GenomeNet

Database: RefSeq
Entry: NC_036031
LinkDB: NC_036031
Original site: NC_036031 
LOCUS       NC_036031             963005 bp    DNA     linear   CON 23-OCT-2017
DEFINITION  Kluyveromyces marxianus DMKU3-1042 DNA, complete genome, chromosome
            7.
ACCESSION   NC_036031
VERSION     NC_036031.1
DBLINK      BioProject: PRJNA264644
            BioSample: SAMD00067077
            Assembly: GCF_001417885.1
KEYWORDS    RefSeq.
SOURCE      Kluyveromyces marxianus DMKU3-1042
  ORGANISM  Kluyveromyces marxianus DMKU3-1042
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1
  AUTHORS   Lertwattanasakul,N., Kosaka,T., Hosoyama,A., Suzuki,Y.,
            Rodrussamee,N., Matsutani,M., Murata,M., Fujimoto,N., Suprayogi,
            Tsuchikane,K., Limtong,S., Fujita,N. and Yamada,M.
  TITLE     Genetic basis of the highly efficient yeast Kluyveromyces
            marxianus: complete genome sequence and transcriptome analyses
  JOURNAL   Biotechnol Biofuels 8, 47 (2015)
   PUBMED   25834639
  REMARK    DOI:10.1186/s13068-015-0227-x
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 963005)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 963005)
  AUTHORS   Yamada,M. and Kosaka,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2011) Contact:Mamoru Yamada Yamaguchi University;
            1677-1 Yoshida, Yamaguchi, Yamaguchi 753-8515, Japan URL
            :http://ds22.cc.yamaguchi-u.ac.jp/~jo-sei08/index.html
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP012219.
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps and the
            genomic and proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: SPS phrap v. 0.990329
            Assembly Name         :: Kmar_1.0
            Genome Coverage       :: 8.4x
            Sequencing Technology :: Sanger ABI3730
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..963005
                     /organism="Kluyveromyces marxianus DMKU3-1042"
                     /mol_type="genomic DNA"
                     /strain="DMKU3-1042"
                     /db_xref="taxon:1003335"
                     /chromosome="7"
     gene            complement(<2144..>3847)
                     /locus_tag="KLMA_70001"
                     /db_xref="GeneID:34717766"
     mRNA            complement(<2144..>3847)
                     /locus_tag="KLMA_70001"
                     /product="aminotriazole resistance protein"
                     /transcript_id="XM_022821241.1"
                     /db_xref="GeneID:34717766"
     CDS             complement(2144..3847)
                     /locus_tag="KLMA_70001"
                     /codon_start=1
                     /product="aminotriazole resistance protein"
                     /protein_id="XP_022677622.1"
                     /db_xref="GeneID:34717766"
                     /translation="MSQAESSSNSLNEVAEKEGEFPIESIFHPNRLKHFKFLCILSAL
                     ALDFMSLGAMIVLVQDVEKRFNISATKASWSLTSYVITFAGFIAFFGRVGDIVGNGMM
                     MSISIGVFGICSLLCAVIPNFVGFAVFRAFQGMAGAGIVPCSYALVNSMFAGENLQRY
                     FSILSSIGSGTIGVGFVIGGAFAETKIGYKALFYMVFGASILTCMLILLLIGYPEYVR
                     VKSDYSARFKRVTKLDVIGSFTFISGSVLLVVALTDGGDSWKKPSAYVPLVISIILMA
                     AFFAWNLGYQKVLSLLKPHISTGAYKYMESVSVLIPKELLYAHNFAPVLLVSFFAFAA
                     FMVVMYTVVNYSISVEGDAVIVAAVKIMPLIVGLMLANTTIAFHQTILKPKNGLIVGT
                     FVCTLGCAFLTALKEVNGNLYWKLLLLSAFLAGIGGAVYFSYMLSMAIGDAPMEYKAL
                     AGGVVQTASQFGNEVALSVIVSLLGNGKTNRKELRKRYQNVGYFAIACAAMAFISAIT
                     TLRDQLEPSGDEEQQNASVHSVKGCESDESTTHQQCQVTVVQVGFEEEEKMKSQPGRI
                     A"
     gene            complement(<4778..>6283)
                     /locus_tag="KLMA_70002"
                     /db_xref="GeneID:34717767"
     mRNA            complement(<4778..>6283)
                     /locus_tag="KLMA_70002"
                     /product="arylsulfatase"
                     /transcript_id="XM_022821242.1"
                     /db_xref="GeneID:34717767"
     CDS             complement(4778..6283)
                     /locus_tag="KLMA_70002"
                     /codon_start=1
                     /product="arylsulfatase"
                     /protein_id="XP_022677623.1"
                     /db_xref="GeneID:34717767"
                     /translation="MSPKPNLILFMPDQLRYDCIGANGNQKIKTPNIDRLTKLGARFS
                     NCYLQHSVCSQSRASMFTGKYPHVTGHRGLTTLIKPYEDNLFKALKNDGYFVVNVGTR
                     GDLFSAGGYEESFDEYGFTVQIDYNFKRNQSLEKPSFKGIQVDWPRLYYSGNRGSDLK
                     IDYDEALIRSAEKWLTAFKNDPSLTGGKPWVLFLPLFFPHCPFEVEEKWYNMYSREDV
                     PERVKLETKTGEEPLYMRRLREKHGLVDLPEPVWNEVIATYYGMISRLDWQFGRILDL
                     VEEDLKNDLFLFFFTDHGEYLGDHNLIEKWPSGVSEQLTHGPLFIAGPSVEKGQTINH
                     LVEMLDLVPTVFDLGKVKTRYPNNGKSWVPLLHAQSTDDIVHKDYVVSEGGFLKTEEP
                     IIEVAPFPYDIKANLQHDEIDTVGRVVSMRTKEFTFIYRLYEPNELYNRIEDLEERHN
                     LIADPTYTSIVDAFEKKMLKFFIESSDHAPFVTDTRIPEVNLPLPGSKQFK"
     gene            complement(<6510..>8075)
                     /gene="HXT15"
                     /locus_tag="KLMA_70003"
                     /db_xref="GeneID:34717768"
     mRNA            complement(<6510..>8075)
                     /gene="HXT15"
                     /locus_tag="KLMA_70003"
                     /product="hexose transporter HXT9"
                     /transcript_id="XM_022821243.1"
                     /db_xref="GeneID:34717768"
     CDS             complement(6510..8075)
                     /gene="HXT15"
                     /locus_tag="KLMA_70003"
                     /codon_start=1
                     /product="hexose transporter HXT9"
                     /protein_id="XP_022677624.1"
                     /db_xref="GeneID:34717768"
                     /translation="MTSDKDVEYVEEVKQIDSSSKLDEKATKNLFKTLKESFNLTMAL
                     SSLLLICSSFSHGFDNQGFATIQAMDSFTEKFGEYNVRTGVYAIPPKFLSYLNSFQYI
                     GFAFGLVCGSIVSSRFGRKICVLSMSLYALITATIAITSDSKEQILSARVLNYVFIGM
                     EMAVIPVFQAEIVPPKTRGFFVGAFQLSLAIGGLIIHIITNSTAHIHGTSSWRIPLGL
                     YYIFPSIIASLIMFVPESPRWLILKGKNEEAMQSLVRLRSGTILESEIPDEFESIISS
                     VEVEKQHGSKYTELFTGTNKRRTILVILANTFQQVTGQAFSSQYGTIFIKSLHTVDPF
                     QMSIVSSVINIVGVAIVLLFTDAFGRKKFLVVGSVIQAMALLAMGGLGTGDITTAKKK
                     GVVATMMINGFAYCISWAPLSYVISSEIPTPRLRDKTYAVGILFNILFAFLTAFTLPY
                     LLSKPYANLQSKVGFIYGAFTVLAIVFSYFLPECHGLSLEEIELNFVNNVPLNRFSKN
                     PQQSKDDGELYTP"
     gene            complement(<9333..>9884)
                     /locus_tag="KLMA_70004"
                     /db_xref="GeneID:34717769"
     mRNA            complement(<9333..>9884)
                     /locus_tag="KLMA_70004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821244.1"
                     /db_xref="GeneID:34717769"
     CDS             complement(9333..9884)
                     /locus_tag="KLMA_70004"
                     /note="DUP super family[cl02924], This family consists of
                     several yeast proteins of unknown functions."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677625.1"
                     /db_xref="GeneID:34717769"
                     /translation="MITPDSPHQMLMKGESDNPRKLTCSKLGKDLGRGRISHAIAEHP
                     WTAPCLIGLIVIITILSGAILYYTQYNPSDNRLVMYLILIIVCTPVLLRLLAFMFDPI
                     SIRLISETDDALFFLKLIIKGHSWEEIGEIMNSYLFERGIWPTDSYFYDGQQCYDLFD
                     LYSQKCTDPAILAFIQQTKKKLP"
     gene            complement(<10561..>11946)
                     /locus_tag="KLMA_70005"
                     /db_xref="GeneID:34717770"
     mRNA            complement(<10561..>11946)
                     /locus_tag="KLMA_70005"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022821245.1"
                     /db_xref="GeneID:34717770"
     CDS             complement(10561..11946)
                     /locus_tag="KLMA_70005"
                     /note="Uncharacterized membrane protein YNR062C"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022677626.1"
                     /db_xref="GeneID:34717770"
                     /translation="MQLEYSQKHLYLQYLGVSLIAVQFSFDTCVYLSSVVRYIKQCGS
                     DDPESYLFVLQAVSAAVQVFFSFFIGDIAEYVGSIKWILIFLYFLSFVGNFLYSCAGA
                     ISLNALLGGRIICGTASSSGALVYSYISAITKDKTTVFKLFSIYRTSAGISMALAQLV
                     AILFALCDFTIRGYQITSYNAPTFASSFMVLLICFILVFVLEDPPIKKTRKEQSYLNA
                     WKKFFCADSNKLIACIILLWNMFLSTFFMCEILYFMPIFLTLKVGWKVEYEGVAFMIS
                     AILGVSGSFFAPNLVKLFSKLNSRATQNDTTDSSGNVKMEKEKTEQIRDMNELHRNQV
                     SLTIFALFVALIGQAFMIGASEALKHNDLPETNSGIFFTSGMAITMTGYNFMGSSVPA
                     LFSMYIDPQVKVQLMPFIGAIAGIGKLVAPIVLAALYKTPLGLSIGVGFGMILVGISV
                     PSLVYLRMKNI"
     gene            complement(<12861..>14636)
                     /locus_tag="KLMA_70006"
                     /db_xref="GeneID:34717771"
     mRNA            complement(<12861..>14636)
                     /locus_tag="KLMA_70006"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821246.1"
                     /db_xref="GeneID:34717771"
     CDS             complement(12861..14636)
                     /locus_tag="KLMA_70006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677627.1"
                     /db_xref="GeneID:34717771"
                     /translation="MACLECKKRKQKCDGQEPCGRCANLNVKCIYGTDGRKDKRKKIK
                     DGSNMFIFKNQTLFSDKCIDVIPRCFSHSSIADGETCNPSFPAFSDEVNFADMISTEN
                     TTGSAPLHFDSDFTNIETFDVNNFLRLIGDPFFLTNDDTFEVNEIGNSQPILTRTSSN
                     KLETSIQRNHLIEVLFENDSHTPPGILRDHILELSETYDDLEAIHSENNGKFLLSAVL
                     CLGALTLRKRELMNRDKNKPHLNGISEVASEAYKYYTIATDLIPSVLETPNIDGFCGL
                     VLMANFMTLMIPLEGQLYLSNNALEVAVALNLHQREYYNKMLISNPAQTGVFLLFWNL
                     WCSSCMLATLLGKEPFLTVETISLPRPHEMQPIMNSNPLSIDFMRLRIQLATLQSKIF
                     RSLYVYGSLDKALLQEIETELSLVSTHISNMKGYPIYDKELFYRSKVLMLELSCLKAH
                     NIFLLYRPNLIQKRSLHAVDAAKHIILEIWSHYTKQFPKNAQELVDHLDWNFSYPLRS
                     ATLTLSISCIILLKYQQSLDFSEEYNIFEYTLALDVLDDLIQVIPIDERLVKLLKVTT
                     SATVEDTNKLIKEDSLKFWTSMLVC"
     gene            <16601..>18160
                     /gene="FCY2"
                     /locus_tag="KLMA_70007"
                     /db_xref="GeneID:34717772"
     mRNA            <16601..>18160
                     /gene="FCY2"
                     /locus_tag="KLMA_70007"
                     /product="purine-cytosine permease FCY2"
                     /transcript_id="XM_022821247.1"
                     /db_xref="GeneID:34717772"
     CDS             16601..18160
                     /gene="FCY2"
                     /locus_tag="KLMA_70007"
                     /codon_start=1
                     /product="purine-cytosine permease FCY2"
                     /protein_id="XP_022677628.1"
                     /db_xref="GeneID:34717772"
                     /translation="MSSPICNEGYLSCDIEKQDISDSGLQELEKDHSVYTTTTEVSRL
                     SWVNRLADRVNAETKGIDPVTESEKNDADIMNAATMWFSSNMVISAFSLGCLGISACG
                     LNFGTSVLTIFFFTILGVMPVALFSVFGVELGLRQMVLSRFLVGNITARLFSLMNVIA
                     CVGWVSVNTMASASLLHMINPSGNNCPPWAGCLIIIMCTIVVTFFGYRFIHLYEKWSW
                     VPNFTVFLVIIARLAKSGNFTNGPWGGGPNTAAGVLSFGSSIFGYAAGWATYASDYTV
                     YMPRQTNKRKVFFSVMLGLGLPLLFTMTLASAAMACTQTNKRWAELYASHSVGGLCYA
                     ILVEDSLWGFGSFCCVLLAMSTVANNTPNMYSIALGTQSIWEPLARVPRVFWTLVGNL
                     AALAISIGAYYKFESFLSKFMDSIGYYIGIYIAVSLSEHYIYRHGFVGYTVSDWNRWD
                     KLPVGYAGCTALFIGAFGVAFGMSQSYWKGEIGRHIGSGGADIGFELGAGFAFIAYNI
                     CRPLELKYNGR"
     gene            complement(<18720..>20009)
                     /locus_tag="KLMA_70008"
                     /db_xref="GeneID:34717773"
     mRNA            complement(join(<18720..19894,19964..>20009))
                     /locus_tag="KLMA_70008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821248.1"
                     /db_xref="GeneID:34717773"
     CDS             complement(join(18720..19894,19964..20009))
                     /locus_tag="KLMA_70008"
                     /note="Flocculin super family[cl09259], This short repeat
                     is rich in serine and threonine residues."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677629.1"
                     /db_xref="GeneID:34717773"
                     /translation="MDRHLHDNCSDCYHHTTTINVAWTGSYTATYSTELVTTTGADGV
                     ITIEAVYHVKTPAVGSSNTKISTQLNNNTINGADVVPNVHTTMPVETTEVGNPSIINS
                     PWTGTYATTYSTEFVTVTGTDGIVTLKAVYHVETPAMASSNAKTPTETSNNSATSADS
                     VINVQTTNHVVTGGIGSTSKVNIPWTGTYTTTYSTGAITSTFSDGIQAVQTAFYVKTP
                     EMSSFGFGYSNSSSTISHSTDSNDNKSLQDETSKPLDKISVTSGSAMIHPMTETNVQM
                     SQETISNRPTTSRNDDEPVPKRHSSANLNTPLGTTMNAVGETSGVVSGMLDTETKGKQ
                     SKTMSDSVGQPVTTSPTTSEAASPQLSLNLSIPNITIMISGHSQINTVETHFEGKANK
                     ILISPLMIIILAFL"
     gene            complement(<19805..>20908)
                     /locus_tag="KLMA_70009"
                     /db_xref="GeneID:34717774"
     mRNA            complement(<19805..>20908)
                     /locus_tag="KLMA_70009"
                     /product="flocculation protein FLO9"
                     /transcript_id="XM_022821249.1"
                     /db_xref="GeneID:34717774"
     CDS             complement(19805..20908)
                     /locus_tag="KLMA_70009"
                     /codon_start=1
                     /product="flocculation protein FLO9"
                     /protein_id="XP_022677630.1"
                     /db_xref="GeneID:34717774"
                     /translation="MWFALFQVLLLMGIPLVDCQSFNTDLNTVLGCDPKTNSLSKGFS
                     VSYYHYPLIPSGSAGCYVGDSQTFLTDEYLHGGYATYGDGLIGSSTGVTDLTFQFRFP
                     GGCLRPILGSLPSNYNNPPQFSMSNFSMLITGYFFAPKTGLYDFVITNGDDVIDINMG
                     DGKAFACCQLENTITKPAPFDISVVWRTTSGSGSFNLVGGYYYPLRIFYMNRYQDAAI
                     KMYFKDPDGVVHNNFDGYVFTIPDGEKCPAPVATTTLPWTFQSTATGTAIGTTTAVDG
                     EAITEDFIVVRLPHIETATAINIPWTGTYTTTVATATTTVTGVDGIPTIETIFMWKPL
                     RLKQRLQLMWHGLVRTRPLTPLNWLLPLVLMVL"
     gene            complement(<22101..>23372)
                     /gene="ARR3"
                     /locus_tag="KLMA_70010"
                     /db_xref="GeneID:34717775"
     mRNA            complement(<22101..>23372)
                     /gene="ARR3"
                     /locus_tag="KLMA_70010"
                     /product="arsenical-resistance protein ACR3"
                     /transcript_id="XM_022821250.1"
                     /db_xref="GeneID:34717775"
     CDS             complement(22101..23372)
                     /gene="ARR3"
                     /locus_tag="KLMA_70010"
                     /codon_start=1
                     /product="arsenical-resistance protein ACR3"
                     /protein_id="XP_022677631.1"
                     /db_xref="GeneID:34717775"
                     /translation="MSSSFTRRCDEPSMESRDQEPSQSNDWRLLDTAKKLSYKDLMLP
                     VTIILCMIISVLISVYVPSSRHVFDAKKDFNLVNVSIPLAIGMIVMMIPPICKVPWES
                     IHVFISKNSVWKHIAISLVLNWVIGPLLMTGLAWLVLFKHEEYREGIIMIGIARCIAM
                     VLIWNQIAGGDNDLCVVLVICNSLLQMFLYAPLQLLYCYVISAGNFQGSYNRVFEEVA
                     KSVGVFLGIPLLCGIATRMLFVCIIGKDKYERNVLKYVAPWSTIGLHYTICVLFISRG
                     YQLVHELGSAFLCFVPLILYFIIAWTLTFVLLRCLTKQSTEDNQECDCDQEKLLLPNS
                     WGKKTCTSNFPITMTHCFTTASNNFELSLAVAISLYGNDSKQAIAATFGPLLEVPILM
                     MLALLSKYLHAKFMWESEGISSGLRYSSNDS"
     gene            complement(<25613..>26800)
                     /locus_tag="KLMA_70011"
                     /db_xref="GeneID:34717776"
     mRNA            complement(<25613..>26800)
                     /locus_tag="KLMA_70011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821253.1"
                     /db_xref="GeneID:34717776"
     CDS             complement(25613..26800)
                     /locus_tag="KLMA_70011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677632.1"
                     /db_xref="GeneID:34717776"
                     /translation="MVRLFDILGALLVAELMGLANAKQSYQVVEFGNVGFSGTYKNVK
                     KISNEDKDSCTCNLGDEIWFSGENAPLNEGVSVHFRGPLSLSKFAFYTSPSFDINDSS
                     SSQSWNRTAYYDASNKTANNVTFLTNAGDNSSCLGKALTYADSTGTGKASDATILGSD
                     NLLKSDEEFSIFSEVKCPKSGYNKACGVYRSGIPAYHGFDGETKMFLFEFTMPTASEK
                     NSSSIEYYDMPAIWLLNDHIPRTSQYPTNPNCSCWNTGCGEFDIFEVMNGTERNNLYS
                     TFHTFQGIEYLGYGIQADGYIPRDTEGTMKGGVLFDSKGNTVVFMSNDTTFDTEVDYN
                     TIQKLTSVSKNEKYDTNLATISATAPTSTSKSGAAILIPQLSGTFQALLMSAILSTIN
                     FIF"
     gene            <28424..>29539
                     /locus_tag="KLMA_70012"
                     /db_xref="GeneID:34717777"
     mRNA            <28424..>29539
                     /locus_tag="KLMA_70012"
                     /product="1-aminocyclopropane-1-carboxylate oxidase"
                     /transcript_id="XM_022821254.1"
                     /db_xref="GeneID:34717777"
     CDS             28424..29539
                     /locus_tag="KLMA_70012"
                     /codon_start=1
                     /product="1-aminocyclopropane-1-carboxylate oxidase"
                     /protein_id="XP_022677633.1"
                     /db_xref="GeneID:34717777"
                     /translation="MSFRTLPVIDFKQAFHKESKPRFLQELRYALIEVGFFILVNFDQ
                     YGPSEQDFIDIEKQSADFFALPTELKEDIAMVNSPHFLGYTAVGNEITGGIVDQREQI
                     DLATELPAPSKELPIFNQLEGPNQWPSKEALPEFRKVVTNYIQKMTELSMYMKDLVEE
                     AIGLPKHELDSFFKENQQYKMKLVSYPEIPEDYEHNNNEELSQGVGAHRDNTFMTFIY
                     QCIEVDGSLQVENFEGQWIPVNKIPNSLVVNVGQLLESITNGVCKATIHRVVSPKKGS
                     GRRLSIPFFQNVHTNAYQRTLANFPSEVIQLRDKRDKLITKWGINVGFQFEPELSKYP
                     AGVSVFKNRIKSHQDVAARWYPQILQDVLTEYESTKN"
     gene            <30588..>32285
                     /gene="VBA2"
                     /locus_tag="KLMA_70013"
                     /db_xref="GeneID:34717778"
     mRNA            <30588..>32285
                     /gene="VBA2"
                     /locus_tag="KLMA_70013"
                     /product="vacuolar basic amino acid transporter 2"
                     /transcript_id="XM_022821255.1"
                     /db_xref="GeneID:34717778"
     CDS             30588..32285
                     /gene="VBA2"
                     /locus_tag="KLMA_70013"
                     /codon_start=1
                     /product="vacuolar basic amino acid transporter 2"
                     /protein_id="XP_022677634.1"
                     /db_xref="GeneID:34717778"
                     /translation="MTIDTRPLIYGEEVASTYSSIESNVQSGYGQQSTETHDDDVEEV
                     PLSQIPNLFLIQLSLFSNVFLAGFDGTITASTYQLIGNEFNHVSVASWITTAYLVTST
                     AFQPLYGSFSDVLGRRKCLFFANVIFAVGCLACAIAPKIFVLVAARALCGIGGGGLVT
                     LSTVINSDLVPPSRRGIFQAFQNLILGFGSIIGAASGGWISTKIGWRWCFLLQVPISL
                     FGTAVGYFYVKNQKEYELTRLSKKSDSFYSVLSEIDILGALLLVVGLTTQLLYITFVS
                     SITSGGILWLKPSYLFLLLTSIGVLLLFAYNEEHTKARPIIPRKLVQGNYSFCILSLA
                     ILIGFASFAYLFTLPLYFQIVVGDTPSIAGLKLAIPSFCTPIGGLITGVGMSKSDCLP
                     TLLKSGILLMALGNGLFTLLRESTPNWLTTVFLLPNNIGQGMAFPASLFSFIFAYSRS
                     DQATATSALYLFRAVGSVWGVAGSSSIIQYFVSKRLRLSLKDKLSEEQINKILIKLSK
                     NTQYIEELKGEIRDAVVGSYAYGAQKTHIISTLFCVISLILAFISVKYKPNTFKKFH"
     gene            <32932..>35346
                     /gene="AMD1"
                     /locus_tag="KLMA_70014"
                     /db_xref="GeneID:34717779"
     mRNA            <32932..>35346
                     /gene="AMD1"
                     /locus_tag="KLMA_70014"
                     /product="AMP deaminase"
                     /transcript_id="XM_022821256.1"
                     /db_xref="GeneID:34717779"
     CDS             32932..35346
                     /gene="AMD1"
                     /locus_tag="KLMA_70014"
                     /codon_start=1
                     /product="AMP deaminase"
                     /protein_id="XP_022677635.1"
                     /db_xref="GeneID:34717779"
                     /translation="MSPLHNIIERMSSGVEMSEPSENHEIHPMSNPNDFASYHDDLAS
                     ASDTDTHSISTNFSYHDGKSLLEQGIKKLALQHLQNQDSAPDTVNAQNSLHLPPYLSS
                     SHMTDTATAAAAAVPRSERRISLSVHPTDQDTLPATSRSKRPSSSSTFGGLDPDRLKS
                     AQYKMGTIDDDGQSAHDIPSPELVELYTSVQECRELRKRYQEVSLQKHHQNPKNRPDW
                     KIYPPPPKPTYDAANKTVVKVENLPDSKTFDVNECEIPGPDPDISFKPNDDEVFVLYD
                     NKSEMQERVGEKIPSLRDYYIDMEKIISVSSDGPAKSFAFRRLQYLEARWNLYSLLNE
                     YHETAVSKKNPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKHKLRHSSDEKVIFRDGK
                     VLTLEEVFKSLNLTGYDLSIDTLDMHAHKDTFHRFDKFNLKYNPIGESRLREIFLKTD
                     NFIHGKYLAEITSEVISDLENSKYQNCEYRISVYGRSTDEWDKLAAWVVDNKLFSHNV
                     RWLIQIPRLYDIYKKTGTVENYFEICKNVFLPLFEVTQNPQSHPKLHIFLQRVIGFDS
                     VDDESKIDRRFQKKYPKPSLWDSNQNPPYSYQLYYLYANIASLNNWRSKRGFNTFVLR
                     PHCGEAGDPEHLISAYLLAQGISHGILLRKVPFVQYLYYLDQIGIAMSPLSNNALFLT
                     YDKNPIQYYFKRGLNVSLSTDDPLQFSYTREPLIEEYSVAAQIYKLSNVDMCELARNS
                     VLQSGWEAQIKRHWIGKHFEKDGIEGNDQEKTNVPDIRINYRYETLKTELELVKYYSD
                     FKNMVQ"
     gene            complement(<35495..>36568)
                     /gene="PFA5"
                     /locus_tag="KLMA_70015"
                     /db_xref="GeneID:34717780"
     mRNA            complement(<35495..>36568)
                     /gene="PFA5"
                     /locus_tag="KLMA_70015"
                     /product="palmitoyltransferase PFA5"
                     /transcript_id="XM_022821257.1"
                     /db_xref="GeneID:34717780"
     CDS             complement(35495..36568)
                     /gene="PFA5"
                     /locus_tag="KLMA_70015"
                     /codon_start=1
                     /product="palmitoyltransferase PFA5"
                     /protein_id="XP_022677636.1"
                     /db_xref="GeneID:34717780"
                     /translation="MPLVARITRFTHHPNFRYLVPSLVIVLQCYGVWAFSHQFCYLRL
                     YEKFHDKAACIGLIIANLFLTFLVWYIWALIVIIGPGQQPHVPPFSILPDVVTAIPAT
                     NTSLASANSVRIDESSISPPDIYPCDDRGYPIWCTTCQSLKMSRTHHSNKLGYCVPRF
                     DHYCVWIGSVIGRSNHRMFVQFTFYLMISSLIMVISIGSQMKKLKHHTSGNVYAVFIL
                     ACCALFMVGPLFLTHVYYMCCNRTSIEVIEVKNKKKASRKCFCIYNPFDGYRYVVQFL
                     PGEGQDFWNKNNAIINLKEFLGDNYFFWFFPTVLHSKSRYGKPSDNFYDLIGECDETL
                     SDQYRQCMFDKIEKKEYLTRLRA"
     gene            <37247..>38224
                     /gene="ENV9"
                     /locus_tag="KLMA_70016"
                     /db_xref="GeneID:34717781"
     mRNA            <37247..>38224
                     /gene="ENV9"
                     /locus_tag="KLMA_70016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821258.1"
                     /db_xref="GeneID:34717781"
     CDS             37247..38224
                     /gene="ENV9"
                     /locus_tag="KLMA_70016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677637.1"
                     /db_xref="GeneID:34717781"
                     /translation="MAKPVNVADLPYYDPVVDKKVALVTGGNSGIGYYTVLHLYLHGF
                     KVYLGGRNSHRVNHAIKEIRQEAKVRLQKDKDNTLSRKVGQLEYLHIDLTDLNSVEKA
                     CKKLRTQETTLDVLINNAGVMALPYGLTKDNFEIQMQTNYISHFLLTIRLLPLLKAAH
                     GRIVTVSSVGHQLILFNCNPGSQFNYWPDAFFMWCRYALAKTASIQFTKMLAIKHPDI
                     LSVSLHPGLVMNTNLFSYCTRLPFVGIFFWILFQVVGYFFGVSNEQGSISTLKCALSP
                     DLSTELDNGAYFTTGGYMSTPSRVARSLDNAASTWIWTVNELRNRGHEV"
     gene            <38625..>41906
                     /gene="CDC60"
                     /locus_tag="KLMA_70017"
                     /db_xref="GeneID:34717782"
     mRNA            <38625..>41906
                     /gene="CDC60"
                     /locus_tag="KLMA_70017"
                     /product="leucyl-tRNA synthetase"
                     /transcript_id="XM_022821259.1"
                     /db_xref="GeneID:34717782"
     CDS             38625..41906
                     /gene="CDC60"
                     /locus_tag="KLMA_70017"
                     /codon_start=1
                     /product="leucyl-tRNA synthetase"
                     /protein_id="XP_022677638.1"
                     /db_xref="GeneID:34717782"
                     /translation="MSAKTESKGLVLENTARRDALIAIEKKYQKLWAEEHQFEIDAPS
                     LEDENISIDSEELQKKYPKFMSSMAYPYMNGVLHAGHCFTLSKVEFSIGFERMNGKRA
                     LFPLGFHCTGMPILACADKLKREAEMFGKDYMGAPVDEVEEEEVKPVQEKEDPTKFKA
                     KKSKAAAKKGRGKYQFEIMLQLGIAREDVIKFADASYWLTYFPPLTERDCTSFGARID
                     WRRSFITTDLNPYYDSFIRWQMNKLKALGKIKFGERYTIYSEKDGQPCMDHDRQSGEA
                     VGPQEYIGIKIEVTEFAEAAQKIVDASDLDHSKKIYFVAATLRPETMYGQTCCFVSPK
                     INYGVFDAGDCYYITTERAFKNMSFQKLTPKRGYYKPVVSILGKDFVGSKIHAPLTPY
                     PELRILPMDTVIATKGTGVVTCVPTNSPDDYMTTQDLKHKPEYYGIDPEWINHELVPV
                     IHTDRYGDLTAKTLCEELKIKSPKDTNQLAEAKKLAYKEDFYSGTMIYGKYKGEKVET
                     AKNKVRNDLIANNEAFVYNEPESVVISRSGDECVVSLEDQWFIDYGEEEWKKQAVECL
                     EGMEVFAPEVKNAFESVLEWLKNWAVSRSYGLGTRIPWDPKYLVESLSDSTIYQAFYT
                     IAHLLFKDYYGKEIGPLGIKAEQMTDEVFDYIFQHTDDVKSTDIPIEALQKLRREFEY
                     FYPLDVSISGKDLIPNHLTFFIYTHVALFPKKFWPKGIRANGHLMLNNAKMSKSTGNF
                     MTLQQMVEKYGADASRIALADAGDSVEDANLDESNANAAILRLYNLKEWAEDVVKNEE
                     NLKTDSEYGFFDTAFENEMNYLIEQTYKQYAATNYKNALKYGLFDFQAARDYYRESCE
                     TMHRDLVLRYIENQALLLAPIAPHFAEYIYREVLKKEGSVQNAKFPTVSKPVDIGISA
                     SLDYVRDLQRSIREAEGQALKKKKGKGADVDPSKPAKLILYIIETFPEWQTKYIDLVR
                     ELFEKQSLDDNKVIKTRVEPKDMKRAMPFISLLKQRLSTESPDSVFNRELLFNEIETV
                     KATFDSLKKSSQAIKISEYEIVSLPYNADVGKNIFTNEEVVVQKSKVVENAIPGEPAI
                     IIKNI"
     gene            complement(<43138..>43680)
                     /gene="PET20"
                     /locus_tag="KLMA_70019"
                     /db_xref="GeneID:34717783"
     mRNA            complement(<43138..>43680)
                     /gene="PET20"
                     /locus_tag="KLMA_70019"
                     /product="protein PET20"
                     /transcript_id="XM_022821260.1"
                     /db_xref="GeneID:34717783"
     CDS             complement(43138..43680)
                     /gene="PET20"
                     /locus_tag="KLMA_70019"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="protein PET20"
                     /protein_id="XP_022677639.1"
                     /db_xref="GeneID:34717783"
                     /translation="MNECNNAEASDSKSAMKDINDTNEINTTKAVTKKLPRDYSWLPR
                     VPTTDHVLREQFNSDMLYSGYRPIVIGDKNAKEDKLMQFAMKLEKLSEPVPWVSSATG
                     QEFFSEWDNVPSDVIKDLKPFHPPSVEETNHLKDKEAKEKLQRQILLNEQDKLINRKR
                     GRKKPIIRLLDLKRKFDKND"
     gene            <44392..>45708
                     /locus_tag="KLMA_70020"
                     /db_xref="GeneID:34717784"
     mRNA            <44392..>45708
                     /locus_tag="KLMA_70020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821261.1"
                     /db_xref="GeneID:34717784"
     CDS             44392..45708
                     /locus_tag="KLMA_70020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677640.1"
                     /db_xref="GeneID:34717784"
                     /translation="MGLSDIYSLLPWVQTVQQHEPIEPLTFIDNKYDTHVTIKTLIDK
                     YIPEFQHGSTSLIPPFLCSGHMQTIFSSMFTFENKHQVYYKRWILNYPDGGEGALDIC
                     VPKLSFKKSSYVPINQTKQLLERYTYFTPDEQFESTDSKPMLIVLHGLTGGSNESYVR
                     SLVDTICNNYGFEACVLNSRGCCQSSITTPSLYCGLWTDDIRHCVKELRSRFPNRKFF
                     LLGVSLGASMVANYLGQEGDNSDISLGVVLGNPWDLAESSYHLERNIIGKYAYSPALA
                     KNLVKLTSSHLDVLKKNPEMAKLYTDHLNSVKTVEQFDNYFTSRMFGFNTSFEYYRHG
                     TSSNRLYNMRTPLLILNALDDPIVGSESLPYREVQCNPFIMMITTTRGGHIGWFDVNL
                     ERWYVKPVCELLHKFYTDICMQNLIPDIQSVSLPKKNSFKVDRIVI"
     gene            complement(<45897..>47708)
                     /gene="AIM44"
                     /locus_tag="KLMA_70021"
                     /db_xref="GeneID:34717785"
     mRNA            complement(<45897..>47708)
                     /gene="AIM44"
                     /locus_tag="KLMA_70021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821262.1"
                     /db_xref="GeneID:34717785"
     CDS             complement(45897..47708)
                     /gene="AIM44"
                     /locus_tag="KLMA_70021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677641.1"
                     /db_xref="GeneID:34717785"
                     /translation="MIRTPTRTKTKSYNGSQADFRFPYEENQHLRKISEHALNNHHLL
                     NEQLNKCSEDDTHSLHFSDYTTSNSNSGNSSNGYYSFANISDNTTNPERLSATRNSKG
                     ALNSNRYSYISSSGSSVQYPGTLAPERTPKICSSSNSPKFGKPSEGNFDMQCIPETFS
                     AVTSSFTLPTADNISFQISSNSDSENNSPNNHVPLLQRTVSDIKLNSKKSLVKRSTSL
                     SSQRSQLKRSNAIRCKGGMLEYFTKAGLKLKRYLKKLYFTVKRRLFSYKHRRLSKSDK
                     KKTTSHLMRSNGYLANIKRSQTIRSLASHLESNHLPVTTPTKFQNINNDDLKTPGATH
                     HSLRRTPSSIKRAASILVTNNSITDSKNKHDVARNYSNKLVRSQPSLNLNMAVRQPSI
                     VVKNKVIPLSRFDNKSYCIREEDEEEEEDAEDEYIIDTNKMQSLCSDMDSITSSLHDE
                     SIFQDALSYSSSAESLPESVKVTNARKAWDSYLRAVISQRIQMRLQIAKFQASQDNDV
                     YKELLEAITTDYESDAIFSNEESHTEEESISKSEYDSGSDIESLHPLSPAPESIKSTP
                     LIIPQSFCDSFTSLSNFQSSVQTSVRRTLTLPVGITI"
     gene            <49077..>49973
                     /gene="TGS1"
                     /locus_tag="KLMA_70022"
                     /db_xref="GeneID:34717786"
     mRNA            <49077..>49973
                     /gene="TGS1"
                     /locus_tag="KLMA_70022"
                     /product="trimethylguanosine synthase"
                     /transcript_id="XM_022821264.1"
                     /db_xref="GeneID:34717786"
     CDS             49077..49973
                     /gene="TGS1"
                     /locus_tag="KLMA_70022"
                     /codon_start=1
                     /product="trimethylguanosine synthase"
                     /protein_id="XP_022677642.1"
                     /db_xref="GeneID:34717786"
                     /translation="MSWLIKFYPDLSCFEGIDGINNTKIRHRLKKLFYNDSYRVYPYE
                     KPQERSLYKYWKNRRTIFKLIDEGDIFLTDELWFSVTPENLAQFTASYIRHCLPHAKY
                     VVDVFCGGGGNVIQFARLFDKVYGVDSNIDHLYCTYKNAQCYEVTDKVNLIYGDWEAV
                     LNKTLKNKINQKQDCIFASPPWGGVNYLKQDTYDLEKHLEPVSLSKLLVLLFKLCDNV
                     VLFLPRNSNLDQLSAITEELLGPGEKCKVVYVKDNGYMKGILVFWGRPFYDFSDQYPE
                     GNDNAPKLEQERDINIRMEDLY"
     gene            complement(<50107..>50982)
                     /gene="PRM4"
                     /locus_tag="KLMA_70023"
                     /db_xref="GeneID:34717787"
     mRNA            complement(<50107..>50982)
                     /gene="PRM4"
                     /locus_tag="KLMA_70023"
                     /product="pheromone-regulated membrane protein 4"
                     /transcript_id="XM_022821265.1"
                     /db_xref="GeneID:34717787"
     CDS             complement(50107..50982)
                     /gene="PRM4"
                     /locus_tag="KLMA_70023"
                     /codon_start=1
                     /product="pheromone-regulated membrane protein 4"
                     /protein_id="XP_022677643.1"
                     /db_xref="GeneID:34717787"
                     /translation="MRTLDSKKPSRKSSKALAITIALFSLIALLVVTAGVDDQFVNLY
                     SYASSELEDQKEDIGITLTNHISQIASNSENNLEKETSNIEEQLIISESENGKELELR
                     KQNVLSPSKVHLPAESEVAPAVLQNDPSYTVTNTNPNTNPNSNGGNQDMPSSSSSFSP
                     ARGFQEILTTSPAVLFIRSSNKDSLGLKNMLNTEYTFSPEVIVVDLDKHTYGDRIQEY
                     IRRNKLETYKSNYEEASQSPDVPYLFINGVSMINKSLKEDIMKQHIDGNLITKFREIS
                     DGKVSVSKVDTPSNS"
     gene            complement(<51935..>54001)
                     /gene="KIP2"
                     /locus_tag="KLMA_70024"
                     /db_xref="GeneID:34717788"
     mRNA            complement(<51935..>54001)
                     /gene="KIP2"
                     /locus_tag="KLMA_70024"
                     /product="kinesin-like protein KIP2"
                     /transcript_id="XM_022821266.1"
                     /db_xref="GeneID:34717788"
     CDS             complement(51935..54001)
                     /gene="KIP2"
                     /locus_tag="KLMA_70024"
                     /codon_start=1
                     /product="kinesin-like protein KIP2"
                     /protein_id="XP_022677644.1"
                     /db_xref="GeneID:34717788"
                     /translation="MMMKPSAPFNSLSNNSPKRLMRPPSTPNLRTSFGTRPHSTSSSS
                     SSQCSSPVRSISTRAASPTHGSRSLYQGTISVGVRIKPSKNKQDTWHVSNNSIIHEEF
                     GEFGFDHVFGPSMSNNEVYKTIALPMVDKLFEGFNCTIFAYGMTGSGKTYTMSGSDSG
                     PGIIPMCVNTVFDRINEGLPNKKFNVKVSYLEIYNERIFDLLNLPQGKPFGIASNNMT
                     NSANALVNDLKLRDDPRYGVKVVGLTERNVSSKEELMRCISIGDHNRKTGETDFNTRS
                     SRSHAVVLIRVFCTDELTGEEVISTLSLCDLAGSERATGKQERRKEGAYINKSLLALG
                     TVISKLSMESTGNGAALGHIPYRDSKLTRILQPALSGDSLVATICTIDTRPETNMESM
                     NTIRFASRAKNITLNVKRNDSDTNLGKTQLIQSLRKQIREQQDLINSLTKQGNTRNDF
                     IGTTSAQQTDDLLRKENEFLKLKLQHYENLELLEPTELRDSQLIEIIESLPSDIGVML
                     ETKLMNMNSQFLEMKRYVAQVESLERRFTSSSNATTELLSTAYGVDLTQVLHEQEQEL
                     MQLNQSLARKDKMIEALTSSKMLRHNLAEFSSNHVGNSEADKHTDIEKRALKPISSDA
                     SELNNRGSLERPLTIGSGASISHSSTTCDSTSSGNTLDDGTYTKLSTKYLTASDILPN
                     SSESVC"
     gene            complement(<54966..>56192)
                     /gene="PEP4"
                     /locus_tag="KLMA_70025"
                     /db_xref="GeneID:34717789"
     mRNA            complement(<54966..>56192)
                     /gene="PEP4"
                     /locus_tag="KLMA_70025"
                     /product="saccharopepsin"
                     /transcript_id="XM_022821267.1"
                     /db_xref="GeneID:34717789"
     CDS             complement(54966..56192)
                     /gene="PEP4"
                     /locus_tag="KLMA_70025"
                     /codon_start=1
                     /product="saccharopepsin"
                     /protein_id="XP_022677645.1"
                     /db_xref="GeneID:34717789"
                     /translation="MQLSGKTLLSLASLFIALLDGADAKVHKSKIYKEKLEDQLQGMP
                     FTAHVSRLGEKYLSNFKRAYPQETFSREGVDTVFTEESTSVPLTNYLNAQYYTEITLG
                     TPPQSFKVILDTGSSNLWVPSAECGSLACFLHTKYDHESSSTYKANGSEFSIQYGSGS
                     LEGYVSSDLLTLGDLAIADQDFAEATSEPGLAFAFGKFDGILGLAYDTISVNKIVPPV
                     YNAIKKGLLDEPVFAFYLGDADKSEDGGEATFGGIDSSKYTGDITWLPVRRKAYWEVK
                     FEGIGLGDEYAVLEGHGAAIDTGTSLIALPSGLAEILNSEIGAKKGWSGQYSVDCDSR
                     ASLPDLTLNFSGHNFTITPYDYTLEMSGSCISAFIPMDFPEPVGPLAIIGDAFLRKYY
                     SIYDLGHNAVGLAKAV"
     gene            <56840..>58438
                     /gene="SWP82"
                     /locus_tag="KLMA_70026"
                     /db_xref="GeneID:34717790"
     mRNA            <56840..>58438
                     /gene="SWP82"
                     /locus_tag="KLMA_70026"
                     /product="SWI/SNF global transcription activator complex
                     subunit SWP82"
                     /transcript_id="XM_022821268.1"
                     /db_xref="GeneID:34717790"
     CDS             56840..58438
                     /gene="SWP82"
                     /locus_tag="KLMA_70026"
                     /codon_start=1
                     /product="SWI/SNF global transcription activator complex
                     subunit SWP82"
                     /protein_id="XP_022677646.1"
                     /db_xref="GeneID:34717790"
                     /translation="MTSVEGNDDKVNTDTVKSEIVTNFHPVPDSVLKNHELFVLKTTL
                     SILNNPDLVLGDLDKLPNRLPELPSFTIKERLSDNNDSYVLGKGDLSGEAKIDKQGHL
                     KGSRNYLFPTFSYSCPENNNSENLYVLVRDLIKALNLNDDEQHFLQKYSDLYPMDAPD
                     NLLEYLKSKKALPKDVTSAKYTTARSAFLVFGAAILASGSRVIDDYWEQLSKEQGFQT
                     QHRVYILSAKLIDMIHAIEPKFSHHVTTLNTNTTLESQSKTPSSIDGIRVNQNSSTDP
                     DPQFENPFLTVTEIPSTEVRREFLNHLANGNPTAIIAGQTIHGSIELSNAYKIPKYHY
                     KNSFASAQQNNALDTPIGTHTHPVESHNFGRGRKANYVPPEETDVLAQIPGWKFTQLP
                     TTTNQELPTTFSSGGLPIYNKLKLPSRLKELTPNQIKDLERSHDVVQLNKVLGNVRKV
                     RNSRWTKFWQYKAGVPVGLTEEQIPYYKSRYLQNVLDHVEVNIVPNDLKNVDEKHTVK
                     RIPNPNFIGYSNISGFKPPFIDKP"
     gene            complement(<58594..>59895)
                     /gene="EMP47"
                     /locus_tag="KLMA_70027"
                     /db_xref="GeneID:34717791"
     mRNA            complement(<58594..>59895)
                     /gene="EMP47"
                     /locus_tag="KLMA_70027"
                     /product="protein EMP47"
                     /transcript_id="XM_022821269.1"
                     /db_xref="GeneID:34717791"
     CDS             complement(58594..59895)
                     /gene="EMP47"
                     /locus_tag="KLMA_70027"
                     /codon_start=1
                     /product="protein EMP47"
                     /protein_id="XP_022677647.1"
                     /db_xref="GeneID:34717791"
                     /translation="MWARWLLVYLASIAITVAEELYERKETSDNDILDRSHSLSDLVN
                     MDKLPSEWKTGGDLVLEQGRLRFTPVASSQGSIWHNSDYQIKDSFTVEWTFRSVDFIG
                     KSEGGLSFWIVNGKSVGDNSLFGGPQRYDGLQILVDSNGPVGSTVRGILNDGTKKFTE
                     TDIYDQTFGYCLLAYQDTAIPTTVRLSYDRKNNNLLKLQIDNRVCFQTREIQFPSNAK
                     MRLGITAKNDKNKESFEILKMHTHNGLTKEVSLPNVNPMEQPRLVTKIINKETGKEDV
                     VETDFMKMKGLANKVDNYELYKKLDKIEGKILANDISIINEKLEKIIKTQNDHSKKLD
                     HLLSTLDVMVSSMGKEGEVNTEAFKDFFGMNDKLEKLLQDQAKIREETKLSMQSGGHG
                     VTVDEIVKRLFIWMLPLILIVLVMAYYTFRIRQDIVKVKLL"
     gene            complement(<60399..>60806)
                     /locus_tag="KLMA_70028"
                     /db_xref="GeneID:34717792"
     mRNA            complement(<60399..>60806)
                     /locus_tag="KLMA_70028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821270.1"
                     /db_xref="GeneID:34717792"
     CDS             complement(60399..60806)
                     /locus_tag="KLMA_70028"
                     /note="Rdx super family[cl01407]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677648.1"
                     /db_xref="GeneID:34717792"
                     /translation="MPFPKISIVFCVKCKWNLRSAWYLQELLQTFGSELKEVSLVIGN
                     PGDFKVLGYRDEGSEPILIWDRVENGGFPDSKYLKQRVKRLLFNDSVTVGAHIDSKNS
                     QGSEALVSGPSRENNASVCAPEDSLSSVCTDCQ"
     gene            <61036..>63099
                     /gene="RGD2"
                     /locus_tag="KLMA_70029"
                     /db_xref="GeneID:34717793"
     mRNA            <61036..>63099
                     /gene="RGD2"
                     /locus_tag="KLMA_70029"
                     /product="rho-GTPase-activating protein RGD2"
                     /transcript_id="XM_022821271.1"
                     /db_xref="GeneID:34717793"
     CDS             61036..63099
                     /gene="RGD2"
                     /locus_tag="KLMA_70029"
                     /codon_start=1
                     /product="rho-GTPase-activating protein RGD2"
                     /protein_id="XP_022677649.1"
                     /db_xref="GeneID:34717793"
                     /translation="MPSFAESFWSPDFLTGIDKLFEKLNQGCDQNDLFIQLFASRMQY
                     EVEFGRNLCDIKKAVDVFDPATSTATSSLAEMIDQMVAEGNLHLKIAYTIETTVLGPF
                     TKWRQEHRQRVEYSEKILKTNATNFLKARKYVEKLEQTYLNKCRVLEDFKRSTFNEDE
                     LVEAMKSLDLQREHETKVLQEKEYQKFGEFGGIDYDYKSMRETLKLLLTKLPKHPYKV
                     PFISFTIENTNSGREIVKFLMEHMSLKDIDHAELFGQDLLNHGFIKYCNGVGTTFVNS
                     NKFQYQWKPYAYKFCNISTSDPNEDSLNETENGIVNYLQKITVGSETKYASLHKPDFS
                     ENEMKLYKMVRDVEVSDSKYMRECKKLDSLRCSLEELIVDHYTFMEKCESDRMMALRK
                     VTLDFCAAISNTISTMKLTIEKLTDSESRMDPAADLLRTIEENRVGFFQPQVITYNNY
                     YNPGSYQTFGIDLETRCRSDNRLVPLILSALLSYMDQAYPEMENDHKRAVVWTEPVKL
                     HDVHHLRQLLIKPFKEEAEIIDVIRSANAQPSTVASVFKIYLLELPKALITDDAYDIL
                     KVLYRELPPSETHEQTETQRIHGIVTALSTLSKPNMVTLDAITTHFERLIEIIKMNKS
                     EESQELAENLYDTISQEFANCLIRPTGPTINDLGYKLLQDLLKHRKKVFKELKRKGSN
                     SVKKG"
     gene            complement(<63412..>63867)
                     /locus_tag="KLMA_70030"
                     /db_xref="GeneID:34717794"
     mRNA            complement(<63412..>63867)
                     /locus_tag="KLMA_70030"
                     /product="protein SIC1"
                     /transcript_id="XM_022821272.1"
                     /db_xref="GeneID:34717794"
     CDS             complement(63412..63867)
                     /locus_tag="KLMA_70030"
                     /codon_start=1
                     /product="protein SIC1"
                     /protein_id="XP_022677650.1"
                     /db_xref="GeneID:34717794"
                     /translation="MGSRVLDFYEDSTGKAPMEEKDDGPCSSDFTRNKLPKQIPGTPS
                     DKITTYELASKWHNQSGIGKSAAFDTEEEKDIYGQEPIENPFLSNVVADKSLREERKK
                     KLLEEDPDLEDAITYVNKSGKVVSKRYMTQEEKEQLKPTRLFADELDSS"
     gene            <64777..>65532
                     /gene="BOS1"
                     /locus_tag="KLMA_70031"
                     /db_xref="GeneID:34717795"
     mRNA            <64777..>65532
                     /gene="BOS1"
                     /locus_tag="KLMA_70031"
                     /product="protein transport protein BOS1"
                     /transcript_id="XM_022821273.1"
                     /db_xref="GeneID:34717795"
     CDS             64777..65532
                     /gene="BOS1"
                     /locus_tag="KLMA_70031"
                     /codon_start=1
                     /product="protein transport protein BOS1"
                     /protein_id="XP_022677651.1"
                     /db_xref="GeneID:34717795"
                     /translation="MNALYNHAVKQRSLLNKDLGKLEKESIVAPISLQGTIATTLISL
                     EKTISQYKEQLKQYGLNNADDDEATKLKYETRLQTLTQDYEDAKSKFMELKAKLSNSI
                     AREQLLRQDTSMVEDNVMNKRNINTRQQTLSTFGIGETSDGDHERTTINSAAGLPLYE
                     GMKKEHSIFDRSNAQLDRIIQMGQESLDDIIEQNKVLQRLQSQMSKSLHTLGISDETI
                     EKINKRVFKDKLIFYVALLLLILGIYFVQKWFR"
     gene            complement(<65616..>67436)
                     /gene="FMP25"
                     /locus_tag="KLMA_70032"
                     /db_xref="GeneID:34717796"
     mRNA            complement(<65616..>67436)
                     /gene="FMP25"
                     /locus_tag="KLMA_70032"
                     /product="protein FMP25"
                     /transcript_id="XM_022821275.1"
                     /db_xref="GeneID:34717796"
     CDS             complement(65616..67436)
                     /gene="FMP25"
                     /locus_tag="KLMA_70032"
                     /codon_start=1
                     /product="protein FMP25"
                     /protein_id="XP_022677652.1"
                     /db_xref="GeneID:34717796"
                     /translation="MIRFIGCSLPARVLRASYPKNNRLITVANFHSCIRLSKNEPKYD
                     DAEIIGKRLTKDNYVGKRDKSEYRWDDKPNALAEKEYIDRMEKLAKIYAVFQGVLLLL
                     GVGAAGTAYMMWPQIKGWWLSKDIRVSDDVIEKLKEKKERKKLEDIPVVPDETPDSSV
                     PGLYYWGKQLDGDSNNSSVSKFPLRVPFFNDKALRDVALADTQKYGNLAIDKDGNLFQ
                     WDLNRCELILKDQNLVTVKISNDVAYALNKSGDILVIPLNDSQARLSRTSSSRSLLLP
                     WKKYTKYSWKLDTKSAFHYPGERRVTYFDVGSNHLVLLSNAGKAYTCSTGVKTNPDER
                     SKGQFGIPNFSQFDPYPTVNKLYEIELLNKGITGDHITSRYISKVACGDYHTLAIDSN
                     GELFSFGLNTYGQLGQNISYDMEYVPFPKKVSTFSGHFDKQSFLKCVDIHCSGDTSYV
                     VISSQDILQLFKRDRPLAMDEQSDITYFAFGNGIQGQLGNGHFKHSQSDPTKMKIIND
                     FKDSNAKVADWYCGGQHTFVKLKNGEVMCWGSNDCGQLGNGKKIKYDKPKAIPKLIEP
                     GEHYDSKNVSTLYDEKNKLVLSNKQEIRAGKHASCLFWKA"
     gene            <67793..>68476
                     /gene="FMP32"
                     /locus_tag="KLMA_70033"
                     /db_xref="GeneID:34717797"
     mRNA            <67793..>68476
                     /gene="FMP32"
                     /locus_tag="KLMA_70033"
                     /product="protein FMP32"
                     /transcript_id="XM_022821276.1"
                     /db_xref="GeneID:34717797"
     CDS             67793..68476
                     /gene="FMP32"
                     /locus_tag="KLMA_70033"
                     /codon_start=1
                     /product="protein FMP32"
                     /protein_id="XP_022677653.1"
                     /db_xref="GeneID:34717797"
                     /translation="MRPLMKLSTLWKASSNFGLAHGPKYRHQFIQFRNIQSTAVLQDN
                     METVHIRDTNHFKQRLMSEGKFSEQQSDVIVNIMIDALRGGVAHVSQDLASREKLTKL
                     TYQQRVDFSKLREQLLTADKSEIHNLQNEHERIRKDLEVMRNKLREEITKANAGFKLD
                     LSLEKGRIREESSHHDMQIKEIDTRIDQEVTNMKMQIDSVKTQVMQWLIGVCTGTFAL
                     VLAYVRLLT"
     gene            complement(<68593..>69357)
                     /gene="SEC53"
                     /locus_tag="KLMA_70034"
                     /db_xref="GeneID:34717798"
     mRNA            complement(<68593..>69357)
                     /gene="SEC53"
                     /locus_tag="KLMA_70034"
                     /product="phosphomannomutase"
                     /transcript_id="XM_022821277.1"
                     /db_xref="GeneID:34717798"
     CDS             complement(68593..69357)
                     /gene="SEC53"
                     /locus_tag="KLMA_70034"
                     /codon_start=1
                     /product="phosphomannomutase"
                     /protein_id="XP_022677654.1"
                     /db_xref="GeneID:34717798"
                     /translation="MSIPEFAYKEKPKTLVLFDVDGTLTPARLTISPEVKETLQKLRQ
                     KVVIGFVGGSDLSKQLEQLGSDVLDQFDYAFSENGLTAYRLGKELASQSFIDWIGEEQ
                     YNKLAKFILQYLANIDLPKRRGTFLEFRNGMINVSPIGRNASTAERNEFEKFDKEHQV
                     RAKFVEALKKEFPNLALTYSIGGQISFDVFPTGWDKTYCLRHVEKDGFEEIHFFGDKT
                     AKGGNDYEIYVDDRTIGHSVTSPDDTVRILKELFDL"
     gene            <70578..>72011
                     /locus_tag="KLMA_70035"
                     /db_xref="GeneID:34717799"
     mRNA            <70578..>72011
                     /locus_tag="KLMA_70035"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821278.1"
                     /db_xref="GeneID:34717799"
     CDS             70578..72011
                     /locus_tag="KLMA_70035"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677655.1"
                     /db_xref="GeneID:34717799"
                     /translation="MNLVCTSTPTKKRSFDDQQLMSPVSEIGDDPNCESLSYERPTKI
                     HKTQMCSATNTDTSLFIDQEDFESNLDNKWKGNSKLPSSFDQELLVGKLPNVKVYKGN
                     VDSMQWSHCRSRPYKGIVQPIWSYFKENTENNLYRCMLCSMVLKVEKHQNGNTVRILK
                     KHIAQSGSKYYRCSIGCNPDQAYIGSCSWEDPAHVNTETLSHNPGVKTMTPNEYIWFI
                     MNSTNQPMSFADDKAVIEVSKKLKELVPDSKQAACNSANMKKLLEDNVNEIDNLLLRE
                     IQRGNSILDSPLVITHKQEFEQKCINRIKDLSNVHYVSLVLDHWSDTRLRSFIGVIIV
                     IWDRYQKKQRSFVIGMPETVNHSSAAIKDQLQQVISNYSGLNKLIVSSAADNASAVKN
                     ACLQLTTQCPDRLLHVNCVNHSLNVVNSKLVTEPGNRSIEQQIIKQNEERTKIKVLDS
                     EMLSGFRKALEKKVKLRRFLLVIIKLF"
     gene            <72038..>73492
                     /locus_tag="KLMA_70036"
                     /db_xref="GeneID:34717800"
     mRNA            <72038..>73492
                     /locus_tag="KLMA_70036"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821279.1"
                     /db_xref="GeneID:34717800"
     CDS             72038..73492
                     /locus_tag="KLMA_70036"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677656.1"
                     /db_xref="GeneID:34717800"
                     /translation="MDTDTDIEGDTLIEEINLDDDDDDDRNDESTSSTSADVYDIFYN
                     ELFNSDDARSSISGAHSLLEAINRLEIECRKPNIRKIIKSFTKSRNLGDIDSLIPYVK
                     TRWTYSVLSFERLLLLAPCLLNLMKEGMLSPLLDESDIECIKVYIVLLKPFQTITSFF
                     NSPETTSRYLLSALRSYKDTVLPHVWKLRSKLNKKQMQNRNNDSRLTIILTQIERFLS
                     KIKEYIESYEKEQLLVVASYFNCGYRNSPYLMEKLGLKYEEGNNKSNNDALSKRISDI
                     ITGILFPMLNIRLETTNENMARPRIPGIMSIVFDDGSESIDNQGVSESHFQYIFYSMV
                     LKEVQSFNSQYNKIHVRYTEEHMKEIGTEYDQATGMFKLSNGNLLSEYEYLLLTMRDV
                     HHKIWEDIRNCPILTLFNQIIDSVAVSSTHIEHIFSISSILTSKRRGRILPSSLEKRM
                     KTKVAYMTLGNYHKFDLKKTTLDQILFVQKSESQ"
     gene            complement(<73771..>74433)
                     /gene="RPL10"
                     /locus_tag="KLMA_70037"
                     /db_xref="GeneID:34717801"
     mRNA            complement(<73771..>74433)
                     /gene="RPL10"
                     /locus_tag="KLMA_70037"
                     /product="60S ribosomal protein L10"
                     /transcript_id="XM_022821280.1"
                     /db_xref="GeneID:34717801"
     CDS             complement(73771..74433)
                     /gene="RPL10"
                     /locus_tag="KLMA_70037"
                     /codon_start=1
                     /product="60S ribosomal protein L10"
                     /protein_id="XP_022677657.1"
                     /db_xref="GeneID:34717801"
                     /translation="MARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVD
                     EFPLCVHLVSNELEQLSSEALEAARITANKYITKMTGRDSFHLRVRVHPFHVLRINKM
                     LSCAGADRLQQGMRGAWGKPHGLAARVDIGQVIFSVRTKDNNKETVIEALRRARYKFP
                     GQQKIIISKKWGFTSLNREEYIKKRDAGEIKDDGAFVKFLSKKGPLEENMRAFPEYFT
                     KA"
     gene            <75070..>75573
                     /gene="BUD20"
                     /locus_tag="KLMA_70039"
                     /db_xref="GeneID:34717802"
     mRNA            <75070..>75573
                     /gene="BUD20"
                     /locus_tag="KLMA_70039"
                     /product="bud site selection protein 20"
                     /transcript_id="XM_022821281.1"
                     /db_xref="GeneID:34717802"
     CDS             75070..75573
                     /gene="BUD20"
                     /locus_tag="KLMA_70039"
                     /codon_start=1
                     /product="bud site selection protein 20"
                     /protein_id="XP_022677658.1"
                     /db_xref="GeneID:34717802"
                     /translation="MGRYSVKRYKTKRRTKDLDLIYEELASQKQIDGLLNQPIDETKP
                     GLGQHYCIHCAKYFETAYALKTHLKTKVHKRRVKELKGVPYTQEVANAAVGYNLNRFL
                     ARVEQIKTQVGPQKEENEKVLDSHLKSSLANVSTTESTLPYLDSVVQDQKQQEVAATE
                     EEVQMAD"
     gene            complement(<75742..>76665)
                     /gene="OTU1"
                     /locus_tag="KLMA_70040"
                     /db_xref="GeneID:34717803"
     mRNA            complement(<75742..>76665)
                     /gene="OTU1"
                     /locus_tag="KLMA_70040"
                     /product="ubiquitin thioesterase OTU1"
                     /transcript_id="XM_022821282.1"
                     /db_xref="GeneID:34717803"
     CDS             complement(75742..76665)
                     /gene="OTU1"
                     /locus_tag="KLMA_70040"
                     /codon_start=1
                     /product="ubiquitin thioesterase OTU1"
                     /protein_id="XP_022677659.1"
                     /db_xref="GeneID:34717803"
                     /translation="MRVKVSIPGKNDKIINVDGDCDLETFQGIILSTYDEDILLGGLR
                     FGFPPQSLSFHGNESKMLEDLGISNGERIIITLPSSADATKNIKSGVSANEKKKESSG
                     GGIIDSKRVLQVHEVPDDNSCLFHAISYAVYKDISLSAELRNIVASEVSKDTITYSDA
                     ILGRPNREYSQWITKPSSWGGGIEIAVLSKHLQYAIYVLDMDACKFEKFNDELFNLFI
                     IIAYNGVHYDTVEIVDGAQHQTVFNADDEDTSLILKRTEEIARKMKREGKTFNTTRDS
                     ILCNTCGKTLVGEREVSKHAETTGHVDFRQK"
     gene            <77143..>77730
                     /gene="RFU1"
                     /locus_tag="KLMA_70041"
                     /db_xref="GeneID:34717804"
     mRNA            <77143..>77730
                     /gene="RFU1"
                     /locus_tag="KLMA_70041"
                     /product="regulator of free ubiquitin chains 1"
                     /transcript_id="XM_022821283.1"
                     /db_xref="GeneID:34717804"
     CDS             77143..77730
                     /gene="RFU1"
                     /locus_tag="KLMA_70041"
                     /codon_start=1
                     /product="regulator of free ubiquitin chains 1"
                     /protein_id="XP_022677660.1"
                     /db_xref="GeneID:34717804"
                     /translation="MRSSSQLKQEALEYKFNANVPLKLYLTTCISIVEEAQKSARSND
                     MERAYLLYLRYLDLCLNKLIHHSEVNTTVDSLNRREYLQLLKLEVPAIMKITEELKGK
                     IDAIHHSLASNVAVSAYTKPSTRPQAVVPSRTAVEEVQLPSTFDEKKFNQSIRWFHNN
                     PSRFSTATVSSTNEYPELPELNISHTQLSHTMPAL"
     gene            complement(<77982..>80234)
                     /locus_tag="KLMA_70042"
                     /db_xref="GeneID:34717805"
     mRNA            complement(<77982..>80234)
                     /locus_tag="KLMA_70042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821284.1"
                     /db_xref="GeneID:34717805"
     CDS             complement(77982..80234)
                     /locus_tag="KLMA_70042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677661.1"
                     /db_xref="GeneID:34717805"
                     /translation="MVPFDLEMDTANKVSSDESNDRRQSASSSVFRTPLQKSGSADAA
                     SLKSTPADPHLTETNGQSTSLRKYEESSDKRSTREQLSDIIIQDQSSMDSQSLSLHLN
                     GNHTVNHSRSQSRSTILSNTKDESKPGPEPEILAHRRENSGTITVSQLKPKNELPVGK
                     PSVSLSQLDSFDPKRYVNEFYADTRYRFSTDKRNEDFHALFPKSPKSERLLDDFSCAL
                     NREFLIQGRVYITPERVYFHSNLLGWVTSLDIEMRDIVTLEKISTAGLFPNGICIHLA
                     NEKHYFASFISRDATFKFLEIIWHTRKELDYLTLKPEQLALNHSRSLNDFLTGTTSTC
                     PPSRSSFADDGDTIESAIMSVDDDFPVNRSLTSLNENPERNFSNDTDEYASEDEFDEE
                     DEDEEEDEDDEMNINVTSNDKYATLLYDEEAVASDAEDKSLRKVFKLKKKSKFHYSGP
                     YYFKATEFMYNPEDNKETVLAELDLKAPPGVVYQLMFSEECPDFLITFLKAQDSSQIS
                     EIPPFDKANPEGQHYREYSYAKALSYPVGPKSTKCLVSEHILYCAYDNYINIVNTTKT
                     PDVPSGNNFSVKTRYLYRWKDSTSCVLKISYWVEWTGSSWIKSMIDNSVKSGQAEATK
                     RLVELIHEFVNNNVEETEMRVNTQPRRGSPQSRRVSKMSSKPVLPPVEKSELQTVLEK
                     DIKSTLTKDNAILVLLVFITFLLIFNTTCQVRIIRKLNKLMNTGSISVVDEIKDILSV
                     YNELPILQED"
     gene            <81022..>83970
                     /gene="RGR1"
                     /locus_tag="KLMA_70043"
                     /db_xref="GeneID:34717806"
     mRNA            <81022..>83970
                     /gene="RGR1"
                     /locus_tag="KLMA_70043"
                     /product="mediator of RNA polymerase II transcription
                     subunit 14"
                     /transcript_id="XM_022821286.1"
                     /db_xref="GeneID:34717806"
     CDS             81022..83970
                     /gene="RGR1"
                     /locus_tag="KLMA_70043"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 14"
                     /protein_id="XP_022677662.1"
                     /db_xref="GeneID:34717806"
                     /translation="MTTEVIPGKTTGTDTSSSMGVKQKDAKMPPPIPHVELNQLPLSM
                     LLRNLTTFAAKEISQFFKLNVHTGGKTPFEKKLELLNMILYLRNQFLKLYVLVKWAKT
                     LKQNNFHTLIDLLNWFRSTNMQVNNCTMALKQILGTMAGAKLPNPDLITSLEVLMLGR
                     PNLPTHGFNINGGQTDNPPIPKELILKRIRDLNTCLSVKISLIDVPSQMSNYQIKDGR
                     IIFTVKDEFELQLSTIDQSSPFFFVHLKLLFNERLPLNLSKLEKHINDILFKSANPLQ
                     LLYQFLHKYTLTLQMYMIHVELNTLELNGKYSGGHLVHSYDSKRQIITLKYWLQSKIA
                     NTCKCIIGMDKETESIVLEWQNPDVNKDTVDTRYHGLLNNIESIIDEITFNHAQMIRS
                     DLLRTETFQEDDEDTTSTSLLFQIPTTCATVSQIQLKIDQVSGIFYFHNPSNLLLSYA
                     RQINQCSSTKELITVLGRLKLDKVVSILRHMLDKTGWICSDVIKLKTPIVPSTDSTFS
                     KDIFVKLKDWPSNWFLILTVISSTNTCIVEKAIGKITSVKGTWELKYMDRKDVISAKL
                     DSMTYPKMLTLQKSILNKIVNHMIIDSLNEMQIKNKICTFSTEDDNHLPSFIVNKDGK
                     VDTSTITVIALGLESFLEGSKALNTILESSMLLNINYQKMDIELYGKFKTDNQMIRCQ
                     CDELSIKFLEEDSLSFFMHENFGNLDEIMLYLSKFRKKLMQLIALTDVMDTLYANFRS
                     GDFRVVELKPNEIRFKYLPMKDSPDSEDCTIKIVTNQDKVQKLDIKLSEHNPQAMVQK
                     FLDEREGLVHNFIFHYLQFTLPLFRATMETKSGIGSTPFVKVHLFMHSLQEYHLLYRN
                     HKVGGELSFIVQLKSVLWTRYKEDTRYFIRFAQDYSQQSQHPLASAISDIQKNAFSLG
                     FLNNQISGISGGPTTAQNSTDLQDPDSRDTKMASWDTISCVRLGSALACSQDEILPIL
                     LQFHQSISSC"
     gene            <84956..>86020
                     /gene="SOR1"
                     /locus_tag="KLMA_70044"
                     /db_xref="GeneID:34717807"
     mRNA            <84956..>86020
                     /gene="SOR1"
                     /locus_tag="KLMA_70044"
                     /product="sorbitol dehydrogenase 1"
                     /transcript_id="XM_022821287.1"
                     /db_xref="GeneID:34717807"
     CDS             84956..86020
                     /gene="SOR1"
                     /locus_tag="KLMA_70044"
                     /codon_start=1
                     /product="sorbitol dehydrogenase 1"
                     /protein_id="XP_022677663.1"
                     /db_xref="GeneID:34717807"
                     /translation="MTNTQKAVVLKKQGEIAFEERPVPEIKDPHYVKVHIKKTGICGS
                     DVHYYTHGAIGDFVVKEPMVLGHESSGVVVEVGEAVTLVKVGDRVAVEPGVPSRYSDE
                     TKSGHYNLCPHMEFAATPPIDGTLVKYYLIPEDFVVKLPDHVSLEEGACIEPLSVGVH
                     ANRLAGTGFGKKVVIFGAGPVGLVTGNVASAFGASDVVYVDVFEHKLKRAKEFGGTQI
                     INSKDYPKEDDLVKAIQDKLGGKSPEIAIDCSGAEVCIRSAIKVLKVGGTFVQVGMGR
                     DNVNFPITLIITKELRVLGSFRYYFDDYNIAVKLVSEGKVNAKALITHTFKFDEAIDA
                     YNFNRDHGNEVVKTIIDGPE"
     gene            <86418..>88262
                     /gene="FET5"
                     /locus_tag="KLMA_70045"
                     /db_xref="GeneID:34717808"
     mRNA            <86418..>88262
                     /gene="FET5"
                     /locus_tag="KLMA_70045"
                     /product="iron transport multicopper oxidase FET5"
                     /transcript_id="XM_022821288.1"
                     /db_xref="GeneID:34717808"
     CDS             86418..88262
                     /gene="FET5"
                     /locus_tag="KLMA_70045"
                     /codon_start=1
                     /product="iron transport multicopper oxidase FET5"
                     /protein_id="XP_022677664.1"
                     /db_xref="GeneID:34717808"
                     /translation="MKGSDMEVQSWPLIRLFVMLIWGHSLLVSAKTHVFNFTTGWVTV
                     NPDGMGERQMIGFNGEWPLPDIHINKGDRVELYLTNGFDNLTTSLHYHGLFMSTEHGN
                     SVQMDGPEMVTQCPIQPGDTFLYNFTVPDQVGTYWYHSHSGSQYTDGMRGAFVVHDPN
                     APFEYDEDMTILVSDLYDKPYYKIMDSFLSRYNPTGAEPIPRNVLFNHTTNYTMHFDT
                     DKTYLIRLINGGTFVSQYFFIEDHDMTIVEIDGTYVQPTKSKLIYIAAGQRMSILVKS
                     KHTKTKNFAFMQIIDESMLDVLPPELQLNRTNTISYDSELGPAKQAYIDSLDEFTNDF
                     DLIPLHKKELLHEYDYQIKLNVEMENLGDGIQYAFFNNITYVAPKVPTLLTALSAGEL
                     ATNAAIYGDNINAFVLEHGEVVEVVVNNHDSGRHPFHMHGHIFQVVQKSEGKEDGEEP
                     IDYDEKNPVSPYPDYPILRDTVVVEPLGHVVLRFKATNPGVWLFHCHVDWHLEQGLAA
                     VFIEAPLLLQEKEELTASVLNTCKTGNIPVRGNAVGDEKDWFNMNGLPKQPGPLPKGF
                     TFKGYFAFILSTLVGVWGIFTITKYGLGEVVQDEKELLIHLKSVLENS"
     gene            <88568..>90832
                     /gene="MEF1"
                     /locus_tag="KLMA_70046"
                     /db_xref="GeneID:34717809"
     mRNA            <88568..>90832
                     /gene="MEF1"
                     /locus_tag="KLMA_70046"
                     /product="elongation factor G"
                     /transcript_id="XM_022821289.1"
                     /db_xref="GeneID:34717809"
     CDS             88568..90832
                     /gene="MEF1"
                     /locus_tag="KLMA_70046"
                     /codon_start=1
                     /product="elongation factor G"
                     /protein_id="XP_022677665.1"
                     /db_xref="GeneID:34717809"
                     /translation="MFRRFGLVCGAAAALTKHSGLSADIGRRTFSAAATRFSTYEEEK
                     AVLDEIQPLLTEKDVEASRKLRNIGISAHIDSGKTTFTERVLYYTGRIKAIHEVRGRD
                     NVGAKMDSMDLEREKGITIQSAATYCSWDKDNESYHFNLIDTPGHIDFTIEVERALRV
                     LDGAVLVVCAVSGVQSQTVTVDRQMRRYNVPRVTFINKMDRMGANPFRAIEQINTKLK
                     IPAAAIQVPIGAESELKGVVNIIDRVAIYNEGENGENLVTGPVPEDLKDLVEEKRALL
                     IETLADVDDEIAELFLEEKEPSVQEIKAAIRRSTIARKFSPVLMGSALANTGVQNVLD
                     AIVDYLPNPSEVLNTGLDIANNEAKVNLIPSAAQPFVGLAFKLEEGKYGQLTYIRVYQ
                     GKMRKGGYITNVKTGKKVKISRLVRMHSNEMEDVDEVGAGEICATFGIDCSSGDTFTD
                     GTLKYSMSSMFVPDAVISLSITPKTKDSTNFSKALNRFQKEDPTFRVKFDSESKETVI
                     SGMGELHLEIYVERMKREYNVECVTGKPQVSYRESIQSAAEFDYTHKKQSGGAGQYGR
                     VMGNLTRNEDSSTNNFRTAIIGGRIPEKYLAACAKGFEEACEKGPLVGHKVIGVDMLI
                     NDGAIHAVDSNELAFKTATMAAFKQAFLESQPVVLEPIMNVSVTSPNEFQGNVIGLMN
                     KLQAVIQDTENGQDEFTITAECPLNTMFGFATSLRASTQGKGEFSLEFKHYAPASPQL
                     QKQLIAEYQKKQQK"
     gene            complement(<91141..>91575)
                     /gene="FYV7"
                     /locus_tag="KLMA_70047"
                     /db_xref="GeneID:34717810"
     mRNA            complement(<91141..>91575)
                     /gene="FYV7"
                     /locus_tag="KLMA_70047"
                     /product="rRNA-processing protein FYV7"
                     /transcript_id="XM_022821290.1"
                     /db_xref="GeneID:34717810"
     CDS             complement(91141..91575)
                     /gene="FYV7"
                     /locus_tag="KLMA_70047"
                     /codon_start=1
                     /product="rRNA-processing protein FYV7"
                     /protein_id="XP_022677666.1"
                     /db_xref="GeneID:34717810"
                     /translation="MTKVEKKKFTKEYRLKEIQKNLTKKARLKKGYLKVLKEEGYAVP
                     EKPQAEKHDRASVHEKKELNKKKVKEQKEEHKLRKRSAKEKERAFREQEIERIKLAKQ
                     KQQQREDRAKRLLKKTRRGQPIMGPKINDLLDKIKNDDTYTG"
     gene            <92127..>94982
                     /gene="PET309"
                     /locus_tag="KLMA_70048"
                     /db_xref="GeneID:34717811"
     mRNA            <92127..>94982
                     /gene="PET309"
                     /locus_tag="KLMA_70048"
                     /product="pentatricopeptide repeat-containing protein
                     PET309"
                     /transcript_id="XM_022821291.1"
                     /db_xref="GeneID:34717811"
     CDS             92127..94982
                     /gene="PET309"
                     /locus_tag="KLMA_70048"
                     /codon_start=1
                     /product="pentatricopeptide repeat-containing protein
                     PET309"
                     /protein_id="XP_022677667.1"
                     /db_xref="GeneID:34717811"
                     /translation="MHRVGALIGNQWVRRFSSNSICSARNPWLLKQPFDRLSKLMPSV
                     PHHVLEVVHNSNGEIPLNDEQRTTMLNYLTSQKTTMTGFDKSIFLKYLSGKKEYDVVV
                     AMGQHHLFDGEGNYYSECAITHLIYYYDALIRTGQVEKLATEASKFISQFSINRQGST
                     VYVINYIFSLLFKFNSPETALYIWTKLVRVYYGHNELTNINIHWPFLSRLFYFFKANE
                     ESHRCLTHLLKRIEIEDSKIQASQLASTLITFFAHVRWFGEVNRIWQWKVDRNLPIIA
                     SDLTAAMRSRSHFKDWDEVIRLHNTYSLAHDDYNQFDYVLVALAKKQDWEKLKTQFDM
                     LFGIGELPTVNHYGVIMYALSLHGELDLVERLHGQLLRRNMSPNYAVLLSIINAHYKA
                     GDNNGAIREFALFKRYNIRPTSKTYLLMLKAYKKMGSLDSCFRILKTMSAEDVPIYET
                     HFNIIIDLCDRYNNYPVAEELFNVMISDYSIQPTGMTVSTLARVFLHSNRHEKALKLL
                     EKYESPKLSDNYKILQMKIAYFDHIGKPEKAEDLIRLYIQQKYQANYNFYLILLKHLV
                     CFRRDYSSAEKVLSELLKSKSQQSSPNHFNILLEEYDRVGNVEGSLSIISKLVDNGIT
                     MNSKTLYFLVKSRFNLHRKRGESYENLIPWLEEVLDNIAKKKLNFNSPSIHPSVITWP
                     MNFLSRKDDPSRAVDIFAKYVKTFYPFSKEYNEKLVVLRALMVFSAESERWDDFDELF
                     ERYKKRVKFYQTQSSAVVRNSNLKSAFVGLFKYQIQRLCDRNEIPLLPGLIHEIEDLG
                     CILSNSEWNEAIWKMIRRHSTFDFAMKKLNGVFISGYTWIHRARNLKKQEKLGLSRGN
                     TSSELSQISNKKVHLFLSSDKYELVMAQIDKHLRFDPDSLETELKRLITEYPYVMKQY
                     LRKPRTRVTNWELIEEKHFSFLQKLRHSHEIIPVEEF"
     gene            complement(<95168..>95743)
                     /gene="SPC3"
                     /locus_tag="KLMA_70049"
                     /db_xref="GeneID:34717812"
     mRNA            complement(<95168..>95743)
                     /gene="SPC3"
                     /locus_tag="KLMA_70049"
                     /product="microsomal signal peptidase subunit 3"
                     /transcript_id="XM_022821292.1"
                     /db_xref="GeneID:34717812"
     CDS             complement(95168..95743)
                     /gene="SPC3"
                     /locus_tag="KLMA_70049"
                     /codon_start=1
                     /product="microsomal signal peptidase subunit 3"
                     /protein_id="XP_022677668.1"
                     /db_xref="GeneID:34717812"
                     /translation="MFSLTQRFQHVSSLALTCSFAIIAFIIATSWVQLLKENAFELDS
                     KLSNIRSAVRLAKQKRYGGTALNPTEVAKIRFNADVDFSPLFNWNTKQVFAYVTAEYE
                     SDDKPNSWSEVTIWDKIITSQDDAIVSLSNVDAKYQLWDLESKITERPLTFKLKWNIQ
                     PWFGILINGETTGSRTIELKKPAAKNSSKKA"
     gene            <96555..>98054
                     /locus_tag="KLMA_70050"
                     /db_xref="GeneID:34717813"
     mRNA            <96555..>98054
                     /locus_tag="KLMA_70050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821293.1"
                     /db_xref="GeneID:34717813"
     CDS             96555..98054
                     /locus_tag="KLMA_70050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677669.1"
                     /db_xref="GeneID:34717813"
                     /translation="MRHAFEVKRLVGLLVCVGFLLGMDTSSLSLFLGTDYFKEYFNNP
                     NEMQTGMMTGANQIGGFFGCLLSGTLLESIGCRWCLSLCSVIWIIGSIVSLFVNEVYT
                     MALGRFIKGLAVGVLSVLASFYLMEVFSTNIRGQATALLQMALTVSILIIYFTSMALD
                     KLQSPLAFKITWGLELIPSIVLFGLFQALPESPNWLHKHGHSEQSIDRSLQILRIKDL
                     KKFKEEFINVNRISLKISHIIKKGYWKHMSLGIIIQILIQMSGINVIMYYMMYICEMM
                     GFDEEISSKLTAGPYIVNVLFTLIPVFLLDKFNRKVFIGWAGLFLGAIMLAIGMLIGE
                     RERHVGDVVLRNIAVALCFLFVSVFSSSLSCAGFVYTNEILPESIKSVALSVCISTSW
                     ITGFFLALVTPKLMQMVEWWIFIILGTSTIALSTIVVLWFPETKGLSSIEVEMLFDRK
                     EKYVAEVTSEKFSEDTTTDNISIPDRSGAPEPDYFASSSTHIEILGLPN"
     gene            complement(<98685..>99821)
                     /gene="ACT"
                     /locus_tag="KLMA_70051"
                     /db_xref="GeneID:34717814"
     mRNA            complement(<98685..>99821)
                     /gene="ACT"
                     /locus_tag="KLMA_70051"
                     /product="actin"
                     /transcript_id="XM_022821294.1"
                     /db_xref="GeneID:34717814"
     CDS             complement(98685..99821)
                     /gene="ACT"
                     /locus_tag="KLMA_70051"
                     /codon_start=1
                     /product="actin"
                     /protein_id="XP_022677670.1"
                     /db_xref="GeneID:34717814"
                     /translation="MDHFLAEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ
                     GIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE
                     EHPVLLTEAPMNPKNNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGD
                     GVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTTAEREIVRDIKEK
                     LCYVALDFEQEMQTASQSSAVEKSYELPDGQVITIGNERFRAPEALFHPSVLSLEAAG
                     IDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIA
                     PPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHLKCF"
     gene            <101575..>102117
                     /locus_tag="KLMA_70053"
                     /db_xref="GeneID:34717815"
     mRNA            <101575..>102117
                     /locus_tag="KLMA_70053"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821295.1"
                     /db_xref="GeneID:34717815"
     CDS             101575..102117
                     /locus_tag="KLMA_70053"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677671.1"
                     /db_xref="GeneID:34717815"
                     /translation="MAGKSSKKIAAKNAAILKQLDVLVVTVLSLTILRKLFTNGLSSC
                     IKPLIFNVPMLVCFYILEKSGRPKYEVSDATHGKYKLVSEGLDLESGGLTEYMFDFVY
                     VSLFCNLGTVIFNTMKWWFLVLICPTFILYKLYGLKQQFFPGNNKRPHQEQMQASEPS
                     KSKRQQKKEKRGDKAQVKYR"
     gene            complement(<102277..>102891)
                     /gene="YPT1"
                     /locus_tag="KLMA_70054"
                     /db_xref="GeneID:34717816"
     mRNA            complement(<102277..>102891)
                     /gene="YPT1"
                     /locus_tag="KLMA_70054"
                     /product="GTP-binding protein YPT1"
                     /transcript_id="XM_022821297.1"
                     /db_xref="GeneID:34717816"
     CDS             complement(102277..102891)
                     /gene="YPT1"
                     /locus_tag="KLMA_70054"
                     /codon_start=1
                     /product="GTP-binding protein YPT1"
                     /protein_id="XP_022677672.1"
                     /db_xref="GeneID:34717816"
                     /translation="MNTEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVD
                     FKIKTVDLEGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTW
                     LQEIDRFGTAGVLKLLVGNKNDLTDKKVVDTEVAKEFADSIGIPFIETSALDSSNVEE
                     AFLIMTKQIKESVAKQQKDNGRTEEKSNVNLKGQSLTGSNSSCC"
     gene            complement(<103538..>104380)
                     /gene="PER33"
                     /locus_tag="KLMA_70055"
                     /db_xref="GeneID:34717817"
     mRNA            complement(<103538..>104380)
                     /gene="PER33"
                     /locus_tag="KLMA_70055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821298.1"
                     /db_xref="GeneID:34717817"
     CDS             complement(103538..104380)
                     /gene="PER33"
                     /locus_tag="KLMA_70055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677673.1"
