLCKLKSEIAAAIEKPLKHIVELESKATAKVALQAREILIQ
                     GALPSIKERTDQIQYILKSSVLSTSYGSTESKRTKPDLEVLKDLIDSNYVVFDVLSQF
                     LTNSDDAVAAAAAEVYIRRAYRAYTIGDLMHFKTSGSPVVEWKFQLPSAAFTSMPQVK
                     SKLGMNRAISVSDLTYVSEGENQPLRTGLLIPAKHLDDVDGILSSALSMIPPHHVSTG
                     PAPDRSGSSSASLSNVANVVVNSTEGFESESEVLLRLKEILDLNKQALVESAIRRITF
                     VFGYSDGTYPKYYTFRGPNYNEDETIRHIEPALAFQLELGKMSNFNIRQIFTENRNIH
                     VYEAVGKNSPVDKRFFTRGIIRTGRIRDDISIVEYLTSEANRLMSDILDNLEIIDTSN
                     SDLNHIFINFSAVFDVSPEDVEAAFGGFLERFGRRLLRLRVAAAEIRIIIKDPQTGTP
                     VPLRALINNVSGFVVKTELYTEVKNAQGEWIFKSLDKPGSMHLRPIATPYPAKEWLQP
                     KRYKAHLMGTTYVYDFPELFRQAIVTQWKKYSPKKKLSDDFFIANELIEDENGELTEV
                     DRELGANNIGMVAFKVTAKTPEYPHGRQFVIVANDITYKIGSFGPQEDEFFNKVTEYA
                     RKRGIPRVYLSANSGARIGIAEELVPLFQIAWNDEKDPSKGFQYLWLTDEALEELRAQ
                     GKENSVVTQRVVEEGKARNIITAIIGSEDGLGVECLKGSGLIAGATSRAYKDIFTITL
                     VTCRSVGIGAYLVRLGQRAIQIEAQPIILTGAPAINKLLGREVYSSNLQLGGTQIMYN
                     NGVSHLTAPDDLAGVEKIMNWLSYIPAKRDLPVPILESDDKWDRLVDFTPTTNEQYDV
                     RWMIEGRETDEGFQYGLFDKGSFQETLSGWARGVVTGRARLGGIPLGVIAVETRIVEN
                     LIPADPANPDSTEMLIQEAGQVWYPNSAFKTAQAINDFNHGEQLPLMILANWRGFSGG
                     QRDMYNEVLKYGSFIVDALVDYKQPIITYIPPTGELRGGSWVVVDPTINADQMEMYAD
                     INSRAGVLEPEGMVGIKYRREKLLATMARLDDKYRALKDRFANPDLTPEEHQQVSKEL
                     AEREKQLLPIYHQITVQFADLHDRSGRMLAKGVIRKELNWPESRRFFFWRLRRRLNEE
                     YLMRRLNNELGSASRLEKMARIRSWYPASVSLDDDRQVATWIEENYQLLDEQIKSVKL
                     EAFAQNLAKSIRNDHDNSINGLAEVLKLLSVKDKEKLQKALE"
     gene            <1010053..>1010712
                     /gene="TIM23"
                     /locus_tag="KLMA_60470"
                     /db_xref="GeneID:34717684"
     mRNA            <1010053..>1010712
                     /gene="TIM23"
                     /locus_tag="KLMA_60470"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM23"
                     /transcript_id="XM_022821150.1"
                     /db_xref="GeneID:34717684"
     CDS             1010053..1010712
                     /gene="TIM23"
                     /locus_tag="KLMA_60470"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM23"
                     /protein_id="XP_022677541.1"
                     /db_xref="GeneID:34717684"
                     /translation="MSWLFGGKKPSTDSQTASTDSEQNNEKLKKTLGFDPSSVTNVSN
                     VISVPGGLSPSQLHPLAGLERGVEYMDLEEEQLSTLEGSQGLIPSRGWTDDLCYGTGA
                     VYLLGLGLGGSYGFFEGLKNIPPNSPGKLQLNTVLNHITRRGPFLGNNAGVLALTYNL
                     INSTIDSLRGKHDVTGSVVAGALTGAVFRSSRGLKPMAYSSALMAAAAAGWCGIKSVV
                     L"
     gene            complement(<1011294..>1012793)
                     /gene="RRT12"
                     /locus_tag="KLMA_60471"
                     /db_xref="GeneID:34717685"
     mRNA            complement(<1011294..>1012793)
                     /gene="RRT12"
                     /locus_tag="KLMA_60471"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821151.1"
                     /db_xref="GeneID:34717685"
     CDS             complement(1011294..1012793)
                     /gene="RRT12"
                     /locus_tag="KLMA_60471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677542.1"
                     /db_xref="GeneID:34717685"
                     /translation="MRVSYLCLFVWIQFICPALCTEYLISLKTPKTLKYLFNFKLGGS
                     TVKDLIESKIHREFSFGNFNAISVDIPPLVAEKLKDIPFISDVVANTKISLFDAFPEM
                     EASLKGSNKLTKGKDKKTMFIDDGEDDDDESVEDGLEFKENYTSQKSAPRHLARISRR
                     TQLPIIPQDYDTSALKYHYHADRQGEDVHVYVLDSGINYSHPDFEGRAKEGIDTTGEG
                     SGDFIGHGTHVAGLIGSKTYGVAKKANIYEVKVLDSLGRGNVTDIIEGLEYVVSQCQD
                     NKKKCVVNMSLGAPGTHSILDRAVSAVIDEGIVVVVAGGNSGLNACWYSPAKVKKAIT
                     VAAMDDRTDLMAQFSNWGACVDIWAPGVNVESLSNRGDDTVTLSGTSMASPIVAGAAA
                     LFLDQGYKPSEVRKALLKYSTKGVFKKRALAVRPRSPNRLLYTGNNEKDDSFEYGLFP
                     QIDEYKFISRLQEDTKDFNESNDPNSALLIRGRKLLEPNLTFKSKKQVK"
     gene            <1014901..>1015566
                     /gene="RCF2"
                     /locus_tag="KLMA_60472"
                     /db_xref="GeneID:34717686"
     mRNA            <1014901..>1015566
                     /gene="RCF2"
                     /locus_tag="KLMA_60472"
                     /product="altered inheritance rate of mitochondria protein
                     38"
                     /transcript_id="XM_022821153.1"
                     /db_xref="GeneID:34717686"
     CDS             1014901..1015566
                     /gene="RCF2"
                     /locus_tag="KLMA_60472"
                     /codon_start=1
                     /product="altered inheritance rate of mitochondria protein
                     38"
                     /protein_id="XP_022677543.1"
                     /db_xref="GeneID:34717686"
                     /translation="MKILTREEIDAHSHYTLLGGIKGAAAGFLISAAIFKLVPRRYPK
                     FNPQNMTWSIKTALFITPPTLLASIVAEESSTKFDQKMYSGDASADIIAEHNRWKNLP
                     MKDKLLEGLSNNKYKIIVGSWAACLYGSWKLVDKDPYMTKAQKAVQARMYAQGLTVFL
                     LLASIGLSMYEEKLHPDQKKEARDRRWQAALAQAEKEEKMTAAAGYRSNEDRVNAKIF
                     KYD"
     gene            complement(<1016093..>1016614)
                     /gene="IMG1"
                     /locus_tag="KLMA_60473"
                     /db_xref="GeneID:34717687"
     mRNA            complement(<1016093..>1016614)
                     /gene="IMG1"
                     /locus_tag="KLMA_60473"
                     /product="54S ribosomal protein IMG1"
                     /transcript_id="XM_022821154.1"
                     /db_xref="GeneID:34717687"
     CDS             complement(1016093..1016614)
                     /gene="IMG1"
                     /locus_tag="KLMA_60473"
                     /codon_start=1
                     /product="54S ribosomal protein IMG1"
                     /protein_id="XP_022677544.1"
                     /db_xref="GeneID:34717687"
                     /translation="MFRKTLPVLLKQAVRRYQLPAKAEKKIIPVYPPVERVSNPLVIK
                     TLAEKDLKVLDPNGVKTELISRKNPNCLRAGDVVRVVYDSTKCNYDTFTGYILAVDRK
                     PLVQDSSILLRDHIYKTCVEMRVPIFSPLVERIDLIRRADGRRGRNKHYYIRNTRLDV
                     GDLAASMRKKKHN"
     gene            complement(<1016901..>1017704)
                     /gene="BUD23"
                     /locus_tag="KLMA_60474"
                     /db_xref="GeneID:34717688"
     mRNA            complement(<1016901..>1017704)
                     /gene="BUD23"
                     /locus_tag="KLMA_60474"
                     /product="putative methyltransferase BUD23"
                     /transcript_id="XM_022821155.1"
                     /db_xref="GeneID:34717688"
     CDS             complement(1016901..1017704)
                     /gene="BUD23"
                     /locus_tag="KLMA_60474"
                     /codon_start=1
                     /product="putative methyltransferase BUD23"
                     /protein_id="XP_022677545.1"
                     /db_xref="GeneID:34717688"
                     /translation="MSRPEDLAPPEVFYNDSESKKYSGSTRVQHIQAKMTLRALELLN
                     LPHTSYILDIGCGSGLSGEILTEEGHIWTGLDIAPSMLAEALNREVEGDLMLHDIGQG
                     IPFRAGVFDAAISISVIQWLCNADTSYNDPKRRLMRFFNSLFASLKKGGKFVAQFYPK
                     NDEQIEQILGAAKVAGFSGGLVIDDPESKKNKKYYLVLSSGSTETGEQVNLDGVKMDA
                     DLVAKRERKKKLVESRKDYINRKKEVMKKRGRKVALDSKFTGRKRRTRF"
     gene            <1018364..>1019317
                     /locus_tag="KLMA_60475"
                     /db_xref="GeneID:34717689"
     mRNA            <1018364..>1019317
                     /locus_tag="KLMA_60475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821156.1"
                     /db_xref="GeneID:34717689"
     CDS             1018364..1019317
                     /locus_tag="KLMA_60475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677546.1"
                     /db_xref="GeneID:34717689"
                     /translation="MTLDDGHSANGGTFGVNGASNADSPNSLTTGFSGAGNRMGMNQM
                     GPNTAVWNSPWFQEAYHNAQEFYEKDKVLDPKDRLELSKIYLSIARAQLWSGWVAFGL
                     VTSVPFVLQYKKTGGVKGTKVSRAFAFGFLSMFAATQAGGSLMYKSKLASIRPETLED
                     DPNVPKSSRQKQYEMMKLLNMGMPTRWATYFNLTYRNPEKRIPDPKLTMEKLKNGQAT
                     TRNRSVMFDNKDPMGLYTGPQFEKKEGVPKAGAISPPAQQVPQQVPQNDEYDPFNEED
                     NKEEESLSAWDRIRKENAVADTKAGNSWEEIRKKNYDNSPK"
     gene            complement(<1019562..>1021793)
                     /gene="THS1"
                     /locus_tag="KLMA_60476"
                     /db_xref="GeneID:34717690"
     mRNA            complement(<1019562..>1021793)
                     /gene="THS1"
                     /locus_tag="KLMA_60476"
                     /product="threonyl-tRNA synthetase"
                     /transcript_id="XM_022821157.1"
                     /db_xref="GeneID:34717690"
     CDS             complement(1019562..1021793)
                     /gene="THS1"
                     /locus_tag="KLMA_60476"
                     /codon_start=1
                     /product="threonyl-tRNA synthetase"
                     /protein_id="XP_022677547.1"
                     /db_xref="GeneID:34717690"
                     /translation="MCADKVEKPVEEQVKDLSLEQKAEKQPAAVENKKEKKDKKKDKG
                     NGKPSLYLEPQPAFIDERIQMFERLKKEYDEKVAAQPRVPLKVVLKDGTVKEATAWET
                     SPMDIAQGIAKSFAERQCISKVNGELWDLERPLEGKEGDELKIEFFDFESDTGKKVFW
                     HSSAHVLGEACECNLGAHICLGPPTDDGFFYEFACRDSMDPDSPERTVSQADFPNLEA
                     VAKAAIKQKQKFERLVLSKEDLLKMFHYSKYKTYLVSTKIPDGGSTTVYRCGPLIDLC
                     TGPHIPHTGRIKAFKLLKNSSCYFLGESTNDSLQRIYGIAFPDKKLMDAHLKFLQEAS
                     LRDHRKIGKDQELFYFNEMSPGSCFWLPHGTRIYNTLVDLLRTEYRKRGYDEVITPNM
                     YNSKLWETSGHWANYKENMFSFEVEKETFGLKPMNCPGHCLMFKARERSYRELPWRVA
                     DFGVIHRNEFSGALSGLTRVRRFQQDDAHIFCTQDQIEQEIANIFEFLKYIYGVFGFE
                     FKMELSTRPEKYVGELETWNNAEAKLEAALNKWGGNWELNPGDGAFYGPKIDIMISDA
                     LHRWHQCATIQLDFQLPNRFELEFKTKEVEGDDNYERPVMIHRAILGSVERMTAILTE
                     HFAGKWPFWLSPRQILVVPVGVKFQEYAQEVRDKMAEAGFYADVDLSGNTLQKKVRNG
                     QMLKYNFIFIVGEQEMTEKSVNIRNRDVMDLQGKNATVQVESVIEQLKKLKEEKRNDN
                     VLA"
     gene            <1022536..>1023609
                     /gene="AIR1"
                     /locus_tag="KLMA_60477"
                     /db_xref="GeneID:34717691"
     mRNA            <1022536..>1023609
                     /gene="AIR1"
                     /locus_tag="KLMA_60477"
                     /product="protein AIR2"
                     /transcript_id="XM_022821158.1"
                     /db_xref="GeneID:34717691"
     CDS             1022536..1023609
                     /gene="AIR1"
                     /locus_tag="KLMA_60477"
                     /codon_start=1
                     /product="protein AIR2"
                     /protein_id="XP_022677548.1"
                     /db_xref="GeneID:34717691"
                     /translation="MLSEVESADTLPFFKDASPKYEVNENDKIIAPSIAEVDSDPEKL
                     REIRGQGRYFGIEDGEDGIVEPLPKCNNCSQRGHLKKNCPHVICSYCGVLDDHYSTHC
                     PKTMRCSHCNEPGHYRQHCPVKWKRVFCTLCHSSRHSRDRCPSIWRSYCLKESSDKRV
                     LPLHQIYCYNCGGKGHFGDDCLEARSSRVPNDDGSAFAGNNLPSSVRPDYNRNLKEYK
                     VKTDYSYDDYDYNNYNFEEDDGGSHYYSSRYNNGESNGNKNKRSAVDYGDARPSNFYA
                     PPYNKKNKRSNNSNGGNGNTARLPAPTVKGKVLPPKPTRSHPLDFPRNPNVNIPRYGS
                     SSYQPSNDRYRNYNSYSGFKKRR"
     gene            complement(1023796..1023871)
                     /locus_tag="KLMA_R615"
                     /db_xref="GeneID:34718774"
     tRNA            complement(1023796..1023871)
                     /locus_tag="KLMA_R615"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:34718774"
     gene            <1024316..>1024726
                     /locus_tag="KLMA_60478"
                     /db_xref="GeneID:34717692"
     mRNA            <1024316..>1024726
                     /locus_tag="KLMA_60478"
                     /product="protein SNA4"
                     /transcript_id="XM_022821159.1"
                     /db_xref="GeneID:34717692"
     CDS             1024316..1024726
                     /locus_tag="KLMA_60478"
                     /codon_start=1
                     /product="protein SNA4"
                     /protein_id="XP_022677549.1"
                     /db_xref="GeneID:34717692"
                     /translation="MCLCCVCCTVSDLLLYIVAIIFPPAAVGIRSGLYSSDLLLNALL
                     TLFGFLPGMIHAFYYITVTSPLRLDTESRYYYQQGWTDAQRFGSPSAVTVVSQQPAPV
                     EAPLLPPAQTSNPYHSIPRAGTPKGSPPPYSETV"
     gene            complement(<1024878..>1026929)
                     /locus_tag="KLMA_60479"
                     /db_xref="GeneID:34717693"
     mRNA            complement(<1024878..>1026929)
                     /locus_tag="KLMA_60479"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821160.1"
                     /db_xref="GeneID:34717693"
     CDS             complement(1024878..1026929)
                     /locus_tag="KLMA_60479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677550.1"
                     /db_xref="GeneID:34717693"
                     /translation="MQPSFNFLVSQPSSCKTKPSGFRAFECKNDRIYPLKVDTVDRNA
                     DTNSIVQKICYLRPRVRPIDISIGNTYGEECSDYLLVAKNNGIIEIIKDYDFKIRNRI
                     PLRPNYLLVCVPINTNIVTNDTTIVGMEYSDKFLYVCSSNGDLFGFILNLPDDYVSEQ
                     DFQAPEAYKRYKDTIMWRSDSTPPEDTTPAERFLREGTQFKNAHSCAHICYYCYPVNE
                     DGFFHETIRQWYPKPIPAFSNCFITFLRTDVSSFHINPMDRFSVITVAPHTPLTIHKI
                     LLPEFYVVFFHEFVKLKDEYFSKKLRQNSEPPSFDFMSRVVYDVGFQDYLKRNCSQYA
                     SDHDIRLWRSMLVCDMVCEFKYSSVWRQKQGNMKDSLHRLFFYDASLNDGKNVQNDIE
                     NLSDSVVDLELDSQSNSMLGFANASIDVDHHAHSNITHTERFLKHLRKRTFPINFQVV
                     KTVSVNTETETNELEATTSFLTDTYKDMDIILVEKFLNINAFRPKYVDEPLMKLDSIH
                     DVQEINEKEYEAQVALNNLSSFVKFFMLSDSLCMIWDSNGVLLIDRFQLRNTTRLLEN
                     DVNAVKVIDYRVGVVNDIGLVLTEFEHTGSDYHIEFYAILSMLTNEIVLLKGEFNTGQ
                     RLGKIAALDKLRVTERDRFVDQIMVTNYHPTKKRTLDSFSAEILRKQKRQKHENTDIL
                     T"
     gene            <1027202..>1027726
                     /locus_tag="KLMA_60480"
                     /db_xref="GeneID:34717694"
     mRNA            <1027202..>1027726
                     /locus_tag="KLMA_60480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821161.1"
                     /db_xref="GeneID:34717694"
     CDS             1027202..1027726
                     /locus_tag="KLMA_60480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677551.1"
                     /db_xref="GeneID:34717694"
                     /translation="MLHVERFRFIYLRRVVGIRSMSTIKWNESEILVDRKSKFQARCC
                     KITTQADIANILEQLVQENKAIQKATHKHMYAWRTADVAHEKENGNNLKKGKKSSSTK
                     VAPVLKNVQQGSSDCGESGAGQRLLTLLERSHVVNVLVIVTRWYGGTALGPARFRHIT
                     TTAVESLRNAGFLT"
     gene            complement(<1027765..>1028697)
                     /locus_tag="KLMA_60481"
                     /db_xref="GeneID:34717695"
     mRNA            complement(<1027765..>1028697)
                     /locus_tag="KLMA_60481"
                     /product="NADPH-dependent alpha-keto amide reductase"