                     /db_xref="GeneID:34717817"
                     /translation="MVDRRANSGTSGGNRRSAARPTSSFGSVLRAKSKQPQFYWFLAN
                     AFCLYYYVQYMLSFREHSIKTNHRKILICMVISYGIVLHQYVKSKQLTFQWANLKQQI
                     RQLDNLQYFTLSVVLLTCSLGGGKTLSGTESSMAIYSLFHALNYFKENVLPFIPINPM
                     LKGSLSNKITSFITTYNAAFFQVAVSLELGAMFKWFPTLPIRLLVLLVRFDASSLFTL
                     LSIWTYATFFKLRYNQSEQMRILCNERQVALEQLIATRVPALMDKYLGVKHLAKVFFD
                     RIPA"
     gene            <105577..>106926
                     /gene="TUB2"
                     /locus_tag="KLMA_70056"
                     /db_xref="GeneID:34717818"
     mRNA            <105577..>106926
                     /gene="TUB2"
                     /locus_tag="KLMA_70056"
                     /product="tubulin beta chain"
                     /transcript_id="XM_022821299.1"
                     /db_xref="GeneID:34717818"
     CDS             105577..106926
                     /gene="TUB2"
                     /locus_tag="KLMA_70056"
                     /codon_start=1
                     /product="tubulin beta chain"
                     /protein_id="XP_022677674.1"
                     /db_xref="GeneID:34717818"
                     /translation="MREIIHLSTGQCGNQIGAAFWETICGEHGLDFDGNYHGSDDIQK
                     ARLNVYFNEASSGKWVPRSVNIDLEPGTIDTVRNSKIGTLFRPDNYIFGQSSAGNVWA
                     KGHYTEGAELVDSVMDVVRREAEGCDSLQGFQIAHSLGGGTGSGMGTLLISKIREEFP
                     DRMMATFSVVPSPKTSDTVVEPYNATLSVHQLVEHADETFCIDNEALYDICQTTLKLP
                     QPDYANLNHLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTSI
                     GSQSFRSLSVSELTTQMFDSRNMMAASDPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQ
                     TRNSSYFVEWIPNNVQTAVCSVPPKDLDMSATFIGNSTSIQELFRRVGDQFSVMFKKR
                     AFLHWYTNEGMEEIEFSEAESNMNDLVSEYQQYQEATVEDDEELEFVDEQPMTENFE"
     gene            <107489..>111277
                     /gene="RPO41"
                     /locus_tag="KLMA_70058"
                     /db_xref="GeneID:34717819"
     mRNA            <107489..>111277
                     /gene="RPO41"
                     /locus_tag="KLMA_70058"
                     /product="DNA-directed RNA polymerase"
                     /transcript_id="XM_022821300.1"
                     /db_xref="GeneID:34717819"
     CDS             107489..111277
                     /gene="RPO41"
                     /locus_tag="KLMA_70058"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase"
                     /protein_id="XP_022677675.1"
                     /db_xref="GeneID:34717819"
                     /translation="MLRISRTRVGCRMASRIQARTLQQPVTQLISCRMISSTAETESA
                     DLGFAKSSKASIQPTFTPFDASTAGVEAQARTTYFNLWSLLEACLNSGYMDRAFSILQ
                     SLYENRMNGKFFIRDYNEYFLKYSSQVDNIDALQEKLFNDLNKVFKDVSYDDRTLSIL
                     LHKSLNSMDKNMYLNCKKFLSMNINGHRSVLKNMDVLTVADYSALCNEMKMVDVSEVP
                     ESVRSIIENSTDDLNSLTNSGEKGIETLKKNAVELKSVDTFGMKTVRISLQGLSLSPE
                     QRERIDEYLSDPKLNPIVSNSSQKGINFFEIFKNLKTKEDKEAFNEFLDMINIERQRE
                     LENRSFDASKERWKYEFDQAASQGGLKLKKNMNVRLWEWYQQMLPVVKQEIALCQEIL
                     EKQQLGSNKQNVDRAKYGPYLLLVPAEKMCVITILELLKLQSSGGVTEGMRTARAVLS
                     VGRSIEMEFRSEKLLRSENKMFKEVNKRSHEFKMFVQNAKTALRNMHVDENMIQWPSD
                     VKAKIGSILVSMLIHVARVTVEGIDPITKEKVIGDAPAFCHTFQYRSGTKIGILKIHR
                     SLVNQLSAERMTTNVQPQHLPMLVRPRPWTNWNSGGYNYSQSVLIRSRDSPEQIAYIK
                     AVSEQGSIQNVYEGLNVLGNTAWTINEKLFNVISEVWNTGEEFLDIPPLQDKLELPAQ
                     PPRSADPLVLKEWRNKCRQLTNEFKGFKSYRCDSNYKLEIARAFLGEKFYFPHNMDFR
                     GRAYPLAPHFNHLGNDMTRSLLIFWNGKRLGENGLKWLKIHLANLYGMDKSSFEERVA
                     FANAHFDDIKDSAENPLGGKRWWTKADKPWQLLATCIELNEAMKLDNPEDFISHQPVH
                     QDGTCNGLQHYAALGGDIEGARQVNLVPSDRPQDVYAFVAKLVSERLRKAAEAGDESA
                     LKLKDLVSRKVVKRTVMTNVYGVTFVGAADQIMKELDGYFDNPEESNELSRYLAKHVF
                     ASIRELFHAAHLIQDWLGECAKKISKSIRLDFNQSDSKTINSTDLMTSVIWTSPLGLP
                     VVQPYRDLKKKQVQTNLQTVFITDPFAINPINPRRQQAGLPPNFIHSLDASHMLLSAI
                     QCGKAGLDFAAVHDSYWTHACDVDDMNFLLRQEFINLHKIDLIERLKNEFDERYRDYL
                     EIVKIRRDSDLGKKILEIRSEFAKKEGRNMTIADEIKMEKMRVDLLRSEDPEEQRKGR
                     EMVTSVSCTLDYDIKEEENKTKNKVSQITILTPLRLPEIPPKGNFDVEELMNSKYFFS
                     "
     gene            complement(<111583..>112504)
                     /gene="MOB2"
                     /locus_tag="KLMA_70059"
                     /db_xref="GeneID:34717820"
     mRNA            complement(join(<111583..112375,112482..>112504))
                     /gene="MOB2"
                     /locus_tag="KLMA_70059"
                     /product="maintenance of ploidy protein mob2"
                     /transcript_id="XM_022821301.1"
                     /db_xref="GeneID:34717820"
     CDS             complement(join(111583..112375,112482..112504))
                     /gene="MOB2"
                     /locus_tag="KLMA_70059"
                     /codon_start=1
                     /product="maintenance of ploidy protein mob2"
                     /protein_id="XP_022677676.1"
                     /db_xref="GeneID:34717820"
                     /translation="MSFLNSLKGFGRSSKKNKALNSQQGPPTTNGFYASSQHSSSKAS
                     LRRTQSPSRLSMLSSSHQPSQQSTNSVGNSDSQEVMFLSEPFVRTALVKGSYKTIVQL
                     PKYVDLGEWIALNVFEFYTNLNQFYGVIAEYVTADAYPTMNAGPRTDYLWLDANNRQI
                     SLPAGQYIDLALTWINNKVNDQQLFPTKSGLPFPPNFLRDIQRIMIQMFRIFAHIYHH
                     HFDKIIHLSLEAHWNSFFAHFISFAKEFNLIDRREMAPLEPLIVSFEQQGKII"
     gene            complement(<112820..>113857)
                     /locus_tag="KLMA_70060"
                     /db_xref="GeneID:34717821"
     mRNA            complement(<112820..>113857)
                     /locus_tag="KLMA_70060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821302.1"
                     /db_xref="GeneID:34717821"
     CDS             complement(112820..113857)
                     /locus_tag="KLMA_70060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677677.1"
                     /db_xref="GeneID:34717821"
                     /translation="MAKRGEKGPRTLPVSHEDIVPPQDILDLFKVSFSDELYGDELNL
                     HSQIQSVKADLYERKYVEAFNSDEKRVAYCCRWSPSRAIAYTSLFAQLNEVKRIIECK
                     RSEENVDEDDDEEDSLEKSVSKLNIETNSTNVLCIGGGAGGELVAIASIFAPSRDYNS
                     KFASSQSKSKTIKAELNLQLVDISDWSNIVERLESSIKSKWLRSEADCLNVTFKKADI
                     LSLSPKELNLKNLDLITLLFTTNELFMENKSQSIRFLQSLNAHCTSNTYLLIVESAGS
                     FSHIEVGSKKFPIQFLIDTILQGKRGEESRGSWEVVSMEDSIWYRCAETFDYKLKLEN
                     MRFFYRLYRKK"
     gene            complement(114067..114176)
                     /locus_tag="KLMA_R701"
                     /db_xref="GeneID:34718777"
     tRNA            complement(join(114067..114105,114142..114176))
                     /locus_tag="KLMA_R701"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718777"
     gene            complement(<115129..>115983)
                     /gene="ATP10"
                     /locus_tag="KLMA_70061"
                     /db_xref="GeneID:34717822"
     mRNA            complement(<115129..>115983)
                     /gene="ATP10"
                     /locus_tag="KLMA_70061"
                     /product="mitochondrial ATPase complex subunit ATP10"
                     /transcript_id="XM_022821303.1"
                     /db_xref="GeneID:34717822"
     CDS             complement(115129..115983)
                     /gene="ATP10"
                     /locus_tag="KLMA_70061"
                     /codon_start=1
                     /product="mitochondrial ATPase complex subunit ATP10"
                     /protein_id="XP_022677678.1"
                     /db_xref="GeneID:34717822"
                     /translation="MNNSFVLGKRFFFSSSNRSGIFRRLNNNIINSAPKDIQIEELRK
                     PIGLPQPPFNTKEYKYGNSFLDLFNSEKTEKRAGELEVEFRKSGFHDLYVLKKTNGKI
                     FYSPPSYWKADKSLYFPHLSGQRLADGEECNIEDSLAGKVSIVRMFTTDVGKNLIDSY
                     FVDKTHGLDYLKNDLDLLKDVEGAKSAQIIEINMAENWLKMAIVNFAKNKYASIVPEH
                     RHDKTFICNRTQLPFQIREEIQINNLYSGYVFVIDENLKIRWAASGEASQKDFNLLWR
                     CVNAIRKE"
     gene            complement(<116502..>117188)
                     /locus_tag="KLMA_70062"
                     /db_xref="GeneID:34717823"
     mRNA            complement(<116502..>117188)
                     /locus_tag="KLMA_70062"
                     /product="covalently-linked cell wall protein 14"
                     /transcript_id="XM_022821304.1"
                     /db_xref="GeneID:34717823"
     CDS             complement(116502..117188)
                     /locus_tag="KLMA_70062"
                     /codon_start=1
                     /product="covalently-linked cell wall protein 14"
                     /protein_id="XP_022677679.1"
                     /db_xref="GeneID:34717823"
                     /translation="MRFSTALGAAISLAVLSTEVVATPPACLLACVAQVAKKSQCNSM
                     EDISCLCSTKGSDLSSCLDSSCPSGDADSAKSALQSTCKAQGASLKENSSSSASSSAT
                     SSSASSSATSSSASSSAAPSSSAAPSSSAAPSTSAAPSSSAAPSSSAAPSSSAAPSSS
                     AAPTSSAAPSSSAAPTSSAAASSTLETSQAPVVSSSSTAVHQISSDGANALLLGNSVF
                     GGLALAGLLL"
     gene            complement(<117724..>118734)
                     /gene="PEX19"
                     /locus_tag="KLMA_70063"
                     /db_xref="GeneID:34717824"
     mRNA            complement(<117724..>118734)
                     /gene="PEX19"
                     /locus_tag="KLMA_70063"
                     /product="peroxisomal membrane protein import receptor
                     PEX19"
                     /transcript_id="XM_022821305.1"
                     /db_xref="GeneID:34717824"
     CDS             complement(117724..118734)
                     /gene="PEX19"
                     /locus_tag="KLMA_70063"
                     /codon_start=1
                     /product="peroxisomal membrane protein import receptor
                     PEX19"
                     /protein_id="XP_022677680.1"
                     /db_xref="GeneID:34717824"
                     /translation="MKSQKVGHEKEPLKHRRCETLNWILAGTMDEFDDLDDYLEDPSK
                     LDTTEDANSKDQVKSNGPGHKGPEPLGNNDDPEVAEMMEDLQKQFEQLMQDGGEGADQ
                     EMVKNFESLLNVLGDASKEKEQKSSNIKKVQDELKNSEGDGFKSIISNTLDRLKESST
                     KVDETLEEEKKSQNSDDILSQLLDQLVANGDSLDGSGEEGMDNAILKMLSQMSSKEVL
                     YQPMKQMQVEFTEWLKVNEVNPDPEHSDKIDDYRKQYLLINKIIGIYESSDYTNEKYH
                     SEIADLLDELEQLGDSPVAKGFNNSEAGNDMSELAKLLEIQGDDNIGEIDKDLEDTCK
                     QQ"
     gene            <118929..>119402
                     /gene="UBC9"
                     /locus_tag="KLMA_70064"
                     /db_xref="GeneID:34717825"
     mRNA            <118929..>119402
                     /gene="UBC9"
                     /locus_tag="KLMA_70064"
                     /product="SUMO-conjugating enzyme UBC9"
                     /transcript_id="XM_022821306.1"
                     /db_xref="GeneID:34717825"
     CDS             118929..119402
                     /gene="UBC9"
                     /locus_tag="KLMA_70064"
                     /codon_start=1
                     /product="SUMO-conjugating enzyme UBC9"
                     /protein_id="XP_022677681.1"
                     /db_xref="GeneID:34717825"
                     /translation="MSSLCLQRLQEERKKWRKDHPYGFFAKPTKKADGSMNLQKWEAG
                     IPGKDGTLWKNGLYPLTIEYPDDYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQD
                     WRPAITLKQLLLGVQDLLDSPNPNSPAQEPAWRAFSKNIKEYERKVAEQALKYTK"
     gene            complement(<119573..>121420)
                     /locus_tag="KLMA_70065"
                     /db_xref="GeneID:34717826"
     mRNA            complement(<119573..>121420)
                     /locus_tag="KLMA_70065"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821308.1"
                     /db_xref="GeneID:34717826"
     CDS             complement(119573..121420)
                     /locus_tag="KLMA_70065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677682.1"
                     /db_xref="GeneID:34717826"
                     /translation="MGKSKKRSRASNARANPLLKNAAKDDQIRTKRIQPLIAQLSSVI
                     PNDRSMALGTILVLCEDPHMRSLFLKEKLVNVVTSKLLTDSNTDIVVEAYGVLRNLAL
                     EEGYDLATHVWRSNIWVNIESGLSQVQDSFHSMEADETKSKKESKRLLFDFAENVLSL
                     LLALMNGSDAILDEVITSDKLNKIFLTISDILKYGMVISDNQVTLKITTQLFNTILDF
                     IYDVSSDSAEFIDKVSEHENLSLFVENLINWQFTNDNELTKVLIQGIYLQFMDTDISY
                     QIASSIISTVLQSVQHIDLSQVKMTLSNKTEDSELEKASNDEIAKKMKDYSKKRTEAM
                     VKYQSIEIALDIVTASIELVASKYEETQKPLDDALVQVLTQAVPQAFFALYEEFTSSV
                     LIGWNNLLWLYLSVGISLFELGDCWKQLWSSMQNTTNNDEFSVNIGKLSVTWALLKNV
                     LAVFGSSGAGQFFEITQIDSEDFVNSIIKCFNNVENLEDDEIIQLQQRCCGVLGALAT
                     FSNHIELNRLIGNFFISTLSNKETKAAVLIDFMNTFFEIYSDMNFDYDEPVFINNNYL
                     TLLQSQVSPNLKAVFKFVDKNKNPQLKERCQDCFTTLGSFIAYKQNERR"
     gene            complement(<121849..>122121)
                     /locus_tag="KLMA_70066"
                     /db_xref="GeneID:34717827"
     mRNA            complement(<121849..>122121)
                     /locus_tag="KLMA_70066"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022821309.1"
                     /db_xref="GeneID:34717827"
     CDS             complement(121849..122121)
                     /locus_tag="KLMA_70066"
                     /note="Protein ECM19"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022677683.1"
                     /db_xref="GeneID:34717827"
                     /translation="MVGRIRATDVAIFSIICAVGVYTGTKFFEPIIIDQLKKDGNLRT
                     DIDVPQYDEEGNPVLPKSMLQLREELDQVIREQKVAKEAGFPDKKN"
     gene            <123052..>126072
                     /gene="STE23"
                     /locus_tag="KLMA_70067"
                     /db_xref="GeneID:34717828"
     mRNA            <123052..>126072
                     /gene="STE23"
                     /locus_tag="KLMA_70067"
                     /product="a-factor-processing enzyme"
                     /transcript_id="XM_022821310.1"
                     /db_xref="GeneID:34717828"
     CDS             123052..126072
                     /gene="STE23"
                     /locus_tag="KLMA_70067"
                     /codon_start=1
                     /product="a-factor-processing enzyme"
                     /protein_id="XP_022677684.1"
                     /db_xref="GeneID:34717828"
                     /translation="MLSVISGLVTQQPSLALFSRISATFLFRSSSRFLHYNYNLMSKN
                     YKVLGTDSEFLKPDLDDRKYRYIQLPNDLKALLIHDPEADKAAAALDVNIGSFQDPEH
                     LPGLAHFCEHLLFMGNKKYPDENEYASFLSKHGGSSNAYTGSQNTNYYFHLNHEHLYP
                     ALDRFSGFFSCPLFNQDSTDKEINAVDSENKKNLQNDIWRMYQLDKSLTNWDHPYHKF
                     STGNIKTLGEIPKLKGIDIRSELLEFHKNNYSANLMKLCILGREDLDTLSDWVYELFK
                     DVPNLNKQVPYYPAPLYTENQLQKIVHCKPVKDLKKIEFTFPTPDADPYWESKPNHYL
                     SHLIGHEGNGSLLAFLKEKGWALELSAGSHTISKGNAVFCIDMDLTDEGMEHINEIVI
                     ATFQYLEMLKVTLPQEWIHNELKDTSVSSFKFKQKDSPASTVSNMARLLEREYVPVSD
                     ILSTSVIRKYVPKLIVDYVKALNWQNSRLMLTSQKLPVDSKEQWYGTEYQVLDYPESL
                     TKQLPNVGLNPKFHLPRPNEFICTKFDVNKIDTKKPLNEPLLLKDDNYSKLWYKKDDR
                     FWVPKGHIYVSMKLPHTFSSVVDSMLTSIYVEMVKDDLTDLQYDASCADLRVSMGKTN
                     QGIDIQLSGYNEKLTILLTRFVEGIKAFRPNESRFNVIKDRIIQKLNNQQYDVPYNQI
                     STTFNSLVNERSWNLKQKLEVTKGITFQHLESFIPLAFEQLYHEVLVHGNFSVEVAYE
                     IDEIVRMLTPDTIPNLQVKNNKLRSYLLPDDCAYRYETLLEDKKNVNSCIQYLIQFGV
                     YSEEMAAKANLIAQLLHEPCFDTLRTKEQLGYVVFSSVANTHGTTNLRILVQSERSSA
                     YLESRIVAFLNSFGRTLEEMPEDVFEKHKSSLIKSLEQKLTNLRQEHERFTTAIYLAD
                     YNFCAKQRRADIISNFSKNDMVEFYKNFVLSPHSPRLVIHLKSQVENNRPEDAVEGYP
                     TGSLITSIDEFKSNLCLAPVRQAVKNFEVAHPKL"
     gene            complement(<126855..>127143)
                     /gene="RPS29"
                     /locus_tag="KLMA_70068"
                     /db_xref="GeneID:34717829"
     mRNA            complement(join(<126855..127028,127093..>127143))
                     /gene="RPS29"
                     /locus_tag="KLMA_70068"
                     /product="40S ribosomal protein S29"
                     /transcript_id="XM_022821311.1"
                     /db_xref="GeneID:34717829"
     CDS             complement(join(126855..127028,127093..127143))
                     /gene="RPS29"
                     /locus_tag="KLMA_70068"
                     /codon_start=1
                     /product="40S ribosomal protein S29"
                     /protein_id="XP_022677685.1"
                     /db_xref="GeneID:34717829"
                     /translation="MDMRLRSILIIFGSFVNKMAHENVWYSHPRKFGKGSRQCRISGS
                     HSGLIRKYGLNIDRQSFREKANDIGFYKYR"
     gene            <128115..>130496
                     /gene="TSR1"
                     /locus_tag="KLMA_70069"
                     /db_xref="GeneID:34717830"
     mRNA            <128115..>130496
                     /gene="TSR1"
                     /locus_tag="KLMA_70069"
                     /product="ribosome biogenesis protein TSR1"
                     /transcript_id="XM_022821312.1"
                     /db_xref="GeneID:34717830"
     CDS             128115..130496
                     /gene="TSR1"
                     /locus_tag="KLMA_70069"
                     /codon_start=1
                     /product="ribosome biogenesis protein TSR1"
                     /protein_id="XP_022677686.1"
                     /db_xref="GeneID:34717830"
                     /translation="MAGHSHRSSVKNGHKPFKSKHASKGSLKKVFKGKVEKESKQGKT
                     NKVVSKLERKNLAKQLRQKKILSTLEAKKLFEGNNGAKKIITVIPLTADVYADDIVKK
                     LILSAETIEKTEEDLDFDLKTPSVTNFKINKFKTTLQVVIPDMSNFINILDCAKVADF
                     VVFGLSGTSEVDVEFGEQIIRALEFQGIASYMGVVTNLSAVHPKEKFQLDVKKSLESY
                     FRHFFPTEESIFNLEKPSEALNAIRTLCQKYPRSIKWRDARGYLLADNIDFMETSEDK
                     GHLIVQGIVRGSGFNVDRLIHLPGMGDFSVSKIEKLTASRRAKSSSEASNDGTEFSPS
                     ADRDSLEEFAAQDMEMDWSDYEDGFEYDNLTAARYDDHGFLPGREQEAKKVRLPKGTS
                     EYQARWYLDDVIEVGEEEEIDEDEDDIEMDEQEQGEDSMMVEDEEGFQQEPQVTEMDT
                     QTEVDGDEMFVDLSPEEEERQLREYREQEKDDLEFPDEIELDPNASAIETLKSYRGLK
                     NLHNCVWDVDEKDPECPKEWNRVLRVGNFKNTMKKLKKEAIRSAQVVAGDTVRLYIDV
                     PKFILEKIAEPKAEIFAVYSLLKHEHKNAIVNFSIERWEEYDKPVPSSEPIIVQYGIR
                     RYIIAPLFSSASNSPNNVHKFERFLHQNFVSVATCIAPVDFTQSPAIFFKTSPTDPKG
                     IELVGHGSFLSADHTRILAKRIILTGHPFKFHKKLVTIRYMFFRPEDVEWFKSIPLFT
                     KSGRSGFIKESLGTHGYFKATFDGRLTAQDTVAMSLYKRVWPKTSLPWTDKIN"
     gene            <130787..>132001
                     /gene="REH1"
                     /locus_tag="KLMA_70070"
                     /db_xref="GeneID:34717831"
     mRNA            <130787..>132001
                     /gene="REH1"
                     /locus_tag="KLMA_70070"
                     /product="zinc finger protein REH1"
                     /transcript_id="XM_022821313.1"
                     /db_xref="GeneID:34717831"
     CDS             130787..132001
                     /gene="REH1"
                     /locus_tag="KLMA_70070"
                     /codon_start=1
                     /product="zinc finger protein REH1"
                     /protein_id="XP_022677687.1"
                     /db_xref="GeneID:34717831"
                     /translation="MSDTVMFTCNSCMIQFQSSDLQRHHMKTEWHRYNLKRRVAELPP
                     ISASLFAEKLQLSRREQERNQIDEFGFPLLKPVINSSGYKKKGRRLGRSKLNTLDDPY
                     LQNRSQSPASSITSRVSRATFRSTDLEEDDFLLEHGFTTEDTASHYSDSDYTSDSETE
                     SIHTDPESFNPKECIYCGKISRELEMNVKHMFSKHGLYIPERSYLVDLEGLLKYLADI
                     IIQNNECLCCSYQGSSIESIRAHMDAKRHCMLPYESKAERALVAQFYDFSSLENAEPA
                     TSENVEDIISDSEESKSNDRDDSINSNYALVRVDDSGVELQLDNGIKVGHRSMRRYYR
                     QNTPLGNDIPDDRKTVVAADRRVSSLLASRHMTKAVKQMKQLEKQHADKALHLRIKNS
                     NNQKHFRDELLQ"
     gene            complement(<132063..>134765)
                     /gene="VAC14"
                     /locus_tag="KLMA_70071"
                     /db_xref="GeneID:34717832"
     mRNA            complement(join(<132063..134680,134762..>134765))
                     /gene="VAC14"
                     /locus_tag="KLMA_70071"
                     /product="vacuole morphology and inheritance protein 14"
                     /transcript_id="XM_022821314.1"
                     /db_xref="GeneID:34717832"
     CDS             complement(join(132063..134680,134762..134765))
                     /gene="VAC14"
                     /locus_tag="KLMA_70071"
                     /codon_start=1
                     /product="vacuole morphology and inheritance protein 14"
                     /protein_id="XP_022677688.1"
                     /db_xref="GeneID:34717832"
                     /translation="MDKSIAKGLNDNIYEKRKAAAQQLEKFTRECIQNGDHETLEKII
                     DELCREYAYALDRPMARNAGLMGLAAVSIALGSKYLNKYLDTILPPVLACFGDQNDQV
                     RFYACESLYNIAKIAKGDMLLYFNEVFDVHCKIIADSDPSIKAAAEVLDRLMKDIVSE
                     CATTHVVRVNNDPKDAPPATITDPHTGEVLANNEPPYEENESKLAFSLPKFIPLLSER
                     IQAVDPNTRIFMVGWLQVLENIPDLELISYLPTFLSGLFTYLGDSHKDVRVITHSLID
                     VLLHEVERVANIQKQLKEHETEIQRQKHASMMDSTPIKRTDGALISERKKSLINALEQ
                     LSTNEKAAGSVDASSAIENVNSDPTDSLADSTEMSKIGNNRYGDIYIPGQDIHLDFPK
                     IIEILVNNLTSSETEIQGVVLKWIDVCLNIDPDGFIPFLTKLLAVLLKLLNESDVEFC
                     EMVQKVNQKLISLTQRPDVSSEGIKYGPIVNTLTLHFLDSNATTKEACLDWLILIHHK
                     DPSQLLEHHDSTFLTLLKSLSDRDERLVSKSLELLRLLCNTSPDNYFKKFIQNLLSLF
                     RSNEKLLKTRANYILRQLCLKLSAERVFKIISLMLDGNDDIVFTRIMVQILSSNLVTA
                     PELSALRKSLRKGEDWTCFSILFKSWSHNPISLLSLCLISEKYELAYNILKTYVDYEL
                     SVNDLIQIDILVQFLESPAFTSLRMQLLEPYKYPYLYKCLYGILMVLPQSKAFHILDN
                     RLNSVGRVASQSLSSSPGHSSPTSSVGRGSSNGSTQSGSTRWHQYQDLLEHFQQVCEQ
                     HNCDGSTRKYNENNYVLLNEILSPNNTINPNISHTPITDAMNNTLEPDVSDSESVIYR
                     SNDSHSRLGMRVKSIEH"
     gene            <135020..>135397
                     /gene="SWC7"
                     /locus_tag="KLMA_70072"
                     /db_xref="GeneID:34717833"
     mRNA            <135020..>135397
                     /gene="SWC7"
                     /locus_tag="KLMA_70072"
                     /product="SWR1-complex protein 7"
                     /transcript_id="XM_022821315.1"
                     /db_xref="GeneID:34717833"
     CDS             135020..135397
                     /gene="SWC7"
                     /locus_tag="KLMA_70072"
                     /codon_start=1
                     /product="SWR1-complex protein 7"
                     /protein_id="XP_022677689.1"
                     /db_xref="GeneID:34717833"
                     /translation="MSIQNDSITLLLLQITLYRQQDLVHSDSSLNLDELLVEPIVDES
                     VVEAFVSHKLVKLHAQELTSLNKTTTKALITDIFKKTQIEGPKNLITLANYYYSQRLN
                     YLEKEKIPELISLIKQSCEDQSK"
     gene            <136191..>140168
                     /gene="IKI3"
                     /locus_tag="KLMA_70073"
                     /db_xref="GeneID:34717834"
     mRNA            <136191..>140168
                     /gene="IKI3"
                     /locus_tag="KLMA_70073"
                     /product="elongator complex protein 1"
                     /transcript_id="XM_022821316.1"
                     /db_xref="GeneID:34717834"
     CDS             136191..140168
                     /gene="IKI3"
                     /locus_tag="KLMA_70073"
                     /codon_start=1
                     /product="elongator complex protein 1"
                     /protein_id="XP_022677690.1"
                     /db_xref="GeneID:34717834"
                     /translation="MRNLITLNHGRLQPVSQTHPDLELYTSCFDTLSDSITCVLGAAD
                     IGILEVQQYMKDGTMKVLSSFYIQSFNDKLLSFAHFDDINQLVFVFQQGDIISVTYDP
                     TSMDYEKSEVSIVGSIDQGIEAAEWSPDQETLALVTYERHVVLLSRQLEPIAETALEV
                     DDLKISKHVTVGWGKKDTQFRGKGARAMEREALQSLKASGLVGNELRDPTMPYAVDSG
                     HITELDNHQIKISWRGDCEYFVVTTVETVKDPADESRDMERRALRVYTRDGQLDSASE
                     PVNCMTEHLSWKPQGSLIASIQRRTEIPDEEGLELIFFERNGLRHGEFDLRLPSDEPI
                     LDLCWNANSEILTVVLIDRIQLWTTKNYHWFLKQEVNLNNIQFAKWHPEKDFTIMVGD
                     SEKITIVDFAYKMTVGPTLQPFDNGTSLVIDGNTVNITPIGIANVPPPMYFREFECSN
                     NVLDAACSVSNEVYAAITKDELIIATISSLKEMKKGKSPSIASTLNKSHFGTAFDVLR
                     QVAFINDSTVAILLDTDSLSRIALIDISDTNNPSLVTIIETFEKVVLLKSQFDYNFVV
                     YESSDGKITQLSAEGQLTQISKFPQLAYDFRVKRVDSAAAENDWGNEQSKTIAFGLTS
                     TGKLFANDVQLASAVTSIEITDSLLLFTTAQHNLQFVHLNTTDFKPLPNVEENTTDER
                     VRAIERGSILVNVIPSKAAVVLQAARGNLETIYPRIMVLSGVRANIIAKNYKEAFITC
                     RTHRINLDILYDYNPELFLENLSQFIDEIDRVDYLDLFISCLDEDDVTETKYKETLNV
                     GSAVAFEVAPPPPTEMQLYMKKKMFDPKKSKVNKVCQAIIEVLLNNQTYRQKYLQSII
                     TAYACQNPPDLKSALQLISSLESEEQKESTVTYLCFLQDVNIIYKVALSLYDIHLTLA
                     VAQKSQMDPREYLPFLQSLLDEEPLRRKFMIDDYLKNYEQAIEHLAEIDKATNTVSEE
                     FIEYVEDHELFKYALNIFKSEPARQNIIYHIFAKNLSSKQMYGEAGIILEMLGEFKEA
                     LDAYTLGKKWNEAMSIVLSHFPEKKVEVAEELVSSLSFDHKYVDAAQIEIRFLKNIKE
                     GMSLLCKAYDYEAATLIAVCENHPELIEEVVDPALGDGFGTIAELLADCKGQVNSQLR
                     RLRELRQKKAEDPFAFYGEESEHADDVSIAPSETSTKESFFTRYTGKTSGTAKTGASR
                     KTAKNKRREERKRARGKKGTIYEEEYLIQSIGRLIDRLHQTQPEAIKLIEGLLRRNMR
                     EQAYQIQKNFIDLVAILKENVKEIYTISEKDRERFDEDGQLYYLPEIPVPEIKDFPKR
                     NIIDF"
     gene            complement(<140267..>140896)
                     /gene="RAD59"
                     /locus_tag="KLMA_70074"
                     /db_xref="GeneID:34717835"
     mRNA            complement(<140267..>140896)
                     /gene="RAD59"
                     /locus_tag="KLMA_70074"
                     /product="DNA repair protein RAD59"
                     /transcript_id="XM_022821317.1"
                     /db_xref="GeneID:34717835"
     CDS             complement(140267..140896)
                     /gene="RAD59"
                     /locus_tag="KLMA_70074"
                     /codon_start=1
                     /product="DNA repair protein RAD59"
                     /protein_id="XP_022677691.1"
                     /db_xref="GeneID:34717835"
                     /translation="MSRYTDISYENTSYSVNTGLDLKDFQVEEDWYNRPASEWSVKRI
                     GQLQAKIERYTYRIYHSNRYGKHNLARLIPGHVFINFANECFGYDGWSTQVEEVITLE
                     HVENSETAEKPATHTVLAEARVKLVLKDDTYTSSSGFGKSTMPSKGDAFAKAKKEALT
                     NALKNCLLAFEKVIIDHEAKIKQNYYVDGVYKNQGPKMEGSSSFAKPVH"
     gene            <141637..>146907
                     /gene="USO1"
                     /locus_tag="KLMA_70075"
                     /db_xref="GeneID:34717836"
     mRNA            <141637..>146907
                     /gene="USO1"
                     /locus_tag="KLMA_70075"
                     /product="intracellular protein transport protein USO1"
                     /transcript_id="XM_022821319.1"
                     /db_xref="GeneID:34717836"
     CDS             141637..146907
                     /gene="USO1"
                     /locus_tag="KLMA_70075"
                     /codon_start=1
                     /product="intracellular protein transport protein USO1"
                     /protein_id="XP_022677692.1"
                     /db_xref="GeneID:34717836"
                     /translation="MELIQGIIQPPKAQSVEETIPTLCDRLENSTLISDRRSAVLGLK
                     SFSREYRETVVASGLKSLINTLVKDQEDEDLVRAVLETLLILFIRGEGEEDLTRNWIS
                     QQSRLQNGKYPSPLVMKEENESVDQFSLWITDALTQTDEVIKLLFTFLDSSVFQIKLY
                     SIQLLEALIATRPTKAREVILNIPTGVSNLVKLLDDINEPIRDETILLLMAVVNDNSH
                     FQKLVAFENVFEKLFSIIDDEGGLRGSLVVNDCLSLINNILKYNTSNQTLFFETGNLQ
                     HLINLLREPLSTEEEFFWNEQRIKNVNTVLDIIRLTVEDGNTVTKAHQDRLFEAEGLM
                     VVLRLAFFIHTPNDTRLTALLTIADMIRSNSAIQHKFSQIDVPYWDPSMPSSPVSAET
                     KLVPVTTLLLSWTLNLNSVHIFDIRVASLELLKSYFLEKENRVSLLADQIEKFNETSD
                     SIESNTNASVLEPIFNYDPNLNLNPYKLFFSTDLLMFFISCDKSEGTTLSMLRDISFA
                     GDIDDNDDEKMVAVQTVGELLITSFNSKDIRIPIAFLSFLIFWLYEDPVSVSQFLSNK
                     SLINSLVSFAVQVEHQDTSLRCLVTMLLGVIYEFSSPDSPLTRKDLYGLLISRISEDN
                     YSSRIKQLRESELFTSSPESYLAPSFDETGLPNIFFSTYFIDLVNKNIYRIQSSLKRP
                     PDELPAVKITFELYDQLLSDFHKTKLDLTATSAEYKEKADSLNKELDKVTEKLQRIEE
                     EKNQAESELKRMTSEYADMKRDLEQTKENLHSVSTTSKNLEELKIKNSTDIAEKEKLL
                     QQLKDKVERLEQELLDMTNLKLKAEDGINKMSRELFSLTKEKESLKTEVTNLNNQLQK
                     HEKSSSTQIASLQKQINAKDQEILNYNKSLKDYREKNNAFEKKVNTLTKEKEELDAKL
                     SSQTALIPKLTEKLKSLANNYKDLEAEKEECAKQYLEENATIQKSLNEANAKIEMILE
                     EKTSLIKQLDELKQNHKIETLKTEESLARLSTENSEKTATIIHLQNSIKELQSQLDVS
                     SSQNDQLEEKIKVLNAKCLDLEKSLNIAKKSSADSASTIEELNDSIIAINEELQAVTS
                     ERDSLSSINKTLLEEKNSYEDTIKEKDVHLEEVKKSLDGLEINIQQLKDDHDKKVSEL
                     QDTIDQKEFKLSELQDNINALEHQSKTTIDALNSEIEALNTKIKEFDSLQASRDELTS
                     ELENKSQKIKSLQEDFEKNLKKEQEKSEELVSKLAEKDTKVLDLESKVEDLTKSIALS
                     QEKLEAKDIELKKHEINVKEKIASLESLNHALNSAKKENQDLLSSLEQEKAKAKKEQE
                     KLIENLSSAKSELKEKIEELEEERKLLTEGSSELNQQFSAKISKLEGTLEKTKTNYEK
                     KMQGLEDTIDSLREQSKKVHKELEEEVNKLRTETDKRQKLEKLIAQKDKEIQDYKEKL
                     DLSDSNLVSLTEKLKSTNERLDDAIKNSSEMEALSEKEKEKTLEGQNKIRALEAEIES
                     TKGLQSEIDDVKKELASVIKEKTFLSNEVKALEEKLSELESKTEADTSQITSLENELK
                     QATANVDVSNNKIKESETLLEKTRKNLEILQDQYNEARDNFELKSTELNAVMKDNHEL
                     KLEFEAHKTSNDSLLNSLKKENQELLENISKLKDELLQKEKSTVDLEQSSVKEREKLS
                     KELSESTSKLTVLSEEKDSLNKEITILKKELSEWKKRAEDRSEIDELMILVSELDEQK
                     SKYKQKLCDLGVEISSDEEEEGSDDGTDED"
     gene            complement(<146974..>150297)
                     /gene="SMC6"
                     /locus_tag="KLMA_70076"
                     /db_xref="GeneID:34717837"
     mRNA            complement(<146974..>150297)
                     /gene="SMC6"
                     /locus_tag="KLMA_70076"
                     /product="structural maintenance of chromosomes protein 6"
                     /transcript_id="XM_022821320.1"
                     /db_xref="GeneID:34717837"
     CDS             complement(146974..150297)
                     /gene="SMC6"
                     /locus_tag="KLMA_70076"
                     /codon_start=1
                     /product="structural maintenance of chromosomes protein 6"
                     /protein_id="XP_022677693.1"
                     /db_xref="GeneID:34717837"
                     /translation="MPPKRPLEEDFNSDDEIHKLTRLTTESQQIAPRKRNFHDVQPMT
                     QYLSQSRDIAADSELATDEFTERAGYIKQIKLTNFMCHANFTLRLGPRLNFIVGNNGS
                     GKSAILTAITIGLGAKATTTNRGTSLKDLIKQGCNSSKIQIVLCNEGINSYEQHIYGK
                     EIRIERTLKREGTSGSFSIRSENNKEVSSKKRDLDAILDYFSIPVMNPMCFLSQDAAR
                     SFLTASSSQEKYLHFMKGTLLEETKQNLEAAEGSMLSSKTRLSLLEESVRHLHEDYKQ
                     AETLLNELVSKNDWISRRRLLQGKHMWVVYKSNREKARILEKKKNALQVKKQEYLDRI
                     SDTENKIERYLIQKEEAVKDVSFNLTERQKIEAERSSLQIEIDKYKRQHTQLKQQEKI
                     AQEDLQTSESAYANIISQIEAAESELRKKKGGDEESIRSQIDEIKLELSEIKDKMPKL
                     HEDQHTLDQEEGILTRERKKRINDLEKSITEMRQEYNELRSSEDKLAHAFDRRMPMVR
                     QMINRRINEFSSPPIGPIGYHVKVKSGYEDFAFLIQTHINSTLGAFVVNNSRDELLLK
                     KIFDACQLRKTPAVITHQLQSFDYSRGKATAGTTISDVLNYDMPELEYLLVDLNRIEK
                     TVLVKNKSEGDRILRHQRPRNLNLVLASRDNSSGLHMSLSGGSGMRLNVVTFANTLRI
                     KLGDDNDLSFLEKKITYQIRELKKMRADFTEKINKIRSEKKGIEGKLTELPRTQKKLS
                     RKLEELEDSLNGQTDTSRLEALKESLKEYEIQIQQLKANLASFDEKFGDLGLQLEPAK
                     QKYDDVTRRYQEAMAAYENSRNLEISISNKIDKCRAVILETQRKISVNNEKTQICEEE
                     LNHLLSKCDEQFQQANAFCTEAEIANGDLPEDESEILREIKRIDESVRASERQLGMTH
                     ENIIKLFESAKTKYEGAIEKYNELDDSLQKIYNALMLRRAALELSVKGTCTDADIDFR
                     TSMKTRSGYSGSLSFKVAGQLNVMVQTMNDTSPRNVDTLSGGEKSFSQIALLLATWLT
                     MRSRIIALDEFDVFMDQVNRKIGTDLIIRRLGKDVKSDTQTIIITPQDIGKMANIDEQ
                     FVNIHRIRNPERHVQTDNI"
     gene            <150777..>153425
                     /gene="NAM2"
                     /locus_tag="KLMA_70077"
                     /db_xref="GeneID:34717838"
     mRNA            <150777..>153425
                     /gene="NAM2"
                     /locus_tag="KLMA_70077"
                     /product="leucyl-tRNA synthetase"
                     /transcript_id="XM_022821321.1"
                     /db_xref="GeneID:34717838"
     CDS             150777..153425
                     /gene="NAM2"
                     /locus_tag="KLMA_70077"
                     /codon_start=1
                     /product="leucyl-tRNA synthetase"
                     /protein_id="XP_022677694.1"
                     /db_xref="GeneID:34717838"
                     /translation="MKLSSLNLTAIRYYASVGEVSSLTPNSKLLSINRKWNEKVIQGV
                     PKLTKDDRNKDIYILCMFPYPSGTLHIGHLRVYTISDVLNRFYQLKGYNVLHPMGWDA
                     FGLPAENAAIERGINPAVWTRNNIKKMKDQMKLMASNFNWDRELATCDPEYYKFTQKL
                     FLELFRHGYAYRKEAEINWDPVDQTVLANEQVDSQGRSWRSGAIVEKKLLSQWFLGIT
                     KFAHELQRDLDNLKDWPEHVKLMQKNWIGESTGAEIDFVLSSMDETVKVFTTRAETLY
                     SVQFVTLALDHPIVKTLKETNSSLNEFLKRAEKLPADSKEGYLLPKLSVYHPLIPKKQ
                     IPVFVAPYVLGNYGHGAVMGCPAHDQRDFDFWKTNCPEEPVLFTISNPNNSKNTDGPY
                     TSKDGVMNENAGSYAGMKTVEARENIIQQLAEAGRGRPSVQFKLRDWLISRQRYWGAP
                     IPIIHCKSCGPVPVPDEDLPVKLPETEVLSKNGNPLSKLDDFVNVPCPSCGSPAKRET
                     DTMDTFMDSSWYFFRFTDPHNASLPFSYEKASKHMPIDMYIGGVEHAILHLLYSRFIS
                     KFTASIGMWDGSKVNGEPIKKLVTQGMVHGKTFVDPKTGSFMKPEEIDNSDPNKPKNV
                     QTGEPLEVSYEKMSKSKFNGADPAQCISTHGIDATRAHILFQAPVSDVLNWDESKIVG
                     IERWLERMLKYCSTLCSQEITPIFNKTPIDLSQEEVDFHNNVQSLVNSITSSLEKTVS
                     LNTVISDYMKLSNSIENAIKSSSIRKGLVLLNLQKLTTMLYPVVPCVSEELASIIKTK
                     GYDFRQYSWPEVEEAKLSNIVKYQIIINGKRRAAYEGPEEFTKNIDKVLDTIRLLPET
                     KKYLDGVSVMKVITKGNIISLVVKPN"
     gene            complement(<153480..>155345)
                     /gene="CTF3"
                     /locus_tag="KLMA_70078"
                     /db_xref="GeneID:34717839"
     mRNA            complement(<153480..>155345)
                     /gene="CTF3"
                     /locus_tag="KLMA_70078"
                     /product="central kinetochore subunit CTF3"
                     /transcript_id="XM_022821322.1"
                     /db_xref="GeneID:34717839"
     CDS             complement(153480..155345)
                     /gene="CTF3"
                     /locus_tag="KLMA_70078"
                     /codon_start=1
                     /product="central kinetochore subunit CTF3"
                     /protein_id="XP_022677695.1"
                     /db_xref="GeneID:34717839"
                     /translation="MNGETAEDCVDFLINYAHSASEAELKGCINVLRNTAIADGLNNT
                     VILQLIDFLTTTDALGEDTKVFLLSHCLVPNELIKADCITHILNKLSTPTVFVPYKTV
                     PPPRLQVALVKWVCHIYPWVEETHFFKTSFSIWFELWKLDYLQKWITYIIIWSFDETH
                     ITKWRCKVLLNVGNNVGYANSRTHATYILGAFASLDSPLQDTIHDYISILHGNEKRLH
                     KLSEFEHDTELVSNIKTVFDRLGVIDSSLFEDIWAEFGNQCSFESRTDANILTIEQLV
                     DNWDRFSIPYDFSSVMTSKSNITWIKLASYGQNDPRVKGLEEFLKRSRNCRKLMKSTP
                     LLLIMFPELFHIRNLSSLNEQQQLLRNSDEIFEFQVSLCCTLFQTYNFENVGTQSSIH
                     ITICTTKLLGNLVQNQSEGLLVICSILLKCWTKLLHYEKYIILHAFADLSLEQVLAIN
                     ESLLTSDLCDFFAEAKDILTSKTLNENQLTDFNKCISFLVGYLWNYNIIDSNYKLLPN
                     EYWESLRSNQYLSHTSFPSKCLYSLPNFGIMSFVCHSLLFDKETTSKLTHYSNEFSEG
                     GFKLWIKTLNKNKKWFTNVSRYSSFRKQLLLLLKEDHKYTGIANFLFTYVKSLQE"
     gene            complement(<155700..>157046)
                     /gene="CSR1"
                     /locus_tag="KLMA_70079"
                     /db_xref="GeneID:34717840"
     mRNA            complement(<155700..>157046)
                     /gene="CSR1"
                     /locus_tag="KLMA_70079"
                     /product="phosphatidylinositol transfer protein CSR1"
                     /transcript_id="XM_022821323.1"
                     /db_xref="GeneID:34717840"
     CDS             complement(155700..157046)
                     /gene="CSR1"
                     /locus_tag="KLMA_70079"
                     /codon_start=1
                     /product="phosphatidylinositol transfer protein CSR1"
                     /protein_id="XP_022677696.1"
                     /db_xref="GeneID:34717840"
                     /translation="MSKPQSQPGRIDTLTPEEELKLKQVWAHLFHSWGIPVDSSKVLT
                     HSNASIRRSDSVSSSHSHATTASKKSSGGKLFGRFRKSSKHEKKEPTGQHHTRHSRTS
                     SVTSTRSRESIEAMYNPNMIHEALKGLKPEEIRSNLWEMLRTDYPDNLILRFLRARKW
                     DTDKTLSMLANSLHWRLKESHPDEIIKRGELGAYQDGKAGLVKNIELRKAVIHGYDKA
                     GHPLVYIRPRKHFSSDQTEQELELYSLLIIEQARLFLREPTDAATILFDLQGFTMSNM
                     DYAPVKYLISCFEAHYPECLGKLFIHKAPWIFPPIWNIIKNWLDPVVASKIVFTKSAK
                     DLAKYIPDEYIPKSLGGECTYDYDNYSKPDGSLDTKLDKKDELEVVMEERHSIVEKFI
                     QATVSWIEAGDKETSAKFLDAKIELSKELTRNYVKLDPYIRSRSFYDYEGTLKIEE"
     gene            <157789..>159651
                     /locus_tag="KLMA_70080"
                     /db_xref="GeneID:34717841"
     mRNA            <157789..>159651
                     /locus_tag="KLMA_70080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821324.1"
                     /db_xref="GeneID:34717841"
     CDS             157789..159651
                     /locus_tag="KLMA_70080"
                     /note="Putative uncharacterized protein YDL057W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677697.1"
                     /db_xref="GeneID:34717841"
                     /translation="MVVQSQITIKVADYPHKDVSPLLDHEDFVYIKDSKYHVKSGIAG
                     ILTKPESLKFKSFAEQVKNESTFSLPTHKLILVLHGDQAHKNSTFQPMLADKLSKLGY
                     YVLRIDFRGLGDSEDNFDPKIGRTIEQDVEDITSVYDFAQSDACEAWLGRTLTLDTII
                     AHSRGVLSMFEFARSHYVPNIINLCGRFDTGGLLQKVSKLHHEWEKDNGYWCNTLRYG
                     KWTDIWIPRNETLSAGSIDTSKFTEVDDETSILSVYCSNDTVIPITAAAEYSKLFQGR
                     HTLEIVPNSDHNFYGLPNDPNVFDLPIRKGKVNYSYYLMEILVPHLNQESQINRFCHS
                     HKLVRSRLNPGDLRDRWPLPFEFSHISNFRDIGGYKTKSSKQVRPGIMYRCANPDQAT
                     PEAIKYMKERLYVNKIFDLRALTEANEGGIISGFDVENLAFNNNMVLSPEEMAKHYEG
                     MFLSSHKFPKAYEIVLRNSFPSIRRFFEYVLQGEVDEKHSVVFHCTAGKDRTGLLAML
                     TLGIAGVDVDTIARDYELTTIGLRTETRLIEKINNRGDQFYVMLGPDGREKARMYGLD
                     PERMARHVLSSTYEAMRIFIDQFHQQYGSFNKFFINQLQFTQKEVDTIREYITI"
     gene            <160223..>162499
                     /gene="MBP1"
                     /locus_tag="KLMA_70081"
                     /db_xref="GeneID:34717842"
     mRNA            <160223..>162499
                     /gene="MBP1"
                     /locus_tag="KLMA_70081"
                     /product="transcription factor MBP1"
                     /transcript_id="XM_022821325.1"
                     /db_xref="GeneID:34717842"
     CDS             160223..162499
                     /gene="MBP1"
                     /locus_tag="KLMA_70081"
                     /codon_start=1
                     /product="transcription factor MBP1"
                     /protein_id="XP_022677698.1"
                     /db_xref="GeneID:34717842"
                     /translation="MSSDQIYSAKYSGVEVYEFIHPTGSIMKRKADNWVNATHILKAA
                     KFPKAKRTRILEKEVITDTHEKVQGGFGKYQGTWIPLELARKLAEKFEVLEELRPLFD
                     FTQQEGTASPPQAPKHHHASRTDSVRKRATKSASTTTSKVPEAKSSSQSSSQRQQQKQ
                     QQKAASASGSVSVPRRGRPPRNKPTVALQRSQSEMVFPKPSIPFSSIQGTKLPSLQPQ
                     LARSSTSLSPIVDVKSPLDQTSPQFKELDIEDGLSSDIEPNSLMAAKHEDSTHIMNSK
                     DEPVSSSSSLPSSPTEFSQSVPFSSRPNIQTPLQMNGTTSMNMILPKFPSSQNSQSDS
                     NQRANDYLTKLVNYFISNDLQNESETPVDLLNPPLHCSPFIDTWIDPEHHTAFHWACA
                     MGNLAIVEALLKAGASIRSVNNVGETPLIRSSIFHNCYTKRTYPQIFEILKDTVFDLD
                     AKSRNVIHRIVARKSHTPSAVYYLDVVLSKIKDFTPQYRIDVLINQQDSEGNSPLHYA
                     AMNKDNQFYQLLVKNGALTTIHNLNGMSPNGIINGKYSTEDISKGQRLDDPYDFNRMY
                     PSQAATTANRAIPDVINMMKEMSNSYQNLYQKRQNDAIQMERTVKSMNKTISSIENKL
                     MDTLHVKQLGDIDVVINQRRESIEELQTKISANKRTLMNTLESGQVKLIKKFVDEESK
                     EETENDENSESVHELLKDLVLLQLKRKRKITQIIDVITDNSKVYKYRKMISQGTDIDV
                     PDVDECLDVIYDTLSKES"
     gene            complement(<163121..>164206)
                     /gene="MPG1"
                     /locus_tag="KLMA_70082"
                     /db_xref="GeneID:34717843"
     mRNA            complement(<163121..>164206)
                     /gene="MPG1"
                     /locus_tag="KLMA_70082"
                     /product="mannose-1-phosphate guanyltransferase"
                     /transcript_id="XM_022821326.1"
                     /db_xref="GeneID:34717843"
     CDS             complement(163121..164206)
                     /gene="MPG1"
                     /locus_tag="KLMA_70082"
                     /codon_start=1
                     /product="mannose-1-phosphate guanyltransferase"
                     /protein_id="XP_022677699.1"
                     /db_xref="GeneID:34717843"
                     /translation="MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALAAA
                     GVTDIVLAVNYRPEVMVETLKKYEEEYGVSITFSVETEPLGTAGPLKLAEDVLKKDNS
                     PFFVLNSDVICDYPFKELADFHKAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRF
                     VEKPVEFVGNRINAGLYILNPEVIDLIELKPTSIEKETFPILVEEKSLYSFDLEGYWM
                     DVGQPKDFLSGTVLYLNSLSKRNPAKLAKGENIVGNVLVDPSAKISSTAKVGPDVVIG
                     PNVVIGDGVRITRSVVLSNSNIKDHALVKSTIIGWNSTVGKWARLEGVTVLGDDVEVK
                     DEIYINGGKVLPHKSISANVPKEAIIM"
     gene            complement(<166205..>168109)
                     /gene="FUI1"
                     /locus_tag="KLMA_70083"
                     /db_xref="GeneID:34717844"
     mRNA            complement(<166205..>168109)
                     /gene="FUI1"
                     /locus_tag="KLMA_70083"
                     /product="uridine permease"
                     /transcript_id="XM_022821327.1"
                     /db_xref="GeneID:34717844"
     CDS             complement(166205..168109)
                     /gene="FUI1"
                     /locus_tag="KLMA_70083"
                     /codon_start=1
                     /product="uridine permease"
                     /protein_id="XP_022677700.1"
                     /db_xref="GeneID:34717844"
                     /translation="MTDALAPKFEVFEKKSDADLESSVDNSEQFEKKGPQVETLVETD
                     SNDAETETKGKWLRFVDKAIKFLEVKQRTNLSSTSDHRAESFIESFLYNDDLRPVESK
                     RRVWDWKQYISFLVSGALNVNTLETCVIGLQLGLTWWQTWIMSSLGFTCVAVYVTLAA
                     RVGNMYHISFPITARVSFGIYFSIWIVINRVVMAVVWYGVQTYIGSQAVQIMLKSIFG
                     NDLEQKVHNTFNSPNVTTFQFMCFMLFWGAQLPALWFSPHTLRHLFVTKTVITPIALI
                     AFLIWVVKRSDGHLALGSLTSEPPSKSLLGWAYVRSMMAALDNFSTLILNTPDFTRFA
                     KTPRSSIYPQLLFIPVLYSVLGIIGIIIASAAFHIYHVNYWNPLDVLSRFLDHYTSGT
                     RAGAFFISTSFALAQLGTNVASNSISAGTDMTALFPKFINIRRGSYICAAISLAICPW
                     NLMATSSKFTTVLSAYAVFLSSVSGVIAADYYVVRKGVINLHHCYTNKLGTLYMYNRF
                     GTNWRAVVAYVIGMIPNFPGFVGSIGPHVPIGAMKLFYLNYFVGWGLSFLVYVGLCYY
                     SPVEGMPKDVKLFERVWLEKWAEVEHFNEERKELQENDYNVDSEFLTTTGAQLHDSVS
                     ETKESSTREF"
     gene            complement(<169911..>170474)
                     /gene="VPS25"
                     /locus_tag="KLMA_70084"
                     /db_xref="GeneID:34717845"
     mRNA            complement(<169911..>170474)
                     /gene="VPS25"
                     /locus_tag="KLMA_70084"
                     /product="vacuolar protein-sorting-associated protein 25"
                     /transcript_id="XM_022821328.1"
                     /db_xref="GeneID:34717845"
     CDS             complement(169911..170474)
                     /gene="VPS25"
                     /locus_tag="KLMA_70084"
                     /codon_start=1
                     /product="vacuolar protein-sorting-associated protein 25"
                     /protein_id="XP_022677701.1"
                     /db_xref="GeneID:34717845"
                     /translation="MSKSPKVPQIYKFPPLYTPQTNKLIRKQQLQTWESIILQICSQL
                     SKWCISKNGKIYDTNSGELIISLFENDEIQRSCSQEFQQEIWNYMLQNGTALQLKDSE
                     DSTLMAIFWESLDSWSSTILEWCESTGKLNQVITIYEICESDENINCKFYGMPSSFCL
                     LVLQRLVDRNRATLLKDQGKVVGVKIV"
     gene            <170756..>171247
                     /locus_tag="KLMA_70085"
                     /db_xref="GeneID:34717846"
     mRNA            <170756..>171247
                     /locus_tag="KLMA_70085"
                     /product="central kinetochore subunit MCM16"
                     /transcript_id="XM_022821330.1"
                     /db_xref="GeneID:34717846"
     CDS             170756..171247
                     /locus_tag="KLMA_70085"
                     /codon_start=1
                     /product="central kinetochore subunit MCM16"
                     /protein_id="XP_022677702.1"
                     /db_xref="GeneID:34717846"
                     /translation="MGETNDELEARYVAIYKELLFELDKLFLLENGSMMDAEMAEKSR
                     LRSMHQLNVSETAALLNMKDTNTSIKSHTDELLVNKLKRDQELRSSIEGHFSLIQEWL
                     YEAKKTQRLREKLVNISSSIPEREEDSMVDLKATQTLEILESIYSVLVVHGGYLDVAF
                     NEE"
     gene            <171749..>173485
                     /gene="URA7"
                     /locus_tag="KLMA_70086"
                     /db_xref="GeneID:34717847"
     mRNA            <171749..>173485
                     /gene="URA7"
                     /locus_tag="KLMA_70086"
                     /product="CTP synthase"
                     /transcript_id="XM_022821331.1"
                     /db_xref="GeneID:34717847"
     CDS             171749..173485
                     /gene="URA7"
                     /locus_tag="KLMA_70086"
                     /codon_start=1
                     /product="CTP synthase"
                     /protein_id="XP_022677703.1"
                     /db_xref="GeneID:34717847"
                     /translation="MKYVVVSGGVISGIGKGVLASSTGMLLKTLGLKVTSIKIDPYMN
                     LDAGTMSPLEHGECFVLNDGGETDLDLGNYERYLNVTLTRDHNITTGKVYSHVIAKER
                     KGDYLGKTVQVVPHLTNEIQEWIERVSRIPVDNTGLEPDVCIIELGGTVGDIESAPFV
                     EALRQFQFRVGRENFALIHVSLVPVIHGEQKTKPTQAAIKDLRSLGLTPDMIACRCTE
                     KLDTPTIEKIAMFCHVGPEQVVNVHDVNSTYHVPLLLLEQNMIHNLAERLHLSTIELS
                     SEDKQRGQDLLQRWKDLTVNIDESFETVKIALVGKYTNLKDSYLSVIKALEHSAMRCK
                     RKLEIVWVEASDLEPETSENAEHKSKFHHAWNCISVADGILVPGGFGNRGTEGMVLAA
                     KWARENNIPYLGVCLGLQIATIEFVRNVLGNKNATSAEFFPEAEEEDQVVVYMPEIDK
                     EHMGGTMRLGLRPTIFEPNTEASKIRKLYGGATQVEERHRHRYEINPKLVKSLEENGL
                     KFVGRDESGQRCEILELDNHPFFVATQYHPEYMSKVLDPSTPFLGLVAASAGILNETI
                     AASAANTGKADF"
     gene            complement(<173939..>174403)
                     /gene="SOD1"
                     /locus_tag="KLMA_70087"
                     /db_xref="GeneID:34717848"
     mRNA            complement(<173939..>174403)
                     /gene="SOD1"
                     /locus_tag="KLMA_70087"
                     /product="superoxide dismutase [Cu-Zn]"
                     /transcript_id="XM_022821332.1"
                     /db_xref="GeneID:34717848"
     CDS             complement(173939..174403)
                     /gene="SOD1"
                     /locus_tag="KLMA_70087"
                     /codon_start=1
                     /product="superoxide dismutase [Cu-Zn]"
                     /protein_id="XP_022677704.1"
                     /db_xref="GeneID:34717848"
                     /translation="MVKAIAVLKGDSNVSGIVRFEQESEDQSTKISWEITGNDANALR
                     GFHIHEFGDNSNGCTSAGPHFNPYKKTHGAPSDETRHVGDLGNISTDAQGVAKGSVTD
                     KHVKLLGPLSVIGRTVVVHGGQDDLGKGGNEESLKTGNAGGRVACGVIGISN"
     gene            complement(<175186..>175413)
                     /locus_tag="KLMA_70089"
                     /db_xref="GeneID:34717849"
     mRNA            complement(<175186..>175413)
                     /locus_tag="KLMA_70089"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022821333.1"
                     /db_xref="GeneID:34717849"
     CDS             complement(175186..175413)
                     /locus_tag="KLMA_70089"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022677705.1"
                     /db_xref="GeneID:34717849"
                     /translation="MAFFHHNPVFDFFHRVMRKPSSIVMWLFSGLIVASTLATIWSLP
                     AVPDSSKSTSRESSSDSKSKSKDALPHSKKT"
     gene            <175668..>176804
                     /locus_tag="KLMA_70090"
                     /db_xref="GeneID:34717850"
     mRNA            <175668..>176804
                     /locus_tag="KLMA_70090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821334.1"
                     /db_xref="GeneID:34717850"
     CDS             175668..176804
                     /locus_tag="KLMA_70090"
                     /note="PDI_a_family[cd02961], TRX_family[cd02947]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677706.1"
                     /db_xref="GeneID:34717850"
                     /translation="MLLWLVWFETLWWLALGARIFEVHDTDEFYDAVLYGYSNADANG
                     NANGNAGSAGALSPKSTLLYVYKPGCRYCAALEPKLDYLTDMFPNEEAVQFVKINGVQ
                     ASQLEIDLNVRSFPQLFLFKPKSPSGAIKSVDGTDSRHTVHHYYTLSRFQGERTIERL
                     AQWVSKTVGEMIHWPESRVNYDIVDMESFRNTLPQDAVDTVFPSPEAETTLGNASAVC
                     LAFINPWIDLYYQDMFNGDIEALILEKLSKAWPQVKFYVLDTSTPELSPLFRQLQISH
                     APTISFIYDGKILYTQLLPMDRNSNSKEEQYLADIISTCVVGAQEEEKQCEDLIRSLD
                     YADFFKPSSPLADDANDPESDLRSSDEEDENELDEDLPFDIYDL"
     gene            <177156..>178030
                     /gene="ERD2"
                     /locus_tag="KLMA_70091"
                     /db_xref="GeneID:34717851"
     mRNA            join(<177156..177180,177396..>178030)
                     /gene="ERD2"
                     /locus_tag="KLMA_70091"
                     /product="ER lumen protein retaining receptor"
                     /transcript_id="XM_022821335.1"
                     /db_xref="GeneID:34717851"
     CDS             join(177156..177180,177396..178030)
                     /gene="ERD2"
                     /locus_tag="KLMA_70091"
                     /codon_start=1
                     /product="ER lumen protein retaining receptor"
                     /protein_id="XP_022677707.1"
                     /db_xref="GeneID:34717851"
                     /translation="MLNIFRIAGDLSHLASIIILIQSIKTSNSVDGISMKTQFLYTLV
                     FITRYLNIFTRWTSLYNFLMKIFFVSSSIYVIVLMRQQKYKNPVAYQDMITRDVFKIK
                     FLIIPCAVLAFLFNYGYNPVQLCWSFSLWLESVAILPQLFMLTKTGKAKQLTSHYIFA
                     LGLYRTLYIPNWVWRYYAEGRFDKLSIFTGIIQTLIYSDFFYIYYQKVIKLGGDFELP
                     Q"
     gene            complement(<178192..>178914)
                     /gene="PRE7"
                     /locus_tag="KLMA_70092"
                     /db_xref="GeneID:34717852"
     mRNA            complement(<178192..>178914)
                     /gene="PRE7"
                     /locus_tag="KLMA_70092"
                     /product="proteasome component C5"
                     /transcript_id="XM_022821336.1"
                     /db_xref="GeneID:34717852"
     CDS             complement(178192..178914)
                     /gene="PRE7"
                     /locus_tag="KLMA_70092"
                     /codon_start=1
                     /product="proteasome component C5"
                     /protein_id="XP_022677708.1"
                     /db_xref="GeneID:34717852"
                     /translation="MATIASEYGNEASNTPIQHQFNPYSDNGGTILGIAGEDFAVLAG
                     DTRHTTDYSINSRYEPKVFQCEDDILISANGFAADGEALVKRFKNSLKWYHFNHNKKL
                     SLKSAARNIQHLLYGKRMFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGSA
                     ASLIMPFLDNQVNFKNQYEPDSNGTKRKEVKYLSVDEVIKLVRDAFTSATERHINVGD
                     GLEIFIVTKDGVRKEYYDLKRD"
     gene            complement(<179266..>180675)
                     /gene="CPS1"
                     /locus_tag="KLMA_70093"
                     /db_xref="GeneID:34717853"
     mRNA            complement(<179266..>180675)
                     /gene="CPS1"
                     /locus_tag="KLMA_70093"
                     /product="carboxypeptidase S"
                     /transcript_id="XM_022821337.1"
                     /db_xref="GeneID:34717853"
     CDS             complement(179266..180675)
                     /gene="CPS1"
                     /locus_tag="KLMA_70093"
                     /codon_start=1
                     /product="carboxypeptidase S"
                     /protein_id="XP_022677709.1"
                     /db_xref="GeneID:34717853"
                     /translation="MYKPFYTLHEQLEADFPLIWSKLQVEKVNELALLITWKGSDESL
                     KPLLFASHLDVVPVERQTWDEWKHPPFSADIEYDPEDYLKSTVWGRGSFDDKNMLIGE
                     LQAVELLLSKGFEPKRGIIIAVGSDEEASGFFGAQKINEVLLERYGEGGIYAIVDEGL
                     NGIQVKEGVHIASPGTGEKGFINFWIHLTTPGGHSSVPPDHTSIGIVSGLLKKIESQK
                     FPVLFTEKNPVSQWYQCVAQYSPDMDNELRFDFLNAMNDEESNAHVISYLLETGGKKV
                     EYLLRTSQAIDIIDGGFKANALPETVSVLINSRVALESTVNETMAKFINQIKETCAEF
                     DLGLEYNGLEIIEKTEYGSFSVEIDVGRDPIPSSPNNDVWKHFAGSIKSFYEDVVFPA
                     RFENPPNELVIAPTIMSGNTDCMNYLSLTDNIYRFQPGFISPDTIGTIHSVNEHVDFE
                     TVMNSVAFVYHYIEAVQLV"
     gene            complement(<181802..>182539)
                     /locus_tag="KLMA_70094"
                     /db_xref="GeneID:34717854"
     mRNA            complement(<181802..>182539)
                     /locus_tag="KLMA_70094"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821338.1"
                     /db_xref="GeneID:34717854"
     CDS             complement(181802..182539)
                     /locus_tag="KLMA_70094"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677710.1"
                     /db_xref="GeneID:34717854"
                     /translation="MTTIMSLSQQYILASRAKRKLLSAANQSGGKDHELRVLVGHANL
                     LDRLSESISKFDSLLSRNSYEESHVIHEEEEDEEFYEDGEDEYSSSSDSEDEDTQPLV
                     SSKISSLSPYNRVRDAHSSSGKDAPESEQDSAVSSSSDEEESTSDSDYDESNARSRYL
                     ATLQDMQDESEDEEPNYILSTHPILYKCPSQNLTLSSVSLNLTSGTSNDLLHNDESRV
                     TTLVLSDDESENELEEDLGTLSPVYVL"
     gene            <184465..>185802
                     /gene="COR1"
                     /locus_tag="KLMA_70095"
                     /db_xref="GeneID:34717855"
     mRNA            <184465..>185802
                     /gene="COR1"
                     /locus_tag="KLMA_70095"
                     /product="cytochrome b-c1 complex subunit 1"
                     /transcript_id="XM_022821339.1"
                     /db_xref="GeneID:34717855"
     CDS             184465..185802
                     /gene="COR1"
                     /locus_tag="KLMA_70095"
                     /codon_start=1
                     /product="cytochrome b-c1 complex subunit 1"
                     /protein_id="XP_022677711.1"
                     /db_xref="GeneID:34717855"
                     /translation="MLRTTVRSSFLKRTIATQIAPKSIVTELSNGVVVATEPNPSSAT
                     AAVGVVFGSGATAENPYNNGVSNLLTNAFVASSVKEAHKLGFSLDTKVDRDYQSYIVN
                     SQPGQYAKALDFLQSKLLNPVSDAVFESTKASTLASVAKFEETEHEERVFEHLHATAF
                     QNTPLSLPVRGTVESLEGLENIDLTNFAQSHFKSSNAVIVGTGNVNHDELVKAVETKV
                     SLLSGEKPVQKKKSSFLGSEVRLRDDTLPKAWISIAAEGESLSSPNYYVAQVAAQVFG
                     SFNAAEPASNLQGVKLIDEVNEYHICDSFDHFSVSYKDSGLWGFRTTISDPHNIDETV
                     HFTLKQWNRLTISVTETEVARAKAQLKLKLASQATTNAAAANLLGAHTLAIGAKTGLS
                     EAFAKIDKISTKDVKAWASERLWDQDIAVAGTGKIEDLLDYVRMRNDMSMMRW"
     gene            complement(<186780..>187940)
                     /gene="PSY4"
                     /locus_tag="KLMA_70096"
                     /db_xref="GeneID:34717856"
     mRNA            complement(<186780..>187940)
                     /gene="PSY4"
                     /locus_tag="KLMA_70096"
                     /product="serine/threonine-protein phosphatase 4
                     regulatory subunit 2"
                     /transcript_id="XM_022821341.1"
                     /db_xref="GeneID:34717856"
     CDS             complement(186780..187940)
                     /gene="PSY4"
                     /locus_tag="KLMA_70096"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 4
                     regulatory subunit 2"
                     /protein_id="XP_022677712.1"
                     /db_xref="GeneID:34717856"
                     /translation="MMGIRSKQLYDRLSTIVIDKDLSIFNEIPSSEFLPELCMHFSET
                     IPKDIFEYEEDSHEDLLCRLKELSEYLEAKFAKRDKYPFTIQRICELSYHPLEYFRVD
                     ALGKFVSALEKCCFVNTDWTLKLGEVSPNTDPLEDVSLVPIDWPETSKEGSQSLGNLL
                     AKIEAIVAVNFGFDDFEDEDEDDGEDEDGDGNARHSYGNNKRDVLIERYEEFDDDDYE
                     HDDEEYNDEESTSSDSSDDDDDKEGGEEQSHDQGKKNEEVGTYSIEFSKSIDGVQTES
                     SSIEDVIEDDNESVLSRKRNVTELDDYQYNEVKEGTRLITTPKKSKVPANELGSDVVS
                     PVVSNQENATTTSTNDAARINELGSPETSTSEVTQSEKNELSTSPLHDRTRS"
     gene            <188573..>189421
                     /gene="RSM7"
                     /locus_tag="KLMA_70097"
                     /db_xref="GeneID:34717857"
     mRNA            <188573..>189421
                     /gene="RSM7"
                     /locus_tag="KLMA_70097"
                     /product="37S ribosomal protein S7"
                     /transcript_id="XM_022821342.1"
                     /db_xref="GeneID:34717857"
     CDS             188573..189421
                     /gene="RSM7"
                     /locus_tag="KLMA_70097"
                     /codon_start=1
                     /product="37S ribosomal protein S7"
                     /protein_id="XP_022677713.1"
                     /db_xref="GeneID:34717857"
                     /translation="MLRTGRSGLRYVQSYGLVNALGNRVAGRVGSMSLRPIAPVQVRM
                     QSQGGNVESNISQTEQASAQEQEQYRLSDEQVDEWMNAIRNLEEEFSQGEYNPATSLA
                     PENQSRVNILEKAMELNKPKFEPTAEQVEEWERLKTVPIPKREDKTLQHVTNMIMRHG
                     KKERAQKILSRALYIVFCQTRKDPVKVLKESLDVLAPLMLVKTFKTGVAKATVVPVPL
                     NQRQRFRVAWKWIVESSAKRSSSDFAVRLGEELVAVYKGNSSGFEKRDSIHKTAIAHR
                     AYINLK"
     gene            complement(<189568..>190023)
                     /locus_tag="KLMA_70098"
                     /db_xref="GeneID:34717858"
     mRNA            complement(<189568..>190023)
                     /locus_tag="KLMA_70098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821343.1"
                     /db_xref="GeneID:34717858"
     CDS             complement(189568..190023)
                     /locus_tag="KLMA_70098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677714.1"
                     /db_xref="GeneID:34717858"
                     /translation="MFRKKYGVAFCLFSVVVLFLGLTTNSKLAVITSSHDKAAHFIAF
                     GAETMLFVAMFEPQYIDLRELASKLHILGKWVPETVSDRLREAFLDRDASISKYVLAF
                     VVCCLGASTLSEFAQFFLSGGKRSFDVFDMLCNAAGSTVGLLAAYKMEH"
     gene            <190544..>194338
                     /gene="EDE1"
                     /locus_tag="KLMA_70099"
                     /db_xref="GeneID:34717859"
     mRNA            <190544..>194338
                     /gene="EDE1"
                     /locus_tag="KLMA_70099"
                     /product="EH domain-containing and endocytosis protein 1"
                     /transcript_id="XM_022821344.1"
                     /db_xref="GeneID:34717859"
     CDS             190544..194338
                     /gene="EDE1"
                     /locus_tag="KLMA_70099"
                     /codon_start=1
                     /product="EH domain-containing and endocytosis protein 1"
                     /protein_id="XP_022677715.1"
                     /db_xref="GeneID:34717859"
                     /translation="MSGIAFRVPLTGEEKQAFSQHFTRLDDEQLGIVTGEALRPLFSQ
                     SGLTAQQLSQIWTICDTENAGFLKEDQFYAAMRMIAHLQQNPSAPITLELYQTPASKL
                     PVFNQQAGVQSSGAGTGAAPPATVQRNGSVMNRSVSKTNTGSPSTYAVIPVCTPHDYA
                     KFSQLFDRSTDGSGVLAGNKAREIFIKAKLPTQTLGAIWGLCDRNNSGSLDKIEFVMA
                     MHLIQLTLQQNPAVQNLPSVLPNYLWNSLTSTASSSMTPLSANNTGFSFSSGNGSVVR
                     HSSIARKPSLSRLPSGTFSNAAVDWTLTPEKKQQFDAIFDSLDKEKKGSLGSNVLVPF
                     FLTSKLGQDVLATVWDLADIHNSPVFTKVEFAIAMFLIQKKNAGIDLPDVVPDQLLHS
                     PALGLYQNNQQQQQQQPAPRSPIALPKSNEAAPAYQNLPAPVQVQKTSSSALDDLLGL
                     NESFTPPPQQAQLQSQPQSPPPPPAHAPSNMRKFRPTSTFGQTMIPEESNPSQEPEQQ
                     QQQQQFAQSNFSRSTNAPPPPPSKRNSSLPNVPNFTGTIGSSGSSAAASTPGTVGTNR
                     SIIPNVSSSAPPSSLSQATTELANLSTQVSSLTTQATKVHGEKTAAQNELTRITNMKA
                     SIESKLVTLRASYDAEVRQTEEIQTQLNSLRQENESLKQQTAVAEANYHAAQAQNEDL
                     QRQLQEAQEEDRQLKERLAQFNTLTAELQEKLSQTQENVKVEKSRVDVHAKQLEVAEV
                     TSSNLQEEIQALEQTLGVYLSKHKELNDYKATIEAQHAEMQNKHQAYLAKSEEIQARE
                     AEVQARTAEVEKQEQLYREQVAQLQQMFDDLQKKKAEFDAVNSDFEKQQYDYADRVQK
                     FSESQMKFAMGEIPDDEYTNELLQQKKSTAQSTEGGDDEEKQESVFDKDVPTPVSQTE
                     PDDEERNQQLQNGELHEDQQANQQGTEDEVAAEAMADSFEGSLNEYGIPRTGSTTSST
                     ANNPPQSVRDEVDSEPKENALPDIDQQLEDEDEDDNVESGEKEEKKEDAPKAISNEQL
                     PGGWSTGSTLEKEEASHSNPDSGSGSDSDSIKKTPVLGPQDKSASSVGKDSNQLPQIQ
                     NLTLDNDELSSSDEDEQERFESPEKNVPSKTDTPEFVNQFEHISHQDLDDNVFHDASS
                     VRPFSTAESTNAPVGNDEWDEIFSGLGNNTNTSRSVGNGGAAPSAPPVHLQHPMPSTG
                     SVPTSGSSKPPIDRGIAVTPKSLAIEELSSMGFSKEEATKALEKCDWDLDDATNLLLD
                     GA"
     gene            complement(<194434..>195045)
                     /gene="NNF1"
                     /locus_tag="KLMA_70100"
                     /db_xref="GeneID:34717860"
     mRNA            complement(<194434..>195045)
                     /gene="NNF1"
                     /locus_tag="KLMA_70100"
                     /product="kinetochore-associated protein NNF1"
                     /transcript_id="XM_022821345.1"
                     /db_xref="GeneID:34717860"
     CDS             complement(194434..195045)
                     /gene="NNF1"
                     /locus_tag="KLMA_70100"
                     /codon_start=1
                     /product="kinetochore-associated protein NNF1"
                     /protein_id="XP_022677716.1"
                     /db_xref="GeneID:34717860"
                     /translation="MSISQNGNNVDHVRFQRLVQVCNKALEESIKQLESWEKIQDCFP
                     EYCQTREGSENLSVCQQQVSKLWANLSRVEFDAIFHERNIEEKLNQLDELIDKAKRRN
                     ISSTGTNNLRRMDELMPSELIDGNLQSAKLSTLEKLEERLVSIKNMNSTLESELKDLN
                     DKVFEELDKLQQIYDDTLKDEVSVPDDVIKQAVIDMIIETRQD"
     gene            <195297..>196169
                     /locus_tag="KLMA_70101"
                     /db_xref="GeneID:34717861"
     mRNA            <195297..>196169
                     /locus_tag="KLMA_70101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821346.1"
                     /db_xref="GeneID:34717861"
     CDS             195297..196169
                     /locus_tag="KLMA_70101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677717.1"
                     /db_xref="GeneID:34717861"
                     /translation="MLLTAQRLVAISKWNGSFSLTNYLIAATALSVSNEYKEIPKVYH
                     LAMMMSEEPNNDDESLNRTVNTVLSMYEKELQDTNSLIFERKHHMPTGERSNIFESMY
                     EVPSERQRKLTKQFREALLKTIPLAGIPKAINSLLLLSSVTPASLTPSYQSVPRSGTT
                     PQELFPDIVRTINSENHVDRGMAHWNHLYGKVSGRVINKLNRAYPDLWYSVMAHGYGP
                     VLSFSDILDARETSLIIIASLVPQDVNIQLWGHLKGALNLGCTEEDIENARSLSIEVA
                     RWCGVKWKGDVVKL"
     gene            complement(<196468..>198381)
                     /gene="YMR1"
                     /locus_tag="KLMA_70102"
                     /db_xref="GeneID:34717862"
     mRNA            complement(<196468..>198381)
                     /gene="YMR1"
                     /locus_tag="KLMA_70102"
                     /product="phosphoinositide 3-phosphatase"
                     /transcript_id="XM_022821347.1"
                     /db_xref="GeneID:34717862"
     CDS             complement(196468..198381)
                     /gene="YMR1"
                     /locus_tag="KLMA_70102"
                     /codon_start=1
                     /product="phosphoinositide 3-phosphatase"
                     /protein_id="XP_022677718.1"
                     /db_xref="GeneID:34717862"
                     /translation="MDYIKVARVDNVIWHKRGISLKGSIHLTTHHLIFTDDNSSREFW
                     VAYPTIASVFRNKGSSLVSKYKHRSEWEKEELYAGKDIWMFYNIKVITKDYNIFSLDL
                     DNEKNAQDVFDSLSKLTVLDDVHKLYAFIYSPNKAETPFNSWNIYDPEKEFERQGIQF
                     YEGTGDAPANVKWRISTINEDYSFCKTYPNKLVVPKTVSDTLLSYSVKYRSQQRIPVL
                     TYYYAKNGTSISRCAQPLPGITQQRSIQDEKLIKEIFQCATYRTNKNIIVDARPTTNA
                     MAQTALGGGTENMDNYGFNDTCSRMFLGIDNIHVMRDSLNSLVDNYLVDNDLYLPIDK
                     NMLNSDKSNSWLRYIKLLLSSTDTLVKSMVFNHSNILVHCSDGWDRTAQITSLVQLSL
                     DPYYRTMDGFMVLVEKDWLSFGHRFCERSGHLSSPSIFHDHSSRLSISLGTESLTLND
                     KRENELGDFAAMTSVADHLPTASKLKKSRNGTNMKLTSPVFQQFLDCVHQLLIQYPNR
                     FEFNERFLRRLVYHLYSCQYGTFLFNNEHERVVNQAHKLTRSVWDYFKSRRNEFTNPN
                     YNTSTDTEEEWILPDWEKVEWWWQLFGRRNEEMNGPCTNNGSCDTAAAKKSTNIVSNL
                     KIPKFSLEMFSKR"
     gene            complement(<199253..>199627)
                     /gene="MOH1"
                     /locus_tag="KLMA_70103"
                     /db_xref="GeneID:34717863"
     mRNA            complement(<199253..>199627)
                     /gene="MOH1"
                     /locus_tag="KLMA_70103"
                     /product="protein yippee-like MOH1"
                     /transcript_id="XM_022821348.1"
                     /db_xref="GeneID:34717863"
     CDS             complement(199253..199627)
                     /gene="MOH1"
                     /locus_tag="KLMA_70103"
                     /codon_start=1
                     /product="protein yippee-like MOH1"
                     /protein_id="XP_022677719.1"
                     /db_xref="GeneID:34717863"
                     /translation="MGISCCVYIEKPSTEDICLKHKHERFVIYGCRNCRTHLSSSTQL
                     MSKDYRGKTGDAYLMNEVVNVFEGERQTRYMITGKYVVCDIFCSTCGALVGWRYLKSE
                     KSNQQYKEGKYILELLPITQCR"
     gene            complement(<200946..>203099)
                     /gene="CFL1"
                     /locus_tag="KLMA_70104"
                     /db_xref="GeneID:34717864"
     mRNA            complement(<200946..>203099)
                     /gene="CFL1"
                     /locus_tag="KLMA_70104"
                     /product="ferric reductase transmembrane component 3"
                     /transcript_id="XM_022821349.1"
                     /db_xref="GeneID:34717864"
     CDS             complement(200946..203099)
                     /gene="CFL1"
                     /locus_tag="KLMA_70104"
                     /codon_start=1
                     /product="ferric reductase transmembrane component 3"
                     /protein_id="XP_022677720.1"
                     /db_xref="GeneID:34717864"
                     /translation="MKLLQLPTLLALLITFFARFSAAADFDKIFRDRPPVEKITTSCH
                     QAIIALATFCLNPRDTTCVCRNDAYAGSYFNCVFDQIKDDTTKAAFFGMMEGMCHFNE
                     TYVLDTYHNATAHMVNVSTVPNYNRTIPITYPIYYSPLIYVANFKSMENFFNSYHHSF
                     YYGGTLTGYLVGIFFFGGIIHWFGVLFPKKTASIKRLFLKARSVRLFKKHVVVPSLFN
                     GTHAAPAPITGGFYPTRGHSVLIGGYFIMWIVFLCISYRSHVVGDVVYSTRSIYLSRV
                     IADRAGIICVYLIIMTFLLAGRNNLFIWWTGWKQSTFFAYHKAVARTCVLSAVIHACC
                     YVHYYKLTHGYSVYAVKQTFWKYGSVAVVAGGIMLLQANGKLRALNYEVFLYLHIMLA
                     IAFMVGAWHHVKDFDFTIFVYFATAFWAFDRFVRVVRILSFGVKTAQVRLVHDEVLVV
                     TMPRNKFWPVYPGAFGYIYFMKTSLFWQSHPFSVVESEDGKSINLYIKIKKGATSIIM
                     KQMQKQGCDSMEMKVLFEGPYGSEHKLDHYDHVMVYSSGNGIPGVYPYIIKLLKAPGS
                     EKKTIKFNWIIQTRKAVDWFRDELAALQRFSNVEVVIHVTRHNKPTNAFESSDNEKNI
                     GNGQEPLMVELTDSSNISDDYVVKEMSNIDFKYERPCVDFIVREDLSCVPTGDVAVLS
                     CCHGSICDAVRAATADLCGSRSAGTLDYIEELQAW"
     gene            complement(<205458..>207413)
                     /gene="CFL1"
                     /locus_tag="KLMA_70105"
                     /db_xref="GeneID:34717865"
     mRNA            complement(join(<205458..207346,207407..>207413))
                     /gene="CFL1"
                     /locus_tag="KLMA_70105"
                     /product="probable ferric reductase transmembrane
                     component"
                     /transcript_id="XM_022821350.1"
                     /db_xref="GeneID:34717865"
     CDS             complement(join(205458..207346,207407..207413))
                     /gene="CFL1"
                     /locus_tag="KLMA_70105"
                     /codon_start=1
                     /product="probable ferric reductase transmembrane
                     component"
                     /protein_id="XP_022677721.1"
                     /db_xref="GeneID:34717865"
                     /translation="MDRFEHQVLEACPKFTAADLKEKYENATHYIQSPKEIPGFNKTK
                     PVHVPVIYNKVKYGYALKTYKARYHNEDDAMAMGGALIGYWGVIILIGTVLNIFEKLF
                     PKQWLAAHRSFSNNMLVKLMRKYFFMPALIGKKHTERNFFLGVVPTRVQSVVVFVFSS
                     LVIIFSAVRIHYMENNITWPRKKIQLTRYVGDRTGIISCFLIPLTYFMAGRNNFFAFM
                     TGWKQSTFLIYHKWVARATVLCSVAHSIAYYLNSMWFKKMKTRKLTIWYRMGTLATIA
                     FAVMFCISIGWVRTHHYELFLNAHICLAIISIAGLYYHLRQFDLNQYTYAAIAIWGFD
                     RVVRVVRLFSFGAKKATITVVNNEMLHVTVPKPAHWPTFPGAFGFVYFLNSSCFWQSH
                     PFTIVSSKSNTEINFYIKIKNGVTHTIYKKLLDKPGMTGTFTVSVEGPYGNGRRLEAF
                     DDVVMISSSNGIASNFSYARQLSEIHKKTGNKTFVKFYWIVRHWHSLDWFLNELKEMK
                     DFDNVEPIIYVTKYHEGKVGEKLLASSGSDSSDADEKNSVKVSDAEYNWLESIKNALP
                     HIEFRDGRPDFEQIVKSDLSEFNGQNVAVLTCAHNALSDDIRYTVANEIPNHDGRIDL
                     FEEIQVW"
     gene            complement(<209655..>210747)
                     /gene="SEC17"
                     /locus_tag="KLMA_70106"
                     /db_xref="GeneID:34717866"
     mRNA            complement(join(<209655..210503,210718..>210747))
                     /gene="SEC17"
                     /locus_tag="KLMA_70106"
                     /product="vesicular-fusion protein SEC17"
                     /transcript_id="XM_022821352.1"
                     /db_xref="GeneID:34717866"
     CDS             complement(join(209655..210503,210718..210747))
                     /gene="SEC17"
                     /locus_tag="KLMA_70106"
                     /codon_start=1
                     /product="vesicular-fusion protein SEC17"
                     /protein_id="XP_022677722.1"
                     /db_xref="GeneID:34717866"
                     /translation="MSEVQELIAKAEKKAKPSSGFFSFLGGSDSYRYEEAADLYVEAA
                     NLYRLRKELDQAGETFLKAAECQIKASNEDEAGNTFIEAYKCFKTGSSPAKAAESLSK
                     SIDIFTRRGQFRRGANFKFELAELQEQQLQDYPSAISNYETAGDWYLQDQAVALSNKS
                     YLRCADLKALNGEYLDATEILKKVVENSLGNKLSQWSLKEYLLKIGLCYLAAGDVVAA
                     DKSLNESQSLDPSFSQSREYELLSNVIDAVREGDSEKLSQKIYEYDKFNKLDHWKVTI
                     LLKVKNTIVEADDDLL"
     gene            <214046..>215074
                     /locus_tag="KLMA_70107"
                     /db_xref="GeneID:34717867"
     mRNA            <214046..>215074
                     /locus_tag="KLMA_70107"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821353.1"
                     /db_xref="GeneID:34717867"
     CDS             214046..215074
                     /locus_tag="KLMA_70107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677723.1"
                     /db_xref="GeneID:34717867"
                     /translation="MMLACDSEIDVSSYLQLDGLQECGVNMEWHGELELSDCEERLEG
                     GILEHVIRTPEDRHIGRSNDYYNGIHHQEQVDYGHSYSSSSSIDSFNCCGDNREFSWC
                     KDQQQEQNQQRHFSRGTDNSGATTATTATTAGDEKYFGRLLPAQMINMVHTQPVHLIH
                     VHNLKALQTSFEDEEAAANVAALEAAAEAAEAAIIERSAAANASSTPPSLADTRNNSV
                     FSSTRSINNLLQDQQDMENDIKLMPPTKKRSLVAPIMFHAGKSQVTANTNNTHNKIKH
                     HNEPQKLKPNCKNTTKPVSEKDQFVYTLTNKLLPYFGYFLADSNDLEYFDKVRFQEID
                     YKFSKTYF"
     gene            <216378..>217235
                     /gene="FIP1"
                     /locus_tag="KLMA_70108"
                     /db_xref="GeneID:34717868"
     mRNA            <216378..>217235
                     /gene="FIP1"
                     /locus_tag="KLMA_70108"
                     /product="pre-mRNA polyadenylation factor FIP1"
                     /transcript_id="XM_022821354.1"
                     /db_xref="GeneID:34717868"
     CDS             216378..217235
                     /gene="FIP1"
                     /locus_tag="KLMA_70108"
                     /codon_start=1
                     /product="pre-mRNA polyadenylation factor FIP1"
                     /protein_id="XP_022677724.1"
                     /db_xref="GeneID:34717868"
                     /translation="MSSEDEDEKFLYSDGEDSQVVVSTEEPASKKQKVDTHNDVETAA
                     NDSANEGVSEVSDQDSDSVSDESDSDSDIEIIIGTGNDTSKIDSGKSKISTITGAAST
                     TTTESNIGAVSDTNAATSVPEGSVSLEQQQQQTIDLNPDAEFDGKPIVQIDPEILKEK
                     PWRQPGANLSDYFNYGFNEQTWMEYLHRQEHLKKEYNPQKILMNLLALQQQGKLNDNG
                     SVPNSQNNPMAMPPPPMGLSPMFGGFPGFPFPGMMNSMQTQNVPNMNNNNNNNNNSNN
                     KINGNHNDK"
     gene            complement(<217443..>221057)
                     /gene="BUD4"
                     /locus_tag="KLMA_70109"
                     /db_xref="GeneID:34717869"
     mRNA            complement(<217443..>221057)
                     /gene="BUD4"
                     /locus_tag="KLMA_70109"
                     /product="bud site selection protein 4"
                     /transcript_id="XM_022821355.1"
                     /db_xref="GeneID:34717869"
     CDS             complement(217443..221057)
                     /gene="BUD4"
                     /locus_tag="KLMA_70109"
                     /codon_start=1
                     /product="bud site selection protein 4"
                     /protein_id="XP_022677725.1"
                     /db_xref="GeneID:34717869"
                     /translation="MAQQSDLEKSDAMDSLLKEIDQGITHTDVSDTFDITEDATHIME
                     ELGNAPLETAWVRHTYNNPKPVVSKRLISNDGSEISVDENHHQDPNYDPDHPESEALT
                     NVELKENMVTDIGERLSHLLDEKKNSNPNVPILKDMLTEADERAMDANSIDRNTGVDQ
                     EKLVFQIESTKPLFPSKESPSSELIEVEVAPTNTQDAQDTEIEDLGSTSKIPITPNVP
                     INRFISDQPQVRNSSGSSIDTIEEELDTYSLDAKYQLLKSTENVPQLPQLPTLSLQDF
                     KSVSNQNINASRVFSTATTNDNYQSAREFDLVSNTEHEDLSDERSIEDLEIPDSSTLP
                     NSNTFSLEPEYIITSRSMETVKQEDVAGKQSKDEDNGDLVSDNDMENSVKPDSGDDET
                     IDSALDETIQPINNTSLVGIPEEQKEDGQEDSITHHPEFYYEYECDTSNTSDSFVNEH
                     VTIDLPPLPTSRGLSTMFDDDLFNDQENSNDSFNLTSACEKDDYLLIWHSQHSVSNQV
                     SPAISANSQFSEQSKISSAPSNYSSGSFKFKSRVISNSHIHHQEAFRQVSDEYILNGL
                     NDSKLDPLRRNTIISKRIQQELKTQHRLYPFANRVCSDETTGMNSRKASNLAEDIKQE
                     PLYEVKEQEDTIKDDTGIKRDTSIVKNECPENGMSLLPTDSPKTVFSSFLDNFGRDDF
                     EEKLAQHSKLNSEPTIFGNWNAPIDVTDEPVDIKATQQQITKLLGNKTHNNPVQIASP
                     AQGAEVLIGHTAQGVEVQRSDSETSMETIKRSPGKHISSPFKIVQKEHLPEQPQTPSR
                     PPKSKHSHLDAEVQENSKSTPTYKHGTSTSSCASVYLENNDFVNKTRDLPDQGKFYVK
                     LKSIKAIRLDQIKHHQAKYSVEFDNGKEVVETPWKDMPEGGSIKLDQEIEINMDSPDM
                     KLFITLRIRYTSPQCQLVEVVEKVPIKKKFNFGKTKYKLEKRFVNKKITFDDWDFKFA
                     KDGSFARCHVDVDKRVLRKIEYECKELTFDMINEWERQFDPHAAKSYNQNNIWKLPRK
                     PASTVCSLAADILYIPRTSPMERFPKNLKSVKKCYQKYLEQQNIFKEGFLWQEGGDVD
                     GMLKRRYMVLKGTELIAHDENSRKPETLLNLLNVVDVYVDGKTISGKQIRNFTDMVLF
                     SDCFKLVFVNDEVINFNADSQTSKREWVDALSRVIELNKFHQPWIKRLVEKEKYKIQL
                     "
     gene            <222544..>225951
                     /gene="JSN1"
                     /locus_tag="KLMA_70110"
                     /db_xref="GeneID:34717870"
     mRNA            <222544..>225951
                     /gene="JSN1"
                     /locus_tag="KLMA_70110"
                     /product="protein JSN1"
                     /transcript_id="XM_022821356.1"
                     /db_xref="GeneID:34717870"
     CDS             222544..225951
                     /gene="JSN1"
                     /locus_tag="KLMA_70110"
                     /codon_start=1
                     /product="protein JSN1"
                     /protein_id="XP_022677726.1"
                     /db_xref="GeneID:34717870"
                     /translation="MDKRKLSGDAISGLSNIPEVIDPGVTIPIYEDDFTLSSANGIEQ
                     LPTQPQKLGSYRSKAGKFSNTLSNLLPSISAKLHHNKKGSKGPSAVGEGNTSGELSME
                     DGATTTTNGSEQTSKSGSMSQMNVGMTGHITPPLEMDYDQAIHLPDTSGLVVPVQSRI
                     SGDSFTFSAVTAASNNNNNNTNNNNISLQPTASNTISRTRNNTVSSQITSLSNVNSLI
                     PNVGNVWLPNDINVAPVPTVGISPPGSATTNMNSMNNMNNNGFQPGAYSPYETTGSYF
                     DLNLSNNNLNNNLGVPVTTPGGPNGPLQFQQQQQQQQQQQQQQQQMAHMWNTRPRSQS
                     NASSIYTDAPMYDQLDTRSRASTFIIPPSMDPQLKAAAASTNPIVQDDMDPRSINWVT
                     TDPSVPSINHISNLLPTNTISISNVFSLQQQQPHLSNTINLTSTSLATLCLKFGTVIS
                     ARTLKGVNMALVEFASVDSAIKAKEALNGKEVSLVGAPSTVSFAKVLPMHQQLPQNPP
                     PQHSNNNHHTGQINPQSLLQEQLYSGAVQLQQQGNVSIPTFNSHNHTQPNSQSFVSPT
                     NPSSSSGNSEKEHCPFPLPPPSFKENISLLNEIIDKFGVTYNKPQYQHIIVNAIEYNG
                     TSDTTDFGPLPEPLASREFDAPRLRELRKSIDSGQMSDLEIEQLVLAMLDELPELSSD
                     YLGNTIVQKLFEHASSVIKDIMLRKTSVYLTSMGVHKNGTWACQKMITNAETPRQKMY
                     VANGVYKYCTPLFNDQFGNYVIQCVLKFGFPWNNFIFENIVSNFWNIVQNRYGARAVR
                     ACLEAHDIITQEQLLLLSSMIVFFVKYLATNSNGALLVTWFLDTCTLPKRHSILAEAL
                     LPNIFELGCHKLASLTILKILNYRGDENAKRMILDTIFGPMDNENSSKPPQLLYQLLN
                     DTNYGPSFVYKVLSIPMLEGDIRHHVIEQVRYILTTESNITQHRRLLEEVGLNAPNNS
                     NSNNQQSGGAGKPRMSISHVFGNENPQHMRTVSVNSVRSASSRRRASSTAQAQAPTQT
                     QQQQPQQPQNQPQPAQSAAIPPSSQTIPGQPSYYTYPGMFPGTQPYQYSTSTSGLNDD
                     LVSNFDLLNLNNGTQISLPQLTMNGQPMPQNQNRHPNGQYGNGMFGH"
     gene            <226688..>230461
                     /gene="GRR1"
                     /locus_tag="KLMA_70111"
                     /db_xref="GeneID:34717871"
     mRNA            <226688..>230461
                     /gene="GRR1"
                     /locus_tag="KLMA_70111"
                     /product="SCF E3 ubiquitin ligase complex F-box protein
                     GRR1"
                     /transcript_id="XM_022821357.1"
                     /db_xref="GeneID:34717871"
     CDS             226688..230461
                     /gene="GRR1"
                     /locus_tag="KLMA_70111"
                     /codon_start=1
                     /product="SCF E3 ubiquitin ligase complex F-box protein
                     GRR1"
                     /protein_id="XP_022677727.1"
                     /db_xref="GeneID:34717871"
                     /translation="MESQQPSGGNSEWRFQVSPGAAWNLRAQARREQAANRSNSDVAV
                     GDLDERMARRVITGIDGNDNTLSDIFRSNHSEVALGNNTVENGRHGNQNNNGGNILLG
                     SDGAMVYSDDQPSFSRAAAAVASTGPKNGSENEEDDLVIARGGNSRFVPGLPASWFTN
                     AFQGSMGGANQQQQHMLARERRSAMGSLAQMENDLKMLFEKVEKEGWKLPPIEGDAKM
                     LQRYFESHHIDMRVRESLQEFINKMQKKTPDDTNNNNNNNSSWAEKEALLDYLLKQVQ
                     LTPEDAAALREIVELSRYRFKFALGIIELRKSYLKESLQLGIQRLRDLNNPEFSSHSN
                     LPAEDIDHLKATIMKQQRIILRAVEMELYSLHSYQEKYSSIIKRMARSIQDYYKRKTT
                     NPNVPNPIYYYHDLFLKYSPWTKRGLDLALYDMHVSEEEWNFMSNQVRTQLPQVASIA
                     LKDNNALYTKMKSSKNTFPLSDLPHEILAMVLEAKSQKSNIVPLMAVSKAWAEVIAKL
                     IYYRPHINKQQQLNSFLVTMSKSKDETLFDYRSLIKRLNFSFVGDYMTDRKLEYFIGC
                     PNLERLTLVFCKYITTKSVAQVLKGCQYLQSVDITGIHHIGDDLFEVLASDCRRIQGL
                     YVPHSNDVSPVSISHFITNAPMLKRVKITFNQSIENSLVMQMVKCCPFLVEVDLTSTP
                     NIDNQGLVTLFTSLPQLREIRVTHNTNITDEFMQIVSQEISSLPALRLVDFSGCENIT
                     DKTIDKLVTLAPKLRNLFLGKCSRITDASLKSLARLGKNIQTMHFGHCFNISDEGVRV
                     LVSNCPKIQYIDFACCTNLTNKTLYELAELPKLKRIGMVKCSQITDEGLLTMISIRGR
                     NDTLERVHLSYCTSLTIYPIYELLMACPKLSHLSLTAVPSFLRPDITQFCRAPPSEFT
                     ANQRQIFCVFSGKGVHKLRHHLMGIHEPTDGPSTKYDEIFIRFLKKKNAIQSNTIEDE
                     DLDRLSHNADLDSAALFAASAVFNFANEPFNQIEFAHLDHIFSSMLLTSEDTETINSA
                     DLSSIDGFDQSFYDNPLDPRFADRYVTVAPPASPNINNELADVIRKFRKILNRVLDFE
                     VNVASLCRIQFQYCGTLIAEMSSIYITFVDLNRYISEIYQRIKASEDQQDLLGFVLWK
                     KWWSPCFKDLMRSFKITALVLRIYVKESLTVLTRQRELVLQRARETWDREAANGGADQ
                     EGDIDMGVNMLLPPGGGPAENNGNENQMDLRLFLPPGNDQNGIEETDDQIIDE"
     gene            complement(<230654..>232897)
                     /locus_tag="KLMA_70112"
                     /db_xref="GeneID:34717872"
     mRNA            complement(<230654..>232897)
                     /locus_tag="KLMA_70112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821358.1"
                     /db_xref="GeneID:34717872"
     CDS             complement(230654..232897)
                     /locus_tag="KLMA_70112"
                     /note="AT hook, DNA-binding motif"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677728.1"
                     /db_xref="GeneID:34717872"
                     /translation="MNELTMSSAMDLSFLSEESHESKPNDQNNIESVKRKRGRPRTKP
                     ILPVELDAEGNPIKKKRGRPKKILTEPNQESSNLFLQSKSGSPLEENVPVVKKRRGRP
                     RKSLINPTTIAFVTETSKNETHSISGDHQDKDHLRIGDRSDTNKRNPVLLQPKKRDIN
                     GDIKKTEKPQEGKEGIQNGSQRSEPTDKPELERHDPSIEEAPALNENPEPAKPSSVTS
                     ELSIQKNQELDNKGKVPESRLQTAEPSKPEKPHKKRGRPRKNPAENMAPKIKRPRGRP
                     PKPKSQEEQFQNQKHKQRRDSKERKGTQDTDERKQANIKEYSTNLTDILRDNSQQKGI
                     SSTSPKKKIKLAKTITQQTFNDSKESHVEDTNAGKAIEKNKDVFLNFKKNQEKATKPN
                     NILDDSYDVFSFDNNGTSNFIIPEEALPVPNNAKNKNPKTTPMKPLQEQLEHIDTTNI
                     EFSDDDDYNVEDDDSKKISESEKSSDESYNSENDAYSDISSTVPSPSSPNDDSLRHLP
                     SSVSQKQSSIPESQAAIEHEDQMPQGLDSRPLSIHNSEKTPRKLSEEWSLSISFQDVN
                     GQGTPDASPSRPKEIISAFPSSPNISPKVKNTINSDPEPEKVNEKAVTEHRTMRNTPI
                     KTLPSWSPLDNDRLRTLTEDTITLNKYFTDLLIYMNKNSATLASDATGELSFFINQMP
                     KHETSLNFCDWVDRKGMEVYRQLEKGIDEKIEEIKLQFQKAKELINQIDDDTILLEFA
                     ERFNIDI"
     gene            complement(<233407..>234612)
                     /gene="TIF5"
                     /locus_tag="KLMA_70113"
                     /db_xref="GeneID:34717873"
     mRNA            complement(<233407..>234612)
                     /gene="TIF5"
                     /locus_tag="KLMA_70113"
                     /product="eukaryotic translation initiation factor 5"
                     /transcript_id="XM_022821359.1"
                     /db_xref="GeneID:34717873"
     CDS             complement(233407..234612)
                     /gene="TIF5"
                     /locus_tag="KLMA_70113"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 5"
                     /protein_id="XP_022677729.1"
                     /db_xref="GeneID:34717873"
                     /translation="MSINICRDNNDPFYRYKMPPIQAKIEGRGNGIKTVVMNTMDVAR
                     ALNRPAPYIIKYFGFELGAQTAINVENDRYIVNGAHQPAKLQDVLDGFINKFVLCGSC
                     KNPETEIVITKDNDLVRDCKACGKRTPMDLRHKLSSFILKNPPDSMNGSKKKKKAATA
                     SANVRGGGLSISDIAQGKSQAEAGGEDGEENDSDDDELARQINAAASNLATIEVKDED
                     WAVDMSEEAIRARAKELHGEAAKETTEFTKLEEFGEWVLQSEELPTDVELYKKIAELE
                     LLDDPKVAAVLAQVLFDEDIVSDISEHTAFLQKLLKDEDFEKNFLGGIERFLGLDHPD
                     LIPLLPKILVQLYNNDIISEEEIMNFGTKCSKKFVPKDVSKKVRRAAKPFITWLKTAD
                     EDDDDEDSE"
     gene            <235255..>236112
                     /gene="EMC2"
                     /locus_tag="KLMA_70115"
                     /db_xref="GeneID:34717874"
     mRNA            <235255..>236112
                     /gene="EMC2"
                     /locus_tag="KLMA_70115"
                     /product="ER membrane protein complex subunit 2"
                     /transcript_id="XM_022821360.1"
                     /db_xref="GeneID:34717874"
     CDS             235255..236112
                     /gene="EMC2"
                     /locus_tag="KLMA_70115"
                     /codon_start=1
                     /product="ER membrane protein complex subunit 2"
                     /protein_id="XP_022677730.1"
                     /db_xref="GeneID:34717874"
                     /translation="MDLFREKLLTIHKTAAWTVLPPAEIEYAYKEAKFLLASGLNGLN
                     EVNYMSVTELLFYLCIVRGSDEEAQSIYQTVKDQFGEDSPRIHLMRATLIQVTESDDA
                     AKEYINKLIKGQLEIATDSEDYVQMKKKLLAIERPSMTKEKWVQELLDLVEKFPLDAE
                     LWSLLSKEYEESGNYDQAIYCMEEVIVSIPFNYEAFGQLAYLHYLKYTKDPSSEASLQ
                     SSLSNALRSVELAEAYVKGWGLVLTTSEKLMKKDLHELATRKLVELQKNTDNADIVNI
                     SKYLLDSSA"
     gene            complement(<236181..>237377)
                     /gene="TIP41"
                     /locus_tag="KLMA_70116"
                     /db_xref="GeneID:34717875"
     mRNA            complement(<236181..>237377)
                     /gene="TIP41"
                     /locus_tag="KLMA_70116"
                     /product="type 2A phosphatase activator TIP41"
                     /transcript_id="XM_022821361.1"
                     /db_xref="GeneID:34717875"
     CDS             complement(236181..237377)
                     /gene="TIP41"
                     /locus_tag="KLMA_70116"
                     /codon_start=1
                     /product="type 2A phosphatase activator TIP41"
                     /protein_id="XP_022677731.1"
                     /db_xref="GeneID:34717875"
                     /translation="MSDNGQGQDQGQNENQNPDVKQSNAESRRPFGSGIPIIQVNQAR
                     EMFQSTVRARRPGSSQPRDTVTMRESSVISTRSLASPMATQRPNTMMSPRPKMKPKTT
                     QNHPHKSNNPNNPNCDHCGVVIVPSPVASLPAKDDPSVTIGDWTITTTKRPILSSDEI
                     DEWTEKLHFPIPEMIFGNSGVEIINNSTNWWIKFSPFHALSEVKLGDSGLRVSYSEKW
                     LNSKLKSSQISNTEEGLQFGKHWDWSYTTLYKGTTNEDSDYEFVRDDDYQLPIDKLSR
                     RDPILFYDDFILFEDELADNGISILSIKLRVMAERLLLLCRFFLRVDEVLFKIVDTRL
                     YIEFAEELVVREWKYMEDDYKTVLNKCKMNSSDPKRSLRDSNWVGSVLPLKERVCEVL
                     RKKETV"
     gene            <237838..>238440
                     /gene="ERV2"
                     /locus_tag="KLMA_70117"
                     /db_xref="GeneID:34717876"
     mRNA            <237838..>238440
                     /gene="ERV2"
                     /locus_tag="KLMA_70117"
                     /product="FAD-linked sulfhydryl oxidase ERV2"
                     /transcript_id="XM_022821364.1"
                     /db_xref="GeneID:34717876"
     CDS             237838..238440
                     /gene="ERV2"
                     /locus_tag="KLMA_70117"
                     /codon_start=1
                     /product="FAD-linked sulfhydryl oxidase ERV2"
                     /protein_id="XP_022677732.1"
                     /db_xref="GeneID:34717876"
                     /translation="MSSIKVKLGVHRQRVLMFVSLFVMGLLWFTFSNSQLPIDGAPSG
                     LIGDFAKVGSKSENTEDRTIMPKMPDQEAKAALGRASWKYFHTLLARFPDEPTEQEKT
                     KLREFLYLYAELYPCGECSYHFVKMLKKHPPQVSSRTTVALWGCHIHNMVNEYLKKPI
                     YDCNTILEDYDCGCSDANGNIDPALNMNKVTFEKEDKQLG"
     gene            complement(<238513..>238785)
                     /locus_tag="KLMA_70118"
                     /db_xref="GeneID:34717877"
     mRNA            complement(<238513..>238785)
                     /locus_tag="KLMA_70118"
                     /product="guanine nucleotide-binding protein subunit
                     gamma"
                     /transcript_id="XM_022821365.1"
                     /db_xref="GeneID:34717877"
     CDS             complement(238513..238785)
                     /locus_tag="KLMA_70118"
                     /codon_start=1
                     /product="guanine nucleotide-binding protein subunit
                     gamma"
                     /protein_id="XP_022677733.1"
                     /db_xref="GeneID:34717877"
                     /translation="MGELPYKIQLLKLRRIEELNNKLRNELARERITASNACLSIIDY
                     ASTQKDYLIPDVWGYPDIGEIPYTNSKRNIQNRSQNNDANNCCTIM"
     gene            <239785..>240102
                     /locus_tag="KLMA_70119"
                     /db_xref="GeneID:34717878"
     mRNA            <239785..>240102
                     /locus_tag="KLMA_70119"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821366.1"
                     /db_xref="GeneID:34717878"
     CDS             239785..240102
                     /locus_tag="KLMA_70119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677734.1"
                     /db_xref="GeneID:34717878"
                     /translation="MEHPSYTLAALATIGGTMGYVRKGSVPSLIAGLTFGGIYGYAGY
                     LLKQNADYGLELALGASGVMLATGIARGIPSRFTKPVPLVLTLLGGLGSFYYYKKYKE
                     FYP"
     gene            complement(<242001..>243308)
                     /gene="CSN12"
                     /locus_tag="KLMA_70120"
                     /db_xref="GeneID:34717879"
     mRNA            complement(<242001..>243308)
                     /gene="CSN12"
                     /locus_tag="KLMA_70120"
                     /product="COP9 signalosome complex subunit 12"
                     /transcript_id="XM_022821367.1"
                     /db_xref="GeneID:34717879"
     CDS             complement(242001..243308)
                     /gene="CSN12"
                     /locus_tag="KLMA_70120"
                     /codon_start=1
                     /product="COP9 signalosome complex subunit 12"
                     /protein_id="XP_022677735.1"
                     /db_xref="GeneID:34717879"
                     /translation="MAQLIYVCFRDNILNDSFKDLVNYEYDHQIKVSKPHFALKEFDK
                     VSQLIEICNDMKKMYQKDNATISVPLFRLALEQLRVLNRIFENRTNWMIPLLYQSGEQ
                     LYDIANTLDTHKEQSGGRLQNDEEEESFLIQAGRVIHMTLNTCFKDRNENELENKKIG
                     VFYFATLLFKLYYRIQAYGLLSNMCKVFESRLNEIDPYIRKVDNDLIIIRFKYYMGLY
                     YGYEKNNYQLGHQWLNEAFDICRRYETIKDTHAVRTRVLLYLIPMKLMHTRQYPRLQV
                     LQRTYRKLSNFYKPLITSICTGNLHEYDTFVRENELFLVSRNLHVTILKLRELVELKL
                     VKVAWSCNGATTKVPLDIVARAFAFASGSRDKNRKKADAGSSKNGDSSAADDLDELEC
                     ILATLIAKNYIKGYLSHTHRVMMTSKAPFPSLVKSGVTGISRG"
     gene            <243628..>244284
                     /locus_tag="KLMA_70121"
                     /db_xref="GeneID:34717880"
     mRNA            <243628..>244284
                     /locus_tag="KLMA_70121"
                     /product="assembly-complementing factor 4"
                     /transcript_id="XM_022821368.1"
                     /db_xref="GeneID:34717880"
     CDS             243628..244284
                     /locus_tag="KLMA_70121"
                     /codon_start=1
                     /product="assembly-complementing factor 4"
                     /protein_id="XP_022677736.1"
                     /db_xref="GeneID:34717880"
                     /translation="MSKRIVSDSTGLYKLNIVNKEKNSQDSATGRNSTEKEELENEKP
                     SSQPQSPRRAALKINIANDLKEPEETEDEIITKIAQVEDEILQCESKLSSLKEELKIL
                     QAKLQPVVKQAESVPESRRSSRSDFRSKVRSISPQKSVPGSPTSKWKLFKENGSSLLK
                     KFKEFTIDDEDEQEYDDLMAKNKNSGIHHFTVKNGLNYNYDTDSESGDETDDKSSEED
                     "
     gene            complement(<244424..>245806)
                     /gene="VMA13"
                     /locus_tag="KLMA_70122"
                     /db_xref="GeneID:34717881"
     mRNA            complement(<244424..>245806)
                     /gene="VMA13"
                     /locus_tag="KLMA_70122"
                     /product="v-type proton ATPase subunit H"
                     /transcript_id="XM_022821369.1"
                     /db_xref="GeneID:34717881"
     CDS             complement(244424..245806)
                     /gene="VMA13"
                     /locus_tag="KLMA_70122"
                     /codon_start=1
                     /product="v-type proton ATPase subunit H"
                     /protein_id="XP_022677737.1"
                     /db_xref="GeneID:34717881"
                     /translation="MNYQFKHILLDSTHFQQIRHSLNSRTIGWDALVRSSEISKFDGE
                     TTKKLESGMLKNEKIDMPLDTALTALLHILATSNNLDVNKCVVNLLSQLLTLEPYSEE
                     LITLISKKDSKKVLSQFYEHTLNKGLVEEQFNLISAFTFVSLLLQFEDVELTSKLLEN
                     KQFQNLFKSEHKDAVYLAIRLLQELTVNKTYKQLVWSQHAYYLPIVFESIFSINEYQP
                     QQTNTNNLQIQLQYYALMIIWLLTFDPKITEAFTKQYLSQYLQLLALIRSTIKEKVVR
                     LSVSIILNGISDSVKNHKSTVKNLILLGNAIPTLNQIMERKFLDDELKEDLATLKESL
                     ETEYHELTSFDEYMAELNSKILLWSPVHQDSQFWLDNLDKFKENNWKLFTQLIDLLKE
                     FVAEKKPSAVSLQILLNDIRKVMELDNDSIKKVQKDKLIIMQLLQHQDSKVKYEALKT
                     TQVIVSNTFK"
     gene            complement(<246884..>247993)
                     /gene="GLN1"
                     /locus_tag="KLMA_70123"
                     /db_xref="GeneID:34717882"
     mRNA            complement(<246884..>247993)
                     /gene="GLN1"
                     /locus_tag="KLMA_70123"
                     /product="glutamine synthetase"
                     /transcript_id="XM_022821370.1"
                     /db_xref="GeneID:34717882"
     CDS             complement(246884..247993)
                     /gene="GLN1"
                     /locus_tag="KLMA_70123"
                     /codon_start=1
                     /product="glutamine synthetase"
                     /protein_id="XP_022677738.1"
                     /db_xref="GeneID:34717882"
                     /translation="MSDIVEKTTILQKYLELDQRGTIIAEYVWIDAEGNLRSKGRTLS
                     KKVTSVDSLPEWNFDGSSTGQAPGHDSDVYLKPVAFYPDPFRRGDNIVVLAECWNNDG
                     TPNKFNHRHEAAKLFEAHKKAEMWFGLEQEYTLFDQYDNVYGWPKGGFPAPQGPYYCG
                     VGAGKVFARDVIEAHYRACLYAGINISGINAEVMPSQWEFQVGPCEGIAMGDQLWIAR
                     YFLHRVAEEFGVKVSLHPKPLKGDWNGAGCHTNVSTKEMRAPGGMKYIEDAIEKLSKR
                     HNEHIKLYGADNEQRLTGRHETASMSTFSSGVANRGASIRIPRSVNKEGYGYFEDRRP
                     ASNIDPYLVTGIMVETVCGAIENADMTKEYERESL"
     gene            complement(<249733..>251112)
                     /gene="ARP7"
                     /locus_tag="KLMA_70124"
                     /db_xref="GeneID:34717883"
     mRNA            complement(<249733..>251112)
                     /gene="ARP7"
                     /locus_tag="KLMA_70124"
                     /product="actin-related protein 7"
                     /transcript_id="XM_022821371.1"
                     /db_xref="GeneID:34717883"
     CDS             complement(249733..251112)
                     /gene="ARP7"
                     /locus_tag="KLMA_70124"
                     /codon_start=1
                     /product="actin-related protein 7"
                     /protein_id="XP_022677739.1"
                     /db_xref="GeneID:34717883"
                     /translation="MSVKIVVVQISQTRVVCGFNNQDLPSLTLPAQYLTYKSEQEPER
                     TSEQGSEASNDSIVKVFDKWDMLARCQDPTAEVYQLYDKQGLPCDWDVMDEQWSYMFK
                     RLGLKFEDYPVCVVLPNELKASIRKKFVEHLLGYGIPMVQLLNEPVCNTLSQGRPSGI
                     VVDIGHTGVRVDAVIDGVLFKQYRKENKIGGAFLNWKICDHLLKRDANKSTEVWRDAT
                     EWLPTFKNTMLQVSPIELDANHEIAPHYQHMVSPMDHTKSFLLERKQTVTFTNKQLYA
                     IGELLFKPVINIDKSGSTDTADSTAANGSTNGGDAPPPEKLIGIVGLIRSCIQSLLNG
                     ANAGATTGASAGGASNSGDGSLGGQGSNDSSNAPSHNYTSEQLQSMLLTNILVTGSTS
                     NIQGLEQRLLNDISVSLNDLTTVRPKILFKPTKLDRTFQSWQAATTLCRLPLRESLYA
                     WETLERETK"
     gene            <251480..>251827
                     /gene="EAF6"
                     /locus_tag="KLMA_70125"
                     /db_xref="GeneID:34717884"
     mRNA            <251480..>251827
                     /gene="EAF6"
                     /locus_tag="KLMA_70125"
                     /product="chromatin modification-related protein EAF6"
                     /transcript_id="XM_022821372.1"
                     /db_xref="GeneID:34717884"
     CDS             251480..251827
                     /gene="EAF6"
                     /locus_tag="KLMA_70125"
                     /codon_start=1
                     /product="chromatin modification-related protein EAF6"
                     /protein_id="XP_022677740.1"
                     /db_xref="GeneID:34717884"
                     /translation="MDEQKKEYERLRKKLRDALQEKKQLEAKWDALEQEIYDKETAYL
                     SQKPSSRMGNILMGFQGFNKNSSAQQILSDHSHSSHAHTLDDNDRIFSLSSALFVKQL
                     QGSAPGSGAQEDE"
     gene            <252212..>253279
                     /gene="AIM24"
                     /locus_tag="KLMA_70126"
                     /db_xref="GeneID:34717885"
     mRNA            <252212..>253279
                     /gene="AIM24"
                     /locus_tag="KLMA_70126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821373.1"
                     /db_xref="GeneID:34717885"
     CDS             252212..253279
                     /gene="AIM24"
                     /locus_tag="KLMA_70126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677741.1"
                     /db_xref="GeneID:34717885"
                     /translation="MLWKRSISILRPSPTTVIPSNVLSSPQLDLKPLFENESDQTVTE
                     NGAITSTTRFQLLGDNPTLASIQVSPSIPLYVRHRSLVSIHDADRLSNVSVSFKKWFK
                     LWPTLSLSRFDKVVGTNQFNCLVSSVRPSDTLSLLQLNGTYDWIVLNPNSILSFEENS
                     SLSIQWFHKYLNYFGWLSNKISVFSNYGKLSGRGNVLLNGSGSIYKLELKSEEDQILL
                     QKNRILAINGLNKLDFSQAVTLEKSSTLKHTDSKQLENSTRNDTNADNTTANAFLQFL
                     QKLASFIKTTWQSYNSSDFVRVKGPRTVLVQTDPKSANHISWADHAMSLKPAKNYLSF
                     ASVTKDSTIKFRNTSSLLNKK"
     gene            <253850..>255409
                     /gene="HARS"
                     /locus_tag="KLMA_70127"
                     /db_xref="GeneID:34717886"
     mRNA            <253850..>255409
                     /gene="HARS"
                     /locus_tag="KLMA_70127"
                     /product="histidyl-tRNA synthetase"
                     /transcript_id="XM_022821375.1"
                     /db_xref="GeneID:34717886"
     CDS             253850..255409
                     /gene="HARS"
                     /locus_tag="KLMA_70127"
                     /codon_start=1
                     /product="histidyl-tRNA synthetase"
                     /protein_id="XP_022677742.1"
                     /db_xref="GeneID:34717886"
                     /translation="MSTPSEAVPTPKSAPKSGKLQFTLKTPKGTKDWAEKDMVIREAI
                     FGQLSSLFKRHGGITLDTPVFELREILAGKYGEDSKLIYNLEDQGGELCSLRYDLTVP
                     FARYVAMNNVQSIKRYHIAKVYRRDQPAMTKGRMREFYQCDFDIAGTYESMVPDAEVL
                     SILVEGLTSLGIKDFKIKLNHRKILDGIFQIAGVKDEDVRKISSAVDKLDKSPWEVVK
                     KEITVEKGQTEETANLIGEYVKLNGSLQEVHNTLSNDAAIQGNEKAMEGLKEIETLIG
                     YVNAFGIQNYISFDLSLARGLDYYTGLIYEAVTAASAPPKNASELKEKSKKQKKDDDD
                     ASEYVGVGSIAAGGRYDNLVNMFAEASGKKSTSIPCVGVSFGVERLFSLIKQRVEQSD
                     KVRPTATQVFVMAFGGGKDWTGYLPERMKVAKTLWENGIEAEYVYKSKANPRKQFDAA
                     EKSGCPIAVILGKEEYLENKLRIKRLGPEFADDDGELVDAANLIPAVKEKLAQVHENG
                     VDEITRLIKDL"
     gene            complement(<255533..>256129)
                     /locus_tag="KLMA_70128"
                     /db_xref="GeneID:34717887"
     mRNA            complement(<255533..>256129)
                     /locus_tag="KLMA_70128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821376.1"
                     /db_xref="GeneID:34717887"
     CDS             complement(255533..256129)
                     /locus_tag="KLMA_70128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677743.1"
                     /db_xref="GeneID:34717887"
                     /translation="MGSDLIIDTQLPEFDDAAEAGFLHKDILFDPNGKLVINRERCIN
                     PKLIDNFFRFLRHGSDDVLKQKLNNNKSATNQDRNCDAVLKSVLYPNWKIRHDIISYC
                     ENELNSMQKELNSSSNMDNENQRPIVTERIDPYAVKDMLTEKENRFKDYRILENWISN
                     QKNIESIIQIRTSSVLSEQCGNNRDYIREFENFIKANK"
     gene            complement(<256352..>259318)
                     /gene="SRO77"
                     /locus_tag="KLMA_70129"
                     /db_xref="GeneID:34717888"
     mRNA            complement(<256352..>259318)
                     /gene="SRO77"
                     /locus_tag="KLMA_70129"
                     /product="protein SNI2"
                     /transcript_id="XM_022821377.1"
                     /db_xref="GeneID:34717888"
     CDS             complement(256352..259318)
                     /gene="SRO77"
                     /locus_tag="KLMA_70129"
                     /codon_start=1
                     /product="protein SNI2"
                     /protein_id="XP_022677744.1"
                     /db_xref="GeneID:34717888"
                     /translation="MFKSRKLKTVSNAIKSVASRDASNGISSKMFELSEVSRYGMNGK
                     VTSFAFDPVQSLLAVGTDSCEVHVYGKQQVEVVFTLDVEGIKDIRFVKGIYLLVLDSK
                     DTISVLSLYKKTLLSSFFVPGKVTCIETDPSLGWVLIGLQSGATLAYDIDRDFLSRFK
                     IENLQKSRYFVREHLSQVVSIQWNPRDLGTVLISYDKVTVLYSFVEGEVKQHFIHEVD
                     GKVIKVLKSVFHPNGLNVMTIHEGNCLVFWDSNTGKKIVSRYLLDDGPMSGSINNTNI
                     FKVSWIQEKDENSTSLLFAGGTGDASSGEHSLTLINLGPTPLYSVTSYEKMAAYYTQP
                     VSEKIIPIPNNSPVVNFLPLANGNPHYGGNFAPMVILVLLEDGEIETLLYPSGHITYK
                     ASLFPQSISWIRPAATTSFATSVPKKSWIGMMSVTYNKDYILQGGAPAKKTLRVHESR
                     SALSTGHTNGSVRIWDASHGELDETSVFDVNVSHSLNTAHSVAVDHISYAGETAELAV
                     SIESGDVVLYKFQVNEYFTSTKDAALEMNFRRFSLNDRPNDILVDIRDRAPNNIREGF
                     MPISAIHARKGKVTCLCNSNIGFVAITYEDGTLLVVDRRGPAIIFLDNISKISKERSS
                     YISCLDFAIMEYGEDGYSSIQLLCGTDIGEVLLLKIIPDRSGRYSVQPYDAFRATDDG
                     PIVSLATISKVNANSCTATIPQMLQLSKGLRVPAQVIATGKMDVRLVTPGKSKDTHKI
                     FKFPIASSGLSIVPFTNSKGERLSSTVLVVILLNGDIKVLSLPELKEIKSFSALSKVQ
                     ARYMKESCVLINGDIVYRLSKTEAWLLNIVKEDQNTISSKMDEKTDTLYNPNLKIRSR
                     PYYNTLQWVRGSIYCSSEDLDNILGEKRPEPKFEEEKLANGTIVLSQKEEVRNTHELS
                     SNGEFQYQAPVRHGAKSGGYGAFRSINRAVQNGMDTLEDSFNDYATAANETMNEAIEQ
                     TGKDLIKGAFSSKMGF"
     gene            complement(<259715..>263167)
                     /gene="PKC1"
                     /locus_tag="KLMA_70130"
                     /db_xref="GeneID:34717889"
     mRNA            complement(<259715..>263167)
                     /gene="PKC1"
                     /locus_tag="KLMA_70130"
                     /product="protein kinase C-like 1"
                     /transcript_id="XM_022821378.1"
                     /db_xref="GeneID:34717889"
     CDS             complement(259715..263167)
                     /gene="PKC1"
                     /locus_tag="KLMA_70130"
                     /codon_start=1
                     /product="protein kinase C-like 1"
                     /protein_id="XP_022677745.1"
                     /db_xref="GeneID:34717889"
                     /translation="MDIDHKTAGPVEQEIYKKIDREKNIIFGSNQLKKKTDNVMVIQK
                     CNTNIREAQQNIEYLEDLLKKLKLSQQPDVQNGNDVNSHPGFGQLSTISPEEFRYSRL
                     DLVKYDCPSLSQRIQYMLQQLEFKLQVEKQYQEANDKLTKLYQIDGDQRSSSAAQGGS
                     VESKHRIQLLTKSLKKYQAINVDIDPFRDHTEEATQPKFRRKQLSGTLTIGVTAIRDV
                     DHIQSPLFSRKPETFITIKVDDAVKAKTKPSRNDRWHEDFNIVIDKGNEVEVTIYDKV
                     NDRVVPVAVMWLLLSDIAEEIRKKKVGQQQKQGQTQGEWVQASRIVSAQSKSDQSTFA
                     GEVTESPNTTHPTENRPETQTPNSQHLTTNTWFVLEPAGQILLTLGFSKSNTTQRKNL
                     MGGLHRHGAIVNRKEDVYEQHGHHFVQKSFYNIMCCAYCGEFLRYTGYQCQDCKFLCH
                     KKCYSHVVTKCIAKTSNDSDPEETKLNHRIPHRFVPVSNRGTKWCCHCGYILPWGKKN
                     VRKCTECGVMCHAQCAHLVPDFCGMSMEMANKVLLTIQDTKRSQQQRGTNNIKVHKNK
                     PQPKTPTDSNKKFSNAFDQPVVHPGTIKPTTPAEVRKDQVIDRLNNFITQHDSQYESF
                     TNSVGNTSPQNKSLPFSLDPGLSPDVGEHSFSSGGYQQGYTYDQVHNYQEPSSNNPEY
                     SNSDDYNNVGNTTQELRERLRREEEERWYLENARSQEEQTQQKQLHQEQSYYIPDKLP
                     TKKNDYDLVEETVTSQEIHSETPTPHSESIHAPTSLEAPSLPPDDISKVVSKSPPSSP
                     QKSYSSGTRHKRKTPKRRKVSLDDFVLLKVLGKGNFGKVLLARSKNTNSLCAIKVLKK
                     DNIIKNHDIESARAEKKVFLLATETKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWH
                     VQNQRLSVRRAKFYAAEVLLSLKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKD
                     NMWYGNKTSTFCGTPEFMAPEILKGQAYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDE
                     VFNAILTDEPLYPIDMAGDIVQIFQGLLTKDPEKRLGAGPKDALEVMAEPFFSNINFD
                     DILNLRVEPPFVPEIKAADDTSYFEKEFTSAPPTLTPLPSVLSSDLQEEFRGFSFMPE
                     DLNL"
     gene            complement(<263770..>266661)
                     /gene="SEA4"
                     /locus_tag="KLMA_70131"
                     /db_xref="GeneID:34717890"
     mRNA            complement(<263770..>266661)
                     /gene="SEA4"
                     /locus_tag="KLMA_70131"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821379.1"
                     /db_xref="GeneID:34717890"
     CDS             complement(263770..266661)
                     /gene="SEA4"
                     /locus_tag="KLMA_70131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677746.1"
                     /db_xref="GeneID:34717890"
                     /translation="MGLIKHVPCWSNVDGLDFLSVNPTRDEVSHYRVKLDVDSDESIV
                     KLNTVKDFGNITCLDYSKTDDKMVAVGEKSGILRLFSISETDDEYNGFDLRVRAKQQR
                     TINSLSVNTNGLIAMGLERNKHDASLQVWDVNYQSTESNMITPSFSYCVNESIVSLKF
                     VDDTSILASSTKLLKEIDLRVPNPVYQHPTRISYDIKINPFNPWQFSTYADDGTLAFW
                     DRRKLASISDDPEYLEAQPLLKFDKLVGHGAASRKYMNSCFRWSPLRNGEFSTLHSGA
                     SIKRWRLATVPDLQSGNELNDSLFVSTVTDIKTTYDRVVTFDYIPTENGKTSLLCMRQ
                     SGTIYRMNVEHGFSKSKINNYNSIMSISDDNSNANELRITGEDEISIFDNLDTGLLNL
                     SFEDLDTGDDLDLSDTEDRNSVNSLENGHTSDSEEVNEYFIDAEKLLQNDISFIMRKR
                     ASLGYGLDPMKTVEMIDKSRLFNNNIYIRNTWRWMAIAKASIDDGTMVSGDLDLGYEG
                     ILGIWNGLEGLSNQNRYRSGGMLTEKQLNKELDKIIKMRSKSKNKIGNVSSLSSSLNS
                     KKSIQRKLCMIISGWDLSPADYEEKYKALIDLNHYEKAAAWAVFFGDVQRAISILGSA
                     NKERLRLIAAAIAGYQAYSEKPGDNAWRQQCRKMAAELDDPYLRVIFSFVADNDWWDI
                     LYESAISLRERLGVALRFLNDTDLTRFLERTATTVIENGELEGLILTGITPSGIDLLQ
                     SYVGKTSDVQTAALISVFGSPRYFKDQRVDEWVETYRYMLNSWEFFTMRGKFDVLKMK
                     LSRTSDGRISSQVKPRQMYLQCSKCKKNINKTSESSSSTNMARHISQNVNGAKKFGLN
                     NTNNETPQQKHSCPHCGTSYPRCAICLLPLGTSNLPIVINGTTNSCEVNIDQNSKIND
                     LTERKRLRMNEWFSFCLKCNHGMHAGHAEEWFERHFICPVPGCSCLCHQ"
     gene            complement(<266858..>269026)
                     /gene="NTO1"
                     /locus_tag="KLMA_70132"
                     /db_xref="GeneID:34717891"
     mRNA            complement(<266858..>269026)
                     /gene="NTO1"
                     /locus_tag="KLMA_70132"
                     /product="nuA3 HAT complex component NTO1"
                     /transcript_id="XM_022821380.1"
                     /db_xref="GeneID:34717891"
     CDS             complement(266858..269026)
                     /gene="NTO1"
                     /locus_tag="KLMA_70132"
                     /codon_start=1
                     /product="nuA3 HAT complex component NTO1"
                     /protein_id="XP_022677747.1"
                     /db_xref="GeneID:34717891"
                     /translation="MHTQEEAVRLREEVSYKRFYPDLDVNDDVVFTKETGGPGQMGGD
                     DENASLLQYMTSWKQLIVNDTITMEKLGPQIKHAEFKRCGIQISQLNPQGRVNKQYLR
                     YGYGTQNGRCCALDKKTYCKKTDILLRHKNEYFADISPYQVNFKVEYDMDEQDDLFLR
                     HLNESFSNPRNKITHELFEIIITVLENEAFHLEKKIPPRVSPTSTNDTHESHAAWKHH
                     ELYGSDDGTGYPMDQPCAVCGGIECDNSNAIVFCDGCDIAVHQECYGVVFIPEGQWLC
                     RRCMISKNRKIGCLFCPSTTGAFKQTDNGSWGHVVCEIWIPELYFGNLHYMEPIGGIE
                     NIPKSRWKLVCYICKQEVGACIQCSNKNCFAAYHTTCAKRAGLYMNFNGCTVQEAASK
                     SMPPGAFLESYCHKHSPKGWNDCEEGIRKTREYFKHVNDHETLLNTVVPTNSNNSTQK
                     TTKNKWKTSRGTLIAPQKFADIVQMILKRFHIPETERISFDFCKYWTMKRELKRGAPL
                     VRKFSPSSLNTLSSEELQDRIAFSELLLQDLNQLEDLASTFVEKHKCNVKKVEKSKIC
                     YDIAFHPVRYILRESVWDNLSKSSSFKTFMQLEESAGLDILRPIEQKLTKDEYESIYE
                     FKSEVIEKLSHIVEDGNYPRLLTITASKLLQTFQSYICKIDGIDIKSLLNDDFDIDEK
                     THKIEEVAWKGRKLLMREDLSDVEDLSIMEERQLKGALRD"
     gene            complement(<269636..>271075)
                     /gene="RTG3"
                     /locus_tag="KLMA_70133"
                     /db_xref="GeneID:34717892"
     mRNA            complement(<269636..>271075)
                     /gene="RTG3"
                     /locus_tag="KLMA_70133"
                     /product="retrograde regulation protein 3"
                     /transcript_id="XM_022821381.1"
                     /db_xref="GeneID:34717892"
     CDS             complement(269636..271075)
                     /gene="RTG3"
                     /locus_tag="KLMA_70133"
                     /codon_start=1
                     /product="retrograde regulation protein 3"
                     /protein_id="XP_022677748.1"
                     /db_xref="GeneID:34717892"
                     /translation="MDFDADNLLDQFLQQNALAQRGSSFGTGSSHSQTPIPMTIPGSH
                     DDGNSSVEGRMGLRMNSGVAGGMGTNVDVSEGMSSSVSTIYAEQQSRQQSISGNQIDA
                     GNIPTSFMDEYVSLSNNNRPGPGGPGPGPGGAVGSVVSDVERRGHPAFEHINLDETTR
                     NLFDEPIFQDGSQATDDLASSFNDDFVSSLGSSIHSDLMTPVSSYQPHPLNSFDSHSL
                     SQMSSSLRSPSTSYRGTSQLSSSLRSNRGTSQQFPTSSSLASTPKELTGSSSLGPEEK
                     IRRRREFHNAVERRRRELIKAKIKELGTLVPPTLLHSSDNGKKVKANKGTILMKTIDY
                     MEFLKQVLEIQEAQKEKLRQRVHQLEMRKQQLANAKGHHQEHHHQHPQDNYHQHHNNE
                     RNENANVNVNVHLNDTEDYTARIIDGRAYPALLNERHDDTQTHESNPLHDDLQQFLSG
                     ILMENEDNNKLMFNGHDENPVDILLKFEE"
     gene            <271620..>272261
                     /gene="SFT2"
                     /locus_tag="KLMA_70134"
                     /db_xref="GeneID:34717893"
     mRNA            <271620..>272261
                     /gene="SFT2"
                     /locus_tag="KLMA_70134"
                     /product="protein transport protein SFT2"
                     /transcript_id="XM_022821382.1"
                     /db_xref="GeneID:34717893"
     CDS             271620..272261
                     /gene="SFT2"
                     /locus_tag="KLMA_70134"
                     /codon_start=1
                     /product="protein transport protein SFT2"
                     /protein_id="XP_022677749.1"
                     /db_xref="GeneID:34717893"
                     /translation="MSGNDSDVSNLRDSLNRWNESRNNHSQGFNEGAKTIFASWADSI
                     NERAQDVYQRLPLTQQDLTTNPEPEWFSLSRTERLSLFVCFVLGSVACFTICVFLFPV
                     LAVQPRKFGLLWSMGSLLFVLAFGVLQGPIAYMKHLTSRERLPFTVFFFTSCFMTIYF
                     AAFTKSTLLTIPCAVLELIAVIYYAVSYFPFGGAGLRMISSIGVNQARGVLRI"
     gene            complement(<272385..>275774)
                     /gene="ECM21"
                     /locus_tag="KLMA_70136"
                     /db_xref="GeneID:34717894"
     mRNA            complement(<272385..>275774)
                     /gene="ECM21"
                     /locus_tag="KLMA_70136"
                     /product="protein ECM21"
                     /transcript_id="XM_022821383.1"
                     /db_xref="GeneID:34717894"
     CDS             complement(272385..275774)
                     /gene="ECM21"
                     /locus_tag="KLMA_70136"
                     /codon_start=1
                     /product="protein ECM21"
                     /protein_id="XP_022677750.1"
                     /db_xref="GeneID:34717894"
                     /translation="MSFFSAHEHGKESGDSRRKSKSGIKHAFASILGGQGGGHGGGNS
                     GDSSNNSNNSNNNKNNNHNNHHNHSHSHNGNNSNNGNHGSVGRSHSHSGAASARTSGS
                     SMVRRSNSNVQAPPLGLASNVPGGFGPMMAFGSPYPLYGSQDYGAPQNELATTSDDET
                     ENDLDQYRGASSLLEYSFGPELDAADGGPRSRPFSVISDSDIEEEGGGGASVDLDENC
                     LGRRITRVSTALSAAGSQMSGALDSSRKRAAARAYLLNYLGERGFLKPKLLSSKNGVS
                     FHVATSGDTVFLPTVSPSDDEYLNHLNWLDGDEDYYDGGGAPNSSNPGSRPRMDHRES
                     QSTISASTHGANNNDSNNLHNTHSHSSRPQDASSPSLDGDSNSDSVPASVRESGGVPY
                     NIAVIMSLKTPMELSSLKAELYSRIRIYWSNGVPPDRSESEEYYTGGQLHWDFTNENY
                     NLYVGFSSADQEMVIAENTQNIFQSRVFSDIPEFEDRPYLKKSKTKEDFLKKVNAASE
                     FSTNSFQAGDYVFIVPVVFDNNIPESIYLPSARVSYYFRCGVKVINTESANNTDNDSY
                     KNQNSDSALSGNGYNSPHGSNSDLNNDDSNPPSSTGDSSVSHFKFGGSKLFKKMKGHL
                     HIQGGRSITKADYQRLIYSRLSLNLIRTPPMRSISTADKPIYINRVWTDSLSYEISFG
                     QKYVPLDADIPLKIKLVPLIKDLSIKRIRICAIEKITYVSKNLEYEFDQVDLVANDPY
                     SPYYQEFASRRKPERVFPLLEIRTREKGGKAMKEEVVENCIGDNLLSYSSFKDSETNS
                     TVNMVEALTVDTKIRFPKYKVLNKKMARSVPPYGIDEFVQQDYIKSSGNSRRGSAASG
                     VIDFLAGRRSRKDSSVTETNVAVAKNTTTFRVNSNHKVLNHTRLNEPKRGLYVTSINS
                     SHINVKHKLEIMLRISKPDEKDPAKQRHFEVLIDTPVHIVSELCTSDNLELPTYAMAT
                     MSDTPFAGTISFDEPLPSFEQAISVPNSPRMSPIGSPQLRASYDPDELSIQQLMLSRA
                     STQNFDDASSQAASMATRRYSNIDEMMGNRNQKSGRSPSLNQGTNVNSGSSPTVTFKN
                     AFVETGADIPLNSEESLNSGNTYEEALLSDDEPPTYEEITS"
     gene            <276391..>278814
                     /gene="APL4"
                     /locus_tag="KLMA_70137"
                     /db_xref="GeneID:34717895"
     mRNA            <276391..>278814
                     /gene="APL4"
                     /locus_tag="KLMA_70137"
                     /product="AP-1 complex subunit gamma-1"
                     /transcript_id="XM_022821384.1"
                     /db_xref="GeneID:34717895"
     CDS             276391..278814
                     /gene="APL4"
                     /locus_tag="KLMA_70137"
                     /codon_start=1
                     /product="AP-1 complex subunit gamma-1"
                     /protein_id="XP_022677751.1"
                     /db_xref="GeneID:34717895"
                     /translation="MGSLRTFIKDVRSAKTLAEERSIITKESAKIRTKLKDDHISLER
                     RRKYIHKLLYLYILGEKTHFAQVECINLIASEEFVDKRMGYLAAILLLDENQELLTLL
                     TNLLNNDLNHQSRYVVSLAMNALGALASPELARDLYSDIKNILDHSRDSFLLKKALVC
                     AAKLISKDASLLEIFAPYPAKMLRSKDSISHGVLIGTNKLIQAILIHSAQYEFDNLND
                     IIQSLSNLIPDLLAKLGSLTLGGGSANSHYSAGGCLDPFLQVELMTTLRLFLQNFPQQ
                     TEPAKNKLLDALTQVATYTPTSSNSNTAVLYEAVRTIFSFKAEHALRVLGVNVLGNLV
                     ASKDCNIKYVSLNALLDVVSVEPQAVQRHRKFISKCIFDPDVSIKKRALEMTFALLNP
                     TNMKELVAEILAFLEKSGENDKPLILYCVDQLILVFDMLDASEDKWKLDVIVKVLKYV
                     GQFIPVEKITDALIMINNTSDLDHKKDVVADIVNVALENDSSGQPDENLAWRMVSIWC
                     IGEYGDLILGIGKSSEESLTNYLYESDSLHRDNTTVIHYVLMAALKLSIKIQTPMLIE
                     RLRQLIKSHTQNVNLMIQIKAVQYDIIFNQPTAVKAALLEPMPIFHKKLPDASAVKSF
                     TSRAPQTTAKKPAKKEDDLLIDLLGDLSTPDSSSNPQQPVKTSNDLLSGLSDLSSQVP
                     QNNGNNVHSTPILTKTIINVPNDAISIHSSEFVEVFSKFGSVSSGLAELSLFLRAKKN
                     INSLQILVAVPKSQVAEFGPLSSHKLASNEVAKQSLKILGGGKVKLRVKLNIDSNEDQ
                     FDHKYDVTI"
     gene            complement(<279077..>279738)
                     /gene="YOP1"
                     /locus_tag="KLMA_70138"
                     /db_xref="GeneID:34717896"
     mRNA            complement(join(<279077..279580,279688..>279738))
                     /gene="YOP1"
                     /locus_tag="KLMA_70138"
                     /product="protein YOP1"
                     /transcript_id="XM_022821386.1"
                     /db_xref="GeneID:34717896"
     CDS             complement(join(279077..279580,279688..279738))
                     /gene="YOP1"
                     /locus_tag="KLMA_70138"
                     /codon_start=1
                     /product="protein YOP1"
                     /protein_id="XP_022677752.1"
                     /db_xref="GeneID:34717896"
                     /translation="MVDYLKFFKSSLKDVEKNFGNNEVMNTIEKKTKLPKSYIIYGSA
                     ALYFLLILINVGGIGEILANFVGFCIPTYYSLKALKTNTTKDDTQLLTYWIVFSFLSV
                     IEFWSKAILAWVPFYWFFKTLFLLYIAIPSLGGAQFVFKRVIEPLSDKYMPLVEGKPE
                     NLAKKVEEAANNAANNAKASGFTR"
     gene            280390..280462
                     /locus_tag="KLMA_R702"
                     /db_xref="GeneID:34718778"
     tRNA            280390..280462
                     /locus_tag="KLMA_R702"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:34718778"
     gene            complement(<280745..>284224)
                     /gene="ATH1"
                     /locus_tag="KLMA_70139"
                     /db_xref="GeneID:34717897"
     mRNA            complement(<280745..>284224)
                     /gene="ATH1"
                     /locus_tag="KLMA_70139"
                     /product="vacuolar acid trehalase"
                     /transcript_id="XM_022821387.1"
                     /db_xref="GeneID:34717897"
     CDS             complement(280745..284224)
                     /gene="ATH1"
                     /locus_tag="KLMA_70139"
                     /codon_start=1
                     /product="vacuolar acid trehalase"
                     /protein_id="XP_022677753.1"
                     /db_xref="GeneID:34717897"
                     /translation="MIIIPLVVLVFTVLAPVYFYVTKPESSTHSLFPELAPARISWPF
                     AGTCASSSGGEEDPLYCPDAYRKASEKMYDLLKDNEYAFYDETSETLGNLLLSENTFS
                     RQPYVANGYIGSRIPNVGFGFAYDAINIWVNDSAIPGALNNGWPLRNQRYAGSFVSDF
                     YSLQEKLNSTNFAELDKDGYSTVISSIPDWTDLSIMIHRGPGEHNVEYINPTDVKLDK
                     ITDYMQNLSMRDGIVTTKFVYDNNLFVTTRTLAHRSIYPLGIVDMEIELLPQATENGL
                     HEASVELEICDTFNFTTSHRTVLADFGHDKKNEGIYMIVEPENVPYSNASMFSYFDIP
                     SRDEYTVAKTNDSVSQCTRRVLTTDSRENSTFIVRKFTGIVSSEYDNNNPEHMSNLER
                     ATAVVMENKGDYKNLLKMHRDHWKRLYADASIEIPSDGLLEMTAKSSIYHLLANSRSH
                     NVSQSRGLPVPPSGLSSDSYGGMVFWDADVWMLPALLPFFPEIAKQMSAYRNASLAQA
                     KENAKKYGLQGAIFPWTSGRFANCTSTGPCVDYEYHINVDIALSSLYIYMSGEEDEEK
                     SEEYLRYTTWPFIENAAKMFTDYVKWNDTLQQYTTHNLTDPDEFANHVDNGAFTNAGI
                     KSIMGWAHDIANHLGLDPDPKWTEIAEKIHIPISDTNITLEYTGMNSSVDIKQADVVL
                     MTYPLGYFTETSQPRNAIKDIYYYSERQSASGPAMTYPVFVAASASLLNSGSSSQSYL
                     YKSVVPYLRSPFAQFSEQSDDNFLTNGLTQPAFPFLTANGGYLQSILFGLTGLRYSYE
                     VDKDTGKMHRLLKFNPISLPMFPGGIRINNFKYMGQVLDILLTDNEGIIKHKKGNKSI
                     LIKIPDRGDIPDVKPDEYTQINGTSVNVKRAVPSGESYHTIEPGTVFKTPLYNPKRNM
                     ANNIVESKRATNITVGVPGDVAVSAIDGNNYTHWQPANKKQPGRILIDMGNGTANEIK
                     SGKILWGNRPAKSFSLSILPQFDQITQNMTSVLSQPSSHNCSNDNGWDSNSNCKYQEE
                     EENIDAAIKDVFEWYGMDLQSVIENYPELSNVSMGFIKLVDHYNVTPSYPWKNVNSTR
                     IELTLGNETNFVVDYSKVPELNLNNNLGVDLQSKDTRWRKPRFVVLTVFDTYDDDDEV
                     KGATIKELSLFDN"
     gene            <285912..>287558
                     /gene="ATP1"
                     /locus_tag="KLMA_70140"
                     /db_xref="GeneID:34717898"
     mRNA            <285912..>287558
                     /gene="ATP1"
                     /locus_tag="KLMA_70140"
                     /product="ATP synthase subunit alpha"
                     /transcript_id="XM_022821388.1"
                     /db_xref="GeneID:34717898"
     CDS             285912..287558
                     /gene="ATP1"
                     /locus_tag="KLMA_70140"
                     /codon_start=1
                     /product="ATP synthase subunit alpha"
                     /protein_id="XP_022677754.1"
                     /db_xref="GeneID:34717898"
                     /translation="MLSRSAIRAASRSVVAANLVRSMNRVARPAMVVAGRRFASAKAQ
                     PTEVSSILEERIRGVSEESNLNETGRVLAVGDGIARVFGLNNVQAEELVEFSSGVKGM
                     ALNLEPGQVGIVLFGSDRLVKEGEVVKRTGKIVDVGVGPELLGRVVDALGNPIDGKGP
                     INASGRSRAQVKAPGILPRRSVHEPVQTGLKSVDALVPVGRGQRELIIGDRQTGKTAV
                     ALDTILNQKRWNDGTDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDALKYSIIVAATA
                     SEAAPLQYIAPFTAAAIGEWFRDNGRHALIVYDDLSKQAVAYRQLSLLLRRPPGREAY
                     PGDVFYLHSRLLERAAKMSEKNGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFL
                     EAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDL
                     DASTKQTLARGERLTQLLKQNQYSPLAAEEQVPLIYAGVNGYLDNIELSRIAEFETKF
                     LAYLKANHDEITNAIRDKGELSKELLAQLKAATESFVATF"
     gene            <288359..>289573
                     /gene="CCL1"
                     /locus_tag="KLMA_70141"
                     /db_xref="GeneID:34717899"
     mRNA            <288359..>289573
                     /gene="CCL1"
                     /locus_tag="KLMA_70141"
                     /product="cyclin CCL1"
                     /transcript_id="XM_022821389.1"
                     /db_xref="GeneID:34717899"
     CDS             288359..289573
                     /gene="CCL1"
                     /locus_tag="KLMA_70141"
                     /codon_start=1
                     /product="cyclin CCL1"
                     /protein_id="XP_022677755.1"
                     /db_xref="GeneID:34717899"
                     /translation="MSSAGSATEANNSADSSETTRAHRITDDDLYRHSTQYRLWSFTK
                     EQLEQKRREVNQAAVDLVQKKQKDLVLNHSELTQEELDAIKEKAVPVTMEEEKNFVNF
                     FAKKVQSFCQSLNLPTEVCATAISFFRRFFLVNSAMNIHPKHILLTSIFLACKSENYF
                     IGIEPFAKKTKSQPSAILKYEFKLLESLHFTLLNHHPYRPLHGFFLDIQYVLRGKVDL
                     NYMGQIYTNCKRRITDTLISDAVYHFTPPQITLACLLIEDEALTLKYLEVKFGPTPQE
                     QAESVEKAKIEEEDKAKTEEESKKEETKKTEEGQSKDEPIEIKEEKPKPKTVGGSNLD
                     LDKLLALIRECQEMILKTENLSKEEATKIDARLHYCQNPMLIVERLRRQKQQRENSST
                     PNEPESKKLKVE"
     gene            complement(<290049..>292190)
                     /gene="YME1"
                     /locus_tag="KLMA_70142"
                     /db_xref="GeneID:34717900"
     mRNA            complement(<290049..>292190)
                     /gene="YME1"
                     /locus_tag="KLMA_70142"
                     /product="protein YME1"
                     /transcript_id="XM_022821390.1"
                     /db_xref="GeneID:34717900"
     CDS             complement(290049..292190)
                     /gene="YME1"
                     /locus_tag="KLMA_70142"
                     /codon_start=1
                     /product="protein YME1"
                     /protein_id="XP_022677756.1"
                     /db_xref="GeneID:34717900"
                     /translation="MGINRQLGQQRHAGLQYKRFYSDKKDGSDNGPVKPEDEAKESGE
                     ESSVGPVSHAVLASKEQQANKDLSNPKAQAEFYTLLLRSNYPQYVVSRFETPGIASSP
                     ECMSLYMEALQRIGKHAEAESVRQTLLATAPPGTVSQSLGSGTGSPVAGAPGIAGAPG
                     MAAPAYPGANNFYNPFMGSKKEPLHVVVTESTFSIVSRWLKWLIVFGAVTYGLTEGFK
                     YITEHSTLFKNNEVADKSVDVAKTNVRFDDVRGCDEARAELEEIVDFLKDPTKYESLG
                     GKLPKGVLLTGPPGTGKTLLARATAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQ
                     ARARAPAIIFIDELDAIGGKRNPKDQAYAKQTLNQLLVELDGFSQTSGIIIIGATNFP
                     ESLDKALTRPGRFDKVVNVDLPDVRGRADILKHHMKKVTVAPDVDPTIIARGTPGLSG
                     AELMNLVNQAAVYACQKNAIAVDMNHFEWAKDKILMGAERKTMVLTEATKRATAYHEA
                     GHALMALYTPGATPLYKATILPRGRALGITFQLPEMDKVDITKKECLARLDVCMGGKI
                     AEELIYGKENTTSGCGSDLQNATNTARAMITQYGMSEQVGPVNLADKWESWSGKIRDI
                     ADNEVLELLKASEQRTRALLAEKEPELHRLAQGLMEYETLDSTEIQKVCKGEVINKLK
                     MATNTVIEGPDSDDRKEIGGDKSKIPVLIKA"
     gene            complement(<292669..>295005)
                     /gene="BRN1"
                     /locus_tag="KLMA_70144"
                     /db_xref="GeneID:34717901"
     mRNA            complement(<292669..>295005)
                     /gene="BRN1"
                     /locus_tag="KLMA_70144"
                     /product="condensin complex subunit 2"
                     /transcript_id="XM_022821391.1"
                     /db_xref="GeneID:34717901"
     CDS             complement(292669..295005)
                     /gene="BRN1"
                     /locus_tag="KLMA_70144"
                     /codon_start=1
                     /product="condensin complex subunit 2"
                     /protein_id="XP_022677757.1"
                     /db_xref="GeneID:34717901"
                     /translation="MSTQLQYDDDDNGLFTNKSTMMANFEEWIKMATDNKINSRNSWN
                     FALIDYFHDLNVLKDEEDNINFQKASATLDGCVKIYSHRVDSVATETGKLLSGLAERK
                     KKQTNADGSGKDADGNEKGTDSDHEDSLEIDPLTGMPVAREDPEALAKKKRTYNRVLE
                     TTLVDFESIRVKDLAQNLSIDPLFKKALADFDEGGAKSLLINTLHVDNDLRVVFDATT
                     TEHELEHQTNTSESISSGENSVRKNGNEEEVLTEAAEPRQQEEDGEEDNEDDDDDNDE
                     VDHDISMISTPDTSVTLIEDDILDLGVKFLDFNTIEMSTICPSMDQLQSAVADIGKAK
                     SFVEGVNEQSNNFLSEKDLQTLPEVDDGIESNYDLPPDDDADIIDGAGSINYDIQQSF
                     HGSEHQGGASNYQNISQVEEKSFLDSSLINQELLSYFDVAIGQNWRGREHWKVRKIRE
                     NFKKDSSGKQVPESTNSADSNETTTEKKVPKKQFEINFFDIDEDIEEEIFASKKGFLE
                     IPVKQRTNQTHFLLPDDYKFTTEKITKLFIKPDQKMSFFSHRKNGRNKLQGSLRYNDT
                     DIKEGSNLPEIADEHFWAENYEIHEKEENDVQEYDNENAENVNNLSLEEDNGIDFNQA
                     FEDEDLDMDTKEDILGTQGILSNNNKVTYSRTAKKVDVRKLKNNVWKSISNRLHVMKS
                     EEQEEQEHRAEFQEEEEQQQQEKVTREVYDLKFTDIAQDIGKMYSSSAKADLSTSFCF
                     ICLLHLANEYGFSISDFDDYQDLKIEFPEKVVNAILSK"
     gene            complement(<295700..>297724)
                     /gene="ywtG"
                     /locus_tag="KLMA_70145"
                     /db_xref="GeneID:34717902"
     mRNA            complement(<295700..>297724)
                     /gene="ywtG"
                     /locus_tag="KLMA_70145"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022821392.1"
                     /db_xref="GeneID:34717902"
     CDS             complement(295700..297724)
                     /gene="ywtG"
                     /locus_tag="KLMA_70145"
                     /note="Sugar_tr[pfam00083]"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022677758.1"
                     /db_xref="GeneID:34717902"
                     /translation="MLEVKPDKSSNSESDTNSSTRKSGDVLVKDETSVHHKDFTSPTG
                     GVFVPLNDDDTSSLSSAAAGEDPEKRDPTKLDQDNVLSEYSEEQVMNMGRAFAAKYNL
                     PNDDDIFGRAAALARRPTEYDRMDHLKEDERIACYDEIHHPFRMPRKLLNVIAASAMG
                     AAVQGMDETVINGANLFYPKELGLGAKTKRNDWLQGLVNGAPYLCCAGVSCWTTDFLN
                     NRFGRKKVIFITCCISAITCFLQAFGPAGTRGWHYLFAMRFLLGFGIGPKSATVSVYL
                     AECSTKQLRGIVCMNWQTFTAFGIMWGYVFSLIFYKVGRAGIAGGLNWRLMLASAMIP
                     AILVLFQIPFCPESPRWLMGKGRYQEAYESTLTIRNHKILACRDLFYQHVLLMEENSL
                     QMSYRDRFKEVFTVRRNRNALVTAFICAFMQQFCAINVIAYYSSAIFLQSGFSEVSSL
                     CASLGFGLINFFFAIPAFFMIDRFGRRFLLLHTFPWLAVFLLIAGFSFWIDDRDKRIG
                     VVSMGIYVFSAIYSFGCGVVPFVIAGEVFPLYVRAIGASLFTIVLWGFNFILSLTWPS
                     MLRAFKPQGSFGFYAAWNVIGWFLVYFFMPETKQLTLEELDEVFDVPLMTRARHQLLN
                     LWPNFQIHFLRRKGVKLQPPLDRHHRMAIKAAEWNEKAEVEEIEIRKDEE"
     gene            <300047..>300796
                     /locus_tag="KLMA_70146"
                     /db_xref="GeneID:34717903"
     mRNA            <300047..>300796
                     /locus_tag="KLMA_70146"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821393.1"
                     /db_xref="GeneID:34717903"
     CDS             300047..300796
                     /locus_tag="KLMA_70146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677759.1"
                     /db_xref="GeneID:34717903"
                     /translation="MSGKFTRLVLLPVTGFALGFGYFVKPWHLDEASLQTLHRPLHDQ
                     RTDILDKLRQTEWVRKLKESSAYVMHRQSEKVPPPHRDYHVGQGLLYGPSKLEIDPVV
                     FSDDENHKIHVIYHLGQNLSNEKGAVHKGVLALLLDEALCYCGFPTLPSKRGVTAALD
                     ISFVKDVPVDSTIVLNAQVVENKGRKCIIKGTLESPPIDSTTTLGSMKYWIAKSVPKW
                     AYNPQPTIYATATCILVEPKWFKYVSWINIF"
     gene            <301602..>303155
                     /gene="GLO3"
                     /locus_tag="KLMA_70147"
                     /db_xref="GeneID:34717904"
     mRNA            <301602..>303155
                     /gene="GLO3"
                     /locus_tag="KLMA_70147"
                     /product="ADP-ribosylation factor GTPase-activating
                     protein GLO3"
                     /transcript_id="XM_022821394.1"
                     /db_xref="GeneID:34717904"
     CDS             301602..303155
                     /gene="GLO3"
                     /locus_tag="KLMA_70147"
                     /codon_start=1
                     /product="ADP-ribosylation factor GTPase-activating
                     protein GLO3"
                     /protein_id="XP_022677760.1"
                     /db_xref="GeneID:34717904"
                     /translation="MASIDESGEIYCDKEFVDKVFARLASKSENRVCFDCGAKNPTWT
                     SVPFGVLLCIHCSGEHRNMGTHITFVKSANLDKWTVNNLRRFKLGGNDRAKEFFLKNN
                     GKQYLSSSSNRMAKYTSQVAKKWQAHLNQKVAKDAEQHPGELVFSTEDDSNTDANSGS
                     SKGNSADDFFSNWEKPANHSNLSLTGSPRSLTPTATGNKNGSSILSGNGNGNKSGNGS
                     RITTTRRSTLAGSSGLSQNKKHSILSSSRKGKKTATAKKVDADLFDQFEKEAKEEEEL
                     ATTFASTSLGTANLTSNKYAATTQSLDTASRQGSYSSKPSKSSISGGVDDQEEDEWSS
                     RYNDGITFDQINSSNVGLIGSDSTSKPKLAKLGFGMTSNNAVKEANAANESKRAASGP
                     KYTGKIAQKFGEQKGISSDQVFGRGSYDDEASKEAQEKLRQNFSNATSISSASYFGED
                     QQEESFDEFGRPINPQNAGRTNRSGSLGGRNFMEFTSGADDEFDLLKNAVEQGAQKLG
                     NYLRDYIRN"
     gene            complement(<303818..>304435)
                     /gene="ROX3"
                     /locus_tag="KLMA_70148"
                     /db_xref="GeneID:34717905"
     mRNA            complement(<303818..>304435)
                     /gene="ROX3"
                     /locus_tag="KLMA_70148"
                     /product="mediator of RNA polymerase II transcription
                     subunit 19"
                     /transcript_id="XM_022821395.1"
                     /db_xref="GeneID:34717905"
     CDS             complement(303818..304435)
                     /gene="ROX3"
                     /locus_tag="KLMA_70148"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 19"
                     /protein_id="XP_022677761.1"
                     /db_xref="GeneID:34717905"
                     /translation="MTDIEESESSYPNYYYYVDPTLPVYEPQQPNPVDDLISVYGLEE
                     VARQVARTNPDGTKAVKLRKSYKNQIQDLSGRFLTIPSRENGKGGDISHVIFQNNPDM
                     VNHVKLVDNMSEEEYRSAMMNRDTALFEPPQMDWDMCSTVIGQLMKSHPSEFKNAGFD
                     VDDLAFDLNGTGTKTKKRKYKSNGSSMASPNAELQQDDMKRRRLE"
     gene            <306574..>306966
                     /gene="RPL32"
                     /locus_tag="KLMA_70149"
                     /db_xref="GeneID:34717906"
     mRNA            <306574..>306966
                     /gene="RPL32"
                     /locus_tag="KLMA_70149"
                     /product="60S ribosomal protein L32"
                     /transcript_id="XM_022821397.1"
                     /db_xref="GeneID:34717906"
     CDS             306574..306966
                     /gene="RPL32"
                     /locus_tag="KLMA_70149"
                     /codon_start=1
                     /product="60S ribosomal protein L32"
                     /protein_id="XP_022677762.1"
                     /db_xref="GeneID:34717906"
                     /translation="MAASLHPKIVKKHTKKFKRHHSDRYHRVSENWRKQKGIDSVVRR
                     RFRGNISEPTIGYGSNKKTKFMGPDGRKVVLVSNVKDLSPLLMHTKTFAAEIAHNVSS
                     KNRIVILAEAKKNGIKVTNAKARLALEA"
     gene            complement(<309590..>310873)
                     /gene="MAP2"
                     /locus_tag="KLMA_70150"
                     /db_xref="GeneID:34717907"
     mRNA            complement(<309590..>310873)
                     /gene="MAP2"
                     /locus_tag="KLMA_70150"
                     /product="methionine aminopeptidase 2"
                     /transcript_id="XM_022821398.1"
                     /db_xref="GeneID:34717907"
     CDS             complement(309590..310873)
                     /gene="MAP2"
                     /locus_tag="KLMA_70150"
                     /codon_start=1
                     /product="methionine aminopeptidase 2"
                     /protein_id="XP_022677763.1"
                     /db_xref="GeneID:34717907"
                     /translation="MSDEIKAEVREAADASQEQTPETSTPVEVGAEGVEETDAAGAGE
                     QDGKKKKKKKKKKANNMKNIALIYPDEKYPEGEWMEYHQDFNLNRVTDEEKRYNERNE
                     EYEQRVNDMRKAAEIHRRVRRNARNKIKPGMTLTEIVNIVEDATRKFTGTDPNGDHVD
                     QPKSQGVAFPTGVSLNHCAAHFTPNAGDKTVLKYEDVMKLDFGVHVNGYIIDSAFTVT
                     FDPQYDNLLAAVKDATNTGIKEAGIDVRLTDIGEAIQEVMESYEVEINGKTYQVKPCR
                     NLCGHNIAPYRIHGGKSVPIVKNGDTTKMEENEHFAIETFGSTGRGYVVQEGECSHYA
                     KKQGAHSTPSLSSAKHLLKVIDDNFGTIPFCRRYLDRLGEDKHLYALNSLVKQGIVQD
                     YPPLNDIKGSYTAQFEHTLILHPHKKEVVSRGDDY"
     gene            <311358..>311807
                     /locus_tag="KLMA_70151"
                     /db_xref="GeneID:34717908"
     mRNA            <311358..>311807
                     /locus_tag="KLMA_70151"
                     /product="37S ribosomal protein MRP21"
                     /transcript_id="XM_022821399.1"
                     /db_xref="GeneID:34717908"
     CDS             311358..311807
                     /locus_tag="KLMA_70151"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="37S ribosomal protein MRP21"
                     /protein_id="XP_022677764.1"
                     /db_xref="GeneID:34717908"
                     /translation="MLGFRGILSSVRVNARPFSQSAVRTQEIIDFTRLSLLKRTKEAD
                     GLSRKDSSLSSMMQSPREAALHSKLTGIQAGRTVDVFTGNTAAAFQRLGAVVRANGIM
                     RDKRSQRFYLKPGKAREMRRSRKHRKEFMKSFKHLIEVVKDAKRKGY"
     gene            <312177..>313577
                     /gene="AVT6"
                     /locus_tag="KLMA_70152"
                     /db_xref="GeneID:34717909"
     mRNA            <312177..>313577
                     /gene="AVT6"
                     /locus_tag="KLMA_70152"
                     /product="vacuolar amino acid transporter 6"
                     /transcript_id="XM_022821400.1"
                     /db_xref="GeneID:34717909"
     CDS             312177..313577
                     /gene="AVT6"
                     /locus_tag="KLMA_70152"
                     /codon_start=1
                     /product="vacuolar amino acid transporter 6"
                     /protein_id="XP_022677765.1"
                     /db_xref="GeneID:34717909"
                     /translation="MSSSVQSGVITLLHTACGAGILAMPYAFKPFGLIIGLLMIAFCG
                     LCSFTGLYLQAYVSKYVPGRHASFFSLCQLTYPQLSVVFDAAIAVKCFGVGVSYLVVV
                     GDLLPQIMSTFSHNEWLLSRQFHITAITLVVVTPLCFIKKLDSLRYTSSIAISAVGYL
                     CLLVVFHFLVPSSEIDELKGHVSIWKPSDVDSSVLSSFPIFVFAYTCHHNMFSIINEQ
                     SNNSLASLTKLIRTAIGLAMCLYFMIGALGYCTFGDNISGNIITLYPMSVSSTIGRIA
                     IVLLVILAFPLQCHPARASINHILHFFTNSKEHQHQHQLSANEQNRLLSNLEENAPLS
                     GSASSFIDDIDDLVEEDSPRQPPIVTLEGKKFICITTGILVCSYALAMTVTSLAKVLS
                     IVGATGSTSISFILPGIFGYKLIASEYQNQEGSTKPPTGERVLRIVSLLLSIWGVIVM
                     VTSLSATLLFHAVGSH"
     gene            <313883..>314965
                     /gene="SHO1"
                     /locus_tag="KLMA_70153"
                     /db_xref="GeneID:34717910"
     mRNA            <313883..>314965
                     /gene="SHO1"
                     /locus_tag="KLMA_70153"
                     /product="protein SSU81"
                     /transcript_id="XM_022821401.1"
                     /db_xref="GeneID:34717910"
     CDS             313883..314965
                     /gene="SHO1"
                     /locus_tag="KLMA_70153"
                     /codon_start=1
                     /product="protein SSU81"
                     /protein_id="XP_022677766.1"
                     /db_xref="GeneID:34717910"
                     /translation="MVLIRRSQARAVRQNSHVKHEFHISSFLGDPFAIGTISIAFVAW
                     VIALGGSIAVASSSVSFPRFSWWSIVYQILVLLTLFGMYCMDLVDYYRTFLTCAVGVA
                     FVYTSNSTNSIVYNQGSNSGAAAAGFILLSMINLVWVFYFGGDNASPTNRWIDSFSLR
                     GIRPSVVETTMGIARSQRLPPKPVYPYQYQEDLRSNSLHDLQHNSEDEENIERTGNLY
                     APELQSSTKYVSSTVLNGFENTDHSSSKPNLNLDLAAPNTATFNTQASNSFITDTTNA
                     NTDTTMGDTLGLYSDIGDELNSFPYTAEALYTYQADESDAYEISFEQGEILKVGDIEG
                     RWWKAKKSTGQTGIIPSNYVKLLDGK"
     gene            complement(<315188..>323500)
                     /gene="TEL1"
                     /locus_tag="KLMA_70154"
                     /db_xref="GeneID:34717911"
     mRNA            complement(<315188..>323500)
                     /gene="TEL1"
                     /locus_tag="KLMA_70154"
                     /product="serine/threonine-protein kinase TEL1"
                     /transcript_id="XM_022821402.1"
                     /db_xref="GeneID:34717911"
     CDS             complement(315188..323500)
                     /gene="TEL1"
                     /locus_tag="KLMA_70154"
                     /codon_start=1
                     /product="serine/threonine-protein kinase TEL1"
                     /protein_id="XP_022677767.1"
                     /db_xref="GeneID:34717911"
                     /translation="MSLSYEVSSIISGLSSQKLKERKESLENLNSVLKTSPDQITVKA
                     FSPIIDALVNTIELEKVKYDKLQTQANNDSRLDLQEDRLNSTAYALRLFIEKCCNRFK
                     PKHVKLLSFMLFELMTRHGSLSIVPSVAEHLTYALLTLSSSPVFEHNFDLQHWISLIN
                     NICESMACYLDITLNDKIITNFLNILLSLMGLDTIGMEEIGGSIIRMLNKYLSLVTKE
                     NSNTKIVMGLINMTVLKLHLLYFQETLYLIYKTMNHLLNVKVCNDSVLKEISRFNLMT
                     SELLHNNVPLMVGADKSHLFVCKTDIFRALQSYLEHSLQQMDTLKLTFDGLGTTDAVN
                     YSEFDWYNFPNIQIIDDVETEDPWHFILSMTILLDVNYKFVENQENALTGGSLLFKRR
                     KVKDSFSHMLKDSMTYNDFLCNCLESSYNKIKISGLQLTLFYLSIFDCNKNDILQLKD
                     SLMSCTKDPDLMVWCLKSFTTLCAQKEIVFTTDELMRLFKLVIPLLKIKEKCKIACAL
                     FYNLIENHDIVFEDKNILQHFQDLFLLSDVNGPAILCNEAFKFWMNLYGYVQHLQMGK
                     SAIKSIYGWLYSKWDQLYTIESSAIQIDIFASWLTSKKHVSFRRLADNKGSAFHRNWM
                     QLAHERKHLLSYSIKPRTKILTNESYAIVLTDEPERIRFLYKLFELLDDHVNPYSFLV
                     RSTVVIRVIETFVGDKSYRDYVVRFNELFTIFESSIDYKENHTLLSIIQNAKVIKNSL
                     LGYTFLEALPTENILTILKQKITNELDFNADLDDFASSSPKPILSSKSFVNNFEMVLE
                     FMLDICSLSDSSLEPLLIFIELFKDLPPALLLEALQIFINSINRLEVNFSENAVEQFT
                     QFLGSTLLVPGYDTSSVCMTVLIEYLSLISKYWIMKNREDVIAGDCNDIFDWIIEKYE
                     DVSFCSCHSFFTLSRFMIHLLENFNLSQSSISGGKQRVFQILSGCINRLPKYLINRLV
                     PELKNYANKVGVTNQRILFKEVIQRFSSHQITVESTSFYSLTCVQLSNINEYFLTNVI
                     LHLLESPNIEYVTHYVKKSITLISSHRQLNNGKELFHQCRFSIISQWFDESAKSRVYE
                     PTIWKVDLFGFEFDDFCIKYQLELTAFFFAKSSTYYFIIDHLKTLLNVKQEKLLNQAI
                     APTIALSYIDNGVKDLIFDILEDVLGKRLVKIFSNIPEDFVYYLIKFTDLSNLSTVIL
                     VWKKIFIHSTFKNLLASNTLGYTQIKNNVTVPFATIYKVAKGKGLFDMIDESKFAYLI
                     QRLLRDLSECKLVDQKINTIRQIALLVLVFENLLSSFKDFDFLLLEIANLLNDGHFLE
                     VQSLIMDLLDCAMRLDISIERSFFQLFRFCIQNTENTDVTTTLLPIMNPKLFNSKYLN
                     HRSLWVTCYELLIQKRGSFCFNDIKTVLTLDIMNDRTIFLLSDLFDNFEYNNSSPVEE
                     EISQNVISNLIHILDHGLGICNSVKKWAGKLLGEVFCERSYEELVTSKNSSIHLEFDL
                     PIMLKTLWSYHKNSDNIKVRFLLDNILYIVLTDRNVISELKSEEYPDISAFTPITVSN
                     FEECHGAISCMIDEQLLHEIFLDKYCEYSKWIGGILSHILSLVIDNYPSFRVLLSLIG
                     VADDLCETLLECLVKLLLARSPKQRSVFLASIFNKIGLLKDTKDYKPKTKTLVHMFLL
                     IRGMAFNDIHEAAFLYKKIDFNSLIPILLDLEMNHFALMLYEEYQGTIHDNTPKIEEL
                     YEIYSPIKENDMFYGLPLTTSLSSSLNLIMKTKFDSFNNFALNSGQFEEAVRNGRMSS
                     LPDFASVASSNGFTGLAMMLDNNIEHSTFTEEQYNWSLKLNRWDLPIPDKLDSLAKTS
                     FAIIKGYSNNSVVDLDEHLLRVVNSSSLITDNQTNLDILECLRSISMLKKIESIDGDV
                     LLNLSKLHENELMNADYVPSTCQDIQYWTRHHFLMLKTKNYDDGENNASPTQTFKLAT
                     VLNLVHMCEYLRSEGRQQDIINSAILLENVVLKLTDLPNREVNDIYTLSCKRASTVES
                     ARMLWKTNESAIAIKMLESLLQDKITVKSISAKLPDGLRYIILPDIVIDSQLVAWYSH
                     SKHRSSDTIYKDHILRYESELSEISDHDMKSSICYSYAEFCYKQCQRVKEDELLNLKD
                     KIEKSCQEQSELYKIFKNTKLREIERKEAKRHYNRITLQIQHDKDRYNKIVNSRTSFV
                     SHALHFFLTVLVYSNAKDDEVMDKFCSLWFSFSHDNIINSKLQKEIGTIPSYKFLPWV
                     NQMASKLTNLGSPFQDTLQLTLKRMLYKLPYETLYPLLSMSFQDSESSVIDPITKARV
                     DIANRIVTALDMYDNGKYGSEFTVPIKDFCSMSVGLASYKLPPKTKFIQLENLNIGNY
                     WLKDLPKAHLPLPTVPFPISCSQDGRRKDRPYITSIDPVVQISSSGLSLPKIATFTLS
                     DGSKHRVLLKGSNDDLRQDAIMEQVFKQVNKILNANTETRKQKLRIRTYEVIPLGPRA
                     GIIEFVANSIPLHNILLDLHLNDELSFDKARKIMKAVQNQSIEERVAAYERITEKIKP
                     QFRNFFFQSFVEPHEWYDKRLSYTKGVVTTSIVGYLLGLGDRHLNNILIDKKTGEPIH
                     IDLGVAFDQGKLLPIPELVPFRLTRDIVNGFGVTGVEGVFRKNCERVFKVLQDEKERV
                     MCVLNVLKWDPLYSWKMTPLKKRKLQAKIAVDYDDDEDVEDVGENDDNNNGINASRIN
                     GFSNEENNNDESIRALNGVENKLYGEGLSVEAIVQDLLASATDTQSLATIYMGWSPFY
                     "
     gene            complement(<323829..>324789)