                     /transcript_id="XM_022821162.1"
                     /db_xref="GeneID:34717695"
     CDS             complement(1027765..1028697)
                     /locus_tag="KLMA_60481"
                     /codon_start=1
                     /product="NADPH-dependent alpha-keto amide reductase"
                     /protein_id="XP_022677552.1"
                     /db_xref="GeneID:34717695"
                     /translation="MTNQKFFTLSNGNKIPAVAVVGTGTKWYKAEETDATFSQELTDI
                     VKLSLDTVPGIVHIDAAETYKTYPELGAALKETKKPREEIFITDKFSSLHKISEDPKS
                     ALETALKKLGVDYVDLYLIHSPFFDKDLNIDLETAWKQLEELYKSGKAKNIGVSNFTV
                     EDLKKVLAIAEIKPQVNQIEFSPFLQNQTPGIVEFSQKNDILLEAYSPLGPLQKKPTD
                     ADQQPFYQYLKELSEKYNKTEAQVLLLWVYKRGILPVTTSAKIERIKQAQDIFSFDLT
                     EEEVKKITDLGLQHEPVRLYWVDFYTKYNSEAQK"
     gene            complement(<1029205..>1030851)
                     /gene="DLD2"
                     /locus_tag="KLMA_60482"
                     /db_xref="GeneID:34717696"
     mRNA            complement(<1029205..>1030851)
                     /gene="DLD2"
                     /locus_tag="KLMA_60482"
                     /product="D-lactate dehydrogenase [cytochrome] 2"
                     /transcript_id="XM_022821164.1"
                     /db_xref="GeneID:34717696"
     CDS             complement(1029205..1030851)
                     /gene="DLD2"
                     /locus_tag="KLMA_60482"
                     /codon_start=1
                     /product="D-lactate dehydrogenase [cytochrome] 2"
                     /protein_id="XP_022677553.1"
                     /db_xref="GeneID:34717696"
                     /translation="MIRTFVPGRARASARLLSHAKAPSRTFSLLHRVPVKSTITRTSL
                     STEQFRFYSDKPQPKLTVENYPNVKRLESFKKLGKEDLDYFKTILSEQEILEANAEED
                     LAFYNEDWMRKYRGQSKLVLRPKTTQQVSQILKYCNEQHLAVVPQGGNTGLVGGSVPV
                     FDEIVLSLTQLNKIREFDEVSGILKCDAGVILEAADTFLAEHGYIFPLDLGAKGSCHV
                     GGVVATNAGGLRLLRYGSLHGTVLGLEVVLPNGEIVNSMQALRKDNTGYDLKQLFIGS
                     EGTIGVITGVSILCPPRPNAFNVSFLGVESYEAVQKVFVQAKKELGEILSAFEFMDLK
                     SQNLTKIHLADMEHPLSDDHPFYILIETSGSNKDHDDAKLESFLESAMEEGLVLDGVV
                     AQDETELKNLWQWREMVPESSQAAGGVYKYDVSLPLKDLYSLVDAANARLEEHGLSST
                     EDESKPVISAVGYGHVGDGNLHLNVAVRRYTKEVEKCLEPFVYEFVASKNGSISAEHG
                     LGFQKKNYIGYSKSDQEIKMIKQLKQLYDPNAILNPYKYV"
     gene            <1031759..>1032367
                     /gene="HNT1"
                     /locus_tag="KLMA_60483"
                     /db_xref="GeneID:34717697"
     mRNA            join(<1031759..1031813,1031973..>1032367)
                     /gene="HNT1"
                     /locus_tag="KLMA_60483"
                     /product="hit family protein 1"
                     /transcript_id="XM_022821165.1"
                     /db_xref="GeneID:34717697"
     CDS             join(1031759..1031813,1031973..1032367)
                     /gene="HNT1"
                     /locus_tag="KLMA_60483"
                     /codon_start=1
                     /product="hit family protein 1"
                     /protein_id="XP_022677554.1"
                     /db_xref="GeneID:34717697"
                     /translation="MSAAAAHDAACIFCKIIKGEIPSFKLIETQYSYSFLDIQPTTEN
                     HILIIPKYHGGKLHNIPDEYLADLLPVTKKLVKLIGIDKDGPEGAGYNVLQNNGRIAH
                     QEVDHVHFHLIPKTDAKTGLIVGWPAQQSDFNKLGEQHKKLLAKLEG"
     gene            <1033030..>1035528
                     /gene="CDC48"
                     /locus_tag="KLMA_60484"
                     /db_xref="GeneID:34717698"
     mRNA            <1033030..>1035528
                     /gene="CDC48"
                     /locus_tag="KLMA_60484"
                     /product="cell division control protein 48"
                     /transcript_id="XM_022821166.1"
                     /db_xref="GeneID:34717698"
     CDS             1033030..1035528
                     /gene="CDC48"
                     /locus_tag="KLMA_60484"
                     /codon_start=1
                     /product="cell division control protein 48"
                     /protein_id="XP_022677555.1"
                     /db_xref="GeneID:34717698"
                     /translation="MPEEHKKLLDGSGAAPEADDATATAILRRKKKDNMLLVDDAVND
                     DNSIIAINSNTMDLLQLFRGDTVLVKGKKRKDTVLIVMIDDELEDGVCRVNRVVRNNL
                     RIRLGDLVTIHPCTDIKYASRISVLPIADTIEGLTGNLFDVYLKPYFVEAYRPVRKGD
                     HFVVRGGMRQVEFKVVDVEPEEYGVVAQDTIIHSEGEPINREDEENNINEVGYDDIGG
                     CRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVANETGAFF
                     FLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRV
                     VSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGVPDVTGRLEVLR
                     IHTKNMKLADDVDLEKLAAETHGYVGADIASLCSEAAMQQIREKMDLIDLDEDEIDAE
                     VLDSLGVTMDNFRFALGNSNPSALRETVVESVNVTWDDIGGLDDIKEELKETVEYPVL
                     HPDQYTKFGLSPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESE
                     SNIRDIFDKARAAAPTVVFLDELDSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAK
                     KNVFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDEAGRLSILTAQLRNTPLEPGLDL
                     KAIAQATQGFSGADLSYIVQRAAKFAIKDSIEAQRRAEAIKKEKEAEEEGTTKVKTEE
                     DVEMSDVQQEDPVPYITKEHFTEAMKTAKRSVTDTELRRYEAYAQQMKASRGQFGNFS
                     FDDASGAAPAQTGTEGSGAAFGEAAGEDDDDLYS"
     gene            complement(<1035832..>1036836)
                     /gene="PCL2"
                     /locus_tag="KLMA_60486"
                     /db_xref="GeneID:34717699"
     mRNA            complement(<1035832..>1036836)
                     /gene="PCL2"
                     /locus_tag="KLMA_60486"
                     /product="PHO85 cyclin-2"
                     /transcript_id="XM_022821167.1"
                     /db_xref="GeneID:34717699"
     CDS             complement(1035832..1036836)
                     /gene="PCL2"
                     /locus_tag="KLMA_60486"
                     /codon_start=1
                     /product="PHO85 cyclin-2"
                     /protein_id="XP_022677556.1"
                     /db_xref="GeneID:34717699"
                     /translation="MSEYQALVHFNAQAVNLEMVHFLAATAASVISTTDTDVRNGGGS
                     AVSLVDFIKTLISHSNVQTPTLMATTVYLIKLRSILPTDVTGISTTRHRIFIGCLILA
                     AKNLNDSSPLNKHWTKYTNGLFTLEDINAIERELLALFGWNLNFSTQDLTRALSHFLV
                     PIQHQLSARSAAHKQELMAKQNSASMLLFNAPVSGYTKQHLVNVEAHSRSSSHMSIPS
                     LSSSNTLSTIESTSTMSSVPTGAYSSSSSSAPSSAGSSSSLSSSAGSNAYQYSKHTRL
                     KVINEEPLEKPPSKRKFGLTKPIILSSKSYTDLKALPAVAVTNSRSVSSKSGWASIFN
                     "
     gene            complement(<1037837..>1039057)
                     /gene="VCX1"
                     /locus_tag="KLMA_60487"
                     /db_xref="GeneID:34717700"
     mRNA            complement(<1037837..>1039057)
                     /gene="VCX1"
                     /locus_tag="KLMA_60487"
                     /product="vacuolar calcium ion transporter"
                     /transcript_id="XM_022821168.1"
                     /db_xref="GeneID:34717700"
     CDS             complement(1037837..1039057)
                     /gene="VCX1"
                     /locus_tag="KLMA_60487"
                     /codon_start=1
                     /product="vacuolar calcium ion transporter"
                     /protein_id="XP_022677557.1"
                     /db_xref="GeneID:34717700"
                     /translation="MDSNTPLLSSTRAGVRHSTSALANCAEVSKIVFYSSPVNYLLVF
                     VPLGLLFGYGGFSSTWVFILNFMSIIPLAAILAFATEQLSDKAGSTIGGLLNATLGNA
                     VELIVSVIALKEGQIRIVQASMLGSILSNLLLVLGFCFVCGGYNRTQQKFNQTAAQTM
                     SSLLAISSASLLIPAAFKATLPDDKKSVHFVDAKILSLSRATSIVLLIVYVLFLVFQL
                     GSHREMFEQQNEETEEVLHNQEQRDLVGESMSITSSLVILTITTVLVSICADFLVGTI
                     DDIVASSGLSKTFIGLIVIPIVGNAAEHVTSVIVAMKDKMDLALSVAIGSSLQISLFV
                     TPFMVLVGWAIDVPMTLNFATFETVIMLISVFLSNYLILDGESNWMEGSMSLAMYVLV
                     ALAFFFYPDEQAVK"
     gene            complement(<1039658..>1041196)
                     /locus_tag="KLMA_60489"
                     /db_xref="GeneID:34717701"
     mRNA            complement(<1039658..>1041196)
                     /locus_tag="KLMA_60489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821169.1"
                     /db_xref="GeneID:34717701"
     CDS             complement(1039658..1041196)
                     /locus_tag="KLMA_60489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677558.1"
                     /db_xref="GeneID:34717701"
                     /translation="MALLSYASDLFMPLFCSSRAYVVVFNLINLIAIYAAVYWSSSFL
                     QSTYNVPGIFAPNSQDYFRTSLLGFLSPFLLYFIKTFLFSVNSSYLALNIVVEHCIND
                     WFMLLIIFSLAYPQLQDSTSPIGGFSFHFGKTDSSTVWHIIPKQCYIFGISWSFSEVV
                     ISVMETLYNYEEVSSFTESDLKASMMSNTSDGYEDIRKEIELGKCVSIRRNRSKISSN
                     VYSPGYGSTNFPSVASTPESATNQDINSDESTMVINFNTDTMKFLNDIESHGNDMGNY
                     QWIPIRTGSFSYQQSSPLIQHKVFPRIQNWKELMSKIVVSNLIHIDYILNNVGQALIL
                     SIYFIYVPSHPSLFTKIVVYFGSKSFANFLLSVVIPFFVIRALFFVFLYTWKDMSVSV
                     YNAGSSSQEQQHPSRSLNTEFAYDTINTPLMMQTSAPPNLTSIRSVSPENVLLYHSIH
                     PPVDVNLQTDDSKLLRLSRRIVNFWQKSSTNPWFVPIGLTCWSITVFVIAMLATVKFD
                     SCHN"
     gene            complement(<1042139..>1042993)
                     /locus_tag="KLMA_60490"
                     /db_xref="GeneID:34717702"
     mRNA            complement(<1042139..>1042993)
                     /locus_tag="KLMA_60490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821170.1"
                     /db_xref="GeneID:34717702"
     CDS             complement(1042139..1042993)
                     /locus_tag="KLMA_60490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677559.1"
                     /db_xref="GeneID:34717702"
                     /translation="MRTLRTRSSRDSSVSTAYGNVSSGNSRGSMQTITPEEPGKLEFG
                     LEFPGSNNNNNNESEEASSSRSHSQSMALLSEECDVMQDTQQHSLKNTRILEIEIAKM
                     VSDLEKKDPRTEEMTKIISLLNRSLSAISHWSLQAQLSHWENRKEKDDRAAVEKDLVK
                     KEAEFFKNKLQKQTRFLIDSSSTSQPDNIPSSLSSPTSKIANLSTFPNNNSNANNSDV
                     LLSPKRVTKQRKLASPRRNESQIHPPTPSQSLKLVENTKPHPRLKRNLNDQTNQGLIR
                     VFHLEKGR"
     gene            complement(<1043983..>1044297)
                     /gene="RPP1B"
                     /locus_tag="KLMA_60491"
                     /db_xref="GeneID:34717703"
     mRNA            complement(<1043983..>1044297)
                     /gene="RPP1B"
                     /locus_tag="KLMA_60491"
                     /product="60S acidic ribosomal protein P1-beta"
                     /transcript_id="XM_022821171.1"
                     /db_xref="GeneID:34717703"
     CDS             complement(1043983..1044297)
                     /gene="RPP1B"
                     /locus_tag="KLMA_60491"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P1-beta"
                     /protein_id="XP_022677560.1"
                     /db_xref="GeneID:34717703"
                     /translation="MSDAVISYASLILADAGLDVTADNLLTLTKAAGASVDNVWAEVF
                     AKALEGKDIKEVLSGFHAAGPAAPAAGAAAASGAAEEAAEEAAESEKEESDDDMGFGL
                     FD"
     gene            complement(1044976..1045048)
                     /locus_tag="KLMA_R616"
                     /db_xref="GeneID:34718775"
     tRNA            complement(1044976..1045048)
                     /locus_tag="KLMA_R616"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:34718775"
     gene            complement(<1046099..>1046365)
                     /locus_tag="KLMA_60492"
                     /db_xref="GeneID:34717704"
     mRNA            complement(<1046099..>1046365)
                     /locus_tag="KLMA_60492"
                     /product="ATPase inhibitor"
                     /transcript_id="XM_022821172.1"
                     /db_xref="GeneID:34717704"
     CDS             complement(1046099..1046365)
                     /locus_tag="KLMA_60492"
                     /codon_start=1
                     /product="ATPase inhibitor"
                     /protein_id="XP_022677561.1"
                     /db_xref="GeneID:34717704"
                     /translation="MLSRSTRSVLTRVSRIQPIAVRMYSSEGSIGSTRPDGSSDAFTK
                     RERAQEDFYVKQHEKEQLQHLKESVKQQEKKIENLEEKLDNLTK"
     gene            complement(<1047088..>1048416)
                     /gene="LYS21"
                     /locus_tag="KLMA_60493"
                     /db_xref="GeneID:34717705"
     mRNA            complement(<1047088..>1048416)
                     /gene="LYS21"
                     /locus_tag="KLMA_60493"
                     /product="homocitrate synthase"
                     /transcript_id="XM_022821173.1"
                     /db_xref="GeneID:34717705"
     CDS             complement(1047088..1048416)
                     /gene="LYS21"
                     /locus_tag="KLMA_60493"
                     /codon_start=1
                     /product="homocitrate synthase"
                     /protein_id="XP_022677562.1"
                     /db_xref="GeneID:34717705"
                     /translation="MSSNQEFQAVTESASNGSTFQQNPYGPNPADYLSNVNNYQLIDS
                     TLREGEQFANAFFDTEKKIEIAKALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKA
                     KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVK
                     SKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLK
                     SVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVAVLGIGERNGITPLGGLMARMIV
                     AAPEYTKSKYKLHKIRDIENLVAEAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPS
                     TYEILDPHDFGMKRYIHFANRLTGWNAIKSRVDQLNLNLTDGQIKEVTAKIKKLGDIR
                     PLNIDDVDSIIKDFHAEVSTPQLTAVRRDNEDVNDISIHDEPAAKKAKVE"
     gene            complement(<1049003..>1051432)
                     /gene="CDC53"
                     /locus_tag="KLMA_60494"
                     /db_xref="GeneID:34717706"
     mRNA            complement(<1049003..>1051432)
                     /gene="CDC53"
                     /locus_tag="KLMA_60494"
                     /product="cell division control protein 53"
                     /transcript_id="XM_022821175.1"
                     /db_xref="GeneID:34717706"
     CDS             complement(1049003..1051432)
                     /gene="CDC53"
                     /locus_tag="KLMA_60494"
                     /codon_start=1
                     /product="cell division control protein 53"
                     /protein_id="XP_022677563.1"
                     /db_xref="GeneID:34717706"
                     /translation="MSDTLPRSDDLEATWNFVKPGIDQILDRDGTSSLKTNRVQKVLS
                     PRMYMEVYTAIYNYCVNKSRSTGHFQSDVIGKQMNQSSILVGGEIYENLKSYLKDYIA
                     NLKKDDNETFLNFYVRRWERFTIGAIFLNRVFDYMNRYWVQKERSDGKRHIFDAHTLC
                     LMTWKEVMFETHKTELVHEILEQLDLQRRGELVNKTAITVAIKSFVILGIDPSDLKKL
                     NLNVYIQNFEQLFLQNTKEYYTKMSNEFLQTHSVSEYIEKANECITFEEKDMVLYLDS
                     HTTAPLSAALNQVLIANHAEELKREFITLLDRQDQRLIKLIYELMKRDYRMLPDLVDT
                     FDTYIKRVGNEEIDKLLEAHQRNEANEPHSRKQAGLPPRDYLHCLIRVYKLFYNITID
                     CFDNHPAFAKALDYGCRCFINNNSFALPPGSPKSATSKTPEMLAKYSDQLLKRSTKNA