                     /gene="RPL23B"
                     /locus_tag="KLMA_70155"
                     /db_xref="GeneID:34717912"
     mRNA            complement(join(<323829..324200,324748..>324789))
                     /gene="RPL23B"
                     /locus_tag="KLMA_70155"
                     /product="60S ribosomal protein L23"
                     /transcript_id="XM_022821403.1"
                     /db_xref="GeneID:34717912"
     CDS             complement(join(323829..324200,324748..324789))
                     /gene="RPL23B"
                     /locus_tag="KLMA_70155"
                     /codon_start=1
                     /product="60S ribosomal protein L23"
                     /protein_id="XP_022677768.1"
                     /db_xref="GeneID:34717912"
                     /translation="MSGNGAQGTKFRISLGLPTGAIMNCADNSGARNLYIMAVKGSGS
                     RLNRLPAASLGDMVMATVKKGKPELRKKVMPAIVVRQSKAWRRKDGVYLYFEDNAGVI
                     ANPKGEMKGSAVTGPVGKECADLWPRIASNSGVVV"
     gene            <325507..>326322
                     /locus_tag="KLMA_70156"
                     /db_xref="GeneID:34717913"
     mRNA            <325507..>326322
                     /locus_tag="KLMA_70156"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821404.1"
                     /db_xref="GeneID:34717913"
     CDS             325507..326322
                     /locus_tag="KLMA_70156"
                     /note="RING[cd00162], RING-finger (Really Interesting New
                     Gene) domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677769.1"
                     /db_xref="GeneID:34717913"
                     /translation="MEGGEGEGVRSIGSALSNSVDAMAHLSDGNDEHSIVEVGEQTEG
                     SRQDGVDDEDGSIGMGSRRRRIDLGQNETDTETQVRKIRRISSEDDEGSDVVDVEDND
                     DLEDGSQSDDQQPVEILDISQTNAATADGTDQHQQQVEQNGSDGNSDEGNESEDLKVL
                     TEEDQIRAQQVIEVDDENDSEVDYSKKSTSEMPLETKKAADYVCPICMEPPEAALVTK
                     CGHIFCTTCLYGMINSSKGNGRKNGLCALCRENVRPQELRLVIMRKQRIRKPN"
     gene            <326673..>327224
                     /locus_tag="KLMA_70157"
                     /db_xref="GeneID:34717914"
     mRNA            <326673..>327224
                     /locus_tag="KLMA_70157"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821405.1"
                     /db_xref="GeneID:34717914"
     CDS             326673..327224
                     /locus_tag="KLMA_70157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677770.1"
                     /db_xref="GeneID:34717914"
                     /translation="MTYNYNTSTTKQFQCKPIPKYKAEKKEPKASKQDETGTSNGKNT
                     LTALTPQQCMNYYYKKKPAPYYLWSKTYRVRHKPLRLDRFPDSELRKIRCGAFVGHQD
                     HRCDYCPFHGIKHGHTLHPTLNCICRFKSVAPSPLKHDITKYMVTKTEPLFNYKHVYF
                     NTGNRQIDRIISHMCMNNANKKN"
     gene            <327832..>329190
                     /gene="PFS2"
                     /locus_tag="KLMA_70158"
                     /db_xref="GeneID:34717915"
     mRNA            <327832..>329190
                     /gene="PFS2"
                     /locus_tag="KLMA_70158"
                     /product="polyadenylation factor subunit 2"
                     /transcript_id="XM_022821406.1"
                     /db_xref="GeneID:34717915"
     CDS             327832..329190
                     /gene="PFS2"
                     /locus_tag="KLMA_70158"
                     /codon_start=1
                     /product="polyadenylation factor subunit 2"
                     /protein_id="XP_022677771.1"
                     /db_xref="GeneID:34717915"
                     /translation="MDASAEGNASKKYTSQRRTIDISSSYDRLYFLKKHGLDKSLYIE
                     PESSYNANILPPDSYGIHGNGINMATKFTHLSSNKVKHVIPALTWTPEGRRLVVATYN
                     GEFSLWSGASFNFESIMQAHDSAVTVMTYSHTGDWMVSGSADGELKIWQPNFNMVKVM
                     DQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPK
                     MGLIISGSKDNLIKFWDPRSGGCVSTMLGFKHTIISTKFQPKQGNLFSVISKDKTCKV
                     YDIRQQAKELFSVRDDVDYMTLQWHPINETMFTVGCYDGSIKHFDLSQENQPNKPTHN
                     IPYAHEKCVTSLAYSPIGHIMASASKDRTIRFWTRSRAVDPNAFDDPTYNNEKVNAWY
                     FGINNNINAVRNKTEHGIALPPNEDENENETNEISKKIETERGPTMQLPGLGSGLPGL
                     SF"
     gene            complement(<329950..>331338)
                     /gene="PFK27"
                     /locus_tag="KLMA_70159"
                     /db_xref="GeneID:34717916"
     mRNA            complement(<329950..>331338)
                     /gene="PFK27"
                     /locus_tag="KLMA_70159"
                     /product="6-phosphofructo-2-kinase 2"
                     /transcript_id="XM_022821408.1"
                     /db_xref="GeneID:34717916"
     CDS             complement(329950..331338)
                     /gene="PFK27"
                     /locus_tag="KLMA_70159"
                     /codon_start=1
                     /product="6-phosphofructo-2-kinase 2"
                     /protein_id="XP_022677772.1"
                     /db_xref="GeneID:34717916"
                     /translation="MSGTSSSSNDLSRPDTLKTMESTRKHLNSLTVSTNTSTNSLFSL
                     HGSSSSSIFRTISRVETEPEVDGDVYYRALQDSSSAHATNNSYLSQGSSLTIQFGNKR
                     QNLNHKFCVILIGLPATGKSTISRHLINFLHSSARTSHLRCSIFNAGNVRRKLSVRRR
                     HVSAPFMAPELNKSDDDLFNPKNSHKKEEYARITLAKLLDEIENDRCDLAIFDATNST
                     LKRRDFVLQEIRNFNKTQYELYNAKNAGTGSSSGTDTESTYGAETEGKPDEDSGSIHI
                     TPIFLQVSCTEPTFVKFNIHNKTFNQDYYDKPYEYAVRDFARRLQHYHSQFVQFSKDE
                     FDHYCKENARINEGSHNPNFGLFFFHIMNAGQFSADDSSMYYFPSQYCSDTAELINTM
                     EYFVENYSKMYGYEYIEKANTFWKYGSTTTNRQTLQASSSECTDQIDASVRKQHLVTL
                     NEVINDAYLQTL"
     gene            complement(<333116..>333757)
                     /gene="MED7"
                     /locus_tag="KLMA_70160"
                     /db_xref="GeneID:34717917"
     mRNA            complement(<333116..>333757)
                     /gene="MED7"
                     /locus_tag="KLMA_70160"
                     /product="mediator of RNA polymerase II transcription
                     subunit 7"
                     /transcript_id="XM_022821409.1"
                     /db_xref="GeneID:34717917"
     CDS             complement(333116..333757)
                     /gene="MED7"
                     /locus_tag="KLMA_70160"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 7"
                     /protein_id="XP_022677773.1"
                     /db_xref="GeneID:34717917"
                     /translation="MSDKNEISALYPPPPPFIQFFTEENAVLHSKCQADKAVAESLTA
                     RQLEQLKYFEKPELPKDGTYRAFGNVWQINDKLPELSQMGIEQLYKKHSSASGSASGS
                     GSASESADDSPQSGANYENKIQELKKLLKSLLLNFLELIGLLGVDSSMYDKKLNEIRV
                     IAINIHHLLNEYRPHQSRESLIMLLEEQLEHKRREMEQINKTCDEVEAKLAEL"
     gene            <334249..>334575
                     /gene="HRT1"
                     /locus_tag="KLMA_70161"
                     /db_xref="GeneID:34717918"
     mRNA            <334249..>334575
                     /gene="HRT1"
                     /locus_tag="KLMA_70161"
                     /product="RING-box protein HRT1"
                     /transcript_id="XM_022821410.1"
                     /db_xref="GeneID:34717918"
     CDS             334249..334575
                     /gene="HRT1"
                     /locus_tag="KLMA_70161"
                     /codon_start=1
                     /product="RING-box protein HRT1"
                     /protein_id="XP_022677774.1"
                     /db_xref="GeneID:34717918"
                     /translation="MATDIDPREAQVDSPQDAKPNFEITKWTAVAFWSWDIDVDNCAI
                     CRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIKSRNVCPLDNKPWK
                     LARCGK"
     gene            complement(<334797..>335732)
                     /gene="PHA2"
                     /locus_tag="KLMA_70162"
                     /db_xref="GeneID:34717919"
     mRNA            complement(<334797..>335732)
                     /gene="PHA2"
                     /locus_tag="KLMA_70162"
                     /product="putative prephenate dehydratase"
                     /transcript_id="XM_022821411.1"
                     /db_xref="GeneID:34717919"
     CDS             complement(334797..335732)
                     /gene="PHA2"
                     /locus_tag="KLMA_70162"
                     /codon_start=1
                     /product="putative prephenate dehydratase"
                     /protein_id="XP_022677775.1"
                     /db_xref="GeneID:34717919"
                     /translation="MVKVLYLGPAGTYSHQAVLQQFADEELIPTNSIPSCFKTLIEDE
                     DIDYGVVPLENSTNGQVVFTYDLFRDFMQSEEEPKLEVVGEQYVDIAHCLIAPAPLEV
                     DKLRKIGTIYSHPQVWGQVKDYLADLEKKYGKFTKIDCNSTSEAVTKCIQEWDSKERI
                     TLAIGSRASAKLNKGFIVDSGINDIKGNTTRFLILRRRKPNNRLVTDCLPPNTDSKKV
                     NLVTFVTKQDDPGSLVDVLNVLKDQRLNMCSISSRPFHADSLAGRKWQYCFFIEFYHS
                     ETTDYELLMEKFDEYCAKWIHWGRFYRNPSYYQVS"
     gene            complement(<336077..>337048)
                     /gene="ATP11"
                     /locus_tag="KLMA_70163"
                     /db_xref="GeneID:34717920"
     mRNA            complement(<336077..>337048)
                     /gene="ATP11"
                     /locus_tag="KLMA_70163"
                     /product="protein ATP11"
                     /transcript_id="XM_022821412.1"
                     /db_xref="GeneID:34717920"
     CDS             complement(336077..337048)
                     /gene="ATP11"
                     /locus_tag="KLMA_70163"
                     /codon_start=1
                     /product="protein ATP11"
                     /protein_id="XP_022677776.1"
                     /db_xref="GeneID:34717920"
                     /translation="MIKSWTRVATRSASQLTAAQFKRIISASSSLYSTSNYSTESLDQ
                     KYKDKLLEKAREQGYNSIEELKNALKEEIEKKKLELNKIDPLKELEDYEQRTKMSSNI
                     AKSRGPIDPSTPKMPYKTLDSFLDVEKVKNLSKQECEFLWRARWANKDNVLTAVVPID
                     VWNKMSALAKENPYFVIPLPRESAVVEGNEESNAAPADKKEPAVEMHYIQWQFVGPKT
                     VHCIMTTLAEFKLHKEYARPHTTLQFHLDLAEDKNIVLMNGQVETDSNVTLPESQLLV
                     LNVQRFYGAMGQDTSFAKKRVQLLKDFTSGSPQFNVDLLVALAQTME"
     gene            <337361..>338179
                     /locus_tag="KLMA_70164"
                     /db_xref="GeneID:34717921"
     mRNA            <337361..>338179
                     /locus_tag="KLMA_70164"
                     /product="protein DAL82"
                     /transcript_id="XM_022821413.1"
                     /db_xref="GeneID:34717921"
     CDS             337361..338179
                     /locus_tag="KLMA_70164"
                     /codon_start=1
                     /product="protein DAL82"
                     /protein_id="XP_022677777.1"
                     /db_xref="GeneID:34717921"
                     /translation="MAGNANSNLDELLVALLAEYKPHLQTHSHRMKTWDDLLKEFNRR
                     SGLRYRQTRTLKRRFDKLCSVYLKYGSVKVMNFDTFKQLVFEFEHERQKSSSSTIETS
                     NALNRLARKLSETGEINDPPVGKALEEVQHDDVEDDGNVEDDERDPISVPSTANMESA
                     EIILDDSEDDQTPLDSITVLPHTQMKRFRRQQLQENKLRSDLAHETLSNASNSTYGNN
                     VNGLEVEGRASNEVSLQQQIYELQNSIEESRRREEEFRRQVSYKLDYIVSLLKE"
     gene            complement(<338249..>340939)
                     /gene="EMW1"
                     /locus_tag="KLMA_70165"
                     /db_xref="GeneID:34717922"
     mRNA            complement(<338249..>340939)
                     /gene="EMW1"
                     /locus_tag="KLMA_70165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821414.1"
                     /db_xref="GeneID:34717922"
     CDS             complement(338249..340939)
                     /gene="EMW1"
                     /locus_tag="KLMA_70165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677778.1"
                     /db_xref="GeneID:34717922"
                     /translation="MNALLHTHLLSSSDVSALSAYPDDTLTLATQKILSGLSHEVIEG
                     IVSDVIALESNDRETTLKTLKEWTDSYVLSKHSAEESLLVAIAFLHCFIQNNFTGQAT
                     PTSSDTLVFGKEKLERTQRNVLASLLNVAGQPAYELCDDPVYLILALLILESLTDERS
                     LFHPDWEHDAEITITKDIPSTKALAYWWRARAILVQLSLVSEPSGIHPIVASSILKSV
                     DIAHAITKDLPNEATESLKKQLYTIYYLENCKCLLAIQTEHLCLPALTKAKKLTGFEF
                     VLTGARAKRTKFQQVAHSGLIILAKSQSNENDTINNELPETFELNSDLLLEKPHFESI
                     GAEPLDEQIIKKQKVDETNGFDDEKLLPVAVRQEFIPQALKDLDPNNQPALNQYDNIQ
                     LLLRLYTIRQTSPANNPMTEEELSALIARVLYQEGSKNWTVFSRALWERSIVETKKAK
                     TIERGLLQMQSLVEELGLRITTKMIPDRVGSVESTQQRLKYIHQLPFIPRWSLDATLA
                     EKYMSLGILRSAVEIYERLQMACEAALCYAAVGDEKLAEEILVKRIETNPEDARAYSI
                     LGDIRQDPALWEKSWEIGKYANAKNSLGRYYYNPPKESGLERDYTQALKHLNDSLSIF
                     PLSFDTWYFYGCIGLECGKMNLAAEAFSRCVALDETHSLSWSNLSAAYVQLDKLKEAH
                     SCLRRAISSDARKNWRIWDNYMIVSMKLGEWDEVLLAFRHLVDLRKDQGGETSVDLPI
                     LEKLVEILISSDYPTDSSQRLSHFQQSCLEFVCDILPSIVTTSVRLWKLVAKVELWRR
                     RPWVALACHEKAFRAITHNPDLTIDEKIWNESVDVCGDLVAAYESLGEMEGKYGAGDV
                     VCKNWNYKARSSIKTLMSRAKNYWEDSDGWDRLMDLKATL"
     gene            complement(<341288..>343669)
                     /gene="ALR1"
                     /locus_tag="KLMA_70166"
                     /db_xref="GeneID:34717923"
     mRNA            complement(<341288..>343669)
                     /gene="ALR1"
                     /locus_tag="KLMA_70166"
                     /product="magnesium transporter ALR1"
                     /transcript_id="XM_022821415.1"
                     /db_xref="GeneID:34717923"
     CDS             complement(341288..343669)
                     /gene="ALR1"
                     /locus_tag="KLMA_70166"
                     /codon_start=1
                     /product="magnesium transporter ALR1"
                     /protein_id="XP_022677779.1"
                     /db_xref="GeneID:34717923"
                     /translation="MSDTKSVESSERNLSRTTSAGASLASLKTEEHNELYDHRQQQDY
                     ASHSFVPTAAAAATNPLRSARNPLPSMSPKLSGVHAAGLSGSSGINFNGDSDDELGIP
                     GHHPDPTPGHNPRINVTSASRAPSVTSDFRTRTPPAAPPHSGLHRNRSHLDPQQQEQQ
                     QPQAPPSRRGSHSLGIPLKKKKSRSSSTTSVKGAPLARTLSVKSQNSQKSRELRRRNT
                     RNASIDSDDSQISHLSQETEEDVCFPIQKREHTRINGIDFDELEEFSTQERVMNKSHL
                     YSETIPSPLDNTYGAHSLRKPNSSTETSTSSSSAALKYTPKMEIHQHGISFGNNKVEP
                     DEYDEEDMKKMNSNYTAAAPPTPEPPFEVPNRFAFFSSDVSDTIHAPDLSSLIRPNQS
                     FRELFKDGASTWWLDCSCPTDEEMRCLTKAFGIHPLTSEDIKMQETREKVELFKNYYF
                     VCFHTFENDIESENYLEPINVYIVVFANGILTFHFNPISHCANVRRRVRQLRDYVGVN
                     SDWICYALVDDITDSFAPVIQSVEYEADAIEDSVFMARDMDFAMMLQRIGEGRRKTMT
                     LMRLLSGKADVIKMFAKRCQDDINGIGLPLTSQVNIANLQYKNSQDAPPPPERRQQPR
                     ADIAMYLGDIQDHIVTMFQNLLSYEKIFSRSHSNYLAQLQVESFNSNNKVTEMLGKVT
                     IIGTMLVPLNLITGLFGMNVRVPGQPDGTGTFGWFFGILGVIFVFAVGSLLFSSYWLS
                     RINPPATLNEASASGTKSILNFKPRTMKHQPHGPNKSDKSVLSFSTNKMGRYE"
     gene            <344784..>345125
                     /gene="TDA2"
                     /locus_tag="KLMA_70167"
                     /db_xref="GeneID:34717924"
     mRNA            <344784..>345125
                     /gene="TDA2"
                     /locus_tag="KLMA_70167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821416.1"
                     /db_xref="GeneID:34717924"
     CDS             344784..345125
                     /gene="TDA2"
                     /locus_tag="KLMA_70167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677780.1"
                     /db_xref="GeneID:34717924"
                     /translation="MTTEVEISDRSTELNGPVSAERLTTLLNDALGKDEPVQASIESV
                     VKHLNESSSKHKFIVNATTLEANSVENADFSIDNYVGSSWNAKSDGVFHCQLKKGDRT
                     TVLVSVFWIAV"
     gene            complement(<345181..>347565)
                     /gene="SEC6"
                     /locus_tag="KLMA_70168"
                     /db_xref="GeneID:34717925"
     mRNA            complement(<345181..>347565)
                     /gene="SEC6"
                     /locus_tag="KLMA_70168"
                     /product="exocyst complex component SEC6"
                     /transcript_id="XM_022821417.1"
                     /db_xref="GeneID:34717925"
     CDS             complement(345181..347565)
                     /gene="SEC6"
                     /locus_tag="KLMA_70168"
                     /codon_start=1
                     /product="exocyst complex component SEC6"
                     /protein_id="XP_022677781.1"
                     /db_xref="GeneID:34717925"
                     /translation="MPSSEIERISQLLKDDVSIESIRRVRDNLIKEKSTVEYQLNKQA
                     KARFQDAQSCLQLMTQAQRNMKSLKNDLQKVDHLSKENRSSIERYDIINDATRLHELL
                     DNTMTIHQKILQFNDFINELELLLDHELSQDALESGCPNLLKIHFMITMARDFHDQMT
                     TLALISSVDVQTTMSKVFQKVPECVEKFNKLISDITYDIIEAVRTENQSLLIRLFKVI
                     HVEECEDIKIIATRNIIKAKELEFESKKMKKLSNKLQTLDDEENKRIEYPTPSAIAAE
                     ITKGTIQTRTQPRGYKNMFLSTIKKGIHEMFIEVRKEYNGEKKFEVLNNLDWVFNELI
                     VVRDHVSKLGPTHWRLFDRYFDFYYEEIHQLITELVASEPETIIILDILDYDKNFQNV
                     LKQEFGFTKDKIKTIIGENEKEQLLSDYLTLILNKMREWIDNLEKTEITIFTERSSPP
                     HVDSDNWLFLDGTKTCFQMFNQQVEVAAGSGQAKILVGVVERFCNLLVSRQEVWAKII
                     NDQVQKCIQYNHFCEENPESVTKENAFPGGLVEYLVAAANDQMKAADYAVAISQKYGS
                     YVSKVHERTITAQIENTLDGFAYVAKCATSGICQLIFDDLRRPYSEVFDKSWYGGNQT
                     QQISSTIQEYLNDIKDQMNPFIFFSMIETAVEETLLKYVQCLKYDHSIKNKGNKFLDC
                     VRRDFKIFYQLYAEYVPPEEMSMVDERFKFAEYFIDLCCDTQESVLETWRLCLETYWD
                     CPLELLQHILKSRKDVDKSDMKKILAQAELIQSNPTRLSQLKTMNLPPTFIRRF"
     gene            complement(<347872..>349842)
                     /locus_tag="KLMA_70169"
                     /db_xref="GeneID:34717926"
     mRNA            complement(<347872..>349842)
                     /locus_tag="KLMA_70169"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821419.1"
                     /db_xref="GeneID:34717926"
     CDS             complement(347872..349842)
                     /locus_tag="KLMA_70169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677782.1"
                     /db_xref="GeneID:34717926"
                     /translation="MDMEGSEHPAVMQHTDEEMQFYEMHDMTSTDHINKSTEESNELS
                     RELRPMDSRSIWEKIWYGPLNPEDKPPRFFLRWKTLKYIDELPGRFNDSVIGSSTLLR
                     YGALTVYTTIWMLIVSAILFPYLLVPPKFEPNNDSSAVTIIPLTCTQSLKDWKGDNNA
                     CGLNAELCNINSQKDVFVRCPAFCDRAWIYSAQTVGDHRVKYTEYNIGGGPIKDGDKR
                     SLPYRGDSAVCSSAYHSKLISGFSGGCVKVSKSGAHSSFPSGKGKSGWSVPFDSFFPA
                     SFSFTEIRDGITSGCYDPRCLIMILNILFSLPIFYLYESIIGYWTITIAGFWTLLLIF
                     DPPILTDPSKPSTVAELISIGFERLLPLCFILYVIWRAAVKRTLQDGSPLVKITLWFP
                     TFWLGVMNNVTFDRLPVDRLTLKDLKELAGALIAVGSIITTILICAVIQAYSIWKSGR
                     FAKYFKCLVAVVAGIYVLTLLPGLTLRIHHYILGMTLVMFCSSRGASAYLFQGILIGL
                     VISGVGTWGFASIVETNISLLRGEAGASFVPPVFVFNNSEPHIVSWHPRNASHVPPKM
                     DGYSLLINDVERYVGNATHLDLDWLITENQSFGELLNNSITNSENHSLPLYLRIAHTS
                     TKNPTKDVGDYTNAAILQWPEGVWQDPPPGVS"
     gene            complement(<350313..>352952)
                     /gene="RNR1"
                     /locus_tag="KLMA_70170"
                     /db_xref="GeneID:34717927"
     mRNA            complement(<350313..>352952)
                     /gene="RNR1"
                     /locus_tag="KLMA_70170"
                     /product="ribonucleoside-diphosphate reductase large chain
                     1"
                     /transcript_id="XM_022821420.1"
                     /db_xref="GeneID:34717927"
     CDS             complement(350313..352952)
                     /gene="RNR1"
                     /locus_tag="KLMA_70170"
                     /codon_start=1
                     /product="ribonucleoside-diphosphate reductase large chain
                     1"
                     /protein_id="XP_022677783.1"
                     /db_xref="GeneID:34717927"
                     /translation="MFVYKRDGRKEPVQFDKITARVSRLCYGLDPRHIDAVKITQRII
                     SGVYEGVTTVELDNLAAETCAYMTTIHPDYATLAARIAISNLHKQTTKQFSQVVEDLY
                     RWVNPKTGIHSPMISDEVYDIVMENKDTLNSAIVYDRDFQFNYFGFKTLERSYLLRIN
                     GKVAERPQHMIMRVAVGIHGRDIEKVLETYNLMSLRYFTHASPTLFNAGTPHPQMSSC
                     FLVAMKEDSIEGIYDTLKECAMISKTAGGIGLHIHNIRSTGSYIAGTNGTSNGIIPMI
                     RVFNNTARYVDQGGNKRPGAFALYIEPWHSDIFDFVDIRKNHGKEEIRARDLFPALWI
                     PDLFMKRVEKNEDWTLFSPNEAPGLPDVYGDEFEALYERYEREGRGRKTVKAQKLWYA
                     ILEAQTETGTPFMLYKDACNKKSNQKNLGTIKSSNLCCEIVEYSNPEETAVCNLASIA
                     LPAFIEISNDGKTQTYNFKKLHDISKVLTRNLNRIIDRNYYPVETARRSNMRHRPIAL
                     GVQGLADAFMMLRLPFDSEEAKRLNVQIFETIYHGACEASMELAKEEGPYESFPGSPA
                     SEGKLQFDLWGKTPTNLWEWDNLKAEIKQHGLRNSLLLAPMPTASTSQILGYNECFEP
                     YTSNMYSRRVLSGEFQIVNPYLLRDLVDLGIWDEAMKSHIIADNGSIQNLPNIPQELK
                     DLYKTVWEISQKHIIDMAADRAAYIDQSQSLNIHIRAPTMGKLTSMHFYGWKKGLKTG
                     MYYLRTQAASAAIQFTIDKAVAEQASHSVVDLSKLSRPVYVPQAVDMNDNSAIIPVVD
                     AFKEPSPTPSTDDSVVNSVASLKIEDSQPVTPITPVEQAKDIKENKQETTATTDTSEF
                     DIFNSKVIACAIDNPEACEMCSG"
     gene            complement(<354318..>354785)
                     /gene="FIS1"
                     /locus_tag="KLMA_70171"
                     /db_xref="GeneID:34717928"
     mRNA            complement(<354318..>354785)
                     /gene="FIS1"
                     /locus_tag="KLMA_70171"
                     /product="mitochondria fission 1 protein"
                     /transcript_id="XM_022821421.1"
                     /db_xref="GeneID:34717928"
     CDS             complement(354318..354785)
                     /gene="FIS1"
                     /locus_tag="KLMA_70171"
                     /codon_start=1
                     /product="mitochondria fission 1 protein"
                     /protein_id="XP_022677784.1"
                     /db_xref="GeneID:34717928"
                     /translation="MTNINYLPELESSYSALSSEQIEILRQQVLNEGGEIASVQSRFN
                     YAWGLVRSVEKEDQMLGVKLLTDIYKESPMRRRECLYYLTIGCYKLGEYSTAKRYVDV
                     LVSHEPENQQARVLQTAVEDKINRQGLKGIAMVSAGIAIGATTIGLLFRNRKR"
     gene            <355143..>355832
                     /gene="SEE1"
                     /locus_tag="KLMA_70172"
                     /db_xref="GeneID:34717929"
     mRNA            <355143..>355832
                     /gene="SEE1"
                     /locus_tag="KLMA_70172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821422.1"
                     /db_xref="GeneID:34717929"
     CDS             355143..355832
                     /gene="SEE1"
                     /locus_tag="KLMA_70172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677785.1"
                     /db_xref="GeneID:34717929"
                     /translation="MEDTTKLNTSKLGTKEYWDDFYSLEKRNFEENPEDLGECWFADN
                     DAEEKMVEFLLDNLGEYEIKQDSTMIDLGTGNGHLLFSLLEEGFNGKMVGVDYSEKSV
                     EFANEILETKYSDKENVKFEAADIFSDEWAPGTFDIVLDKGTLDAIALSGIKFSHGKT
                     VVDLYPKVIEKLLSKNSVFLITSCNFTEDELIKIIETDSLKKWKSIPYPVFEFGGVKG
                     TPICSVAFVKL"
     gene            complement(<355929..>356972)
                     /gene="YRB2"
                     /locus_tag="KLMA_70173"
                     /db_xref="GeneID:34717930"
     mRNA            complement(<355929..>356972)
                     /gene="YRB2"
                     /locus_tag="KLMA_70173"
                     /product="ran-specific GTPase-activating protein 2"
                     /transcript_id="XM_022821423.1"
                     /db_xref="GeneID:34717930"
     CDS             complement(355929..356972)
                     /gene="YRB2"
                     /locus_tag="KLMA_70173"
                     /codon_start=1
                     /product="ran-specific GTPase-activating protein 2"
                     /protein_id="XP_022677786.1"
                     /db_xref="GeneID:34717930"
                     /translation="MPELAKDTKKRELKEEHSSSEGPETQNKRAKVEQAEKQEQQEEA
                     NKEDAESSKDDSETVEKSEGELREVSKPEETKKDVTEEVKNKDEAEVETKDEAKDEAK
                     DEAKDEAKDEAKDETKEKKPAFGQSSSFSMGFGAASKPFGSSTPFSSGFGAVKKTTDD
                     KDAGKPSSGFSFGAGLSFGAGFKAAKVESKEDDKSGNETRSVSDTKESTSTPITEPIV
                     KLTKQEIKSGEETEESLFQTNIKLYQLTDIKEGWKERGVGTLHLNKDKNSEKARIIMR
                     SRGLLKVVLNLPLVKGFCIKKGFPGSLHGDKFVRVITVDENKLPVQYALRTAKPEIAD
                     QLYDLMTEHVPEN"
     gene            complement(<357212..>357673)
                     /gene="ARC15"
                     /locus_tag="KLMA_70174"
                     /db_xref="GeneID:34717931"
     mRNA            complement(<357212..>357673)
                     /gene="ARC15"
                     /locus_tag="KLMA_70174"
                     /product="actin-related protein 2/3 complex subunit 5"
                     /transcript_id="XM_022821424.1"
                     /db_xref="GeneID:34717931"
     CDS             complement(357212..357673)
                     /gene="ARC15"
                     /locus_tag="KLMA_70174"
                     /codon_start=1
                     /product="actin-related protein 2/3 complex subunit 5"
                     /protein_id="XP_022677787.1"
                     /db_xref="GeneID:34717931"
                     /translation="MEDWRRIDIDAYDPESGRLTVEDLKPPYSHLLTLQELQPAIQQL
                     RAYAASGDFVSAVQVFTSEPPYSADEQAKSQYFFGVLEVLTQVRQADIANIIKQLDAK
                     QQDVLVKYLYKGMSIPEGQKHGGILLAWFEKLTQASGVNPIVHYLSDRRTV"
     gene            complement(<358114..>360693)
                     /gene="ARG5,6"
                     /locus_tag="KLMA_70175"
                     /db_xref="GeneID:34717932"
     mRNA            complement(<358114..>360693)
                     /gene="ARG5,6"
                     /locus_tag="KLMA_70175"
                     /product="protein ARG5"
                     /transcript_id="XM_022821425.1"
                     /db_xref="GeneID:34717932"
     CDS             complement(358114..360693)
                     /gene="ARG5,6"
                     /locus_tag="KLMA_70175"
                     /codon_start=1
                     /product="protein ARG5"
                     /protein_id="XP_022677788.1"
                     /db_xref="GeneID:34717932"
                     /translation="MCAAPAKLLVSMKGLNPSRLSQVTSILSRYSATASLPKKRVGYS
                     RRFITSSNGVGSTGTRSTVIQLLNNIGSKREVEQYLKYFTSVSQQQFAVIKVGGAIIS
                     DNLQELASCLAFLYHVGLYPIVLHGTGPQVNGRLEAQGIEPDYIDGIRITDDHTMAVV
                     RKCFLEQNLKLVTALEQLGVRARPITSGVFTAEYLDKEKYKLVGNITSVARDPIEASI
                     KAGALPILTSLAETESGQMLNVNADVAAGELARVFEPLKIVYLNEKGGIINGSTGEKV
                     SVINLDEEYDDLMKQSWVKFGTKLKIKEIKELLDFLPRSSSVAIINVQDLQKELFTDS
                     GAGTLIRRGYKLIQRSSLTEFPSPDALRDILQRDPEIQAGNQSVASYLKELSESTFTS
                     YADEPLDVLAVVKTNSSVPKLDKFLSSKTGWLNNVTDNVFSALNRDFPALQWIVNEDD
                     ANIAWHFNKSDGSYLKNGKVLFWYGIDDLETVSKLISEFTKDLASTGHGSTSNGSTSG
                     VFANGQSSRAYSTKARSAPKVEGTNQAPRKVALIGARGYTGQNLISLINSHPYLELSH
                     VSSRQNAGKKLEGYTKSEIIYSNLQIEDIKKLETENAVDVWVMALPNKVCEPFVEAIE
                     SVAEGKSKIVDLSADHRFVPETEWAYGLPELNNRDAIANAKKIVNPGCYATGAQVAIA
                     PLVEFITGLPTVFGVSGYSGAGTTPSPKNDPKFLNNNLIPYSLTNHIHEREISTRLGL
                     EVAFIPHVAQWFQGISHTISIPIKKNSLTSEQIKTLYQEFYANEKLVHVADDIPLVKD
                     VSGTHGVVVGGFKVNDAGDRVVVCATIDNLLKGAATQCLQNINLALGYGEYSGIPDNK
                     IIQ"
     gene            complement(<361240..>362151)
                     /gene="SNP1"
                     /locus_tag="KLMA_70176"
                     /db_xref="GeneID:34717933"
     mRNA            complement(<361240..>362151)
                     /gene="SNP1"
                     /locus_tag="KLMA_70176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821426.1"
                     /db_xref="GeneID:34717933"
     CDS             complement(361240..362151)
                     /gene="SNP1"
                     /locus_tag="KLMA_70176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677789.1"
                     /db_xref="GeneID:34717933"
                     /translation="MKQQTKQYNRHDGFHTLTKLPPTVTKLFTQGPPLKPSKLKLKKA
                     EERKYILTGVAELLPEVSNYEKLDCKISENKYLDVYEDAINESQREQEALRAKLQDWH
                     PESDPNISSDPYRTLFVGRLDYSVDEVALQKSFVKYGEIESCRVVRDKEGKSRGYGFV
                     QFVNYEDSKQCFRDLGVRRGIEIMGRTSIVDIERGRTVKYFKPRRLGGGLGGRGYQKK
                     QLMNKLSTPASSGAPLGMTRRVPRRHDTYEGRGSLPPQSRYPASGAPLTTPPVPPYQK
                     PASSSYRSRRDRSRHQPSNSSDDALMY"
     gene            complement(<362453..>364207)
                     /gene="MOT2"
                     /locus_tag="KLMA_70177"
                     /db_xref="GeneID:34717934"
     mRNA            complement(<362453..>364207)
                     /gene="MOT2"
                     /locus_tag="KLMA_70177"
                     /product="general negative regulator of transcription
                     subunit 4"
                     /transcript_id="XM_022821427.1"
                     /db_xref="GeneID:34717934"
     CDS             complement(362453..364207)
                     /gene="MOT2"
                     /locus_tag="KLMA_70177"
                     /codon_start=1
                     /product="general negative regulator of transcription
                     subunit 4"
                     /protein_id="XP_022677790.1"
                     /db_xref="GeneID:34717934"
                     /translation="MMTAATENPHVHQNQHEIQKALSNYDTSFLSDDEEDLCPLCIEP
                     LDVMDKHFKPCPCGYQICQFCYNNIRQNPELNGRCPACRRKYDDESVEYIVLSPEELK
                     LERSKQARKERERKQRERERRENDTHNRKQLAGMRVIQKNLVYVIGLNPPYPYEELPS
                     ILRSDKYFGQYGKINKIVINKKTGHEHHSVSSSSSHVNSGYGIYVTFSRKDDAAKCIQ
                     AIDGIYIDGHPVKAAYGTTKYCSSYLRGQPCPNPNCMFLHEPGEEADAFNNSRKEHSH
                     HPHAPPALAKTTTSASSTPKLAHASLRTEDANSITSAGSNSKPTPPVLTPAPVPSGSN
                     PWGISQAPTPVSTIFNKTVTSTTFPTLSSSLADGSHSSAPGTPINAGSASTTNASSGN
                     SSKKKGEKTYEDPYDPMATCIKFLDQTFKFLSDIPERNYSFNSSMLSDETYKSYPSLF
                     SFDRITCSEQSDNVLGAKLCDMLAIKPVDHMSSLLPFLQSKTTPTVLPPGIAVQQQQQ
                     QQVVQQQQQQQQQQQQHQQQQQQQQQQQQQQQQQISLQMQMQAQQGISHPMMNPPQSN
                     SSDLLNQLIHGKKQTATV"
     gene            complement(<364834..>365319)
                     /gene="RGI1"
                     /locus_tag="KLMA_70178"
                     /db_xref="GeneID:34717935"
     mRNA            complement(<364834..>365319)
                     /gene="RGI1"
                     /locus_tag="KLMA_70178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821428.1"
                     /db_xref="GeneID:34717935"
     CDS             complement(364834..365319)
                     /gene="RGI1"
                     /locus_tag="KLMA_70178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677791.1"
                     /db_xref="GeneID:34717935"
                     /translation="MTKKDKGPKFTTVTTKSGEVVKVFEDLESFETFIKNETEDEEFD
                     HVHCHLKYYPPFVLHESHDDPEKIKDSANSHSKKFVRHLHQHIEKHLLKDIKERVHLP
                     DLKFKDKGKEETFEHIVWKYNDVAQYHGKDFEIHVTVECHNDSAIVDVDYLTTPVVAA
                     A"
     gene            366257..366340
                     /locus_tag="KLMA_R703"
                     /db_xref="GeneID:34718779"
     tRNA            366257..366340
                     /locus_tag="KLMA_R703"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:34718779"
     gene            <367466..>369130
                     /gene="ICL1"
                     /locus_tag="KLMA_70179"
                     /db_xref="GeneID:34717936"
     mRNA            <367466..>369130
                     /gene="ICL1"
                     /locus_tag="KLMA_70179"
                     /product="isocitrate lyase"
                     /transcript_id="XM_022821430.1"
                     /db_xref="GeneID:34717936"
     CDS             367466..369130
                     /gene="ICL1"
                     /locus_tag="KLMA_70179"
                     /codon_start=1
                     /product="isocitrate lyase"
                     /protein_id="XP_022677792.1"
                     /db_xref="GeneID:34717936"
                     /translation="MSPSVASPAISVSVKGSVTEKKVFLQNEVDEIEKWWSQPRWKNT
                     KRIYSAYEIAKRRGSIQPTVYPSSLMAQKLYKILEGHAKNGTVSKTFGALDPVQITQM
                     SKYLDTIYVSGWQCSSTASTSNEPGPDLADYPMDTVPNKVEHLFKAQQFHDRKQWERI
                     CDGTIEESEIIDYLTPIVADADAGHGGLTAVYKLTKMFIERGAAGIHIEDQTSTNKKC
                     GHMAGRCVIPVQEHINRLITCRMAADVLGSDLVLVARTDSEAATLLSSTVDSRDHYFI
                     LGATNPEVKGQPLNELLNKAILDGATAEDLQAVEKKWLAKADVKLFHEAFADAVRAAG
                     KGESLIKEFNSKVGPLTESSIYEMQALAKELLGSETELFFDWDLPRGREGLYRYQGGT
                     QCSVMRARAFAPYADLCWMESNYPDYEQAKEFAQGVTAKFPGKWMAYNLSPSFNWTKA
                     MSVEEQETFIQRLGDLGYIWQFITLAGLHTSGLAIEQFSKNFAKYGMKAYAQDIQKKE
                     LDNGIDMVKHQKWSGAEYIDGLLRLAQGGLAATAAMGHGVTEDQFK"
     gene            <370957..>373020
                     /gene="VHR1"
                     /locus_tag="KLMA_70180"
                     /db_xref="GeneID:34717937"
     mRNA            <370957..>373020
                     /gene="VHR1"
                     /locus_tag="KLMA_70180"
                     /product="transcription factor VHR1"
                     /transcript_id="XM_022821431.1"
                     /db_xref="GeneID:34717937"
     CDS             370957..373020
                     /gene="VHR1"
                     /locus_tag="KLMA_70180"
                     /codon_start=1
                     /product="transcription factor VHR1"
                     /protein_id="XP_022677793.1"
                     /db_xref="GeneID:34717937"
                     /translation="MNKVHKPSGTTHRIREQLNFSDDKKWKQFSSRRLELIDKFNLSE
                     RKASEQDENIRQIANILRTEFGYPTTTSSEFEKLVTAAVQSVRRNRKRSTKTRSRRSE
                     MSSATSDEDSLISRTTSPLGSSSQNAPSMVSSLISQVQVQPQFQARTQTPVHAQAQAH
                     AQAQSQIPPPPAPVHIAGSSVRATTPVSSAHHLQAPLLGSGSAPAQTQTQAQAQSHGT
                     VPIIQPKPIRMVYKSNASLHQQVSNSNTFKQNYDEFMKDVIKDLTTGPVNLQKNETES
                     KQHNSLADLALSTHDFSLLNLALSNDKKGENAAGSDGTSVSGSNSTATQASQPASISQ
                     NQQNASSQQQSIPFFLREKLMHFIQNSKTLTELTTSLNLHEMNNLLKLGQYVLLSSIS
                     FVLEKFFSNLSMNSIDYIHDKLSSPDSLSEMCIKLIGSGTKRNLNQLPLEWRVKLLNF
                     IVGSVVKDFGFDPCVYPLTEIFHDSILKKYPLVCNEGKNQGSNSFKNAVIASLPLKPE
                     MANKDMNKKVVIKFGEKEQRFVFHLLSNGAPTIQEILENSSNLFQINREKFSSLTIYH
                     QNEIVKDDAQLASLLNGFSNQEIVLEIKGHSAVQNSSHESSAMNGLQILSSVSQVAAE
                     NSSSSPACLTTLDNIISRISSPISTIKKEDSSISPLLHPPSIPNKHGKNFVNGLPQPV
                     FQPLL"
     gene            complement(<373591..>375159)
                     /locus_tag="KLMA_70181"
                     /db_xref="GeneID:34717938"
     mRNA            complement(<373591..>375159)
                     /locus_tag="KLMA_70181"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821432.1"
                     /db_xref="GeneID:34717938"
     CDS             complement(373591..375159)
                     /locus_tag="KLMA_70181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677794.1"
                     /db_xref="GeneID:34717938"
                     /translation="MTHYSGHPYMEFMPPELMNIHIRIDNIPQGKDWKQVRTFLSKFI
                     PRDHILNIKVLPAMATMTPPFIPITSCVCVLHASVDWNSLLMQLNGVQWEYYTLGAIL
                     LPPPALAPAMGPALGAPHLSGANAGVAGVPSGSGRTLQPRQPHQHAVRQHRVGSGGAA
                     GMYLGPGPAQGPAPGTVQGPGPGPGPGGLPGPDNGTSSSRQQQHHQHQHQHQHQHQRP
                     QSTSGPSGMPHQPRKLKQLFNETSFRKQMSSRSMYQIKFKNFPPCLHWDEIVKFKTMG
                     IAGQHVTRAGTAPDLIVKTLEPQTYGKLKWTMLKDFIKSHCPELFENTSSFEFYVGVY
                     ESGELDVEIQLCEPQDETEIEIEIETETKNGDSSQAGSNDDSSSSQPDVPETNNDTPK
                     ETDAKDTDSKKSDGVKENSTQDTVQDTDSKTEVNDKDLKDGKNEVEGCSDAPDENSNK
                     TLDKNSNSSSSSSPEAEDSKVEKYMVKATQYEAVVGFVNYDKFLKCLDTFQGKDFGLN
                     HKLVLEVLESVEPS"
     gene            complement(<375975..>376586)
                     /gene="THO1"
                     /locus_tag="KLMA_70182"
                     /db_xref="GeneID:34717939"
     mRNA            complement(<375975..>376586)
                     /gene="THO1"
                     /locus_tag="KLMA_70182"
                     /product="protein THO1"
                     /transcript_id="XM_022821433.1"
                     /db_xref="GeneID:34717939"
     CDS             complement(375975..376586)
                     /gene="THO1"
                     /locus_tag="KLMA_70182"
                     /codon_start=1
                     /product="protein THO1"
                     /protein_id="XP_022677795.1"
                     /db_xref="GeneID:34717939"
                     /translation="MSYSGNTVAQLKELLKQRNLSTDGLKADLITRLQEDDAKNAAAE
                     PKPTDASSQAENKTESATAQENKDETTHQSAVQTGAEAGAETQAQAQDPAPAQDPAPA
                     ETSAQTPTPAPKPQLSPEQLKQTAIDHLQKKIHRAEKFGQDDSIVEDLKRQINRIEKF
                     GLDLTTQLAQELGFGKGPRAAIGKPNRKPFQKKHKNKKNIKRN"
     gene            <378096..>378842
                     /gene="RHR2"
                     /locus_tag="KLMA_70183"
                     /db_xref="GeneID:34717940"
     mRNA            <378096..>378842
                     /gene="RHR2"
                     /locus_tag="KLMA_70183"
                     /product="(DL)-glycerol-3-phosphatase 1"
                     /transcript_id="XM_022821434.1"
                     /db_xref="GeneID:34717940"
     CDS             378096..378842
                     /gene="RHR2"
                     /locus_tag="KLMA_70183"
                     /codon_start=1
                     /product="(DL)-glycerol-3-phosphatase 1"
                     /protein_id="XP_022677796.1"
                     /db_xref="GeneID:34717940"
                     /translation="MSAAPISLRVNAALFDVDGTLIISQGAIAEFWRDFGKDKPYFDS
                     QHVIDISHGWRTYDVIKKFAPDYANEEYVTKLEGEIPDKFGKHAIEVPGAIKLCAALN
                     ALPKEKWAVATSGTFEMAHKWFDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLGY
                     PINEANPAASKVIVFEDAPAGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTK
                     LRVAAYHPETDEVEFVFDEYLYAKDDLLEW"
     gene            <379392..>380687
                     /gene="CEM1"
                     /locus_tag="KLMA_70184"
                     /db_xref="GeneID:34717941"
     mRNA            <379392..>380687
                     /gene="CEM1"
                     /locus_tag="KLMA_70184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821435.1"
                     /db_xref="GeneID:34717941"
     CDS             379392..380687
                     /gene="CEM1"
                     /locus_tag="KLMA_70184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677797.1"
                     /db_xref="GeneID:34717941"
                     /translation="MSLKRVVVTGLGAYTPLGANVAKSWAGLLAGNQSLIPLSDFYNR
                     DEFAKLQKLVPLDTVVSRQHANPLDTFPNYDQRRTTPAHQIVLEKTREALTHAKLLKE
                     EDQDDSTELLWDLDKTRVGCVIGTGMPSMPDLQSTISTLFTKPKVSPFLIPRVLPNMA
                     TGNVMIKYGFQGPSSCPSTACATGNSSIIDGFNMIQLGLADLMICGSYEFSIDPISIA
                     GFYRSKAISRKHQTRPFDVERDGFVMGEGCGILILESWDSATSRGAPILAEVKGAGMS
                     NDGHHITTPLPDGSGGKLAMENALKRANLTPDKIGYINAHATSTQLGDLAESTAIVNI
                     FGTKDTGKAPFVSSNKGHIGHLLGASGSVESIFTILGLQNGKFPPNLNLQKLDESSTI
                     NDVNLIRDSTLTDDTIEYAITNSFGFGGVNTSILFAKVH"
     gene            complement(<380715..>381416)
                     /gene="DFG10"
                     /locus_tag="KLMA_70185"
                     /db_xref="GeneID:34717942"
     mRNA            complement(<380715..>381416)
                     /gene="DFG10"
                     /locus_tag="KLMA_70185"
                     /product="protein DFG10"
                     /transcript_id="XM_022821436.1"
                     /db_xref="GeneID:34717942"
     CDS             complement(380715..381416)
                     /gene="DFG10"
                     /locus_tag="KLMA_70185"
                     /codon_start=1
                     /product="protein DFG10"
                     /protein_id="XP_022677798.1"
                     /db_xref="GeneID:34717942"
                     /translation="MNTYDILLYSTFYVGIVCVFIAEFYIPQLLKYGKTWKASNNYWF
                     NLTCSKSTFTHFYLIAIVLSTYNLFEKRNLLTLCVFIHSIRRLYECFFITKWGHSKIH
                     LSHYLVGIWFYTTLNIGIAFKNGETENRLVSVVMFIAASLDQAVNHQHLSKLKKYSKP
                     SYGLFRYICCAHYFDEFVIYLSFLLMNVGTRALLAHCVVWILVNLGTSSHETGNWYLQ
                     KFGYRPRWYMLPYVF"
     gene            complement(<382049..>383608)
                     /gene="FCY2"
                     /locus_tag="KLMA_70186"
                     /db_xref="GeneID:34717943"
     mRNA            complement(<382049..>383608)
                     /gene="FCY2"
                     /locus_tag="KLMA_70186"
                     /product="purine-cytosine permease FCY2"
                     /transcript_id="XM_022821437.1"
                     /db_xref="GeneID:34717943"
     CDS             complement(382049..383608)
                     /gene="FCY2"
                     /locus_tag="KLMA_70186"
                     /codon_start=1
                     /product="purine-cytosine permease FCY2"
                     /protein_id="XP_022677799.1"
                     /db_xref="GeneID:34717943"
                     /translation="MSSSTSREEYVLHDVEKQELTKTHLNEYEEDEPVIVETSEVTQL
                     SWVDRLASKLKAETKGIEPITDDEKDDTDILNAASMWFSANMVIAAFSLGCIGTSVFG
                     LNFGTSVLTIIFFNFLGLIPVAFFSVFGIEFGLRQMVLSRFLLGNVTARVFCFINIIA
                     CIGWGAVNTIASASLLHIVNPSGPNCPPWAGCLIIVFSTIIVTFFGYRVIHAYEKYSW
                     VPNFVVFLVIIARLAKSGNFANGPWGGGADTAAGVLSFGSSIFGFASGWTTYASDYTV
                     YMPRTTNKKKVFICLVLGLAFPLLFSMILGAAAMACALNNEKWNALYQSHSVGGLCYA
                     ILVEDSLWGFGSFCCVLLAMSTVANNIPNMYSIALGTQAMWEPLAKVPRVLWTCVGNL
                     LVLAIAIPAYYKFESFMTKFMDSIGYYLAIYIAIAVSEHCFYRRGFKGYNISDWNRWD
                     KLPLGYAGCAALFIGAFGVAFGMSQTYWNGQIGRQIGKFGGDIGFELGAGFAFITYNI
                     CRPLEKKYTGR"
     gene            complement(<386169..>387467)
                     /gene="PCL6"
                     /locus_tag="KLMA_70187"
                     /db_xref="GeneID:34717944"
     mRNA            complement(<386169..>387467)
                     /gene="PCL6"
                     /locus_tag="KLMA_70187"
                     /product="PHO85 cyclin-6"
                     /transcript_id="XM_022821438.1"
                     /db_xref="GeneID:34717944"
     CDS             complement(386169..387467)
                     /gene="PCL6"
                     /locus_tag="KLMA_70187"
                     /codon_start=1
                     /product="PHO85 cyclin-6"
                     /protein_id="XP_022677800.1"
                     /db_xref="GeneID:34717944"
                     /translation="MSYLDNATSSSYAETEPIEIPIARDGTGPFSSSLQESHNNSDTI
                     TTSTRLIDSSNSSIDHYGSTGLTPQEISHNAPHAYFDSGDSSYIKHTSGNSGFLDSSS
                     GISSSVESGPNLRRRSMSTSFQNTSDHKNSLHVQTQAAVPVQVPVPVKSVSELRSNGV
                     TRSHSVPPQYVDGRSENESKNKSSSTKTHSTPDTAKSANEGSGAGSHHMDIATFPTDE
                     LLDMLTKLLTKIINSNDALGSVSSMDNPNLQGKNIPLLREILSFRGKQVPGITLKQYF
                     QRIQKYCPTTNDVLLSLLVHFDRIAKKCNSIAQEYMTPSPALKTAGDGEAPAPAPPQQ
                     LFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDF
                     RLIISVEELQRYADLLYKFWDKETSAGQALESNKTQPIAL"
     gene            complement(<388311..>388574)
                     /gene="PET117"
                     /locus_tag="KLMA_70188"
                     /db_xref="GeneID:34717945"
     mRNA            complement(<388311..>388574)
                     /gene="PET117"
                     /locus_tag="KLMA_70188"
                     /product="protein PET117"
                     /transcript_id="XM_022821439.1"
                     /db_xref="GeneID:34717945"
     CDS             complement(388311..388574)
                     /gene="PET117"
                     /locus_tag="KLMA_70188"
                     /codon_start=1
                     /product="protein PET117"
                     /protein_id="XP_022677801.1"
                     /db_xref="GeneID:34717945"
                     /translation="MIVGVHYVQQLERETLHQGPIKDAQRMKEKRLARENAGGVDPEK
                     ERQRMVNKSEHEYQLELRKKYEQMQPLSGEVRTKDDELVELKK"
     gene            <389165..>389587
                     /gene="MMF1"
                     /locus_tag="KLMA_70189"
                     /db_xref="GeneID:34717946"
     mRNA            <389165..>389587
                     /gene="MMF1"
                     /locus_tag="KLMA_70189"
                     /product="protein MMF1"
                     /transcript_id="XM_022821441.1"
                     /db_xref="GeneID:34717946"
     CDS             389165..389587
                     /gene="MMF1"
                     /locus_tag="KLMA_70189"
                     /codon_start=1
                     /product="protein MMF1"
                     /protein_id="XP_022677802.1"
                     /db_xref="GeneID:34717946"
                     /translation="MFRQAFRSAVRNMNTLTPVRTQLAPPPAASYSQAMKVDNLIFVS
                     GQIPYTAENKPVEGSIAAKAEQVIQNVKNILTEANSDLNKIVKVNIFLADIKDFAEFN
                     SVYAKYFNEHKPARSCVAVKDLPLNVDLEMEVIAVEKD"
     gene            <390426..>391252
                     /gene="RPL34B"
                     /locus_tag="KLMA_70190"
                     /db_xref="GeneID:34717947"
     mRNA            join(<390426..390462,390912..>391252)
                     /gene="RPL34B"
                     /locus_tag="KLMA_70190"
                     /product="60S ribosomal protein L34-B"
                     /transcript_id="XM_022821442.1"
                     /db_xref="GeneID:34717947"
     CDS             join(390426..390462,390912..391252)
                     /gene="RPL34B"
                     /locus_tag="KLMA_70190"
                     /codon_start=1
                     /product="60S ribosomal protein L34-B"
                     /protein_id="XP_022677803.1"
                     /db_xref="GeneID:34717947"
                     /translation="MAQRVTFRRRNPYNTKSNKIKVVKTPGGVLRSQHVKKLATRPKC
                     GDTGVPLQGVASLRPRQYATVSRTKKTVSRAYGGSKSANAVKERIVRAFLIEEQKIVK
                     RVIKEQADAAKKAEKKDAKKSKK"
     gene            <392112..>395558
                     /gene="NEO1"
                     /locus_tag="KLMA_70191"
                     /db_xref="GeneID:34717948"
     mRNA            <392112..>395558
                     /gene="NEO1"
                     /locus_tag="KLMA_70191"
                     /product="probable phospholipid-transporting ATPase NEO1"
                     /transcript_id="XM_022821443.1"
                     /db_xref="GeneID:34717948"
     CDS             392112..395558
                     /gene="NEO1"
                     /locus_tag="KLMA_70191"
                     /codon_start=1
                     /product="probable phospholipid-transporting ATPase NEO1"
                     /protein_id="XP_022677804.1"
                     /db_xref="GeneID:34717948"
                     /translation="MSFSPPPGSQLPNKNLKSSQNPTKNTDRDSFDLQFEDSLDAAFE
                     SLQVPEGSRQKDNNTAFEDFEMKSMHSDHQTSMLNSDVDTAPLINNSSNPGRLSLHND
                     RNAQYTNNSIWLKAKSWFESSFSGSKSKHSSLSAYNTSSSTTNTTKIELNDQNVEREI
                     HPATTPIYDRKKYPSNVVSNAKYNPFTFIPIILYEQFKFFFNLYFLLVALSQAIPQLR
                     IGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDRESNNELYEVVNKPGPVPSKDLKVG
                     DIIKLKKGSRVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACPLTQTLTENDIF
                     NNITITASAPEHSIHKFNGKITYKDSTSAPLTVDNTMWENTVLASSAACVCCVVYTGR
                     DTRQSMNTTKSSVKTGLLELEINGLSKILCACVFLLSIILVAFAGFDNKDWYVDIMRY
                     LILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIKDTIVRTSTIPEDLGRIEYLLSDKT
                     GTLTQNDMQLKKIHLGSVSYTNETMDIVSNFIQSMNSKTTVNTPATTRKSISERVIDL
                     VTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRNSISLFHDHSG
                     MKLEYDIKMIFPFNSDSKRMGVIIFDKQKQEYWFLQKGADTVMSTIVVRNDWLDEETS
                     NMAREGLRTLVIGRKKLTSNVFEQFEKEYSEASLTMMNREVHMQNVVKKYLENDLELL
                     GLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLIARGQYVHTVT
                     KVNKPEGALRHLEYLQVNHNSCLLIDGESLGLYLQYYPDEFFEIVVNLPTVVACRCTP
                     QQKADVALFIRHATGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQ
                     FCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYKGWLMV
                     GYATCYTMAPVFSMTLDHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGC
                     VIQLASQSFTSLDESDFTKMVAISFTALVMNELIMVALEINTWNRIMVITEVVTFIVY
                     FGSIPFLGEYFDLSYVTTTKFPAMVLVILLISVVPVWATKSIYRRLNPPNYAKVQQFS
                     MV"
     gene            complement(<395827..>396798)
                     /gene="SOL1"
                     /locus_tag="KLMA_70192"
                     /db_xref="GeneID:34717949"
     mRNA            complement(<395827..>396798)
                     /gene="SOL1"
                     /locus_tag="KLMA_70192"
                     /product="6-phosphogluconolactonase-like protein 1"
                     /transcript_id="XM_022821444.1"
                     /db_xref="GeneID:34717949"
     CDS             complement(395827..396798)
                     /gene="SOL1"
                     /locus_tag="KLMA_70192"
                     /codon_start=1
                     /product="6-phosphogluconolactonase-like protein 1"
                     /protein_id="XP_022677805.1"
                     /db_xref="GeneID:34717949"
                     /translation="MTTTVPKIFAFPEFAGVAEAVADHVVHSQNMALKDIATGPSSAR
                     QSSTHISNQSQGSVRSATSMQKVPSTRSIRNNSSGGGSSGGKLKKPKERRFKIAISGG
                     SLIQVLHEGLLKRTDVQWGKWDIYFADERLVPFESNESNYGQAKRHIFDLIDTEKYGT
                     PRIFHIDESLINDAQECADHYEKILIKEFAGRDSVKLPMFDLFLLGCAPDGHIASLFP
                     NFQENLREKFAWVVPVENAPSGPSNRISLTIPVICHSHQVTFVVEGATKAPVIKTIME
                     RPEKGLPSSIVNEGAAGRVAWFVDDDALSDVLVTKKKYKFLITDDNN"
     gene            complement(<397476..>399731)
                     /gene="ABZ1"
                     /locus_tag="KLMA_70193"
                     /db_xref="GeneID:34717950"
     mRNA            complement(<397476..>399731)
                     /gene="ABZ1"
                     /locus_tag="KLMA_70193"
                     /product="aminodeoxychorismate synthase"
                     /transcript_id="XM_022821445.1"
                     /db_xref="GeneID:34717950"
     CDS             complement(397476..399731)
                     /gene="ABZ1"
                     /locus_tag="KLMA_70193"
                     /codon_start=1
                     /product="aminodeoxychorismate synthase"
                     /protein_id="XP_022677806.1"
                     /db_xref="GeneID:34717950"
                     /translation="MTFYVLFIDSYDSFTYNVVELIKEQREDIEVVTIHNDTFASYEE
                     LKPFLRLFDAIVVGPGPGNPVNGPADVGIVASLFNDDLVIPILGICLGFQVMCHVHGA
                     TIEQLDNIRHGQVYPINVKECGAGTEGLFSEYPSTFDSVRYHSLHVICDSESSNKIVP
                     LAYTLDEGKQVLMAGMIAGKPWYGVQYHPESCCSKLGGKLIQNFIKLATNYNQKDVMR
                     GGSHHDSECDMQKLSILCHKIDREPIVKKTPNAGPKSTVSFDTMEINQDPKVTLRICE
                     ALEKNKIPFFLLASSTINPNRGEMSIIALPNKQSKVFTHYAQLDKTTIHNWQQDDLTV
                     EEYHDYLSSGKTDDRMTVVSETKNEFWKTIGTYMDSRSCPSEYPELPFVGGFVGILGY
                     EMGQFTVSESQEKLRPDAKLCFVENSILINHKEGKLYTIGLNCEFPSDINTLIKQTIE
                     TKEDLAWPMELPEDVSYDISLPKQEAYEKAFELSQKYLHQGDSYEVCLTTQTNIKPSK
                     VIEPWRIFQTLIQRNPAPFSSFFMFDDVEPHRFDLCLISTSPERFLKYSNDTCELRPI
                     KGTVKKGPDMDLEKATAILKTPKEFGENLMILDLIRNDLYEVLPKVTVDEMMSVEEYA
                     TVYQLVSVVSGHKMASSPYSGLDVLKHSLPPGSMTGAPKKKTVELLQERIEPIFGAAT
                     RGVYSGVTGYWSANMNGDWSVNIRCMYSYDEGKNWRIGAGGAITVLSTCEGEWEEMFT
                     KLESALQVFTK"
     gene            <399999..>400223
                     /gene="HUB1"
                     /locus_tag="KLMA_70194"
                     /db_xref="GeneID:34717951"
     mRNA            <399999..>400223
                     /gene="HUB1"
                     /locus_tag="KLMA_70194"
                     /product="ubiquitin-like modifier HUB1"
                     /transcript_id="XM_022821446.1"
                     /db_xref="GeneID:34717951"
     CDS             399999..400223
                     /gene="HUB1"
                     /locus_tag="KLMA_70194"
                     /codon_start=1
                     /product="ubiquitin-like modifier HUB1"
                     /protein_id="XP_022677807.1"
                     /db_xref="GeneID:34717951"
                     /translation="MIEVLVNDRLGKKVCVKCLEEDTIGEFKQVLSVQLGTASAAKIV
                     LQKGGSVLKDHITLEDYEIHDGTNLELYYV"
     gene            complement(<400309..>401343)
                     /gene="PPG1"
                     /locus_tag="KLMA_70195"
                     /db_xref="GeneID:34717952"
     mRNA            complement(<400309..>401343)
                     /gene="PPG1"
                     /locus_tag="KLMA_70195"
                     /product="serine/threonine-protein phosphatase PP2A-like
                     PPG1"
                     /transcript_id="XM_022821447.1"
                     /db_xref="GeneID:34717952"
     CDS             complement(400309..401343)
                     /gene="PPG1"
                     /locus_tag="KLMA_70195"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase PP2A-like
                     PPG1"
                     /protein_id="XP_022677808.1"
                     /db_xref="GeneID:34717952"
                     /translation="MNLDWCLEQLYEGKLLPAETIRALCFKLKELLVKESNVVHISTP
                     VTVVGDIHGQFHDLLEIFHIGGPLPSTNYVFLGDYVDRGLYSVETITLLITLKLRYPS
                     RIHLIRGNHESRQITQSYGFYTECLNKFGEGSQVWQYFTDLFDYLVLACIIDDTIFCV
                     HGGLSPNIQSIDQIRIIDRIREIPHDGAMADLVWSDPEDDRNEFTSSQFKVSPRGAGY
                     TFGRAIVDKFFSINGVTKMLRAHQLCNEGYQDYFGGKVTTVWSAPNYCYRCGNKASIL
                     ELYSPTDFYFNVFDEAPENKLLTDPMLNDKTLHSFFDEEDGMSSAQFDVFSDEHQTKY
                     AQKRQIDYFL"
     gene            <401720..>406381
                     /gene="SSK2"
                     /locus_tag="KLMA_70196"
                     /db_xref="GeneID:34717953"
     mRNA            <401720..>406381
                     /gene="SSK2"
                     /locus_tag="KLMA_70196"
                     /product="MAP kinase kinase kinase SSK2"
                     /transcript_id="XM_022821448.1"
                     /db_xref="GeneID:34717953"
     CDS             401720..406381
                     /gene="SSK2"
                     /locus_tag="KLMA_70196"
                     /codon_start=1
                     /product="MAP kinase kinase kinase SSK2"
                     /protein_id="XP_022677809.1"
                     /db_xref="GeneID:34717953"
                     /translation="MSEDQEHTDEEYVQEQFHAYSAKVSAMKGCQPFPNGRGRSSSQL
                     NWPGSVPSVTSDSSNETLKVNTNMVSGGGANIGPSFLKKTPSAHAVPTSSSASTQYQA
                     GLLSPSSANSSAISSRKPSTSGSSSGHTPTTAQMKTITSPKLSGALSSRSRSSSLTSN
                     KLFALNQSNDSSTSTNSFPVPPIVASLNSQTASSVSASTSVDPNYSSQLNSSAPNLTP
                     TLSSPSVRSLSSNATATLKSTKPLQKQYVLNEQVYLSSMKNKAVDDYYTRGITSSGND
                     DDDESKVDGENDDADDDLNRINDKMDSAIFGNNIATSADRDFRSIDDDELVLMSYKIL
                     LDKMEWLRSVDPNNNIGNTLNILHKSERSRNGSVDEEGLSYIETQLIMEQLSNNPLVR
                     ERLEWQTMLSSVLKGDIVRSEKTKLANKKPDEILLDHNDLIWLELKAWLNGRTVEDQR
                     ESLEYSRSTSDEVFDEILNYKNNIENDPDAVIQEIKTLLQKYYRVVGYWKNVANMNME
                     KPVTKTTNFISRIETFNSLINSYDSLQYEIDALKLWTQNDDLDVTFTKDTLDNDGIFM
                     NDRSFAEQIMKEKDIEAIFQKKIFFKHAPWMFKSKLIFLKQRNFIDEMNLPLPVDKIH
                     SLLTFPLRLIQEIISIRLEYARKLKKPTMMMIDQMIYDFSTYIKLSVQIKHTLIEYRS
                     GWEIGIEISDSFDAKVVEAIEFLFKLLHLKLIDSSKNSFRTFKEPDILFSHWENLKNV
                     GCYISGASRVVAEGFVNITIRLLNRLYLYIVEQQKQKNEFESASQARKWILGVIENIG
                     AFKRKTNRFANVLTKAFQNSVLYNINDHALLLERLKDSGHFLIYTGGVLEENGYYLIA
                     SEELLGCSDEDILDIIKSTKIGSDLIPKVEINNSLAIYNPPADLSLPEAMFVQEERRD
                     GVLYYHLKQDDVNHRIGSRGKTISGPHNDETEELVQLENKLKKLGYILVFCPKKPMIW
                     NGEMYNLTTENPLSIEEFNINIAPDTIVMLNQGSTYALDYQVDRFQSFVGDSVAIREK
                     RCAINEIETSLQRINRSFFRMTYAALANFEKVQKNISAHTSEVNFFNIAYLFIKNFAK
                     SFLLLNVATPETKAIIIRLMMRMSIDWLGFILDECDPTNPETFRWCVPAMEFAMQMTN
                     GWNIMSINEKDFKILKERIAGCMSLLVSHFDITGARSREAERINAQQSRPNLDIDDAD
                     DDMILAVNSEMRMNAISDMEKELKVKRHYSVGKVIDDTDNESKFLKSLASSISNLSIR
                     WQKRSFIGSGSFGTVYSAINLDTGDILAVKEIKIQDSKAMKQIFPSLKEEMRVMEILN
                     HPNIVQYYGVEVHRDKVNIFMEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLACL
                     HQSGVVHRDIKPENILLDGNGVIKYVDFGAAKLIAKNGSRRLSLDSNKQGAGGKDMIG
                     TPMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEWAIMYHVAAGHL
                     PQFPSKSEISSAGRKFLSRCLIQDANKRATALELLLDPWIAQIRTIAFGGDSDVTISE
                     Q"
     gene            <406879..>408426
                     /gene="RSA4"
                     /locus_tag="KLMA_70197"
                     /db_xref="GeneID:34717954"
     mRNA            <406879..>408426
                     /gene="RSA4"
                     /locus_tag="KLMA_70197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821449.1"
                     /db_xref="GeneID:34717954"
     CDS             406879..408426
                     /gene="RSA4"
                     /locus_tag="KLMA_70197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677810.1"
                     /db_xref="GeneID:34717954"
                     /translation="MATLLPPPSKKQRREAQTEREVDLIPKDLPNVLIKFQAFDSGET
                     VGGSLRVPGAITEKQLEELLNQLNGDTDEPVPYTFGCLVNNKSKNGEEEMVDIRDNLY
                     QSILKPGLKSTEDFLTLVYTPRAIFKVKPVTRSSSAIAGHGSTILCSSFAPHTSSRMV
                     TGAGDNTACIWDCDTQTRMATLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESQKG
                     KPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLSG
                     HASSVSCIKWGGRNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYAL
                     RVGAFDHKGEKPVSAEEAQQKALKNYEKVAKKNGELEELMVTASDDFTMYLWNPLKAT
                     KPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQV
                     AWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDK
                     MVRIWTH"
     gene            <408727..>409266
                     /gene="IMG2"
                     /locus_tag="KLMA_70198"
                     /db_xref="GeneID:34717955"
     mRNA            <408727..>409266
                     /gene="IMG2"
                     /locus_tag="KLMA_70198"
                     /product="54S ribosomal protein IMG2"
                     /transcript_id="XM_022821450.1"
                     /db_xref="GeneID:34717955"
     CDS             408727..409266
                     /gene="IMG2"
                     /locus_tag="KLMA_70198"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="54S ribosomal protein IMG2"
                     /protein_id="XP_022677811.1"
                     /db_xref="GeneID:34717955"
                     /translation="MLTRLSRNFIQKGPRPLWACARLQSTQSQQPQSTVSSDTQAEFL
                     DELKHEMDKLGPLSDSELQELEAFAGHHDEFTVFPKIHEVKPEEVVGFVPFGKNTYFV
                     QRSATGNLPVYTDYKNGNKLVTEIRKIQGDPVQLRNDLQERLPFIAKKYWKVSIYSKK
                     IFIQGDATKHVKKVLATTF"
     gene            complement(<409386..>411002)
                     /gene="ALG12"
                     /locus_tag="KLMA_70199"
                     /db_xref="GeneID:34717956"
     mRNA            complement(<409386..>411002)
                     /gene="ALG12"
                     /locus_tag="KLMA_70199"
                     /product="dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-
                     alpha-1"
                     /transcript_id="XM_022821452.1"
                     /db_xref="GeneID:34717956"
     CDS             complement(409386..411002)
                     /gene="ALG12"
                     /locus_tag="KLMA_70199"
                     /codon_start=1
                     /product="dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-
                     alpha-1"
                     /protein_id="XP_022677812.1"
                     /db_xref="GeneID:34717956"
                     /translation="MDSILDLTAALTCAVSLHLWYSPYTKVEESFTIQAVHDILKYGI
                     FDISKYDHVTFPGAVPRSFVGPLILSLFTYPFNLTISNDPYRTQMLVRFLIGLTNTVA
                     LNRFAVAAKRALTNEQQAKANEKNDPMNKISTFDLSSWFGLFTVTQFHLMFYSSRPLP
                     NFVMALPLTLVGLSWALEGNYRWCLMLLSFTSIVFRLEIAALTIGVAIGAYYFKKLSL
                     LSIVRTGFVGAAAGFLLSVQVDSYFWDRLTVPEIESFFFNVIHGQSSHWGTQPFLTYL
                     TGYLPMMFLPPTALFINHLGYMISPVPFKIVGIAAYFHVLVLSFQPHKEWRFIIYANP
                     PITLLGATAAAYLFKTIDNKTAKGVAVRFILLLTPLASLILSVLFSFISSMNYPGGVA
                     LTQFNDMVKSQNISNAVVHLDVPVCMTGASLFGQLDDSWNITYDKTEDESLSSKWSTF
                     DYLITSLDNPTYIPADNETTWELVSTTKGFGGIDTAYLAKTFTEQYANGLDLYVTWER
                     TGDLNFLKEIFNNTFIMTDIFYTYKKVPIL"
     gene            <411190..>412452
                     /locus_tag="KLMA_70200"
                     /db_xref="GeneID:34717957"
     mRNA            <411190..>412452
                     /locus_tag="KLMA_70200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821453.1"
                     /db_xref="GeneID:34717957"
     CDS             411190..412452
                     /locus_tag="KLMA_70200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677813.1"
                     /db_xref="GeneID:34717957"
                     /translation="MSALKDYSFKEDEDGELPRLVTGDEADLESILKQYQPDGGKQIV
                     SDKKINRANMQWKQYYDKQQRIPVTIITGYLGAGKSTLLEQIALKGSDKRLAVILNEF
                     GDSSEIEKSISIKNNGEAYEEWLDLGNGCLCCSLKDVGVKAIEDMVARSPGKIDYILL
                     ETSGIADPAPIAKMFWQDKGLNSNVYIDGIIAVLDSEHIVSCLDDVSPASHWHGEKVT
                     LDGDEESNTTIAHLQIAMADAILVNKSDKIEGNEAKRQKLEQVVRSINSAAPLYYTKY
                     GDIDLDRILDLHAFESTKLLEARTETTFHDPRISTITLTFPFFTTREQFDSFIENFLQ
                     VLLWKNFGVEHPLTTQGEDFEVHRTKGLIVVSGEYKVIQGVRDTYDIIPGERVPNVKE
                     NKIVLIGKHLDETHIRKLLDSALIKEDN"
     gene            complement(<412641..>413552)
                     /gene="CPR4"
                     /locus_tag="KLMA_70201"
                     /db_xref="GeneID:34717958"
     mRNA            complement(<412641..>413552)
                     /gene="CPR4"
                     /locus_tag="KLMA_70201"
                     /product="peptidyl-prolyl cis-trans isomerase CPR4"
                     /transcript_id="XM_022821454.1"
                     /db_xref="GeneID:34717958"
     CDS             complement(412641..413552)
                     /gene="CPR4"
                     /locus_tag="KLMA_70201"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase CPR4"
                     /protein_id="XP_022677814.1"
                     /db_xref="GeneID:34717958"
                     /translation="MRLFCLLTWFAGVVFGAAIQTSGEKTVYEPNPPVTKRVLMGINF
                     THPETKQPMNIDVGIELYGSVVPKTVDNFYALAKGVKGQLGEEVIDISYKHTRFYRII
                     SDFMMQGGNVLPNVGPFSIYGYKFDDESFDLKHDRPGRVSMANAGPNTNACQFFITTS
                     NEPMPHLDGKHVVFGQVISGLEDLIRYVQHVETDEHDKPLDDVTITYTYSEELKIGNL
                     EQQHEDWKKKVEQFRNGDKSVGITLEQELAQGAKDEVKLENDYYYYQHPYAKFVFGML
                     FLGGLFTVYANRRSIIPRARNIVSVRS"
     gene            <414063..>414617
                     /gene="TOM20"
                     /locus_tag="KLMA_70202"
                     /db_xref="GeneID:34717959"
     mRNA            <414063..>414617
                     /gene="TOM20"
                     /locus_tag="KLMA_70202"
                     /product="mitochondrial import receptor subunit TOM20"
                     /transcript_id="XM_022821455.1"
                     /db_xref="GeneID:34717959"
     CDS             414063..414617
                     /gene="TOM20"
                     /locus_tag="KLMA_70202"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit TOM20"
                     /protein_id="XP_022677815.1"
                     /db_xref="GeneID:34717959"
                     /translation="MSSNQVSFGRILTIAGVTVATAFAGYAAYFDYQRRNNPEFRKQL
                     KRKLKQHAELEKQAKEEAKQEKLKRVNEILIAELSKDPLPQDPSQREAAFSSNVEMGE
                     KLAAVPGSELESALKFYKALSVYPNPSDLLGIYQRSLSEEIYENIVLMIALMPPSNVS
                     SFLTGAGVGSASSAAPAATVEIDE"
     gene            complement(<415026..>415627)
                     /locus_tag="KLMA_70203"
                     /db_xref="GeneID:34717960"
     mRNA            complement(join(<415026..415464,415581..>415627))
                     /locus_tag="KLMA_70203"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821456.1"
                     /db_xref="GeneID:34717960"
     CDS             complement(join(415026..415464,415581..415627))
                     /locus_tag="KLMA_70203"
                     /note="Uncharacterized mitochondrial outer membrane
                     protein YPR098C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677816.1"
                     /db_xref="GeneID:34717960"
                     /translation="MSILKPTAHLLFYSFVFGGTTFYSYVASPIAFKTLERDQFSILQ
                     HNVFPMFFQMQTASPIILGLTAPFALTTGAITSLVTASVSGAINYFFLLPRTQKIKEE
                     RKKVAKEFSGDELEAKDAPLRKSFGQSHGLSLLFNMTNVLGTLAYGIYLSRGLLKYVP
                     K"
     gene            416252..416327
                     /locus_tag="KLMA_R704"
                     /db_xref="GeneID:34718780"
     tRNA            416252..416327
                     /locus_tag="KLMA_R704"
                     /product="tRNA-Val"
                     /db_xref="GeneID:34718780"
     gene            <417251..>420574
                     /gene="SYT1"
                     /locus_tag="KLMA_70204"
                     /db_xref="GeneID:34717961"
     mRNA            <417251..>420574
                     /gene="SYT1"
                     /locus_tag="KLMA_70204"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821457.1"
                     /db_xref="GeneID:34717961"
     CDS             417251..420574
                     /gene="SYT1"
                     /locus_tag="KLMA_70204"
                     /note="Sec7 super family[cl00136]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677817.1"
                     /db_xref="GeneID:34717961"
                     /translation="MNHLIVDYIKGKLNKRRQDSGSEDEDDEGDDHHSFEKEKDFVGD
                     SDPGHAQAQSPIPSPWATFEPSYNNAKNVRNNSTSTTVLNDIAEERGPVSESEETTYT
                     KKEEEPLEEVTDRRPPLTNMQRLKKRVSSLPDLRLKALAQHRNRNSSSQSAEHNTSTN
                     TSTTINTTTTTTNPSNKKVESKERIHSPPSFLSLRFGTNNDNANKSNNNSSNSTISAN
                     TSSASHSRKSAKLATWLNFSPAQKKHDIDDTETDPKDTSGSILKQKVVISNAAGSSLD
                     ERSLSSEPGLGSVGAASISRSSVKDLTAMSPVNRSKSFESVSNNSNTTSTPPNISINR
                     LSSARRSISSFADSVMRTSIVGGQHTREASLDSANDATLSKLNVRRMRSKTVDTVDQN
                     KPELIWYRPSPLENVSFPGAGENVTTRSRSDSASSNLGLGITTTNGTSTQRNASTHLS
                     RRSNSIVTTLTNIMSLRSVTGMHSQKFPLPTPIPFSNMEKPPKPNSEESEEKYLDRIL
                     PIYQKYLAIVLCAREDPFILSCLRLFMERDFDFSQQPLDLALRTVLLFLELPKEGQQI
                     DRFLRCFSSAYYNHNYQSAETSDNQEHIWKDSEQVYFLTYSLLVLHTDNFNPNNKEKI
                     TKAEFVKLIHSDTDSSGKSIPREYIEYLYENITAREFPVTILPPYEVDDSLNPQERII
                     NWFPPSYSPVNMIKSQWLSHRSFLILGNKSNPSTYQYSLTPPPIPSGPNSSTSSSLSL
                     FAVEDIDPYHYIINDSLKNISLENFVDPVPYETLESTSTLMDSHGVKKLLSLLKDTKG
                     GYLKFNKTQLLSKLHDVNIEILNEDASSEIAYLKILKMGELEMKVSTRKFSLVGNVVK
                     SQWRSKFAILTTSHLLFFDGTTWLDPKIELDSKTNTSNYIIDLSLPLSAYHEINYCNN
                     LFLTESKSEAPNILSIINQNLRRDIMFRDKAEAEEWRNSIYFSGSLDGCKMDIKGLSN
                     TFIVERKVSLQEKIVKLQSNHEQNMSKWHSLYDQLNLYLNTAPISVKTRSSLIDHVNG
                     IRKRMEMVSYQNERLELYIKLLELIVGLEPSVSGYVSLDLDSIDESFLFNQQQYRKSS
                     DLPLASETDQSGSDRAGTT"
     gene            complement(<420615..>420956)
                     /gene="RDS3"
                     /locus_tag="KLMA_70205"
                     /db_xref="GeneID:34717962"
     mRNA            complement(<420615..>420956)
                     /gene="RDS3"
                     /locus_tag="KLMA_70205"
                     /product="pre-mRNA-splicing factor RDS3"
                     /transcript_id="XM_022821458.1"
                     /db_xref="GeneID:34717962"
     CDS             complement(420615..420956)
                     /gene="RDS3"
                     /locus_tag="KLMA_70205"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor RDS3"
                     /protein_id="XP_022677818.1"
                     /db_xref="GeneID:34717962"
                     /translation="MSRHQYDLVMCLNLPGTSIGKLCDKCDGRCPLCDSDVKLISKVR
                     ICDSCAVGGSGGKCITCGNAGKHEALYCLECVRSEKSRDGCPRILNYGSNKTDRYYNK
                     KLDNKRSTYDT"
     gene            <421179..>422078
                     /gene="ASR1"
                     /locus_tag="KLMA_70206"
                     /db_xref="GeneID:34717963"
     mRNA            <421179..>422078
                     /gene="ASR1"
                     /locus_tag="KLMA_70206"
                     /product="alcohol-sensitive RING finger protein 1"
                     /transcript_id="XM_022821459.1"
                     /db_xref="GeneID:34717963"
     CDS             421179..422078
                     /gene="ASR1"
                     /locus_tag="KLMA_70206"
                     /codon_start=1
                     /product="alcohol-sensitive RING finger protein 1"
                     /protein_id="XP_022677819.1"
                     /db_xref="GeneID:34717963"
                     /translation="MCGDSDSVCKAEVCGICLESMKEIDIGELLPCKHRYHISCIRQW
                     HLYSNDFHCPTCRKDSKHLHRIYEDIKIDLQYWCNVSLVEQFTKLRLLNEDCENNSSG
                     EGDAASTAAAELDSAEREEIQDEPKSGSPELVLVQCALCGDMDDSVSLYCETCETLFH
                     PSCLTELLCEVGETDWLCTECHGNLSHLRGRGPSSMIVRDSNVRIYEGRMRDKRSILT
                     ECIYNRFAQPYTLSYDDKCKIQRFVRSELDSYYQQGSLTKDRYITINKIVSRKLYEMS
                     PSGFDPVQLDYKELAKLSIKAVI"
     gene            complement(<422181..>423128)
                     /gene="TWF1"
                     /locus_tag="KLMA_70207"
                     /db_xref="GeneID:34717964"
     mRNA            complement(<422181..>423128)
                     /gene="TWF1"
                     /locus_tag="KLMA_70207"
                     /product="twinfilin-1"
                     /transcript_id="XM_022821460.1"
                     /db_xref="GeneID:34717964"
     CDS             complement(422181..423128)
                     /gene="TWF1"
                     /locus_tag="KLMA_70207"
                     /codon_start=1
                     /product="twinfilin-1"