                     EQIDLNVDDIMTVFKFLADKDAFEMHYRKNLAKRLIHGSSKSEADEEIIIQRLQSENS
                     LEYTSKITKMLQDVKLSKNLHDEFTSFIAQDSDSSNTAREKIPELEPLILADNVWPFS
                     YQPTEFTLPPILESSKNKLEAMYTEKHSGRVLKWLWPMSRGEIKAHIGKPGKPPFLFT
                     VTIFQMAILALFNDISTLTFEQIQERTNLKATQIASNIYPFVKMRLLTQSPEGVDNMI
                     RLDTKYTLNKPYRLSKTSVNFAAAVKNDLTFTSGINGSSLNEDEISEQKTAEKELNQQ
                     RLMFLRACIVRIMKAKRRLPHTSLMNECIAESQQRFNAKVPMIKKAIDNLIEQEYLKR
                     TDDGECYEYLA"
     gene            complement(<1051998..>1053437)
                     /gene="SRF1"
                     /locus_tag="KLMA_60495"
                     /db_xref="GeneID:34717707"
     mRNA            complement(<1051998..>1053437)
                     /gene="SRF1"
                     /locus_tag="KLMA_60495"
                     /product="hypothetical membrane protein"
                     /transcript_id="XM_022821176.1"
                     /db_xref="GeneID:34717707"
     CDS             complement(1051998..1053437)
                     /gene="SRF1"
                     /locus_tag="KLMA_60495"
                     /codon_start=1
                     /product="hypothetical membrane protein"
                     /protein_id="XP_022677564.1"
                     /db_xref="GeneID:34717707"
                     /translation="MSAGSVERMHALSKGGKDGHVSPKKPKASPVAGLSLSGGDPSNE
                     NGQTPNILNAYSLDARTVPPFAVDTAAVSGNQRRSKRLESDQMFKDTFLMSHADKWSE
                     FLQNAGSNPSYTSRIVLERKKHGESITTSDTKGHAVSKGRSTIVSHHTASSVAEKGEK
                     SEKVGSSSITSETISDNKGYDYESTTDSSYNEEAERVRREILQDLDGEWEGGKRLDAI
                     FNAPIPENYELSNQRDRSEWLKYIAQLKAFYYLKKEGSKASMEGHPYDNGMFHSLVNK
                     GKDKFHDKKNSWASLERRKKQQWLPRIRRLLLQSQYLPLSLRFIIGILCIVSLSLATR
                     IYQNSDSTVASIESSIPQQPSTIMALCVNSIAIVYLIYIGYDEFSGKPLGIRDPLGKL
                     RLIMLDLLFIIFSSANLSLTFNTLYDSRWVCTSNGRSISDLPHVGYICHKQRALAAFL
                     FLVLVTWVLTFTISIVRVVERVSSGSPRI"
     gene            <1054019..>1054945
                     /locus_tag="KLMA_60496"
                     /db_xref="GeneID:34717708"
     mRNA            <1054019..>1054945
                     /locus_tag="KLMA_60496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821177.1"
                     /db_xref="GeneID:34717708"
     CDS             1054019..1054945
                     /locus_tag="KLMA_60496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677565.1"
                     /db_xref="GeneID:34717708"
                     /translation="MYQVQVRSFSVFRTLKKHQEFGSTIKEYINNPVKLLVIPITNKK
                     SYFYFKYSNELLNNDSRLIRYETKLANKAAKIWQNMQESDKSYNKKIVAWITKLLDRI
                     PWTESSLQTIPSESYILKRIESGSKTNVTFHEYERAKNDSSVVSMKPKPICVYFPKSI
                     LNESTINKQLKELADAGQQYNKKYAALCAVGIPITFPLILVPVVPNVPGFYLAYRLYC
                     NAKAYFGAKHLESLIKSEDQTLEMRNLVQYSDILQGANSMQARNEREEVVLLRESDLD
                     RILDSLEIHEISTDLRKAIRQETSRLECQSKD"
     gene            complement(<1056613..>1058466)
                     /gene="VMA1"
                     /locus_tag="KLMA_60497"
                     /db_xref="GeneID:34717709"
     mRNA            complement(<1056613..>1058466)
                     /gene="VMA1"
                     /locus_tag="KLMA_60497"
                     /product="v-type proton ATPase catalytic subunit A"
                     /transcript_id="XM_022821178.1"
                     /db_xref="GeneID:34717709"
     CDS             complement(1056613..1058466)
                     /gene="VMA1"
                     /locus_tag="KLMA_60497"
                     /codon_start=1
                     /product="v-type proton ATPase catalytic subunit A"
                     /protein_id="XP_022677566.1"
                     /db_xref="GeneID:34717709"
                     /translation="MAGALENARKELKRVSLEDHAESEYGSIYSVSGPVVIAENMIGC
                     AMYELVKVGHDNLVGEVIRIDGEKATIQVYEETTGVTVGDPVLRTGKPLSVELGPGLM
                     ETIYDGIQRPLKAIKEISQSIYIPRGIDAPALSRSIKWQFTPGKYQVGDHITGGDIFG
                     TIFENSLLDDHKILLPPRARGTVTWIAPAGEYTVDEKILELEFDGVKYDHSMYHTWPV
                     RVPRPVTEKLAADYPLLTGQRVLDSLFPCVQGGTTCIPGAFGCGKTVISQSLSKYSNS
                     DVIIYVGCGERGNEMAEVLMEFPELYTEISGRKEPIMKRTTLVANTSNMPVAAREASI
                     YTGITLAEYFRDQGKNVSMIADSSSRWAEALREISGRLGEMPADQGFPAYLGAKLASF
                     YERAGKAVALGSPDRIGSVSIVAAVSPAGGDFSDPVTTSTLGITQVFWGLDKKLAQRK
                     HFPSINTSVSYSKYTNVLGKFYESNYPEFPVLRDRMKEILSNAEELEQVVQLVGKSAL
                     SDGDKITLDIASLIKEDFLQQNGYSTYDAFCPIWKTYDMMKAFIAYHDEAQKSVSNGA
                     NWAKLSEATRDVKHAVSSSKFFEPSRGEKEVHAEFEKLLTNIQDRFAESTD"
     gene            complement(<1059288..>1060016)
                     /locus_tag="KLMA_60498"
                     /db_xref="GeneID:34717710"
     mRNA            complement(<1059288..>1060016)
                     /locus_tag="KLMA_60498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821179.1"
                     /db_xref="GeneID:34717710"
     CDS             complement(1059288..1060016)
                     /locus_tag="KLMA_60498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677567.1"
                     /db_xref="GeneID:34717710"
                     /translation="MTEPSQRSEYGWGFEPIVGGSNKAGTLQGADNSQEQSLHHSEKS
                     VRDLVISKQHARVFPVQNRLMGRMEDQLVRWKRPPSSHVGTMQVIEGTHPFQQDQTSM
                     AQTWCQIKDAFSVRMQKLNSDDTDEEDLEDIIFSDQGSPVNCHSTGNDNNNDSSNRDQ
                     YNAKTSKTTNAVPVTMRLPSRQDDLTINSRYTYHYPIPQYYLSQQATGSDENRVSTTY
                     NNNSRQVEEGDDSFSYASWLCSPY"
     gene            <1061028..>1062110
                     /gene="PPH21"
                     /locus_tag="KLMA_60499"
                     /db_xref="GeneID:34717711"
     mRNA            <1061028..>1062110
                     /gene="PPH21"
                     /locus_tag="KLMA_60499"
                     /product="serine/threonine-protein phosphatase PP2A-1
                     catalytic subunit"
                     /transcript_id="XM_022821180.1"
                     /db_xref="GeneID:34717711"
     CDS             1061028..1062110
                     /gene="PPH21"
                     /locus_tag="KLMA_60499"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase PP2A-1
                     catalytic subunit"
                     /protein_id="XP_022677568.1"
                     /db_xref="GeneID:34717711"
                     /translation="MDVDTDVPMHDAVEDQLDPTLDEGSTGYDNGLTNLSPGTSGIAD
                     NKSAKPVELTSSSIGQLDGWLEKLSQCQYLSEEDVGKLCKMAVDVLQFEDNVQPVSVP
                     VTICGDVHGQFHDLIELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVALKVRYPN
                     RITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLH
                     GGLSPMIETIDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDIS
                     EQFNHTNNLSLIARAHQLVMEGYAWSHQQSVVTIFSAPNYCYRCGNQAAIMEVDDTLN
                     RQFLQYDPSVRPGEPTVSRKTPDYFL"
     gene            complement(<1062433..>1063017)
                     /locus_tag="KLMA_60500"
                     /db_xref="GeneID:34717712"
     mRNA            complement(<1062433..>1063017)
                     /locus_tag="KLMA_60500"
                     /product="probable allantoinase 1"
                     /transcript_id="XM_022821181.1"
                     /db_xref="GeneID:34717712"
     CDS             complement(1062433..1063017)
                     /locus_tag="KLMA_60500"
                     /codon_start=1
                     /product="probable allantoinase 1"
                     /protein_id="XP_022677569.1"
                     /db_xref="GeneID:34717712"
                     /translation="MTRLPNFNDFLSLELPAQVDVLDVLFEHTDSLVWFTLQNKQFMS
                     GRWSSYKEFLEAIRSRLQQVCDDTEKEGISSRGVDHLANIIGAHPRLGEPKAKLSEHS
                     KREQSKLTGTGNNSPDVLAKLKQLNDKYESTYEGLKFVVFVNGRSYEQISKVMEQRIN
                     SGNSWFQECRLAVDEMVDIALDRLDKCSEMKGKI"
     gene            <1063662..>1064261
                     /gene="RDI1"
                     /locus_tag="KLMA_60501"
                     /db_xref="GeneID:34717713"
     mRNA            <1063662..>1064261
                     /gene="RDI1"
                     /locus_tag="KLMA_60501"
                     /product="rho GDP-dissociation inhibitor"
                     /transcript_id="XM_022821182.1"
                     /db_xref="GeneID:34717713"
     CDS             1063662..1064261
                     /gene="RDI1"
                     /locus_tag="KLMA_60501"
                     /codon_start=1
                     /product="rho GDP-dissociation inhibitor"
                     /protein_id="XP_022677570.1"
                     /db_xref="GeneID:34717713"
                     /translation="MGEEEDFKEFEEETDNYKVGAKKTVEEYQKLDADDEALRKWKES
                     LGLGGDVLPLEYPGDTRRVVIKQIQLIVDTEPQPITFDLTNEKTLKELASKRYKIKEK
                     SVYHLKITFKVQHEIITGLRYVQYTKKAGIAVDKIDDHLGSYAPNTVNKPVYEVELPE
                     SEAPSGFLVRGNYSAVSKFIDDDKNDHLTLNWGVEIVKR"
     gene            complement(<1064463..>1065821)
                     /gene="RBS1"
                     /locus_tag="KLMA_60502"
                     /db_xref="GeneID:34717714"
     mRNA            complement(<1064463..>1065821)
                     /gene="RBS1"
                     /locus_tag="KLMA_60502"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821183.1"
                     /db_xref="GeneID:34717714"
     CDS             complement(1064463..1065821)
                     /gene="RBS1"
                     /locus_tag="KLMA_60502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677571.1"
                     /db_xref="GeneID:34717714"
                     /translation="MEELKVTPALLIALFQKPQDRVFLIELENSIIDFVRSSAYTYQL
                     KPMNSYYRLLSHQVAEYHGLQHTVSKDNDKCVIVYKQSDYEPKTNLVLLQQLEPQVMY
                     QFPPEYYALASMAAANNQQQILHKSLRTKSRQSSNHRRSSTSTTPDSSVNGAVTDTNA
                     EDASTGTGKNQPGTTANKKKVKILKRENDSKQEESKQTSKKDNGSGTESGTEETSAVD
                     DSETANNKDVTPIDLEEQRKLKEQQYNEEKEKIFSGSPLSLTPISTPPVTPTKLSTAN
                     RLNDMDDDSPQPHQFETSRFRLNNQNEMRYLKKTHQQHHNRKQYSNNNNSNNNNNNNN
                     NNGNGSGNIHNHNNSNNNRYNKGSIRQHHIQPYFGMPPPMGPMGSGAIPYGYPMIAPM
                     EYMYYPMGNPIPNSQMMIPGQPLYTISPPVYQPYEKKSNTKYDSNGYRKNSGKHNNQR
                     TD"
     gene            <1066761..>1069634
                     /gene="UFD2"
                     /locus_tag="KLMA_60503"
                     /db_xref="GeneID:34717715"
     mRNA            <1066761..>1069634
                     /gene="UFD2"
                     /locus_tag="KLMA_60503"
                     /product="ubiquitin conjugation factor E4"
                     /transcript_id="XM_022821184.1"
                     /db_xref="GeneID:34717715"
     CDS             1066761..1069634
                     /gene="UFD2"
                     /locus_tag="KLMA_60503"
                     /codon_start=1
                     /product="ubiquitin conjugation factor E4"
                     /protein_id="XP_022677572.1"
                     /db_xref="GeneID:34717715"
                     /translation="MTLLRDIFMVTLDPNDSKGYTFIGDLEDVSELSGDSVDSILLYQ
                     LTENEGLDEGPVQYLNSCFQRCQQFKRISKKSLNEQQTAILQEIDRLIIGYALVCFEV
                     EEFAIKGSLEQYIVNILRDLDKFTDLLQAMINRAIQEGTLFEFAESFFRTLQSHIMKL
                     DSQVGFDMSDSSIYNNILTLFELFVSFKPMANIFTSLPGFFADHTTEANQFEKVTLMG
                     PILSLSPLQTAVALKNYIDPDTQSQKQTNMIHTSLQTEHNVVLQRLFFIVDKIIRASQ
                     ESRSDLLTYFGHIVNKNHLRRGDHAQANKLASNAFMTNITLILIKFSLPFLDVSYKKI
                     DKIDVNYFNNLNLYIDLNQETRMNSDIKEADEFYEQNKKSDQEEPNFISHCFFLTLTY
                     LHYGMGGTILFDERYAPEITKLKEHLTHLRQVISNSQNSMMARFGEIQLKQLEKRYNH
                     LSSIHSACQGFFSNKTLHLEVFDFISGASTFLIRVIDPSHQYPFHTIELPLIPDQIGV
                     ENVDNAEYLRKNAPVPFKYYPEFVIEGLINYCQYVTKYVHNPLFKNPRLHSYIELATV
                     ILRCPELISNPHLKGKMVQVLSIGAMPMSDNTPGFMMEIFENNDIVLKNLLYGLLDFY
                     VIVEKTGSSSQFYDKFNARYSISIILEALYNIPHYRKQLLWQSQNNSDFFIRFVARML
                     NDLTFLLDEGLSTLAEVHNLQHELENRSKGLPPSREEDTQELQSRLKSAERQAKSSCG
                     LSEKSLVLFNIFTNHIPEAFASAEIVDRLAAMLDYNLEMLVGSKCRELKVKDPSKYQF
                     NPKTLLQTLATIYINLANEPDFVAAVARDGRSFNKELFKKAVHILSVKTGLFSEEKSR
                     KLLNFAEEADKMRLQEEQEDLEMNDAPDEFLDPLMYTIMNDPVILPTSKVTIDRSTIK
                     AHLLSDSTDPFNRSPLKLEDVIPNEELKRRIAEFKKSKRLNRD"
     gene            complement(<1069917..>1070764)
                     /gene="RPL35B"
                     /locus_tag="KLMA_60504"
                     /db_xref="GeneID:34717716"
     mRNA            complement(join(<1069917..1070276,1070762..>1070764))
                     /gene="RPL35B"
                     /locus_tag="KLMA_60504"
                     /product="60S ribosomal protein L35"
                     /transcript_id="XM_022821186.1"
                     /db_xref="GeneID:34717716"
     CDS             complement(join(1069917..1070276,1070762..1070764))
                     /gene="RPL35B"
                     /locus_tag="KLMA_60504"
                     /codon_start=1
                     /product="60S ribosomal protein L35"
                     /protein_id="XP_022677573.1"
                     /db_xref="GeneID:34717716"
                     /translation="MAGIKAYELRTKSKEQLENQLVELKKELAELKVQKLSRPSLPKI
                     NTVRKNIARVLTVISQNQRQAVRELYKGKKYQPKDLRAKKTRALRRALTKFEASQVTE
                     KQRKKQIAFPQRKYAIKA"
     gene            complement(<1072198..>1072743)
                     /gene="ARF1"
                     /locus_tag="KLMA_60505"
                     /db_xref="GeneID:34717717"
     mRNA            complement(<1072198..>1072743)
                     /gene="ARF1"
                     /locus_tag="KLMA_60505"
                     /product="ADP-ribosylation factor"
                     /transcript_id="XM_022821187.1"
                     /db_xref="GeneID:34717717"
     CDS             complement(1072198..1072743)
                     /gene="ARF1"
                     /locus_tag="KLMA_60505"
                     /codon_start=1
                     /product="ADP-ribosylation factor"
                     /protein_id="XP_022677574.1"
                     /db_xref="GeneID:34717717"
                     /translation="MGVSFSKLFSNLFGHKEMRILMVGLDGAGKTTVLYKLKLGEVVT
                     TIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRARIAE
                     AREVLQRMLNEDEIRNAVLLVFANKQDLPEAMPAAEITEKLGLHSIRQRPWYIQATCA
                     TSGEGLYEGLEWLSTTLKNQS"
     gene            complement(<1074242..>1075291)
                     /gene="NUS1"
                     /locus_tag="KLMA_60506"
                     /db_xref="GeneID:34717718"
     mRNA            complement(<1074242..>1075291)
                     /gene="NUS1"
                     /locus_tag="KLMA_60506"
                     /product="probable undecaprenyl pyrophosphate synthetase"
                     /transcript_id="XM_022821188.1"
                     /db_xref="GeneID:34717718"
     CDS             complement(1074242..1075291)
                     /gene="NUS1"
                     /locus_tag="KLMA_60506"
                     /codon_start=1
                     /product="probable undecaprenyl pyrophosphate synthetase"
                     /protein_id="XP_022677575.1"
                     /db_xref="GeneID:34717718"
                     /translation="MSGENVVRTRLPPATKTPLDPSVNGLRKTVKQVMGSDVDELLKH
                     KKPDALSDGKQQEQKQTIGGQIEFAVYKTLLVILYVFYAVTRYFQREYNRIAIKLLDL
                     AYNPSNSPQLIRQDVTKLQKIPKRLAAILESKAEGDIGGGLPGLINDASDVVCWTVSA
                     GIRYLTLYDYDGKMKQNVDGLRAGIHHKLTKYFGPDHVPKFAIKIPHTNQVFFNLSDE
                     ESATGYVSDESSTSSSGHKNRVAIEISLLSNVDGRETILELTKTMADLCAKGQLNADD
                     VDTNLVNQELTQLVGQEPDLLLYFGPALDLQGFPPWHIRLTELYWETDNDQVSYYVFI
                     RGLKQYAECKINVGK"
     gene            complement(<1075910..>1078351)
                     /gene="SNF3"
                     /locus_tag="KLMA_60507"
                     /db_xref="GeneID:34717719"
     mRNA            complement(<1075910..>1078351)
                     /gene="SNF3"
                     /locus_tag="KLMA_60507"
                     /product="high-affinity glucose transporter SNF3"
                     /transcript_id="XM_022821189.1"
                     /db_xref="GeneID:34717719"
     CDS             complement(1075910..1078351)
                     /gene="SNF3"
                     /locus_tag="KLMA_60507"
                     /codon_start=1
                     /product="high-affinity glucose transporter SNF3"
                     /protein_id="XP_022677576.1"
                     /db_xref="GeneID:34717719"
                     /translation="MIINSNHRKNISKAARLVLLRRRANGDNEAGVSGLPAGNKSNNG
                     LSGSASPQELYQENGEEFELSNFASLTDMESEIFLQPPAKQSKKISIFVGLFVAVGGF
                     LFGYDTGLINNVSQMPYVLKTIAPNKHQFTTSQISILVSFLSLGTFFGALFAPFISDR
                     YGRKTTMLFSTFFVFMVGNSLQVAATSMTLLVVGRVLSGLSVGLISAAVPLYQSEAAQ
                     KSVRGAIISTYQWAITWGLLVASAVSQGTYKRMNASSYRIPISLQYVWAFTLGVGVLF
                     LPESPRYYVFKDRLDLAAKSLSFLRGVPEDDSGLLEELVEIKATYDYELSFGKTSFLD
                     CFRSTKSRSKQRLRMMTGIALQAFQQVSGINFIFYYGVNFFNKTGIKNSYLVSFITYA
                     VNVVFNVPGLFLVEYIGRRKLLLGGGIVMTLANFTIAVTGLVADSKIANKVMIAFICL
                     FIASFSATWGGGVWVISAELYPLGVRAKCTSICAASNWLFNFICALITPYIVRIDNGQ
                     HSSTMGSKIFFVWGSLNAISVLVGYFTIYETSGLSLEEIDELYKNSSSGVDSMKWNKK
                     IRSMPELFQRNAQNDDSIGEEVVVTGNNVHNFGAAQGSSSNETNSNENSNEKYTSPIA
                     MPQFGARSIDHPSSASDMFSKRLPLAELNFVDLGNGLGITTYQRGPPSVLTDSSDEDE
                     EEQDLADAYSLEHASQDTEDLHHLHHLTSNRRNTNGSEPLSSKSGSSAAGTVRTSPPK
                     HNKHRREDFNMYMAQLINRGSQEAVSCSSEPKNHPIPHDIMSQWNSSSKEESNRRNSS
                     TDNSNPSTPKNTHHK"
     gene            complement(<1079038..>1082808)
                     /gene="SEC31"
                     /locus_tag="KLMA_60508"
                     /db_xref="GeneID:34717720"
     mRNA            complement(<1079038..>1082808)
                     /gene="SEC31"
                     /locus_tag="KLMA_60508"
                     /product="protein transport protein SEC31"
                     /transcript_id="XM_022821190.1"
                     /db_xref="GeneID:34717720"
     CDS             complement(1079038..1082808)
                     /gene="SEC31"
                     /locus_tag="KLMA_60508"
                     /codon_start=1
                     /product="protein transport protein SEC31"
                     /protein_id="XP_022677577.1"
                     /db_xref="GeneID:34717720"
                     /translation="MVKLAEYPRTATFSWSHDRVPVLATGTASGAIDADFSSTSTLEF
                     WSLLSFDEAKPKGSIVADARFNDLDWSKDNKIVAGALENGTVEFFDADAMKSVAKISK
                     HQGSVKTLSFNTKQSNVLVSGGSQGDIFVWDTNKIESADYSPFSSGSRTTPIDEVSSL
                     AWNQSLAHVFASASSSGYASIWDLKAKKEVLHLSYSSPTSGIKVPLTVVEWHPSNSTR
                     IATATNLDSEPVILVWDLRNSNVPMKVLANGHSKGVLSLDWCKQDENLLLSSGRDNTS
                     ILWNPEEGSLLTQFATRGNWVFKSKFAPEAPDLFASASFDNKIVVQTLQNLNTSLDAQ
                     ANESKQHASEDEFWNNVTENSVDDKPNTVKIQAPSWYGNRSPAAQWAFGGKLVKITND
                     QKGVSIVRPSVSGMEKNELFDESLKNKDFVKLINKRLSHKINATNEEDWNLLENLSMD
                     GTEIFLKEALSLDEAEEEQNEKETDQEGSDFFNDLNDKFVPSGSFELDFSESVKPITS
                     ALVKGDLRGALSHALEKDLLLEALIIGITSGDETLIDRAKNSYFTKYSQESSLARTLY
                     STAQKDVTDIVENIATSQWKEAVKLTFTYTKDEEKKNSLLVKLGERLLAEGNRKDAIL
                     LYLAGQSLDNIASIWLDEFTELESELKSRKDTLYEAHLECLTEFVERFTVLSDYINKD
                     VKITNQELISKFLEFVNVTATNGDFDLALRFLETLPGDNEEVKGEKQRVLIASGKSVS
                     SRTSNLSDATKSKQGRYSSVSANAPVAGIATPNPLLTGGQPSIASSTNARPRQAAYAS
                     YTPAATSTPNPYAPPVAAASNSTANPYAPPAAATNTAAVAANPYAPAVSSIPNNSTPA
                     GNHNTAMNGRTSFTPASGNIPANPYAPRSAATPLQPSSPVSHPPISGARTYSGQTPHL
                     HEKPIDGWNDLPSIQKEKPTRAKAVNTAPIGVVGSQYGTPELPSGPGSLSRIGSNPSF
                     PAPPPPPSNMRRTPKPTPPQVTSPPPPPPATSKKTSSYAPTVAPTQPATTNAPSFPVP
                     SSNPAPNGHSQFVPPPNPYSPSPPIATPTGIVPPKPQVSNLPAPVPKVAAATAPPPMK
                     MKRKSHAVGNASAANDLLSAIQSKPSPPSASVPAPPSSTAQISATPVSTATPESIQPA
                     GISEGDRPIVDFFLAELERVTPLIPQEYSKQLKDCNKRIKILIKHLEQHDLLTQPTID
                     KLHHIVELLKEGKYADALEIHKDLSENHSAEAGNWLTGVKRLINIAEATSSQ"
     gene            <1083467..>1083727
                     /gene="COA4"
                     /locus_tag="KLMA_60509"
                     /db_xref="GeneID:34717721"
     mRNA            <1083467..>1083727
                     /gene="COA4"
                     /locus_tag="KLMA_60509"
                     /product="coiled-coil-helix-coiled-coil-helix
                     domain-containing"
                     /transcript_id="XM_022821191.1"
                     /db_xref="GeneID:34717721"
     CDS             1083467..1083727
                     /gene="COA4"
                     /locus_tag="KLMA_60509"
                     /codon_start=1
                     /product="coiled-coil-helix-coiled-coil-helix
                     domain-containing"
                     /protein_id="XP_022677578.1"
                     /db_xref="GeneID:34717721"
                     /translation="MAEEQSKYYKQALEEYQEMDQEDPDAWDKRITNTGCYVENLALQ
                     LCHAETNDWRQCLGEMKLFKECWQSKGNDHRVGTVNAPQQQP"
     gene            <1083955..>1084566
                     /gene="SCM3"
                     /locus_tag="KLMA_60510"
                     /db_xref="GeneID:34717722"
     mRNA            <1083955..>1084566
                     /gene="SCM3"
                     /locus_tag="KLMA_60510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821192.1"
                     /db_xref="GeneID:34717722"
     CDS             1083955..1084566
                     /gene="SCM3"
                     /locus_tag="KLMA_60510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677579.1"
                     /db_xref="GeneID:34717722"
                     /translation="MNKSSLGVTKKKKSSLKRLTGVLKDLLVKESSSKSEEDQDHKTS
                     PKTRKDGVVYILSKENRLIPKLSDEEIMERHRKADENMKRVWSEIIAKYENIEDQGDT
                     IDLRTGEIIQDNGHLRNLNQNDRSSKISPDTAVVYKSVLRDILDIDDDQTLNTSIWNE
                     EEDTNQDSKLIKETEVEEEEFLEEPDSDNDYTSESYNNIAREK"
     gene            <1084889..>1086007
                     /gene="CPR6"
                     /locus_tag="KLMA_60511"
                     /db_xref="GeneID:34717723"
     mRNA            <1084889..>1086007
                     /gene="CPR6"
                     /locus_tag="KLMA_60511"
                     /product="peptidyl-prolyl cis-trans isomerase D"
                     /transcript_id="XM_022821193.1"
                     /db_xref="GeneID:34717723"
     CDS             1084889..1086007
                     /gene="CPR6"
                     /locus_tag="KLMA_60511"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase D"
                     /protein_id="XP_022677580.1"
                     /db_xref="GeneID:34717723"
                     /translation="MSEARPKTFFDISIGGEPAGRIVFELYSDVVPKTAENFVKLCEG
                     KSGFAKTKPDVPLSYKGSIFHRVIKSFMCQFGDFTNFDGTGGESIYGEKFEDENFTIK
                     HDKPFLLSMANAGANTNGSQAFITCGPTPHLNGKHVVFGEVIQGKRLVRVIEKIETDD
                     YDKPKKEVKIEDCGILPSDYQVPADAEATPADKYGDNYEENLSDDIKVDLKDVNSVLK
                     AVEAVKAIGTQQFKEKNFEVALEKYEKSSIMLRQFFPEDLPEEDILRVDTLRVSIFLN
                     IAVTASKLKNYSRTLSAATEALHADNINDKSKAKALYHRGLAYYNTKNPEMAVTDLEL
                     ASSYDAQNAAIQKALQEARVASKKLLEQQKKSLSKMFG"
     gene            <1086996..>1092179
                     /gene="RPB1"
                     /locus_tag="KLMA_60512"
                     /db_xref="GeneID:34717724"
     mRNA            <1086996..>1092179
                     /gene="RPB1"
                     /locus_tag="KLMA_60512"
                     /product="DNA-directed RNA polymerase II subunit RPB1"
                     /transcript_id="XM_022821194.1"
                     /db_xref="GeneID:34717724"
     CDS             1086996..1092179
                     /gene="RPB1"
                     /locus_tag="KLMA_60512"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB1"
                     /protein_id="XP_022677581.1"
                     /db_xref="GeneID:34717724"
                     /translation="MVDFPYSSAPLRTIKEVQFGLFSPEEVRGISVAKIEFPETMDES
                     QMKAKIGGLNDPRLGSIDRNYKCQTCGEGMSECPGHFGHIELAKPVFHIGFISKIKKV
                     CECVCMHCGKLLLDEYNEQMRQAIKIKDSKRRFNAVWTLCKTKMVCETEVPSPDDPTV
                     FISRGGCGHIQPSIRKDGLSLVGTWKKDKNAEDSDQPEKRIISAEEILNVFKHISPED
                     GWRLGFNEDFSRPEWMILTVLPVPPPPVRPSISFNESQRGEDDLTYKLGDILKANINV
                     QKLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSGRPIKSIRARLKGKEG
                     RIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLV
                     RNGPNEHPGAKYVIRENGDRIDLRYSKRAGDIQLQYGWKVERHITDNDPVLFNRQPSL
                     HKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP
                     LQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIEIDQVLNMLYWIPDWDGIIPTPAIL
                     KPKPLWSGKQILSMAIPNGIHLQRFDDGTTFLSPKDNGMLIIDGQIIFGVVDKKTVGS
                     SSGGLIHVVTREKGPEICARLFSNIQKVVNYWFLHNGFSIGIGDTIADEKTMREITEA
                     IAIAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAEVNLKDL
                     NNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPESKG
                     FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTT
                     RNSLGNVIQFIYGEDGMDASHIEKQSIDTIPGSDAAFEKRYKIDLLNEEYSLDPSLLE
                     SGSEIIGDSKLQLLLNEEYKQLVEDRQSLRKIFVDGEHNWPLPVNIKRIIQNSQQTFR
                     VDLTKPTDLTIEDVIHGVQNLQKKLLIVRGQSDILKEAQKNAITLFCCLLRSRLATRR
                     VIEEYRLNKQTFEWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG
                     VASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDPEYASDQEKAKEIRSAIEHTTLKSV
                     TVASEIYYDPDPRSTVIEEDEEIIQLHFSLMDEETEKSLDYQSPWLLRLELDRAAMTD
                     KDLTMGQVGEKIKETFKNDLFVIWSEDNADRLIIRCRVIRDPKTLDADVEAEEDHMLK
                     KIENSMLQKITLRGVEDITRVVMMKYDRKIPSETGEYHKVPEWVLETDGVNLSEVMSV
                     PGVDSSRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTS
                     QGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVILGQMAP
                     IGTGAFDVMIDDESLVKYMPEHKEVKTEGQDGGATPYSNDSGLANAEIDVKDELMFSP
                     LVESGGADALSGGFTAYGGTDYGSATSPFSGYGNAPTSPGFGEATSPSYSPTSPAYSP
                     TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
                     PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
                     YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPQYNPGSYSPADPKKEESDEEKKDN
                     K"
     gene            complement(<1092479..>1094548)
                     /gene="BPL1"
                     /locus_tag="KLMA_60514"
                     /db_xref="GeneID:34717725"
     mRNA            complement(<1092479..>1094548)
                     /gene="BPL1"
                     /locus_tag="KLMA_60514"
                     /product="biotin--protein ligase"
                     /transcript_id="XM_022821195.1"
                     /db_xref="GeneID:34717725"
     CDS             complement(1092479..1094548)
                     /gene="BPL1"
                     /locus_tag="KLMA_60514"
                     /codon_start=1
                     /product="biotin--protein ligase"
                     /protein_id="XP_022677582.1"
                     /db_xref="GeneID:34717725"
                     /translation="MNILVYNGAGSSPESVRHTIETFRTLLEPYYAVSPVSARTLETE
                     PWTSKTSAVVFPGGADLSYVRDCAKVIPKIRDFVYKDGGLFIGICAGGYFGSSYCEFA
                     RGDPNYEVSGPRDLKLFPGMARGPAFNGFRYNKEDGAKTVHLKVNGVDGMNEAYSYYN
                     GGAIFVDSQKMPDVQVLAEYMDTPDASYSDDPNSEEKIPAAVVLIKHGKGKALLLGPH
                     PEVPSSALKKIGEDWYDNGVVDKLKKNEKLRFRFMKEILIKAGLKCNNTITNPGYPDL
                     TPIFVSTKHNKDILKTFEANLKAKATKSDAVDGSFHLVCENDEFDVYEGFTHSEIAHQ
                     KLLGVHPEEAVKQIIFPDNSESVPNNSLVSHFDIEKFFDQLRPSNTLGSLLLYGDVVT
                     STSMILDQNKTLLAALPENSAIHVGTIQVSGRGRGGNTWVNPKGVLASTTAINVPAVS
                     SHTGKNTPIVFVQYLAMLAYCKAIKTYAPGYEDLPVRIKWPNDLYAMKPQFYYNNDVK
                     LLGKGFSDSVLSRDDIDPALVKVSGLLVTTNFIGGKYSLLLGCGINVTNEAPTTSLAT
                     WVNILNQERDALGMPHLPAIEHEVLLAKYLNELDSLLKKFLVQGPSAILPDYYELWLH
                     SNQIVKLTDHNSVRAKIVGITEDYGLLIAKELAAGSDYQYTGNVYHLQPDGNTFDIFR
                     GLISKKA"
     gene            <1095284..>1096153
                     /gene="CRD1"
                     /locus_tag="KLMA_60515"
                     /db_xref="GeneID:34717726"
     mRNA            <1095284..>1096153
                     /gene="CRD1"
                     /locus_tag="KLMA_60515"
                     /product="probable cardiolipin synthetase 1"
                     /transcript_id="XM_022821197.1"
                     /db_xref="GeneID:34717726"
     CDS             1095284..1096153
                     /gene="CRD1"
                     /locus_tag="KLMA_60515"
                     /codon_start=1
                     /product="probable cardiolipin synthetase 1"
                     /protein_id="XP_022677583.1"
                     /db_xref="GeneID:34717726"
                     /translation="MIVPLHTHIYKLPMMRYFSIRGGRGYSGIMNGIYLPISRVHVRT
                     FSQALIKKAEEPKNGSKKVSDIVKMKNGIWTIPNILTISRIACAPFIGHYIITQNFTP
                     AICLFVYSCITDFLDGYLARSYKMRSVAGTVLDPMADKILMMTTTAALCIPSGPQIIP
                     LGVAALIFGRDFLLGLSATYFRYASMKHTYGKVTWNSYWDIFHYPSAEVKPTRISKWN
                     TFVQMIYVGMGVVLLIINNSVDEDDEKQMAFREKFQNAFTLMGYLVSVTTIWSGASYI
                     HNKDAFRYLNKVK"
     gene            complement(<1096321..>1097913)
                     /gene="CCT4"
                     /locus_tag="KLMA_60516"
                     /db_xref="GeneID:34717727"
     mRNA            complement(<1096321..>1097913)
                     /gene="CCT4"
                     /locus_tag="KLMA_60516"
                     /product="T-complex protein 1 subunit delta"
                     /transcript_id="XM_022821198.1"
                     /db_xref="GeneID:34717727"
     CDS             complement(1096321..1097913)
                     /gene="CCT4"
                     /locus_tag="KLMA_60516"
                     /codon_start=1
                     /product="T-complex protein 1 subunit delta"
                     /protein_id="XP_022677584.1"
                     /db_xref="GeneID:34717727"
                     /translation="MVSQAKQPSNATFKNREKPQEVRKANIIAARAVSDAIRTSLGPK
                     GMDKMIKTSRGDVIISNDGHTILKQMAILHPVAKMLVEVSGAQDVEAGDGTTSVVIIT
                     GALLGAAEKLLNKGIHPTIIAESFQRAAERSVEILLDMSTKISLDDKEALVRAASTSL