                     /protein_id="XP_022677820.1"
                     /db_xref="GeneID:34717964"
                     /translation="MSNQSGITADQEVLNAIAALKSRHASVVAKIEQSEQPVIKLQET
                     FQDLESLREYVGSNDDTPLYIIIYDEPKMHFIAYTPDYAPIRSKMLYASSKITFQRQI
                     GANNLKSYMFTDVNDIDEKSWTDTTSKEELMTAAELEKLQIDAQQNSMRSSGAVKLVS
                     AHTNGSNSLGFKVADAGSLKDLFQKYNLVLFQIDMKSEEIIIKNKFTTSTDDEIVEKI
                     PNDSPTFSIFRKAGDYYFILSCPSGSAIKERMVYAANKRAFILNLKDSDDIDIKKTIE
                     IGDPQELELSDLGEKEETAGSQTPAKPRLNKPKAPSRRR"
     gene            complement(<423607..>424551)
                     /locus_tag="KLMA_70208"
                     /db_xref="GeneID:34717965"
     mRNA            complement(<423607..>424551)
                     /locus_tag="KLMA_70208"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821461.1"
                     /db_xref="GeneID:34717965"
     CDS             complement(423607..424551)
                     /locus_tag="KLMA_70208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677821.1"
                     /db_xref="GeneID:34717965"
                     /translation="MAKNVCIGKKHESQFKIATRVIPETAITPLSRETGMQSTDESDV
                     DGTESGGLFSPVGSDREMEMEMELGLELDDEFEFDWFADSSHPKSFRTVRQPEKCEES
                     EVEVVGKDLSVSEDLKGLILPKARGEDDDGTGNDVELPINEDFWKEVDTSVGETDVEI
                     HVQDFHGSALLTGKSSNLAASAASAAAAAAATENSSASVAAIEDFIKMDNYSFSNGVG
                     TNSGSSSMEEHAEARITHFMYPIKKFTFRDASGKLVLDPQVSANPSGISTATHTYTRD
                     RILKARKAKSKFKKISRSREGWCEMVSTGVGIGEFMLV"
     gene            <426807..>429194
                     /locus_tag="KLMA_70209"
                     /db_xref="GeneID:34717966"
     mRNA            <426807..>429194
                     /locus_tag="KLMA_70209"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821463.1"
                     /db_xref="GeneID:34717966"
     CDS             426807..429194
                     /locus_tag="KLMA_70209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677822.1"
                     /db_xref="GeneID:34717966"
                     /translation="MISIKTFFLIYLFGGITFIPICVFIVFYLLSKPVSDVDEKENDT
                     LLVDVDPDFEVGDFNELKGVAAKKEGWIHMTRQFYPHQSDVDNQSQVDGSDETDSSIN
                     LTSSEQQITRDKLKKKDKFYAVLKHGNLFLYKDNSPGAGPQQVIVLNDAFISIWPRTI
                     SPQDNTPISDGSLFTKKTCISIWKKHTAYLSESGEVQFRKGGPSDQFFIYLDLNTDKE
                     DWYFALIQATKLSNSSFGTSASTTNLEVDKALSAEYFAQTAHFKTKDMLQLIQTLNST
                     EGQHSSQWFNALLGRLFLSFQHTETLSNALKERIYKKLRKINKPGLLDDFSIETVDVG
                     NGAPLITNAKLLDLTPEGLTRVSFDLLYTGHLHLIIATKVNINLGSRFKKREMDIKLS
                     ITAKKVEGPVVILVKPPPSNRLWYAFQSEPLLDIDVEPVLSTRQLSNNMVTNMIKSKF
                     KEAIKESIVLPYMDDMVYYTTTSEIYRGGIWKRPETETDTKENINLEELKTQTAHSSG
                     FSVKEENDYSQNVEQQDEKPQNNFVPSSPTTDNNETSFTNIIEPEIPRRSGENLKAFL
                     KNRSNDDSNLSLRSKSSSDSINSNTTKRYLQTGMKKIGRWYKDQVTTVKESLNDDSKD
                     YSDRGDLRALDFKQEVVEETSFIEKDVKVQESTNNHLELDTGLRVESNHKTTGKPSSP
                     EMISSRRMPRSKTSSIDSTKAENYTKQHNELHKGDMFVNRSRARSTSGSFGPTSPIPD
                     SFRRREDSFSFSNNENLNPQTATPHNIPEEVNIVFTPASPKKKNKRPPPPPLLSS"
     gene            complement(<429239..>436150)
                     /gene="MEC1"
                     /locus_tag="KLMA_70210"
                     /db_xref="GeneID:34717967"
     mRNA            complement(<429239..>436150)
                     /gene="MEC1"
                     /locus_tag="KLMA_70210"
                     /product="serine/threonine-protein kinase MEC1"
                     /transcript_id="XM_022821464.1"
                     /db_xref="GeneID:34717967"
     CDS             complement(429239..436150)
                     /gene="MEC1"
                     /locus_tag="KLMA_70210"
                     /codon_start=1
                     /product="serine/threonine-protein kinase MEC1"
                     /protein_id="XP_022677823.1"
                     /db_xref="GeneID:34717967"
                     /translation="MSTAKVKYLDELIVALRSAAAAATMTSATAAAAADGNTSENTGT
                     DGSTASAKLLHTLLRNIHAPAEELIFHKSFVALDLLLKCNPHLLRASILDNMLECSMI
                     HWDNLQYMWLIRRYVLRWLDVCVFKGPDLASWFADQMDQFDRQLLQCLKGTLEVNQFH
                     ALMKKVVIVNEWIMNHYILKTYSYRGWNSQFLRLMRFLVFVLKSINLKPNDTRTQNQS
                     LVEYSRIVNLLVTYIVTSKQSLPVFSFSFDLIQTLIKDHYRHIPPTSLAKSLLRTLYL
                     CRDNVSMINYMKNTFQLHHWIATNAKDLDTDYQVLFVRTVNYVAFKLGLIDTIEEFTF
                     PNKQLHWLHEKIERSEALPPAKITELTAKAHYDKIYDSLASANKNNSSLDDILLPVFP
                     SIRQLALDESLIHNTNTGDSPTSQQTLEHSRTMKLSPKKLLPLHKSLAYQLLVRYILR
                     PGHDVSTMSEPMLTGVILVIIDILSQFDPPQLTSKPDPSNASFGYFCFQVINTSFTRK
                     SRPLRLLSVGLFPLFARSGCSHEESNLKFLIMFLQKPWPSHLTETCQMSWINLILNCN
                     SDYFDDLLLKLIDVFNSSDFAEHTMMSYQLRYLSRIEEKSPYQLLSPILPVIFKKMGK
                     NLVEKRLGLQRIVQLVEYPAKTLLENFQRYVVPYALGHYKSDAIAEIARIMSDNNKNL
                     IEEKKLQLLDRNSRQIFAVALVKHAFFSIETIETLFLNTAPNFKKQYIALYLPDYKTL
                     AEVLKMSKTISSLDSPLTENERSILASLRYLVITNFSKDRRRGTRFRNIEDWNEEMQK
                     QFLYKMEQNILGIFQVFSNDMHDSDGKTSYYEKLRVLNGITFLMKHSSKKSIISALAQ
                     LSICLQTGSEIQEIQLNALQCWHLLVRLLNEEQITAIIDSLFCLVLQKWDCFSSSCKS
                     ECQAIFDTLLRDRQSLVLESRPFLLLSFLNNPELQVLERHPMVARKVLKVMTTTNWLR
                     VFTQNLGSNNRYVILQTLLELEKYFTTSLYRKHVDVITKHDDSIHLSRLLGALLDSAY
                     KFRNKDLKICQLSSSCIGLMGLLDVTKHSLPRNNNLSEEICDFNNHSQTVKFLINIIN
                     DILVPAFWQSENPTKQLFVALVMQESLKYCGLSAANWDINNPENYPMEAKLWSRFNDI
                     SKTTLYPLISSLYLAQSWKEYVPLKYPSFRAKDPFQVWIRNLTLDLLKIGTDEDHPLH
                     VFSSLIREDDGSLSNFLLPFITMDIILRASKGSKYIEIIENLSIEFQYIFNYDIQQLN
                     HFQMDSLKMAYNSIFRVYEYCKKWVSNFKQDYQAANGTYMIQEDRFLKILDRTENFVN
                     IIPSDVLAKKSLETDSFERSALYLEQSYREQGTAPSSSSDLLQSLQMTYAEIGDVDAV
                     GGVLKMFSTGNLTTKIEELQYSKNWRMAQDCFEALSVFKQSDTSYVSEDLIKSSNMKM
                     LKSMYNHQLYDELLSKIKLHLPEIKGFVAENDNDLLNMGIEAASQTGSIDDLTKWIER
                     LEYIQNFNDPSLLLHYNIAKVLQAVNKNELNKFERYLNRCFALIGVQFTTPSTSTTLL
                     KNRETLQKLHALTDTKMLFSTRSTTDFANILKTLNGRLSHVGSDFSPNHYLLSIRKTV
                     EIVSSKEHLHTDISNVYFHLSQLDRKENRLELAAEDLMNALKYNHHSAELEFAEILWK
                     QGEKDMALKTVAEITKRFENDPSTLSSKNQDFKEVLLKYTEWLDLSNSSVSDQIIKQY
                     NELIRLDKSWHAPFYSMGLYYSKLLEKKKAEGYVSDGSLEYRSITNFLASFEKGSSNI
                     RQSLPKVVTLWLDTTKSESSDSNSDRSTYSSKICAKIDATVKQCGIHIWYTVLTQLLS
                     RLLHPHTATIHSIVNILFHMTMEYPSVMLWYISILLNSENLERRNIGKQIIDAFQKKN
                     PKTKLPNTAISLVQSLTRVCIKDVKSTSSRSGRSIDNDFRFNLELAPNDMCVPVNINL
                     KKLLPSTANSMDSETFKSVMVTISKFSPQYMVFNSLKKPKKLTVIGSDGNIYGIMCKK
                     EDVRQDNQYMQFANTMSFLLSNDVESRKRNLGITTYGVLSLREDCGLLEIVPNVLTLR
                     SLLSMKYESMKIKYSLKSLQEKWQGIPSDQKLGFHQDCLKKFPPVLYQWFLDNFPDPI
                     TWYNARNGFVRSYSVMAMVGHILGLGDRHCENILLDVSTGRVLHVDFDCLFEKGKKLP
                     VPELVPFRLTQNIVDAFGIIRTEGTFKKSCEVTLRVMRNNEIGLVNIIETIMYDRKID
                     ESIQMALKVLRDKIRGIDSRDGLALSVSGQVEALTQEASSVENLSKMYIGWLPFW"
     gene            complement(<436805..>437203)
                     /gene="CKS1"
                     /locus_tag="KLMA_70211"
                     /db_xref="GeneID:34717968"
     mRNA            complement(<436805..>437203)
                     /gene="CKS1"
                     /locus_tag="KLMA_70211"
                     /product="cyclin-dependent kinases regulatory subunit"
                     /transcript_id="XM_022821465.1"
                     /db_xref="GeneID:34717968"
     CDS             complement(436805..437203)
                     /gene="CKS1"
                     /locus_tag="KLMA_70211"
                     /codon_start=1
                     /product="cyclin-dependent kinases regulatory subunit"
                     /protein_id="XP_022677824.1"
                     /db_xref="GeneID:34717968"
                     /translation="MYSTHTFQGRKLSELERSRVLEFQDSIHYSPRYSDDTHEYRHVM
                     LPKAMLKVIPSDYFNGDTGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRP
                     LNYEQELRAAHAAAAAASQQQQQQQQQVGR"
     gene            <437661..>440201
                     /gene="HSL7"
                     /locus_tag="KLMA_70212"
                     /db_xref="GeneID:34717969"
     mRNA            <437661..>440201
                     /gene="HSL7"
                     /locus_tag="KLMA_70212"
                     /product="protein arginine N-methyltransferase HSL7"
                     /transcript_id="XM_022821466.1"
                     /db_xref="GeneID:34717969"
     CDS             437661..440201
                     /gene="HSL7"
                     /locus_tag="KLMA_70212"
                     /codon_start=1
                     /product="protein arginine N-methyltransferase HSL7"
                     /protein_id="XP_022677825.1"
                     /db_xref="GeneID:34717969"
                     /translation="MGIGITTQSNVFVGIKPELGQGAYGAYTAGIGEEEDKRSAQSPL
                     EQCDYLLVPLTNARYRDSMKAQFEAYRESGASELRLEAPQLQELGVLPSSGGNGGSRS
                     NSNGSTSGGNGGIGAATPQYIGLVSSFLELDSSEVDVRELSLQVLQHELEYANFVGIR
                     QVIVAPPKRLNTLHYYAQSLARVFDQFGERCPTVSISLPLFEDSDPLSTWELWNTIRK
                     MCRYAGKLSVSLALPRQRTPGYVLERWLSEPVTCLLISASVFTTNQYNYPVLNRFNQH
                     LITAFQRINGNASQFGELAILLHGMEKYVDKLCVGPSQYLEYINYLLKKGDKLIAMEN
                     SDANLDSNSKSNPIANGNGNGNGNGNANASHAFFSMEPRVMPPLLPHCEDLSNAVYQT
                     FERDAVKYEQYERAIAMAVSDILMENSSRWRGSNEIVILVAGAGRGPLVDKTFKVLDT
                     LRVTNFRLLAIEKNPHALLYLQKRNFEHWDNRVEITMCDIREWDDHVKVDLCISELLG
                     SFGCNELSPECLAPIEQFHSKPSTRFIPQSYSSYAAPVSSPILYQSLSQRGPQYLEQP
                     SVIHHIPYCQTSSRINEIWNFTHSHEERLSHFNKTSVSHFRVKHKSEIHGIVGYFIAT
                     LYADITLSTVPDGSILKTLQDQENSTIENSRNHNGSSSTPTKGNHTENMRSWSPIFFP
                     LKEPLFLNDDTEVELFMSRNNNKDKVWYEWSASCFVYLVSSSDAHNNSVEREKHNHTL
                     KDNGTDLETQKLTNAFARFGHQHDSSNGESKFFEDSVNHTDFMSNRGNEWESVKDLHE
                     LQNRQIPSILDKERVERKKSFVEEYHVRVRTSVSQLHNPNGSTYAIPL"
     gene            complement(<440424..>442682)
                     /locus_tag="KLMA_70213"
                     /db_xref="GeneID:34717970"
     mRNA            complement(<440424..>442682)
                     /locus_tag="KLMA_70213"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821467.1"
                     /db_xref="GeneID:34717970"
     CDS             complement(440424..442682)
                     /locus_tag="KLMA_70213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677826.1"
                     /db_xref="GeneID:34717970"
                     /translation="MDIEDPWKSADSGSSPAGLGGFGILQRGNDDQLMKIKESLKKGL
                     NDTTWGPVYKLFEDEDSSAMEFEAATEKIDVNEKHLTGVPLLTYCVAFDRLSFLESLL
                     MTKDNRKKKMDLNVKDDFNKWTPIMWCCYLDRYSCLTELMRFSDELDLYYKTATGQSL
                     ESLAVPGTAIYGFMDIHQVFTKKPQQVEDLYKAPADINPGIDSTMDELNLQTAGLRVH
                     DDIDEDTAYFHPAERSTAVEQPPDIPPESEFNYKILEPRQYIVFTSLDIDKIAALVET
                     IPNKFPHKPNIAAAVTFQCIRYAHHKRNNRKMIESVYDLCLQKLCPPEEDQDILKKSY
                     ALGYLNFLYYYLYRDETVLPAYPNILQNIIDTMLSLIKSLSSAINNRLKPLLVPGILE
                     YTTISDVKETLYKNDWNFFKKRKINRLKHDSYDHILKQLYPPSVKEQMKPSPLKIVQI
                     FGALTYVFDLHSIHPVLLQQCISISAKWLAHTIFNELIRSKQLLSRAHAMQIRLNLSI
                     LHDWVKNHNFKVDKPELMDTFMWQRFPLTIVQDVGAIDLSDPSKQPIKNVLFYKPVAE
                     EPCSDETNSLFFYQPFARIWQYHFEPVYQLLQWLQVATSLEASEDVMQSTLKLFNRLN
                     ATQLYKSLDRYRYEINEEKSKMKKLLRQRVKAEKEEEPIMLETEFDVYLALPTLHELY
                     ALYDECESSYIYLPVLPVEIQDEVDDVHDQVKGDQDLETASGTFENMDEPKPAAHAVW
                     SSNDMKLQENPW"
     gene            <443805..>445520
                     /gene="AGP2"
                     /locus_tag="KLMA_70214"
                     /db_xref="GeneID:34717971"
     mRNA            <443805..>445520
                     /gene="AGP2"
                     /locus_tag="KLMA_70214"
                     /product="general amino acid permease AGP2"
                     /transcript_id="XM_022821468.1"
                     /db_xref="GeneID:34717971"
     CDS             443805..445520
                     /gene="AGP2"
                     /locus_tag="KLMA_70214"
                     /codon_start=1
                     /product="general amino acid permease AGP2"
                     /protein_id="XP_022677827.1"
                     /db_xref="GeneID:34717971"
                     /translation="MIGGSNYIRLQQQTSGDGKDLMTGSISLLSKQKAQESEEVVAFS
                     SDDSSGYFRTSTARSLKNYHVQLIGISGVIGTALFVSIGKALYHGGALSLIFGFALWC
                     IPILCITVSTAEMVCYLPISSPFLRMSKRCCNDSMAVMAGWNFWFLECVQIPFEIVAV
                     NTILHYWRDDFSPAIPLCIQVVLYIGISLFAVRYYGETEAFLASFKILLAVGLFLFTF
                     ITMLGANPKHDRYGFRNITTTKFKKYFPNGEGSESIGYFQGFLACIIQASFTIAGPDY
                     VAMIAGETMLPRKVLPTAFKQVFIRLTILFLGGCLCVGIVCSSKDPALTAVINEPRPG
                     AGSSPYVIAMNNLGIKVLPDVVNAALVTAAFSAGNAYTYCSSRSLYGLSLDGYAPRVF
                     QYCTKSGVPIFAVAVSLVWALISLLQLSSNSAVVLNWLINLITASQLINFAVLCIVYL
                     SFRRAYIAQYPSKSLPELPFKSWGQPYTCYCGLTAVTLMIGVQGYTVFLRGNWDVENF
                     LFCYLMVFVDIAIFLGCFFVFKRAKDPWVKPHEADLLTGIDEIEEHEKSLGFHKYALN
                     SIQNC"
     gene            <446054..>447457
                     /gene="RVB2"
                     /locus_tag="KLMA_70215"
                     /db_xref="GeneID:34717972"
     mRNA            <446054..>447457
                     /gene="RVB2"
                     /locus_tag="KLMA_70215"
                     /product="ruvB-like helicase 2"
                     /transcript_id="XM_022821469.1"
                     /db_xref="GeneID:34717972"
     CDS             446054..447457
                     /gene="RVB2"
                     /locus_tag="KLMA_70215"
                     /codon_start=1
                     /product="ruvB-like helicase 2"
                     /protein_id="XP_022677828.1"
                     /db_xref="GeneID:34717972"
                     /translation="MSIQTQDSQETLKSLSLIAAHSHISGLGLDENLQPKPSSQGMVG
                     QLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGLSQSLGKDVPFTAIAGS
                     EIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQIDRSITGGHKQGKLTIKT
                     TDMETIYELGNKMIEGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTK
                     FVQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKVA
                     EWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVIMATNRGISKTRGTN
                     YKSPHGLPLDLLDRTIIITTQNYDKSEIKTILTIRSTEEEVELTPEALDLLTNIGTET
                     SLRYSSNLISVSQQIAQKRKSNVVDVVDVERAYLLFLDSSRSVKFVQEFESQYIDNQG
                     QVNISIGKSEDAMDTSA"
     gene            complement(<447704..>448201)
                     /gene="VMA11"
                     /locus_tag="KLMA_70216"
                     /db_xref="GeneID:34717973"
     mRNA            complement(<447704..>448201)
                     /gene="VMA11"
                     /locus_tag="KLMA_70216"
                     /product="v-type proton ATPase 16 kDa proteolipid subunit
                     2"
                     /transcript_id="XM_022821470.1"
                     /db_xref="GeneID:34717973"
     CDS             complement(447704..448201)
                     /gene="VMA11"
                     /locus_tag="KLMA_70216"
                     /codon_start=1
                     /product="v-type proton ATPase 16 kDa proteolipid subunit
                     2"
                     /protein_id="XP_022677829.1"
                     /db_xref="GeneID:34717973"
                     /translation="MSQVISEDQYAPLFAPFFGFAGCAFAMILSCFGAAIGTAKSGIG
                     ISGIGTFKPELIMKSLIPVVMSGILAVYGLVVAVLIAGGLSPSEDYTLFNGFMHLSCG
                     LCVGFACLSSGYAIGIVGDVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNT
                     RGSSS"
     gene            <448616..>449284
                     /gene="NSL1"
                     /locus_tag="KLMA_70217"
                     /db_xref="GeneID:34717974"
     mRNA            <448616..>449284
                     /gene="NSL1"
                     /locus_tag="KLMA_70217"
                     /product="kinetochore-associated protein NSL1"
                     /transcript_id="XM_022821471.1"
                     /db_xref="GeneID:34717974"
     CDS             448616..449284
                     /gene="NSL1"
                     /locus_tag="KLMA_70217"
                     /codon_start=1
                     /product="kinetochore-associated protein NSL1"
                     /protein_id="XP_022677830.1"
                     /db_xref="GeneID:34717974"
                     /translation="MSAYVDKLDVTQKQLRFLHKQFKEILDEKVRKALPGYSEDDEVS
                     QEIQLQLDQFLMDAIEMAGESMNVVDAGRGTTVKSIIQEVQKEYMEPFDVDLNERVRK
                     LYQEWEDRTVEVSQLRREAPQVVISEYTNLEKQLLDDIDAKIEAAAARRDQETGTGTE
                     TETETETDTQDPDSSEYWSQLADQYKQALTALKSTNQDIPSHETRQKRLRTLLDLIEQ
                     EVGS"
     gene            <449740..>450597
                     /gene="SSO1"
                     /locus_tag="KLMA_70218"
                     /db_xref="GeneID:34717975"
     mRNA            <449740..>450597
                     /gene="SSO1"
                     /locus_tag="KLMA_70218"
                     /product="protein SSO2"
                     /transcript_id="XM_022821472.1"
                     /db_xref="GeneID:34717975"
     CDS             449740..450597
                     /gene="SSO1"
                     /locus_tag="KLMA_70218"
                     /codon_start=1
                     /product="protein SSO2"
                     /protein_id="XP_022677831.1"
                     /db_xref="GeneID:34717975"
                     /translation="MSYNNPYAQEYEMEAQQPHGGGHGSSKNDFVGFMNGINDINNGL
                     SDYQQLINNIDVLQRRLLSEVNEEREQQARAELDQVTAEATNLQYHLKDQIKNAQQQA
                     VGDSAKMAQAENSRQRFLKAIQDYRIVEVNYKEQNKEQAKRQYRIVQPEATDDEVEAA
                     ISDVGGQQIFSQALLNANRRGEAKTALAEVQQRHQELLKLEKTMAELTQLFNDMEQLV
                     IEQQENIEVIDKQVENAQQDVEQGVGHTNKAVKSARRARRNKIRCLIILAIVIIIIVV
                     AVAVPLATR"
     gene            <452438..>458122
                     /gene="FAS2"
                     /locus_tag="KLMA_70219"
                     /db_xref="GeneID:34717976"
     mRNA            <452438..>458122
                     /gene="FAS2"
                     /locus_tag="KLMA_70219"
                     /product="fatty acid synthase subunit alpha"
                     /transcript_id="XM_022821475.1"
                     /db_xref="GeneID:34717976"
     CDS             452438..458122
                     /gene="FAS2"
                     /locus_tag="KLMA_70219"
                     /codon_start=1
                     /product="fatty acid synthase subunit alpha"
                     /protein_id="XP_022677832.1"
                     /db_xref="GeneID:34717976"
                     /translation="MKPEVEQELAHVLLTELLAYQFASPVRWIETQDVFLKDFNSERV
                     VEIGPSPTLAGMAQRTIKNKYESYDAALSLQRQVLCYSKDAKEIYYTPDPAELAPKEE
                     ATGAESAPAAAAASAPAPAAAAAPAAAPAAAAAPVAAAADIPDEAVKASLLIHVLVAQ
                     KLKKPLEQVPMSKTIKDLVGGKSTVQNEILGDLGKEFGTTPEKPEETPLEELAETFQE
                     SFSGSLGKQSSSLISRLLASKMPGGFTITVARKYLQTRWGLGSGRQDSVLLVALTNEP
                     SARLGSEADAKAFLDSMAQKYASIAGINLAAASASAGAAGGAAGGSGATIDAAAFEEL
                     NKDQRVLARQQLEILARYLKLDLNQGEKKFLKEKDTVAELQSQLDYLTEELGEYFIQG
                     VSTSFSRKKARVFDSSWNWAKQSLLTLYFEIIHGVLKNVDREVVTEAINIMNRSNETL
                     IKFMEYHISHTDENDGENYKLAKQLGQQLIENCKHVLHMDPVYRDISKPTGPKTIVDK
                     NGNIKYSEEPREAVRKFSQYVQEMALGGPLTKVNEGSITEDLKRVYKAISAQAAAHNI
                     SDSTQIQFETLYGELIEFLESSKEIDASVATRPAGVDEDALDEDSTKEVASLPTKSAI
                     VKTVSSTIPRETVPFLHLKKKLPSGEWAYDRQLSSLFLDGLEKAAINGVTFKDKYVLI
                     TGAGVGSIGAEVLQGLVQGGAKVIVTTSRFSKKVTDYYQSIYAKYGSKGSTLIVVPFN
                     QGSKQDVENLVDFIYDDEKNGGLGWDLDAIIPFAAIPENGIELENIDSKSEFAHRIML
                     TNILRLMGCVKKQKSARGIETRPAQVILPMSPNHGTFGGDGMYSESKLSLETLFNRWY
                     SESWGNQLTICGAIIGWTRGTGLMSANNIIAEGIEKMGVRTFSQKEMAFNLLGLLIPE
                     VVSLCQKSPVMADLNGGLQFLNDLKEFTGKLRSELMETSEVRKAVSIETALEHKVVSG
                     NNADAAHSKVEVQPRANIQLNFPTLKPYDEIKKITAPELEGMLNLERVIVVTGFSEVG
                     PWGSSRTRWEMEAYGEFSLEGCVEMAWIMGLIKYHNGNLKGRPYTGWVDAKTNEPVDD
                     KDVKAKYEAHILEHAGIRLIEPELFNGYNPDKKQMIQEIIIEEDLEAFEASKETAEQF
                     KLEHGDKVDIFEIPETGEYSIKLLKGATLYIPKALRFDRLVAGQIPTGWDAKTYGISE
                     DTISQVDPITLFVLVSVIEAFIASGITDPYEMYKYVHVSEVGNCSGSGMGGVSALRGM
                     FKDRYKDEPVQNDILQESFINTMSAWVNMLLISSSGPIKTPVGACATAVESLDIGVET
                     ILSNKAKICIVGGYDDFQEEGSYEFGNMKATSNTLEEYEHGRTPAEMSRPTTTTRNGF
                     MEAQGAGIQVIMTADLALKMGVPIYGILAMTATATDKIGRSVPAPGKGILTTAREHHG
                     NLKFPSPMLDIKYRKRQLTARQEQIKQWVENEIEMLRYEVESVPAEEQEEFIQERTAE
                     IEREASNQLKAAQQQWGNEFYKSDPRIAPLRGALATYGLTIDDLDVASFHGTSTKAND
                     KNESATINEMMKHLGRSEGNPVLGVFQKYLTGHPKGAAGAWMMNGALQILNSGIVPGN
                     RNADNVDKLLEQFEYILYPSHSIKTDGIKAVSVTSFGFGQKGAQAIAVHPDFLYAAVD
                     KTTYEKYVEKCRLREKAAYKYFHHGMINNSLFVVKEHAPYSDDLEQGVYLDPLARVTN
                     DKKTGELKFTPAKIQSEESYVSEANKKTASVVNGLVQNLQGASGKKSSLSPGVDVELI
                     KSINIENETFLERNFTKQEIEYCQKQPCPQASFAGTWSAKEAVFKSLGVKSQGAGAPL
                     KDIEIVREKSGEPPKVQLHNEAAKIASSAGVSNVKVSISHDDLQSVAVAIAE"
     gene            <460521..>461318
                     /gene="USV1"
                     /locus_tag="KLMA_70220"
                     /db_xref="GeneID:34717977"
     mRNA            <460521..>461318
                     /gene="USV1"
                     /locus_tag="KLMA_70220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821476.1"
                     /db_xref="GeneID:34717977"
     CDS             460521..461318
                     /gene="USV1"
                     /locus_tag="KLMA_70220"
                     /note="Zinc finger, C2H2-type"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677833.1"
                     /db_xref="GeneID:34717977"
                     /translation="MIEKTGKSSRRKRHSSSGGCSKTFKCHGYGDCQMEFTRQEHLAR
                     HIRKHTGEKPFQCQLCLRFFSRLDNLKQHTESVHSVSMGNTYLKCAKPNRLWLPVSTP
                     PGRGSGVVGGSWDGYRAEQELGLELNQNQNQNLAQAPGFRTKPVLPPTPPVVGHSFGL
                     MPPLSKCPSPTASEFSQHPVVDFKNYELTVGPIVFPHSKPPSNVSSRNPSQNQNQIQY
                     QHQHQHQQQYHQQQIHLGMPQRVIPQTIFCQRLPQMYSPTFAGFDEN"
     gene            <462514..>463080
                     /locus_tag="KLMA_70221"
                     /db_xref="GeneID:34717978"
     mRNA            <462514..>463080
                     /locus_tag="KLMA_70221"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821477.1"
                     /db_xref="GeneID:34717978"
     CDS             462514..463080
                     /locus_tag="KLMA_70221"
                     /note="Uncharacterized protein YPL229W"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677834.1"
                     /db_xref="GeneID:34717978"
                     /translation="MSNGTPPWQYTSTGSPQTPSAVHAGLFGNSGSLSSNSSASSAST
                     GNTSAFNMSGFEGSGKANMNMNMHMNANLNGGGMQGLPPTMLNANMPINVGTGSLMYT
                     LPHESLISKNMSKSFEDDLFFCPRSLLSKEELSQCSQIDLLYCQQQQQQQQIQQIQQN
                     HAVSQQPVQQQRPRFNPYVSQSFNPGAA"
     gene            <463704..>465356
                     /gene="CET1"
                     /locus_tag="KLMA_70222"
                     /db_xref="GeneID:34717979"
     mRNA            <463704..>465356
                     /gene="CET1"
                     /locus_tag="KLMA_70222"
                     /product="mRNA-capping enzyme subunit beta"
                     /transcript_id="XM_022821478.1"
                     /db_xref="GeneID:34717979"
     CDS             463704..465356
                     /gene="CET1"
                     /locus_tag="KLMA_70222"
                     /codon_start=1
                     /product="mRNA-capping enzyme subunit beta"
                     /protein_id="XP_022677835.1"
                     /db_xref="GeneID:34717979"
                     /translation="MKPNRGLSLTDLVNHDDTPPLKTDNVVQPQANVQIGSVPEATQP
                     GAPAVGPAVPVSGSNFNNSSASQGGLQSSSAFGPGKAAEESDETDTDDEPGEIVFANT
                     KFKFDDEEPSVKKSPAKKPTVAKEKETQVKKEPEPEPKAESKAESKAESKAEVKPEVK
                     PEPEIKSKPEEKVEIQPKPQTSLEQDDKTTPSSAAHAKKENNDIFKQKSSNASVKNNI
                     KKDLMILNELSSSSLPKRYNIPPIWARKWKPTVKALQAIDSKNLKLDDSILSFIPEDD
                     LTKSVQDWIYATLVSVEPQLRQFVEIEMKYGVIIDPTSSSRVNPPVSSQCVFTDLDST
                     MKPDVDERVFDEFNRYMRNLSELNENMGKFNIIESHTSDLSYRVRTHTERPKFLRMTK
                     DVNTGRIAQFIEKRKISQLLLYSPKDSYDCKISISLELPVPESDPPEKYSNHTPTGNR
                     IKKRTSYIHNDSCTRFDITKVENKPVRVNNNKKDRNEEPETTYEVELEINTPALLEAY
                     DNIQHDSKQYAAIVRTFLNNGTIVRRKLSSLSYDIFQGSNKL"
     gene            complement(<465505..>466452)
                     /gene="ALG5"
                     /locus_tag="KLMA_70223"
                     /db_xref="GeneID:34717980"
     mRNA            complement(<465505..>466452)
                     /gene="ALG5"
                     /locus_tag="KLMA_70223"
                     /product="dolichyl-phosphate beta-glucosyltransferase"
                     /transcript_id="XM_022821479.1"
                     /db_xref="GeneID:34717980"
     CDS             complement(465505..466452)
                     /gene="ALG5"
                     /locus_tag="KLMA_70223"
                     /codon_start=1
                     /product="dolichyl-phosphate beta-glucosyltransferase"
                     /protein_id="XP_022677836.1"
                     /db_xref="GeneID:34717980"
                     /translation="MAVFGDLKVLIGTVVCALLVGLYLVVLLLSNNPREAFSEELVYR
                     TVKDGSIVKGDLPHVGDESSDGIELSVIIPSYNETKRIKVMLEEAIEYLEKNMSNKWE
                     ILIVDDGSRDGTSEYCLELAKDHFKLTDGQFRVVTLEKNRGKGGAVRHGMLHARGQFT
                     LFADADGASKFSDVSKLLEKTSKDEPMVSIGSRAHMVNTDAVVKRTIIRNFLMYSLHA
                     LVFTFGIRSIKDTQCGFKLFNRKAAKTIFPKLHTEGWIFDVEILIIALRKNIPINEVP
                     ISWHEVDGSKMDLARDSINMAKDLVVVRLAYLLGIYSDK"
     gene            complement(<466848..>468776)
                     /gene="SPT21"
                     /locus_tag="KLMA_70224"
                     /db_xref="GeneID:34717981"
     mRNA            complement(<466848..>468776)
                     /gene="SPT21"
                     /locus_tag="KLMA_70224"
                     /product="protein SPT21"
                     /transcript_id="XM_022821480.1"
                     /db_xref="GeneID:34717981"
     CDS             complement(466848..468776)
                     /gene="SPT21"
                     /locus_tag="KLMA_70224"
                     /codon_start=1
                     /product="protein SPT21"
                     /protein_id="XP_022677837.1"
                     /db_xref="GeneID:34717981"
                     /translation="MSDQEQVYMTLKVLYTLDNDPNSFLSRSNDVVPVSVEQIPNPNN
                     VTSTLKIGAVEVDKVLQQVCQSSPELFPSCDGQEVVDKSLRSTDFNVYVKDICEEDEP
                     FVSLGLLSKLRQEKHMDRTYMIGRVCTNFASMLQRSTSQMNSLNGTVSKDTLEVKIRF
                     SKVMTRANSRRSSIGGNNANQSMIGMVATPVLSAGTPESSGVVNTKARRMPSMGNVRR
                     PSITNTTMPSGNTSFNKKKRVTNPMPAPKAVRTQSLPIWNNPGIPKNSIAHKIYMADR
                     NKEQNQSPNELRQEKKLTYQISSLQQDNSVSKFKVDDSISKRFDFMKKKSTVTKKSNG
                     NSSSGNNNTTNAVATPASSTINATTKSNKKQKRMNTAGGTASHNETIYENMEVDQRTP
                     EIFNKENIPPANNNANIEDLLLDLGSSNEDWFQGLFQSPAKETPNDTNTGHAVNVDVD
                     RTSPIDTLSMPLVDLEPNSDGPIQVSTGEQLKKLSLLPHIKKRKLEEHDNVSADRPEV
                     SVAMQNDDEDDDDDDVVVEDDDATSIMLQFSTSPSIVQDSSSTSKLSGHRDNAQKDPH
                     NPKSSKNRTNQMDSDDDYESKKRSTAMPSSPTAMFQYQLDDPSTESEQDFSNARQKFD
                     EDSTPATQYGFSDDKNGP"
     gene            <469924..>473487
                     /gene="NEW1"
                     /locus_tag="KLMA_70225"
                     /db_xref="GeneID:34717982"
     mRNA            <469924..>473487
                     /gene="NEW1"
                     /locus_tag="KLMA_70225"
                     /product="[NU+] prion formation protein 1"
                     /transcript_id="XM_022821481.1"
                     /db_xref="GeneID:34717982"
     CDS             469924..473487
                     /gene="NEW1"
                     /locus_tag="KLMA_70225"
                     /codon_start=1
                     /product="[NU+] prion formation protein 1"
                     /protein_id="XP_022677838.1"
                     /db_xref="GeneID:34717982"
                     /translation="MPPKKFKSLDDFLQEQAPPQDATPSPYGGFFKTQAAPGAPAQQR
                     SYKNYKQGYTQNYNQNYNQNYNQNYNQGYNQGYNQGYNQGGYNQNYNQGYPQYYQGYA
                     AQQQSPIVTSPQTSNTPTPSHSTTSLTSLSTNLANMQLSPISNYLAALSEQTSLVDVK
                     KQIKNIVDVFNEEGNSAKCLEEWKVAETVTKFMKPKNSNLVREAGMMLISSLVQNFTG
                     KTPQEIFFLPMLAIALDALIDKETNVKRAAHRAIDSIFSAFPVEAQTTVILPELLKYL
                     SGSAKWQCKVEALKLVDRIREESPNDLLELSFRSTIPTLTDMATDFKPELAKQGYKTL
                     LDYVKILDNLDLQPRYDLIVDTLQDPQRVPDCVKSLSSVTFVAEVTEPALSLLCPILT
                     RSLNLSSSSQEQLRQTVIVIENLTRLVNNRIEIEAFIPQLMPGVQRVLDTASLPEVRE
                     LAEKALAVIKEDSNDDGKFPGRINAQQAREHLDDILSKLSNNELLKDETVKAYLANIL
                     LADSNVNDWKRLSEFFTMVLGEESAEFIEHDIVDRMRGVFHQERKQYDGEEGVEIVNA
                     DFSLAYGSRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRSIANGQLEGFPDKDTLRT
                     CFVEHKLQGEEGDLDLVSFIALDPMLQDVSKEDIASALESVGFDDYRRSQTVGSLSGG
                     WKMKLELARAMLQKADVLLLDEPTNHLDVANVKWLQDYLLEHTDITSLIVSHDSGFLD
                     TVCTDIIHYENKKLAYYKGNLAAFVEQKPEAKAYYTLTNTNAQMHFPPPGILSGVKSN
                     TRAVAKMTDVTFSYPGATKPSLSHVSCSLSLSSRVAILGPNGAGKSTLIKLLNGELIP
                     DSGKVEKHPNLRIGYIAQHALQHVNEHKEKTANQYLQWRYQFGDDREVLLKESRKISS
                     EEEKKMFEKEIDIGDGRGMRQVEALVGRQKLKKSFQYEVKWKYWLPKYNSWVSKEKLL
                     EEGFDKLVQKFDDHEASREGLGYRELTPSVITKHFEDVGLDAEIANHTPMGSLSGGQL
                     VKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREWTGGVVMISHNNEFVGALC
                     PEQWIVENGTMVQKGIAEIDQTRFEDGGNANAVGVSAPKRVDDDDSPANIKVRQRKKR
                     LTRNEKKAQAERRRLRYIEWLSSPKGTPKPVDTDDEGDDEE"
     gene            complement(<473668..>474525)
                     /locus_tag="KLMA_70226"
                     /db_xref="GeneID:34717983"
     mRNA            complement(<473668..>474525)
                     /locus_tag="KLMA_70226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821482.1"
                     /db_xref="GeneID:34717983"
     CDS             complement(473668..474525)
                     /locus_tag="KLMA_70226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677839.1"
                     /db_xref="GeneID:34717983"
                     /translation="MQAVQRNIIRKMSGINAACVIIGDEVLNGKITDTNSRFFAQYCY
                     NLGINLREIATVGDSEEQIVSTIRRLTPENDFIITSGGIGPTHDDITYESVAKSFNLP
                     VAIDGECQRRMHKISSPESRLSEQALKDFYRMATLPKGASVKNYYLVEDYWVPVVSIE
                     NKVFVLPGIPQMFERLLNGLKPVIKQLYKLNPNHSEDFRRYFVKTKLSESEISQYLRD
                     LQSRANEVSPDIKIGSYPHFGQGFNTVSILGIKKHEDFLREITKQTVEQLKGEEISEE
                     QEKAYSDNR"
     gene            <474776..>475213
                     /locus_tag="KLMA_70227"
                     /db_xref="GeneID:34717984"
     mRNA            <474776..>475213
                     /locus_tag="KLMA_70227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821483.1"
                     /db_xref="GeneID:34717984"
     CDS             474776..475213
                     /locus_tag="KLMA_70227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677840.1"
                     /db_xref="GeneID:34717984"
                     /translation="MSTFKAEEAENLEDIEKQFAVVAVEQAETYWNLITKVPGSKLRL
                     TKYDDEIYEAFQEHFPEFKDIEKLKKFNEDELKTKEAKDRWRRFITLFEKKIDDFNFG
                     TLLRTDCTQEYGQFNTCFAVRIQFYAFEIARNKHGLNDWAVGH"
     gene            complement(<475361..>476860)
                     /gene="MMT1"
                     /locus_tag="KLMA_70228"
                     /db_xref="GeneID:34717985"
     mRNA            complement(<475361..>476860)
                     /gene="MMT1"
                     /locus_tag="KLMA_70228"
                     /product="mitochondrial metal transporter 1"
                     /transcript_id="XM_022821484.1"
                     /db_xref="GeneID:34717985"
     CDS             complement(475361..476860)
                     /gene="MMT1"
                     /locus_tag="KLMA_70228"
                     /codon_start=1
                     /product="mitochondrial metal transporter 1"
                     /protein_id="XP_022677841.1"
                     /db_xref="GeneID:34717985"
                     /translation="MSILYGRQIHTVPRVLSGVVKSNVPLTLSSSFHSFSILRAKEAP
                     PPSEAEKSAAEIREELEKNPQYAKLAEDFSSHDHIHLQESETEQNDSFTLGTMLTRTP
                     QHANHTHSHGLGNPMLVLSKEQFKTNPGVRITWIGLLTNVGLAVGKFTGGVVFHSQAL
                     IADSVHALSDLVSDFLTLFSVGLATRTPTHDYPYGYGKIETVGSLAVSSILTMAGLSI
                     GWSSLCAIVGPIIPHTLLEVFASHSHSHSHVHAVTDINAAWIAAGSIVLKEWIYRATK
                     KVAVETKSNVLMANAWHHRVDSLTSLVALVTISSGYLFNIHALDAVGGLIVSGLVVKA
                     GADGMVTAIKELIDKSVPKTDPRYIQVQSVTDEVLSKLISNNNAKKPYRIVDLTVMTS
                     GPNMHANLVLEAPLQRWDNVLTIKEFEIVTDHLRSVLYKNIPALRRLNVEYVEERPEL
                     SEEEKLELEKQKKLGSADIPKTETQVTDSHSHGHSHSHFGLGGGHSHKH"
     gene            complement(<477937..>482355)
                     /gene="ECM5"
                     /locus_tag="KLMA_70229"
                     /db_xref="GeneID:34717986"
     mRNA            complement(<477937..>482355)
                     /gene="ECM5"
                     /locus_tag="KLMA_70229"
                     /product="protein ECM5"
                     /transcript_id="XM_022821486.1"
                     /db_xref="GeneID:34717986"
     CDS             complement(477937..482355)
                     /gene="ECM5"
                     /locus_tag="KLMA_70229"
                     /codon_start=1
                     /product="protein ECM5"
                     /protein_id="XP_022677842.1"
                     /db_xref="GeneID:34717986"
                     /translation="MQFNQVSSLPNNSVAMLLNPDQPAMTHSDQPSKTENEVQSNPAK
                     PLMDDKKISTESALASVMTEPQPSKIGQGKEKMAPSSHKSHNNTSPHSNGQNQSIYIY
                     TQHKTRLNAPFDLSHVHCQKIIHDTRIASEGTIKGIKYTVQEGSIPTVVIDRSDNYPT
                     PYELYAIMEPLGKQFGAVKIDFRNCDDPLFASFGIDTENFWFKPRKQHSNSYNIELQK
                     RVKLHHDLYRFHKLKKDPKRNSTLGKIPSIDKRTLDLHRLRSCVQSRGGFENVCQKKL
                     WAQIGRELGYSGRIMSSLSTSLRSAYIKMFSDFDKQEESSQLSLDTTTSPADSIKIPQ
                     EKFYTTGKRDTDYAQIKDRDASTSDQHLIKRQCTEKILNFELGGSGKEYFRMRDILDA
                     KGFSTRYGSVVEPKIGITEPNDSTYPDYNFNLWNRESEIYDNSLYEWRSSPIYNLKQY
                     FEKSQRHREMIQESLQDLYPSLSSYGDAMSIEDFERLYQTIIQEESLSFDIETGLDLP
                     TIVHGSGFVNFAAPTSNTKPRTPHPWDLNTINLCKESILQYLDIDYGNLCSSKIDIGM
                     LFSTSGWAVEDGLLPVLDYSHVGSSKVWYFVPPQYKNRMESLFEDIKQKIPKNDVEKY
                     EADFIESDFFQSFQATNLLDQNKTSRKRTINNSLLDIVGIKPDIQNPHNDIQVPTSNL
                     SSAGIRYFKVVQEPKTFIMKYPQVYSTTIHSGFQISEKSLFAPKEWLNSLEAVESWRS
                     HNHLLPSVLPFQLLVNISENSSDNELIRTIQPLLIKSIKEELQLRNKIEKNIPHVINK
                     FDFISDIDLSPTGASKMVISNESNSISISITQYLELESKFTELQGLNIELHEYYTESF
                     LTDLLIKLQNDPTNRENSIPYETTSLLDMINNLKCSQGSGPKISINDLSNLLISIPDE
                     NLDEKCIIKEFINEAQMVTRGCKSIIERTRVPKITKISHDAGFMTKRILPPEFDVGLE
                     DLDNLLQKIRELPVSIDYSNDIDRIVNSFAQFQKDAALYRRSNQIEILEKIYTKGLSL
                     GINSKYLQIYAERISQLQWLKVYDMIFGNDKRGIAINDISTFQAHDVFSFLSLGVDLF
                     GDDEIDKLENIAKEIAKLQWITNTVQKLLIDKSHRIKSSTLQELVNTSNSVRIPLSSK
                     LLDQLSEINKTIGAARNILLPMHQKLSINDQWVSEFQSAVRNRTTEQSQVVNRFNGSA
                     NDLRLTQADALQNLEPPLYSKHIKATKAWQHDFNSVFNGVSQSLQAVMDRVKRCWSPL
                     DKFDNPEETRRYCFCRQVDNGDVMVECEICNEWYDFSCINQGKWVLPEDDSTVFCCEI
                     CLHRPLEKNSQGPTFDQIQRLIIESAKIKIVPDKTIISNLFDLYKLCCNYRNAVEQIL
                     LEQHNCKLIKFYLRKIIGAGISMPELCNKLLDSCKSQDETKIQEILRNKTKIVSGYPS
                     EDTSLVNQGQEQIQHTKAEHMSLAPSSNNIHPLLGE"
     gene            complement(<483751..>484374)
                     /locus_tag="KLMA_70230"
                     /db_xref="GeneID:34717987"
     mRNA            complement(<483751..>484374)
                     /locus_tag="KLMA_70230"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821487.1"
                     /db_xref="GeneID:34717987"
     CDS             complement(483751..484374)
                     /locus_tag="KLMA_70230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677843.1"
                     /db_xref="GeneID:34717987"
                     /translation="MSHLLHKFSEKLTGDDGRDQEDTRVDEYGNPLSPQQQSHGRYTD
                     TGSIEHPSGRGNDSSMSGGSKQYGGYDDDNYNGRTTRSKGKSSQNNRDHFDEYDYDSS
                     DLRDSSTSGGRQKTTSTSGQMGFGSNDYQQRSATEQGYGNQEQYGSGGGQSFGDNNPA
                     NTHIPGTPPSARAGSGGYGGNAYSKQGMGRQSGNSRSDQTYNNDSSW"
     gene            <485443..>486855
                     /gene="TUB4"
                     /locus_tag="KLMA_70231"
                     /db_xref="GeneID:34717988"
     mRNA            <485443..>486855
                     /gene="TUB4"
                     /locus_tag="KLMA_70231"
                     /product="tubulin gamma chain"
                     /transcript_id="XM_022821488.1"
                     /db_xref="GeneID:34717988"
     CDS             485443..486855
                     /gene="TUB4"
                     /locus_tag="KLMA_70231"
                     /codon_start=1
                     /product="tubulin gamma chain"
                     /protein_id="XP_022677844.1"
                     /db_xref="GeneID:34717988"
                     /translation="MTGEIITLQVGQCGNQVGREFWSQLAKEHGIGKDGLSLVEESPT
                     IIREDNPLTFFKQNDSNRYTPRALLFDLEPSIINDIRSNFPGFFNDRNVWVSQDNLGA
                     GNTWSTGYDYGTENQDQFINMIDREIDATENFEGFQLIHSVAGGTGSGLGSNLLELLA
                     DSYHKKLVTTYSVFPSNESEVVVQPYNTMLTLRRLIEDSDASVVFDNNALSNITARVL
                     RDSNISYAQSNQVISTVMSCITNSVRLPSYMFSSLPSIFSTIVPTPSMHFLVPSFSSF
                     TTDFVPESKNIKRSTAYDVILDLFDHNNSMVTHSSDEPVYIAIYDLLQGYIQQSDITR
                     AILKTQKRVQFAPWSKSSLHVNIGKKSSFNQSPNSDYVSGLMLSNSTAINSLLKKTCH
                     SFDTIYNRGAFLHKFQNGRVFENGWDEFKESREVVQSVIEEYAYAAQDSYVDDILLDD
                     NVLMGNDDASMNIQDDDNII"
     gene            complement(<487055..>488602)
                     /gene="LDB17"
                     /locus_tag="KLMA_70232"
                     /db_xref="GeneID:34717989"
     mRNA            complement(<487055..>488602)
                     /gene="LDB17"
                     /locus_tag="KLMA_70232"
                     /product="protein LDB17"
                     /transcript_id="XM_022821489.1"
                     /db_xref="GeneID:34717989"
     CDS             complement(487055..488602)
                     /gene="LDB17"
                     /locus_tag="KLMA_70232"
                     /codon_start=1
                     /product="protein LDB17"
                     /protein_id="XP_022677845.1"
                     /db_xref="GeneID:34717989"
                     /translation="MTRLHEELSMGRYFDEELWFEQRRVIAKKSAIYSWPMSMATSAI
                     IEDDTLVEFWEKLEGLLDVDINNESDVNSALVSFIKITADHYSSLIKCDQDLYRVGLI
                     LVESEMFERTTDFCLRKLLSLLSIDLLELSLKLIIAYIILYKCKIDISSMDILVENQG
                     FVVIYNNIYSNFAYLSKYSNDSPREAEEQQTETDTDIIEGIKHLTTILIDIMYQFFRY
                     SKCQIANLQMIDDFFIYYLVSSVRSDVIDDIFNNIKFKLLLALNEQYMIFGYEYDIEN
                     KAYEFILNQTMSKDFIGLLLLKFNRETDASLLIMICKVIYIILTKDLKVARDFFYLND
                     LNVFVDVLLRNLNNISENEEVLRNTYLRVLLPLLNNTELSSTHYHREEIAKTLEFFTD
                     AGNFSANKVPTIEERTTVRMAKRCLTEVKWLEHDGQPYGDQNDSEESRRSSISTKSSS
                     TTPQDSKPPNNFNHIYRNVQNAYSADSINHRTAQQIPPPPPPSRKSKHRIGSDKKLAT
                     ASLEISK"
     gene            <488745..>489466
                     /locus_tag="KLMA_70233"
                     /db_xref="GeneID:34717990"
     mRNA            join(<488745..488765,488870..>489466)
                     /locus_tag="KLMA_70233"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821490.1"
                     /db_xref="GeneID:34717990"
     CDS             join(488745..488765,488870..489466)
                     /locus_tag="KLMA_70233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677846.1"
                     /db_xref="GeneID:34717990"
                     /translation="MTSELNNVFECIEDAESFIKSNKVVVAIQEYRKAIKQLDYINET
                     EDLPENVQYAVTLLHDDILLRVKELGVLQEVQSNSESSESGSNSSISRFVSDGSLYPN
                     GNSVLISDPLLLSITSKLENNVMRLINASEDPGSVSKTEIMQQFSQFKRELTVYEQKK
                     SKDYEGKMEQVIKENKKLSNQVNRLKERWDSLVESAKQKRNQQHV"
     gene            complement(<489561..>490886)
                     /gene="RPN5"
                     /locus_tag="KLMA_70234"
                     /db_xref="GeneID:34717991"
     mRNA            complement(<489561..>490886)
                     /gene="RPN5"
                     /locus_tag="KLMA_70234"
                     /product="26S proteasome regulatory subunit RPN5"
                     /transcript_id="XM_022821491.1"
                     /db_xref="GeneID:34717991"
     CDS             complement(489561..490886)
                     /gene="RPN5"
                     /locus_tag="KLMA_70234"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN5"
                     /protein_id="XP_022677847.1"
                     /db_xref="GeneID:34717991"
                     /translation="MSRDAPLKAEKDYTEILDAEFPKIEILAKNDYSAALDQLLSLEK
                     KTRQSSDLVSSKRVLAKIVDVLVKENQWDLLNEQLVLLSKKHGQLKLSIQYMIQTVME
                     HLKDVTDKEIKIKVIETIRVVTENKIFVEVERARATRDLVNIRRAEDKIDEAADLLCE
                     LQVETYGSMEMYEKIEFILEQIELSILKGDYSQATVLSRKILKKTFKNEKYESLKLEY
                     YNLLVKIGLHKKSYLEVAQYYQEIYNSASVKEDEIQWKAVLSRIVYFLILSPYDNLQS
                     DLIHKIQLDNNLKKLPSQESLVKLFTTAELMRWPIVQDTYKDVLNKDGIAFGSNEDHW
                     EDLHKRIIEHNLRVISKYYTQITLPRLKELLDLDEAKTESFISNLVNQGVIYAKINRP
                     AKIVSFGKPNNSSDLLNEWSANVDQLLEHIETIGHLITKEEIMHGLKAK"
     gene            <491568..>494054
                     /gene="NOP14"
                     /locus_tag="KLMA_70235"
                     /db_xref="GeneID:34717992"
     mRNA            <491568..>494054
                     /gene="NOP14"
                     /locus_tag="KLMA_70235"
                     /product="probable nucleolar complex protein 14"
                     /transcript_id="XM_022821492.1"
                     /db_xref="GeneID:34717992"
     CDS             491568..494054
                     /gene="NOP14"
                     /locus_tag="KLMA_70235"
                     /codon_start=1
                     /product="probable nucleolar complex protein 14"
                     /protein_id="XP_022677848.1"
                     /db_xref="GeneID:34717992"
                     /translation="MGGSQLKNLKAALKANGLTGQTNDKKKSKKKGSRPKDFDKEERQ
                     RTIQKIREQFNPFDVKANRNKKIGVTKESATKLAVGKPGVAKQADEEQRRIFYEAKKV
                     KKSGGIQDKRFGERNKNLTAEEIMLERFTKERQRQSSSKRSLFNLEDSDAEDDGATFG
                     ESLTHSGKSLALEDDFDAGDLGLQDSDNDIARATKSGKRLLMEEQELGDASVQEPVRK
                     KTKAEVMQEVIAKSKFYKHERQKAQEKLVHDIEDLDDDFEDIMSELRVLPTPKRNAQQ
                     TSDVPELAPDYDRKVKELVMEKRAAPADRTKTDEEIKKEYEEKQKELEQKRLDRMNGL
                     FNIDDPDAAGVEDLGEEFWEGSDSEEGEYGEYMKQIHDSDDDVDLRENDKNGKSQKSQ
                     LNTKTIPSVPCPQNHEEILEFLEKYPIEEHPVLVKSIIKTYQPKLAEGNKERLGKFAG
                     VLLRHILFLSNEDYSENVDKIAELHNELIAILKALSEKFAIPLSEECRIIINEIQKRF
                     KESQFYGLSPADLVFFSLVGMLFSSSDHYHLIITPCLLLIGEFLEQIRFNTVQKLLFG
                     SLLVRIAIQYQRISKRYIPEITYFLHTSFKMLIPGAKVEGKPESSDKKEVSLSLPKNI
                     NWENVDSSLQLHVLFSTDLDTNDSVKSTIFANNLDSLDWCLTNIWKDLSAFPEIISLF
                     VDLLQVAQKSYATYPKINQLLERVEKIMKFQERVPLALQQHKPLAIPSNTPKFEENFN
                     PEKKSYDPDKTRSELNKMKAQLKKERKFTMKEIRKDTRFEARQSIEEKKKEYAEYHSK
                     MARIVNQISTEEGAEKNKYEREKKLRNTKR"
     gene            complement(<494099..>496819)
                     /gene="ATG9"
                     /locus_tag="KLMA_70236"
                     /db_xref="GeneID:34717993"
     mRNA            complement(<494099..>496819)
                     /gene="ATG9"
                     /locus_tag="KLMA_70236"
                     /product="autophagy-related protein 9"
                     /transcript_id="XM_022821493.1"
                     /db_xref="GeneID:34717993"
     CDS             complement(494099..496819)
                     /gene="ATG9"
                     /locus_tag="KLMA_70236"
                     /codon_start=1
                     /product="autophagy-related protein 9"
                     /protein_id="XP_022677849.1"
                     /db_xref="GeneID:34717993"
                     /translation="MVDNQDNVNEPPKNTFLSRVFGVHSSAVENSIDGAEMSHISIHN
                     SQEFNHFVENEHHERLIESDQESSTNEEESNDEEPLIKQPQSIRFQEVPNGIAITHPF
                     SESEDDEGEIEGRDPEFFSDQDLGSSISKHGQGSSSEDESEQAPTGDDAGPIGFERNS
                     PIVENTRLGFHSPYDANSKANLKGPYLGHSKVFDRIFANKPAGMSRNRRHDDLEESFL
                     FRKPSVADPRSTKTPAPFNLKPPPIFQNVPNLTSVNKNSLSTLSPKERALWKWANVEN
                     LDTFLQQVYDYFLGNGFYCIIVDKVVQLATILFVVFISTYMGHCIDYSRLSSSHSFKE
                     VHIEQCYKTQISPTAKVLLWIFYAFIGLKILQLYFDVKALKDVQNFYNYLLGISDKDL
                     PTIPWQSVVQQLVLLKDQNAITANATEVKAKNRLSAHDVANRIMRKENFVIALYDNNI
                     LDLSLPIPLFRTCALTKSLEWNINLCILGFAFNERGYLKQAFLRESQREYLSEELKKR
                     FVLAGFLNIILSPFLVTYFILLNFFRYFNEYKTTPGSIGSRQYTPIAEWRFREYNELY
                     HIFEKRKKLSMVIADDYISQFPNTLMSSLLSFVQFVSGSFVAILGILTVFDPDNFLNF
                     EITSDRTVLFYMTLFGSIWAICHGAINEEYTAFSPEETLRELISFTHYSPKSWEGKYH
                     TEDIKEEFCKLYNLRIILLLKELVSIILTPFILWFSLPKNSDRIIDFFRECTVYEEGL
                     GYVCKYAMFDGAKVNKGLNAKTQASKMFSQTDNDDESDSDNDIGVNKMLQSYMYFVDD
                     YKKAENALGKNQLISPKEGSFGYPRDYSWKTQFALGKKINKRSGEGPSQRRNLEHGSA
                     NPDVGSLNASFINKSSLYKDDFTENTDEMKKGNGVMGLLNQYYKKYDNKR"
     gene            complement(<497224..>498465)
                     /gene="RPC53"
                     /locus_tag="KLMA_70237"
                     /db_xref="GeneID:34717994"
     mRNA            complement(<497224..>498465)
                     /gene="RPC53"
                     /locus_tag="KLMA_70237"
                     /product="DNA-directed RNA polymerase III subunit RPC4"
                     /transcript_id="XM_022821494.1"
                     /db_xref="GeneID:34717994"
     CDS             complement(497224..498465)
                     /gene="RPC53"
                     /locus_tag="KLMA_70237"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC4"
                     /protein_id="XP_022677850.1"
                     /db_xref="GeneID:34717994"
                     /translation="MSGRLPGLTQGKPGGKPASGSALKFKPKVVARKSKEERDANVLK
                     VEEPKKQPERKKYTQKPPGGQRRQPKYLNNTRVITSGPLAAGNFSGGSSRGNGFIKTE
                     GSQSSLLQQGLKSVSDDEANASDGEDSSAGKRINMGKEYSEADFKKETDNLFEGDEDD
                     VAANMPIDEETRTSKQLANLFPVRAVRINHEKVDSMQKAVQESMSTLNTRDPTPGPVK
                     LEHDQNQDLDGTLSDVVKEREDQLKEKLRVLNLQQEINSVDAEEVLKEVNLLFEDHKH
                     IYKKLNRINDVPNKFLFIQFPSNFPEFKRPLAKTQDTVVENKEEETSKASDEDSKDGK
                     QPKTKKNAPESPQPLVGNVGSIRVHKSGKLSVKIGNVVMDISRGAESTFLQDVVSLDL
                     EGQEAELLGQIDGRAVVTPHI"
     gene            <498877..>500706
                     /gene="SAS10"
                     /locus_tag="KLMA_70238"
                     /db_xref="GeneID:34717995"
     mRNA            <498877..>500706
                     /gene="SAS10"
                     /locus_tag="KLMA_70238"
                     /product="something about silencing protein 10"
                     /transcript_id="XM_022821495.1"
                     /db_xref="GeneID:34717995"
     CDS             498877..500706
                     /gene="SAS10"
                     /locus_tag="KLMA_70238"
                     /codon_start=1
                     /product="something about silencing protein 10"
                     /protein_id="XP_022677851.1"
                     /db_xref="GeneID:34717995"
                     /translation="MAKRTGKSVSKRSSGRENEEEDPYGLNEVDDFAKKREKVMLEDA
                     GINEREASDSDDFSVDEEEEVLGMSDEESSDEDVEDEDEDEDEELDGEAAYKKVFGRK
                     LEMDEIPEEREEGGMLDNDNAWGTSKSEYYGADDLDDEETAKEIEKEALRQQKKHLED
                     LQIDDYLEDEVEEEWVKEAKAFDMGQFQGQKDDKSSNQVSAKDILNMDDESKENFLTT
                     SFPEYLPLSKEFSKLSPVLEELIAKQKTENNDSLQAKIVALSCYLGTISTYFAVFLHE
                     LQNNEDFTTMKNHPVMERILECKEIWRQANELPEVDSAVYEQTSGVESNVSDIEELSE
                     ELLQEQDELDEEGSSDGSEDEAMEDSEEEEEEEEEDFDIELSDRTVIKNRKEDLPQDV
                     DDFVEDEIADVDKQEKKTRKKTLRFYTSKIDQKANKKTERFKGDDDIPYKERLYERQQ
                     RLLEEARKRGLHDNKAADLNNEDYNSDDEKTAKNINDEAESEYYKSIKADRQRKKEAR
                     MQAHKEVTKAAKEGKLAELAENITEDGKRAINYQILKNKGLTPKRKKENRNSRVKKRK
                     KYEKAQKKLKSVRAVYSGGQSGSYEGEKTGIKKNLTKSVKFKN"
     gene            complement(<500794..>503508)
                     /gene="MSH5"
                     /locus_tag="KLMA_70239"
                     /db_xref="GeneID:34717996"
     mRNA            complement(<500794..>503508)
                     /gene="MSH5"
                     /locus_tag="KLMA_70239"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821497.1"
                     /db_xref="GeneID:34717996"
     CDS             complement(500794..503508)
                     /gene="MSH5"
                     /locus_tag="KLMA_70239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677852.1"
                     /db_xref="GeneID:34717996"
                     /translation="MYRAAKRPLFVHQSYSEPSTDSKKKNIQTSNETLLTAEGNSQQF
                     AVKNMGNSLREESFDWENDVILCLELSQTNLGIVIYDFERESLLVLSQDITVKNNDSQ
                     TSCSEINMILEGLINENRPTVLVCSSNMGGSLFEHLTYLSHSYDFRIQMQPRDKFKIQ
                     YFFQAWIAFQEENAIIEIQGFQILDHICSSDKLIELTSTALGCIIKSMEHHSFMSLAD
                     EGNENNNNCLPNFFSRVTKVEQLLLKDRVFLDQEALEALQIFRPIENMSSSGKNTKNN
                     ASCIFDLLNYTTSEVGKSLLKKWLVSPLCNKELIEQRQSTIQILLDDKNAIQFDDLKE
                     ALKEIPNIFRIINTLNKTVSKFNAWVQWHRFCEKALDIIKLCHIIYDDSIDCELLKKI
                     KYHVDKAVLGQLLQKTEQMIDVEASILQKQIVIKDNINVQLDQARNTYSKLENILSVV
                     ANESNELVSSLLSESEKAIFDKLNSEEMAINAIYVPQLGYLLSVDIRIQEMIKAKELS
                     WDEVFREENFIYYKTDDNRAMDEHFGDIHAIISDLEIEILQEFQSVVLNSKCFLFQVG
                     ECFAELEVLVGFARASEIHNYVKPEIEEQEGIIDIKKGRHPLYESAVLTYIPNDMEMD
                     GGPFNSDTWDESFHRVAVITGPNSSGKSVFLTQNGLIVYLTHIGCYVPADGARIGLVD
                     KILTRIVTKETVSKTQSTFQIDANQMSKCLSLATVRSLVLIDEFGKGTDVIDGPSLFG
                     AIIKRYSENTNCPRVIACTHYHEVFSPNILTTNIPGVLFYKTEILLKDSNPQITTNGF
                     EQNITFLYKMVNGITEDSYGIYCARNCGLRSDIIDRAQKIFVNITNGFDMASYYQKYS
                     PQELEQFHANQVIVKNFLTWDLEPTSQENTVEDKTLRRKLLRILNLEK"
     gene            complement(<503933..>505291)
                     /gene="CLB4"
                     /locus_tag="KLMA_70240"
                     /db_xref="GeneID:34717997"
     mRNA            complement(<503933..>505291)
                     /gene="CLB4"
                     /locus_tag="KLMA_70240"
                     /product="G2/mitotic-specific cyclin-4"
                     /transcript_id="XM_022821498.1"
                     /db_xref="GeneID:34717997"
     CDS             complement(503933..505291)
                     /gene="CLB4"
                     /locus_tag="KLMA_70240"
                     /codon_start=1
                     /product="G2/mitotic-specific cyclin-4"
                     /protein_id="XP_022677853.1"
                     /db_xref="GeneID:34717997"
                     /translation="MMQVQQQARVALGDVTTQINNRANRFEDHEGKKAYANSETLKSH
                     DGVSMKENNATCYASKAVTGEADQRIQRFQQPEHAAFLSSGNTVNTHSRIMSYDKEAE
                     IIIPNDMDDEDLVSGTEVVELDDDDDDRDTDDESIDSKDRGGVADDKDFTPLLPVVTE
                     NSERLYAYVYNRLHRDEPDPQDEDTWDPVMVSEYTTDIFKHLRFLEVKFSPNPRYMKH
                     QPELTWNYRSTLIDWIVQVHDRFQLLPETLFLCINIVDRFLSKRQVTLNRLQLVGAAA
                     LFIAAKYEEINCPTLKDMLYMLDNAYSREEVLRAERFMINTLNFEFGWPGPMSFLRRV
                     SKADDYEYDTRTVAKYLLETSIMEPELVAAPPSWLAAGAYYLSKIIIGITGWSDDHIY
                     YSGYTEEQLIPLATMILDSCRHASTRHKSILEKYSRSRHRKSALVVSKWISIAESRLQ
                     QK"
     gene            <506618..>508432
                     /gene="MNN5"
                     /locus_tag="KLMA_70241"
                     /db_xref="GeneID:34717998"
     mRNA            <506618..>508432
                     /gene="MNN5"
                     /locus_tag="KLMA_70241"
                     /product="alpha-1 2-mannosyltransferase"
                     /transcript_id="XM_022821499.1"
                     /db_xref="GeneID:34717998"
     CDS             506618..508432
                     /gene="MNN5"
                     /locus_tag="KLMA_70241"
                     /codon_start=1
                     /product="alpha-1 2-mannosyltransferase"
                     /protein_id="XP_022677854.1"
                     /db_xref="GeneID:34717998"
                     /translation="MAPYRLKLITKRVLLIVLIVGALNIFFFLGDLKSALFHGHLGRN
                     IAARERAAIRNTISRVDRTVASDAFFNALFSQLEAAAPVKREFDWKYTRVGGCDIGDV
                     GVDTANRDTRLSYENLARCLELPEKNYMSLKNSHAKFVDYVNKIDTSSKTLDIIYPTK
                     RGIVTVGGGRYTLLSYLMIQMVRRSGSKLPIEVVIPPNDGPEEDFCRNIQQYNARCVL
                     FEDRLPQKLIDSLKLKTYQVKGLALLLSSFQEFVFIDSDNMPLKNVDKVFEYDVYKDN
                     KMVVWPDIWRRVTSPSLYEIVGLPVDLSARVRNGGDDISPVTRYDKSYSSLAENKANK
                     PMHDFFATLPDPTTESGQMIVNKRTHLKSLLLAFYYNVYGPEYYYQLLSQGTSGQGDK
                     ETFILAAHVLHQSYYQVKKVLGFTGYHDPTQETGGMYNGAGLLQFDPQQDYAYYLQLK
                     EEVNAHFEKYSKYDENYSIKKTFYQNMIDRIGDEPREILFLHASFHKYDPWDLYVTGK
                     LVHPGGQQFRAYPCASPTFGGFDVELFLWGHVEKLVCSNKPLEMHYVQKLQQDPSLYS
                     AVCQWTKDRLHHLLETHDEYVSYKDTKKCVNIKKVVEM"
     gene            <509529..>511778
                     /locus_tag="KLMA_70242"
                     /db_xref="GeneID:34717999"
     mRNA            <509529..>511778
                     /locus_tag="KLMA_70242"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821500.1"
                     /db_xref="GeneID:34717999"
     CDS             509529..511778
                     /locus_tag="KLMA_70242"
                     /note="GAL4[cd00067], GAL4-like Zn2Cys6 binuclear cluster
                     DNA-binding domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677855.1"
                     /db_xref="GeneID:34717999"
                     /translation="MIDVKKEALENSSIGKVIGDVDANVKDGSDASTPVEKKKKQRKT
                     RSTAGCFTCRLKRMKCDEKRPICSRCNRNMLTCIWPKEGNGRLTKEMRRSMKETIEPY
                     AGMDPNKAHFVVAVEEDGKLQITTEDTERHSTGKSKTKVNFTGAGTSKDVKSLDKIVI
                     KSPIVVHADSTDFKQVSPDKPGTASIDFVNYSYESKDKDFVKLERDKTTSTLSSSEED
                     SINDAFFSTLLENMPGAASDTRVVSRATANNLQQFNVIGSDPDFFWGKVFDMNFTKPL
                     MTPNFNIISPLPSMATLPAADDTSMQPDSLLLSQFGEKDCYVLDNEQTGEIYLNLLQN
                     FKDWSKLNDDDDDLLSIANILSKYAFTEKELLLYFTCVHYFFPAIGPQPTLPQLTTTE
                     TFLPLIKQHAVVKDVFLCCGATFLEWCQPSKYSDVAEELYQKSRTKLKQMTKEGTIKG
                     DETWAFACFQLLCLTDKFRKGSGTSMTDRCVDNLAHSFNIIKKKIKLIQTQGSTATDR
                     MLIESFMYNYTVSLLVARDLSKLPSPFSKNFYELTKILKSPLFDGCDVNWINNPILGS
                     SVEAFEMLAKVSYLSRFPLPLRETEWIERGKRLLEECLYYTPPSLPDEVKNDPQKYAT
                     YRPSLLCGSIISKACYLLLSKILRFTEFKIDDFEIQGVVKYTIKSLCAVEKGNPLLCI
                     LLWSLLIIGAFTIDMEDRLVIKEYLRSASETIHTYGALKIADFLDLIWQQKNIDLLFV
                     RENLSQVVI"
     gene            <513102..>513830
                     /locus_tag="KLMA_70243"
                     /db_xref="GeneID:34718000"
     mRNA            <513102..>513830
                     /locus_tag="KLMA_70243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821501.1"
                     /db_xref="GeneID:34718000"
     CDS             513102..513830
                     /locus_tag="KLMA_70243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677856.1"
                     /db_xref="GeneID:34718000"
                     /translation="MNVVSPPNSPGHEHAELEVSKQRHSRTVVPLNQTHDIVKACECL
                     NKAFAYSPANDYLLKKFFNVPIQEKCSKERINSMLAYHLHLYDDFGAEIVEANNYDAV
                     AVWTTPKSHFAQDKTNDPVFNQIFFDLLSDKTKEVLPPGVGYYYLFIIGKDLTHPEIR
                     GSIRKIFETYKARADAENCAMVLEAITPKAKSVYEYFGFKNYLDFQYGQNEVDSEGNY
                     DPHGEGFTGHLMIYYKDELPGALP"
     gene            complement(<514570..>516126)
                     /locus_tag="KLMA_70244"
                     /db_xref="GeneID:34718001"
     mRNA            complement(<514570..>516126)
                     /locus_tag="KLMA_70244"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821502.1"
                     /db_xref="GeneID:34718001"
     CDS             complement(514570..516126)
                     /locus_tag="KLMA_70244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677857.1"
                     /db_xref="GeneID:34718001"
                     /translation="MGELTEFQLKRLENIKRNNELLKKLNLSNISSEIKREAGVDENG
                     GPHKEKKKRNTGAKRVTKREPKPAPIPTRRSRRLRGETVDGDGIPNVNDNQLLKMGQT
                     ENSSRDMEALEQLKNTAVSGDVKIADLIKSENEDDLLDKFSSFAKMNFSSGDFFKELQ
                     KHQKPTPEVQQLQEDFDLKLYDIFQPNEIKLTFERISAAYFHPSVDKKLVICGDTAGN
                     VGLWNVRETEPEDEMEEPDITRVKLFTKNVGRIDTFATDSSRLLTASYDGSLRSINLE
                     NMQSEEILVLKNEYDDALGISDFQFSYDDPNTVFLTTLSGEFTSFDTRTKPSDLSLKR
                     LADKKIGSFSINPKRPYEIATGSLDRTLKIWDTRKLVDKPEWSQYEDFPSLEVVSVYD
                     SRLSVSAVSYSPMDGTLVCNGYDDTIRLFDVSNVPDRELQPKLTLKHNCQTGRWTSIL
                     KARFKPNMDVFAIANMKRAIDIYNSAGVQLAHLPTATVPAVLSWHPTQNWIVGGNSSG
                     KAFLFTDKAA"
     gene            <516433..>516759
                     /locus_tag="KLMA_70245"
                     /db_xref="GeneID:34718002"
     mRNA            <516433..>516759
                     /locus_tag="KLMA_70245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821503.1"
                     /db_xref="GeneID:34718002"
     CDS             516433..516759
                     /locus_tag="KLMA_70245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677858.1"
                     /db_xref="GeneID:34718002"
                     /translation="MSSNITSLFNPPPQRELSENETKDCVPCQIMATLFSLGFGGYLA
                     SGKPFQYSEVEKKKGVTMEEFIKRNPKWWVSSARAFGGALIAFGFVRGTEGWLWNKDK
                     TYKTYK"
     gene            complement(<517014..>518498)
                     /gene="STE7"
                     /locus_tag="KLMA_70246"
                     /db_xref="GeneID:34718003"
     mRNA            complement(<517014..>518498)
                     /gene="STE7"
                     /locus_tag="KLMA_70246"
                     /product="serine/threonine-protein kinase STE7"
                     /transcript_id="XM_022821504.1"
                     /db_xref="GeneID:34718003"
     CDS             complement(517014..518498)
                     /gene="STE7"
                     /locus_tag="KLMA_70246"
                     /codon_start=1
                     /product="serine/threonine-protein kinase STE7"
                     /protein_id="XP_022677859.1"
                     /db_xref="GeneID:34718003"
                     /translation="MAVEVLSQEASGGPDTSNLFRPKTLKRKNLKHLTLQPAASGDDS
                     PKAGSTSPLEGSVGSNVTRKQPTLEAIASLNRDTSLQSISVLPGSSSASDMSSITSGT
                     TPTMPMAMGAAVSVSAANAGSGMAQNQDETATLTTQIARLSLTPENGIQLENLVRLSK
                     IGAGNSGTVVKTLHVPDSSIIAKKTIPVENKEVLKNQLVRELTIMKNVKAHDNIVGFY
                     GAFYDPSTTNEIVILMEYMDCGSLDKILTVYRSDCQRKNLPISCKTSWFNEMTLSRIS
                     YCVLNGLIYLYDNYKIIHRDIKPSNILISSKGSVKICDFGVSTTLINSLADTFVGTST
                     YMSPERIQGGRYTTKGDVWSLGLMIIELSTGEFPLGGHHDTPEGILDLLQRIVNEPAP
                     RLPKHEHFSIQMTDFVNRCCIKEERGRSSLKELICHDFICKYNTRDTIAKEFRHWCKK
                     VKKRIKEDKMIKREESERNKAEKRQLEKAALAVTAARSSGSVRR"
     gene            <519742..>521325
                     /gene="DHH1"
                     /locus_tag="KLMA_70248"
                     /db_xref="GeneID:34718004"
     mRNA            <519742..>521325
                     /gene="DHH1"
                     /locus_tag="KLMA_70248"
                     /product="ATP-dependent RNA helicase DHH1"
                     /transcript_id="XM_022821505.1"
                     /db_xref="GeneID:34718004"
     CDS             519742..521325
                     /gene="DHH1"
                     /locus_tag="KLMA_70248"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DHH1"
                     /protein_id="XP_022677860.1"
                     /db_xref="GeneID:34718004"
                     /translation="MSDNSVSDWKTQLNIPKKDTRPQTDDVLKTKGRSFEDFYLKREL
                     LMGIFEAGFEKPSPIQEEAIPVAIAGKDILARAKNGTGKTAAFVIPTLEKVKPKLNKI
                     QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRLNEPVHILVGTPG
                     RVLDLASRGVTDLSECHLFIMDEADKMLSRDFKVLAEQILSFLPERRQLLLFSATFPI
                     TVKEFMVQHLKNPHEINLMDELTLKGITQFYAFVEEKQKLHCLNTLFSKLQINQAIIF
                     CNSTNRVELLAKKITELGYSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRGI
                     DIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELNTE
                     IGPIPSQIDKSLYVAEDSSAVPIPFPLESLPNARAPGQQNESADPLPPQQTQVQFHAP
                     PQQQQQQLPQHVQQQMQQQQQQQQHYQQMPNQQLHPQSQQYAQPPLPQQHYQQQGYPP
                     QNFPPQGYPPQQYAQPPQQ"
     gene            <522451..>523371
                     /gene="PNP1"
                     /locus_tag="KLMA_70249"
                     /db_xref="GeneID:34718005"
     mRNA            <522451..>523371
                     /gene="PNP1"
                     /locus_tag="KLMA_70249"
                     /product="purine nucleoside phosphorylase"
                     /transcript_id="XM_022821506.1"
                     /db_xref="GeneID:34718005"
     CDS             522451..523371
                     /gene="PNP1"
                     /locus_tag="KLMA_70249"
                     /codon_start=1
                     /product="purine nucleoside phosphorylase"
                     /protein_id="XP_022677861.1"
                     /db_xref="GeneID:34718005"
                     /translation="MSSFDISEERALIKAADRYISEKIEQHFSEKFAPKTLIICGSGL
                     GGISTRVSETPKPLVLPYSSIPGFKVSTVPGHNGELIFGFMNDSPVVLMNGRLHSYEG
                     HSLVETVHPIRSLHMLNSIETLIVTNAAGGINASFKTGDLMCVYDHINFPGLCGFHPL
                     RGPNFDEYGPRFLATSDAYDLELRKLLFAKQKELKIERTIHEGTYAFVHGPTFESRAE
                     SRFLRMAGADAVGMSTVPEVVTARHCGWKVLALSLITNECVVDPPASVRDEKPVPIQE
                     GKATHAEVLENSAKASKDVQDLIYAIVAEL"
     gene            complement(<523648..>524553)
                     /gene="SEC13"
                     /locus_tag="KLMA_70250"
                     /db_xref="GeneID:34718006"
     mRNA            complement(<523648..>524553)
                     /gene="SEC13"
                     /locus_tag="KLMA_70250"
                     /product="protein transport protein SEC13"
                     /transcript_id="XM_022821508.1"
                     /db_xref="GeneID:34718006"
     CDS             complement(523648..524553)
                     /gene="SEC13"
                     /locus_tag="KLMA_70250"
                     /codon_start=1
                     /product="protein transport protein SEC13"
                     /protein_id="XP_022677862.1"
                     /db_xref="GeneID:34718006"
                     /translation="MVAINNAHTELIHDAVLDYYGKRLATCSSDHTIKIFEVDGETHK
                     LIDTLQGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEVNGRWSQIAAHEVHSASV
                     NSIQWAPHEYGPLLLAASSDGKVSVVEFKENGTTAPIIIDAHAIGANTACWAPATLQQ
                     HSAHSNSTNSAQQVRRFVTGGADNLVKIWRFNPEAATYLLEHTLEGHSDWVRDVAWSP
                     TVLSRSYLASVSQDRTCIIWTQDNNEDTWKKTLLKEDKFPDVLWRASWSLSGNILALS
                     CGDNTVTLWKENLEGKWEPAGQVTE"
     gene            complement(<524952..>527396)
                     /gene="HRD3"
                     /locus_tag="KLMA_70251"
                     /db_xref="GeneID:34718007"
     mRNA            complement(<524952..>527396)
                     /gene="HRD3"
                     /locus_tag="KLMA_70251"
                     /product="ERAD-associated E3 ubiquitin-protein ligase
                     component HRD3"
                     /transcript_id="XM_022821509.1"
                     /db_xref="GeneID:34718007"
     CDS             complement(524952..527396)
                     /gene="HRD3"
                     /locus_tag="KLMA_70251"
                     /codon_start=1
                     /product="ERAD-associated E3 ubiquitin-protein ligase
                     component HRD3"
                     /protein_id="XP_022677863.1"
                     /db_xref="GeneID:34718007"
                     /translation="MVMLIHLVYILLLHLTRFADSASNGDEAWNSAQRLLGKLPIPQD
                     LRRSNALEYDPFANFADDRIRLTIPMDYYEGQREREYYKFWQDSITEAQMEFYQLLQH
                     ASLEGSHQSDAHWVLKDMFLYGKHCFPHNKTLAHYHLEKFNQLTEGKNSTALFELSVM
                     YSTGFFGTIEKDTAKALIYLQESARLENLQAKQALAYRYDRGVDLIEDKSKSLILYES
                     IANTLRSKYSYEEWFINFPIIESYNVQIPDLTGEGLMGSQRIHHHSSAKRLTKKKPKE
                     VESLFPSSGNGFAEYDEFSIYQQEDDFETDKISDIYYVALNNFYGSYTILRNPEASAS
                     ILNLTYAKYIDKVSTMELFSKFYFSLCVELLGIHYLRGEGVERDIDLAEKYFKQAAIL
                     NEAVKGHNSANEYLGVIAQYYRNDPNRALEFYKKQTIFNNGLGSDKFHLWKLGCDNPS
                     LLREDEIKDALDRSVGMGHIPSYFENAKQSIREHTTYNYNYPLENYKEFVESNEQYMA
                     PYLKDAFLALLRGESEVALWYYSMAAEQGYLNAQVSAAWIMYQPNRLFEDPPNIPEAR
                     WQTALRYYLLAAQQGSIDSATVAGNMYFEVGEYKKTVELYMKHQRYFFNKHRTYFSYS
                     SPNIWNLGYMYEHGLGVEQDFHLAKSLYERHLPDSLALKLTLLKLYVHWILSWASKKF
                     ASLNISKPHRSRSSDWTNLFYKKRISSKHVREGPRNGPKTSLLKTVGNIKWLKKVTKF
                     INWVIFDMNEDLLMIIITLGIILGSFIVTFFRGNLNIRVNGVPIRRNNNNDGDGDANL
                     DAEAPGGDLNIMFFAI"
     gene            <527713..>528927
                     /locus_tag="KLMA_70252"
                     /db_xref="GeneID:34718008"
     mRNA            <527713..>528927
                     /locus_tag="KLMA_70252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821510.1"
                     /db_xref="GeneID:34718008"
     CDS             527713..528927
                     /locus_tag="KLMA_70252"
                     /note="Dynactin_p62[pfam05502]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677864.1"
                     /db_xref="GeneID:34718008"
                     /translation="MVQFLYRSGCGCECSYMELSLCSKCHLSSCQECQGYEIIGKYCP
                     QCEKDTSKKDAVYCHRNCFQCPRCNMSLKIISNKEESEAAPNKRSYSFKCQGCDWSYC
                     TSKVEKVKSLTKYVMELESLTEYHKRFQSLLEFYQTKNSVSKLMAKQAAIDFQSLDRK
                     GPDTWWKRIANGESLWKIMDEESPIQSETLMDDVDTFPRLCKLRPKYNYSCPYCKRSL
                     TKLDPKADVLKWLKTSPAYNGIPRISVIFHPMLKQKYQQKFLLDDSTVLLHMENTRQE
                     HNMTVKVNAEESLLVPDYEVKITSSNLKQSGSHKDHVKQLQGILRSMPTCLLDTSPDV
                     DKLMRVENTRRLGQLNKAVTQPVEYLQIIDEGDGWVVIPLKIINRKCQYELNFLVHFD
                     DWDMGITGTLYL"
     gene            <529122..>529361
                     /locus_tag="KLMA_70253"
                     /db_xref="GeneID:34718009"
     mRNA            <529122..>529361
                     /locus_tag="KLMA_70253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821511.1"
                     /db_xref="GeneID:34718009"
     CDS             529122..529361
                     /locus_tag="KLMA_70253"
                     /note="DUF2008 super family[cl09661]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677865.1"
                     /db_xref="GeneID:34718009"
                     /translation="MSTNSFNATIARILQTEGFQDKNTKITEECMKLLEPYIELLIRE
                     GVLRALENKDESSPENVLEYTDLESVAGLLLMDFQ"
     gene            complement(<529869..>531413)
                     /gene="ENT2"
                     /locus_tag="KLMA_70254"
                     /db_xref="GeneID:34718010"
     mRNA            complement(<529869..>531413)
                     /gene="ENT2"
                     /locus_tag="KLMA_70254"
                     /product="epsin-2"
                     /transcript_id="XM_022821512.1"
                     /db_xref="GeneID:34718010"
     CDS             complement(529869..531413)
                     /gene="ENT2"
                     /locus_tag="KLMA_70254"
                     /codon_start=1
                     /product="epsin-2"
                     /protein_id="XP_022677866.1"
                     /db_xref="GeneID:34718010"
                     /translation="MSKALLRSAKNLVNGYSQAQVLVRSATSNDKEGPSVDQLEELAE
                     RSFDNVEFFEIMDMLDKRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYII
                     KTLREFTHSDELTGIDDGEIVRVKAKELTALLRDEERLREERMMRLKGRKRGGRRRRE
                     KGESDEDLQRALEESRLTAEEEERRRREQGDDPNLQAALELSKEEEELRRLQQLQAQQ
                     QAALWQQQQLQQQQLLQQQQLQQQQQPQAAYYDIFGNPISAEEYLQYQQQQLLAQQQQ
                     EQYMAEQQYLAAQQQYLAQQQMLAQQQQQQLLAQQQQQQFQNQMSLQSGSNNPFSLNK
                     PPSPEEIEEPEEPDFTPVHLPPSPVPQQPLYSQQDQNISSTNPYNNNNNNNNGIPEQR
                     TGSQSISDKFSELNNLLASGTGIDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVTND
                     PPKHNPFLTSQYTGIPSSGIAPSYTGYGFGNQGQSSSQHNGSSYGNNTSNSNNNNNNN
                     PNLIDL"
     gene            <537992..>538165
                     /gene="NOP10"
                     /locus_tag="KLMA_70255"
                     /db_xref="GeneID:34718011"
     mRNA            <537992..>538165
                     /gene="NOP10"
                     /locus_tag="KLMA_70255"
                     /product="H/ACA ribonucleoprotein complex subunit 3"
                     /transcript_id="XM_022821513.1"
                     /db_xref="GeneID:34718011"
     CDS             537992..538165
                     /gene="NOP10"
                     /locus_tag="KLMA_70255"
                     /codon_start=1
                     /product="H/ACA ribonucleoprotein complex subunit 3"
                     /protein_id="XP_022677867.1"
                     /db_xref="GeneID:34718011"
                     /translation="MHLMYTLDAEGKRIYTLKKVTENNEITKSAHPARFSPDDKYSRQ
                     RVTLKKRYNLLPN"
     gene            complement(<538522..>538740)
                     /gene="DAD4"
                     /locus_tag="KLMA_70256"
                     /db_xref="GeneID:34718012"
     mRNA            complement(<538522..>538740)