                     SSKIVSQHSSFLAPLAVDCVLNIASHDSTNVDLNDIRLIKKVGGTIDDTQMVNGVVLT
                     QNVAKSAGGPTRIEKARIGLIQFQISPPKPDTENNIVVNDYRQMDKILKEERAYLLNI
                     CKKIKKAKCNVLLIQKSILRDAVNDLALHFLSKLGIMVIRDIERDEVEFLSKSLGCKP
                     ISDIELFTEDRLGSADVVEEVESDGSNIVTITGVKSTNTNPTVSVVIRGANNMILDET
                     ERSLHDALCVIRCLVKERALIAGGGAPEIEVSCRLMKEARALEGVEAFVWQEYAQALE
                     VIPTTLAENAGLNSLNVVTELRLRHENGESNAGISVRRSGTTNTYDDHILQPVLVSTS
                     AIRLASECVKSILRIDDITFSR"
     gene            <1098829..>1099935
                     /gene="CDC123"
                     /locus_tag="KLMA_60519"
                     /db_xref="GeneID:34717728"
     mRNA            <1098829..>1099935
                     /gene="CDC123"
                     /locus_tag="KLMA_60519"
                     /product="cell division cycle protein 123"
                     /transcript_id="XM_022821199.1"
                     /db_xref="GeneID:34717728"
     CDS             1098829..1099935
                     /gene="CDC123"
                     /locus_tag="KLMA_60519"
                     /codon_start=1
                     /product="cell division cycle protein 123"
                     /protein_id="XP_022677585.1"
                     /db_xref="GeneID:34717728"
                     /translation="MTEDSYTPLAEIKASSSEIKACAFSAWYHTFKKYTPKAHIIHPL
                     PQEFIKYLAQDGIRLSLEENDSSFYDSCLKPDDDNDYSDWEDNQLPESESDEESEFTN
                     NKKEEEEEMVPIVNFPDLHKEISDVIREYGAVTPKLNWSAPRDATWILPNNTSKCIHV
                     NDVYLLLNASNYIAYDLDHAFDECEDKVDPQSVQYELILRKWFDINPALEFRVFIRDG
                     EICGISQRDLNYYNYLEPLQDTFTTLIEDFVHDVVLPKFELSCFVLDVYLPRPFVQCW
                     IIDINPWSRTTDPLLFSWSELASKNLEAETQAEIRLITEHNIGRFVTKEHSENHVPKD
                     IVTASLDPESLRELTYKWKEILKMQEEDAESDDD"
     gene            complement(<1100167..>1102251)
                     /gene="FRE1"
                     /locus_tag="KLMA_60520"
                     /db_xref="GeneID:34717729"
     mRNA            complement(<1100167..>1102251)
                     /gene="FRE1"
                     /locus_tag="KLMA_60520"
                     /product="ferric/cupric reductase transmembrane component
                     1"
                     /transcript_id="XM_022821200.1"
                     /db_xref="GeneID:34717729"
     CDS             complement(1100167..1102251)
                     /gene="FRE1"
                     /locus_tag="KLMA_60520"
                     /codon_start=1
                     /product="ferric/cupric reductase transmembrane component
                     1"
                     /protein_id="XP_022677586.1"
                     /db_xref="GeneID:34717729"
                     /translation="MRAYVLLAWIFLWCRYPVNALVFVDSTIASACIYYELQYDWGCH
                     SHSNGMKAYACRCGNTEWLGSVTECIYDNSPNERLRNHALRHVALRCKQKGGFHYSLE
                     KMKGFRENATQYLREPTHKDLTTPVNAPLKVNESNYQYYHRGFKQYTVATERSQWFGW
                     GLVFYWATIIALASFFNLSKRIFGFTWETNWIRRTFTLPPVLGRHHNSPYVLWKVIQI
                     SFPTHLQFWVIAVFLIQTVISCAVGYNIVTLPNPYFATLWYRNLTLISYRTDMMAISL
                     FPIVYFFGIRNNPFITISGISYATFNLYHKWTAYVMVILGFIHSVIWTVWADSKDGGG
                     YKVWWQDAYWQWGVFATMLSFFLVVHSYKWFRDLAYEFFLILHKIFNVMFIVCMYYHM
                     NTLGWLGWIWAMVGIWGFDRVMRFAKIVLCGGLQTATVSDCGNGVVKMKVKKPKYLKF
                     YPGSFAFVYFFSKYDPWVYTFQSHPFTILSVPEDSETHLTILFKAQKGITRNVLNRLL
                     KAGVDEMQYNVMIEGPYGNSFPCYKNSKRKVVAMAGGLGVSAVFPHLKSVIEQTSTSI
                     IHEFKWVVNDLNCLEWFGKELEWLASNNCRVTVICTNKEENMDFESISDYSEKPKQFH
                     SKSSNLEVVNLASRPDIRQMVRESIENSEQNITVISCGPSSFLDDVRYSVKEELSTAK
                     VDVDFEEESFTW"
     gene            <1103063..>1104151
                     /locus_tag="KLMA_60521"
                     /db_xref="GeneID:34717730"
     mRNA            <1103063..>1104151
                     /locus_tag="KLMA_60521"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821201.1"
                     /db_xref="GeneID:34717730"
     CDS             1103063..1104151
                     /locus_tag="KLMA_60521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677587.1"
                     /db_xref="GeneID:34717730"
                     /translation="MNSSTSSEITSVNALIIGAGGVGVITAYSLYFGGKCNVSLVTRS
                     DYEHVSEFGYKIDSCDYGEIRDWKPHNLFKTVEHAAASGKFFDYIIITTKNIPDGPKD
                     STVHAILKPVIESNSRVEDSRVTNVVLIQNGIDIEKEVLENFDKSTFHLSLLSGVQLI
                     ASTKIGPGHIVQKGKDHVSFGAFNKNDDIAIGQAKKLVELYHNEPHNTCLFDEDVRYT
                     RWKKLLYNAAINTTTALVGLDVPRCFEFSTDKKATEYELFRPAMEEIISIAASENVIV
                     EKELVDFFNDVTRNIMYKPSMCVDLENGRLMELEVILGNPIRIAKEKGIRTPTLSVLY
                     NLLYLIQNKLKEQKKIIEFDEETLKLVS"
     gene            <1104710..>1106272
                     /gene="CRR1"
                     /locus_tag="KLMA_60522"
                     /db_xref="GeneID:34717731"
     mRNA            <1104710..>1106272
                     /gene="CRR1"
                     /locus_tag="KLMA_60522"
                     /product="probable glycosidase CRR1"
                     /transcript_id="XM_022821202.1"
                     /db_xref="GeneID:34717731"
     CDS             1104710..1106272
                     /gene="CRR1"
                     /locus_tag="KLMA_60522"
                     /codon_start=1
                     /product="probable glycosidase CRR1"
                     /protein_id="XP_022677588.1"
                     /db_xref="GeneID:34717731"
                     /translation="MILLSNIIFWILYAGVFPSFGQVIRYFPETTIPCASGANCPEAW
                     PCCSQFGMCGSGPFCIGGCNPRFSNKPGSCLGQPALLPPISSNFKAQSSMEEKPALHS
                     SFNIRKESSFGSEAVSSGQSDLNKRGLIYYADFLISPLQQKIKSMLRDYHFTYSGFVS
                     YSGPGQLTLGMPRHSTGSIISATKSFLYGRSTVKMKTARGRGVVTAIVLLSAVGDEID
                     FEFIGGELLHTQSNYYHQGELNHTRMVKLPVASDSFANTHIYEVDWNEERIHWIIDGA
                     IARTLYKKETWNEEKKLFEYPQTPMRLQVSVWPAGRVDAAPGTIQWAGGLIDWDNSPD
                     ILQTGQFYATVESVTITPFENKFWSQIVTDLQKSKQTLNSDTLLDITYDFNYDTVETT
                     KWREESVVWKRGKLPYLSAPDKNGLNPGEAKFGTMVDRQLLIEQDVNPDNQFIQDISK
                     KLSTTNNDMLLQAPSSKNEKQKGKSKSKNKNKNKKNKKDSKPASSNGRSFHDLNPIRR
                     LITVFKLLSLTE"
     gene            <1106822..>1110457
                     /gene="COP1"
                     /locus_tag="KLMA_60523"
                     /db_xref="GeneID:34717732"
     mRNA            <1106822..>1110457
                     /gene="COP1"
                     /locus_tag="KLMA_60523"
                     /product="coatomer subunit alpha"
                     /transcript_id="XM_022821203.1"
                     /db_xref="GeneID:34717732"
     CDS             1106822..1110457
                     /gene="COP1"
                     /locus_tag="KLMA_60523"
                     /codon_start=1
                     /product="coatomer subunit alpha"
                     /protein_id="XP_022677589.1"
                     /db_xref="GeneID:34717732"
                     /translation="MKMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGV
                     LLHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLETNKCLFTLDGHLDYVRTVF
                     FHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDET
                     VRVWDISGLRKRHSAPGSQSFDEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWASFH
                     PTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPYQNLIISVGEDKT
                     LRVWDLDKRTPVKQFKRENDRFWLVRAHPNLNLFGAAHDSGIMIFKLDRERPPTATNQ
                     NQLFFINKEKQVQMFDYHKRITSLPYVSLKNIGKPWSSFRSMSYNPSQHSVLVNSSEK
                     ESDRFSLCVLPKQPTGAVEASNVITDDGSFATFVARNRFIVHNSSSSSLEVRSLDNKV
                     TKSIKLSASVKDITLAAPGTVLILYSHSVVLMDVQQGKALAELPLKNIKYTVWSQDGQ
                     YVALMSKHTLTIANRKLEIVTSNHESIRIKSASWDETGVLIYSTLNHIKYCLLNGDSG
                     IIKTLEKTLYISKVHGKFVYALNREGEVEILTIDPTEYRFKKALVNKNFPEVIRIIKN
                     SNLVGQNIISYLQKSGYPEIALQFVEDPQTRFDLATQYGNLEVALEEAEKLNNDLVWE
                     KLGKEAFAQGNTDIVELVYQNTKQFDKLSFLYLLKGDTSKLTKMETIAEHRSDIAGLI
                     QNTFYNNSIQKRASVFLNAGSAPLAYAVAKANGDDDLAESILQSEEIDEQDVSLPEIV
                     SSSTNIKNSVLPAPLKNWPLKDAEVSFFEKALLGQMQELDISDEKEEEPLESQEVDQF
                     AIADQENIEFEDEDIGNEEDAWDLDENDLELDDDLEPEETEVAEETGEESELPTWIKN
                     SKLPAVLVAAGAFDAAAQALNKQVAVVNFEPLRKRFIDIYDGARTYISGTPNEIPSIV
                     GYIRAVADEEDRSKILPLVPGVEVVTAILNEGFKAFKANKLEIAIQHFRDVIYTVSLL
                     VVNDKEDETTAQSALATAREYVLGLSMELERRSLPASDVKRNLELAAYFSRTKLLPVH
                     RSNALNVAMTQSFKNKNFVLASYFAGEFLKIVTTGARAEQAQKIKAKADSLAHDAIEI
                     DFDPYAEFDICAASHTPIYKGTPSVTDPLTGAKYHVSEKGKIDSIALISKIGAPASGL
                     RIQLSIN"
     gene            complement(<1110643..>1111626)
                     /gene="SPC42"
                     /locus_tag="KLMA_60524"
                     /db_xref="GeneID:34717733"
     mRNA            complement(<1110643..>1111626)
                     /gene="SPC42"
                     /locus_tag="KLMA_60524"
                     /product="spindle pole body component SPC42"
                     /transcript_id="XM_022821204.1"
                     /db_xref="GeneID:34717733"
     CDS             complement(1110643..1111626)
                     /gene="SPC42"
                     /locus_tag="KLMA_60524"
                     /codon_start=1
                     /product="spindle pole body component SPC42"
                     /protein_id="XP_022677590.1"
                     /db_xref="GeneID:34717733"
                     /translation="MIPMGSTPKRFGFGQNDVNERMVPEEYIYNSSMINELIKQNKDL
                     HKQLTQKQEEIDRLNVLIGSFRAKLIKYTELNKKMQQQQQQQQQQQQQQQQQDIRYSN
                     NIPSYKSDSPHFSSPQDHQGSQAEHIQVKKNNRTEESKIDDIYEKLELLTKLVNEAVQ
                     KQHDGSRSGFSKQDIKIVNDDDIIVSESQEFKHLQDQIDILKRKLLIKKENELRKLSL
                     NKELIDLMEELNMNSSNTPNPLSRSTSEHHSEHYNHHKSNQQGYHNENSHPLHCEHCH
                     VKSHSENHPPEPKFVNLKESLETPTPTPTQTPRKLRKENDNSVANKQYSLW"
     gene            complement(<1112002..>1113711)
                     /gene="SOK2"
                     /locus_tag="KLMA_60525"
                     /db_xref="GeneID:34717734"
     mRNA            complement(<1112002..>1113711)
                     /gene="SOK2"
                     /locus_tag="KLMA_60525"
                     /product="kilA-N super family protein"
                     /transcript_id="XM_022821205.1"
                     /db_xref="GeneID:34717734"
     CDS             complement(1112002..1113711)
                     /gene="SOK2"
                     /locus_tag="KLMA_60525"
                     /codon_start=1
                     /product="kilA-N super family protein"
                     /protein_id="XP_022677591.1"
                     /db_xref="GeneID:34717734"
                     /translation="MNYYGYWDYPYYGQAQAQAQAQAQAQAQAQGQMPPPIGQVQQIP
                     QVSQIGQVPSASQVPQIGGQPSHHQPGDDTTSGILQRLNPQNQQYSNYSQPQQQGQQQ
                     SQQSQQSQQVQQAQQQQQQQQQQQQQQQQQYEKGLPQLQPMANGTQQVMYYPYSGYSY
                     YYQQLSQQMGQQMPPQDEEPELTGQTQQQTQQQAQQSQQQQQQQQQPLAPPVISTVSQ
                     HSNGYTQSPSSRYYHLPHTSSYQYPRFQQYGLPLMQQQANQSTAGIPTSTSRNGSATS
                     IGGGQFGNNSPMSSFGSSSPNPKDFPMKRRKSGKKSNLTPTQQNLPTFSQQGQRSKVT
                     TTMWEDENTLCYQVEANGVTVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKIRHV
                     VKIGSMHLKGVWIPFERALVMAQREKIVDLLYPLFVRDIQSIIQQESNGKYQQPHQHH
                     QTLISTPQQNSLPHNNVQNTPSSHIMPISQAGVVMQQGSSYDQNQHLSGSNANIKEVQ
                     DDNSHQQSLRPSPNGPNHTQMHHHHGSSQVTNHDINGSSNNQLDGSSASEKPNNIATS
                     MKD"
     gene            complement(<1116332..>1117804)
                     /gene="PRI2"
                     /locus_tag="KLMA_60526"
                     /db_xref="GeneID:34717735"
     mRNA            complement(<1116332..>1117804)
                     /gene="PRI2"
                     /locus_tag="KLMA_60526"
                     /product="DNA primase large subunit"
                     /transcript_id="XM_022821206.1"
                     /db_xref="GeneID:34717735"
     CDS             complement(1116332..1117804)
                     /gene="PRI2"
                     /locus_tag="KLMA_60526"
                     /codon_start=1
                     /product="DNA primase large subunit"
                     /protein_id="XP_022677592.1"
                     /db_xref="GeneID:34717735"
                     /translation="MFRQTKKRVANRRNFIDDEQNHIDIKGYGNEDDGMQYDVLYPTR
                     LTWYRLPPRGEITLEQFETWAIDRLKVLLELESLWQRNRSMKEIESVIKPILSNKLNL
                     GTDIESRKKDYYSHFILRLCFCRSKELRDKFVRAETLLFKIRFQMLTTQDQLKFIKCL
                     DLPYLEAIDEEEKQSISTELYQTVSHILSFQLSLTDENQRKQFFNREKYYKLPMENVM
                     DLVGSRQVYVRRGWAYVPQFQQLNLISNEFSENLQTELMRTYQMIPKLNEDDRLLPIL
                     HHLSSGYVVTESQELNGTGVNDEFTHRTVKTKEIMSHFPLCAKQLMEQLQANHHLRYQ
                     GRQQLSFFLKGIGLSVDEALQFWTESFTQGGKMTVDQFNKEYRYNFRHNYGLEGNRIN
                     YKPWDCRTILSKPRPSRGEYHGCPYRDYNADKLASTLKEMSLTQQQINSVVESCQQQD
                     YTIACTKVFEAVHKGTAVSELQIVHPNQYFERSRQCETVP"
     gene            <1118928..>1120496
                     /gene="MSK1"
                     /locus_tag="KLMA_60527"
                     /db_xref="GeneID:34717736"
     mRNA            <1118928..>1120496
                     /gene="MSK1"
                     /locus_tag="KLMA_60527"
                     /product="lysyl-tRNA synthetase"
                     /transcript_id="XM_022821208.1"
                     /db_xref="GeneID:34717736"
     CDS             1118928..1120496
                     /gene="MSK1"
                     /locus_tag="KLMA_60527"
                     /codon_start=1
                     /product="lysyl-tRNA synthetase"
                     /protein_id="XP_022677593.1"
                     /db_xref="GeneID:34717736"
                     /translation="MWCQDMLRTKLLIGSLRRLYSSGASTLEYKARNVQIQNNVSKWY
                     PSLSHLPKTTTDISNFFKQYNGLAEDDRSVKHILQGKIIGMRFSGKKIGFINLLNDKH
                     TLQLIVNFNNLNMTNEEFQTHLKQFKVGDHIQVSGFPGLSQKQKTLSLKVTEPIQILS
                     ASQIPIPPKLEDASKRNSNKVLDYLVNGTETLYIRHLIIKRIREWLYNREFVEVETPI
                     ISSKSSGANAKPFETCCTAIDKDETAELRIAPELWLKRLCIGGMNRIFEIGKVFRNEG
                     IDATHNPEFTTLEFYQCYTDMEQLIEMSESLVKYVCEGIDTPKSKELLQHLEKNEWKF
                     KRLEFLPTLYTQTNIDFSTIDLNDADGIKNLLLKHDIHIPSNCQSTQQILNELCARYV
                     ESQCDTLLPTVIYHHPTILSPLAKSDPEHPQVTKRFEIFIKGKEYINAYEEENCPDLQ
                     LKKFAQQSEARDKFNDAEMMGIDLPYVQAMKYGMPPIGGFGLGIDRLCMLLTDSQRIE
                     QVLSFGTLDDVNRQ"
     gene            <1120800..>1121675
                     /gene="RNH201"
                     /locus_tag="KLMA_60528"
                     /db_xref="GeneID:34717737"
     mRNA            <1120800..>1121675
                     /gene="RNH201"
                     /locus_tag="KLMA_60528"
                     /product="ribonuclease H2 subunit A"
                     /transcript_id="XM_022821209.1"
                     /db_xref="GeneID:34717737"
     CDS             1120800..1121675
                     /gene="RNH201"
                     /locus_tag="KLMA_60528"
                     /codon_start=1
                     /product="ribonuclease H2 subunit A"
                     /protein_id="XP_022677594.1"
                     /db_xref="GeneID:34717737"
                     /translation="MSIPPTVAGSLGSLHSKTYHSEIPASLLSTDEEIILGVDEAGRG
                     PVMGPMVYGISYCTRKYEKEVVCKYGFDDSKKLTDQVRQKLFAKIYNGEIDGIGYATT
                     AITACDISSGMLRFPPEKNYNLNQQAHDVTISLIDDVLKSGVKIGHVYVDTVGPPSTY
                     QKKLEERFPQCKITVAKKADSIYPIVSVASVVAKVTRDVILIGSKKTPDEILGSGYPG
                     DAKTVQWLKQEMTPLMGWSPYMVRFSWQTCETMLSKSTDTVPIEWEEDAMTKKKMQWA
                     PEIKNKPISLDSWYQ"
     gene            <1122315..>1123718
                     /gene="LAT1"
                     /locus_tag="KLMA_60529"
                     /db_xref="GeneID:34717738"
     mRNA            <1122315..>1123718
                     /gene="LAT1"
                     /locus_tag="KLMA_60529"
                     /product="dihydrolipoyllysine-residue acetyltransferase
                     component of pyruvate dehydrogenase complex"
                     /transcript_id="XM_022821210.1"
                     /db_xref="GeneID:34717738"
     CDS             1122315..1123718
                     /gene="LAT1"
                     /locus_tag="KLMA_60529"
                     /codon_start=1
                     /product="dihydrolipoyllysine-residue acetyltransferase
                     component of pyruvate dehydrogenase complex"
                     /protein_id="XP_022677595.1"
                     /db_xref="GeneID:34717738"
                     /translation="MSALLTRITPRVGALACAARLQLRTYAAYPPHTIVGMPALSPTM
                     TQGNLAAWSKNVGDKLAPGEVLAEIETDKAQMDFEFQEDGYLAKILVPAGTKDIPVGK
                     PIAVYVEEESDVPAFADFSVADADSGAAPAAKEEAPKEEAPKEEAKPAETKPAPKKAA
                     SSSSSAPSGRIFASPLAKNIALEHGVALKDVKGTGPNGRITKDDVEAFLASAKSAAPA
                     ASSAGAAAGAAPAATASYEDVPITNMRQIIGDRLLHSTQSIPSYIVSSQISVSKLLKL
                     RQSLNATAKDQYKLSINDILVKAIAVAAKRCPDANAYWMPEQGVIRKFNNVDVSVAVA
                     TPTGLLTPIVKNAEAKGLVSISKEIKDLGKRAKENKLKPEEFQGGTICISNLGMNPAV
                     TMFTSIINPPQSTILAIGTVNKVPVEDSGAEFGFTFDEKINITGTFDHRTIDGAKGGE
                     FMRELKKVIENPLELLL"
     gene            <1124317..>1124499
                     /locus_tag="KLMA_60530"
                     /db_xref="GeneID:34717739"
     mRNA            <1124317..>1124499
                     /locus_tag="KLMA_60530"
                     /product="mitochondrial import receptor subunit TOM7"
                     /transcript_id="XM_022821211.1"
                     /db_xref="GeneID:34717739"
     CDS             1124317..1124499
                     /locus_tag="KLMA_60530"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit TOM7"
                     /protein_id="XP_022677596.1"
                     /db_xref="GeneID:34717739"
                     /translation="MAFLPSFILSDESKERITKILNLTQTVAHYGWLPFILYLGWTHT
                     SNRPHPLNLLSPLPSV"
     gene            <1124720..>1125643
                     /gene="FLX1"
                     /locus_tag="KLMA_60531"
                     /db_xref="GeneID:34717740"
     mRNA            <1124720..>1125643
                     /gene="FLX1"
                     /locus_tag="KLMA_60531"
                     /product="mitochondrial FAD carrier protein FLX1"
                     /transcript_id="XM_022821212.1"
                     /db_xref="GeneID:34717740"
     CDS             1124720..1125643
                     /gene="FLX1"
                     /locus_tag="KLMA_60531"
                     /codon_start=1
                     /product="mitochondrial FAD carrier protein FLX1"
                     /protein_id="XP_022677597.1"
                     /db_xref="GeneID:34717740"
                     /translation="MDSNSRSSLSPLQKEVASGLTAGIITTIVTHPLDLIKLRLQLAA
                     INSKPVSYYSQVQQVLKDGNGLNHTLKEAYRGLAINVLGNAIAWGLYFGLYRVSKDLV
                     YSMSSYTNQENKFMNDRQMSSTLYLFSAGASGLATAVLTNPMWVIKTRIMSTNSSHGY
                     SSISNAICRICKEEGIKTFWKGLLPSLLGVSQGALYFSIYDTLKLKYLHDKTAVKERK
                     LTAGETIGIISLSKMISVSTVYPLQLLKTNLQAFKSQNNENSSTKALIRSIWARNGLS
                     GFYKGLMANLIRAIPSTCITFGTYEHFKHIL"
     gene            complement(<1125905..>1126978)
                     /gene="RPL16A"
                     /locus_tag="KLMA_60532"
                     /db_xref="GeneID:34717741"
     mRNA            complement(join(<1125905..1126470,1126945..>1126978))
                     /gene="RPL16A"
                     /locus_tag="KLMA_60532"
                     /product="60S ribosomal protein L16-A"
                     /transcript_id="XM_022821213.1"
                     /db_xref="GeneID:34717741"
     CDS             complement(join(1125905..1126470,1126945..1126978))
                     /gene="RPL16A"
                     /locus_tag="KLMA_60532"
                     /codon_start=1
                     /product="60S ribosomal protein L16-A"
                     /protein_id="XP_022677598.1"
                     /db_xref="GeneID:34717741"
                     /translation="MSSFEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRAEALNI
                     SGEFFRNKLKYHDYLRKATAFNKKRGPFHFRAPSRIFYKAVRGMISHKTARGKAALER
                     LKVFEGVPPPYDKKKRVVVPHALRVLRLKPGRKYTTLGKLSSSVGWKYEDVVAKLEEK
                     RKARSAEYYLKKKAYNAVVAKKSATVGAEVSEKLAALGY"
     gene            complement(<1127755..>1128381)
                     /gene="CSM2"
                     /locus_tag="KLMA_60533"
                     /db_xref="GeneID:34717742"
     mRNA            complement(<1127755..>1128381)
                     /gene="CSM2"
                     /locus_tag="KLMA_60533"
                     /product="chromosome segregation in meiosis protein 2"
                     /transcript_id="XM_022821214.1"
                     /db_xref="GeneID:34717742"
     CDS             complement(1127755..1128381)
                     /gene="CSM2"
                     /locus_tag="KLMA_60533"
                     /codon_start=1
                     /product="chromosome segregation in meiosis protein 2"
                     /protein_id="XP_022677599.1"
                     /db_xref="GeneID:34717742"
                     /translation="MEIRLGEENICQDFVLYMKEESFKPHLHYISAISSFPISKLTEI
                     LPMSENKEAYDRINVLSAVDLQELNACIKQLYQRIIFNTTAKDLNTEQTSKIQNGVED
                     RHWLYIDGIQTMFQLSQLQDQVQAHAALNNSLLRLRLLHKKCNSVKVMFQLPKTEAPE
                     YVRHLREREEDEAERNRIANGRDRHSNKRFKRDNTGILIGDYLWKYYM"
     gene            complement(<1128717..>1131152)
                     /gene="FKH2"
                     /locus_tag="KLMA_60534"
                     /db_xref="GeneID:34717743"
     mRNA            complement(<1128717..>1131152)
                     /gene="FKH2"
                     /locus_tag="KLMA_60534"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821215.1"
                     /db_xref="GeneID:34717743"
     CDS             complement(1128717..1131152)
                     /gene="FKH2"
                     /locus_tag="KLMA_60534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677600.1"
                     /db_xref="GeneID:34717743"
                     /translation="MMPQSHIQEQQQQRHPDIYYHGNPGGVVMPNGMGPGNGINSSMG
                     VGAVSLQQQQDFVNAVISILEVPKDPTAVATCYANDKNTASEVQAYAKIAGKDWTYYL
                     KDIVITIGRNTSPGDNSVDIDLGPAKVVSRQHATIKFNSNSALWELHVTGRNGAKVNF
                     HRVNSGQNSTPQPLSSGSILDIGGTQMMFILPDQGPYIDPNAVAHLTPKLFMAYYNVT
                     TNPLLRNLFDSNPELVRSLERSANSHHGPISAHGSQTQLLPQSRKSLQQQHHNPHQQQ
                     MVQSSMRAFKMYDDPDSAMRSDILSPMGGHMFGSHEDNDGHGMPHNNSSGLSNGQLYG
                     TVANTGFNIASTDVSTDLSRDENRNIKPPHSYATMITQAILSTEEGELSLSDIYKHIA
                     TNYSYYRYTKAGWQNSIRHNLSLNKAFEKVPRKPGEPGKGMKWRISEETQRDFLEKWQ
                     SGKMGKVRRGSSVTRQLQAHMAHFNSLPIQRENFSFNDQRQSNGKSQSNHNSEFKQKP
                     KLENNGKTISRKSQSPNLQGSDSQSSNSSYTQQDHESSRLSPSHPHPSDLPLPKRQHL
                     NPPQQHGLKQNPQSESQKQNQQQNNLQQSQQFNPPAPSSNHTKSPNNQEVPSNVSSSG
                     SLLHSPNKHFQVSAVEAYTPERGSNLQKSPQPLLNLPSLPQSTDMSHAQSSSEQGIPH
                     LPPKSSPGVMNLLQFSSVNNTPSTNVQRTPVSNVQAAESLDGRDSRSNMLVINDAYQE
                     SNSTNGTEKQGILETKRLQNEDDNVANDNENDNENGNENGIMSSPIKVNDQRNTNLVV
                     DDSNDHKVVVKSD"
     gene            <1133085..>1135700
                     /gene="ASG1"
                     /locus_tag="KLMA_60535"
                     /db_xref="GeneID:34717744"
     mRNA            <1133085..>1135700
                     /gene="ASG1"
                     /locus_tag="KLMA_60535"
                     /product="cutinase transcription factor 1 alpha"
                     /transcript_id="XM_022821216.1"
                     /db_xref="GeneID:34717744"
     CDS             1133085..1135700
                     /gene="ASG1"
                     /locus_tag="KLMA_60535"
                     /codon_start=1
                     /product="cutinase transcription factor 1 alpha"
                     /protein_id="XP_022677601.1"
                     /db_xref="GeneID:34717744"
                     /translation="MELQSKRRRVTRACDECRKKKVKCDGKQPCIHCTVYNYDCTYNQ
                     PTRRAIPGSGPVPAGNDANRKTAGTDNGGSDAGGDTSGPSHSKRTGGNDHYSNSSYGG
                     TAPQNHSHQKKYSTSKNKQLQNKVSKYHELLKEMIPDIPDIDAIDIPTFTQLFHNTTK
                     DVNFNEMVQEYKLIAPTEVAPIVTRDNHDSSSVTGSLNSGGQQQNHHQREPIENVDGS
                     IQSHEGKEIKIILPPKPIAIQFIKSTWENCCVLFRFYHRPSFIKQLDLLYETDPENYT
                     HEQMQFLPLCYAVMAVGALFTKTVNQLYSDEQSPNNNDASTKFLHDEGYKYFIAARKL
                     IDITNARDLNSIQTILLLFIFLQCSARLSTSYSYIGVAMRSALREGLHRKLELDPSKK
                     KLNFIEIEMRKRLFYTIYKMDIYINTMLGLPRTISPRDFDQELPLELSDDYITEDAVY
                     PEEQGDVLSSSGIANQHTKIIMILDQIMAELYPIKKTNNLISHQMVTNLELKLRQWLD
                     QLPPELIPGLKDVPERYLRANRLLHLSFLQVQIILYRPFIHYLSPSAPQSDPLSIQRA
                     NNCISVARTVVKLAKEMMDVKILPGSYWFSIYTIFFSVAALIYYVRELTPTTTQDIEK
                     YDRIMEDVKTGKQVLSQLKETSMAAARTYKLLTALFNSFNAKTKQSAEMQKKFQQDQQ
                     KNSVNAQDQNDMDSSFFELPVYPSSDNAVISPDRFIDGVDKQISTPPFPMNSFPLEPN
                     TSISGVNTLNTTQTANLFSSTNFNDPLEPNDNNMDRYFPVENTNNSQQQQQQQQQQQQ
                     QQEQQQQNPQFVSATSLSQIPDSAVDGTYVPGMFDQLDVQLFGRYLPPYMSGISGGDA
                     KTKDGTNENIKRETN"
     gene            complement(<1135840..>1142631)
                     /gene="TAO3"
                     /locus_tag="KLMA_60536"
                     /db_xref="GeneID:34717745"
     mRNA            complement(<1135840..>1142631)
                     /gene="TAO3"
                     /locus_tag="KLMA_60536"
                     /product="cell morphogenesis protein PAG1"
                     /transcript_id="XM_022821217.1"
                     /db_xref="GeneID:34717745"
     CDS             complement(1135840..1142631)
                     /gene="TAO3"
                     /locus_tag="KLMA_60536"
                     /codon_start=1
                     /product="cell morphogenesis protein PAG1"
                     /protein_id="XP_022677602.1"
                     /db_xref="GeneID:34717745"
                     /translation="MNSGFMFPPLGKENRVLEQAPSNSDSMDFKFPRENMQSGQQAQP
                     QDIRADPTTMGSNIEQCSQQAVNVIDIPYVEHNGTQYEYNIDKTKVVENRSSSTADQD
                     SMSVPNPNKGVSAIVTSNQPHPGPASANSASSFPDEYAAGLRQKAATDWKSPSEYALH
                     ILFTKFVRFAETKLNLCLQYPRDTEPPIIDILGEGKDSEFDKVIESLGYISKKNAKPV
                     IDAMMFWRKTKSEVASLAADNLNKVLQEYDQYIRENDPGFAVKKTHSKSLSSSSSRLT
                     HKRNNSSKSSASISSNIDPKLSFLQSQVERARDMAFQADRKSLITIYILCRVLIEIVK
                     QNPTNFDNELSSKLENIVFTQLKTTDPSSLSSTLIKSANWNSFAELLGWMSEKNFVSV
                     SDKFIADLEKVPAKIPRDQEPSIHILILGMTYLKLKNFPLEMFEESAGFIKSISKFFG
                     LSQNQSIRMAYAEVLSQLLLPLAGDMTAEVNHPTWIEAMTSILSTCKKMQSDSKCWTL
                     AFKLTVAVLCVANAELFSKNWLPLIEKNITKIKSKSLQDRVAFSMGLSRLIWVYLFRC
                     TETLNNTDKTLTKLFSLFLSTKKKENWITTDMNIINPLCDVFVTVGYVHPTFVFENVL
                     LHLVKSSFNGINLENIVHEKLILVINTYRGLLMTKERPSFPDAERRFYEVDLNKISIH
                     QTDKNWANHEELVKYLYKLFMLLDSNIGSEVWSPENEHRRQPSTPFSSITNFGFGINN
                     ENNANYARSLNMALFATLIEVLPCCLSVSQSIPFKSTIEILSRNAVHADQLIATSAQN
                     ALKVLAAKKNPYTLITWFAKYSFDFDEKTQSRYSLYYLSSAEYKILLELYVELLECWL
                     EDFTKNDPKDSDPDGSLNGSNNAQKTFDTVSHESDKIEWKNTQTVVEDVEGNGLFFLC
                     SADAAIRRLAIRILQLTSKFDKALLQKSSLYDKGHSRSSSRLVAQSGSRLIDMLVSFD
                     IPKLLEPEKQSLSVAEKSRLVKLTMKSKKNMLIRICESEYGIDAALWQRIFPKLLTYI
                     FEQSPVTMALCRSIVCIRLVQLYDLILSITNNVSDRFKDISPEAVVNQWKLYLIVACS
                     SLTSTNDQKLYIPATNAQHGRKKSQQIFTVQHQKIKSATSVFKIVLPLLNCDKTFIKS
                     AIITGLSAMNINIYRAYIESIDQFLTTWSLTSSNNGMRMEMVHILVILSPFLKDKQIN
                     SDEWILEKLSHYLKEMKVFLELEEVQQSFQYQPLRQYFAGFLSSFYTAIRTHDSCEVF
                     FPFEARASCFNFLKEWCGYGQYTAIASQRYRIMANNYQKGSEEATFATALEFQRSKLE
                     IVALECMIILCSSEVSKTIFGSDDMPIQMSFDIAGLLCWIDSLLHASNDKIKILGVRA
                     LKTLLEANSSNLQLLRDVLHQIKIQTSDTLIQHAYYSLFCEAVCKQDELLLTDDELIA
                     FGLNGVVSNDKAMREHAIDLLSFIETKLYESSYARIFKERLSNQSKTVYKSTAQEISN
                     IFSELLPQEVRLKVFARMTEYFHILPTELKQNILMMFVPWVNKFVLKSHDDLDTFMIL
                     NNTFALTIYSKNRYPMEVEQLWISLGKGNSFQNIHVVLDYIISTSINYRNPEFVKYAK
                     EIVLFLTNVPGGMGIVDTLFHNLEPKHMIPTSKIAHEEPENNDKYSFIADIWSILDYH
                     GKDVVFSKAQLSMIFLVNLLIIPNESVKARLPLLLHISVCLLDHHVPIIQDSACRILC
                     GIINGLHPTHEKSVETVNLVKNRQMLWQYENLTKESGARSPRSMDIVIRNIIDIFSDI
                     ETLQVEWQRTSLKWATTCSVRHIACRSFQIFRSVLTFLDQEMLRDMLHRLSNTIADEN
                     PDIQGFAMQILMTLNAITAELNAAKLIDFPQLFWSVVACLNTIHEQEYIEVLSSLSKF
                     VSKIDLDSPDTVQCLISTFPSNWEGKFDGLQQIIMIGLRSSSSWDISLQFLDRLNLLN
                     DSQIIANKESRILYALLANLPRFLYALDTNDINENVIRGADCLISLCMANNEPSLSRI
                     IDSMVKSKFRSKKDFMSQIVTFINSNYFPKYAPQALVFLLGLLFNSMDWVKIQTMQLL
                     KNIFPLTDLSRPEFIGVGADFISPLLRLLLGELEPQALEVLNTIPKVSGSKMDKDVLR
                     ISMGNKDAKKVYNKTATLFGIPEESGWSIPMPALTAASTRHNVHAVFTTCTVIIGGET
                     DATGSDVLEEIVEFHADGGYVQGTDEYGDIISVPEEKDPSLSHMWAELDNLGSFFTKS
                     DFMQAEEEEEEEEEV"
     gene            <1143071..>1146160
                     /gene="MET18"
                     /locus_tag="KLMA_60537"
                     /db_xref="GeneID:34717746"
     mRNA            <1143071..>1146160
                     /gene="MET18"
                     /locus_tag="KLMA_60537"
                     /product="DNA repair/transcription protein MET18/MMS19"
                     /transcript_id="XM_022821219.1"
                     /db_xref="GeneID:34717746"
     CDS             1143071..1146160
                     /gene="MET18"
                     /locus_tag="KLMA_60537"
                     /codon_start=1
                     /product="DNA repair/transcription protein MET18/MMS19"
                     /protein_id="XP_022677603.1"
                     /db_xref="GeneID:34717746"
                     /translation="MSGHYSEDDLKAEIVSFMANIKVNTSKADKLAKKIANQVTNENV
                     ELLRIVLLLRDYLTSEDNTIRQNALCCLSSILAAVSPSVLKNNDVTVIFDFYQSKMED
                     SGCMKETLQGINSLVLMECFYSSHVRKLLDILANDYQPTNFLAATRYFGFNIMDNILA
                     KFKAQMLENDELNDKFIETFIRVATGEKDPRNLLISFRLNKEITTGLNNIDKFKEELF
                     DILFCYFPIMFRPPSNDPYKITNGDLKLALRNAISATEKFEEDAFGNLLDKLTASSPS
                     VKNDTIMTIKACLDNFSGTSSLKHWLPIWDALKFEIMNGTDPEPSLLDVGGAIENSSS