                     /gene="DAD4"
                     /locus_tag="KLMA_70256"
                     /product="DASH complex subunit DAD4"
                     /transcript_id="XM_022821514.1"
                     /db_xref="GeneID:34718012"
     CDS             complement(538522..538740)
                     /gene="DAD4"
                     /locus_tag="KLMA_70256"
                     /codon_start=1
                     /product="DASH complex subunit DAD4"
                     /protein_id="XP_022677868.1"
                     /db_xref="GeneID:34718012"
                     /translation="MENPYEKVQSNILSRIIGNVERLNESVVILNQELRRVNSKNKNL
                     ELMSQMCENYRESVDFQLQATSKKQEPL"
     gene            <539375..>542443
                     /gene="OSH3"
                     /locus_tag="KLMA_70257"
                     /db_xref="GeneID:34718013"
     mRNA            <539375..>542443
                     /gene="OSH3"
                     /locus_tag="KLMA_70257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821515.1"
                     /db_xref="GeneID:34718013"
     CDS             539375..542443
                     /gene="OSH3"
                     /locus_tag="KLMA_70257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677869.1"
                     /db_xref="GeneID:34718013"
                     /translation="MDTIDVQNKAFVVRWVRVSQGDVVSFRLKPLKKSIGFGIYRRFD
                     GSSSIDLNNPDERTPSSASSTPSIKYSSNAKPHLALADHDKDKNVPLQTRLVQSGLEK
                     VIWYGTISNNTTVAESFESTCENCYYAFILDNTTSKQTKKKCLFSVSIKPPAIVADSY
                     DDDERSFISNQDEPVSSNNNINDSNANTASSVALNGSNNPTTLSVKRALNYSQSSFHN
                     NTSSSSLPYPNQQSQSYSQMNSSSVSNAADIPGVNASSVSVGGVKQLSPASTATTDLD
                     LKNSRYFQGYLLKKKRKKLQGFTKRFFKLDIKYGILSYYLNSKSPMCRGEIVIPLSSV
                     SANKQTKLIIIDSGMEIWILKAHDPKDWEQWISMIESCFKQEAPTSSQDHESRDVVGA
                     PLVKTHDTDTTSLLRNLTTLRKRIEECKNMSLSYSPTPITLRPPMSAIQAPTNASKQR
                     NVSRSSSVSSFMNNFSRQKNGSFTEQGTSSQAQGGQLYSDASTPALPGSSDPQQHYHH
                     ALYYKLVELEKLAKQLDVETNQIAERWMPRSPPASIFSDDEYFDANEEPIITMLNDDV
                     AYENDVRPTYNMPKEEEEEEDDDDDDDEGEEEEEEEEEEEEEDRATTTTNEFMTPADR
                     KRQVSTETQIVKSQEVDLSPLPINHQVKRRNDIKAATSSPPSLLSFLRKNVGKDLSSI
                     SMPISINEPVSILQVLSEAFEYSWLLNKAAEVQSDEVQRLKYISAFALSYMSIHRQKT
                     RSLRKPFTPLLGETYELVREDMGFRLISEKVCHKPPVFASYTEHRSWKCGYTLTPVQK
                     FWGKSIEFTNEGQFELTFSDVDTKYKWAQPTLVLKNIIAGERYMEPTNQFTITSSKNI
                     KSIIAFKSGGMFSGRSEDVDVTIVDDKGKKLGSLKGQWTKGMHDVDTGEEIWKCGPLL
                     PNSEKKYGFTVFTSNLNEITEIEKNHIPCTDSRLRPDIRMYENGNVKEAEEMKLSLEQ
                     KQRDRREKGNDVQPQYFKQVKPSKWVPILDKNGYWEKRKKQDWSSSKPLW"
     gene            <543971..>545689
                     /gene="PHO84"
                     /locus_tag="KLMA_70258"
                     /db_xref="GeneID:34718014"
     mRNA            <543971..>545689
                     /gene="PHO84"
                     /locus_tag="KLMA_70258"
                     /product="inorganic phosphate transporter"
                     /transcript_id="XM_022821516.1"
                     /db_xref="GeneID:34718014"
     CDS             543971..545689
                     /gene="PHO84"
                     /locus_tag="KLMA_70258"
                     /codon_start=1
                     /product="inorganic phosphate transporter"
                     /protein_id="XP_022677870.1"
                     /db_xref="GeneID:34718014"
                     /translation="MENKEEEKVYVKTAGGNAAFHNYINDFAHIEDPLERRRLALNKI
                     DNASFGWYHIRAICVAGVGFLTDSYDIFAINLGVSMIEFVYWKGKMPSSTSTLIKVST
                     SVGTVLGQFGFGVLADVVGRKKIYGTELIVMIAATVLQCTLGHSPAVNFVAVFVFYRI
                     IMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAFGQIAAGIIALILVAAYKSK
                     LEHFTGATCDAECIRACDQMWRVLIGMGCVPGCVALYFRLTIPESPRYTFDVEVDINK
                     AAADAAKFTSGEHGNADTEDIARLERAPTAVEAMEIKPPAASFGDFCRHFRQWKHMKI
                     ILGTSLSWFFLDVAFYGISLNSAVILQTIGYASSKDVYKKLYNSAVGNLILICAGSLP
                     GYWASVATIDTIGRKPIQVGGFIILTILFCIIGFRYDQLGDHGLLALYVLCQFFFNFG
                     PNVTTFIVPGEAFPTRYRSTAHGISAASGKIGSIIAQTALGTLIDHNCKKDHKKTNCW
                     LPHVMQIFALFMLCGIFSSLLIPETKRKTLEQISEEYHGEIDPSRYATPSGKAHDSAS
                     SQIETV"
     gene            <546598..>548392
                     /gene="TUB1"
                     /locus_tag="KLMA_70260"
                     /db_xref="GeneID:34718015"
     mRNA            join(<546598..546622,547077..547652,547707..547965,
                     548032..>548392)
                     /gene="TUB1"
                     /locus_tag="KLMA_70260"
                     /product="tubulin alpha-1 chain"
                     /transcript_id="XM_022821517.1"
                     /db_xref="GeneID:34718015"
     CDS             join(546598..546622,547077..547652,547707..547965,
                     548032..548392)
                     /gene="TUB1"
                     /locus_tag="KLMA_70260"
                     /codon_start=1
                     /product="tubulin alpha-1 chain"
                     /protein_id="XP_022677871.1"
                     /db_xref="GeneID:34718015"
                     /translation="MREVISVNVGQAGCQIGNACWELYSLEHGIAPDGYLQDGLKKPT
                     GGEEGFSTFFNETGSGKFVPRAVYVDLEPNVIDEVRTGAYRDFFHPEQLISGKEDAAN
                     NYARGHYTVGRELLDEILDRVRKISDQCDGLQGFLFTHSLGGGTGSGLGSLLLEHLSL
                     DYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADYIQRPSFSNLNNLIAQVV
                     SSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPIHSKSKAHHESNSVSEITN
                     ACFEPGNQMVKDVQNAVAQIKTKKTVQLVDWCPTGFKIGICYQAPTATPNSQLSAVNR
                     AVCMLSNTTAIADAWKRIDKKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERD
                     YYEVGADSYADEEF"
     gene            <549187..>550767
                     /gene="ALO1"
                     /locus_tag="KLMA_70261"
                     /db_xref="GeneID:34718016"
     mRNA            <549187..>550767
                     /gene="ALO1"
                     /locus_tag="KLMA_70261"
                     /product="D-arabinono-1"
                     /transcript_id="XM_022821519.1"
                     /db_xref="GeneID:34718016"
     CDS             549187..550767
                     /gene="ALO1"
                     /locus_tag="KLMA_70261"
                     /codon_start=1
                     /product="D-arabinono-1"
                     /protein_id="XP_022677872.1"
                     /db_xref="GeneID:34718016"
                     /translation="MSLESVTGISRSNFVFKNWAGIYSCKPQLYFQPNSIDEVVDIVK
                     AAIEQGKTIVTVGSGHSPSDMCITDQWLMNLDNLNRVIHFEENEKGLYADVTVEAGLR
                     VYQLSEILSERGYAIQNLGSISEQSVAGIISTGTHGSSPYHGLVSSQYVNLTIVNGKG
                     EVVFLDSEHEPEVFRAACLSLGKIGIIVKATIRAIPAFNIKSTQEVINFETLLNNWET
                     IWTSSEFIRCWWYPYTRKVILWRGSKTEEPLTAPRKSWWGSTLGRFLYESLIWLSVKI
                     YPGLTPYVESFVFHQQYGRVETYGSGDIAVQSSIDGLNMDCLFSQFVDEWGCPLNNGP
                     EVLRSLDHSITQAAQNKEFFVHVPVEVRCSNTTLPSSEPDYSNRTETSAGPVFGNILR
                     PFLDSTPRHLRYAPLSDVTNSQLTLYINATIYRPFGCNAPIHKWFTLFEDTMGAAGGK
                     PHWAKNFLGSTSMAAGKVKDETEYLDYEMRGMATKIKEWYGEDLLKFREVREQQDPHN
                     IFLANKEWAIRNGIVDIE"
     gene            <551213..>552145
                     /gene="PGA3"
                     /locus_tag="KLMA_70262"
                     /db_xref="GeneID:34718017"
     mRNA            <551213..>552145
                     /gene="PGA3"
                     /locus_tag="KLMA_70262"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821520.1"
                     /db_xref="GeneID:34718017"
     CDS             551213..552145
                     /gene="PGA3"
                     /locus_tag="KLMA_70262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677873.1"
                     /db_xref="GeneID:34718017"
                     /translation="MSSNKNWDVLNEPLHGIYIPSLLFSVGIIVFTVMNHDVRFLSGF
                     ILLGAILLYRMVIARSRLKSIHSDKWTPLELVDQTIISKNTAIYRFKLKTSLESLNIP
                     TGHHLAVRIPFDGTDEIRYYTPISNKFETGHFDILVKSYPEGKVSKYFAMLKPGQTVD
                     FKGPVGRFNYEVNSSKHIGMIAGGTGLTPMLQVLNTIITTPEDLTKVTLIYANETEND
                     VLLKDELDEISEKYPNFTVHYVVNHPSSSWDGETGWVTKDIMSKYLPEPSAENRLLIC
                     GKPEMKKTLLAYSEELGWPKGVLSSKGDDQVFVF"
     gene            complement(<552247..>554172)
                     /gene="UFO1"
                     /locus_tag="KLMA_70263"
                     /db_xref="GeneID:34718018"
     mRNA            complement(<552247..>554172)
                     /gene="UFO1"
                     /locus_tag="KLMA_70263"
                     /product="ubiquitin ligase complex F-box protein UFO1"
                     /transcript_id="XM_022821521.1"
                     /db_xref="GeneID:34718018"
     CDS             complement(552247..554172)
                     /gene="UFO1"
                     /locus_tag="KLMA_70263"
                     /codon_start=1
                     /product="ubiquitin ligase complex F-box protein UFO1"
                     /protein_id="XP_022677874.1"
                     /db_xref="GeneID:34718018"
                     /translation="MMSELSLQALPVEVLVNVFSHLEESDFRALEQTCKLFEKIVHDE
                     ELWKTLFLQKNSTLWFPSFSRANLYSIEYVERNTGLNQWRHNRATKTKYSITHDVTQQ
                     SHDISSIVFDFPRCACYNEGMVTFLQLHTKRRKDRVAYIQCTTPHGTSARHFNINAVV
                     FGRYDGRVFGKLLTNKSYLSPVTEFDGRHFAAVTAIITTAYQDSSDDICVSGDESGEV
                     IWWRNTHKERQLKISTHPIADLHVHKGITVAIDLETIFVIDSNSEVHSINLQKKTNVD
                     FSACKFIKVDFGGKNIIFATLFQVYVISIDIRKDFGTTKVMNFDHPIQELSIDESTAK
                     RERNPHLPGGDGCYISVLTEDRTVYTINVRVPGSELKYQTKLAFNENWITCQINNLVL
                     VCAFSGMIGIYDAITGNEIRVVQNTEPYPEFLNISHGQILMGKGTTLFYYQYVSEQDN
                     SRKKKGGNRARSNKWNENLQQQLNIYDDEEQRRIEEHNRMAKLQKKFVGDIDDEELQL
                     KIALLESESLSNSTQQNQPHLSAGGDMNNVDGVVSELFANDEDIDEDFLRALQESTEE
                     EHRDKLRKKRNHQPIGELQHTHAVNYMSDTESLDEETKRQIAMIDAAQEHGEQTNPEN
                     DDDLALAIALSLSQMND"
     gene            complement(554370..554445)
                     /locus_tag="KLMA_R705"
                     /db_xref="GeneID:34718781"
     tRNA            complement(554370..554445)
                     /locus_tag="KLMA_R705"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:34718781"
     gene            complement(<554615..>556249)
                     /gene="ORC4"
                     /locus_tag="KLMA_70264"
                     /db_xref="GeneID:34718019"
     mRNA            complement(<554615..>556249)
                     /gene="ORC4"
                     /locus_tag="KLMA_70264"
                     /product="origin recognition complex subunit 4"
                     /transcript_id="XM_022821522.1"
                     /db_xref="GeneID:34718019"
     CDS             complement(554615..556249)
                     /gene="ORC4"
                     /locus_tag="KLMA_70264"
                     /codon_start=1
                     /product="origin recognition complex subunit 4"
                     /protein_id="XP_022677875.1"
                     /db_xref="GeneID:34718019"
                     /translation="MKEIDDEFGPIRKSVHKVNANEIIEDVRIDGQLKKIPLQRGIKR
                     PIDHINSKKEDETIKRKSVEKEDSSSQNSGGPSDSDKQLFKSLQRYLIRKLNGNLSFK
                     DSKVPGFLKDTAFQLERLLRQCIIQKESHSAIIIGPRSGYKSLLIKRELESLRATHEE
                     QFIVINLNGYLNSENSAISSIAEQLEYELSRRSNNTMQGQKTKDLGISDGTPTEVFEN
                     ILKLLDSFTVTPLKGVHSQKEKSEHVTLVFVFDEIDQFAGPVRQTLLYNLFDLVETSR
                     IPVCVLGLTTKISIMQFLENRVKSRFSQRIINMPFISNFDQFVQTFEELLEIDDAELK
                     NQFSWNTYLKSLLRNEKSEIFRVLKTNYDNFKDTEVIRNALIPSIALSKSYEELTQEI
                     ETCIKMKKYLANQLSDTVASKLRSLSELELGILISACRVAVKNDEFINLTLVHEEFTK
                     LGKSHKTTFADKFKLWTKQDMKNVWENLAVLELITERGAISVKFTEDSAIQSANYNSS
                     TMRAPFDLRTYQVYVTLQELRRIVPKNSLFYPWTQL"
     gene            complement(<556778..>558109)
                     /gene="TIF3"
                     /locus_tag="KLMA_70265"
                     /db_xref="GeneID:34718020"
     mRNA            complement(<556778..>558109)
                     /gene="TIF3"
                     /locus_tag="KLMA_70265"
                     /product="eukaryotic translation initiation factor 4B"
                     /transcript_id="XM_022821523.1"
                     /db_xref="GeneID:34718020"
     CDS             complement(556778..558109)
                     /gene="TIF3"
                     /locus_tag="KLMA_70265"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 4B"
                     /protein_id="XP_022677876.1"
                     /db_xref="GeneID:34718020"
                     /translation="MPPKKNAIRMDLSSFLEDDTFNDSWTTDEVDLNNITIPIQNVAA
                     TNTISLDDFSKTTAKKGGNRFGGGGNLDPALRKEREEYPVPDFPPFKAIINNIPWDIS
                     EGGIQQWVEDGLNKEGAVQEVMAPRNPENDRLKGMAFVTFHERGDLEKALTFSGTKLN
                     DRTVYVSVAAPRNNFGGRSNFDDIDWSGARGSNFRGDDRREVAEPDWSSARGANFRES
                     RARDSGPEPDWSSARGSHFRESREPREPRESGPEPDWSSARGSNFRESKPREDVPEPD
                     WSHARGANFKETKPRAPEPDWSSARGSHFREAREPRESKPRESGPEPDWSAARGANFK
                     EPKQRGPDIDWSSARGSKFGKTARAEPAQKKTYSRRELTSQQKEPETPKVVKSAFSVL
                     STEDDDEEEEEEQPVQQKSTEDEDVQEIEKATAELDIEQGDNEEWETVGKK"
     gene            <559264..>567102
                     /gene="FMP27"
                     /locus_tag="KLMA_70266"
                     /db_xref="GeneID:34718021"
     mRNA            <559264..>567102
                     /gene="FMP27"
                     /locus_tag="KLMA_70266"
                     /product="protein FMP27"
                     /transcript_id="XM_022821524.1"
                     /db_xref="GeneID:34718021"
     CDS             559264..567102
                     /gene="FMP27"
                     /locus_tag="KLMA_70266"
                     /codon_start=1
                     /product="protein FMP27"
                     /protein_id="XP_022677877.1"
                     /db_xref="GeneID:34718021"
                     /translation="MYERAWKAVSESPAVFPPLWKVLGVVLLAWTVLNVICYSTVGCL
                     VAGFNPWALRFSGIHVRGKLKIKSIRYNIWKHRIVVDTAEWTGDLDLDSVGKKNEDTK
                     SRGVSVPKKLIKWLPFIAKKLDRLKIVLDGTKVGDVYVSLAVIKLVSDGSKISLEMNV
                     QRAMIKHKCVLGSAGFKADALIDTTRPFPFKEIFIDVEARETYVSAQSVLLAMHERKY
                     GKLDNNDPVGAIEKHQADKQAKQTSETDFTDINKFLEVLNEKVEKFYTVSSSFEKISL
                     VLESPLFSNIPLKPSLSLIKSTQALQLQISATSIAICISRSSFTDPGTKLLFGSEERP
                     LKFSTYVVALKISLLTKKGILKEQSLPRTEELRICEIPNISLYGDTNLFCQDCIVRED
                     TKLFSNTVLKLVGHVTSPVLDLDIQTLSLLVSVQRNLKVLSELLSQDPIEKPLDLKEI
                     YQEIAKRGQFIEYFQNYLPHTELKINIDDPVYIISNGVDSLVQKLSAIKITVQSNRVY
                     QQAEKKLFYSLDTQMDLIEWTGHHQNEDHSLKQDMFSSSNICLSFSTRILPSLLLSAS
                     LQFDNFHMDLTNLKTLVVINDTMRQRNMKLSYVEDTYFKEIFQNLESRLMARIEHFKK
                     HTSNGESVNVNDLIFEDLPPFFESITVQIKNLVAIVGSRSVFIERNDYMNPNFETAHD
                     FVSGEMRKISYSLADMKAIFARVNDSMNTDSNSSSMLEKLDTFASDDKGLGRAVNEEK
                     GRDSGPWSLDFSISDLSVELFSETLRDSLKLIPKPVLKLPTFKFYVYPDQELKRIKAA
                     IDISSVDLLFSLMTVFLFFSSIYNLKMVFGNDVYPSASECIVSKHMDTLKELKKRRLV
                     SFSKADLVKMLDFNFNLAKSSTIILLPNGLRTKLELIDTSVIFTDGCIISASGHYTRL
                     MVESPILKNTWMRMITIVNYKIDSDLSLIKDKSENVGITLSNESWQWTIPHKFEMYKL
                     FDNISTVYKSIKQMNYSLKTESNKSVIYPKITHPSAIPKIKLKSSRWIFSVEDDPFES
                     ELNIILQLGLREQKERLEKYDIFRKRVENEFRKKDAKVLRKASTFMSDTKSNGNKIFK
                     SRSNSSFHLLGLEPADLQRADGLADRLKEEYDTLARNISKSWIVRVKKHKNIIKDHFT
                     ENFEFLWGTVDVTKLPKNFNSNVLEFTSNPSLMNLILEGIDIELSEPSFGINNIPDFI
                     HDVGKGVPKDTEYSIMIPLKLDAKFTEIRCHLKDYPLPALYFPKNTANPVQPSTNLIC
                     DLLITEDMIHSEKELRTIYVPLVPSAHLEDSTSLYALLVPRTITSIKVFTDLKLENTS
                     TENTRIVWGSSYGGAIQQTMDCFDNFSKPPIDPSPAVGFWDKIRNMFHARLHVSIPNS
                     AFEVALKGDKNPHKIGGMSAGYALIFKDNVNICFNKDDNPKKFVTINASELSFSVPNF
                     FAKPIPAWNMPSEKALFFPVEEFSNLQANASFYYLLDSARMPKSDKMLHIMRKAYIEK
                     TAIKLTGGMEFNVGIMFERYSDRIKKRTFDLKPHYDFRLCNPIYVDQPSKHDSYAGFR
                     SDFIHLSFELISKGENAYNCMQLTPNAFKIFFKWWGSFSGNLPVRKGPLFTHQRISPK
                     FGTHLYTISYRADVFPLFICHMVPNLDPRTLIDPTLKVEVFGLKAKMSEFSMDLHQRK
                     EVFHEYKEHLNVTKKITSLKFHSADVTTTDIDIRTVFAKFMRPEYAKKNTPNLNIFDN
                     DQSWFDIYDYSEFNYANFETSVPSVVMSPLLFSPMFAYKKHAPYGNKYQVDVETFEPI
                     EPFDNFNYHNCNLKRYVVIPDRLVNERIKIFAKEKNELDAEIRLSRPTNSKLLERLKM
                     VNRTLEQLELMKSDIKYLNNEYNRADCEHSKAVIDRSELNLPIWKLMRTSQDSDKSYA
                     NKFIVVSMLLKWNEEVRNVFLKYIHRLTLISDMNNVTKLKTLQTLDSLIEKNRLSVST
                     IPEEAEINTEKKESANEYIFKNIFRTDKDPEQILLSFQDDIKLLGGDFDYSTFEKYHV
                     QLIAPQIQLTTATDPDACVLVTAPTIKLNSLYFDSNITDNEYQQNLFMNRAGIQLIQS
                     NVFVFHKMNQESYNHLLFDKFLYGSTNETSWRPWLGLELCFNPENLKDDMLISNFTSV
                     FTYDQVLPFANIPDKLKHSDVLKNRIICDLPRIVIESNSARYLSLFNLVTSLLLYVEP
                     ESAKMKNDIKKLILSFEFEDVTKVKEAIMVLEKQIDILDEIEYEYSFKKYLLDDAEKS
                     DLNTIRHNKMDTAIKMLLMMKVITSASPEQESNEEMLYIIIKAKEVILHMLDDDRHNF
                     LDVAVADATFQRMETPSGYNFNKLNIEMAQVINLSHDALFHDLLSPVQKNVNRDQKPL
                     LELKWEKDKAVGGIQVVKNVVTNLRDLKINVEESTVEKIIAWVSPSSVSTLMDGINQQ
                     EVADGDLDESASSGSASRLSVKSVRPSNVKAQSIDRVRRVTPSEMVSPMEEVIGNDAE
                     MDEMIQRSKENMIIENITINPFLMVISYQGSGVSSLINVTDFNLYFPTIRFANETMTV
                     LDLMMHLKKVLIKSLLRHTGSFIGNKLKKHGSVKKLRTAARSPLKQLNYYKHYTTVDE
                     LKDTSSSSTVRDDKDI"
     gene            <567437..>570931
                     /locus_tag="KLMA_70267"
                     /db_xref="GeneID:34718022"
     mRNA            <567437..>570931
                     /locus_tag="KLMA_70267"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821525.1"
                     /db_xref="GeneID:34718022"
     CDS             567437..570931
                     /locus_tag="KLMA_70267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677878.1"
                     /db_xref="GeneID:34718022"
                     /translation="MTNNYNDFILAENLKDVSLDNSLQIAAITGDISYENEIERFKYP
                     QPATRSKDELTKGTLVNAFKECSIEYEASRRVFHYLVKESNIFRFLFTNAHMTVRSAR
                     EPIIGSDQLDDIYIKATDDRFSSDMILSIHNGRVLQLATFVLTESSTQVKILDRITLP
                     KLGCASKFTIVGDKVKGSQFLCLCQSLNTLSVLFFDIHVDHQETIKLISHDRQLILPR
                     SKLLYGSMMNRGRSLKSSLLAIWNCNRVHLIYFEWNEISDEKHTFRLVLPNFSAVTRI
                     TYLNDSLFLIASEQEQEPILITSSQLKTGDREFKTISTLFNFINMEAECHELLDKLQR
                     LYPQQLASFKKCMILLINHRDILVVISGKGDDVVYSHFLRVKFAVKFYVIDIDDKSMC
                     IDILSNKGIQKHKIPLMLGNLYPLSEDFSVSQKAGNSVSETVYKSYSTVSSFVSCNRE
                     ETKSTLWCSGNSGIYQIDKDGYYIQLVEEIESASYIGFARQHFVLKCNCRHLEEENRT
                     FVIIYLGEEVTTRIVSMNEDGKLIIAKEDTLDFSLNILNEHTVNIFTLSESLFQVLDG
                     CILEIKPNRERTVCFGDKTCTDMQIISCVGVDEYSEIAMLLKVGDDGAILFSVQEFSY
                     GKLIEKWKQWLGHGTAKPIRHNAGTGTLHFEIESGSKIVSYTYDISHKELQMETWNLE
                     EDCMADFAQTVINYGLNGNRRSLYTQTVRQVGRLKRFGNKEEEEEHTLFFSDEVCQLV
                     QIADNCVLIHDSTRVGLLMNGTIVRVPGIENDGISSILEASAVVEHGAVVLLCVVFDT
                     HTTVVRGTFVSNIVRSHDVKAKHNRTHLQRFCYFESLKRMVVCNLQKQVVYALKLETG
                     KTASLEYASVRDLRHIYHLSEVEPNHAAIVGVTRNGAHVVKLCKISFKSGRLRMRDVG
                     ELELASKPCNGTASTSVNVSKRWATAPELWIAAGRNVRVVKLLLPGSHPGSHPGAHVE
                     LKLDVQLELGLELEPELDSALDSSLEPDLELVLSPTLICVKSNSEFYIGRINEVMSYK
                     ASALRRCEGTQRLEPRSSHALLHPDADADAIGSLVIWGNNRSTAAGGEGTVLLFRAAG
                     PQPPVPAAVLSVPPDPVDADAVSVCRPRDSETRSTFKILHVTGRLTTIAIITAHGNKN
                     AKASGPNATTAQTKAYAY"
     gene            <571877..>572503
                     /gene="RHO1"
                     /locus_tag="KLMA_70268"
                     /db_xref="GeneID:34718023"
     mRNA            <571877..>572503
                     /gene="RHO1"
                     /locus_tag="KLMA_70268"
                     /product="GTP-binding protein Rho1"
                     /transcript_id="XM_022821526.1"
                     /db_xref="GeneID:34718023"
     CDS             571877..572503
                     /gene="RHO1"
                     /locus_tag="KLMA_70268"
                     /codon_start=1
                     /product="GTP-binding protein Rho1"
                     /protein_id="XP_022677879.1"
                     /db_xref="GeneID:34718023"
                     /translation="MSQAVSNVASIRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPT
                     VFDNYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENV
                     MEKWISEVLHFCQGVPIILVGCKADLRNDPQVVEELRAQGLEPVSQAQAQEVADQIGA
                     VDYIECSAKTGYGVREVFEAATRASLVGKQGKSKPKTKSSKKKKCTVL"
     gene            complement(<573181..>573528)
                     /locus_tag="KLMA_70269"
                     /db_xref="GeneID:34718024"
     mRNA            complement(<573181..>573528)
                     /locus_tag="KLMA_70269"
                     /product="40S ribosomal protein MRP2"
                     /transcript_id="XM_022821527.1"
                     /db_xref="GeneID:34718024"
     CDS             complement(573181..573528)
                     /locus_tag="KLMA_70269"
                     /codon_start=1
                     /product="40S ribosomal protein MRP2"
                     /protein_id="XP_022677880.1"
                     /db_xref="GeneID:34718024"
                     /translation="MSNFRFPIKTKLPSTYLNARVIRDNFKRQQVAANEVTMKALKFI
                     ARNTTLPPRTRMEAQLQLSVMPNYTRMTQIRNRCVETGHARSVLSDFRLCRTQFRELA
                     RKGDLPGVKKGVW"
     gene            complement(<573783..>574610)
                     /locus_tag="KLMA_70270"
                     /db_xref="GeneID:34718025"
     mRNA            complement(<573783..>574610)
                     /locus_tag="KLMA_70270"
                     /product="uncharacterized protein C1F7.10"
                     /transcript_id="XM_022821528.1"
                     /db_xref="GeneID:34718025"
     CDS             complement(573783..574610)
                     /locus_tag="KLMA_70270"
                     /codon_start=1
                     /product="uncharacterized protein C1F7.10"
                     /protein_id="XP_022677881.1"
                     /db_xref="GeneID:34718025"
                     /translation="MSLYDLPAVKHEKSLPDDELIKVLFVNPNSTQAMTDGCLKMIAG
                     HVAPDTVVYGYTAPMGKAPNVIEGHLDGIQSAIAVMEDAYEIIKQVDCVLVGCFSDHP
                     LIKAVREEFDDVLCMGIVEAAVYSSRIIGSKFGVLASIYKSQLRDEETIAGLGMSEFC
                     VGLLSSGIKTVSDLVKVEESELHRMMSETALTLVEKYHADTIVLGCAGMSDLKAAVSD
                     SLQKHGHDVPIVDGTVCGINIISAVYRSGLHSTSKSGAYSSAREARKLRGDVVGIKR"
     gene            complement(<574975..>575766)
                     /gene="MET16"
                     /locus_tag="KLMA_70271"
                     /db_xref="GeneID:34718026"
     mRNA            complement(<574975..>575766)
                     /gene="MET16"
                     /locus_tag="KLMA_70271"
                     /product="phosphoadenosine phosphosulfate reductase"
                     /transcript_id="XM_022821530.1"
                     /db_xref="GeneID:34718026"
     CDS             complement(574975..575766)
                     /gene="MET16"
                     /locus_tag="KLMA_70271"
                     /codon_start=1
                     /product="phosphoadenosine phosphosulfate reductase"
                     /protein_id="XP_022677882.1"
                     /db_xref="GeneID:34718026"
                     /translation="MSRVYELNNGLLVNQEQLDHWNEKLTALSPQEIIRWAIITFPHL
                     FQTTAFGLTGLATIDMLSNMAESESAEIVPLIFIDTLHHFPQTLDLLKKVEDRYYKPR
                     GQAVNVFQPQGCKSEQEFAAKHGDFLWEKDDDKYDFLVKVEPAHRAYQELQVTAVFTG
                     RRKSQGGARANLKFVELDELNKIIKINPLANWDFNQVQAYIREHNVPYNELLDLGYRS
                     IGDYHSTQPVQEGEDERAGRWKGKAKTECGIHETSRFAQYLQQTK"
     gene            <576374..>576826
                     /gene="NUT2"
                     /locus_tag="KLMA_70272"
                     /db_xref="GeneID:34718027"
     mRNA            <576374..>576826
                     /gene="NUT2"
                     /locus_tag="KLMA_70272"
                     /product="mediator of RNA polymerase II transcription
                     subunit 10"
                     /transcript_id="XM_022821531.1"
                     /db_xref="GeneID:34718027"
     CDS             576374..576826
                     /gene="NUT2"
                     /locus_tag="KLMA_70272"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 10"
                     /protein_id="XP_022677883.1"
                     /db_xref="GeneID:34718027"
                     /translation="MTEQNLEKLQTDLVEAEQRLAAIIDSFIELGVSVYDFPGTEDSM
                     QGMVTNLKRNVDRMKQLNQQANDPESQLQNFLVPLDVLQYIEDGRNPDVYTREFVEAI
                     RRSNQYQRAKIHGLIKLRDSLAEKIVDELPDLQPHVERIIARTSPEKN"
     gene            <577138..>578703
                     /gene="JIP5"
                     /locus_tag="KLMA_70273"
                     /db_xref="GeneID:34718028"
     mRNA            <577138..>578703
                     /gene="JIP5"
                     /locus_tag="KLMA_70273"
                     /product="WD repeat-containing protein JIP5"
                     /transcript_id="XM_022821532.1"
                     /db_xref="GeneID:34718028"
     CDS             577138..578703
                     /gene="JIP5"
                     /locus_tag="KLMA_70273"
                     /codon_start=1
                     /product="WD repeat-containing protein JIP5"
                     /protein_id="XP_022677884.1"
                     /db_xref="GeneID:34718028"
                     /translation="MGKSLKAKKRAASLEVLASSSCPLVEFVFDEPLIQVACHPEQPI
                     VVCAIATGHVFCCKYDAAALKRILNKKESALSKEENQADQKRKKFWKVIKLSPNTSEI
                     PLEEDEEKAPVEILWKTRRHKGSVRGLCFNGDGSELYTIGIDRVLKRADTMTGKVVKK
                     VTLPLEDEKNQYTKLVRSQTHPFLLLGDERGNIYTLNSETLKIQNTIKSIHNGDAIND
                     IFQFVGRSVYKFISLGQTTLAFWDSRESNESDADIPEDDLEAKRKVYTSDDQEDEMIC
                     GTFVNPDDGDVLVCGMGEGVLTVWKPKKNDLVDQVTRIPICKNESIDCIISSYQDNNC
                     VYCGCSNGNVYKVNVKLGKVVEIRKHSSLDEVYFIDLDHEYRVLSAGMDKLKLWDLTS
                     EEGDNEKPSSDQLSDAEDGSESFSDSDLGSDSDSDSDANSDPDSDADSDSSSDEETSD
                     VEETLVGLSKDELLAELDKDLQSSDEESKPEKKRAKKPQPKNAKKQKKELNNKQLRNL
                     QTHEHGIKKFEGL"
     gene            complement(578851..578926)
                     /locus_tag="KLMA_R706"
                     /db_xref="GeneID:34718782"
     tRNA            complement(578851..578926)
                     /locus_tag="KLMA_R706"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:34718782"
     gene            <579930..>581555
                     /locus_tag="KLMA_70275"
                     /db_xref="GeneID:34718029"
     mRNA            <579930..>581555
                     /locus_tag="KLMA_70275"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821533.1"
                     /db_xref="GeneID:34718029"
     CDS             579930..581555
                     /locus_tag="KLMA_70275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677885.1"
                     /db_xref="GeneID:34718029"
                     /translation="MSRSRDPELNSFLSRVEQLDSERSKQKPAVKPKPKTLKYDDNDF
                     KKAEDLLNGSYINRSQPIHNDVADEQVSSLAFKSAYNYDKTFSPKKEKGPKVNGKSNG
                     NSSGKTGDMSYSISHMETRRVSKFDDVYRVEETSKTEEGYFVSKEDYEMLMSIKGRLE
                     ESRTHEQENERELEHKRLPSRPVVIPNRRTSDSPYEQNPPLPSRGRGKKSEEGTPLFS
                     SRNFIDHDNFLDHDIINEPPKSSRKGKSVPPPPPPKKNTIKKPILAASSGSPSKKSSS
                     AEVPNEVLPRAQTKSPLKAAKESLIKSPIKSISKSPTKPTSQPAAKYVIVDEEDSADE
                     FSEMFQKIRLSKESSKSTAEVKAKVPPKPPAKSPSIQLPKLRSPKPKPALPANAKDPK
                     KKSQDQNPDEDEVSALRRSLRKVKTAPPQRNATPEALRAKNRLQKPAVPPKPTIEIPE
                     ALTKRDTLVRPATDPQLKSISPALEGLQRQKVILQKQLIEKVGGSSSPELKFENDQVM
                     SPRPTSSTPSKPLPTKSRTRGPKRKLPTDLKKL"
     gene            <581927..>583003
                     /locus_tag="KLMA_70277"
                     /db_xref="GeneID:34718030"
     mRNA            <581927..>583003
                     /locus_tag="KLMA_70277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821534.1"
                     /db_xref="GeneID:34718030"
     CDS             581927..583003
                     /locus_tag="KLMA_70277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677886.1"
                     /db_xref="GeneID:34718030"
                     /translation="MTDQDLVTGDLVLCTVGSYEPWPAVVVPQRVLSDSVLSAKENDQ
                     QVAVAFFNDATYYWTRPKQLKRLSEGDIKSWIKSPPKRSSKELKKAYHFASEYSTLQE
                     FVQDRLTLEGRVDDLEEISEIEMGEDPLIAPPVDVDEPEELEKPASKKRGRRHHADSD
                     TEDNDETVNNGNGNGNKAKQKQQQTQKSKPKQAPKNAAVKKSSSPLSPDLKKTADSSQ
                     DFNSTLTSSVSDIQQQQQQQQPPPKKRTKLDYTRRVEIAQIFRNKLQKCLIQRDTPPT
                     EADLAESEKLIRKIQSHAKSSPEFFDLEALKISKLHKLLKVIKNMPELSQFHDSCTEI
                     LDIWAPHVQQIKKEKLTLKDQLSQ"
     gene            <583445..>584029
                     /locus_tag="KLMA_70278"
                     /db_xref="GeneID:34718031"
     mRNA            <583445..>584029
                     /locus_tag="KLMA_70278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821535.1"
                     /db_xref="GeneID:34718031"
     CDS             583445..584029
                     /locus_tag="KLMA_70278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677887.1"
                     /db_xref="GeneID:34718031"
                     /translation="MSTVDLPDHLVSLLKTSKYVHLATASKDCIPNVSLMNYTYVPPH
                     RAFQEESSNSHYVIFATSKSTQKYKNIIANPAVSLLIHDWVTAKKLSLRKNSVSSTPT
                     ADNENSEEQPSRLLNLLQELNQSELSQMSATLSGTASVIEPSSEESEYYEKQLLAANP
                     DANCYIKGDDTVIIKVKILNAKVSDSENRTSFYD"
     gene            complement(<584179..>585477)
                     /gene="VPS4"
                     /locus_tag="KLMA_70279"
                     /db_xref="GeneID:34718032"
     mRNA            complement(<584179..>585477)
                     /gene="VPS4"
                     /locus_tag="KLMA_70279"
                     /product="vacuolar protein sorting-associated protein 4"
                     /transcript_id="XM_022821536.1"
                     /db_xref="GeneID:34718032"
     CDS             complement(584179..585477)
                     /gene="VPS4"
                     /locus_tag="KLMA_70279"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 4"
                     /protein_id="XP_022677888.1"
                     /db_xref="GeneID:34718032"
                     /translation="MSTGDFLTKGIDLIQKAIDLDTATQYEEAYTAYYNGLDYLMLAL
                     KYEKNAKSKDLIRAKFTEYLNRAEQLKEHLETEQQKKQEKPNKSATASGSGGNANTNT
                     EDDTDDKKLRGALSGAILTEKPNVKWEDIAGLEGAKEALKEAVILPVKFPHLFKGKRK
                     PTTGILLYGPPGTGKSYLAKAVATEANSTFFSISSSDLVSKWMGESERLVKQLFAMAR
                     ENKPSIIFIDEVDALTGTRGEGESEASRRIKTELLVQMNGVGNDSSGVLVLGATNIPW
                     QLDSAIRRRFEKRIYIPLPDLAARTKMFELNVGDTPCKLTKEDYRSLGEMTEGYSGSD
                     IAVVVKDALMQPVRKIQMATHFKNVSEDPEQRKLTPCSPGDPEAIEMTWTDITAEELQ
                     EPDLTIKDFLKAIQTSRPTVNDEDLRKQEEFTKDFGQEGN"
     gene            complement(<585842..>587563)
                     /gene="ASN1"
                     /locus_tag="KLMA_70281"
                     /db_xref="GeneID:34718033"
     mRNA            complement(<585842..>587563)
                     /gene="ASN1"
                     /locus_tag="KLMA_70281"
                     /product="asparagine synthetase [glutamine-hydrolyzing] 1"
                     /transcript_id="XM_022821537.1"
                     /db_xref="GeneID:34718033"
     CDS             complement(585842..587563)
                     /gene="ASN1"
                     /locus_tag="KLMA_70281"
                     /codon_start=1
                     /product="asparagine synthetase [glutamine-hydrolyzing] 1"
                     /protein_id="XP_022677889.1"
                     /db_xref="GeneID:34718033"
                     /translation="MCGIFAAFRHPEVQAYKPKALQLSKRIRHRGPDWSGNVVQNSTI
                     LVHERLAIVGLDSGAQPITSEDGNFSLAVNGEIYNHIQLREQFPDYKYKTLSDCEPII
                     PLFEKYDVDAPKYLDGMFAWCLYDAKNDRIIAARDPIGITTLYMGRSSASPKTVWFSS
                     ELKCLTDDCDEIVAFPPGHVYDSETDKLTRYFTPDWLDETRIPTTPVDLKAIRESLEK
                     AVRKRLMAEVPYGVLLSGGLDSSLIASIAARETEKANAELDAAKYDEDTKHLAGVDDQ
                     GHLHAAGWSRLHSFAIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYH
                     LETYDVTTIRASTPMFLLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTE
                     SVKRVKNLHLADCLRANKSTMAWGLEARVPFLDKEFLQLCMNIDPNDKMIKPAEGKIE
                     KYILRKAFDTTDEPDVKPYLPEEILWRQKEQFSDGVGYSWIDGLKDAAENAISDEQFA
                     QPKSEWGDDIPTTKEAYWYRLKFDALFPQKTAASTVMRWIPKADWGCAEDPSGRYAKI
                     HEQHVEK"
     gene            <588806..>590374
                     /gene="NOC4"
                     /locus_tag="KLMA_70282"
                     /db_xref="GeneID:34718034"
     mRNA            <588806..>590374
                     /gene="NOC4"
                     /locus_tag="KLMA_70282"
                     /product="nucleolar complex protein 4"
                     /transcript_id="XM_022821538.1"
                     /db_xref="GeneID:34718034"
     CDS             588806..590374
                     /gene="NOC4"
                     /locus_tag="KLMA_70282"
                     /codon_start=1
                     /product="nucleolar complex protein 4"
                     /protein_id="XP_022677890.1"
                     /db_xref="GeneID:34718034"
                     /translation="MLSKEEVKGIWKAISSGNERRHYNSLVKLVHGYNELLENNGLLE
                     TYEEDFRYVTIALSQIFIKLFERGQLMPHLASNANEKKFFEWCKKVYLNYKAKLLAVI
                     ESLTEENSLSLDCLDSYMKMLHYESIYWTSKPNSPFFPNKTLRSLLSALFKCNYVADI
                     DLKDGQSNNPVFELFVETYYKKNFDIQFYTQSELQTLLPEIQVSDQIKMSKWLKLSNH
                     DLHSAPELEIFVSMPPQAIENDAKFKSMIESNWLYCLNLQDLSTNQYKTVLLVFHKRI
                     IPWFHQPTKLMDFLTDSYDQGGIVSILSLNGLFELMRKFNLEYPNFYSKLYQLLTPEL
                     MHVKYRSRFFRLLDTFLSSTHLSAQLVSSFIKRLARLSISAPPGAIVSIVPFVYNLIR
                     KHPTCMILLHDPEYINCDSSKKQEYKDPFNNEETNPELTNAISSSLWELESLMNHYHP
                     NVATLVKIFKQPFQKLSYNIEDFLDWSYDSLLQAEANRRLKIQPALEFEQFDSLFETN
                     NETSASTFVPLVKW"
     gene            <590644..>592182
                     /gene="PPT1"
                     /locus_tag="KLMA_70283"
                     /db_xref="GeneID:34718035"
     mRNA            <590644..>592182
                     /gene="PPT1"
                     /locus_tag="KLMA_70283"
                     /product="serine/threonine-protein phosphatase T"
                     /transcript_id="XM_022821539.1"
                     /db_xref="GeneID:34718035"
     CDS             590644..592182
                     /gene="PPT1"
                     /locus_tag="KLMA_70283"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase T"
                     /protein_id="XP_022677891.1"
                     /db_xref="GeneID:34718035"
                     /translation="MTEEKQTIDKEKALELKNEGNKLVKEKRYAQATEFYTKAIECDP
                     ENSILYSNRAFTNLKLDNFQSSLNDAKRAIELDNNNLKAYHRRAMSYIGLLEFRKAKK
                     DLAIVLKFKPNELTAKNALSICDKVIQKENFEKAISGGDSSKVDLCETLNISSFDANS
                     DLINYTGKKLEFEQVTSDSGSPAGVRVKNMTQEFISYMVEEIFLKGKYLPKAYVAAII
                     SHANHLFMQENSVVELDNREDPKTRISVCGDTHGQFYDVLNIFKSFGKVGGSNVYLFN
                     GDFVDRGSWSCEVAILFYALKIVYPKHIYLNRGNHETNSMNKVYGFEDECKYKYSQRI
                     FDLFSQSFESLPLATIINGSYLVVHGGLPSDMSATVDDMKKIDRFKQPPREGTFMELL
                     WADPQLQNGFGPSPRGLSNAFGPDITRAFLQKNNLKRIFRSHEVRQGGYEFEHENQLI
                     TVFSAPNYCDTERNLGAIIHVMPGNESEKKSSIDEDLIIETFTASPHPDIKPMAYSNG
                     GLGF"
     gene            complement(<592385..>593137)
                     /gene="RRP15"
                     /locus_tag="KLMA_70284"
                     /db_xref="GeneID:34718036"
     mRNA            complement(<592385..>593137)
                     /gene="RRP15"
                     /locus_tag="KLMA_70284"
                     /product="ribosomal RNA-processing protein 15"
                     /transcript_id="XM_022821541.1"
                     /db_xref="GeneID:34718036"
     CDS             complement(592385..593137)
                     /gene="RRP15"
                     /locus_tag="KLMA_70284"
                     /codon_start=1
                     /product="ribosomal RNA-processing protein 15"
                     /protein_id="XP_022677892.1"
                     /db_xref="GeneID:34718036"
                     /translation="MSVSVSKKRKLNDKSVKVKKVEKAQAQEDAEASSSSEVESDIES
                     GSDASEDDNDELDLDQVSSSDGSDDDEASEEDKVEEEEEDDSFPRKKKSSKSKHDDGS
                     STFSSALTNILSSHLKAYDRKDPIMARNKRVIKQNEADKLEQKAKKAILAEKKKLLNK
                     TRKKEIIPVAAADTNAEEIREVLEKERKLRRIAQKGVVKLFNAILSTQVKTEKEVSES
                     LGDVKNRSERKELITEVSKEKFFDLVKTAGDS"
     gene            <593650..>595716
                     /gene="KAR3"
                     /locus_tag="KLMA_70285"
                     /db_xref="GeneID:34718037"
     mRNA            <593650..>595716
                     /gene="KAR3"
                     /locus_tag="KLMA_70285"
                     /product="kinesin-like protein KAR3"
                     /transcript_id="XM_022821542.1"
                     /db_xref="GeneID:34718037"
     CDS             593650..595716
                     /gene="KAR3"
                     /locus_tag="KLMA_70285"
                     /codon_start=1
                     /product="kinesin-like protein KAR3"
                     /protein_id="XP_022677893.1"
                     /db_xref="GeneID:34718037"
                     /translation="MNESPLTPERANSRDESNIPSPSQTHLNSPKYKPRQSLKLNPDD
                     LEDINKRRSLTPSNENRASTHMTFFYKENVKELKKLEDQLFEKKMKLDTSRTEVNSLK
                     NKVETVTFKLNNLREAKTLKVRQIELKTNELSSLEQDHKLKTEFMKSGFELELKKAEG
                     KYQNELNELESKFKSEIQQVEYEKAQKYKEEKEHLQDHINSINEEISNNDSIVRQGKK
                     DLDMKYAKLKENWMIGFQEEWKNITDSNQSLIEKITKLNQELDENINTNIEQSNARCD
                     VLKKELEELEEKISEKETYSKSIAVQIDTVEEETKQIIQQRDELNKYIVDSKKELLQI
                     NDILIKEETIRRKLHNEIQELRGNIRVYCRIRPPLEREPQDISHIHVASFDNRTGSQA
                     IQINKEGRINKFLFDKVFDTKSSNSDVFREVGQLIQSSLDGYNVCIFAYGQTGSGKTF
                     TMMNNKDGVIPMTLDHIFDWTQLLKERGWEYSFEAQFIEIYNEQIVDLLRTLNPEPGP
                     LKYEIRHDTDAQRTSITNITSIKLETREKVDIVLKTANRMKSTAATSSNERSSRSHSV
                     FTIRIQGNNTVTGERSDGVLNLVDLAGSERIETSHVTGERLRETQNINRSLSCLGDVI
                     YALNGEDIKHIPFRNSKLTYLLQYSLVGDSKTLMFVNVSPSLTHIKETLNSLRFASKV
                     NNTKIN"
     gene            complement(<596039..>597247)
                     /gene="TAZ1"
                     /locus_tag="KLMA_70286"
                     /db_xref="GeneID:34718038"
     mRNA            complement(<596039..>597247)
                     /gene="TAZ1"
                     /locus_tag="KLMA_70286"
                     /product="lysophosphatidylcholine acyltransferase"
                     /transcript_id="XM_022821543.1"
                     /db_xref="GeneID:34718038"
     CDS             complement(596039..597247)
                     /gene="TAZ1"
                     /locus_tag="KLMA_70286"
                     /codon_start=1
                     /product="lysophosphatidylcholine acyltransferase"
                     /protein_id="XP_022677894.1"
                     /db_xref="GeneID:34718038"
                     /translation="MSFPDVLHRGDEFLSEYPWTNPLWKTAAHGTCLLAVGVSKFMLN
                     TFYNVKLSGYEKLEKAIERSKNENRGLMTVMNHMSVVDDPFIWGVFPWKMYTDFDQIR
                     WCLGAHNVCFQNAFLSTFFSLGKVLSTVRFGGGPFQGSIDASIRLLSPDDTLDLEWTP
                     HSEVPTNNNKTNNGPNILNKLETKDGNVVKYVAPVARSRPSWIHVYPEGFVLQLQPPY
                     ENSMRYFRWGITRLILESTKSPIVVPIFSTGFEHIAPESSAGTMIERYLPRNMGAEIN
                     VTVGSAIDDSVIDQYRKEWLELCQKYYDPSNPTDLSWELKYGEEAQNLRSRLAAELRS
                     HVAKIRHEERKLPLEDERFKSPEWWTRYTKTEGASDPDVKFIGQNWAIRRLQKFLKDY
                     DDAETPGKDN"
     gene            <597517..>598374
                     /gene="LOA1"
                     /locus_tag="KLMA_70287"
                     /db_xref="GeneID:34718039"
     mRNA            <597517..>598374
                     /gene="LOA1"
                     /locus_tag="KLMA_70287"
                     /product="vacuolar protein sorting-associated protein 66"
                     /transcript_id="XM_022821544.1"
                     /db_xref="GeneID:34718039"
     CDS             597517..598374
                     /gene="LOA1"
                     /locus_tag="KLMA_70287"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 66"
                     /protein_id="XP_022677895.1"
                     /db_xref="GeneID:34718039"
                     /translation="MEKYSSWRDEGTGIPPFLPERTVPSSNLIQVIAKALQFAVVWVL
                     SVIFTPFIGFDGSYQWRMKSLYSITEDVQVDGVKKRLVSKEKHFPKPGCLYIVNALCP
                     FDALALKELANNKNCNFIVPRDGSLYLIGFKDWYQFAIGGGLWEDGHERLVKINDLET
                     VCSGKVNYLFAEGTTSNGKSVLTFEISPKLLDEILEVCGSKVSCISLKLNSKITTPLK
                     PKSTLKYSLGCISQGVRYKVRISETVSASQANVKKLRTILVGGDEYKLVGKKLDLKSK
                     KKFSEVYYN"
     gene            complement(<598384..>599556)
                     /locus_tag="KLMA_70288"
                     /db_xref="GeneID:34718040"
     mRNA            complement(<598384..>599556)
                     /locus_tag="KLMA_70288"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821545.1"
                     /db_xref="GeneID:34718040"
     CDS             complement(598384..599556)
                     /locus_tag="KLMA_70288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677896.1"
                     /db_xref="GeneID:34718040"
                     /translation="MWILNTLPEQLPAIDSEISVPELEISRLQCNSLSESQSYTQIID
                     CNTQYINQLLHYSSEHTNPVISEQICIASINAAYGYEQLAQQIRESAYSDDSNPVDSQ
                     QWQSSTNYNKRAIGLLQFASSVPMISIKLLTMCNQYASLYRLNQQLSMVLLTISKMRT
                     RLYPAGKDKYSTLLSFQDSDLQSLSAVSMPYAKLAIGCSGVCDSIQHSIESVHLKTQV
                     LAMKRFLDCLSLALLSIFKYDKENDTDAALDMINTAIANIRPLLSKDQVNLLQNNKSL
                     EKILVKTKFWKESIKDKLKNKKWVHSKKRDKDSNSSYLHPFILEVIADFLLPLIMVLK
                     VRYDTTNEFIFDNVGSNSSHNWVLPQGKAPEVKGVRFFFDGSTLTVDQQAESENLR"
     gene            <600869..>602224
                     /gene="MEP3"
                     /locus_tag="KLMA_70289"
                     /db_xref="GeneID:34718041"
     mRNA            <600869..>602224
                     /gene="MEP3"
                     /locus_tag="KLMA_70289"
                     /product="ammonium transporter MEP3"
                     /transcript_id="XM_022821546.1"
                     /db_xref="GeneID:34718041"
     CDS             600869..602224
                     /gene="MEP3"
                     /locus_tag="KLMA_70289"
                     /codon_start=1
                     /product="ammonium transporter MEP3"
                     /protein_id="XP_022677897.1"
                     /db_xref="GeneID:34718041"
                     /translation="MVSLWTETYEGATVAFLIIGCALVFIMVPGLGFLYSGLARRKSA
                     LALIWAVIMATLVGIVQWYFWGYSLAFSKTAINHKFIGDLKSFGFRNVYGYADPKNPT
                     SYPELAFACFQGLFMCVTLSIVAGATAERGRLLPHMVFLFCFATLVYCPVTFWVWCSD
                     GWAYRWGVLDWAGGGPVEILSAVGGFVYSAFLGKRHENQLLNFRPHNVSMVTLGTSLL
                     WFGWLGFNACTSLDPNMKSVFALMNTNLSAATGGMTWCLLDYRLEKKWSTVGLCSGII
                     CGLVAATPSSGCITFYGSVIQGITAGVVCNFSTKIKYYLKVDDAMDILAEHGVAGIVG
                     LIFNGFFAADWIIGSDGVTEHDGGWLTQNWKQMYKQIAYVGAVCGYGAVVTAIICFIL
                     NKIPGLHLRTTEEAEDRGMDEDQIGEFAYDYVEVRRDYYSWGVPNDSDSGNEKTTGNQ
                     N"
     gene            complement(<605471..>607267)
                     /gene="RRP9"
                     /locus_tag="KLMA_70290"
                     /db_xref="GeneID:34718042"
     mRNA            complement(<605471..>607267)
                     /gene="RRP9"
                     /locus_tag="KLMA_70290"
                     /product="ribosomal RNA-processing protein 9"
                     /transcript_id="XM_022821547.1"
                     /db_xref="GeneID:34718042"
     CDS             complement(605471..607267)
                     /gene="RRP9"
                     /locus_tag="KLMA_70290"
                     /codon_start=1
                     /product="ribosomal RNA-processing protein 9"
                     /protein_id="XP_022677898.1"
                     /db_xref="GeneID:34718042"
                     /translation="MSIEYRKRQRPTEIIESTMAKSSAIENSKKRKRDVVEEVDEEIT
                     DPSSEEGESEDISNDEADEVEENLESDEEFEGENPADKRRRLAKQYLENLKAEAKDIG
                     EALSSETDKQDGSTVIDDYNNFDARDLDRDIIASRLKQDVAEQQGRVYRWVSKKLLIN
                     ESKCTFTRVGENNLTGLSCYQPPVNKFSHNETQNKSKGKIFAYTVSKDLQLTKYDVTD
                     FNARPKKVKYVKGGKKYIPEGKFEFENVTEGHYDEILTVAASPDGKYVVTGGRDRKLI
                     IWSTESLAPVKVIPTKDRRGEILALAFKKNSDQLFAACADYKIRTYAVNQFSQLEILY
                     GHQDLVIDISALNMERCVTVGSRDRTAMLWKIADESRLTFRGGDDPERLRKKWLKNQE
                     AESENNADAAQGDINLSNGSEKKEKPPQFYGEGSIDCISMIDDSHFVTGSDNGNICLW
                     SIAKKKPLFTERVAHGIVPLTADTAISGEKNEEVRAAQLQDGTIAQPYWITSIYAVPY
                     SDIFISGSWNGALKVWKISDNLRSFELLGELPNCKGVVTKIQSVESGKTGRETFRILA
                     SVSKEHRLGRWINKVPGARNGIFSAVIEQTGF"
     gene            complement(<607564..>610413)
                     /gene="CTF4"
                     /locus_tag="KLMA_70291"
                     /db_xref="GeneID:34718043"
     mRNA            complement(<607564..>610413)
                     /gene="CTF4"
                     /locus_tag="KLMA_70291"
                     /product="DNA polymerase alpha-binding protein"
                     /transcript_id="XM_022821548.1"
                     /db_xref="GeneID:34718043"
     CDS             complement(607564..610413)
                     /gene="CTF4"
                     /locus_tag="KLMA_70291"
                     /codon_start=1
                     /product="DNA polymerase alpha-binding protein"
                     /protein_id="XP_022677899.1"
                     /db_xref="GeneID:34718043"
                     /translation="MGIKVTENRVFVAGGNTRAYLSNDNTRLFTLNKNALVKVQNLDD
                     LEKEPDIIDVCEEPSTLALSETNPNFIYVVSKKGDLYWYDVKEYTSGLCFRSSLPLRD
                     LSLIHDDKVCVVGGDDLEMTLVALEKDKDNIKVTLDEQLVSLSYNKQNNILAVSLSNG
                     NIDFYSLSSTIPNKIHTLTDQLPKIFYDDDKAEDSTSGEGQDSIPIDGLDSLLCDDNR
                     TCTRISWSNKGDCYAVPAKDGTIKLFNLSDHSLTTTFKPSVAVNNWDALIVDQLHSNT
                     ITAVGNINKTSHLFIWNISTGVQTSHETTTYSVTSLCWRINSSMNTLSLIAGTWSGDI
                     ITFNDIAKVKESPGSSNLNRTLFAESDDEDLFEESRVGEFSKNTSTDPDLTSKFQNDG
                     SRKESNKIDKRVHEDEGSEDINSDNLFTDAEEEEDVGEGTHRKRTFNYEDENDFIEDD
                     DGEAALYKKARNHYDSVPSLVTTNSRRSNYQTVQPQFQYRPFSTGATPFGNSDKRYLT
                     INQIGHVWTTRNESGSNSITVSFFDVSKFREYHFDDLFKYDLCSLTDEGILLGQSKLG
                     QIQYRPHGVSGETWTKKIPLLPKERITSIACTPKRIIVGTSFGYLRTFNEFGLPLAIE
                     KVSPIVAVTAYEYRIFTIHYSQYHGISYSMFQQHPQTGDKYFQRECPLPITLPQQVQG
                     QTEDIDKEFLKFEDIYHAFNPLGIKSLFFSSFGDPCIFANDNVLLVLSRWRSGNEARW
                     IPIVDTNLELWKMSGGKNVKDVHVWPLGLNFDTFSFLLLKGKNCWPDIPMTVPTEMEV
                     RMPSISKTDITKKKTEEDDDEYENDTKTDGINDQSEVEIPLDLAAEEEFLRSSVLSRL
                     LKDTMDNEGEIYGNEADLLQHLISSHDKSLLRLLAYVCSEQDVNKAVSIVYELKQDKA
                     LAAARKIAERAEILPLVRKINAIIEAKFEADFNNL"
     gene            <610828..>611559
                     /locus_tag="KLMA_70292"
                     /db_xref="GeneID:34718044"
     mRNA            <610828..>611559
                     /locus_tag="KLMA_70292"
                     /product="conserved oligomeric Golgi complex subunit 2"
                     /transcript_id="XM_022821549.1"
                     /db_xref="GeneID:34718044"
     CDS             610828..611559
                     /locus_tag="KLMA_70292"
                     /codon_start=1
                     /product="conserved oligomeric Golgi complex subunit 2"
                     /protein_id="XP_022677900.1"
                     /db_xref="GeneID:34718044"
                     /translation="MDESSEVLDLPVTKELSRELISSVVRENGGLDIDKLLLDNNFQY
                     VSLDELSYEVSALKLSMEQSLLDEINESYPEYMEICSKFETKENNEVLDKLKQVLHDL
                     QQFERKLGHLSETTVSETREKTVTVLSYMKSLDNMLDQLDDINKLSESLRVCQQLLSS
                     LQSMSQLQMNDEISFEIAKQLSLILIRCDYRFRHLEDNDSPLVMRMRNDFKSILEASN
                     SLSKPILERRIISKKNGNGDQKPVA"
     gene            <614875..>616509
                     /gene="NUP57"
                     /locus_tag="KLMA_70293"
                     /db_xref="GeneID:34718045"
     mRNA            <614875..>616509
                     /gene="NUP57"
                     /locus_tag="KLMA_70293"
                     /product="nucleoporin NUP57"
                     /transcript_id="XM_022821550.1"
                     /db_xref="GeneID:34718045"
     CDS             614875..616509
                     /gene="NUP57"
                     /locus_tag="KLMA_70293"
                     /codon_start=1
                     /product="nucleoporin NUP57"
                     /protein_id="XP_022677901.1"
                     /db_xref="GeneID:34718045"
                     /translation="MNNGGLFGNKPAGTNTGFQFGGQQQQQQQQQPAGGNTGLFGQNT
                     NSLNNSGSTGNGLFGNNQQQKPATGGLFGNNNNATGTTTGATGGGLFGNQQTNTTTGG
                     GLFGAKPSGGLFGNTQQQQQQQQPSTINTGGGLFGNNNNNSNTTTGGLFGNNSNANGA
                     SGTSGGLFGGNKGPGATSGGLFGNANPNASTTTSNAGGLFGSNQLGQGTNSLFGQPQG
                     QQQQQQQQQQGTSLFGSSASNTMQPSFAWSNNQQQQQPQQQLPSVQQPQQQLQIQQQQ
                     QQQQMSNYPQQIQEQILKCKESWLPTEQRSKLKTFVYNKCTETEAMLYNKPVSISQED
                     WDQALMSKPANNTIPIRLLGFQDLNERNQLQKQHVAQARVLLGQILEKLNQVNTKHDL
                     DTQSRIAKAVSRNTVIENRILKLASQLAVLKSKNLPLSLHEEEMMSKFDKLLQESNDP
                     AGLGKNNELWARLSVLKERAKNISEQLDSTLVVISENGGSSDNSKKNNQDEELEDRVN
                     KIAEILSNQQRGLCFLNDVLEKDLKLVDEVQSKLKK"
     gene            complement(<616553..>617332)
                     /locus_tag="KLMA_70294"
                     /db_xref="GeneID:34718046"
     mRNA            complement(<616553..>617332)
                     /locus_tag="KLMA_70294"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821552.1"
                     /db_xref="GeneID:34718046"
     CDS             complement(616553..617332)
                     /locus_tag="KLMA_70294"
                     /note="Protein MSS18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677902.1"
                     /db_xref="GeneID:34718046"
                     /translation="MIGKQLNEVIRFNTVFCRFFLRFPGGKPQTAAYQAKAIDRLLVD
                     LCRYGGVLYAQGNEKFMKPTKLPLKVDLAICSPEKVKLVRLISQMRGYVYDESVEPDY
                     SKLVEPVSLEPKRELGETLDSLRKLRESKRHGPVGSTVSIMVPQSPFVFLKKPLKYFR
                     TIGGDTCDITRNNLMHWTWAAGQERYPLENEEYAKIHPFCTHFTRIPSQKPAIQIIPS
                     IITNLSEMPNSLNDWVRRTDVELSDSEKDKLSTMLHGFEGL"
     gene            complement(<617523..>617672)
                     /locus_tag="KLMA_70295"
                     /db_xref="GeneID:34718047"
     mRNA            complement(<617523..>617672)
                     /locus_tag="KLMA_70295"
                     /product="mitochondrial import receptor subunit TOM5"
                     /transcript_id="XM_022821553.1"
                     /db_xref="GeneID:34718047"
     CDS             complement(617523..617672)
                     /locus_tag="KLMA_70295"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit TOM5"
                     /protein_id="XP_022677903.1"
                     /db_xref="GeneID:34718047"
                     /translation="MFGLPQQQSEEEKKLHQQQSNQTLVNAAYAAAALWLSPIIWNFV
                     KKQFK"
     gene            <618077..>619174
                     /gene="IWS1"
                     /locus_tag="KLMA_70296"
                     /db_xref="GeneID:34718048"
     mRNA            <618077..>619174
                     /gene="IWS1"
                     /locus_tag="KLMA_70296"
                     /product="transcription factor IWS1"
                     /transcript_id="XM_022821554.1"
                     /db_xref="GeneID:34718048"
     CDS             618077..619174
                     /gene="IWS1"
                     /locus_tag="KLMA_70296"
                     /codon_start=1
                     /product="transcription factor IWS1"
                     /protein_id="XP_022677904.1"
                     /db_xref="GeneID:34718048"
                     /translation="MSDVERDLSSGVENGGEGEGLSNVVPQERTRKHIEATADSESDE
                     ELDPALGNGLAADDDEEGAGGAGVYGVVDEATRKRQELEARMDSILHKPKKKRTRQDE
                     DDLEQMQDERILRLKDEMNIAAQKDIDTLNERLESGNTRLVAMEKVKLLPKVVKVLSK
                     VNLADTILDNNLLQSVRIWLEPLPDGSLPAFEIQKSLFSALDNLPIKTEHLKESGLGR
                     VVIFYTKSKRVEQKLARLADKLIAEWTRPIIGASDNYRDKRVLKLEFDVEKHRKKTIL
                     DTAKSKKRKSKRKEVDEEKYKSAYEQAAARRNRAAAPAQTTTDYKYAPISNIDATGKN
                     IGVGSSVDSSDLYKRLNSRLSGNKNKKTNTR"
     gene            complement(<619459..>620331)
                     /gene="rps12"
                     /locus_tag="KLMA_70297"
                     /db_xref="GeneID:34718049"
     mRNA            complement(join(<619459..619831,620267..>620331))
                     /gene="rps12"
                     /locus_tag="KLMA_70297"
                     /product="40S ribosomal protein S23"
                     /transcript_id="XM_022821555.1"
                     /db_xref="GeneID:34718049"
     CDS             complement(join(619459..619831,620267..620331))
                     /gene="rps12"
                     /locus_tag="KLMA_70297"
                     /codon_start=1
                     /product="40S ribosomal protein S23"
                     /protein_id="XP_022677905.1"
                     /db_xref="GeneID:34718049"
                     /translation="MGKGKPRGLNSARKLRVHRRNNRWAETTYKKRLLGTAFKSSPFG
                     GSSHAKGIVLEKIGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEV
                     LLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS"
     gene            <621125..>622546
                     /locus_tag="KLMA_70298"
                     /db_xref="GeneID:34718050"
     mRNA            <621125..>622546
                     /locus_tag="KLMA_70298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821556.1"
                     /db_xref="GeneID:34718050"
     CDS             621125..622546
                     /locus_tag="KLMA_70298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677906.1"
                     /db_xref="GeneID:34718050"
                     /translation="MSETDQELSKVLVAQFLKKHGYLDSLASYLKESGVSLRAANESI
                     YEDLESIVKDRIRFNEHAIAEQMKTTSLNSDLDLVNIEKYGIPAWNHKLSWDEVIGSY
                     SKTRSLIIKTRFLTNGVIGNSTVGKEFIVSGIKEEDSVTIMHSMKKSGIVKYFGSISD
                     SLYYTGTIDGKVTVSKINEECSWSFDLPVRALLALELIKLENDKILCFYCTMNNTLNV
                     HLFDLSTSSLTKIDEFKLLSACTTFQLAISSDGCPIIFLTRQDFTQVMILKFQNDKIK
                     HVSNIALNTAQFSTHSFNISDMVILSFDSTEGKTNLGVKKITPSSVLAVATSHTPYMR
                     IIVTKIPSLDTKGPDSTSQLKTQPVSEELNILDDYSSKDAVIPSTARQPDIITHYDMI
                     LINIATDIPQDSYTQPILKVSYPLGGLIVGADAGLYAVDLQKSETWQLTYRTGQRVKS
                     MDCYKDFISVSFADREWVIWKLK"
     gene            <623038..>623631
                     /gene="NAT3"
                     /locus_tag="KLMA_70299"
                     /db_xref="GeneID:34718051"
     mRNA            <623038..>623631
                     /gene="NAT3"
                     /locus_tag="KLMA_70299"
                     /product="N-terminal acetyltransferase B complex catalytic
                     subunit NAT3"
                     /transcript_id="XM_022821557.1"
                     /db_xref="GeneID:34718051"
     CDS             623038..623631
                     /gene="NAT3"
                     /locus_tag="KLMA_70299"
                     /codon_start=1
                     /product="N-terminal acetyltransferase B complex catalytic
                     subunit NAT3"
                     /protein_id="XP_022677907.1"
                     /db_xref="GeneID:34718051"
                     /translation="MTSIQPFEATDFFSLNAVNLDTFTENFPVEFYLEYLILWPSLMF
                     KSVELTSPAPGSNGNEISGYMMGKTEGKGQDWHAHITAVTISPRFRRISLASMLCDTL
                     KTITDNPPHNVNFIDLFVKCNNQLAICLYEKLGYSVFRRVVGYYNSHTDPIPTRATKP
                     NDLKDAFDMRHGMERDHGKSIRADGRKHNCLPQDVRF"
     gene            complement(<623746..>624729)
                     /gene="SCD6"
                     /locus_tag="KLMA_70300"
                     /db_xref="GeneID:34718052"
     mRNA            complement(<623746..>624729)
                     /gene="SCD6"
                     /locus_tag="KLMA_70300"
                     /product="protein SCD6"
                     /transcript_id="XM_022821558.1"
                     /db_xref="GeneID:34718052"
     CDS             complement(623746..624729)
                     /gene="SCD6"
                     /locus_tag="KLMA_70300"
                     /codon_start=1
                     /product="protein SCD6"
                     /protein_id="XP_022677908.1"
                     /db_xref="GeneID:34718052"
                     /translation="MSQYIGKTIALISNTDNRYVGLLESIDSDKGVVTLKQVRCFGTE
                     GRKGWGPQEIYPNPNIYDSVSFNGNDVKDLNILDIPLEKVQPVLPPQLGGQPAVVPTD
                     ANGNNVPAAVAGYGVYAPEKGQQQTQQAPPQMPPQAQQQQQHQHQHQEHAAEKKDKAA
                     KKSQSNPPAAAAAAAASPASSPAVQTQSRKASVVPDSEFDFESNNAKFKNAEAPLEDK
                     LEQEKQANKTDEVFYDKKSSFFDSISSSAVENAGSSKWEEERQVNLDTFGQARLRNSG
                     RGGFRGRGGYRGNRGGNRGGNRGNYRGGNRNNSNGNFSVSSPPPPQSQIEF"
     gene            <625642..>626721
                     /gene="ANT1"
                     /locus_tag="KLMA_70301"
                     /db_xref="GeneID:34718053"
     mRNA            <625642..>626721
                     /gene="ANT1"
                     /locus_tag="KLMA_70301"
                     /product="peroxisomal adenine nucleotide transporter 1"
                     /transcript_id="XM_022821559.1"
                     /db_xref="GeneID:34718053"
     CDS             625642..626721
                     /gene="ANT1"
                     /locus_tag="KLMA_70301"
                     /codon_start=1
                     /product="peroxisomal adenine nucleotide transporter 1"
                     /protein_id="XP_022677909.1"
                     /db_xref="GeneID:34718053"
                     /translation="MASLENAFVGAVSSGLANLAVYPLDLAKTVIQTQLKQGNLASET
                     PEGRVTDGYGSDSESQAKETKKKGVREIQPRPESPKDVRLKSLEERYRNTLDVIVKVY
                     KTEGVQGLYRGLGASLLGSFIQSFSYFFWYTIVRRQYFKIKKVKGQAAKFSTAEELLL
                     SMVAAATSQVFTNPVNTVSTKQQTRRGLGEDNSFLAVAKDVFEENGITGFWKGLKVSL
                     VLTINPSITYASAEKLKDLIYNVEWNSKELNDSSLQLKPSQNFLIGVLSKIISTFLTH
                     PLIVAKASLQRNASQFTSFQDVLAYLYRHEGFLSLWKGILPQLLKGVIVQGLLFMFKG
                     ELAKNIKKLLFMLQVYRKRRLAKTY"
     gene            complement(<627127..>628413)
                     /gene="YLH47"
                     /locus_tag="KLMA_70302"
                     /db_xref="GeneID:34718054"
     mRNA            complement(<627127..>628413)
                     /gene="YLH47"
                     /locus_tag="KLMA_70302"
                     /product="LETM1 domain-containing protein YLH47"
                     /transcript_id="XM_022821560.1"
                     /db_xref="GeneID:34718054"
     CDS             complement(627127..628413)
                     /gene="YLH47"
                     /locus_tag="KLMA_70302"
                     /codon_start=1
                     /product="LETM1 domain-containing protein YLH47"
                     /protein_id="XP_022677910.1"
                     /db_xref="GeneID:34718054"
                     /translation="MRLYSEGKNAEEKVQQAGQQQQQQKSATVTAVQKPAQTTLPAKK
                     EAEPKLSLWGKVKHEAQHYWDGTKLLGLEVKIAMRLVMKMSAGYELSRREKIQLKRTT
                     QDMIRLVPFSAFVIVPFAELLLPIALKLFPNLLPSTYESKKDKQTKLESLRKTRSVMS
                     KIMKENKSHFKPNNITEEQKLVFNNFYKHVRETGEPESREQLIQVARLFTDDTVLDNI
                     TRPHLVAIAKYINLQPFGTDVMLRYRIRYKMLELKKDDLAIYYEGVESLDAIELRTAC
                     ASRGIRNLNVEESVLRDNLRIWLNMRLKDKIPSTLLIMATAYTYGDIGSKKTLYDALC
                     DVLSGIPDELYHEVKVNVVEESSATNKSKMAQLKEQMEIMKEEEQQEKDAVVRVKDEL
                     SLDEVDAKTVNQSSEAKKESDARAEQEEAKEKKKDI"
     gene            complement(<629478..>630260)
                     /locus_tag="KLMA_70303"
                     /db_xref="GeneID:34718055"
     mRNA            complement(<629478..>630260)
                     /locus_tag="KLMA_70303"
                     /product="probable
                     6-phosphofructo-2-kinase/fructose-2,6-biphosphatase"
                     /transcript_id="XM_022821561.1"
                     /db_xref="GeneID:34718055"
     CDS             complement(629478..630260)
                     /locus_tag="KLMA_70303"
                     /codon_start=1
                     /product="probable
                     6-phosphofructo-2-kinase/fructose-2,6-biphosphatase"
                     /protein_id="XP_022677911.1"
                     /db_xref="GeneID:34718055"
                     /translation="MSIQNHLSQGTKTVIVMVGLPARGKSTIAEQICRCDPKHSRIFN
                     AGQKRRQLERAGTDASLELKEQIFDMADPGCVETRDEIAMRTLVELLDWLQESDNHKI
                     GIFDATNSTLKRRKLILSTLEERATTMPLNFVFLEVIVDSKDILEEHLYWKVRHSDDY
                     KHLSDKDWCLSDFQSRMRQYEAVYETIDDQEISAYQKSMERPFSISILKVRNRFDQCF
                     FYGEEAPAFIHYMLFAWRRRRFLETRRHLATLRDPREMIVRV"
     gene            complement(<631034..>635416)
                     /gene="SPT6"
                     /locus_tag="KLMA_70304"
                     /db_xref="GeneID:34718056"
     mRNA            complement(<631034..>635416)
                     /gene="SPT6"
                     /locus_tag="KLMA_70304"
                     /product="transcription elongation factor SPT6"
                     /transcript_id="XM_022821563.1"
                     /db_xref="GeneID:34718056"
     CDS             complement(631034..635416)
                     /gene="SPT6"
                     /locus_tag="KLMA_70304"
                     /codon_start=1
                     /product="transcription elongation factor SPT6"
                     /protein_id="XP_022677912.1"
                     /db_xref="GeneID:34718056"
                     /translation="MSDKEDGHATGVELKAEQRAEEPVVEDDVNGQGAPSDEEEGDDV
                     FDSSEEDDDLDNDEEEAQKVREGFIVDDDDEDEDEDGDGVESGVKKKRRKRRAREEEN
                     DALDEDDLDLLMENAGYKRPSESEASKQRGKLKRLKRVGEEGEESGSVEPESGHASSN
                     KLDDFFSEDDEEDEGMEDDVSRRASSRKKVDKEVTLADDMDDFIEEDEFSDEDEEARK
                     QRIAEKKRMKEQRLVQPAQITGLSPDKVDEMFEVFGDGHDYDWALELENEEELDRVDE
                     SSENEQGDDDEFATEAKKKKKLTLQDIYDLQDLKKNLLTEEDMQIRKADIPERYQELR
                     TGLKNYGKLSPEDIELEKNWISDKVAVDKNFDADYDTTEFKDAIGNAINFIQQENLEV
                     SFIYAYRRNYISSRNKDGFVLIEDDLWDIVFYDIEFHSIIYKRDYVKTFYQKLELKDP
                     IVDEYFSNQTMTELNSLQDIYDYVEFKYAQDINDVLLSAQQDAASKKHLKNSSYEKFK
                     TSALYQAVNDIGITAEQVGENISAEHQLHPVVDHPSLKPSDSVAQILEGPEAKDLQIF
                     SQNPKLALETIEKYYALELSKNPKVRQKIRDDFYKYYIVDVALTSKGRQEIQRGSPYE
                     DIKYAIGRTPAHFRSEPDVFLRMLEAESLHLLNIQIHVSSQDQYTNHLFQTSLETSNT
                     SEIAVEWNAFRRRAFDSALNKVFSDVSQEIKDELKKTCQRLVTKSVRHQFMFKLDQAP
                     FIPNPKDPKIPRVLTITCGQGKFGSDAIIAVYLNRKTEYVRDYKIVENPFDRKEPELF
                     ENALDEIIQHCQPNVIGINGPNPSTQRLYKKIQEVVQKKQIVDNRGFNVPVIYVEDEI
                     AVRYQSSQRAAQEFPSKPTLVKYCIALGRYIHSPLLEYANLSEEELLSLSIHNHQSLL
                     PRDLFLQALETSFVDIVNLVGIEVNKATDNPYYAKALRYIAGFGKRKAADFLESLQRL
                     NEPLLARQQLITHDILTKTIFMNSAAFLYISWNEKNQRYEDLEHDQLDGTRIHPEDYH
                     LATKVAADALEFDPDAIAEKEEQGTMSEFIELLREDPDRRSKLESLNLESYAEELEKN
                     TGQRKLNNLNTIVLELLDGFEELRNDFHPLHGDEVFKSLTGESEKTFFKGCIIPVRVE
                     RFRHNDIYGVTNSGVECIVNAQRHLGAQLKRPAEEVYEIGKTYPAKVIYIDYENISCE
                     VSLLEHDIRRQYVPIHYSKDPSIWNVEQEAKDQEVEKRLALEEARAKRTHRVINHPYY
                     GNFTGPQAEDYLRSRERGDFVIRQSSRGDDHLAITWKLDKDLFQHVDILEKDKENPLA
                     LGKTLIVEDQKYHDLDQIIVEYLQNKVRLLNEITSNEKFKKGTKKEVIKFIEDYSKVN
                     PNRSVYYFSFNYEHPGWFYLMFKINAQSQLYVWNVKLTHTGFFLVNYNYPTVIQLCNG
                     FKTLLKSSSRAKTQDNNTGGYYGY"
     gene            complement(<636035..>637087)
                     /gene="CTR1"
                     /locus_tag="KLMA_70305"
                     /db_xref="GeneID:34718057"
     mRNA            complement(<636035..>637087)
                     /gene="CTR1"
                     /locus_tag="KLMA_70305"
                     /product="copper transport protein CTR1"
                     /transcript_id="XM_022821564.1"
                     /db_xref="GeneID:34718057"
     CDS             complement(636035..637087)
                     /gene="CTR1"
                     /locus_tag="KLMA_70305"
                     /codon_start=1
                     /product="copper transport protein CTR1"
                     /protein_id="XP_022677913.1"
                     /db_xref="GeneID:34718057"
                     /translation="MHAGDSSVTATMSMAMSSASATGMGGMSGMSGMSGMSMSGTATS
                     AMAMSMSSSATASATGMSGMSGMSGMSGMGGMSGMSSGDSMPGMNSYLTRKYMNYPVL
                     FKHLNASNRGQAFGIFVLIVAVAFVYKALLFLSWYLELEWFKRSTTPEDQDVDEATGK
                     KIAYTVQDLELQKQFLPTSFSKFMFNVFAPNWIDFLHDLIRLLITFASTMFIYMLMLV
                     AMTYVLTYIFAVILGLSLAEIFFNRVKINLLKARELKKEWERRFKLCQCAPAPNAGSS
                     YEDDDGQSSTTSKATLDGTEKNRNSTSKAPKVGCCCGSDEDPQDEAERNIRSIATQKE
                     QAGNMNVDLLPADNVI"
     gene            complement(<637616..>638665)
                     /gene="DAM1"
                     /locus_tag="KLMA_70306"
                     /db_xref="GeneID:34718058"
     mRNA            complement(<637616..>638665)
                     /gene="DAM1"
                     /locus_tag="KLMA_70306"
                     /product="DASH complex subunit DAM1"
                     /transcript_id="XM_022821565.1"
                     /db_xref="GeneID:34718058"
     CDS             complement(637616..638665)
                     /gene="DAM1"
                     /locus_tag="KLMA_70306"
                     /codon_start=1
                     /product="DASH complex subunit DAM1"
                     /protein_id="XP_022677914.1"
                     /db_xref="GeneID:34718058"
                     /translation="MSHRPNTPQRDRPTEYRLSLSSNPSSRRSSLGTSQRDQQASNQT
                     MIDKYVFPQLRELSDSIVTLDSNMTHMNFIHESITDLNESLSALLYGLMCNSWCVDFP
                     KISHDTAHELKLVQKLEELKQEKLRLLAKLKPESVSSKSAVPSSIQSISKRGSQLPTS
                     SLNTNRNTNTMMLKNNEDGRPTNQKGAHDENDNNNDDDDDDNTAASFVSNPTTFRSQI
                     PNPTSTTSSSVPHRPMFNEKPNQTSSRIRRQSILHQIRNSTGPSINNAASTNPNSNTQ
                     RKRSLAVSAKRIPSQAGPSASAIISTNNNTKSNTENNQKNGISISGPGNRFRTPRPRQ
                     RTYQSKDLSSRPPFR"
     gene            complement(<639145..>640251)
                     /gene="SHY1"
                     /locus_tag="KLMA_70307"
                     /db_xref="GeneID:34718059"
     mRNA            complement(<639145..>640251)
                     /gene="SHY1"
                     /locus_tag="KLMA_70307"
                     /product="cytochrome oxidase assembly protein SHY1"
                     /transcript_id="XM_022821566.1"
                     /db_xref="GeneID:34718059"
     CDS             complement(639145..640251)
                     /gene="SHY1"
                     /locus_tag="KLMA_70307"
                     /codon_start=1
                     /product="cytochrome oxidase assembly protein SHY1"
                     /protein_id="XP_022677915.1"
                     /db_xref="GeneID:34718059"
                     /translation="MFRLITPKPSTFLRVRPVKRLYSTVKTSTVDWKPIKTKKTPYEG
                     YQKKESTFTRNIFLGLMIAMPVISFYLGTWQLRRLKWKTNLIASCEDKLTYDPIPLPK
                     HFTPDMCEDWEYRKCTVTGRFLHDEEIFVGPRVRKGTKGYILYTPFIRKDTGERILIE
                     RGWIAEEKLVPSSRTLRHLSLPEGDNVTVTVLVRAAKDLTSLQWEKEDRDTRLWQVLD
                     IKDMTAATNTAPIHFQALYDLKDHHWEEEDNTAESTTADDNHSSWKFWSKKKNNSDSK
                     TEKLETKQTTEHKLDDDSIEFDEFQFAKAGVPIGKIPKIDLKNNHLQYLVTWYGLSLL
                     SSIFLVIALRRGRGSAMSQEQIKRHKLKHAKRFM"
     gene            complement(<640681..>641565)
                     /gene="MRPS5"
                     /locus_tag="KLMA_70308"
                     /db_xref="GeneID:34718060"
     mRNA            complement(<640681..>641565)
                     /gene="MRPS5"
                     /locus_tag="KLMA_70308"
                     /product="37S ribosomal protein S5"
                     /transcript_id="XM_022821567.1"
                     /db_xref="GeneID:34718060"
     CDS             complement(640681..641565)
                     /gene="MRPS5"
                     /locus_tag="KLMA_70308"
                     /codon_start=1
                     /product="37S ribosomal protein S5"
                     /protein_id="XP_022677916.1"
                     /db_xref="GeneID:34718060"
                     /translation="MFVRCFSSTARTLQQDLLKKYYSPELLKSISIAEKVIPENVEFK
                     PQTNVEFSPPYLDNFATLHPYWDYKPNSPHLHSGSSSVFVQQLEKHPDLTPPVGSYTQ
                     TEGRSEVQNIANGIQLQTGFDAQHISRKLVMKPLILKMVSNQTAKGKIPSFYSLVVVG
                     DKNGMVGIGEGKSREDMAESIKKAHWDAVRNLKEVPRFENRTIFGDIDYRYHGVKLFL
                     RAAKPGSGLRVNHVIYEICECAGIKDLSAKVYKSRNIMNIAKGTLEAITKSQKSLDEI
                     ALGRGKKIVDVKKIYYSA"
     gene            complement(<643750..>644916)
                     /locus_tag="KLMA_70309"
                     /db_xref="GeneID:34718061"
     mRNA            complement(<643750..>644916)
                     /locus_tag="KLMA_70309"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821568.1"
                     /db_xref="GeneID:34718061"
     CDS             complement(643750..644916)
                     /locus_tag="KLMA_70309"
                     /note="HMG-box super family[cl00082]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677917.1"
                     /db_xref="GeneID:34718061"
                     /translation="MKRTRLPPISQLIDQLNDAESDNPNESEVNSSTMSHGHGIAGEE
                     SSASTQSYHYALPLSGRPRIGSVSDVVASQHQQQQQQQQKHIESLQNMGFSFTSPIGP
                     SMNRPLYNLGIMPGAQHPSDTTTYYVPTQGGPYTLSPQSSMGPSLSANIGGYAPTITT
                     ASTSAGSSSGMVKQSDEQQQQQQQQQHFQVVNAGSVSPSAPIKREDEHVHYCTCQDSQ
                     LATHPQTQPQQQHIPRPRNAFILFRQHWHRQIFNQEKEKINADTKGAASKLGSFRANS
                     QASRDIGQRWRSLSDSERQYWLDLAKQEKECHKRKYPDYTYVPTRKSKRNSHSSKNAT