                     KQEESFNNYASSLSVITSLSLKLILLDEHAFDKFFMHIFDEIIPNFKQNKDLKQCCDL
                     LASISKVNLLTFNKVIKKIFPVLFMEKDLDVTKQKLLLLNLAPFFDAYISVSTLVGEE
                     VSQFSVKNELRVYKDDVVMLLSKCLTGTSKSEVTLRTLSIVHFTTLVKMDGFLDAEEI
                     AMVVQYFTETILTDDNKNIYCACLEGLKFIGSINDAVVYDVSLKYMLDLLPIDEDSKH
                     LTVIGTETVPPERILKVILDFTTSRHHLVKESIVALSIKLKNIVKNPTNSNYCFLVLS
                     CLDSLLQNNVENFEEGTGSYLKAAIEKIIIDCALDKDVIYLDDHSLTLSAHILFYLNL
                     KADIHTHQDILNFYYERFVEHEKIFESPKRSIVVYSRVLSALDKSLLPSSVNAIFRKT
                     INLLESDENMSALESLGYLEFLALLSNKWLTEKFIDDTLDLQNISMKNLQIIFWVNKG
                     LVMKNSASAIALTDYLFGLLGNEQIGNKVAQLFEILVLDLPIFEKFKKVSWNNNVRLL
                     YKQKFFNHIATKMVESFKAAKVMTIKSNYLTGLSLVLKNTPSTITISYIKDLLPLLLQ
                     ALQLENGEVRLSSLQTLNDTVEKNPQLITEHVHTLVPLLLGLISPSKYNNASVRLLSL
                     EVLQKFPENVPLNYLIPLKSDIIMKLQIGLDDKKRKVRKQCIDTKQTYIELGQVPFE"
     gene            complement(<1146331..>1146930)
                     /gene="RRT14"
                     /locus_tag="KLMA_60538"
                     /db_xref="GeneID:34717747"
     mRNA            complement(<1146331..>1146930)
                     /gene="RRT14"
                     /locus_tag="KLMA_60538"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821220.1"
                     /db_xref="GeneID:34717747"
     CDS             complement(1146331..1146930)
                     /gene="RRT14"
                     /locus_tag="KLMA_60538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677604.1"
                     /db_xref="GeneID:34717747"
                     /translation="MSSLTNLHATTAVNSLLRNMLPGSSLVNTDKKRSKRDKGSKAQM
                     IDHNLKKRTAIQERNVQKIKRKEKKVLRKKIAGKKEDQEKIEQKVKLAILRKHQESGN
                     LTDNEKRYLDKLMKRNIKNLKTWDLEEEDELLDLQSKILANTDTSSKARKTKSRKQKK
                     KDFKEKLSTITVDHRYQSLTPGLAPVGASDEEDSEEEDY"
     gene            <1147543..>1151523
                     /gene="STH1"
                     /locus_tag="KLMA_60539"
                     /db_xref="GeneID:34717748"
     mRNA            <1147543..>1151523
                     /gene="STH1"
                     /locus_tag="KLMA_60539"
                     /product="nuclear protein STH1/NPS1"
                     /transcript_id="XM_022821221.1"
                     /db_xref="GeneID:34717748"
     CDS             1147543..1151523
                     /gene="STH1"
                     /locus_tag="KLMA_60539"
                     /codon_start=1
                     /product="nuclear protein STH1/NPS1"
                     /protein_id="XP_022677605.1"
                     /db_xref="GeneID:34717748"
                     /translation="MDQVIPSNSLSLAPQQNPIVENKDTANGINDGDSMTFDNGNNVN
                     SYNHDDDRNNINKGIDGKQLSSVLEEMNKIERIILPLPETKEQLEDLIYRYRYISQYR
                     DHNKLEVEAIEQVFAQISDKQDKFKEELLNLRNNAVTGVQWDENLLKEQLISLQLLSK
                     DVNIPDNFLHEYNASSNENDSSSKHIQLERIKLSIDLYESSKLLGLPDALTTLGIKRG
                     NNTALGDWESEKIISSLIASRIKFLENLPANLGTYSLNDALDFITKDDIPTSVDDFKM
                     RALVELKSLKLLTKQKSLRKKLIESVASKSHNIVPSLRDSPYTLAAQRSINVRPKTIV
                     PQTARLAEELERQELVENRRRERNLRLQRINNTVNGINERLENETTHRDRCYQMGKSI
                     GNLHGHLEKDEQRRMERTAKQRLAALKSNDEEAYLKLLDQTKDTRITHLLKQTNSFLD
                     SLAQAVRVQQNEVRIKRGEEIPPMTDEEREKIDYYEVSHRIKEQIDKQPSILVGGTLK
                     EYQIKGLEWMVSLYNNHLNGILADEMGLGKTIQSISLISYLYEVKNERQPFLVIVPLS
                     TITNWTIEFEKWAPSLRTIVYKGNPNQRKALQHPIKMGNFDVLLTTYEYIIKDRPLLA
                     KHDWAHMIIDEGHRMKNAQSKLSYTLTHYYKSKNRLILTGTPLQNNLPELWALLNFVL
                     PKIFNSSKTFDEWFNTPFANTGTQEKLEMTEEETLLVIRRLHKVLRPFLLRRLKKEVE
                     KDLPDKVEKVVKCKLSSLQQQLYQQMLKHNAFFIGAGSEGATKGGIKGLNNKVMQLRK
                     ICNHPFVFDEVENVINPSRANSSLLYRVSGKFELLDRVLPKFKASGHRVLIFFQMTQV
                     MDIMEDFLRMRDLKYMRLDGGTKAEDRTGMLKLFNAPDSEYFCFLLSTRAGGLGLNLQ
                     TADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDI
                     DGKVIQAGKFDNKSTAEEQEEFLRRLLEGETNKDTELAGELDDEELNDILARNDNERI
                     LFKKMDEQRVAAEEEEAMEMGLKKPLPRLITKEELPPIFREDITDHLQTEPVAVGRIR
                     ERKRVYYDDGLTEEQWLQAVDNDEDLDEAIERQRLARERRQRKMLGLDSQDNSVEPDE
                     HDSVQNTEETAVPPRETGRTRSRRNVTTPAATPEEVPDVKEVKKEEEPPKKKIKLKLN
                     MKKEEPAKVAKAEPIKPKIDSLLSNLRELVDPSDEHSRTFIFEKLPSKKDYPDYYKVI
                     ETPVALETITKKLNKKQYKSLEDVKHDFDTMFKNAKFYNEEGSWVYVDAEFLENFVND
                     WFGNIN"
     gene            <1152074..>1152649
                     /gene="RPL9B"
                     /locus_tag="KLMA_60540"
                     /db_xref="GeneID:34717749"
     mRNA            <1152074..>1152649
                     /gene="RPL9B"
                     /locus_tag="KLMA_60540"
                     /product="60S ribosomal protein L9-B"
                     /transcript_id="XM_022821222.1"
                     /db_xref="GeneID:34717749"
     CDS             1152074..1152649
                     /gene="RPL9B"
                     /locus_tag="KLMA_60540"
                     /codon_start=1
                     /product="60S ribosomal protein L9-B"
                     /protein_id="XP_022677606.1"
                     /db_xref="GeneID:34717749"
                     /translation="MKYIQTDQTLDIPEGVTVQIKSRIVKVTGPRGTLTKNLKHIDVT
                     FQKVSNKQIRITVHNGDRKHVAALRTVKSLISNLITGVTKGYKYKLRYVYAHFPINVN
                     VIEKDGAKFIEIRNFLGDKKVREVPVREGVSVEFSTNVKDEIVLTGNSVENVSQNAAD
                     IQQICRVRNKDIRKFLDGIYVSEKGVVVEEE"
     gene            <1154008..>1157070
                     /gene="KGD1"
                     /locus_tag="KLMA_60541"
                     /db_xref="GeneID:34717750"
     mRNA            <1154008..>1157070
                     /gene="KGD1"
                     /locus_tag="KLMA_60541"
                     /product="2-oxoglutarate dehydrogenase E1 component"
                     /transcript_id="XM_022821223.1"
                     /db_xref="GeneID:34717750"
     CDS             1154008..1157070
                     /gene="KGD1"
                     /locus_tag="KLMA_60541"
                     /codon_start=1
                     /product="2-oxoglutarate dehydrogenase E1 component"
                     /protein_id="XP_022677607.1"
                     /db_xref="GeneID:34717750"
                     /translation="MLRTIRSSQRLLHASRFSHVGGMSAVANINANRTVLLRGFASGS
                     SMDNFLSTTNAAYIDEMYEAWQKDPSSVHVSWDAYFKNMGNLNIPASSAFTAPPTLMP
                     LPTGPGVPHDLPLGGSLHAVDQDVTTHLKVQLLCRAYQVRGHQKAHIDPLQISFGDDK
                     SKPLPRELTLEHYGFTEKDLDRDITLGPGILPRFATETRKTMKLREIIAALEKLYCSS
                     YGIEYIHIPSREQCEWLRERIEIPKPYNYTVDQKRQILDRLTWATSFETFLSTKFPND
                     KRFGLEGLEGVVPGIKTLIDRSVELGVEDVVLGMAHRGRLNVLSNVVRKPNESIFSEF
                     KGSVTPEEFEGSGDVKYHLGMNYQRPTTSGKYVNLSLVANPSHLEAADPVVLGRTRAI
                     QFSKNDIGKYEKAMSVLLHGDAAFAAQGVVYETMGFLHLPAYSTGGTIHIITNNQIGF
                     TTDPRFARSTLYPSDLGKVIDAPIFHVNANDVEALTFTFNLAAEWRATFHTDAIIDVV
                     GWRKHGHNETDQPSFTQPLMYQKISKQKSVIDVYTEKLVSEGSFTKQDIDEHKKWVWG
                     LFEEAYEKGKDYKPTSREWLTAAWEGFKSPKALASEILPHEPTNVDAETLKKIGKVIS
                     SWPENFEVHRNLKRILSNRAKAVESGEGIDWSTGEALAFGSLLLEGYHVRVSGEDVER
                     GTFSQRHAVLHDQKSENVYTPLQHISDKQAEFTICNSSLSEYGCMGFEYGYSLTNPDY
                     FVQWEAQFGDFANTAQVIIDQFIAGAEVKWKQRSGLVLSLPHGYDGQGPEHSSGRLER
                     FLQLANEDPRYFPSEEKLQRQHQDCNFQIVYPTTPANLFHILRRQQHRQFRKPLALFF
                     SKQLLRHPLARSQLSEFTEGGFQWIIEDVELGKSIGTKEEIKRVVLLSGQVYTALHKK
                     REAIQDKTTAFIKIEQLHPFPYAQLRDALNSYPNLQDIVWCQEEPLNMGGWAYAQPRL
                     ETTLKETDKYKDFAVRYAGRNPSGSVAAGSKALHTAEEEAFLKEVFGQ"
     gene            <1158126..>1159019
                     /gene="AYR1"
                     /locus_tag="KLMA_60542"
                     /db_xref="GeneID:34717751"
     mRNA            <1158126..>1159019
                     /gene="AYR1"
                     /locus_tag="KLMA_60542"
                     /product="NADPH-dependent 1-acyldihydroxyacetone phosphate
                     reductase"
                     /transcript_id="XM_022821224.1"
                     /db_xref="GeneID:34717751"
     CDS             1158126..1159019
                     /gene="AYR1"
                     /locus_tag="KLMA_60542"
                     /codon_start=1
                     /product="NADPH-dependent 1-acyldihydroxyacetone phosphate
                     reductase"
                     /protein_id="XP_022677608.1"
                     /db_xref="GeneID:34717751"
                     /translation="MVESKYALVTGASSGIGYEVTKELLRRGWYVYACARRTQQMEEL
                     RSEFGDRCIPRKLDVSNQNDIIQLRLKLEQELPDQKLHLLYNNAGQSCTLPATDVTEE
                     ALDNAFRVNVYGPINSCREFAPLIINAKGTIVFTGSLAGICPFPFGSVYSATKAAIHA
                     YARVLHVELSPLGVRVINMITGGVATNIADKRALPEYSMFNFPEGITAYETRKKMADK
                     NQPMSAAAYARETVNDIERVHTDPVDIYRGTMATMVKWLMLLVPYSLLEWGLRKKFKL
                     DPAYAVLNKQQRQRQHAIKDD"
     gene            <1161404..>1162615
                     /gene="SIM1"
                     /locus_tag="KLMA_60543"
                     /db_xref="GeneID:34717752"
     mRNA            <1161404..>1162615
                     /gene="SIM1"
                     /locus_tag="KLMA_60543"
                     /product="septation protein SUN4"
                     /transcript_id="XM_022821225.1"
                     /db_xref="GeneID:34717752"
     CDS             1161404..1162615
                     /gene="SIM1"
                     /locus_tag="KLMA_60543"
                     /codon_start=1
                     /product="septation protein SUN4"
                     /protein_id="XP_022677609.1"
                     /db_xref="GeneID:34717752"
                     /translation="MKFATALASASFIGATLVSALPHPHAKRDEDCSTTVHAHHKHKR
                     AVAVEYVYQTITVNGQGQTISPSTTEAAPTSTEAQTQQTSTSTSSATTTLQPSSSAQQ
                     SSSSESSSSSTSSASSSSSSSSSSGGNSNGVDGDLSWYSGPSEEFQDGVISCDQFPSG
                     QGVIALDWLGFGGWSGIENSDGSTGGNCKEGSYCSYACQPGMSKTQYPANQPSNGVSV
                     GGLLCKNGKLYRSNQNEKYLCEWGVDSAYVVSELDKSVAICRTDYPGTENMVIPTIVN
                     AGGKEPLTVVDQDTYYQWQGKKTSAQYYVNNAGVSMEDGCIWGTPGSGVGNWAPLNFG
                     AGATGGISYLSLIPNPNNRDALNFNVKIVGADGATVIGDCVYENGSYSGGQDGCTVSV
                     TSGAANFVLYN"
     gene            <1163999..>1165006
                     /locus_tag="KLMA_60545"
                     /db_xref="GeneID:34717753"
     mRNA            <1163999..>1165006
                     /locus_tag="KLMA_60545"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821226.1"
                     /db_xref="GeneID:34717753"
     CDS             1163999..1165006
                     /locus_tag="KLMA_60545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677610.1"
                     /db_xref="GeneID:34717753"
                     /translation="MSSKTDTNENDYDTEDEESTLQQPPDEGFYREIMKNLGLAPSSG
                     SEGSKIPDRDLLIRLIELKRIESAKEVEKLKSENLDKLDRLLIKISALNLPTEVILSL
                     IESPSGQLESNLERIGIMPMHPPSNQIASSDNVRGWSQVTPPQTQTQLPQQSSATVQS
                     QIPHGYHSRTLSHPIELMPSIQKPNQPTQQQMQQKLPPPIVNAGAQQSYSPLPSLGGS
                     QLKYHFPPPAPGPAGVSSDVSPNSSVNNRTVLYYPSRYPGQISYYNPQNIPPPIYEQA
                     SNLPNSRLGHKRSHSAMTVPEMSTFTIRRNDPNEIVNLDPAKKSGKVSFLINTPKNPP
                     K"
     gene            complement(<1165741..>1167555)
                     /gene="REB1"
                     /locus_tag="KLMA_60546"
                     /db_xref="GeneID:34717754"
     mRNA            complement(<1165741..>1167555)
                     /gene="REB1"
                     /locus_tag="KLMA_60546"
                     /product="DNA-binding protein REB1"
                     /transcript_id="XM_022821227.1"
                     /db_xref="GeneID:34717754"
     CDS             complement(1165741..1167555)
                     /gene="REB1"
                     /locus_tag="KLMA_60546"
                     /codon_start=1
                     /product="DNA-binding protein REB1"
                     /protein_id="XP_022677611.1"
                     /db_xref="GeneID:34717754"
                     /translation="MSQNDGNHESVEEAVFKYVGVGLGKSGEEDSVNKQKSVDWFLKE
                     QDHEHEDEQDREQEQGPDQERDDDSKHRDANDVSAVAAAAVAAALSVKKRARTSEQLS
                     GKVNATGQAAKKPKKNKTKLHLAAVDPELASLDDNLVDSNDPEEQSHHQLVHKAIMDT
                     DNIASQHPDFQQYLNTEDDQEPKKEKAHERSYDELSNIDDDHMDDVSVSSSVPAQVKL
                     KKTAEVLPKVLSSETHTRDHQDDVSSLIQEAAAKASHIINPATQSNGKSFDESEEEAL
                     EQFIKEYQKIRGLSRRQICERIWSNERRKDDFWTNICRVLPYRTRSSIYKHVRRKYHI
                     FEQRGKWTPEEDAELARWCAEKEGQWSNIGKVLGRMPEDCRDRWRNYVKCGPNRAANK
                     WSPEEEEKLKSVIHQMLENASAAYEDGEDEGDDAEEEENDIKESSAKVEGSDSSDMLN
                     VQSSEKKSLSTKSKKKPAPKDIINWTVVSEQMGGTRSRIQCRYKWNKLLKKEALNKIK
                     NISEDDKFWLLTKLRDMGFTEDSQVDWEELSTLMPGRRWTGTELKLLYEKVRTSVRQY
                     KRKTINVICKELVGYPETSMPLNNGIHQHDSPVDDEKD"
     gene            complement(<1168032..>1170566)
                     /gene="VPS54"
                     /locus_tag="KLMA_60547"
                     /db_xref="GeneID:34717755"
     mRNA            complement(<1168032..>1170566)
                     /gene="VPS54"
                     /locus_tag="KLMA_60547"
                     /product="vacuolar protein sorting-associated protein 54"
                     /transcript_id="XM_022821228.1"
                     /db_xref="GeneID:34717755"
     CDS             complement(1168032..1170566)
                     /gene="VPS54"
                     /locus_tag="KLMA_60547"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 54"
                     /protein_id="XP_022677612.1"
                     /db_xref="GeneID:34717755"
                     /translation="MSDKVTGNGTPKLSVDADFKAQLSRSPLLIISQASDDASSLNDD
                     LSIMSRSRDHIRDSFSLRRSSFESALNPLSPPMHTVKHGLDYSPLVDNSIYEIVMNTR
                     FKRWLKHPTTEDIPPVILCKNDIKNDWEKEIEGYKHEIGDEYKVYLRTNNISSLNMME
                     QIRSIDNSEKSGNHEGTFAAENSRAKAFEEIPSFYFDKDFKLDHPNFFRMLLQDFEFD
                     TSQLLHNDDKTRNESYEELQGRLNFYLDTVESLLVSDISKSIQNFFAALEDVDQIKDN
                     ATKTIDQLDTVSQNLEVVCKEKVLKRIETIKDLIRRKNVEKLQQGILQVKLANDKTME
                     CKKIYDEGDLQRCLKLIKSVERLLYGDNNDTFVNDWTSKWPYKLSNIYALPAVNSLID
                     LLSNLKVDIGGSYSLNLVNELLNDLRAYATSSCTNDILLKLQSHKDNDKPHLIVNEEF
                     REQIKNNLIQLIECDQLVPAVKLYEEKFIAELKSVIKVNLPHEKVASDNPDGKPTAAN
                     GSRLSKLIQEQSVYEFQTMLVNVFTTEIEILKRLTRHQKLLLDISLGELPTTAEHSDR
                     MVIDLDIRKNINEGIRIVQLRIGKIISVRREITNTLRFDHFLQFYHICILFMKECESI
                     SGEFLTKYLSDVLNVQIDTYMKSLQNLNVRVLKQKIEQEHWVPFKVEQELQKDVNDIV
                     SCIDIDPANWARFAELDKPSPLDVVKEEDESSANTGHKKSVVLGDKTFVASDTLVVAI
                     KMIKTLLILAANLPTQYARQCERQLKDLFKYFNTKTMESVSMKTDKNLNIMAESLDCL
                     AEITLLVQGYFQRTLGSNPEKYEVIWKQFQQSSEKLFQANNIPPPV"
     gene            complement(<1170983..>1173520)
                     /gene="REG1"
                     /locus_tag="KLMA_60548"
                     /db_xref="GeneID:34717756"
     mRNA            complement(<1170983..>1173520)
                     /gene="REG1"
                     /locus_tag="KLMA_60548"
                     /product="protein HEX2"
                     /transcript_id="XM_022821230.1"
                     /db_xref="GeneID:34717756"
     CDS             complement(1170983..1173520)
                     /gene="REG1"
                     /locus_tag="KLMA_60548"
                     /codon_start=1
                     /product="protein HEX2"
                     /protein_id="XP_022677613.1"
                     /db_xref="GeneID:34717756"
                     /translation="MPGNLASYFAQGNSNQNQQRATLSRSSSHDGFESSGINKQVPSY
                     DDMGPSISMAVHADSDDHFKNSTFNLKRTRSMGLLDPYIDDTQKLLSESGGSLNLDSF
                     SNTNIDDKSLNSSYSSSDSNVGNSRSIATVIQKEDKDNNEDNIGKLNTTTINDNDLHM
                     YNSSLSPPNTGYRQDDVEINNDGNDYNVDYSDSDSREMEDSNSPPDPGTDDFLMHHDD
                     NDLMYEPNRHVDYLSHKWNENEISQSWRYIILKKKKKDTDLINTARLENASWRTWAKA
                     RNNLKTVNPESLNWSKDSDVTWLYGPIVVDKQNTPSTASKDNESSNAKTDHSRAATIG
                     YGSDDENSKRMVHSSRSPGPKPILKKRTVSEIIEENSKWRLDVARQHRKQIGNIHMLL
                     DVPAHAVHDDYNAIAAKVNAQYYKGINKQATDSVDSASPAAMNNNYSSSDTDSGPTNR
                     STVEPLSTDIEAPQLSSILTSSMKQKEKRERHIHFNDRVEQCMAVNAIPADGIQNADD
                     DMMSDIESHSDGMNQDRDYNRQYSDMEDGSRSSDPASTEDYADDEGDTVDNDSSEDDE
                     EGGLFISANARKGRSNSLHSEGSDVENSLRSLSLSKYSNPIIKPLPATTLNYGSDDEY
                     YDDEENDSYYGNAVSHNVNTSRGFDYMYDYNSVYTGDTSSFVTENACDIRDVPDGIGL
                     DTPMDDVNDRYMDIDEDTRRNMFGHTRNQQDESQGTDSSDNEFIENSAAGKNDEDEDY
                     SYSGSGSDSDSAIEGEGEGDMIDENDRKSSLQDMPLLRRTPSLGKSRSNSLHDFIGAS
                     NSAPPVLNQTHSFITGNSMPISTPVARRPLKGPSSGSFIFGSDSDSE"
     gene            complement(<1174809..>1175405)
                     /gene="PST2"
                     /locus_tag="KLMA_60549"
                     /db_xref="GeneID:34717757"
     mRNA            complement(<1174809..>1175405)
                     /gene="PST2"
                     /locus_tag="KLMA_60549"
                     /product="protoplast secreted protein 2"
                     /transcript_id="XM_022821231.1"
                     /db_xref="GeneID:34717757"
     CDS             complement(1174809..1175405)
                     /gene="PST2"
                     /locus_tag="KLMA_60549"
                     /codon_start=1
                     /product="protoplast secreted protein 2"
                     /protein_id="XP_022677614.1"
                     /db_xref="GeneID:34717757"
                     /translation="MAKVAIIIYSMYGHVAKTAEAEKKGIEAAGGSADIYQVPETLSD
                     EVLGLMHAPAKPDYPIASPDTLTEYDAFLFGVPTRFGNFPAQWKAFWDSTGGLWATGA
                     LHGKAAGFFVSTGTGGGNEVTIVNALSTLAHHGIIFVPLGYKNAFGELTTLSETHGGS
                     PWGAGVIAGADGSRSPSELELKIHEIQGKTFYETVQKF"
     gene            complement(<1176082..>1177092)
                     /locus_tag="KLMA_60551"
                     /db_xref="GeneID:34717758"
     mRNA            complement(<1176082..>1177092)
                     /locus_tag="KLMA_60551"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821232.1"
                     /db_xref="GeneID:34717758"
     CDS             complement(1176082..1177092)
                     /locus_tag="KLMA_60551"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677615.1"
                     /db_xref="GeneID:34717758"
                     /translation="MKTVEKYVHQEAPYYFDNGIRLSEGVTYVSKAKTLFWIDIYNAL
                     IHKVTDINDISTHSVWNATLENYEGSYPFDSSYPERIGVVFPIDNSRGVEDVYFGAKY
                     GIAKMSYSTGKWEYVVPYANSGLQKDWKNLRSNDGNVSPDGEIFIGIMHDFHSDVDFK
                     DPKGALFKINLPRRTCTLVLDKIMIPNAINWDKDAKYAYFTDSLNYSIFKFPYKGSNL
                     VVEDKSLFVDVKKYNAQYESPEPDGSFIDPATDNIITAVWSTNSVQRYNTKGELVFKW
                     VFPETSRVSCCALAEGHMFVTTANDVIDKDENPQGLGGSIYKIPNVSSYTGSSKNTPI
                     TS"
     gene            complement(<1177379..>1178854)
                     /gene="ERC1"
                     /locus_tag="KLMA_60552"
                     /db_xref="GeneID:34717759"
     mRNA            complement(<1177379..>1178854)
                     /gene="ERC1"
                     /locus_tag="KLMA_60552"
                     /product="uncharacterized transporter C4B3.13"
                     /transcript_id="XM_022821233.1"
                     /db_xref="GeneID:34717759"
     CDS             complement(1177379..1178854)
                     /gene="ERC1"
                     /locus_tag="KLMA_60552"
                     /codon_start=1
                     /product="uncharacterized transporter C4B3.13"
                     /protein_id="XP_022677616.1"
                     /db_xref="GeneID:34717759"
                     /translation="MHLSEESRIASTVSSESDYGSTNNGKAASIDSPVPVSNTSVKSE
                     AYYIFKTALPLVITFLLQSSLSTTALFYAGRLGAVELGGISIGNVTFAVTSAIFIGIA
                     TCLDTVCPQAFGAGNYEMVGLYFQRGVAISLVCSIPITAFWYKSDVVLSLLVKDSAIV
                     TIAATYLRIIILTIPGFVVFECGKKYLQAQGDFITGQNILFLCAPLNVMLNYLFVIKL
                     KLGYIGSPIAIVIVYSTMGFSLIGHIYYQVYRGKDFCWHPITKGFSAIFTNWKPLLSL
                     ALPGVIMLEAEFFAFEIITILSAGFGTQILAAQSIVATIQTFVFQLPFSCSVASSNRI
                     AYHVGSGNITNCKVATKTVVLGVGTTTGIINFVFLYFGRFKVCSLFSNDPNLVKLAAS
                     LLKIVAINQVYDVFNVMAAGVLRAQGRQRIGGYLNIIAYYVVGLEIGALLAYYFKMQV
                     KGLWLGLGLGILTLAIGENSFVYFSDWVSIVRKSKDLQHEV"
     gene            <1179634..>1180995
                     /locus_tag="KLMA_60553"
                     /db_xref="GeneID:34717760"
     mRNA            <1179634..>1180995
                     /locus_tag="KLMA_60553"
                     /product="putative agmatinase 1"
                     /transcript_id="XM_022821234.1"
                     /db_xref="GeneID:34717760"
     CDS             1179634..1180995
                     /locus_tag="KLMA_60553"
                     /codon_start=1
                     /product="putative agmatinase 1"
                     /protein_id="XP_022677617.1"
                     /db_xref="GeneID:34717760"
                     /translation="MKKIILFLVPAFHALSTNAHLVKFNEQELPFQVQDEDLTAHSNG
                     QKQKSLLYQLYGELLYPRNKNDIDAAVNSPRETKNQRVLINIDPEETDEEFKSMCSFY
                     NEYDPDYPDDDFEDDLVLFSGIVSFAHVPIAQCFKNSSLAMDIAIVGAPFDTSVSYRP
                     GARFGPNGIRQGSRRLGNGISPVRGFPGSRLRKLDPYHSGYSIVDCGDIPMTPFDNKV
                     ALNQLYRGQRALHNHKSLHHPENPPRIITLGGDHTITLMALRSAYEKYGKLSVIHFDS
                     HLDTWDPKVIGGNISKRAGLNHGTFLHFAHENGYLSDDSNVHVGIRAPYVAPGFYDEQ
                     HDYECGFDKIVARDLDIISIPEVVSNIKTRVGDGPVYISVDIDVVDLASAPGTGTPET
                     GGLTSRELLTILDGLEGLNVVGADIVEVLPAFDTNGDITTLIAAQVVDSILGLMTVDS
                     VQE"
     gene            complement(<1181169..>1183418)
                     /gene="LYS14"
                     /locus_tag="KLMA_60554"
                     /db_xref="GeneID:34717761"
     mRNA            complement(<1181169..>1183418)
                     /gene="LYS14"
                     /locus_tag="KLMA_60554"
                     /product="lysine biosynthesis regulatory protein LYS14"
                     /transcript_id="XM_022821235.1"
                     /db_xref="GeneID:34717761"
     CDS             complement(1181169..1183418)
                     /gene="LYS14"
                     /locus_tag="KLMA_60554"
                     /codon_start=1
                     /product="lysine biosynthesis regulatory protein LYS14"
                     /protein_id="XP_022677618.1"
                     /db_xref="GeneID:34717761"
                     /translation="MVVGKDNGTGFDCLTPGSYASSQAISVEQHSQNPRSKQPLFTPR
                     SKNGVSPVSTHQPEALTGTAFEGISFEDSINSPRPALVKNTPTSIGTSPNDASLTNLP
                     PIGDVLHANHSMSSSSIMSSTDGSTGTPTSGTDNKVTKRKYSRNGCLECKRRRMKCDE
                     GKPTCWQCARLSRNCIYVLNPKNKKRKPRKPKQEGNSVNHENTDTKPVNSQEGTQSDN
                     NLLDAGLPNLIPTANIDAIDANLLIQNLNDIVNMKLNDSLINDELKDLEFNDLDFPDL
                     NIPLINNSSEFSSVPISFLVDNTITFNTPLDSFKLGGIHDEYLRTFYYDCLDSIAPFF
                     QNQSNPLRDILLSFAKKESYLLSAILAVGASIVHRKSNKVEDEKAYCGYLSHCLQLLG
                     YQFKNENNVIKKIEPIILTVILLTWDCIYTMNSQWRSHLKGITELFKKINSGNSSKVL
                     NVAKCWFKVMETFASISTVLGGALVEEADLDAIFDPYDFEYVESLKFMNITTSLNEFN
                     LLRGHNEQFDLVIKEVFKTLNLVRSLERTSINSSHDGILTKNIDYLLYSNSNSEEFRD
                     KLSYFNIQKIIVEIDRQLEYQFIDKSGVIPPDSALHPSNSKITDNSIDLVTLKSGEVV
                     AVSWYDISHQTQVLSFLLIVLLKLLGIPKESIAVQQVVKKIMSFFRFLDSDNPPVNLR
                     TCYSNFAVLIAGLNAIDEETKSLVRKYYDVNGSRFRRLTEHNLNRLEKVWSGNETKFN
                     LEDQDVLTW"
     gene            complement(<1183783..>1186413)
                     /gene="PRP6"
                     /locus_tag="KLMA_60555"
                     /db_xref="GeneID:34717762"
     mRNA            complement(<1183783..>1186413)
                     /gene="PRP6"
                     /locus_tag="KLMA_60555"
                     /product="pre-mRNA-splicing factor 6"
                     /transcript_id="XM_022821236.1"
                     /db_xref="GeneID:34717762"
     CDS             complement(1183783..1186413)
                     /gene="PRP6"
                     /locus_tag="KLMA_60555"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor 6"
                     /protein_id="XP_022677619.1"
                     /db_xref="GeneID:34717762"
                     /translation="MELPSFLSQTPPPGYIPGIGRGAVGFSTKEKGGERKTPARNGPN
                     SRRLTDTIKDHTNRNKYTKDPLEGAFENQDEEEVNMFKAIEEKLKNKGRYQDNEDSSG
                     NRIVNVSSNFADLKRSLGKLSQNDWLNIPEASDITRRNKRARIEEQLERKTYSAPDSL
                     FQSNINLSKLTEERERLLALEIDKTIHTKYQRSDELIDLDTLSNYQNSFSSASLEEIR
                     RNRKILASYRKSHPRNAENWISSARLEEKANQYNRAKKLLEEGCKMCPKSEEIWLEYI
                     RISHSDEQFCKLLVSTALRHNIKSENLWIKAIELEQQNINKINLVRKALLNIPSSARL
                     WELAVSLEDSKEGKLKVLSRAVELVPDSPNIWLNLIKLQSIDVARQTLRRAENYIKDK
                     LSFWIIKCQIEEENSTDFDSLVNIFINGYSILRSQGTLPAVHESLKEALLLSDQNTHP
                     STPKAIIVSLVNDSQIDTETNIENLLKILSHDLNLKASLFSSFLQKYPSKYSIWREFT
                     KFAEENNMKDVLFEAYNNIVVRNPENIKSYPVLLLMYAKSVWNWGEKPTDALRIIDQA
                     ISVYPAFKEFWLAKFKILNRENTLTDLVKCFKEFQSAIKMGDEQVVVFFIKCLQNQNS
                     VELSIKYIEEALRNHPEQPELYILKSQVHLRYGNIELARSTIYSALEKFNYAPTISIF
                     AGQLEMQHKNWEKARSILNISLSKNPRSESLFEALILMEMEIKDDKQVVYLINQGLKA
                     CPASWKIWSLRIRTLDKKYMRKTIFHDALKATKEHPMVLCEIGRVFLNESQFTKAHKW
                     IIRSVEMNPQYGDPWVWLYICESYLEEEKTNAKNTIAEKITKIEPKFGTLWEAAANSY
                     EHISDPPVDILKSIIKEIKV"
     gene            complement(<1186773..>1188530)
                     /gene="PHO89"
                     /locus_tag="KLMA_60556"
                     /db_xref="GeneID:34717763"
     mRNA            complement(<1186773..>1188530)
                     /gene="PHO89"
                     /locus_tag="KLMA_60556"
                     /product="phosphate permease PHO89"
                     /transcript_id="XM_022821237.1"
                     /db_xref="GeneID:34717763"
     CDS             complement(1186773..1188530)
                     /gene="PHO89"
                     /locus_tag="KLMA_60556"
                     /codon_start=1
                     /product="phosphate permease PHO89"
                     /protein_id="XP_022677620.1"
                     /db_xref="GeneID:34717763"
                     /translation="MTLQQFDYIFAITMMFAFLDAFNIGANDVSNSFASSISSRSLKY
                     WQAMILAGICEFLGAVLAGSRVSGTIKNDIISATPYLEDPAVLMLTMSCALVGSAIWL
                     TIATSCGMPVSTTHSIVGGTIGAGIAAGGRGSVKWGWGGVSQIIASWFIAPIFSGCLC
                     TVIFLISKYSVLDVKPVERSVKNALFLVGFLVFATFSVLTMLIVWKGSPNLKLDDLST
                     TTTVTSIVLTGAVACVIYFIMFFPYYRRKILYQDWTLKLTDLLKGPALYFKPHDNIPP
                     IPAGQTLTIDYYEGRRFGDNVLVENDKSQNIEETDSEGRKEIINADSEMDKEVISQDI
                     VLLQSTSNSEDPPMTTRQLWWSLLKQGPKEWGHLAWLVLSHGWTQDVIHAQVNDKGAL
                     STNFEDLYSRSKFYDNRVEYIYSILQAITAATMSFAHGANDVANATAPLAAVYEIWKT
                     NRVESDSDVPIWILVYCASALVIGCWTYGYRIIANLGNKMILQSPSRGFSIELGAAVT
                     TVMATQLSIPVSTTQVAVGGIVAVGLCNKDVKSVNWKMVAFCYCGWFLTLPIAGLIAG
                     VLNGIILNAPRFGGEYELS"
     gene            1189724..1189795
                     /locus_tag="KLMA_R617"
                     /db_xref="GeneID:34718776"
     tRNA            1189724..1189795
                     /locus_tag="KLMA_R617"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:34718776"
     gene            complement(<1190005..>1191504)
                     /gene="mtr"
                     /locus_tag="KLMA_60557"
                     /db_xref="GeneID:34717764"
     mRNA            complement(<1190005..>1191504)
                     /gene="mtr"
                     /locus_tag="KLMA_60557"
                     /product="N-amino acid transport system protein"
                     /transcript_id="XM_022821238.1"
                     /db_xref="GeneID:34717764"
     CDS             complement(1190005..1191504)
                     /gene="mtr"
                     /locus_tag="KLMA_60557"
                     /codon_start=1
                     /product="N-amino acid transport system protein"
                     /protein_id="XP_022677621.1"
                     /db_xref="GeneID:34717764"
                     /translation="MLSFKASEQNSEANSISDKSDPNKSLLPAHSAKKRVSEDAIEVV
                     HYVEESGTCRESDYLDTDEEGHQIKYRTCSWQHTTGLLLSEYIVLAIMSFPWSFSVLG
                     LIPGLILTVFVACTVLYTGIIILDYCERFPHLKNVCDIGQHLFWGSKVAWYATAVCFI
                     ANNTLIQGLHVLVGAKYLNTITNHSICSVGFTAIVAVISFVFSIPRTFSSLSKVGYFS
                     AITMFISVILAIVFAGIQDHPAKYDGTPVKYHLFAQKGTTYVDAMGACLNIVYTFVGQ
                     ITYPQFIAEMKRPKEFKKVLWIVTICELIIFSLAGALIYVYVGNEYMTAPAYGSLKRT
                     FKIISFTFAVPTIIFVGSLYANVSSRFVFFNIFENSTHLYSHTKVGWLTWIGLLSLTW
                     VGAFLIAELIPFFSDLLSLMSSLFDCWFGFVFWGVAYYRIKQNKYKTKFPYPLLTKSE
                     KIHYFISIFLIVIGIYILGPGLYATIQSIINNFKSGAYGSVFDCASNGI"
     gene            <1193970..>1195673
                     /locus_tag="KLMA_60558"
                     /db_xref="GeneID:34717765"
     mRNA            <1193970..>1195673
                     /locus_tag="KLMA_60558"
                     /product="aminotriazole resistance protein"
                     /transcript_id="XM_022821239.1"
                     /db_xref="GeneID:34717765"
     CDS             1193970..1195673
                     /locus_tag="KLMA_60558"
                     /codon_start=1
                     /product="aminotriazole resistance protein"
                     /protein_id="XP_022678479.1"
                     /db_xref="GeneID:34717765"
                     /translation="MSQAESSSNSLNEVAEKEGEFPIESIFHPNRLKHFKFLCILSAL
                     ALDFMSLGAMIVLVQDVEKRFNISATKASWSLTSYVITFAGFIAFFGRVGDIVGNGMM
                     MSISIGVFGICSLLCAVIPNFVGFAVFRAFQGMAGAGIVPCSYALVNSMFAGENLQRY
                     FSILSSIGSGTIGVGFVIGGAFAETKIGYKALFYMVFGASILTCMLILLLIGYPEYVR
                     VKSDYSARFKRVTKLDVIGSFTFISGSVLLVVALTDGGDSWKKPSAYVPLVISIILMA
                     AFFAWNLGYQKVLSLLKPHISTGAYKYMESVSVLIPKELLYAHNFAPVLLVSFFAFAA
                     FMVVMYTVVNYSISVEGDAVIVAAVKIMPLIVGLMLANTTIAFHQTILKPKNGLIVGT
                     FVCTLGCAFLTALKEVNGNLYWKLLLLSAFLAGIGGAVYFSYMLSMAIGDAPMEYKAL
                     AGGVVQTASQFGNEVALSVIVSLLGNGKTNRKELRKRYQNVGYFAIACAAMAFISAIT
                     TLRDQLEPSDDEEQQNASVHSVKGCESDESTTHQQCQVTVVQVGFEEEEKMKSQPGRI
                     A"
CONTIG      join(AP012218.1:1..1197921)
//
DBGET integrated database retrieval system