                     TESTSYSSASNLHKQTHCPSCNRPKIQNQNQNQNQNQIQNQILDQNIDQTHNQS"
     gene            <649151..>651490
                     /gene="AFG3"
                     /locus_tag="KLMA_70310"
                     /db_xref="GeneID:34718062"
     mRNA            <649151..>651490
                     /gene="AFG3"
                     /locus_tag="KLMA_70310"
                     /product="mitochondrial respiratory chain complexes
                     assembly protein AFG3"
                     /transcript_id="XM_022821569.1"
                     /db_xref="GeneID:34718062"
     CDS             649151..651490
                     /gene="AFG3"
                     /locus_tag="KLMA_70310"
                     /codon_start=1
                     /product="mitochondrial respiratory chain complexes
                     assembly protein AFG3"
                     /protein_id="XP_022677918.1"
                     /db_xref="GeneID:34718062"
                     /translation="MLSRNIAARGPFTSMNTARRFTVSKFSSSLASVSHARSTDLRML
                     RIPSNYISTGFTVRQFSTNTHLGFRQSFASFDKDPKKDNEDQNKNKKDNNKGDEKDQE
                     FKNISDYFKSKEFFRSLYLTVGLTFIFHVLTTPSSQPLDNELLSFQDFKTKYLEKGLV
                     KRIYIVNKYLVEAELLPEATQHLGMGNGFFSVPTTNPVIAFTIGSVDVFEEQMDQIQD
                     KLNIPEQDRIPITYAEKVSPLQYIVPFIPTFLLLGGLLYLTSRRMGGAGGGPGGDMGG
                     MFGVGKSKAKLFNKETDIKVKFKDVAGCNEAKSEIMEFVHFLQKPEKYKKLGAQIPRG
                     AILSGPPGTGKTLLAKATAGEAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKLAP
                     AIIFVDEIDAIGKERGKGGAMGGANDEREATLNQLLVEMDGFTSRDQIVVLAGTNRPD
                     VLDPALMRPGRFDRHIQLDAPDVEGRKAIYEVHLKHLNLAPAYKEKSEFEALSGKLAA
                     LTPGFAGADIANACNEAALIAARHSDPYIELHHFEQAIERVIAGLEKKSRVLSPEEKK
                     TVAYHEAGHAVCGWFLEFADPLLKVSIIPRGQGALGYAQYLPPDQYLINTEQFEHRMI
                     MALGGRVSEEIHFPYVTSGAHDDFKKVTNMAQAMVTSLGMSKKIGYISYDQGDAQFQV
                     NKPFSESTARKIDLEVKRIVDDAHAKCVKLLTDNLDKVDLVAKELLSKEMITREDMIR
                     LLGPRPFPEKNEAFEKYLDPKKGKDDSKNESDLNPSTAQ"
     gene            complement(<651718..>652560)
                     /gene="BIM1"
                     /locus_tag="KLMA_70311"
                     /db_xref="GeneID:34718063"
     mRNA            complement(<651718..>652560)
                     /gene="BIM1"
                     /locus_tag="KLMA_70311"
                     /product="microtubule integrity protein mal3"
                     /transcript_id="XM_022821570.1"
                     /db_xref="GeneID:34718063"
     CDS             complement(651718..652560)
                     /gene="BIM1"
                     /locus_tag="KLMA_70311"
                     /codon_start=1
                     /product="microtubule integrity protein mal3"
                     /protein_id="XP_022677919.1"
                     /db_xref="GeneID:34718063"
                     /translation="MAGISESRSELLSWLNDLLKLNYTKVEQCGTGAAYCQIMDSIYK
                     DLPMNRVNFNAGSEYEYFTNYKILQSCFTRHKIEKSVLVERLVKCRFQDNLEFLQWIK
                     RYWSQHKDESEYDPEARRKARAGGASSPPVSVNKRPASSSTASKPQLRNVRTNIIQNS
                     MRKPSNDQLLTLQTELTQARNQVTELEKECNQYKELNTAYLKERDFYFGKLRDIEILA
                     QSTQDLCDEGIYEHDKDLRGFLTRIQQILYATEEETQSFAAEEAHPISATEVANTIVD
                     EETF"
     gene            complement(<652917..>655175)
                     /gene="FAA2"
                     /locus_tag="KLMA_70312"
                     /db_xref="GeneID:34718064"
     mRNA            complement(<652917..>655175)
                     /gene="FAA2"
                     /locus_tag="KLMA_70312"
                     /product="long-chain-fatty-acid--CoA ligase 2"
                     /transcript_id="XM_022821571.1"
                     /db_xref="GeneID:34718064"
     CDS             complement(652917..655175)
                     /gene="FAA2"
                     /locus_tag="KLMA_70312"
                     /codon_start=1
                     /product="long-chain-fatty-acid--CoA ligase 2"
                     /protein_id="XP_022677920.1"
                     /db_xref="GeneID:34718064"
                     /translation="MNVNMKESKGNEEITLTELIEQSPRFAKIRHKLSKHKKGSTEYY
                     KTLHSNLALAKNTDFKEYIKHQGVPVAGTERTKGFSAVYRNSLYPEKLVSAIDSSLDT
                     GYKLFTVAAQTYPNNDCLGERVFDKETGKWSDYYVWESYSQVQQRSRNLGAGILSLVN
                     QRRGKPLDSTGFIVSIMSTNRKEWILTDLACQSFSLPNTTLYTTLGEETSEYIMNLTE
                     SPVLVLQASNLRKIISYLPRMKHVTTLISMDDLSENELKSINDNFLTNVKLFSLKQVE
                     QIGALLKIDPIPPTPDSLYTISFTSGTTGQPKGVELTHKHYAAATAFAKTNFDLTSAS
                     SDLVKQKQHYELCFLPLAHIFQRQITSLSLSSGFGCGFMHIPDPNYLTECLRILKPTI
                     MAVVPRILTKMESGIKNSLNSDEVSFISKNIAHNILDAKLTRFQNRGGPDDSFINTLV
                     YHKVLIDKIRHQLGFDNLESMVVGSAPVSNDTLMFMRSCLDVGIKQGYGLTETFAGFC
                     ISETFERDVGSCGATGVTCEVRLKSVPSMGYDAEKELKGEILTRGPQVVTSYYKNPTA
                     SKEAIDEEGWFSTGDIGYIDPKGRLHIIDRVKNFFKLAQGEYIAPEKIENSYLSSCPE
                     LTQIYVHGNSLETYLVAIVGIDPIALKEALARHYGVDLKGESISELVSSINSDRPLKL
                     KILKLLNHRLSKLQGFEKIHNITVGIEPLKIEDDNVTPSFKVKRNNCAKFFEKEIRDM
                     YNEGSLIKPNKL"
     gene            complement(<656407..>658020)
                     /gene="HEM14"
                     /locus_tag="KLMA_70313"
                     /db_xref="GeneID:34718065"
     mRNA            complement(<656407..>658020)
                     /gene="HEM14"
                     /locus_tag="KLMA_70313"
                     /product="protoporphyrinogen oxidase"
                     /transcript_id="XM_022821572.1"
                     /db_xref="GeneID:34718065"
     CDS             complement(656407..658020)
                     /gene="HEM14"
                     /locus_tag="KLMA_70313"
                     /codon_start=1
                     /product="protoporphyrinogen oxidase"
                     /protein_id="XP_022677921.1"
                     /db_xref="GeneID:34718065"
                     /translation="MNPTVSKLPANAKVAVVGGGVSGLTFAYFLSKLRPDIKVTIYES
                     KDRCGGWIHSDLIQDRHGDTVMVEKGPRTLRGVSDGTVLIVETLRDLGKEDVVQYIAS
                     DSDANKKFLLDKSNVLTPVPQTILGGIKFMMGPLGKGFFTGLVGEPFRPAKTSDADES
                     AQNLLRRRFGNDHLSRNVFSAIFHGIYAGDIKSLSAKRTLGKMVLMEKKNGSLMKTMI
                     NNVIKRYKSKDKIAVEKGLLSQRLKHFAAVTGRSEAELVSLSRRLKKYPMLGFKTGLE
                     CYPKTLYEYLTGLPNVDIRYERVNRIKPAESQDKVLIESGSAQNPSTFDHVRSTVNPD
                     ILADVVPFEALAKKLREVKANTVILVNFYLPNKDIIPTYHGFGYLVPQCNNNHENLLG
                     VIFDSVIEQNFKPLFSKELPKNPEAKQYTKLTAMIGGHYLGNDGSRSIPSNSIIINSV
                     KNALQNHLHINEQDLKDATWDVTVAKDCLPQYHVGYDDWLAEAVGMLQKNFSNNVSLG
                     GMAFSSGPGVPTVIEDAFEGAYALANTKP"
     gene            complement(<658245..>661583)
                     /gene="PRP22"
                     /locus_tag="KLMA_70314"
                     /db_xref="GeneID:34718066"
     mRNA            complement(<658245..>661583)
                     /gene="PRP22"
                     /locus_tag="KLMA_70314"
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase PRP22"
                     /transcript_id="XM_022821574.1"
                     /db_xref="GeneID:34718066"
     CDS             complement(658245..661583)
                     /gene="PRP22"
                     /locus_tag="KLMA_70314"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase PRP22"
                     /protein_id="XP_022677922.1"
                     /db_xref="GeneID:34718066"
                     /translation="MSTVKKEICDILGLNDEVVADFVLDINKKCSSQEEFVQQLLEMD
                     QELSSAVISKLYTAINGSLQDNTISVAHALLSQQLNIQDEVVTKFIVDVCKKSETMVK
                     FRDTLKEMDAGIPNNLALRIFNIVHAKKPVETKQEPEVKLELPALSLPDSRITLQEDI
                     QEKPTRPSRYAPNVDPEPVVDKVYRGKVQNITRFGCFVKILGVKSANASGLVHISEMS
                     SSHVERPEDIVHLHQDVYVKVIKIQNNKKISLSMKGIDQTTGAELEPRGRKAERSIIP
                     RRKLTSPERWEIRQLIASGAASIDDYPELKEDYNIIQSTTTEDKKHEDQDEELEVEIN
                     VDDAPKFLKGQVKPDRKYELPSITKVPKGSLNRSAMTGSYTMKEHREEKIKRKKEVEK
                     KLNKSKQLNDPANPKALTNSEFDARQLVASAWERSRMKERVSYGKRTSLPIKQQRESL
                     PVFKMRQQLVDAARENQFLVIVGETGSGKTTQLTQYFDEEGFSSNGMIGCTQPRRVAA
                     VSIAKRVAEEMGCNVGEEVGYTIRFEDHTSSKTRIKYLTDGMLQREALLDPLMSRYSV
                     ILLDEAHERTVATDVLFALLKKAALQRPDLKVIVTSATLDSDKFSKYFMDCPIINIPG
                     KTFPVDVLYSSKPQMDYIESALDTTMEIHINEPEGDILVFLTGQEEIDTCCEILYERV
                     KALEGTISELIILPVYSALPSEIQSRIFEPTPKGSRKVIFATNIAETSITIDGIYYVI
                     DPGFSKVNTYNPRMGMEQLLVTPISQAQANQRKGRAGRTGPGKCYRLYTESAFKNEML
                     PNTIPEIQRQNLEHTILMLKAMGINDLLNFEFMDPPPKAFMISALETLFNLQALDENG
                     YLTVLGKRMSQFPMQPGLSKTLLASVENNCSEELLTIVSMLSIQSVFYRPKDKQQEAD
                     QRKARFHHPYGDHLTLLNVFNKWRESNYSKSFCTTNFLHERHLKRALDVREQLINIFK
                     KMNLPLISCHGDVDAIRKTLVSGFFRNAAKRESQAGYKTLTDGTQVAISPGSSLYGKE
                     YDYVLYDSIVLTSREYMMQVTAIEPKWLLESAPHFYKVADPNGSSRKKAKIVPLNDKF
                     AQSKDSWRLSSIRANRDKKLGGKR"
     gene            complement(<661906..>662493)
                     /gene="PRE1"
                     /locus_tag="KLMA_70315"
                     /db_xref="GeneID:34718067"
     mRNA            complement(<661906..>662493)
                     /gene="PRE1"
                     /locus_tag="KLMA_70315"
                     /product="proteasome component C11"
                     /transcript_id="XM_022821575.1"
                     /db_xref="GeneID:34718067"
     CDS             complement(661906..662493)
                     /gene="PRE1"
                     /locus_tag="KLMA_70315"
                     /codon_start=1
                     /product="proteasome component C11"
                     /protein_id="XP_022677923.1"
                     /db_xref="GeneID:34718067"
                     /translation="MDILLGIRVKDSVILASSKAVTRGISVLKATDDKTRQLLPHTLM
                     SFSGEAGDTVQFAEYIQANMQLYLIRENYELSPQAASSYVRTELAKSLRSRKPFQVNV
                     LIGGYDTKKEKPELYQIDYLGTKVELPYAAHGYAGFYTFSLLDRHYRADFTLEQGLDL
                     LKECIKELQLRMPVDFKGVIVKVVDKDGIRVVDDF"
     gene            complement(<662849..>664165)
                     /gene="PRI1"
                     /locus_tag="KLMA_70316"
                     /db_xref="GeneID:34718068"
     mRNA            complement(<662849..>664165)
                     /gene="PRI1"
                     /locus_tag="KLMA_70316"
                     /product="DNA primase small subunit"
                     /transcript_id="XM_022821576.1"
                     /db_xref="GeneID:34718068"
     CDS             complement(662849..664165)
                     /gene="PRI1"
                     /locus_tag="KLMA_70316"
                     /codon_start=1
                     /product="DNA primase small subunit"
                     /protein_id="XP_022677924.1"
                     /db_xref="GeneID:34718068"
                     /translation="MPSLVEASGPGLTSEPPSSSSDTTSGAPMSQASYGPSSSDMQYY
                     YQHLYPFKQIFQWLNHSPKPGRDIINREFAMAFRSGAYKRYNSFNSVQEFKAQIQKGN
                     PDRFEIGAVYNKPPRERDSILKTEMKPIEKELVFDIDMDDYDSYRTCCSGAQVCQKCW
                     KFITLAMKVINVSLEEDFGFEEFIWVFSGRRGAHCWISDKRARVMIDTYRKNMLDYVN
                     VVRDRNIEKRLNLVRPLHPHLSRSLEILKPHFVEIIMREQDTWRDDELAMQSLATSCH
                     DKQLTEQLKKLWTERPGRSSEEKWKDMDVLASQIIMNLPKQRQNDYLQRLRENKEDII
                     IQTLYPKLDVEVTKQTIHLLKAPFCIHPATGNVCVPITEAFSPEMAPKLITLQNEMES
                     NGNQVEKTSLQPYLELFSKYVQTILKQEITSQKREREEDSKQSIDF"
     gene            complement(<664524..>666740)
                     /locus_tag="KLMA_70317"
                     /db_xref="GeneID:34718069"
     mRNA            complement(<664524..>666740)
                     /locus_tag="KLMA_70317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821577.1"
                     /db_xref="GeneID:34718069"
     CDS             complement(664524..666740)
                     /locus_tag="KLMA_70317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677925.1"
                     /db_xref="GeneID:34718069"
                     /translation="MVLERIRVSSNGEFIDSYDRVVQLRGVNFDPAIKYPSSPEHTSH
                     SPLVEAYWDSADNASFVNHPVKLDDIEEHVNKIKSLGYNTIRFCINWEAIEHKGPGQY
                     DYEYIEYVRQALVKIYELGDIYVYLDPHQDVWSRFTGGSGAPLWTLYCAGFNPKRFPY
                     THAAVLHNEYIDKVSSKQTKQYPKMFWPTNYYKLACQTMFTLYFAGDLYAPKCIINNK
                     NIQDYLQDSFNNAIKTLYGYLLEKSPELFEGNLILGLETMNEPSEGYIGCHNLHHIPK
                     ERDLKMGPTPSAFQCFMLGEGHETTVDVYDITVAGSKKVGTTTLNPRGHSAWMTETER
                     KEIDAKYGWERGDEWKPGCVWRLHKVWDVEDGKPKLLDARYFIGNGSSMSYFINKMFI
                     TYFKKFRAMFRSIDTDRFLFMQNPVFQRPPELKGSDLMDNRTVFATHFYDGMSLMFKT
                     WNRAYNVDTLGIVRGKYMNPVFSLVLGEHNIRKSIAKQLRLIRDEAREVLGSNTAVIF
                     SEIGMPFDMDDKIAYKTGEYSSQTSAMDALGFALESNNLSFSLWCYCSRNCHKWGDQW
                     NNEDFSLWSADDAARRKVTVEVPHLGSDSITLQESAGFTSLSGSTMSNKSSEAFKKTG
                     ELITIDYSGFRALDSILRPSAIRISGSFISAKFDPYNSTYNLEIQGYASRENITLIFL
                     PAYHFRLDDIVMKSSSGHFFYDPDRQILQWMHEAGNQFLSISTIAAATNEDNCTIM"
     gene            complement(667082..667153)
                     /locus_tag="KLMA_R707"
                     /db_xref="GeneID:34718783"
     tRNA            complement(667082..667153)
                     /locus_tag="KLMA_R707"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:34718783"
     gene            complement(<667463..>669235)
                     /gene="MDM38"
                     /locus_tag="KLMA_70318"
                     /db_xref="GeneID:34718070"
     mRNA            complement(<667463..>669235)
                     /gene="MDM38"
                     /locus_tag="KLMA_70318"
                     /product="mitochondrial distribution and morphology
                     protein 38"
                     /transcript_id="XM_022821578.1"
                     /db_xref="GeneID:34718070"
     CDS             complement(667463..669235)
                     /gene="MDM38"
                     /locus_tag="KLMA_70318"
                     /codon_start=1
                     /product="mitochondrial distribution and morphology
                     protein 38"
                     /protein_id="XP_022677926.1"
                     /db_xref="GeneID:34718070"
                     /translation="MRPGYGAVGLVTKKAVSRRVLPAQAWVLGAKFASTSSSPSNPES
                     KTGVETPAASKPVPAPAKGKKEKKPPLWDRIKHELNHYVNGTKLLGYEIKVSTKLLIK
                     FIQGYELSRREKNQLKRTMSDVFRLVPFSAFLIIPFAELLLPVALKIFPNLLPSTYES
                     GKEKSLKRTKLNEIRAKTSNFIQETLEESSLISYNSLESTEKKKQFLNFFKKLNSPKD
                     GRENVFTHEEILAVAKMFKNDTVLDNLSRPQLIAMAKYMSLRPFGNDNLLRYQIRLNL
                     KNTMADDKTIDYEGVDSLSDEELYQACVSRGIKTFGVSRDVLVENLKVWLELRLRHQV
                     PSVLLILSSAYTFGGIPKEQKVDAFSTASIENKVEDTKFNNLLDFYYDGILQVLSSIP
                     DPVYNVAKLDVSESKKSTSDVKEATKEHHKEPSIGELASEALATSSASAAAAATATAT
                     ATASAATTHLSNAASSVSGSHPSVEPEATKPSADHDVKKAETLEPGAQPSTEEQKNIQ
                     GETEEEPEETEESTATDDNAFKLSVLKEQDELIKKEEEEARLRSQREVIKDDISLDEN
                     EDESSTPDDAKSTEAEKEKNSEQK"
     gene            <669834..>671160
                     /gene="RPR2"
                     /locus_tag="KLMA_70319"
                     /old_locus_tag="KLMA_70320"
                     /db_xref="GeneID:34718071"
     mRNA            <669834..>670463
                     /gene="RPR2"
                     /locus_tag="KLMA_70319"
                     /old_locus_tag="KLMA_70320"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022821579.1"
                     /db_xref="GeneID:34718071"
     CDS             669834..670463
                     /gene="RPR2"
                     /locus_tag="KLMA_70319"
                     /old_locus_tag="KLMA_70320"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022677927.1"
                     /db_xref="GeneID:34718071"
                     /translation="MIVSSLCNKLMLVAYVVIYLRFMKDQTMSIALLSLVLMFCSYAS
                     HSLLMVYHAELTENHEEMRTIMMRNFRGLQILLLLETVGSLAYHSVIDLEKDVCRWKF
                     GYWFTQFIGDAQCGKGGRTMLIILDIIFVYIVLLSTSYMSTNVEINTVDFKVNLSALD
                     VERYGILSLLRMKSLDIDANSLKVTLDEFNVDLGDSYTNYNTMDVLDSD"
     mRNA            join(<670254..670420,670614..>671160)
                     /gene="RPR2"
                     /locus_tag="KLMA_70319"
                     /old_locus_tag="KLMA_70320"
                     /product="ribonuclease P protein subunit RPR2"
                     /transcript_id="XM_022821580.1"
                     /db_xref="GeneID:34718071"
     CDS             join(670254..670420,670614..671160)
                     /gene="RPR2"
                     /locus_tag="KLMA_70319"
                     /old_locus_tag="KLMA_70320"
                     /codon_start=1
                     /product="ribonuclease P protein subunit RPR2"
                     /protein_id="XP_022677928.1"
                     /db_xref="GeneID:34718071"
                     /translation="MSTNVEINTVDFKVNLSALDVERYGILSLLRMKSLDIDANSLKV
                     TLDEFNVDLGDSEVERRAERDGLRERLEKLLEGFGHSKPALDHFVMGKQEVKESPDVI
                     QVRPPKNVGNKDHFQRLSYLLQVSAFLAEKLKDKDVDEALSRNYIKNMDSIRKKNQLA
                     LSPHVKRLTCKKCQRLLMAGRNMEMEITNTSRKGRTKQSKADVLVYRCKCGTVKRFPI
                     GKDPSYKLHVEESDNLIDV"
     gene            complement(<671328..>671771)
                     /locus_tag="KLMA_70321"
                     /db_xref="GeneID:34718072"
     mRNA            complement(<671328..>671771)
                     /locus_tag="KLMA_70321"
                     /product="mitochondrial import protein 1"
                     /transcript_id="XM_022821581.1"
                     /db_xref="GeneID:34718072"
     CDS             complement(671328..671771)
                     /locus_tag="KLMA_70321"
                     /codon_start=1
                     /product="mitochondrial import protein 1"
                     /protein_id="XP_022677929.1"
                     /db_xref="GeneID:34718072"
                     /translation="MAEEVFNDIPEELHATILPREVSSDANDTTSLKDEEKQYLSENS
                     VSVSRNQSSTTKSLSQLPSENGVSFGKILSFAGSCSINLVLPFINGLMLGFGELVAHE
                     ISWNWNWFNKSNNGYRIFPENRKQAATATAKNPSSNDADANDKFL"
     gene            <672368..>673132
                     /gene="PRE6"
                     /locus_tag="KLMA_70322"
                     /db_xref="GeneID:34718073"
     mRNA            <672368..>673132
                     /gene="PRE6"
                     /locus_tag="KLMA_70322"
                     /product="proteasome component PRE6"
                     /transcript_id="XM_022821582.1"
                     /db_xref="GeneID:34718073"
     CDS             672368..673132
                     /gene="PRE6"
                     /locus_tag="KLMA_70322"
                     /codon_start=1
                     /product="proteasome component PRE6"
                     /protein_id="XP_022677930.1"
                     /db_xref="GeneID:34718073"
                     /translation="MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGQDCVVL
                     GCERRSTLKLQDPRITPSKISKIDNHVVLSFAGLNADSRILIEKARVEAQSHRLTLED
                     PVTVEYLTRYVAGVQQRYTQSGGVRPFGVSVLIAGFDPRDNKPRLYQTEPSGIYSAWC
                     AQSIGRNSKTVREFLEKNYNKDAPPENEKECVKLTIKSLLEVVQTGARNIEITVVKPD
                     SQIVTLTTEEISSYVDEIEAEKQQDLDKKKQQEQDK"
     gene            <673714..>676197
                     /locus_tag="KLMA_70323"
                     /db_xref="GeneID:34718074"
     mRNA            <673714..>676197
                     /locus_tag="KLMA_70323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821583.1"
                     /db_xref="GeneID:34718074"
     CDS             673714..676197
                     /locus_tag="KLMA_70323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677931.1"
                     /db_xref="GeneID:34718074"
                     /translation="MANQGTGLQDIKEEEDNVSDFSGNQGIGDRSVIVRELGVDSGGV
                     AVENEPEIESRLLGLGIQDGHDVVASDGRGGEDGTLGEREEELLLPPLPDVETKAALL
                     YQEESLGNLSSISSSSSETLDDISPVLDTKISEQDETSFDLSQALEIPTNSTTGSSLN
                     RSTSTQNIIVSHGGSGQLPSISSPKSALKRRFSNTLLSHALNQEAMLLSTGATTTTTS
                     SSPQIPHTGEFPLHKTSTRSSGHTSTSSMGTGTRNKSRSNSSVVPMLASSSYDNSNAG
                     SASPGPNNNLLSKKQSNGNINVNIYNNNIANTTEVSDKRFTDLKKLSMGRMGNDSWPN
                     SSDISSPSSSSPLDLANNSTHYDELLYKAQTLLSSTNLNGTGTGTGTGVSTSTSTSNS
                     LRNRSRSNSNLNVITNFFTGGGGGGGGNNTNNSGTSNSSALNSPALPPNTLSSEDASD
                     SRSFNSSEINIPKRVPLLRRASSALLRKRSLRNNGTTVATNSESGGDGDGIHGFAVNS
                     PILADTRVASLDLDAIARLESRNKKNLFINTNDSRPTLSTRESTTSLRSGLSPDPNVN
                     RIPSFSSKVKRGFTRIISSGNINNGSRKDSPIDSRMTSSQNDNTPISSNDSISMNFGL
                     ETNSVNEFVEEHNGIRNNNMIPRRSSSVQRKRISRTRKMSSHSDSIASERGNSNGNKT
                     GKSQRDRETDESEDGDTDLDMIITDADMEELSKKKPIITITEKFGANNTTPLQQQSNV
                     WFYKASFDEWQSSTNKKPSNASLRKYINVLIEQQTLEDARFQTLEQKLQQSGWVSSQE
                     LGYLRQKRVVINRQWAERISFYQNKLEEE"
     gene            complement(<676558..>677433)
                     /locus_tag="KLMA_70324"
                     /db_xref="GeneID:34718075"
     mRNA            complement(<676558..>677433)
                     /locus_tag="KLMA_70324"
                     /product="transcriptional activator of sulfur metabolism"
                     /transcript_id="XM_022821586.1"
                     /db_xref="GeneID:34718075"
     CDS             complement(676558..677433)
                     /locus_tag="KLMA_70324"
                     /codon_start=1
                     /product="transcriptional activator of sulfur metabolism"
                     /protein_id="XP_022677932.1"
                     /db_xref="GeneID:34718075"
                     /translation="MTVGMASAADKGHVLARNGEKTEEGKLDEILLRGLQSSSDEQAG
                     TGSASGSTSTSTSANNYTVSKTGDSQRKVSVSVPSDETEGSSSSSSSRQADLSLQVRE
                     LINNNSELGSRLLSLLLVSSDNAKDIIEAVNRGDISKLRDLTEETTTTTTTTTTTKSE
                     TGTEPTDKVEPQPIKSETQTQPTKGPETAPQESAPSSARSVSPDNVDDPLWKQLEKRR
                     KNTEASARFRIRKKQREKEKLEQLKQLTKDINAMYDTIDTLISENNYWKEKLQELNEI
                     KSRELLDKIKKRSGL"
     gene            <678700..>680253
                     /gene="SLT2"
                     /locus_tag="KLMA_70325"
                     /db_xref="GeneID:34718076"
     mRNA            <678700..>680253
                     /gene="SLT2"
                     /locus_tag="KLMA_70325"
                     /product="mitogen-activated protein kinase SLT2/MPK1"
                     /transcript_id="XM_022821587.1"
                     /db_xref="GeneID:34718076"
     CDS             678700..680253
                     /gene="SLT2"
                     /locus_tag="KLMA_70325"
                     /codon_start=1
                     /product="mitogen-activated protein kinase SLT2/MPK1"
                     /protein_id="XP_022677933.1"
                     /db_xref="GeneID:34718076"
                     /translation="MGEYEAVDRHTFKVFNQDFTVDKRFQLIKEIGHGSYGIVCSARF
                     TEAADETTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFQPDGM
                     FNGLYLYEELMECDMHQIIKSGQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGN
                     LLVNADCQLKICDFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDV
                     WSCGCILAELLGGKPIFKGKDYVDQLNRILQILGTPPEDTLKRIGSKNVQDYIHQLGY
                     IPKIPFSNLYPDANPDALDLLEGMLSFDPQLRITVDDALEHRYLAIWHDPADEPICTE
                     KFDFSFESVNEISQLKQMVIDEVTDFRQFVRLPLLHEQQQEQQQQQQQQQQQQEQQEA
                     LQQQEALQQQKNFNEPIHDNTTAFQAQLGEHVNQFNKNISGIPSFDEPFTSQIIGSAT
                     QQDPLVGIHSDNLPSHDLDFPPRPRENVLDSPPRLENQGPNQSPGTQDINDLLGLERE
                     LEFGLDRQF"
     gene            complement(<680497..>684735)
                     /gene="VPS15"
                     /locus_tag="KLMA_70326"
                     /db_xref="GeneID:34718077"
     mRNA            complement(<680497..>684735)
                     /gene="VPS15"
                     /locus_tag="KLMA_70326"
                     /product="serine/threonine-protein kinase VPS15"
                     /transcript_id="XM_022821588.1"
                     /db_xref="GeneID:34718077"
     CDS             complement(680497..684735)
                     /gene="VPS15"
                     /locus_tag="KLMA_70326"
                     /codon_start=1
                     /product="serine/threonine-protein kinase VPS15"
                     /protein_id="XP_022677934.1"
                     /db_xref="GeneID:34718077"
                     /translation="MGAQLSLLAQTAPSIAISSYVDVLDEVHYQSQLNASRFLKTCRA
                     LDPNGEIVVKVFLKPTESYDLKKIHDKIERQSLILRQLPNVLNYSKIIYTDRAGYLIR
                     QHLKTNLYDRLSLRPFLQDIELKFMTFQLLQLMSDIHMRDITHGDIKTENIMVTSSNW
                     LILTDFSEYIKPKYLPEDNPGEYAFYFDTSQRRTCYLAPERFNTERYNSETSNKLDKE
                     MDIFSLGCCIFELFTEGRPLFNLAQLFKYKNGGNDALETIRSEIKEPALQSLILDMIA
                     IDPKNRLSARTLLSKYRGVLFPESFYSFVYEYCRNLVRPASPTNGSKTTMSSTLEERK
                     YDLDIIVSDIYKDFSKICTVAEFPFKKFSEGDDKDHVDFVNKSVTISGIGKIELQSFN
                     SMKSDSVRNQSSLIFLSILLHCLRNLAYPKNKQRCLEMILALSQYVSDVNKLDRVLPF
                     MMVMIFDENSNVKALAIKTVAQLLLITEEVNRSNANIFIDYILPRLNRLCQSAQADSY
                     VSIVLANTLGHFANTAIRFHEISYLLSFQSSNPAEVNRLHKVGKKLLRQFEEITTTLL
                     TAPEPQVKEALLHNILPICHLFGKERTNDVILSHLITYLNDKNAALRIALIKSITGVS
                     VLLGSVTFEQYILPLLAQTLCDLEETVVITVLQSLISFCKLGLLRSKYFYDIATEVST
                     LILHPNFWIREYTILLIIEMASKLSKSELYCVMYPVIKPFFEFDVEMTWESLYISAKK
                     PISRNVYNLLCTWSLRSSKSLFWKHMPGKEVNSFGNNTIEFITKQHSAKNYGFQTNLK
                     NSKTNITSVTNMDIPLTAEDRNWVDKIKNVGLSETELWKLAALRTYVFRVSKMLSRKP
                     ESDMNEFGNILEDKGLLGLPQNIFFDIEAIDEGKQLNTHVILKHKTSGDALNNIQKAP
                     LPHLLQRPIDMNGSLILTPRSQPIINSTFENVYIQFEPRTPPVSAGSAESPHSSNETK
                     FRVTNSYNGRQASVRKFLKSVDVKPPLRCFKEFGETFQESSREPSFSVFNSLKFISSL
                     SDHKPASVVTITTNEYISYVVSGSDDGYLKVWDLSKIEKGLIFKPSINHELGSSITGI
                     KFVAHYDVIIVSTTDGRIGVFRIVFKNHLKIKEIDTLETIRNFTHKVPGRYSVDIAYI
                     NNDLRPWITTVTNDSQIVIIDITDMSVVYEVPISPIYGTVLCTSVSSDGHWLLCGTTH
                     GALLLWNLTFRVLVKSWTFGESSPIKKVELIRKDHRKAEYSAIVTGGNNDALFTIWNL
                     TRVQAEDVVSMANVDISLDSVLGKPFKRVPKSIKNVTFDNNFVCDFIVKQGNIYYADG
                     LSSEIFKYNIKTKSNIPLLSAQKDLEKPLTTKLTLNCSLTTFRNPSNRNAQDLVSYYH
                     TDLINSMSFGMLRSSPALISADNSGMIHIYALQK"
     gene            complement(<685363..>686682)
                     /gene="SMK1"
                     /locus_tag="KLMA_70327"
                     /db_xref="GeneID:34718078"
     mRNA            complement(<685363..>686682)
                     /gene="SMK1"
                     /locus_tag="KLMA_70327"
                     /product="sporulation-specific mitogen-activated protein
                     kinase SMK1"
                     /transcript_id="XM_022821589.1"
                     /db_xref="GeneID:34718078"
     CDS             complement(685363..686682)
                     /gene="SMK1"
                     /locus_tag="KLMA_70327"
                     /codon_start=1
                     /product="sporulation-specific mitogen-activated protein
                     kinase SMK1"
                     /protein_id="XP_022677935.1"
                     /db_xref="GeneID:34718078"
                     /translation="MEARIISNQPDWNMKHVPNVSRATKKLKKLLDPYVDHVKQSYEL
                     DQNNNIYVDPIVNKRTIYGPANFSVPGRYEIMQVLGKGSYGTVVSALDKANHEREVKL
                     AIKKVTSIFTREILLKRAIRELKFMSYFKGHRNIVSLLDLEIVNEEPYSGLYCYQELV
                     DYDLARVIHSNVLFSEFHIKHFLYQILCGLKYIHSADVIHRDLKPGNILCSITGEVKI
                     CDFGLARGISPSFTVTGGISNHITNYVATRWYRAPELILSHKRYSKSVDMWAVGCILA
                     EFYGRKPIFMGNDSLHQVMEIQKVLGTPSQSVIRTYGSSRCYDIFSTSKPQFKKTPWC
                     EIFPYASQGSVDLMERLIDWCPDSRLTVEEALNHPFVQEVRNPAAEPICPYGPFDFTY
                     EKQLYSMDRLRECLCQEVSKFHNDRQTKDFVSPPLMTPQFISESSSY"
     gene            complement(<687059..>687751)
                     /locus_tag="KLMA_70328"
                     /db_xref="GeneID:34718079"
     mRNA            complement(<687059..>687751)
                     /locus_tag="KLMA_70328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821590.1"
                     /db_xref="GeneID:34718079"
     CDS             complement(687059..687751)
                     /locus_tag="KLMA_70328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677936.1"
                     /db_xref="GeneID:34718079"
                     /translation="MSLITKTFKYLFYAYLASTYKSLPGAYYIRFWFYAIRNIVLPIF
                     TGKQTANIKKLQSDKYGVFKHNVLSTYCSFFEIDGYLHKSNSTYFEELDIARTDLMTK
                     VFQKLFLTSKKWPYIPVAEVSTCFFKDIRPLQPYQVISNIFCWDKKWIYVLSKFTVNN
                     GSTVVSLSITRYVLKDGRKTIRPADALQVCGIYNDEVEQISSENLAYMEANGGFENIQ
                     KLIEQNKEYGSL"
     gene            <688360..>689475
                     /gene="RXT2"
                     /locus_tag="KLMA_70329"
                     /db_xref="GeneID:34718080"
     mRNA            <688360..>689475
                     /gene="RXT2"
                     /locus_tag="KLMA_70329"
                     /product="transcriptional regulatory protein RXT2"
                     /transcript_id="XM_022821591.1"
                     /db_xref="GeneID:34718080"
     CDS             688360..689475
                     /gene="RXT2"
                     /locus_tag="KLMA_70329"
                     /codon_start=1
                     /product="transcriptional regulatory protein RXT2"
                     /protein_id="XP_022677937.1"
                     /db_xref="GeneID:34718080"
                     /translation="MAELADISIEEELAQIKRFKRKVMVKLSGNYPPLNQSQDGAIFP
                     EIRGETSNRGNKLLQHSDAITYSKLRAKEHESKVFYNGAEHRLLSRKRMKFNDGTASS
                     KTGDKQQQKDDEEDEEERANNDNGDDDLNELVSIKDILSPISSLKDVVSHPSHSKPFK
                     SPVLKELALSNVLMVEKEQDNVINYYKLLEIFLGDFPEALYEKDLKLPVYDHKLTIKE
                     EDDDNTNTNSPTSSSSGLELKPKDEEAFFGLPEFTESETLLSLIPKRFHTGDPTVPIS
                     GEITDDIETTRQLAQIALQRNQEFIRNLQKIRNCIVKANRIRERILMWGKEFSGIPEQ
                     GVTVPNALNVVKRGLISATTNQTQPLDAEESDNEENN"
     gene            complement(<689632..>691785)
                     /gene="PBY1"
                     /locus_tag="KLMA_70330"
                     /db_xref="GeneID:34718081"
     mRNA            complement(<689632..>691785)
                     /gene="PBY1"
                     /locus_tag="KLMA_70330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821592.1"
                     /db_xref="GeneID:34718081"
     CDS             complement(689632..691785)
                     /gene="PBY1"
                     /locus_tag="KLMA_70330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677938.1"
                     /db_xref="GeneID:34718081"
                     /translation="MKVLITNDDGPLSDQYSPYIRIFVQYLLKHTDWDIYICIPNQQR
                     SWIGKAHFANHNPTASFIYSSPDAKTNEFVGPFSVPQFKRLTKLSHAVPDQKKTVVPE
                     NYIEWCLVDGTPATCSDIGLNHLIHEPFDVIISGPNVGRNASAPYIGSSGTVGAAMDA
                     YTTNPSVKSFALSWAYFDGVKIVDDAIFEQVCGKSFEAIDYLIRNWDSDVRIYSLNVP
                     LRDLSNAKFKYCPILESTWCSIYSDPILTPNVSPSNEDILDGHQSHTISFNWQPNFKL
                     QRENMINEKSLTDGSCIEQGDISVTPLSHTFKVIEKLFGEFQLNDPARIVLTIPDTDY
                     IYQPLMHSFRKHLPNIPVSRSLPVTMDKLTFHYGEYEQLNMDQLMSNDFYHANAYIYR
                     KAIIRKHYLSHTIHSYVVKNEDSILNKAFLESFNIDVDYAEFLDDALDENWELRQELE
                     SKQKWWILKPSMSDKGQGIRIFKTIEQLQDIFDSFEEDETDDEDVGQDSNKVVTSQLR
                     HFIVQEYLHNPLLLSDMHSRKFHIRCYVTCYGDLQVYVYDRMLALFAPSKFVPPSDDY
                     NVLDNSQLSCHLTNTCLQNDDESKSNSVVEFTNLDDIPPHRKEEIKEQIHEIVAELFK
                     AAVNVDRMNFRPLKNCLETYGFDFLVDSNYQVKLLEVNAFPDFKQTGAELKGLIDELF
                     DDIVSICVRPMFKLPPLNHKNSKFTEVLKLQSNDW"
     gene            <692073..>692396
                     /gene="TIM12"
                     /locus_tag="KLMA_70331"
                     /db_xref="GeneID:34718082"
     mRNA            <692073..>692396
                     /gene="TIM12"
                     /locus_tag="KLMA_70331"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM12"
                     /transcript_id="XM_022821593.1"
                     /db_xref="GeneID:34718082"
     CDS             692073..692396
                     /gene="TIM12"
                     /locus_tag="KLMA_70331"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM12"
                     /protein_id="XP_022677939.1"
                     /db_xref="GeneID:34718082"
                     /translation="MSLFLDPYSAQTVDETKIEVAKVQFDAMNTTFNAMLSTCLEKCI
                     PHDEYGESDLNKGEMTCIDRCVAKIHYSNRLIGGFVQSRGFTPERHLPYDRIVEAKVQ
                     HPSGK"
     gene            <693791..>694072
                     /gene="NHP6"
                     /locus_tag="KLMA_70332"
                     /db_xref="GeneID:34718083"
     mRNA            <693791..>694072
                     /gene="NHP6"
                     /locus_tag="KLMA_70332"
                     /product="non-histone chromosomal protein 6"
                     /transcript_id="XM_022821594.1"
                     /db_xref="GeneID:34718083"
     CDS             693791..694072
                     /gene="NHP6"
                     /locus_tag="KLMA_70332"
                     /codon_start=1
                     /product="non-histone chromosomal protein 6"
                     /protein_id="XP_022677940.1"
                     /db_xref="GeneID:34718083"
                     /translation="MAAPRKKTQRKKKDPNAPKRALSAYMFFANENRDIVRAENPGIT
                     FGQVGRILGEKWKALSEDEKAPYEAKAEADKKRYESEKELYIATKAQSE"
     gene            <694905..>695681
                     /gene="POL30"
                     /locus_tag="KLMA_70334"
                     /db_xref="GeneID:34718084"
     mRNA            <694905..>695681
                     /gene="POL30"
                     /locus_tag="KLMA_70334"
                     /product="proliferating cell nuclear antigen"
                     /transcript_id="XM_022821595.1"
                     /db_xref="GeneID:34718084"
     CDS             694905..695681
                     /gene="POL30"
                     /locus_tag="KLMA_70334"
                     /codon_start=1
                     /product="proliferating cell nuclear antigen"
                     /protein_id="XP_022677941.1"
                     /db_xref="GeneID:34718084"
                     /translation="MLEAKFTEAGLFKRIIDSFRDCVQLINFNCSEKGIAAQAVDDSR
                     VLLVSLSIKVEAFEEFRADRNIVLGCDLTNLSKILRCGNNSDNLTLIAEDSPDSILIL
                     FEDTKRDRVSEYSLKLMEIETDFLEISDMKYESYITMPSADFAKTVRDLSQLSDSINI
                     LVTKDTIKFAAEGDIGSGSIVMKPFTDLDHPQNSIKVTIEKPVDLRFGAKYLNDIIKG
                     STLSDTITIKLSEEAPALFQFDISSGNLQFYLAPKFDEEE"
     gene            complement(<695778..>696416)
                     /gene="MAK3"
                     /locus_tag="KLMA_70335"
                     /db_xref="GeneID:34718085"
     mRNA            complement(<695778..>696416)
                     /gene="MAK3"
                     /locus_tag="KLMA_70335"
                     /product="N-alpha-acetyltransferase 30"
                     /transcript_id="XM_022821597.1"
                     /db_xref="GeneID:34718085"
     CDS             complement(695778..696416)
                     /gene="MAK3"
                     /locus_tag="KLMA_70335"
                     /note="NatC catalytic subunit"
                     /codon_start=1
                     /product="N-alpha-acetyltransferase 30"
                     /protein_id="XP_022677942.1"
                     /db_xref="GeneID:34718085"
                     /translation="MCKRYFKGTETRILRVIRRGKQKLTKKQREEMSSEEGIRYTRFD
                     ISNEMEFSTIKKLIDEDLSEPYSIYVYRFFLNQWPRLTYLAWADGVDTPIGCIVCKSD
                     MHNGVRLRGYIGMLAVEKSYRGRGIAKKLITLAINAMIEEKCDEIMLETECSNAAALH
                     LYENMGFIRMKRLFRYYLNQGDAFKLILPITEKSCVRSTFLGLNSFPKNAIL"
     gene            <696844..>700098
                     /gene="ATG11"
                     /locus_tag="KLMA_70337"
                     /db_xref="GeneID:34718086"
     mRNA            <696844..>700098
                     /gene="ATG11"
                     /locus_tag="KLMA_70337"
                     /product="autophagy-related protein 11"
                     /transcript_id="XM_022821598.1"
                     /db_xref="GeneID:34718086"
     CDS             696844..700098
                     /gene="ATG11"
                     /locus_tag="KLMA_70337"
                     /codon_start=1
                     /product="autophagy-related protein 11"
                     /protein_id="XP_022677943.1"
                     /db_xref="GeneID:34718086"
                     /translation="MPPCELISASNGASFQLSDLYFPSFLDLKQFVGETFHISVDDIL
                     LLLSYGIILKRSQWDSTKIRSEGLKSIYVFDRKLFNEDIELAVEERFRLFKPLDSPMS
                     DLSEVDRNIVLRNMGWLKALQSDVEFFQLSIEQTRKEVQNMLDCGVVMLEYLKNYCHE
                     VETLYNSHVGFLNKLHEHSASSQWREVYDSVLEAVKIDQQRSLASFFQIDELNQIEAK
                     IRHTDHELNMKLKELKKTIDTCYQHRKTLVSELENIKSISVVSPDCMDKQMTDKFNEM
                     AQELEAASNEWVQNSENNDHISEKVKQMKDSHIPNLQTISQSLFNKASKIIETKTDMQ
                     RQLRSLYISVAKSQMDIIEVKSTLTKDMKSDMKLLQTYELQLSQVLDLPMCYGLYLIE
                     LYRQQLWMDNYTHIKDQHESALQVMLQEEIHQRKMWYRDFQWISKFLKVDQSLPSTVS
                     ITPLKALRRVDLLQINEYFNQLSSAKVSETTLNVLKSKLSQAEMDNMLPELSEQSSND
                     TGAAIEGYKSRIKKLENLLLDAQFQRYDSWPSGILNKEIAMVQMFRNNTLNNKVQRSS
                     TDDISNSIQQSYSKTLGDVQNLQKAISEYSGLTDTLKEELSTLKSQISNMEVEKNAYK
                     ESMANLNKELSNLLINRENFHTEMMERSNDFKKHLALVGEENEQLTKQNQQLSNEIIE
                     SQKKYEELNKIKDDLLLNMANQETQAEQERAALQEEIESLKKEVGQLQMAKSSLTESE
                     ELLGINKQLEKTLYDVFQGSIFLLESIGLLLSKDIDGKFQIVRVKGLRKDLDSSVIDM
                     NGSLVKSVVSHEIKDTFESIKDSLDYKPHENFISYTEKLFGNQLFEMAVIRRFNDIES
                     LAKKLRKENKNKKILLQKYTNDKITINNFQLGDLALFLPINDQELLLNSSVSSLNSSF
                     SSIDLNSSTQSMIPPRVIPNRVEPASNTNNSNPSSVPEDMGSPNMNRVNTMGNVKVNA
                     NIGSNNSNNNYVNTGNANGNNKPETNIDTTSSTNAESPKKQIVWAIFTATNTEVKYIL
                     RNTMSNYELLREKEWAVGRITALEKNIVMEGARNPFKFPQNTVWFEVDALFNLS"
     gene            complement(<700116..>701990)
                     /gene="TAH18"
                     /locus_tag="KLMA_70338"
                     /db_xref="GeneID:34718087"
     mRNA            complement(<700116..>701990)
                     /gene="TAH18"
                     /locus_tag="KLMA_70338"
                     /product="probable NADPH reductase TAH18"
                     /transcript_id="XM_022821599.1"
                     /db_xref="GeneID:34718087"
     CDS             complement(700116..701990)
                     /gene="TAH18"
                     /locus_tag="KLMA_70338"
                     /codon_start=1
                     /product="probable NADPH reductase TAH18"
                     /protein_id="XP_022677944.1"
                     /db_xref="GeneID:34718087"
                     /translation="MKDKKIAILYGSETGNAQDFANILSHKLKRLHFPHTLTNIGDYN
                     PKSILKCKYMFIICSTTGQGELPRNARENYKGHSQGTLWQFMKKKNLPSNFLDHLNVA
                     LLGLGDSSYPRFNFGIRKLHERMVNQLGAIEIFPRLEADELGLAGSNKNTGNGSESVY
                     FEFEKKVLSYLTEKYPTRVHDGKVVPRVMVDQDVYLKPSNILEITDDNGSNKKVESEN
                     NIRFVGDESIRKGTVKLNKQITAPDHFQDVRQFVFETEHHESYQPGDTVCLYPENLDS
                     DVQAFLDAQSCWKDVADKPLTITNLETCELFKDGGLVEPLTLRTLLKYHLDIMSIPRP
                     SFFMKIWTFATDLERLSFDKEQLEQQREKLRQFGYDEDLQDLYDYCNRPRRSILEVVQ
                     DFESLKLPWEFVLDFIPIMKPRFYSISSKPSDHNIELTIAVVRYKTILRRIRKGVLTN
                     FLISLSENETIRYKLQHNNLIHDDIIGKPIIMISPGVGLAPMRSLIKSEIFNELYLFF
                     GNRMKNKDYLYGDELSRWNEEGKIKLFTCFSRDPVNSPDAKYVQDQMWNHSELLANLI
                     LNKSAVIYICGSSGKMPVQVRLTILEILKKHGDFKNDDDAEHYLKEMEKTDRYMQETW
                     "
     gene            complement(<702378..>703793)
                     /gene="pheS"
                     /locus_tag="KLMA_70339"
                     /db_xref="GeneID:34718088"
     mRNA            complement(<702378..>703793)
                     /gene="pheS"
                     /locus_tag="KLMA_70339"
                     /product="phenylalanyl-tRNA synthetase"
                     /transcript_id="XM_022821600.1"
                     /db_xref="GeneID:34718088"
     CDS             complement(702378..703793)
                     /gene="pheS"
                     /locus_tag="KLMA_70339"
                     /codon_start=1
                     /product="phenylalanyl-tRNA synthetase"
                     /protein_id="XP_022677945.1"
                     /db_xref="GeneID:34718088"
                     /translation="MFSVSVIQCSKKAGQKLSLQGFVRSFSAGITASKSIQISGKNYE
                     VSDKTNVTDSILNLTDRAVYLKPTHPVGILRNVIEEKLNGTDSSFKIYNDFKPVVTVH
                     ENFDSLGFPEDHPGRSKSDTYYVNDSHLLRTHTSAHELECFKNIDGFVPGHKGITEKP
                     GFLISADVYRRDEIDRTHYPVFHQMEGCRVWKREPGNGHLEKIKTDLARLEKTLADDP
                     VKLIVEDNVSLEGNPKQDYMSMEEVDLCSRHLKRSLELVVLEVFKRKLQSMGNAEGEE
                     LKVRWIQAYFPWTAPSWEIEVFWQNDWLELCGCGLVREDVLLKAGYEKDQSIGWAFGL
                     GLDRIAMLLFEIPDIRLFWTQDERFHSQFKAGTINKFKPYSKYPGTIRDVAFWLPEDK
                     TIEIIHENDLMEIVRNVAGDLVESVKLIDSFTHPKTGKKSLCYRINYQSMDRNVTNEE
                     VNKLQESVRDTLVKLYSVKLR"
     gene            <704206..>704871
                     /locus_tag="KLMA_70340"
                     /db_xref="GeneID:34718089"
     mRNA            <704206..>704871
                     /locus_tag="KLMA_70340"
                     /product="54S ribosomal protein L16"
                     /transcript_id="XM_022821601.1"
                     /db_xref="GeneID:34718089"
     CDS             704206..704871
                     /locus_tag="KLMA_70340"
                     /codon_start=1
                     /product="54S ribosomal protein L16"
                     /protein_id="XP_022677946.1"
                     /db_xref="GeneID:34718089"
                     /translation="MISSVFKNGFKAVRAVESLQVTARRFTHEYAPRFKHQTKKQKGR
                     VPVRTGGSTKGNKIEFGQFGLRLKSEGVRLTALQLKEADNAIMRYVRPLNNGKLWRRL
                     CTNIAVCIKGNETRMGKGKGGFDHWMVRVPTGKVIFEMAGDNLHEKVAREAFRKAATK
                     LPGLYEFISKDSLVRVGLKSVKDPKDDPKINYFEELKKKPTKEYVTKLKSQLPEYRLY
                     RAR"
     gene            complement(<704953..>706020)
                     /gene="RFC5"
                     /locus_tag="KLMA_70341"
                     /db_xref="GeneID:34718090"
     mRNA            complement(<704953..>706020)
                     /gene="RFC5"
                     /locus_tag="KLMA_70341"
                     /product="replication factor C subunit 5"
                     /transcript_id="XM_022821602.1"
                     /db_xref="GeneID:34718090"
     CDS             complement(704953..706020)
                     /gene="RFC5"
                     /locus_tag="KLMA_70341"
                     /codon_start=1
                     /product="replication factor C subunit 5"
                     /protein_id="XP_022677947.1"
                     /db_xref="GeneID:34718090"
                     /translation="MSLWVDKYRPKNLQSLSFNEDLTSQLYSLTKQPQDLPHLLFYGP
                     NGAGKKTRCMALLQELFGSGVYKLKIDVRQFVTPSNRKLELNVVSSPYHLEITPSDMG
                     NNDRVVIQELIKEVAQMEQVDFQDSKDGLAHRYKCVIINEADSLTRDAQAALRRTMEK
                     YSGNIRLIMLCDSMSSIIAPIKSRCLLIRVPAPDKQQIVSILQDCCQKERVNADVNCL
                     QRIADLSRGNLRMSLLSLESTALQNELNLRSDTALNRPDWQLVIHKMARKIMKERNVN
                     SLVECRSINYDLLAHCIPARTIIHELSMQLLEDSKSDSLKLAVIDAACTYDERLCLGN
                     KAIYHLEGFIARVMCEIDRYV"
     gene            <706304..>709183
                     /gene="APL3"
                     /locus_tag="KLMA_70342"
                     /db_xref="GeneID:34718091"
     mRNA            <706304..>709183
                     /gene="APL3"
                     /locus_tag="KLMA_70342"
                     /product="AP-2 complex subunit alpha"
                     /transcript_id="XM_022821603.1"
                     /db_xref="GeneID:34718091"
     CDS             706304..709183
                     /gene="APL3"
                     /locus_tag="KLMA_70342"
                     /codon_start=1
                     /product="AP-2 complex subunit alpha"
                     /protein_id="XP_022677948.1"
                     /db_xref="GeneID:34718091"
                     /translation="MAPGQSQQNAMKGLQLFIADLRASQKTKDHARRIQNELSNIRKQ
                     FSQKGGLNSYQRKKYVAKMAYIYITTNAGMIQELLFGLDQCVQLLKSNNFSDKWVGYM
                     TLELFFNHSVVRNQVMEKTVSCLKSDLSSNDPNIISLALHFIGIVGNRDDIFADNLSD
                     TVFGLLRSPVTDNFIKRKACLALLALIRYKPEVFSNLEEKKRTLWIERITTLLGDGDD
                     DSLLLSLLPLLEFIAANIDVRPLYRLIPQLTDILHDCLSKRAVNVAPSDYKVTDLPNP
                     WLIGKCTSLLDILVSDNGENLIGANVDQRTLGKLRMCVSSAVNLVSVESTDPVAKNAQ
                     YTVFFDMLGLACKLDPTNEAIVNSVEGLHNLIACTDLNIRYSTFDLLIKICRLNGRTA
                     IVAVQNNHLSNLFEMLRREGDVTLLRKIIDLLVILTDSNNFKSVVQELLLALQNHKSM
                     GFSLIEELALKIEKLIERNADDLNWFVISSLKLLSANTSIKDDHVWKRICQIVVNNEP
                     LHKLACEHLIQYLGSPNVAESLVKAGVFLLSEYAQLITDKVSAGDLFNLFTERYFQVG
                     NLTKAMILPAMLKLYHVEPRLSSVVVKFYQLELNSFDVILQTRSYECLKIIQYTKMND
                     MTFLDKLLPGMPPFTNSSSTINLASKLQQNELLTLDQPSSSGEKSSVSSASTTQQQQQ
                     PAPPKSRKDTKLYHSQPLTPGWEAGFKRMAIHKQGVFYQDILMSILFRVERKVDQPST
                     SKISLTFVNKSHRDISGLSCEIIPFRADNNPQYVFQVVRSPEYKLAAQSGSRTVLEFE
                     ITTRFPFPQEQSPLLSLQFKCGGQHSNYRLKIGYTIISTLLPSDNGISLPQFIQRWKS
                     IGDSLGKSGEYSDTIKHQGGEITQAKVLSLLPKIGFDIVEQNSVSNTVFAGGIIHTKS
                     SSNYGCLLKIKVSQTENVIDISCRTTSTEDLSRFVVNCVKKAIDQ"
     gene            complement(<709255..>710052)
                     /locus_tag="KLMA_70343"
                     /db_xref="GeneID:34718092"
     mRNA            complement(<709255..>710052)
                     /locus_tag="KLMA_70343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821604.1"
                     /db_xref="GeneID:34718092"
     CDS             complement(709255..710052)
                     /locus_tag="KLMA_70343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677949.1"
                     /db_xref="GeneID:34718092"
                     /translation="MLKRTSGEVIRRMSSVSGLVYDAARKDELIASYQGMKDQINHAA
                     KEFGREGVELLAVSKLKPASDIKILYDYGVRHFGENYVQELITKSEILPKDIQWHFIG
                     GLQSNKCKDMAKVPNLYAVETIDSLKKAKKLEEARAKWNGESGVVTCFIQINTSQEEQ
                     KAGLTEEQEVYSIVEFFLKEAKHVSLAGLMTIGSWDVSHAEGEENQDFAKLVDWKNKL
                     DGKYNLNLKLSMGMSSDFKQAIKQGTSEVRIGTDIFGSRPPKNEATI"
     gene            <711074..>713782
                     /gene="IST2"
                     /locus_tag="KLMA_70344"
                     /db_xref="GeneID:34718093"
     mRNA            <711074..>713782
                     /gene="IST2"
                     /locus_tag="KLMA_70344"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821605.1"
                     /db_xref="GeneID:34718093"
     CDS             711074..713782
                     /gene="IST2"
                     /locus_tag="KLMA_70344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677950.1"
                     /db_xref="GeneID:34718093"
                     /translation="MSIADLDPNYVLVVEYSKKNLSVLLAELGSKGISCECRPGHDDS
                     NVYVFVRDDLGRALRVAERFDFVKHVTPLYGSKKRDQIREMGSDLIMKRSLIKDSDLV
                     SLAQATGNPRVALYFAFAKTYTRFLMPLALFGLVLRLFNPNGTEFNTHYAIVVFLWAI
                     TFITLWKNKYEPHYTSEFGYLTLVPLEDSRVTFIKKLCFVPVALIFVVLLLVFQLLCF
                     ALEIFVTQLYKGPLASVVALLPTVLLSAYVPILTMIYNKCFVEKMTAWEGGVNPARSK
                     LEKNFVFTFLTSYVPLLMTLFIYFPFGHLLNQYLPTLQSFASKVHIPIHSSEFKMNLS
                     RYQTQFFYFTVTNQVVALAMDNILPIVMGKVMPMITGENKPDSSKSRITKLVSQEFPE
                     EKKYLDEIRSYETGPWGEFNVDDNTRKLVLQFGFVVIFSSIWPLAPLVCICFNILFFK
                     LDLWRALIKCAPLVDGKARRDVMKEDGYEEITMSPWNSILTFLTWFSTLVTPAMLLMY
                     RNNDLPGVGYSSTTEKRSISTTWYQDYPFHYDLKSILLYSFTLEHVFFLIYRAISKIL
                     QAPLTKEAETVLPTEEQKEPEKLNLENVVNRTAQFMDKLSTTKPADAKSTEHDEKTTA
                     MNEAPVTEPKTSAPEDVKTTGVDINRSENNSVKRRGPISPVPVPATTSRNPDPVSVVG
                     VAPGPGVAAPRETGSLSVSKVIPNGTATKESSVSSLTSSSVAGATLPPTIPTSKNYDL
                     RKSTPNIEAASVATISSVPRETAKPTAQPEEQKSASSPAIPATAPVVISTPVAPVDDA
                     VPEKKEPIQNSKVPKLEVSLAADAQQFVSSKATEPEKQFVNENKVMATPQKQIVPENH
                     IKHHRTSLKKDTESIDSTPATTSSASAKKKKKKGIMSPLGKLKKKF"
     gene            complement(<713901..>715829)
                     /gene="POL12"
                     /locus_tag="KLMA_70346"
                     /db_xref="GeneID:34718094"
     mRNA            complement(<713901..>715829)
                     /gene="POL12"
                     /locus_tag="KLMA_70346"
                     /product="DNA polymerase alpha subunit B"
                     /transcript_id="XM_022821606.1"
                     /db_xref="GeneID:34718094"
     CDS             complement(713901..715829)
                     /gene="POL12"
                     /locus_tag="KLMA_70346"
                     /codon_start=1
                     /product="DNA polymerase alpha subunit B"
                     /protein_id="XP_022677951.1"
                     /db_xref="GeneID:34718094"
                     /translation="MTIENDLVVKFGSAANSQDTISTLQHYMKIYDLSVDDLYIKWEQ
                     FSYHNKDKYAANSFSEPVLHEFKSYMQQQMEKKVSASITSSSSVTPSIKKPKLLVPNA
                     NSPSMFGLAIPNTPTLKKRRIETGGTPTEAPKSSPLGITELPLSATKTPANLKAATEA
                     DKCLVTLNVDNVQKSEGIDLEEGSSKVKIAPFYDAKKYKFRTMRQSLLDTADVLDEQI
                     DIFTEVVQKHYNLKPSDIGDPTYQQQSEIYTVGRIVPDAVNADGPLNIDSLALETSRS
                     TGIGRRIRLNFEKLQDVSVFPGQIIALRGKNANGEYFVIEEILKIPYLNSPVSDPETI
                     QDAQMSLDNRSMKVVVTSGPYTSANDLDYTNLQDFVTRINTTIKPHVLIMFGPFLDIT
                     HKLVSTGQIPEFSGLKQQPRTLDEIFAKVIAPILKQIDSRIQVILVPSTKDVVSKHAA
                     YPQDSLDRRSLSLPKNFKCFTNPSTFQLNEIFFGCSNNDIYKDLREVTKGGNVFQRNR
                     FDRVSEHILEQRRYYPVFPGGIKTRKIEDKNGKPVFEHISGADLDVPYLGLTEFIGDI
                     IPDVILIPSELTHFARVVQNVIMINPGAFVRPNGGRGTYVEMSIEAPDMENEKMTRID
                     DVYLHCLWKRSRIDILTA"
     gene            complement(<716040..>720470)
                     /gene="STU1"
                     /locus_tag="KLMA_70347"
                     /db_xref="GeneID:34718095"
     mRNA            complement(<716040..>720470)
                     /gene="STU1"
                     /locus_tag="KLMA_70347"
                     /product="protein STU1"
                     /transcript_id="XM_022821608.1"
                     /db_xref="GeneID:34718095"
     CDS             complement(716040..720470)
                     /gene="STU1"
                     /locus_tag="KLMA_70347"
                     /codon_start=1
                     /product="protein STU1"
                     /protein_id="XP_022677952.1"
                     /db_xref="GeneID:34718095"
                     /translation="MSDEFNGLDALVDESIPPKEKLALLTQFKGHVKKTLVSEQMCMR
                     YFENLSRLLMQLAGEEEQVEVEDERMTLFQLAHSAMCYLVKRVAMQAQYKFQHDVIEL
                     VVCTLLAACDSCGSGDKKVWQSSVKALEAIYLAKPHEFSRVLDECVAHKESIRTQVLL
                     VVDELARSEINNGRSASNFVQKFMPVWVHEMNTNPSFQPKDVELIFDIAASRCPDVVV
                     RNMVDSVMNKTASRLLETKFTKMRGQGQGQGQGQGQSIVATSQPVSRSSTPMNSNGSN
                     AQPFDIHTELQSIMNQAPQFPSVPTPAPTNYSNFNHLLKDLESILVPFQAPRETEQNW
                     KLRQANVIKLRSIVLGNTSTEFPEKFLDAWREYNLHECVTKSALSLRTSLCTQGCSLV
                     KDLCSVFNAILDISIIDNLWSCMAKLMANTKKIANQNAYICLITLLSTVPFHSRLFNH
                     CLALIRDKNTASRLYSSTFLRILIVRFPKRLVSQHHVYVEEWLQKGLTDAQTTIRETM
                     RITFWYWYKISPMSGKKLLGSFQPQIKRALESSIPAHLDIDYDAGGHLTATTTAGIST
                     NSRNSSRRSSLLPKRFPSYAAPTQSSHLPRSSIKRSLTDISHANSFSKRSLRTPPDHE
                     MHIDLTNEITKSHTNPLLNRYMRNDAHKREGDEKAEGEEKQQSEREEEHLVEALSRDP
                     KHGLELLQKYLLSDINIENSDKLQFSIMSLIRTNPKLFKPLLHFPKFYELIPLKFSMI
                     LLPLNHLDITMIESQVSPSTILNNVITILQSLEERNSEWSIFYVRFKFQIYNFCFETI
                     ERMLSKVNMSDTLINELLNACGKDMDAEKYYSLILKIYSSDKNKFTALLKLTPTASTK
                     LKIANEIQKKDPDFEIKNILNNYRPISETVDPPEEKHLLEMTMVNPLEKRTVSTNTVV
                     HNSLDSDIEENEGFERQEVRYSNIPEVSMHNDDDNVSSRNGYSIEPESQAVKQDPAGE
                     IKETKEKEEEEEEEEKEEKEEEERARKDQKDDEEHDDHSVIHENLESVGVKENYQTRD
                     SNVTELTQELLEKASSLMEESDRHKETDEPNGFTKFGGFSKLTEMTKVHSVFQPEAPV
                     NENIDYMDVDSQNDSNLGHKSMLSDIFLKNQTNEDIHTSKEFGEINSNKEHKLDYESH
                     MLTEAINDMEIKTNTEGSVGNKSKDDIVASQPIDKEHAQSHNQYTPLDTSVFPHESLI
                     LFELNFIDSYIETVELNKLNSIVHSITNNGTFKMNELQYLLKCFLTQDDEVLKWIHTD
                     SKLTKLCFITEQLLSSSSSESHIPTNIAYKSLILAACLILINEKLDTRVLKNENFSNL
                     IDSIIFLVAKLDTYDNEIYFASGELRQIMLDHVPNISTAFLERCLTALANMNEQYMVK
                     VSYILQSIGHIVKTIGKSLTVENLKNLSNAVSKYAPSDVPEWRFESCTVLSIIYAELL
                     QRNTPVGYIRSLMPLLDASDFEVVRRMSLFTSKDASRHLG"
     gene            <721079..>721333
                     /locus_tag="KLMA_70348"
                     /db_xref="GeneID:34718096"
     mRNA            <721079..>721333
                     /locus_tag="KLMA_70348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821609.1"
                     /db_xref="GeneID:34718096"
     CDS             721079..721333
                     /locus_tag="KLMA_70348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677953.1"
                     /db_xref="GeneID:34718096"
                     /translation="MSMYKLSSMNMTHSTGSFLNSAPVELTSVKGYQDFIAKQRKLKR
                     SVSTQLSEDRSMWYVLHDSEVVATVTGDAKDYLLQLSGET"
     gene            complement(<721540..>722535)
                     /gene="RIB1"
                     /locus_tag="KLMA_70349"
                     /db_xref="GeneID:34718097"
     mRNA            complement(<721540..>722535)
                     /gene="RIB1"
                     /locus_tag="KLMA_70349"
                     /product="GTP cyclohydrolase-2"
                     /transcript_id="XM_022821610.1"
                     /db_xref="GeneID:34718097"
     CDS             complement(721540..722535)
                     /gene="RIB1"
                     /locus_tag="KLMA_70349"
                     /codon_start=1
                     /product="GTP cyclohydrolase-2"
                     /protein_id="XP_022677954.1"
                     /db_xref="GeneID:34718097"
                     /translation="MTAETVAEAVPSSSTLSQNKSAAAADAAAAAKAASGLPHVQCIA
                     RARIPTVQGPDIFLHLYQNDRDNKEHLAIVFGEDIRSRSLFRKHAGETQEARMIRGAY
                     VGKLYPGRTSADVDEKQGLSLQFDEKDGSLVVEPSTTWCEQETLVRIHSECYTGETAW
                     SARCDCGEQFDRAGKLMAVDHEGDIKGGNGHGVIVYLRQEGRGIGLGEKLKAYNLQDL
                     GADTVQANLLLKHPVDARDFSIGRAILIDLGISQVRLLTNNPDKVAQVEQPPFLHCVE
                     RVPMVPLSWSGNHSEGIHSKEIDGYLRTKIERMGHLLQQPLTLHTAPTDPKTAAI"
     gene            <723322..>724440
                     /gene="HEK2"
                     /locus_tag="KLMA_70351"
                     /db_xref="GeneID:34718098"
     mRNA            <723322..>724440
                     /gene="HEK2"
                     /locus_tag="KLMA_70351"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821611.1"
                     /db_xref="GeneID:34718098"
     CDS             723322..724440
                     /gene="HEK2"
                     /locus_tag="KLMA_70351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677955.1"
                     /db_xref="GeneID:34718098"
                     /translation="MSSSVESIGNGTVQGSAQGTSPGPSPSPGVSQDLDTNLNAAASA
                     SAGPGQAPDNNGLGSNSITFHVLVSLKEAAKIIGPQGNTIESIRKENDIKIGISPREK
                     SCSDRLLNVSGNARQVANALGQVLRVLTTDYEPEEHVFKHLRFMLPPASKEEIEDPEK
                     WKQIGNLRLICTNPQISSVIGQQGAKIKKLIETHSVKLVASKHFLPDSKDRVLEIQGF
                     PTSVANCINEIAELFIQDDVHVPPRTLPRYYPHSKHTKEIQVSQTLAIPKEYVGALLG
                     VGGNRIANLRKFTKTKIVIGQEPNETGNRIFTIWGNDQKSVKLAQTMLLKNLDVEKKR
                     REEHEAALRTTGGAGAGAESAAATDSSAAANNVETAET"
     gene            <725140..>726345
                     /gene="SHE1"
                     /locus_tag="KLMA_70352"
                     /db_xref="GeneID:34718099"
     mRNA            <725140..>726345
                     /gene="SHE1"
                     /locus_tag="KLMA_70352"
                     /product="mitotic spindle-associated protein SHE1"
                     /transcript_id="XM_022821612.1"
                     /db_xref="GeneID:34718099"
     CDS             725140..726345
                     /gene="SHE1"
                     /locus_tag="KLMA_70352"
                     /codon_start=1
                     /product="mitotic spindle-associated protein SHE1"
                     /protein_id="XP_022677956.1"
                     /db_xref="GeneID:34718099"
                     /translation="MDKENIRPLMDGNDIIEYIGVSKRLGNNVLQELEQRASNILPRV
                     SPGKQQLLDEVNGVVQGSHGQIKTSISMKFHDKHEKRFQDMESIDTHYSLAKYVDGSE
                     KVCQTQNQYQSGDVAMEEPQTPAKRSEAQISSEDDGSVQKKQKSVSRDSHGGASSVGD
                     GAALFSPVTDITHRIRRLRVRMSSGSERDRHERDRRRNIISNTPLRRQQQIHESVPMP
                     PSSLPTFAKPTATSLQRKQQNDPFQRLLAASKSNSRPAAAAASKQASKHGDIFRNLNK
                     KDTTTTTTSSSAGPAATTSRAPSRTTSRTTSRTTSRATSRTTTPEKQPHNRIPKSKSV
                     FERLYEQSTISRSNSAQDVSLKPVRKPNTRLPSSKTQNDLHSVTTTAAKLTKSTTMHN
                     LSVNRPQWR"
     gene            complement(<727462..>728379)
                     /gene="AAC"
                     /locus_tag="KLMA_70354"
                     /db_xref="GeneID:34718100"
     mRNA            complement(<727462..>728379)
                     /gene="AAC"
                     /locus_tag="KLMA_70354"
                     /product="ADP,ATP carrier protein"
                     /transcript_id="XM_022821613.1"
                     /db_xref="GeneID:34718100"
     CDS             complement(727462..728379)
                     /gene="AAC"
                     /locus_tag="KLMA_70354"
                     /codon_start=1
                     /product="ADP,ATP carrier protein"
                     /protein_id="XP_022677957.1"
                     /db_xref="GeneID:34718100"
                     /translation="MSADKKQSNFVIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEM
                     IKQGSLDRRYNGIVDCFKRTAANEGIAAFWRGNTANVIRYFPTQALNFAFKDKIKAMF
                     GFKKEEGYAKWFAGNLASGGLAGGLSLMFVYSLDYARTRLAADSKNAKKGGERQFNGM
                     IDVYKKTLKSDGIAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLETSFLASF
                     LLGWAVTTGASTASYPLDTVRRRMMMTSGQAVKYKGAFDAFRQIVAAEGVKSLFKGCG
                     ANIFRGVAAAGVISMYDQFQMILFGKKFK"
     gene            complement(<729387..>729659)
                     /locus_tag="KLMA_70355"
                     /db_xref="GeneID:34718101"
     mRNA            complement(<729387..>729659)
                     /locus_tag="KLMA_70355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821614.1"
                     /db_xref="GeneID:34718101"
     CDS             complement(729387..729659)
                     /locus_tag="KLMA_70355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677958.1"
                     /db_xref="GeneID:34718101"
                     /translation="MSFVPIIFGKKDWDAKSPFEEQYHGIYCPNCHNFQVRPVKRREF
                     ISFWFIPVLPIFWGNQLQCPICNWRQDFKTEDQLRKVMNEQLRVKQ"
     gene            <731054..>731980
                     /locus_tag="KLMA_70356"
                     /db_xref="GeneID:34718102"
     mRNA            <731054..>731980
                     /locus_tag="KLMA_70356"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821615.1"
                     /db_xref="GeneID:34718102"
     CDS             731054..731980
                     /locus_tag="KLMA_70356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677959.1"
                     /db_xref="GeneID:34718102"
                     /translation="MSWCQENVSDVFSLGYGYGYAYGNGYGYGYGCEQEQEQEQEQGS
                     GRQAEYGVVEPGVVLETEFSYTTLGGLDFGLGDEEVGSSSSSSGGVSGSSFSEPSPAP
                     IPRQRRYSKPQQTTPPPSEGSMTTSSSTSSSPASGAKKVSDSRLSARGLAQVLNLDSP
                     AEALCREKFILDIFEKELHYPLGYKTWVRGTTKEYRAKILYQLHERVKVKYPEYDEKV
                     LETIIRRATYYMMQSRLRRERRAKAKANKQQQQQQQQQQRGKASSKNKAVVVQQSHSE
                     PEPESVPDVTAVSNSDLFIAGEAFLSGDSFLM"
     gene            complement(731365..732189)
                     /locus_tag="KLMA_R708"
                     /db_xref="GeneID:34718784"
     tRNA            complement(join(731365..731422,732155..732189))
                     /locus_tag="KLMA_R708"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:34718784"
     gene            complement(<732317..>732655)
                     /locus_tag="KLMA_70357"
                     /db_xref="GeneID:34718103"
     mRNA            complement(<732317..>732655)
                     /locus_tag="KLMA_70357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821616.1"
                     /db_xref="GeneID:34718103"
     CDS             complement(732317..732655)
                     /locus_tag="KLMA_70357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677960.1"
                     /db_xref="GeneID:34718103"
                     /translation="MAKSLRAKSDLNAKSIKRKAVFQKTVDARAERLAEKLKNDLLKQ
                     KMEELKAKNNGMEIDEETLLKQEEEKRKEMESVQKKVSTSGWRDARHHNYKKAKLQKK
                     KSKKGSFTKF"
     gene            <733723..>734590
                     /gene="RPL19B"
                     /locus_tag="KLMA_70358"
                     /db_xref="GeneID:34718104"
     mRNA            join(<733723..733736,734023..>734590)
                     /gene="RPL19B"
                     /locus_tag="KLMA_70358"
                     /product="60S ribosomal protein L19"
                     /transcript_id="XM_022821617.1"
                     /db_xref="GeneID:34718104"
     CDS             join(733723..733736,734023..734590)
                     /gene="RPL19B"
                     /locus_tag="KLMA_70358"
                     /codon_start=1
                     /product="60S ribosomal protein L19"
                     /protein_id="XP_022677961.1"
                     /db_xref="GeneID:34718104"
                     /translation="MPEMKANLRTQKRLAASVVGVGKRKIWMDPSESAEIAQANSRNA
                     IRKLVKNGTIVKKPVRIHSRSRTRAMAESKRNGRHTGYGKRKGTKEARLPSQVVWIRR
                     LRVLRRLLAKYRDAGKIDRHLYHSLYKAAKGNTFKHKRALVEHIIQAKADAQREKALK
                     EEAEARRLKNRAARERRAQRVAEKRDALLKEDA"
     gene            complement(<735644..>738565)
                     /gene="MIS1"
                     /locus_tag="KLMA_70359"
                     /db_xref="GeneID:34718105"
     mRNA            complement(<735644..>738565)
                     /gene="MIS1"
                     /locus_tag="KLMA_70359"
                     /product="c-1-tetrahydrofolate synthase"
                     /transcript_id="XM_022821619.1"
                     /db_xref="GeneID:34718105"
     CDS             complement(735644..738565)
                     /gene="MIS1"
                     /locus_tag="KLMA_70359"
                     /codon_start=1
                     /product="c-1-tetrahydrofolate synthase"
                     /protein_id="XP_022677962.1"
                     /db_xref="GeneID:34718105"
                     /translation="MLRSPLRNAIKYSPVRLLKSSNRHHQQYVHIAKCQYHLLSGTKI
                     AKSIREDAFQEITRIKEKAPEFVPCLKIIQVGSRPDSSAYVRMKLKASEESGVKCIVE
                     KLPEDIGELELLQKIQKINDDDSIHGLLIQLPLPRHLNETEITNAVSYTKDVDGFHRY
                     NVGELSKRGGKPYFLPCTPNGCIRLLKESGIDLKGKRAVVIGRSDIVGTPVASLLKDL
                     NATVTICHRYTENIADVVKNADVVIAACGVPNMVKPDWLKQDAIVIDVGINYIPDATK
                     KSGKRLVGDVDFEACKEKASYITPVPGGVGPMTVAMLVQNVVLAAKRQLQNATKLPQI
                     KPLPLKLETKVPSDIEISRKQAPKYIKTVAEELGVHHSELELYGHYKAKLSPKIIKRL
                     AENEDGKYILVAGITPTPLGEGKSTTTIGLVQALSAHLQKPSIANVRQPSMGPTFGVK
                     GGAAGGGYAQVIPMDEFNMHLTGDIHAIGAANNLLAAAIDTRMFHEATQKKHETFYKR
                     LVPVKKGTRSFTPSMLKRLEKLGINKTNPDDLTTEEIVKFARLNIDPDTITIKRVVDV
                     NDRMLRQITIGQAPTEKGFTRQTGFDITVASELMAILALSKDLKDLRERVGRIVIGSN
                     YDKEPITVEDIGCGGAIAALLKDAVKPNLMQTLEGTPVLVHAGPFANISIGASSVIAD
                     RVALKLVGKPKNADEGVESGYVVTEAGFDFTMGGERFFNIKCRASGLTPNAVVLVATV
                     RALKLHGGAPDVKPGQSLPEEYTQENVELVKNGTANMCKQIENIKQFGIPVVVAVNRF
                     ESDTEAEIDAIKEAAQKAGAFDVVSTNHWAEGGKGAINLAKSVIEASKQPSDFKFLYD
                     VNDTVEEKLSTIVTKMYGGAKIEISEEAQKKIDMYREQGFGNLPICIAKTQYSLSHDA
                     KLKNVPTGFTFPIRDVRASIGAGYLYALAAEIQTIPGLSTHAGYMNVEIDEDGEIEGL
                     F"
     gene            complement(<738998..>740167)
                     /gene="TEC1"
                     /locus_tag="KLMA_70361"
                     /db_xref="GeneID:34718106"
     mRNA            complement(<738998..>740167)
                     /gene="TEC1"
                     /locus_tag="KLMA_70361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821620.1"
                     /db_xref="GeneID:34718106"
     CDS             complement(738998..740167)
                     /gene="TEC1"
                     /locus_tag="KLMA_70361"
                     /note="TEA super family[cl02603]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677963.1"
                     /db_xref="GeneID:34718106"
                     /translation="MKNGTAKIKLKEKNYGRNELISLYIKNKTGEQRSKKQISSHIQV
                     WKKSIANKMFNDIQTSKFESELLNLIENGAEQTPENWHLFETTFNAIIEQEENYNAAA
                     AAAAAAAATGGGSTATGGGAVGDNSMTSTSSSSAGGTAGAAGSHAYHTYHHPHPHHQQ
                     YSTSASSMYHHLPYHVYAQTPSSGVPILPYHIPMMKEPATPIEFAQELYGSLKSFKCV
                     PVNPYEHYNPYTYSSQQQQQQQPGVSRTPLSATTSASATTSASGPHRIPILNTPPPHP
                     LPGNSSSAQSLYQVAKEVENQQKKLIDEMYNKQNHNQNQTNRHTTKPSSSSSSSSSSS
                     SSSSSVHHQFSNLNVNYRHQQFNDQYRRHPVLPPASQLRSTDSNLNSLSTLNSAV"
     gene            complement(<742869..>745904)
                     /gene="MAK21"
                     /locus_tag="KLMA_70362"
                     /db_xref="GeneID:34718107"
     mRNA            complement(<742869..>745904)
                     /gene="MAK21"
                     /locus_tag="KLMA_70362"
                     /product="ribosome biogenesis protein MAK21"
                     /transcript_id="XM_022821621.1"
                     /db_xref="GeneID:34718107"
     CDS             complement(742869..745904)
                     /gene="MAK21"
                     /locus_tag="KLMA_70362"
                     /codon_start=1
                     /product="ribosome biogenesis protein MAK21"
                     /protein_id="XP_022677964.1"
                     /db_xref="GeneID:34718107"
                     /translation="MSLDLSKLKEKVSSKLDASSKNKEAKAKKKEKSKEKSQKQEEKS
                     QEKSKEKSKEKPEENDELVREALSLGASEKDIELVNDVDDDASEIEFKDDDGKEVDEK
                     FKEDFNDLLKNMGFDKMKEPEVVEEEAPEEEEEEEEEEAEEAEEESSLSPPPAQEKEE
                     AKSDLINQTHIVQSDKLVVPSDMLWYEVPLDPELNREQDPLTTEQIDKLYQRGKEFLE
                     QDNTTYYEEFTKNSSQRKFMSQILNDGTLNDKISALTLLLQESPLHNIKSLDTLVGFC
                     GKKSRNSALQALNALKDLFLNGLLPDRKLKFFKNQNLSMLLNKRTLAVLYFEDYLKNL
                     YFKILEILEKLSHDPIIYVRLQVLNHIFDLLSAKPEQEFNLLKLGVNKLGDIDNKVAS
                     KASFKLLKLETLHPNMKSIIVDAVVDIAIRPQADYHTTYYSALTLNQTILKRSEMSLA
                     NQLIKTYFTLFEKFLIQTDADNEESKTKAKASDKSYEKKRKKNFKRGKKGGKSVVEEK
                     TEQDVIEEKNTKLFGAILTGLNRAFPFADMPGSVYEIHLDTLFKITHASNFNTSIQAL
                     VLIHQVVIKTGITNDRYYKTLYESLLDPRLVTSSKQGIYLNLLYKSLKEDKDIGRVDA
                     FVKRILQVCAHWLNVGAISGMFYLLIQLSKAIPQIRNLLLNSPLDAVYDSDDDEGDKN
                     DDKNKNNAAAANGYDSRKRDPKYANAEKSSLWEINQFLTHFHPTVQSYAQGFFDGDTQ
                     QTRELVKPDLGLFTLAHFLDRFVYRNAKQKPTTRGSSIMQPLGGVHTGALLVKASDKT
                     LHEVPVNTENWLNKKVQEIRPDEKFFYQYFSTKTAAIKSGKKEGDAGEFDEESDLDED
                     EVWDALVKSRPDVEGEDEDSDIEFSEEDFGSDLDSSSDAVEGMSEEDEDEDEDEEEEG
                     EEEEEEGDDNDEDADADDISDFDPEEAKIFTNDSEDEMGSDDEVFYSAADNSSDEDEE
                     EKEEPPRKKSKKSHKQKLRELPTFASADDYAQYLNSDED"
     gene            complement(<747125..>748459)
                     /locus_tag="KLMA_70364"
                     /db_xref="GeneID:34718108"
     mRNA            complement(<747125..>748459)
                     /locus_tag="KLMA_70364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821622.1"
                     /db_xref="GeneID:34718108"
     CDS             complement(747125..748459)
                     /locus_tag="KLMA_70364"
                     /note="HLH[cd00083], Helix-loop-helix domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677965.1"
                     /db_xref="GeneID:34718108"
                     /translation="MPLYSEDAYGDPDRGGSRSGSGSGSGSGSGSGSGSGSGSGSNSG
                     AGANIVYPGQSQGQGPGQGQGHDHGSSMLRTVSGSGSGTNTNNTGTGAGTSSAAITLP
                     RPHSQVHLNIGGSGSNSEAVGVGSGNGSGNRNGPGPGPGPGPGPSMLSMPTTMGHNDS
                     EKKYRNNINMHFQYLRRAVPTLRWCDDNSIPVESLEGLAPPSKVNKVQILAKSHEYIR
                     HLEHKNVLLQQKNEQLRMQLAQFMPKYGVPPGPPGPPGPPGPPGPGGPPPMGYLSEQQ
                     AQAQAQYQAQAQAQAQAQAQAQAQAQAQAQAQYQSQMQAQGMVDISSPSSKSLPPTPF
                     YRQPSQSQTQAQTPGQSQNQNQGAGQGASQGPGTAQTPRHPQGLGLAPGSIPNMGIPL
                     PHQQMYPIPPAPAPSQTQGQPQTQTPGPIPHQNYQYLKYQGYYQQPNQSGDE"
     gene            <751467..>752341
                     /gene="UBC4"
                     /locus_tag="KLMA_70365"
                     /db_xref="GeneID:34718109"
     mRNA            join(<751467..751513,751942..>752341)
                     /gene="UBC4"
                     /locus_tag="KLMA_70365"
                     /product="ubiquitin-conjugating enzyme E2 4"
                     /transcript_id="XM_022821623.1"
                     /db_xref="GeneID:34718109"
     CDS             join(751467..751513,751942..752341)
                     /gene="UBC4"
                     /locus_tag="KLMA_70365"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 4"
                     /protein_id="XP_022677966.1"
                     /db_xref="GeneID:34718109"
                     /translation="MSSLKRITKELNDLGRDPPTSCSAGPVGDDVYHWQASIMGPPDS
                     PYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINSNGNICLDILKDQWSPALTISK
                     VLLSICSLLTDANPDDPLVPEIAHLYKTDRAKYEATAKEWTKKYAI"
     gene            <753214..>757215
                     /gene="SPT7"
                     /locus_tag="KLMA_70366"
                     /db_xref="GeneID:34718110"
     mRNA            <753214..>757215
                     /gene="SPT7"
                     /locus_tag="KLMA_70366"
                     /product="transcriptional activator SPT7"
                     /transcript_id="XM_022821624.1"
                     /db_xref="GeneID:34718110"
     CDS             753214..757215
                     /gene="SPT7"
                     /locus_tag="KLMA_70366"
                     /codon_start=1
                     /product="transcriptional activator SPT7"
                     /protein_id="XP_022677967.1"
                     /db_xref="GeneID:34718110"
                     /translation="MLTDYQRSDAASILPTVERLFAEGVFKKYLNPSQLLLLKSLLHL
                     RDSELKARIWDSFLTGKLELFVKLQTKKTGQGSSDGAAVVGGSTGQDSETAAGGSSGN
                     GNGNGDDDDAENDLIDLEQLKAQLEGLDFIGNLSLKVRYVVWEHGLEDLQQQGPLDYL
                     LLEEKGRGESGPDEKLDNDVQMTDDGAADKPADGPANGPAGEPAVAPVTTTSRAAAAP
                     VDEEDDNYDDDEDDDDDDEDNYDDAEEDPQNVTMTNDQPIGGDSSTDSTAQTKPSEEE
                     QKTNSVDEGDSATSPTYEVLDNGIIKLHITITKDTLNELPSVNPYDIIGNFHKIYHLF
                     DNDKETVMRRLKLQENDQMLENSRKRSHDQIEGEEEEDDSGNPSIAHPKSSSDTKSKP
                     KGKNDIQMDLGVVNLSLRHLLKSVQENKSKLDISDYELKHLIMDVRMNRSKWASDDKI
                     GQEELYDACEKVVLELRNYTEHSTAFLNKVSKREAPNYDQIIKKPMDLNRVLKKLKTF
                     QYKSKHEFVDDIMLIWRNCLTYNSDPKHFLRAHAIAMQKKSQQLIPLIPDITIRDRAQ
                     VEKELEEADADSNVKEEEEDAGSGRKGIQRRGVQKVIDDEEDDSQEVQSRGKKAKPSD
                     TPNKKPASSGTEGTKTGSTSETEAKKSPTKQADSGNKEEQEEGAGGEGASSKPSSEQT
                     DSENNKESVQTAAQNTSSATDNNAAEEEEDEEDEEDNTTGMMLLESDDDKDDLELSTW
                     KTLTAKARAEICLKRSQLFTERKINAETDALLKNPSKLKHFDQFFEEYKQQKEAEFAR
                     QKLQEQSIMKNGFGAVMNQSDNALGNGASDSNFKSHSTESAIAKESNEITAEEVPLLT
                     EYNVTNYVPDLAYEGVGKEQLDALEENMVQKIVKEGTTMKSKLMNNIDKGLGPKMNHN
                     IQLIHEIRHICHKISLIRALQNPNKPKTPPQPQRFKEFIINDDIDLDPISQLASHDYK
                     SDEKLINRVLHRNVSKIAMSNGFESTEPTALNMLSEITADYLSNLIKTIKLHHETHST
                     NKRKPIDALNMTLLENGINKPDDLFTYMENEFGKKTRKLEDLKGKLSSFLKDLLRPAL
                     QDINERNFDDESQSFLTGDFSSEVTGEDFFGFKELGLEKEFGDLAGNVPLQLLTFQFS
                     GKDADIQVKTKVIQPEEFEDVIYKKVTRETVQSGTYSKLIQPLLQSAVDRCTAYFAKL
                     ARSKNANQVPKNYDSLSFPLLEDEEYPKVKGSNRPRLPPTGKISTNYKKKHVSELFVL
                     PEEEEKEEPKEEMEADKGVGSNKNDVSGIKETKDGVDDIFKAPMPIDENGFNIEETPM
                     SSFSLNLPGMPDN"
     gene            complement(<757323..>758624)
                     /gene="YOS9"
                     /locus_tag="KLMA_70367"
                     /db_xref="GeneID:34718111"
     mRNA            complement(<757323..>758624)
                     /gene="YOS9"
                     /locus_tag="KLMA_70367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821625.1"
                     /db_xref="GeneID:34718111"
     CDS             complement(757323..758624)
                     /gene="YOS9"
                     /locus_tag="KLMA_70367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677968.1"
                     /db_xref="GeneID:34718111"
                     /translation="MVSVLVFLVLSVTQFARLVFSEPVKDVQQIPYSLKYVDEDFFDA
                     IRGNETLMSKGKVVRIDDTECFYSTSPVEPEIMEEEELSEIVKVINDHLVGCLRKDDF
                     FWIYSLCSEEVRSLSQSHDKTKFILGQSANYNSTSDYSYEGSDDMPYIKQILNNGTIC
                     DITGRPRKTEIRYYCTYDAFSPIKISIEEVQTCQYIEKIFIPELCRFKSMNRLVEEFS
                     AHRIYCHKAQNNVSSLFYLLNHYSFQPCPKDIFLLTPNDRSVDRPVIMFRTELTDKEA
                     SVTTVEDKFIEGLLENLEYILKMEFIRTPEGGAIMPGDVFLWRAPVMDLDGQLLFLID
                     LEFNSASQAIARINYDIFMLDDLPLHNVVTFSRVLDLETTPNPNYGPSKVYKIFQNPV
                     IHPPENIGEDAMGRKIAEALSQAFAEAGLEGFDFQMVEADV"
     gene            <758881..>759471
                     /locus_tag="KLMA_70368"
                     /db_xref="GeneID:34718112"
     mRNA            <758881..>759471
                     /locus_tag="KLMA_70368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821626.1"
                     /db_xref="GeneID:34718112"
     CDS             758881..759471
                     /locus_tag="KLMA_70368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022677969.1"
                     /db_xref="GeneID:34718112"
                     /translation="MNLQGIVTVLLCLISFALANLEVSGDLYLIDDFGSRLELAKLSS
                     TPEDAGNGIDISLDSLAASYEAGNYRVCANLGDYYNECFSYLTIEQPLAYQLKLETVG
                     NELIRMSLEKSSGVNGIEGVIEEIQQGVVPETIKLKKRTMTYEEKKKAESRGTGTAAF
                     EEDIVEEDQKTFVQKNWKFIVVGLLVYVFIANSSQQ"
     gene            <759701..>760519
                     /gene="HTD2"
                     /locus_tag="KLMA_70369"
                     /db_xref="GeneID:34718113"
     mRNA            <759701..>760519
                     /gene="HTD2"
                     /locus_tag="KLMA_70369"
                     /product="hydroxyacyl-thioester dehydratase type 2"
                     /transcript_id="XM_022821627.1"
                     /db_xref="GeneID:34718113"
     CDS             759701..760519
                     /gene="HTD2"
                     /locus_tag="KLMA_70369"
                     /codon_start=1
                     /product="hydroxyacyl-thioester dehydratase type 2"
                     /protein_id="XP_022677970.1"
                     /db_xref="GeneID:34718113"
                     /translation="MSLQRTLIDYVNPVTVQRCQSLLSTILGDNKTISSSTGYHLLFF
                     HPVPTKKTTLSNDGYYSYLTPSSILSQPRPYMRRMWVQGSIEFKKPLKNCWIRCQEDL
                     KFIKELKKDYFVSLKRTITDQDGSLFATELRTLMYTNKAVSEDFKTQEEELEPFSNVS
                     IIKVLDIDAMIYSSISSNPHRIHWDRDYCRNVEGYQDLIVQGPLIVQLAIAYVESVFN
                     KSVTGIKYKNTSHLYVGNDVEICVKEHKSKGSARVLIRDTIEKGRVYFEATARY"
     gene            complement(<760516..>761355)
                     /gene="IPK1"
                     /locus_tag="KLMA_70370"
                     /db_xref="GeneID:34718114"
     mRNA            complement(<760516..>761355)
                     /gene="IPK1"
                     /locus_tag="KLMA_70370"
                     /product="inositol-pentakisphosphate 2-kinase"
                     /transcript_id="XM_022821628.1"
                     /db_xref="GeneID:34718114"
     CDS             complement(760516..761355)
                     /gene="IPK1"
                     /locus_tag="KLMA_70370"
                     /codon_start=1
                     /product="inositol-pentakisphosphate 2-kinase"
                     /protein_id="XP_022677971.1"
                     /db_xref="GeneID:34718114"
                     /translation="MVVSIVGRGNANIVCVVDHDYTEVYRISVRFGQLSANNTYVQDN
                     YKYIDSVVRNIGPIGDLLVPMRIQAVPAISELGDLAKSEGVAIDEEYMSCIVMPHLYA
                     QQNIYKKLDHFNRVHFNEACDLVTWEFKPKWLYQSTDYCRNCSHNAWKGRGIGYCFLD
                     EPSVILHEVFETQQQLPLPREFLDDITKYLSAPDNILQRLYAAQLQAKDDLALLMILR
                     DVTCFLSWSQKTREISVKVVDVDLKPMEKLGHWKSTEAALSSLPNGMKRQRHDFGGTT
                     HIN"
     gene            <761665..>762804
                     /gene="DYS1"
                     /locus_tag="KLMA_70371"
                     /db_xref="GeneID:34718115"
     mRNA            <761665..>762804
                     /gene="DYS1"
                     /locus_tag="KLMA_70371"
                     /product="deoxyhypusine synthase"
                     /transcript_id="XM_022821630.1"
                     /db_xref="GeneID:34718115"
     CDS             761665..762804
                     /gene="DYS1"
                     /locus_tag="KLMA_70371"
                     /codon_start=1
                     /product="deoxyhypusine synthase"
                     /protein_id="XP_022677972.1"
                     /db_xref="GeneID:34718115"
                     /translation="MSNIDGKLPDILNDAVLKQSAPVPDDFVKVEGIDYSKPESRNMR
                     AKDLTKAMSTMGFQASSLGKACTIIDEMRTWRGEHIDKLDEHDRKGSFDENGYQKTTI
                     FMGYTSNLISSGLRETLRFLVQHKMVDAIVASAGGIEEDIIKCLAPTYLGEFSLPGKG
                     LRDQGMNRIGNLLVPNDNYCKFEEWIVPVLDKMLEEQEEYIKKNGADCLDSSFDQDTP
                     IWTPSKLIRRLGKEINDESSVLYWAYKNDIPIFCPAVTDGSIGDMLFFHTFKASPKQL
                     RLDIVSDIRRINSMSMEASRAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEFD
                     GSDAGARPDEAVSWGKIKADAKSVKVYADATVVFPLVVAATFASE"
     gene            <763302..>764603
                     /gene="OMS1"
                     /locus_tag="KLMA_70372"
                     /db_xref="GeneID:34718116"
     mRNA            <763302..>764603
                     /gene="OMS1"
                     /locus_tag="KLMA_70372"
                     /product="methyltransferase OMS1"
                     /transcript_id="XM_022821631.1"
                     /db_xref="GeneID:34718116"
     CDS             763302..764603
                     /gene="OMS1"
                     /locus_tag="KLMA_70372"
                     /codon_start=1
                     /product="methyltransferase OMS1"
                     /protein_id="XP_022677973.1"
                     /db_xref="GeneID:34718116"
                     /translation="MFAISGRCVRITKCSPIRTVPRAMGLVGALRWKTTYIPSPDSVY
                     RKPKTKEQLAKEKFEADLKSDNRFIRWGAIARSEKFSKGLTKYIIGLYVLFIIYGLNY
                     TKKLYKKEKELEKLTIKVDNGEANEYEILRYKELRNKLRTRDVEKLKKYKEIIEAEGT
                     ENLDEMKLETIDENTNNEHILPARDTTDFYEMKAEEYDDGVNFEEMMIRMGKRRKWLM
                     KHCKGDVLEVACGTGRNIKYLDPLAINSITFLDASEKMMEITHKKFRDYLPNFKKCAF
                     VVGKAEDLVDMNAKSGSAAPVKYDTIVEAFGLCSHKDPVKALKNFAELLKPGGRIVLL
                     EHGRGTYDTINKILDDRAEKRLKTWGCRWNLDIGEILDDSGLDIVEEKRTHLGTTWCI
                     VAKRKGDGKKKDEIGFFEKYLGSSVKQRMDSFYNNDKPKDK"
     gene            complement(<764740..>765810)
                     /gene="RRP4"
                     /locus_tag="KLMA_70373"
                     /db_xref="GeneID:34718117"
     mRNA            complement(<764740..>765810)
                     /gene="RRP4"
                     /locus_tag="KLMA_70373"
                     /product="exosome complex component RRP4"
                     /transcript_id="XM_022821632.1"
                     /db_xref="GeneID:34718117"
     CDS             complement(764740..765810)
                     /gene="RRP4"
                     /locus_tag="KLMA_70373"
                     /codon_start=1
                     /product="exosome complex component RRP4"
                     /protein_id="XP_022677974.1"
                     /db_xref="GeneID:34718117"
                     /translation="MSSVISVSKRKEFFSNGLLEEEIDSEYESEEDLRNEDKDVEMDG
                     TSEHQDGSIVTPGELITDDPIWMKGHGTYFLENKTYSSVVGQVSRVNRLLSVLPLKSR
                     YIPETGDHIIGRITEVGNRRWKVDIGAKQYAVLMLGSVNLPGGVLRRKSETDELQMRN
                     FLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGQFVQVPSSLIVRSKNHTHNLPG
                     NVTVILGVNGFIWIRKSSKMDLSGGASATGSGQSADHMPGVSGNAMSVSITRLEEESS
                     WGIYSDVNDKVPVSIRQTITRYANVIRALAHCELGITESRIISAYEASMAYGNVGELI
                     ETETMQSLGQDVINAEKMRGTS"
     gene            <766048..>767556
                     /gene="TRM5"
                     /locus_tag="KLMA_70374"
                     /db_xref="GeneID:34718118"
     mRNA            <766048..>767556
                     /gene="TRM5"
                     /locus_tag="KLMA_70374"
                     /product="tRNA (guanine-N(1)-)-methyltransferase"
                     /transcript_id="XM_022821633.1"
                     /db_xref="GeneID:34718118"
     CDS             766048..767556
                     /gene="TRM5"
                     /locus_tag="KLMA_70374"
                     /codon_start=1
                     /product="tRNA (guanine-N(1)-)-methyltransferase"
                     /protein_id="XP_022677975.1"
                     /db_xref="GeneID:34718118"
                     /translation="MIIRRFISKMSERLARYEPPVHRGMKELDRNAFRKTLPLVVLLL
                     KDPKNISKFTNGFKDDVLRMPRIPFVIRINEAQEKGKQLERAEPGPVQKKSKSLANDN
                     HITKGILLKDTINDVSEVREKLSKEALEFLDKPENEYELRNHEYVLDYDFWKVEEILE
                     SILPEEYLDEIPTGFTIVGHVAHLNLRKEFKPFGSLIGQVILDKNTTIRTVVDKVDTI
                     ATKFRTFQMNVLAGEPDLLVTQRESDCTFTFDFSKVYWNSRLHTEHARLVSLFKPGQI
                     VGDVFAGVGPFSVPAGKKKVIVLSNDLNPESYKYMQLNIKNNKVGNFVEPLNLDGREF
                     IRDSPKLLQQFVAKNQGVIIVPGGKKYKDKTTGETKRTPETRIPIENQFFDHYVMNLP
                     DSALEFLDEFVGLYSRHNLTYESMVQTHGPEFQTPWIHCHCFHKYDPEEQPEPSMEQL
                     HERVHKRILSIMHTNEQVLPFEHFQFHLVRKVAPTKPMFCVSFQLPKSLAFA"
     gene            <768424..>769092
                     /gene="PCL5"
                     /locus_tag="KLMA_70375"
                     /db_xref="GeneID:34718119"
     mRNA            <768424..>769092
                     /gene="PCL5"
                     /locus_tag="KLMA_70375"
                     /product="PHO85 cyclin-5"
                     /transcript_id="XM_022821634.1"
                     /db_xref="GeneID:34718119"
     CDS             768424..769092
                     /gene="PCL5"
                     /locus_tag="KLMA_70375"
                     /codon_start=1
                     /product="PHO85 cyclin-5"
                     /protein_id="XP_022677976.1"
                     /db_xref="GeneID:34718119"
                     /translation="MQHLTPVDRSESGSLGNFANDHPGSSSNSSNNTLNGYVATLLSA
                     LTSNYSNQRINNSKHLILQFLTEIVRRSKSSHHVVIHATYLFHQLYTNGLKRVSMTGM
                     PEFARCSKRVFLSCLILAHKFNNDSTFSMKTWGLISGLKVRDLATMERWALSIFDYKL
                     YVSASVLAKWYTEVLSESFEQTQHQQPCSRKRPLDHHHTGDADESHLDTPHKLRKQAH
                     IEIR"
     gene            <769405..>770004
                     /gene="ARL3"
                     /locus_tag="KLMA_70376"
                     /db_xref="GeneID:34718120"
     mRNA            <769405..>770004
                     /gene="ARL3"
                     /locus_tag="KLMA_70376"
                     /product="ADP-ribosylation factor-like protein 3"
                     /transcript_id="XM_022821635.1"
                     /db_xref="GeneID:34718120"
     CDS             769405..770004
                     /gene="ARL3"
                     /locus_tag="KLMA_70376"
                     /codon_start=1
                     /product="ADP-ribosylation factor-like protein 3"
                     /protein_id="XP_022677977.1"
                     /db_xref="GeneID:34718120"
                     /translation="MFHLARSVYKHWNLREQHDILILGLDKSGKTSFIETLKAYLLKP
                     SKALDRIQPTIGQNVSFVSIDSHHIWKIIDVSGQESFRYLWDSYFNKENIHAVVYVVD
                     SSDPDRLQESVDELRARYLANPPAVQIPIAIIINRADLCLDISLFIDKFTELMIDLDV
                     KRSNVFQISSDQPQDLHDSIQWLRTQLDENKDVISPSYR"
     gene            <770483..>772123
                     /gene="PHO8"
                     /locus_tag="KLMA_70377"
                     /db_xref="GeneID:34718121"
     mRNA            <770483..>772123
                     /gene="PHO8"
                     /locus_tag="KLMA_70377"
                     /product="repressible alkaline phosphatase"
                     /transcript_id="XM_022821636.1"
                     /db_xref="GeneID:34718121"
     CDS             770483..772123
                     /gene="PHO8"
                     /locus_tag="KLMA_70377"
                     /codon_start=1
                     /product="repressible alkaline phosphatase"
                     /protein_id="XP_022677978.1"
                     /db_xref="GeneID:34718121"
                     /translation="MNSERTGLLPGGNKTAKRGFRYVIMGVVIVLAGLMVVAHNFTLR
                     THPDSISKKRNVIFFVSDGMGPASLSMTRSWQQHSQGLPFSHMLNLDKAFIGSSRTRS
                     SSSLITDSAAGATAFSCALKSYNGAIGVDPDKRPCGTILEAAKLQGYMTGMVVTTKIT
                     DATPAAFSAHADYRSMEMLIAQQQLGEYELGRVVDLIIGGGRTFFYPRGATSSPYGVS
                     GSRTDGRDLIKEAIADGWQYAGDRRSFDALEQGKNVKLPLLALLADYDIPFDIDRLDS
                     EHPSLKEEAITAINALTKATENSDKGFFLLIEGSRIDHAGHLNDPAAQVREVTAFDET
                     FKAVVEYANNSDVETVILSTSDHETGGLVTARQVTENYPDYIWYPEILRKVQHSCEYL
                     AKKLIQQKQSDSKHALAKFIEKEIVEQGLGIEDYTKDDIDEIASLIDTPGKLMDKLNN
                     MVSVRAQIGWTTHGHSAVDVNIYGFSNKKASKSAILENLGGNHENTDIGHFMKEYLGL
                     DLQKVTEMLENTTHTQDIVSAAELDFEYKPSFLQEMLD"
     gene            complement(<772253..>773431)
                     /gene="MNN9"
                     /locus_tag="KLMA_70378"
                     /db_xref="GeneID:34718122"
     mRNA            complement(<772253..>773431)
                     /gene="MNN9"
                     /locus_tag="KLMA_70378"
                     /product="mannan polymerase complexes subunit MNN9"
                     /transcript_id="XM_022821637.1"
                     /db_xref="GeneID:34718122"
     CDS             complement(772253..773431)
                     /gene="MNN9"
                     /locus_tag="KLMA_70378"
                     /codon_start=1
                     /product="mannan polymerase complexes subunit MNN9"
                     /protein_id="XP_022677979.1"
                     /db_xref="GeneID:34718122"
                     /translation="MARMSLIAYRVRKSPFLFVVLPIFALFCMYQVLFSKEGSILGLS
                     DAIVNNQWAHQQEKTFYFPYSKKYKMPKYTYKKASGWLLNDKGDDMIPEGHIARYDLN
                     KLKSTSNAVANEEKVLILTPMQTFHQGYWDNLLKMTYPRTLIELGFIIPRTASGDVAL
                     QKLETAVRAVQTGPKEERFAKITILRQASQSFDRLGEKERHALEVQKERRGAMALARN
                     ELLFSTIGPHTSWVLWLDADIIETPSTVIQDMTALNKPVLAANVYQRYFDKEEKKSKI
                     RPYDFNNWAESEIGLQLAQSMGDDEIIVEGYSDIATYRPLMAHFYDENGASNAIMELD
                     GVGGGCTLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYTVHGLPNYLVYHIEE
                     "
     gene            <773992..>774363
                     /locus_tag="KLMA_70379"
                     /db_xref="GeneID:34718123"
     mRNA            <773992..>774363
                     /locus_tag="KLMA_70379"
                     /product="nucleus export protein BRR6"
                     /transcript_id="XM_022821638.1"
                     /db_xref="GeneID:34718123"
     CDS             773992..774363
                     /locus_tag="KLMA_70379"
                     /codon_start=1
                     /product="nucleus export protein BRR6"
                     /protein_id="XP_022677980.1"
                     /db_xref="GeneID:34718123"
                     /translation="MVSASRAVFQLLLVALVCHFCWTVHKDVQWQLMEQEWVDMKKIS
                     RCKLEYVQNRCSEGLRPALVQKCEEWWHCAQLDSHPSVHQMASLYATTLAQTLNSFVQ
                     ALAFRTILLLLVLIYVSRHVL"
     gene            complement(<774408..>775574)
                     /gene="RAI1"
                     /locus_tag="KLMA_70380"
                     /db_xref="GeneID:34718124"
     mRNA            complement(<774408..>775574)
                     /gene="RAI1"
                     /locus_tag="KLMA_70380"
                     /product="protein RAI1"
                     /transcript_id="XM_022821639.1"
                     /db_xref="GeneID:34718124"
     CDS             complement(774408..775574)
                     /gene="RAI1"
                     /locus_tag="KLMA_70380"
                     /codon_start=1
                     /product="protein RAI1"
                     /protein_id="XP_022677981.1"
                     /db_xref="GeneID:34718124"
                     /translation="MGLTANLFVQKRSNATALKQPKEIGHYSRTQDNEFLVNDSSRLA
                     YYYLPDTDLDKRLDLLSGIKKFKECNTDDFDSTTLHGLLSTLIEYEKRKGKKTKVDII
                     TFRGIMRKLISSAFDSPQFNVVNLRVVSFDGQLFIKEMKDASATEASSINKNRESMQA
                     KAYYSGYKFETLATLSQPLPLVSRTTLEKRPKRLINNGDQYISLVRTGIGKCKILLGA
                     EVDCIFDFKEDSDDNLKHYAELKCTTMVNTVADAHKFERKLFRTWLQCFLVGINRIIY
                     GFRDEHFLLRSVEEFTTAEVPVILKNNNPQMQTSCVDAIKWYGAFTEWLLSSIPLDNE
                     NPTAVKAYRLIFENNHLKLSEIEAGDEEYASIVEGEAVLSNSFKEWRKSLHKQD"
     gene            complement(<776032..>777933)
                     /gene="PTR2"
                     /locus_tag="KLMA_70381"
                     /db_xref="GeneID:34718125"
     mRNA            complement(<776032..>777933)
                     /gene="PTR2"
                     /locus_tag="KLMA_70381"
                     /product="peptide transporter PTR2"
                     /transcript_id="XM_022821641.1"
                     /db_xref="GeneID:34718125"
     CDS             complement(776032..777933)
                     /gene="PTR2"
                     /locus_tag="KLMA_70381"
                     /codon_start=1
                     /product="peptide transporter PTR2"
                     /protein_id="XP_022677982.1"
                     /db_xref="GeneID:34718125"
                     /translation="MSASGALSHKDETEVTSKVANNDTTASSNNDSSSREDLNESKKL
                     DEKFENRDLEVYVSDHNEASDKIDFIGGDIDDNGREPTEEEMQTLVHVAEKIPFTCWL
                     IAIVELAERFSYYGLSAPFQNYMQNGPHDTPKGVLQLKSQGATALSYFFQFWCYLTPL
                     LGGYLSDTFWGKYKTICVGAGIYLVGIFLLFMTSIPSINHRNSSLGGYILSLILIGIA
                     TGFIKSNLSVLIADQIPKTKPRIKVLKNGTKVIEDPNVTMQNVFMFFYLMINIGSLSV
                     MATTHLEAEYGFWAAYLLTFCFFWIGIVVLVFGKNKYVKKPIGDNVIAKSFRVCFIAL
                     RNGFNLNRAVPSLNPEKEYPWNDLFVDEIRRAFKACKVFVFYPIYWLVYGQMLNNFVT
                     QAGTMELHGLPNDFLQAINSISLIVFIPIMEHLVYPFIRRFTPFRPVTKIFWGFTFGA
                     ASMVYAAVLQHFIYKAGPCYDHPLKCSPEFKNTPNRVHIGWQVPAYVLIGLSEIFASI
                     TGLEYAYSKAPASMKAFIMSIFLVTNAFGSAIGIAMSPTSEDPKYVWTFSGLAVACFL
                     AGCAFWGCFQHYNKDEERMNALDYEVEEQALTHVGVTGEATALYSVSSARSATQQQQQ
                     LRQKMSREV"
     gene            complement(<779556..>781448)
                     /gene="PTR2"
                     /locus_tag="KLMA_70382"
                     /db_xref="GeneID:34718126"
     mRNA            complement(<779556..>781448)
                     /gene="PTR2"
                     /locus_tag="KLMA_70382"
                     /product="peptide transporter PTR2"
                     /transcript_id="XM_022821642.1"
                     /db_xref="GeneID:34718126"
     CDS             complement(779556..781448)
                     /gene="PTR2"
                     /locus_tag="KLMA_70382"
                     /codon_start=1
                     /product="peptide transporter PTR2"
                     /protein_id="XP_022677983.1"
                     /db_xref="GeneID:34718126"
                     /translation="MSASGALSLKDETEITSKMANNNSASSNSELSSREDLKDAKKFD
                     EDKTHEIYVSEHNETSEKIDFIDGEVDDNGREPTEEEMQTLLHVSERIPFTCWLIAIV
                     ELAERFSYYGLSAPFQNYMQNGPHDTPKGVLELKSQGATALSYFFQFWCYLAPLLGGF
                     LSDTYWGKYNTIFVGAFIYVAGIFILFITSIPSINHRNSSLGGYIVSLILIGIATGFI
                     KSNLSVLIADQIPKTKPRIKVLKNGTKVIEDPNVTMQNVFMFFYLMINIGSLSVMATT
                     HLESKYGFWAAYLLTFCFFWIAIIVLVYGKNKYVKKPLGDHVIAKSFRVCFIALCNGF
                     NLNRAVPSLNPEKEYPWNDVFVDEIRRAFKACKVFVFYPIYWLVYGQMLNNFVTQAGT
                     MELHGLPNDFLQAIDSIALIVFIPIMEHLAYPFIRRFTPFRPVTKIFWGFLFGAASMV
                     YAAVLQHFIYKAGPCYDHPLNCGPQYKNTPNRVHIGWQVPAYVLIALSEIFASITGLE
                     YAYSKAPASMKAFIMSIFLVTNAVGSAIGIAMSPTSKDPKYVWTFSGLAVACFLAGCA
                     FWVCFQHYNKDEESMNALDYVVEEQALSNVGVTGEATALYSISSARSVTQKQQQELRQ
                     NISQAA"
     gene            complement(<783410..>785311)
                     /gene="PTR2"
                     /locus_tag="KLMA_70383"
                     /db_xref="GeneID:34718127"
     mRNA            complement(<783410..>785311)
                     /gene="PTR2"
                     /locus_tag="KLMA_70383"
                     /product="peptide transporter PTR2"
                     /transcript_id="XM_022821643.1"
                     /db_xref="GeneID:34718127"
     CDS             complement(783410..785311)
                     /gene="PTR2"
                     /locus_tag="KLMA_70383"
                     /codon_start=1
                     /product="peptide transporter PTR2"
                     /protein_id="XP_022677984.1"
                     /db_xref="GeneID:34718127"
                     /translation="MSASGAYSKDETEATSKTVNHSSSHNNIGSTTSESSSKEDLIDN
                     KRVDEKVDNKDLEIYVSDHNEASDKIDFISGDIDDNGREPTEEEMQTLMHVSERIPFT
                     CWLIAIVELAERFSYYGLSAPFQNYMQNGPHDTPKGVLELKSQGATALSYFFQFWCYL
                     TPLLGGFLSDTYWGKYNTIFVGAVIYVVGIFILFMTSIPGINHRTSSLGGYIVSLILI
                     GIATGFIKSNLSVLIADQIPKTKPRIKVLKNGTKVIEDPNVTMQNVFMFFYLMINIGS
                     LSVMATTHLESQYGFWAAYLLTFCFFWIAIIVLVYGKNKYVKKPIGDHVIAKSFRVCF
                     IALRNGFNLNRAVPSLNPEKEYPWNDVFVDEIRRAFKACKVFVFYPIYWLVYGQMLNN
                     FVTQAGTMELHGLPNDFLQAIDSIALIVFIPIIEHFFYPFVRRFTPFRPVTKIFWGFT
                     FGAASMVYAAVLQHFIYKAGPCYDHPLKCSPEFKNTPNRVHIGWQVPAYVLIALSEIF
                     ASITGLEYAYSKAPASMKAFIMSIFLVTNAVGSAIGIAMSPTSEDPKYVWTFSGLAIA
                     CFVAGCAFWCCFQHYNKEEERMNALDYEVEEQALTNVGVTGEASALYSVSSARSATQQ
                     LRQKLSHSA"
     gene            complement(<787390..>789126)
                     /gene="UGA4"
                     /locus_tag="KLMA_70384"
                     /db_xref="GeneID:34718128"
     mRNA            complement(<787390..>789126)
                     /gene="UGA4"
                     /locus_tag="KLMA_70384"
                     /product="GABA-specific permease"
                     /transcript_id="XM_022821644.1"
                     /db_xref="GeneID:34718128"
     CDS             complement(787390..789126)
                     /gene="UGA4"
                     /locus_tag="KLMA_70384"
                     /codon_start=1
                     /product="GABA-specific permease"
                     /protein_id="XP_022677985.1"
                     /db_xref="GeneID:34718128"
                     /translation="MSGEQDSMSKKSGVVEQIVPQTSGDDIGVGSVSELRVVSSSHGV
                     PIRNIDALNATSDQHVLAEIGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLI
                     AGPVGLNWGWFVAGGLILTVGISLGELASSIPTAGAVYVACFQWGPAKWRKSISYSVG
                     FLDTLSLCASVCSIVYGLAEQILSAVVVTDPDFNVTSGITYGVFCASMVAITLLTSLS
                     SKVTAKLQTISIFANMFLIILFLIVLPIGVSRSKKVNFNDASFIFGKVENLSDWNTGW
                     SWAINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWILCIVLLA
                     CMNPDINAIVNSAYGQGITQVFMDALGKRWTLTFLSLLIICQFLMGASTVLANSRQFW
                     AFSRDDGIPFSRFFKKVDERTFVPMRAVWGSTLFSIALGALSLAGDTAASALFSLSIA
                     GMYMALVFPIALRLTYGKNDFKPGPFYLGDFWSPINGWISVAFQLFTVIMVMFPGQMH
                     DITPDTMNYTVVIGPGFWVISLIYYFSWQRKFYEGPKSNLTDEEFAEVMGEDGIDAMI
                     SNYVQSHSDKMS"
     gene            complement(<791600..>792535)
                     /gene="PAN6"
                     /locus_tag="KLMA_70385"
                     /db_xref="GeneID:34718129"
     mRNA            complement(<791600..>792535)
                     /gene="PAN6"
                     /locus_tag="KLMA_70385"
                     /product="pantoate--beta-alanine ligase"
                     /transcript_id="XM_022821645.1"
                     /db_xref="GeneID:34718129"
     CDS             complement(791600..792535)
                     /gene="PAN6"
                     /locus_tag="KLMA_70385"
                     /codon_start=1
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="XP_022677986.1"
                     /db_xref="GeneID:34718129"
                     /translation="MKTLNTVEEVRAWRKQNDVRNESVGFVPTMGCLHAGHASLVERS
                     VRDNKFTVVSIFVNPSQFAPSEDLDKYPRTLEKDKQLLESLGVDAVFVPQAQDIYPRG
                     IPLDVSKQTGPFISVLGLSEKLEGKTRPNFFRGVATVVGKLFNIVQPTKAYFGQKDYQ
                     QFVVLQTMVKELFFDIELVMMPIKRSDTGLALSSRNKYLSAESVAIASNIYKGLETGR
                     EVIQKGKQSPNSGDIITRDVVINAIQEVWEPFYKTKDFKLDYISVADAETLDEVETLS
                     GCKANLVISCAVYVTDRVDSSVTVRLIDNVLVPAQ"
     gene            <792982..>795012
                     /gene="NDC80"
                     /locus_tag="KLMA_70386"
                     /db_xref="GeneID:34718130"
     mRNA            <792982..>795012
                     /gene="NDC80"
                     /locus_tag="KLMA_70386"
                     /product="probable kinetochore protein NDC80"
                     /transcript_id="XM_022821646.1"
                     /db_xref="GeneID:34718130"
     CDS             792982..795012
                     /gene="NDC80"
                     /locus_tag="KLMA_70386"
                     /codon_start=1
                     /product="probable kinetochore protein NDC80"
                     /protein_id="XP_022677987.1"
                     /db_xref="GeneID:34718130"
                     /translation="MEEIRTSGAMGTEDVLNSVNPYRYTSQIPNGKGNNNINAKINGN
                     NTLTNMINRSIAKNMNQNGGNNGMRNSMRLSLRNSLPRSSIGPQLSQPTPQLNSTQNS
                     TYHNTSRDPRPLRDKNFQNLLQHEIFSYLSDQKFDVETNHPISLKSLRQPTQKDFIYM
                     FKWLYLRLDPGYVFTKSLEHEVYSILRTIHYPYLATINKSQISAVGGSNWPKFIGMLH
                     WLVVINKKLDECLEHLDMSINNQVTQDITVLNQPLKTVEQQEKKQEKYELMVERLFID
                     YITESYKSFLRLEDDYEPYLHDLELTFQRFVHIIETDIAQLTSTNEQLSVECETIVAK
                     NYDLKTIKEKNVALEHEYKRLSHSVQNTESKSKEWPEKLKELEAEIEKKKKDIRHVST
                     QIDDLNAILKKKNVSGEEIENKNRESDTISKNLDTVSSRLDQFTGLVRQQRLETESVY
                     KNLQDTLKQYKSATEGLIIARKNVGDKIPESSIQLTLPSDLMSEEKIGLTVEELIGEG
                     KSFTESAKKNLHKIAADIQERITSIQSENSKLQESLEDLRNEITVKNEELELLEQELS
                     SVKTEHEEFRQESQSQLLSQNITIEKLERKIQNARVESQQKISKIERDAEQTKLELEE
                     LKIQQSRQRLELHNKIIDLIEYVSNFKIKTQSSLESLQNATTRELERLKNEP"
     gene            complement(<795370..>797970)
                     /gene="SSL2"
                     /locus_tag="KLMA_70387"
                     /db_xref="GeneID:34718131"
     mRNA            complement(<795370..>797970)
                     /gene="SSL2"
                     /locus_tag="KLMA_70387"
                     /product="DNA repair helicase RAD25"
                     /transcript_id="XM_022821647.1"
                     /db_xref="GeneID:34718131"
     CDS             complement(795370..797970)
                     /gene="SSL2"
                     /locus_tag="KLMA_70387"
                     /codon_start=1
                     /product="DNA repair helicase RAD25"
                     /protein_id="XP_022677988.1"
                     /db_xref="GeneID:34718131"
                     /translation="MEDEVDERPYHTRSRGRKDKLVQDAVFSDDSLVTDDEEYGDIAP
                     EIDDNVLDEEEEEELREELMKSGDSAPKVNPLLSRKSKKSALSGGSSKAAAAAAAAAA
                     GSGMNHKLAQKDDFLHAHLDDIPPDFEPDVVSGMFKSNDFSYLKLKPDHASRPLWISP
                     NDGRVILESFSPLAEQAQDFLVTIAEPVSRPSHIHEYRITAYSLYAAVSVGLETEDII
                     SVLDRLSKVPVAPSIVNFIKSATVSYGKVKLVIKHNRYFVETSQADILQMLLNDPIIG
                     NLRIDTDAAIDAAAAKKKLTDSAIETQGVNPNDVKAVFSAVVGSNKELEEEDDDIDAV
                     HAFEIDNASVEIVKKRCQELDYPVLEEYDFRNDHRNPDLDIDLKPSTQIRPYQEKSLS
                     KMFGNGRARSGIIVLPCGAGKTLVGITAACTIKKSVIVLCTSSVSVMQWRQQFLQWCT
                     LQPENVAVFTSDNKEMFQTESGLVVSTYSMVANTRNRSYDSQKVMDFLTGREWGFIIL
                     DEVHVVPAAMFRRVVSTIAAHAKLGLTATLVREDDKISDLNFLIGPKLYEANWMELSQ
                     KGHIANVQCAEVWCPMTAEFYQEYLRENARKRMLLYIMNPTKFQAAQFLIQYHERRGD
                     KIIVFSDNVYALQEYALKLGKPFIYGSTPQQERMNILQNFQYNDQINTIFLSKVGDTS
                     IDLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKDTQEMYYS
                     TKRQAFLVDQGYAFKVITHLHGMENLPNLAYSSARERRELLQEVLLKNEEAAGIEVGD
                     DNDNYIWKNGGKNKKARNKSRAVRSEGSLAGLAGGEDMAYLEYSSNKNKDLRDHHPLI
                     RKMYYKSANK"
     gene            <798830..>800068
                     /gene="SRP40"
                     /locus_tag="KLMA_70390"
                     /db_xref="GeneID:34718132"
     mRNA            <798830..>800068
                     /gene="SRP40"
                     /locus_tag="KLMA_70390"
                     /product="suppressor protein SRP40"
                     /transcript_id="XM_022821648.1"
                     /db_xref="GeneID:34718132"
     CDS             798830..800068
                     /gene="SRP40"
                     /locus_tag="KLMA_70390"
                     /codon_start=1
                     /product="suppressor protein SRP40"
                     /protein_id="XP_022677989.1"
                     /db_xref="GeneID:34718132"
                     /translation="MSVKKASSKASVPKLSKKDEKKVKSREESSSDSDSSSGSGSSSS
                     SSSESESSSSSESDSDSDSSSSSGSSSSSDSDSDSDSSSSSSSGSSSDSDSDSSSSSS
                     SSSSESESDSDSEETTEKKEVKKEEKKEEKKDEESSSDSDSSSSSSSDSDSDSSSSSS
                     SDSDSDSSSSSSSSSSSSSDSDSDSDSDSDSDSDSSSSSSSSSDSDSDSESSSSSSSD
                     SDSDSDSDSSSSSSSSSDSDSDSDSDSDSSSDSDSDSDSDSDSSSSSSSSSDSSSDSD
                     SDSDSEAAENSKKRTHDQQESPITSASSSNESSSSKESSPEEPPRKKKPIPAGKDEIK
                     PGQRKHFSRIEREKIQFEDETLTDNTYKGAAGTWGEMANEKLSRVRGKDFVKNKNKMK
                     RGSYRGGSITMATGSYKFTD"
     gene            <800811..>801032
                     /locus_tag="KLMA_70391"
                     /db_xref="GeneID:34718133"
     mRNA            <800811..>801032
                     /locus_tag="KLMA_70391"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821649.1"
                     /db_xref="GeneID:34718133"
     CDS             800811..801032
                     /locus_tag="KLMA_70391"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677990.1"
                     /db_xref="GeneID:34718133"
                     /translation="MGLLDDVKDFASKHKSEKDGDVIDQAEKYIGEERLGQIKKKVGE
                     ENFDKYEHQAKDFLDGKKEDDKKEEEKKE"
     gene            complement(<801146..>802375)
                     /gene="LPX1"
                     /locus_tag="KLMA_70392"
                     /db_xref="GeneID:34718134"
     mRNA            complement(<801146..>802375)
                     /gene="LPX1"
                     /locus_tag="KLMA_70392"
                     /product="peroxisomal membrane protein LPX1"
                     /transcript_id="XM_022821650.1"
                     /db_xref="GeneID:34718134"
     CDS             complement(801146..802375)
                     /gene="LPX1"
                     /locus_tag="KLMA_70392"
                     /codon_start=1
                     /product="peroxisomal membrane protein LPX1"
                     /protein_id="XP_022677991.1"
                     /db_xref="GeneID:34718134"
                     /translation="MERVTKTIRAACPRSDYRSTLAGTDVLEVVYDVYVPRGGPLGEP
                     YGASEAMGLPVVNIVFLHGTGMTRSIWEWYVEYLEAETRRGRWPFRLGKLITVDQVNH
                     GDSGVVNRGKLGTTFHWVDGARDVVKICELELFGEGQQQQQQQQAYNSYNVLVGHSMG
                     GHQALACGVLSPNMFQLIIGMEPVVKMVHKSGKGRPIESDIRLGPESIGSTMSLNYFK
                     AISRKVEDTFDDKEGYIEFMRKRSFWTNADERILERFCEAEYYLEEVKQTDGIPASVR
                     VKTKTAKDQHLISYLCLYPYTVWLMNNLQWIKTPVVCLVGAKSRWCPPENYQLFQERI
                     RNYQRITIPDVDHLMNIENPDTIAPLLLSHIRNGVSNANRDQLHTNKDDFGPLYTKFK
                     AESIGRSSQAHAKLSKL"
     gene            complement(<802815..>804080)
                     /locus_tag="KLMA_70393"
                     /db_xref="GeneID:34718135"
     mRNA            complement(<802815..>804080)
                     /locus_tag="KLMA_70393"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821652.1"
                     /db_xref="GeneID:34718135"
     CDS             complement(802815..804080)
                     /locus_tag="KLMA_70393"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022677992.1"
                     /db_xref="GeneID:34718135"
                     /translation="MEGTPKRHRANSLVGERSPETPSPSGGRDGARDDDSGISRPSFL
                     PSPRHHHQQPGHEHGQRHGHVYGHIQGHGHGHGHGHGHSHGNSSGAGFPKLNPQSPGK
                     TVSLMPPETPKSKNQELFLSPSLDLQSPVHKPFTANQKPIREISNNLKSRLNYAYVKM
                     MHHQKKDSTDESNATTTTTYTVKPSSYSNVFAQDSDTEPESVSFERKPDTKTGAGSGS
                     GSGSGSGHGSANSLLEPGIELIEENSAQAAFLKALQSPKKKQRSLSSTHPKITRTSSS
                     TDDGPNSQPSEVEAIETLMSLSSPHKRRPSGSFELTLPAPTPPPPSMSVPMSASASVG
                     TIERPIAIPNPGKSEAKLGPGSIISTSEQPKAQAQAKTQAQANAQGHAQDQSEVLLGS
                     PKLSKPAKLTLHSEVQTDVETDVESQSDD"
     gene            complement(<804564..>806042)
                     /gene="PXL1"
                     /locus_tag="KLMA_70394"
                     /db_xref="GeneID:34718136"
     mRNA            complement(<804564..>806042)
                     /gene="PXL1"
                     /locus_tag="KLMA_70394"
                     /product="paxillin-like protein 1"
                     /transcript_id="XM_022821653.1"
                     /db_xref="GeneID:34718136"
     CDS             complement(804564..806042)
                     /gene="PXL1"
                     /locus_tag="KLMA_70394"
                     /codon_start=1
                     /product="paxillin-like protein 1"
                     /protein_id="XP_022677993.1"
                     /db_xref="GeneID:34718136"
                     /translation="MSMSSPNLNSNSSSTYNTPQLGAGPGGAGSFPAIDPVEQSFQQL
                     TNEKRGEPEEKEEEEDDDNYVPDLAPKTDLQSLQSGPVPTPAPATANKNDSVSFKPSD
                     SISFEPNEALNKVLESAPQSVPGIFVTQEQEEQEQEQEQEQEQDTFSDSELPLEPEPG
                     LQLGLKGEPEPEVASVNGHVTDQTLVESQSQSPALPRAASPLPHATITHVPHLPEHEG
                     KLTAMEKLIAELDTVTLAREEEQLDIPTTSFMPQTVNKKSSAYMSRYEPQRIIIPDSP
                     AAVGNSHMSIQSNSTPTFYKFRKDLGPLAPEMEEEQQHQEQELQQEPQQEHSSVPPPA
                     KLKFPPGQGPCRHCNKEVLHKGIYSKHENELSGQWHRGCFKCIVCEKPFSKKVPCYIL
                     DDQPYCQLHFHESNNSICKVCDGFIEGECLENDKNERYHPSCLKCYICDHPITTDYYV
                     YNHKHTICHNHDLAELHRSPNLRDLGRSNTLSKRRTRLINFG"
     gene            <807444..>808685
                     /gene="PUS4"
                     /locus_tag="KLMA_70395"
                     /db_xref="GeneID:34718137"
     mRNA            <807444..>808685
                     /gene="PUS4"
                     /locus_tag="KLMA_70395"
                     /product="tRNA pseudouridine synthase 4"
                     /transcript_id="XM_022821654.1"
                     /db_xref="GeneID:34718137"
     CDS             807444..808685
                     /gene="PUS4"
                     /locus_tag="KLMA_70395"
                     /codon_start=1
                     /product="tRNA pseudouridine synthase 4"
                     /protein_id="XP_022677994.1"
                     /db_xref="GeneID:34718137"
                     /translation="MNGIFAIEKPSGVSSNNFLQQVKNALMKSSIFQSEIQRAVMERS
                     QQYAKETGKKPSKRKLRKVSQIKMGHGGTLDPLASGVMVIGIGTGTKKLSEYLGNCTK
                     VYETEALFGVGTTSGDSEGDIIAETSVKHLNWEDLKSVESKFVGHLKQTPPIYAALKL
                     NGKPLYEYAREGIPLPKAIEPRQIQIHSLQLHEDCLSRDHEYPMLRVKEGSEEEEVLN
                     KLNANLMEDKLYFSKEYCESQGLESEEAQVEPWIPITQEEKQVLMEEKDKYRAPLLHF
                     TTSVSSGTYIRSLISDIGKAMRSSCYMVKLIRCQQQEWALDRQNVFKLEHFENNDEKV
                     WSAVLQKVLSEGSSVNVEQEIARVASSAEPTAAPVETSAPVETSAAPAEPVALEDRPE
                     TKRTRSQEEDEDEDTEQNKNN"
     gene            complement(<808756..>810402)
                     /gene="MID1"
                     /locus_tag="KLMA_70396"
                     /db_xref="GeneID:34718138"
     mRNA            complement(<808756..>810402)
                     /gene="MID1"
                     /locus_tag="KLMA_70396"
                     /product="stretch-activated cation channel MID1"
                     /transcript_id="XM_022821655.1"
                     /db_xref="GeneID:34718138"
     CDS             complement(808756..810402)
                     /gene="MID1"
                     /locus_tag="KLMA_70396"
                     /codon_start=1
                     /product="stretch-activated cation channel MID1"
                     /protein_id="XP_022677995.1"
                     /db_xref="GeneID:34718138"
                     /translation="MQRWLVFEYLVWFWAFCGSSWASVSYSKYKSGHGGNETNPEVIR
                     DWNPVYASILKGQTDYYEFPINASNSNAFVLQSYELFIFLSGNICKYPKNPGTNVTLS
                     IFYSFSWPMNASNAQYSIFSDGYMEALAVMPFTSGDLSSSSSSSSTSNFTGNSTLYMS
                     VQLINNYTGKPYELDGDDDPEQDAWLYQLAVSQSDLAYQWDKRQWLDVVDTDYNSALL
                     VSGNISLANLNWDTQYSISNMSFYDVYVYESRYENYFDEMGLTKSLCAIKNGPYLVSS
                     VNSTYDPKVSENVSLSITDLGAYKSLTKRNGNLREQFHITGLNGSTTYVAFLTKKLAS
                     TSSESLSANSGVVFAKQKFTTMSDPSCTLIFGLGFCDGLAYSVPSSSLLKYEDKSELA
                     NVYDSIAESFYSNFSLAMQMITCDASEDELYSPLRSCDDCKVAYKDWLCSVSIPRCTT
                     TKTDYYIYRSASESRNDKLDELIKPASDYYEILPCIDTCVTMQRDCPPDFGFSCPPYR
                     TYRDLMLNSYNFFHPNETFLTCNFIGNTSDLVVKDPTMKY"
     gene            <810713..>811717
                     /gene="RFC3"
                     /locus_tag="KLMA_70397"
                     /db_xref="GeneID:34718139"
     mRNA            <810713..>811717
                     /gene="RFC3"
                     /locus_tag="KLMA_70397"
                     /product="replication factor C subunit 3"
                     /transcript_id="XM_022821656.1"
                     /db_xref="GeneID:34718139"
     CDS             810713..811717
                     /gene="RFC3"
                     /locus_tag="KLMA_70397"
                     /codon_start=1
                     /product="replication factor C subunit 3"
                     /protein_id="XP_022677996.1"
                     /db_xref="GeneID:34718139"
                     /translation="MQRSEENLPWIEKYRPETLDDVYGQPSVVNTVRKFVHEGRLPHL
                     LFYGPPGTGKTSTIVALAREIYGPNYRNMVLELNASDDRGIDVVRNQIKDFASTRQIF
                     SKGFKLIILDEADAMTNAAQNALRRIIERYTKNTRFCILANYAHKLTPALLSRCTRFR
                     FQPLPEAAIERRIANVLVKEHLQLSPEAHQALIKLSQGDMRRVLNVLQAARATLDDPD
                     PSTTDSHTITEDVIYECIGAPHPRDLETMLDSILKDDWTTTTYTVNKIRATRGLALID
                     MIEGMAELLDDYELKQETRTELLAALSDVEYAIARGGNDVIQTSATIGTIKRCMELEL
                     "
     gene            <812345..>813190
                     /gene="PCL1"
                     /locus_tag="KLMA_70398"
                     /db_xref="GeneID:34718140"
     mRNA            <812345..>813190
                     /gene="PCL1"
                     /locus_tag="KLMA_70398"
                     /product="PHO85 cyclin-1"
                     /transcript_id="XM_022821657.1"
                     /db_xref="GeneID:34718140"
     CDS             812345..813190
                     /gene="PCL1"
                     /locus_tag="KLMA_70398"
                     /codon_start=1
                     /product="PHO85 cyclin-1"
                     /protein_id="XP_022677997.1"
                     /db_xref="GeneID:34718140"
                     /translation="MFKKKSLEMLFESPVSDEMIKFLTDHALKVIPRHQQNYMPTPPS
                     TPGAGASTNGSKNGVPSLMTFISRLVRYTNVYTSTLLTTVVYLNRLRALLPADAAGLP
                     TTCHRVFLACLILSAKYHNDSSPLNKHWTRYTDGMFTLRDVNLMERQLLQLFDWDLRV
                     ESEELWQNLYALANPIRRDLEKGAQINKLRQQQQQQQKSKQVYYHQRNISACSSTATL
                     LGSRSGSVNSLDILKEYESSPENGYSETYAQKYSLGSGVGPSMSTTTLAPSLAPSLDP
                     RYSYM"
     gene            <816815..>818050
                     /gene="CAF40"
                     /locus_tag="KLMA_70399"
                     /db_xref="GeneID:34718141"
     mRNA            <816815..>818050
                     /gene="CAF40"
                     /locus_tag="KLMA_70399"
                     /product="protein CAF40"
                     /transcript_id="XM_022821658.1"
                     /db_xref="GeneID:34718141"
     CDS             816815..818050
                     /gene="CAF40"
                     /locus_tag="KLMA_70399"
                     /codon_start=1
                     /product="protein CAF40"
                     /protein_id="XP_022677998.1"
                     /db_xref="GeneID:34718141"
                     /translation="MFQAQTQGQMQSQMQGQLQGQPQGQPQAPVPGNMFTEQTRRKYF
                     PQLKPYFPGQPGQPGQPGQPGQPGQQNQIPQGQQNQIPPGLQHPQENSGQGQGPNQGP
                     NQGPVPAPGAAPGPGIVHALDDPNVYHWICQLTYGPSKEQALLELGKKREQYEDLAIV
                     LWSSFGVMTSLIKEIISVYPLLSPPALSNQLSNRVCNALVLLQCVASHPDIRPQFLQA
                     HIPLFLFPFLSTTSNQRTFEYLRLTSLGVIGALVKNDSAEVISFLLRTDIIPLCLRIM
                     ENSSELSKIVAIFILQKILLDDNGLQFVCATPERFYAVSQVLATMFKHMSQQQVPGRL
                     LKHVVRCYLRLSDNLEARRLLKQVLPQQLRDNTFTEALQDDVGTKRCLAQLLLTLGEG
                     QQQPPQPQPQQQPQQQQQQ"
     gene            <818500..>821370
                     /gene="SEC21"
                     /locus_tag="KLMA_70400"
                     /db_xref="GeneID:34718142"
     mRNA            <818500..>821370
                     /gene="SEC21"
                     /locus_tag="KLMA_70400"
                     /product="coatomer subunit gamma"
                     /transcript_id="XM_022821659.1"
                     /db_xref="GeneID:34718142"
     CDS             818500..821370
                     /gene="SEC21"
                     /locus_tag="KLMA_70400"
                     /codon_start=1
                     /product="coatomer subunit gamma"
                     /protein_id="XP_022677999.1"
                     /db_xref="GeneID:34718142"
                     /translation="MSTHTYKKSEDPHSGSLPDKMAIYQDCLNRFNESPVNPKLCRTL
                     ITSLLELLSHGETFPRQEATALFFSISKLFQHPNDSLRQIVYVAIKELCGISDDILMA
                     TSSIMKDVQNGSDLVKPNAIRALIRVLDESTAFSAERLLKNSLVSKNPSVCSASLVSS
                     YHLLPIAEATVKRFANETQEAVGDLKQLPFSDENSRYYPTPSHISQYHALGLLYRLKN
                     HDKMALIKLIQQFSGHSSPLKNALAQVQMVKIVHNLVLKDPHLIPQFLPLAANWLQNR
                     HEAVALEACKLVTSLSNLVPNELYVGAISVLQGFLSTPRVATRFAAVRLLNRISMVSP
                     EKIVVCNPELESLVNDSNRNISTYTITTLLKTGTDKNIGSLIKTITKFIHEVNDDFKV
                     IIIEAIRTLSLKFPEECDTILHFLIESLQSAEGSLQFKNSIVEALIDLIQFVPQSKEK
                     ALEELCDFIEDCEFNEILVRVLHLLGKEGPTTKNPSLYVRHIYNRVILENSVIRSAAV
                     VALSKFALVKNDPELVHSIEQLLVQIKTDPDDEVRDRASIALEFIESVKAKSDVAPIA
                     QNFIRPSTTYDVASLENKLSQYLSQGQEAFQEAFDPSSVAKYSEDELKALNLKRRQEQ
                     SLHQDGEGGASAATAGTTGSGAGHGAKKSHGIDSSTGDHHAGDAATDFFADDEEQSQQ
                     LSHFVTEMLELEQFQSFGKCLHSSKIVPLTEIEAEFVVKGIKHLFNDHVVLQFHITNT
                     LKDIALDNVEVACQPEGLSDGALGDTEEFVLPIERLLPDESESCYVCFAKSHDCSPTD
                     IIVERFSNSLKFQSKELDPSTSLPFEDDEGFEDEYEIDPLFLSPGDYMKPSFVSDFTS
                     TFEELPHESVAVYNIVESNTLQEVIDKLLISTGGLPLDNSRIVSHDTTQHTLKISGKS
                     ILDNSKALLSIKMIKTSKGIALKAQVKSDNETLAEDLANNLI"
     gene            <821719..>822234
                     /gene="NPC2"
                     /locus_tag="KLMA_70401"
                     /db_xref="GeneID:34718143"
     mRNA            <821719..>822234
                     /gene="NPC2"
                     /locus_tag="KLMA_70401"
                     /product="phosphatidylglycerol/phosphatidylinositol
                     transfer protein"
                     /transcript_id="XM_022821660.1"
                     /db_xref="GeneID:34718143"
     CDS             821719..822234
                     /gene="NPC2"
                     /locus_tag="KLMA_70401"
                     /codon_start=1
                     /product="phosphatidylglycerol/phosphatidylinositol
                     transfer protein"
                     /protein_id="XP_022678000.1"
                     /db_xref="GeneID:34718143"
                     /translation="MSIPSIIKLLLFCALANAISLSELVRQAPLTLNRPIPGGSPLLQ
                     CDLEEPQSLEITSVSLDPNPPQRGENLTVAASGILKTVVEEGAYVDVEVRLGYIKLLS
                     QTYDLCEQLEENDVSGLKCPIPADEYDLLKSVEIPNEVPPGRYSFFARAYNADDTQIT
                     CLTGEIVFPGY"
     gene            <822606..>823175
                     /gene="EMI5"
                     /locus_tag="KLMA_70402"
                     /db_xref="GeneID:34718144"
     mRNA            <822606..>823175
                     /gene="EMI5"
                     /locus_tag="KLMA_70402"
                     /product="succinate dehydrogenase assembly factor 2"
                     /transcript_id="XM_022821661.1"
                     /db_xref="GeneID:34718144"
     CDS             822606..823175
                     /gene="EMI5"
                     /locus_tag="KLMA_70402"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="succinate dehydrogenase assembly factor 2"
                     /protein_id="XP_022678001.1"
                     /db_xref="GeneID:34718144"
                     /translation="MIAPGILLQGARALPRAVPRAMPRVVSVARPVAWPMARHFHVSS
                     QVSNGKSQDKSQDKSPASSEAGEAADEDDVTLRIRIPPIERTGESLDRKRARLIYQSR
                     KRGILETDLLLSRFAAKYLKTMSPEELQEYDELLNELDWDIYYWATENYSITPLPDKW
                     KDSKMLKRLQEFSKNKDREILSMPDLSKY"
     gene            <823461..>823748
                     /gene="MRP10"
                     /locus_tag="KLMA_70403"
                     /db_xref="GeneID:34718145"
     mRNA            <823461..>823748
                     /gene="MRP10"
                     /locus_tag="KLMA_70403"
                     /product="40S ribosomal protein MRP10"
                     /transcript_id="XM_022821663.1"
                     /db_xref="GeneID:34718145"
     CDS             823461..823748
                     /gene="MRP10"
                     /locus_tag="KLMA_70403"
                     /codon_start=1
                     /product="40S ribosomal protein MRP10"
                     /protein_id="XP_022678002.1"
                     /db_xref="GeneID:34718145"
                     /translation="MSSKAPLYKLPPLPRLKVKKPIIQQEANRCLVLMSNLLQCWSSN
                     GHMHGVCDTLVQDLKACTAENAMGKNQKVQKSNINYHAARLYDRVGGKSHD"
     gene            complement(<823904..>824857)
                     /gene="FAD1"
                     /locus_tag="KLMA_70404"
                     /db_xref="GeneID:34718146"
     mRNA            complement(<823904..>824857)
                     /gene="FAD1"
                     /locus_tag="KLMA_70404"
                     /product="FAD synthetase"
                     /transcript_id="XM_022821664.1"
                     /db_xref="GeneID:34718146"
     CDS             complement(823904..824857)
                     /gene="FAD1"
                     /locus_tag="KLMA_70404"
                     /codon_start=1
                     /product="FAD synthetase"
                     /protein_id="XP_022678003.1"
                     /db_xref="GeneID:34718146"
                     /translation="MLHEVALHCYNITQSYLAINTEPLLNSTTRETIKHTQHAIQLSR
                     RYLLQDIFTRWDPFNGEISFSYNGGKDCQVLLIIYLGCLWELFMKSIQDSQYGVEYHR
                     FPMDRVPTVYIDQDAMFESAQEFLQESVDRYCLSLYESPKDKQVGMAQAFRNFLAVHP
                     ETQAIVIGVRHSDPFGETLRPVQETDENWPRFFRLQPLLHWNLSEIWSFLLYSGEEVC
                     GLYELGFTSLGSVNNTLRNPYLRVPEPVVGATLAPSEQHHSDFEWEIAHNYRGDGQAH
                     CSKVSHGDLQAIREHDASQFHPGWYLTKDEWERAGRLARRK"
     gene            complement(<825089..>826306)
                     /gene="MTF2"
                     /locus_tag="KLMA_70405"
                     /db_xref="GeneID:34718147"
     mRNA            complement(<825089..>826306)
                     /gene="MTF2"
                     /locus_tag="KLMA_70405"
                     /product="mitochondrial transcription factor 2"
                     /transcript_id="XM_022821665.1"
                     /db_xref="GeneID:34718147"
     CDS             complement(825089..826306)
                     /gene="MTF2"
                     /locus_tag="KLMA_70405"
                     /codon_start=1
                     /product="mitochondrial transcription factor 2"
                     /protein_id="XP_022678004.1"
                     /db_xref="GeneID:34718147"
                     /translation="MQSLARGNGRLWLNNAGKLSKTGLRFQSGGSSGSSGNHAGSGAN
                     EVLEEYRAIREAIGKAQERDQARSQPDKEAMNRLLNPAKLQKQIVFSDKTPEWTHSSL
                     MKDVLGHGDGSTTVNGGSSEPGSELAGSGGRPHSSFDLSVDLPVGLSQRRVRLSPMER
                     AILRVEEKEKLRVALDHALEPHLAHLKSTIKSDKDLLDQFNLYLDQYLKADHKLEHTQ
                     SSRFVEQIQKRALAHPESLPQPYAVTLPAIVRYVFESGQFSLPADRCYLILKSIYDRC
                     KSCQDLSLYLNVCNVDFYNLLVKYTWSEYRDVVMVKELIYEMDFNGIRGDITTTEVLE
                     SVCEEMRYVTDAIAEEKEEDLPVPESGLVSGAVVPEASKMAVLWCADNVAALKSLNKY
                     LKTLKKSMMRAEA"
     gene            complement(<826660..>828441)
                     /gene="NBA1"
                     /locus_tag="KLMA_70406"
                     /db_xref="GeneID:34718148"
     mRNA            complement(<826660..>828441)
                     /gene="NBA1"
                     /locus_tag="KLMA_70406"
                     /product="protein NBA1"
                     /transcript_id="XM_022821666.1"
                     /db_xref="GeneID:34718148"
     CDS             complement(826660..828441)
                     /gene="NBA1"
                     /locus_tag="KLMA_70406"
                     /codon_start=1
                     /product="protein NBA1"
                     /protein_id="XP_022678005.1"
                     /db_xref="GeneID:34718148"
                     /translation="MSESMRGEDSLAGAPEKPQEVIGGSPNYNRLSAMIESLSLHGSL
                     DDEAFMPSRKNSPVDDDKDQQDKNSSKSSQFVDLTQTVGVSTTSISLETPESGYTQLQ
                     NMSPGNRESMLSSYSGTVHEGVPVSYVVQKQEGGATTATTATVRKEMMTTTGEPSLPP
                     LPSKKEWSPVEVKSVKAMVISAAGREAEGISGLDQEPGAGLGPGLGPGAIDKSNSLKL
                     LAMDRGSHQKVPSSIASGNLASESGHSHNMSTTSNSGSSTLPHLSELNEPYEEDGEDQ
                     GDQHTHHSAITNTTPLDISDHDAERTVSMTSSVIPPLETQMHPNRGRGIEPDREVISD
                     VLPPVPPRSTKRPKSRIFIKESLEDIQNQLAREMQVQGQGQGQGQGQGQGHRTSPSHA
                     GSASIRSDSFFSATELDETPDQEHELGPGSRGGSRSGGDSDEDVTYTTRPLPSIPSPH
                     FTTPEGQIQNGSNTNTNDDDDNYEDIIEEDTPQNRIRTPQSRLPKTPGKTQAHAKRKP
                     HGKPRAKKELRSFDIDTISQLLNVTKGTLIGSEFSNLGMKIEEKRALEKLVDSLSRLT
                     ADMVLDPEKFHEGLRRLERATKALDGF"
     gene            complement(<828835..>831570)
                     /gene="AGC1"
                     /locus_tag="KLMA_70407"
                     /db_xref="GeneID:34718149"
     mRNA            complement(<828835..>831570)
                     /gene="AGC1"
                     /locus_tag="KLMA_70407"
                     /product="mitochondrial aspartate-glutamate transporter
                     AGC1"
                     /transcript_id="XM_022821667.1"
                     /db_xref="GeneID:34718149"
     CDS             complement(828835..831570)
                     /gene="AGC1"
                     /locus_tag="KLMA_70407"
                     /codon_start=1
                     /product="mitochondrial aspartate-glutamate transporter
                     AGC1"
                     /protein_id="XP_022678006.1"
                     /db_xref="GeneID:34718149"
                     /translation="MELINSNSEKKKQQLEVFKKYASVLTAEQKKLGAPYASDVSNVN
                     AEDDDATERVLRYDDFIRLISNSRSLYSKFTDHSFNLNQIPKNVFGCIFFAMDEKNKG
                     YLTINDWFHFNNILEFNNYHLIVLYEFFRKFDVARIRAQQTSSIDDQRIKSINYGNKF
                     LSFDDLYLNVDQFKSTISLLQRCVNDEFIMKNKLALNWNEFRWFPLYHCTPFGKSSGK
                     YFSLNSLVTILQSDLKDEKLFVGFTKLCHLNPAKNCQSLSKNQLAYLLKLFYSHRISS
                     DVFNSLDLSNTRQIKCDNNYIQFNVIKDIFYLFENFDLLNQVLIRYAQYYEFDENDVR
                     EQIITKKDFMEFLNKEYNKVTNIVEFSPSQINLLFSIVSNSKESRNQCLTSMHHSDEA
                     IDDFIHSQVQMGPQINQGTIKEFNENYNSNVDEFNQDLALQEHNDRKQSHSVSNNLAT
                     SLIDRLWNNKSVKDISESRNLTMEDFMKILNPNYLNDIVHSMELKRIRSESWYSNFYF
                     YPIFDSIHNFTLGSIAGCIGATIVYPIDLVKTRMQAQRNSVLYKNSIDCFVKTFQTKG
                     IRGLYSGLGPQLIGVAPEKAIKLTVNDFMRQHFMGKSRTIKWYQEVLSGATAGACQVV
                     FTNPLEIVKIRLQVQSQHAGGALDIVRQLGLRGLYKGAGACLLRDVPFSAIYFPTYAH
                     LKRDLFRFDPNDKTKRNKLKTWELLLSGGLAGMPAAYLTTPFDVIKTRLQIDPKSGET
                     RYNGIFHAVRTILKEESVRSFFKGGPARVLRSSPQFGFTLAAFEMFQGLFPSKYNPDE
                     VAASGASGANSGASGGSQASADTPIVTGIFNKFYKNVKNEPHTHHHHSTDPMPVELYG
                     PSVDPYSSNFLNYYYKSCQISKVFIDLDYNFAKFDFNVYQQFQNELKRISPKSNR"
     gene            complement(<832373..>835543)
                     /locus_tag="KLMA_70408"
                     /db_xref="GeneID:34718150"
     mRNA            complement(<832373..>835543)
                     /locus_tag="KLMA_70408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821668.1"
                     /db_xref="GeneID:34718150"
     CDS             complement(832373..835543)
                     /locus_tag="KLMA_70408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678007.1"
                     /db_xref="GeneID:34718150"
                     /translation="MASENKGTDEMVGGRHVCPHPDCDKTFSRYEHLQRHKLNHWPKE
                     IFRCDYVYPEDGIVCNRSFVRKDLLVRHQRRHSNNGVRMQMKVRRELGKVKGASGSQR
                     RLSETPDQIQVGQAHEPARLVPETSSNTNSNSYSNANGNLATRKLDHIVLDVGDGKSK
                     SGGTGESNSATASAAGPIGGVSTTTTTTTTTSSSNASLNSGFALGGSGGGGAGSGSGS
                     GMAPNTNLNNFFNWLFAAAPTQEAATPAVAAGGPPPPPHAVGTAPNSNVAQQPHISVN
                     NNNNIASTGMVPGLPQTAMLEPEISSQNNQHVQSSSFETDTSGGGTTSGSSTGSGSAT
                     VANIMDDLFSVDFLPNDPLQSLVQQMSYNNMNNNSQPVSVGSLNTPPNKGSTCSPESV
                     PNRSPKFRDFGKEHIKDNLQAQKSKVEELRSQLKRSESIPGASSSTPGAGAGPSTKRQ
                     KTMLLSKPSFFNSDPNSKFRLSLERQAVFAEQIADIKYILLSDLQTALKSYWLNFHPQ
                     YPILHKPSFDIEKAPSILVLSMIMTGASYLGSANRRSISDVIAGPLRWLIFSHEDFQP
                     TSETYIIQALLLLECYEKTSTNRYLHERSYLHHGTTIQLLRRTPSLGGHPLRIKKEQS
                     PSNYESMEEIYKNWIDFETLKRTALYAFYIDTTHAVVFGYTYLFIHCNQVQLSLPCSD
                     EIWDSYDLSLEKLLQHGFGGKDVSFLDTLKQLLNHVMHRLQRSGNTEPWTKLKTSKFG
                     EKLLLSGLISIMFQLQQHSEVISLGGDNPLSVQNIHWQEIISFAIDYWHSEVMHGCQN
                     SSNSVLSNVDAVNTVDDEGIKLLRLDDVHSCKIPAYHMSQIILRIFQYDYYIYAGAPW
                     RMNVRAGTEEYALVSERILKFSQDPMQGGMAIVYAYMFLFEMFQNGENLSCDVNLDYC
                     ITRPNTLALTSLLIWSYNYSLYGPETHIWDNSSDTDENLNKKLKEEYVPIESFQQHLK
                     RMYSYLHVDKNLDVYTHHQQLKEKARLLKDIPNKNHLAGMMLFMRDLFHGCYWELGRE
                     FSHLFDNCLERSMGRAKVVCEHMYET"
     gene            complement(<836402..>837529)
                     /gene="EAF3"
                     /locus_tag="KLMA_70409"
                     /db_xref="GeneID:34718151"
     mRNA            complement(<836402..>837529)
                     /gene="EAF3"
                     /locus_tag="KLMA_70409"
                     /product="chromatin modification-related protein EAF3"
                     /transcript_id="XM_022821669.1"
                     /db_xref="GeneID:34718151"
     CDS             complement(836402..837529)
                     /gene="EAF3"
                     /locus_tag="KLMA_70409"
                     /codon_start=1
                     /product="chromatin modification-related protein EAF3"
                     /protein_id="XP_022678008.1"
                     /db_xref="GeneID:34718151"
                     /translation="MSIELENKCLCYHGPLLYVAKVLRVYNEQKRTISSKEYTDLSID
                     DERAEADRPPEDMRGIACYFIHYQGWKASWDEWVGLDRIRPYTEENLELKKSLVEQAK
                     AKAASANASASAGSGSNASAKRVGKKKIGVRRVGRPSKKDKELERRALSENSPGLSET
                     SKSSGAGSGTPGTPGAGLDRKSASPPPNSKSPPQMALLNKRSHPKIYIKIPIALRSVL
                     VDDWENVTKDRQLVQLPSSHPLDETLHQFYTDMAGSLASPVDQAQLSEFINGIKLYFN
                     LSLGKLLLYRLERIQFADLLKKYPNKQPTQVYGTVHLLRLITLLPEMIESSNVDDQTA
                     KIIVKHCDSLLDWIASHVPSTVPMDTYINTSSQYEGVALSM"
     gene            <838490..>839923
                     /gene="YCK3"
                     /locus_tag="KLMA_70410"
                     /db_xref="GeneID:34718152"
     mRNA            <838490..>839923
                     /gene="YCK3"
                     /locus_tag="KLMA_70410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821670.1"
                     /db_xref="GeneID:34718152"
     CDS             838490..839923
                     /gene="YCK3"
                     /locus_tag="KLMA_70410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678009.1"
                     /db_xref="GeneID:34718152"
                     /translation="MSKRSSQQVVGIHYAVGSKIGEGSFGIIFEGENILNGGSKNPVA
                     IKFEPRRSDSPQLRDEFRAYRILNDVKGIPHAYYFSQEGIHNILIIDLLGPSLEDLFE
                     WCSRKFSVKTTSMLAKQMIERVRSIHEHDLIYRDIKPDNFLISEFQRELPDGSVVRSC
                     ASSSNGDPNLIYVVDFGMAKQFRDPNTKQHIPYRERKSLSGTARYMSINTHFGREQSR
                     RDDLESLGHVFFYFLRGSLPWQGLKAPNNKAKYEKIGLTKQRLKPSELLKPGIPKQFA
                     EYLSYCRSLRFDQDPDYDYLISLMTQIMQENGYEDDGHYDWMDLNNGEGWNIKINKRV
                     NLHGYGNPTPRNTKHSAQQLTPSHQQQQQQQHQSQSQQQQQQYAQQQNSRHDSRNYRS
                     FSESTPNRSQNKIINSSGSKSRVRLSQNNGYMGPNVPLKQGLNIQTYDSMGKLHGSHN
                     RRSGEIDDDNDSVEEGGFFSKLCCGIC"
     gene            complement(<841064..>842779)
                     /gene="DSE1"
                     /locus_tag="KLMA_70411"
                     /db_xref="GeneID:34718153"
     mRNA            complement(<841064..>842779)
                     /gene="DSE1"
                     /locus_tag="KLMA_70411"
                     /product="protein DSE1"
                     /transcript_id="XM_022821671.1"
                     /db_xref="GeneID:34718153"
     CDS             complement(841064..842779)
                     /gene="DSE1"
                     /locus_tag="KLMA_70411"
                     /codon_start=1
                     /product="protein DSE1"
                     /protein_id="XP_022678010.1"
                     /db_xref="GeneID:34718153"
                     /translation="MNTSYYKAPEVFRQNAIFVKKNRGAAAARNNDDKELALPRTCKA
                     DSSRLNSPLLRKVSGDLNDVVVTKKLRSDCWKLETDVTGVTSMSVDDSTIVLSNSAKT
                     DNVHLYQLRDASQDDDNNIAIAGKKLLHSLQTISVPGNPIVSTDIVPWQHNATVESFD
                     SSVHDTIMLTGHSDGYVNMIATSTSEGKAKILKRFNHAKHLKVTHPISDSFGVDLASQ
                     VYDMHRSKPVRQLKSWNKNHFVSVINESLFVYDVNEHARNPLFLNNFPGLEHVDPNPV
                     NKHTFSLAGTKFGAAGIALLDLRSNDTTGLRVPGGELQQQHQGTTECGRSYVSKWLDE
                     YTVANSVGKTLKVWDIRYGEVKAQLLGHYGYVNSLEFDSKLNKLYSSDDQGLILSWDM
                     NAVEFKDEVVCCRPSHGIQSFNLPSDCIQNGTIINSPDLERVSDKQYGLGSHFLGISG
                     SNLLSLHDQELRSYSIVHMPMAIRAPPRSPLRLLRPKVSRKSTVSKATVSVGGSSSDE
                     TSKDSNSAFEDSEDTLEYEAHSPHTPVLDGTFGAKHLDFFIPELPLLSGIRRESDATL
                     NSVAK"
     gene            <844318..>846831
                     /gene="RSP5"
                     /locus_tag="KLMA_70412"
                     /db_xref="GeneID:34718154"
     mRNA            <844318..>846831
                     /gene="RSP5"
                     /locus_tag="KLMA_70412"
                     /product="e3 ubiquitin-protein ligase RSP5"
                     /transcript_id="XM_022821672.1"
                     /db_xref="GeneID:34718154"
     CDS             844318..846831
                     /gene="RSP5"
                     /locus_tag="KLMA_70412"
                     /codon_start=1
                     /product="e3 ubiquitin-protein ligase RSP5"
                     /protein_id="XP_022678011.1"
                     /db_xref="GeneID:34718154"
                     /translation="MSISVKLVAAESLNRRDVFRSPDPFAVLTIDGSQTKSTAAAKKT
                     LNPYWNEVFQFNNVSENSILTVQVFDQKKFKKKDQGFLGVVNVRIGDVLGHLDEDTAA
                     SGGGRLREETITRDLKRSNDGLSVSGRIILVLTVLPANGRSGASNTSSSQASGTAAAG
                     GSNRQSSSMTNAATIDNRLIAQTVANNLQTTTLDNPDQSQGGAGSGVGAAAAAATNTG
                     SGAGTAAGAGASGGIAGQQSSASSRQYSSFEDQYGRLPPGWERRTDNFGRTYYVDHNT
                     RTTTWKRPTLNQSEVQRANTELERRQHRGRTLPDGGAQSEGGSSSSSNVAVHNNNNAS
                     SQSPTVNGAAAAAFAATGGTTSGLGELPPGWEQRFTPEGRAYFVDHNTRTTTWVDPRR
                     QQYIRTYGPSMNTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPS
                     SLDQNVPQYKRDFRRKVIYFRSQPALRILPGQCHIRVRRKNIFEDAYQEIMRQTPEDL
                     KKRLMIKFDGEEGLDYGGVSREFFFLLSHEMFNPFYCLFEYSAHDNYTIQINPNSGIN
                     PEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQDMEGVDSEVYNSLK
                     WILENSIDGILDLTFSVDDERFGELVVIDLKPNGREIEVTDENKKEYVELYTQWRIAD
                     RVQEQFKAFMDGFNELVPEDLVNVFDERELELLIGGIAEIDVEDWKKHTDYRGYQESD
                     EVIQWFWKCISEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEIQQ
                     LPKSHTCFNRVDLPPYTDYESFKQKLTLAVEETIGFGQE"
     gene            complement(<848071..>850800)
                     /gene="MPT5"
                     /locus_tag="KLMA_70413"
                     /db_xref="GeneID:34718155"
     mRNA            complement(<848071..>850800)
                     /gene="MPT5"
                     /locus_tag="KLMA_70413"
                     /product="multicopy suppressor of pop two"
                     /transcript_id="XM_022821674.1"
                     /db_xref="GeneID:34718155"
     CDS             complement(848071..850800)
                     /gene="MPT5"
                     /locus_tag="KLMA_70413"
                     /codon_start=1
                     /product="multicopy suppressor of pop two"
                     /protein_id="XP_022678012.1"
                     /db_xref="GeneID:34718155"
                     /translation="MMHFQHQPQLSVNSVQSLIEPVTPPLGQMNAKNNHQRTHSLDLS
                     GFNQFISNTSPLNCTTVSPLSTISATANANAASGKTNRMNSLPLINEFESILPQGRTL
                     GQGQGQGQGQASATKTHKPHASSSSHSSNSVAMSSVSSASSSSASSTAAGQTHGQTPG
                     QGQGQGQHGSSSSSSSSKTSASAVASINDLHSIPLKELDYVKLSTDQYGCRFLQRKLE
                     TPQESDQVRDLIFENVNDFFLDLILDPFGNYLIQKLCDYLTSDQKTAMIKDIYPSVFQ
                     ISINQYGTRSLQKIIDTVETQEHIDMIIKGFSQEHTSIEQVVTLINDLNGNHVIQKCI
                     FRFQPANFDFIIDAIVNNDNIITISTHKHGCCVLQKLLSVCTLQQIFKISVKIIQYLP
                     SLINDQFGNYIIQFLFDIKELDFYLLGETFNKLSQKLCQLSCLKFSSNVVEKYIKKLF
                     AIVMNYALTASKNVGSMGSVTNAAGAGAAAAAAANPHLEMDRVDDGDDVVNASMGILL
                     VIADIFMSNITSLIRDNYGNYALQTLLDVRNYSAILEHPKNNVVYTNQRLASFSHEFT
                     LKISKLIIITKELLPSIKNTSYAKKIKLKVRAYTELTGVSFDDLCPAKKKGNEPFRQQ
                     NKHHSRNFSLPSNAYMNHSRSGGQQPNNSNNNNNQFQRNSSLNIMAGTDNKKKNKNNG
                     NNGNTNNININNNNNANTNNNMQPQLSLPHYQQIPAVSMPSQHDYLFSQQQQQQQQLP
                     PPPPQMTMLQQAPPLQQQQQQQQQHQPQQHVNLQTTPLQVQQPQDYFMSAPNSQQPVL
                     MNSTLHYPSNTVANMPNTMYMDTTQYPTPQSHSSMMYGFPTQSQPGLTPSMSQSSFVS
                     LPGSLSGSNLMQMSDSQTNTPPNGMLPRSNSNIMQHSRNVSFPMFGDNPAYYG"
     gene            complement(<852143..>852928)
                     /gene="NSA2"
                     /locus_tag="KLMA_70414"
                     /db_xref="GeneID:34718156"
     mRNA            complement(<852143..>852928)
                     /gene="NSA2"
                     /locus_tag="KLMA_70414"
                     /product="ribosome biogenesis protein NSA2"
                     /transcript_id="XM_022821675.1"
                     /db_xref="GeneID:34718156"
     CDS             complement(852143..852928)
                     /gene="NSA2"
                     /locus_tag="KLMA_70414"
                     /codon_start=1
                     /product="ribosome biogenesis protein NSA2"
                     /protein_id="XP_022678013.1"
                     /db_xref="GeneID:34718156"
                     /translation="MPQNEYIEQHIKQHGKRLDHDERKRKREAREVHKISERAQKLTG
                     WKGKQFAKKRYAEKVAMKKKIRAHEQSKVKGGSKPLDENGEALPTYLLDREQNNTAKA
                     ISSSIKQKRLEKADKFSVPLPKVRGISEEEMFKVVKTGKSKSKAWKRMITKHTFVGEG
                     FTRRPVKMERIIRPSALRQKKANVTHPELGVTVFLPILAVKKNPQSPMYTQLGVLTKG
                     TIIEVNVSELGMVTSGGKVVWGKYAQITNEPDRDGCVNAVLLV"
     gene            <853501..>854358
                     /gene="LCP5"
                     /locus_tag="KLMA_70415"
                     /db_xref="GeneID:34718157"
     mRNA            <853501..>854358
                     /gene="LCP5"
                     /locus_tag="KLMA_70415"
                     /product="U3 small nucleolar ribonucleoprotein protein
                     LCP5"
                     /transcript_id="XM_022821676.1"
                     /db_xref="GeneID:34718157"
     CDS             853501..854358
                     /gene="LCP5"
                     /locus_tag="KLMA_70415"
                     /codon_start=1
                     /product="U3 small nucleolar ribonucleoprotein protein
                     LCP5"
                     /protein_id="XP_022678014.1"
                     /db_xref="GeneID:34718157"
                     /translation="MLSYLSSLMVVLGEKLGKDGVASRGREEAIEQRVVLERGVKPLE
                     KKLGYQLDKLTRAYMRMEADLQGGQVSSTSGKEKEKEAAEEEEDSSESEDETQFRPNG
                     SAMVTGKTSGKASGKASAEANAASADAEASGSIYRPPKISAALPPQHHFEDKFNAQEH
                     KDKSSRSRMQAMEEYLKETSEQPEWEASIGANIVNHGRGGVKTSRDTERERDIQRFEE
                     ENFTRLNPNGSKVDKRLKKQREISAKVNMIAGEDFSIFNSKRKLEESTSRRGSKKSRN
                     AWERAKRKL"
     gene            <854498..>855127
                     /gene="VFA1"
                     /locus_tag="KLMA_70416"
                     /db_xref="GeneID:34718158"
     mRNA            <854498..>855127
                     /gene="VFA1"
                     /locus_tag="KLMA_70416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821677.1"
                     /db_xref="GeneID:34718158"
     CDS             854498..855127
                     /gene="VFA1"
                     /locus_tag="KLMA_70416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678015.1"
                     /db_xref="GeneID:34718158"
                     /translation="MKNEYTKKKVSRKDRKACLICQNPTETVLFNASGPDWFYTCDLH
                     LVDNPQFAQPLYPKEYHDLLAGLKTLKDRIEALERKQAGGWDQWIGKWLDKDGKQKPK
                     EGDKEAEGDKEGDKEPEKEAPKDTLLQLKKQYQDSLDRIALLKQKSNTYTLYDLVYQS
                     RVDRLRKLAQLKEKKRIEQQSYTNTDPQQLLQSVQFPEVPKDIVQKPSS"
     gene            <855372..>857402
                     /gene="NOP9"
                     /locus_tag="KLMA_70417"
                     /db_xref="GeneID:34718159"
     mRNA            <855372..>857402
                     /gene="NOP9"
                     /locus_tag="KLMA_70417"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821678.1"
                     /db_xref="GeneID:34718159"
     CDS             855372..857402
                     /gene="NOP9"
                     /locus_tag="KLMA_70417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678016.1"
                     /db_xref="GeneID:34718159"
                     /translation="MARVRGRKAIQKQKKDEFHPEDGGDDYKHQQHQQMPDDGENAND
                     GVTPNTFFGVLDSSELDYFKKAESTLAIDAFENPDEKYQFINSVIEESKGKELKLATS
                     QICSKLMERIIMESDETQLKGIFKALNGFYFNIACHKYSSHVLETLLVRGAAQVEKEL
                     LTPDFADGSGEGEYEQEFVTMESLFLFLINELQPNLKFMVNHQYASHVLRVLILVLSS
                     KTLPSTWENRSTLRSKKSKIARKMIEIKDNDNYNRVFKTPDSFKVSLRSMLSEIYTGF
                     THGVPQGAQHFSEVSIADIMKFREVCVDKIGSPVVQLIIQVEGIFDRDRSFWHLVFCN
                     SEEKDPKEESFVEYLLSDAVGSHFLQNVLSSTRLKYVERLYRLYIKDRIAKLAKRDTT
                     AAFVLQALLKVMKPNEVKEIMTDLVPDLSVLLNSNMDFGTEIIDASIRTDNYLREEII
                     EQLLKKYYPRESSDKNILESCLLLSSSTLGNTRDDWPTAEERRRSLFLEKLIDYDDCF
                     LNSTIDSMLSLPAERLLQMPYHGVFSHVVEHVLQVKRVEIIKRKLLLNVLCTDIVNMS
                     CNAYGSHIVDKLWVFTAKLAMYKERIATALCAESVKVKNSVYGRQVWKNWSLELFVRK
                     RYDWKRIVKEQELELFPDAKPLQPKNPKRPRENANGSDQQRAPFNKNKFQKR"
     gene            complement(<857506..>858180)
                     /gene="MRP8"
                     /locus_tag="KLMA_70418"
                     /db_xref="GeneID:34718160"
     mRNA            complement(<857506..>858180)
                     /gene="MRP8"
                     /locus_tag="KLMA_70418"
                     /product="uncharacterized protein MRP8"
                     /transcript_id="XM_022821679.1"
                     /db_xref="GeneID:34718160"
     CDS             complement(857506..858180)
                     /gene="MRP8"
                     /locus_tag="KLMA_70418"
                     /codon_start=1
                     /product="uncharacterized protein MRP8"
                     /protein_id="XP_022678017.1"
                     /db_xref="GeneID:34718160"
                     /translation="MSDEVAKLRNQVLELQGLVKRQSTMLAKTGQSIIELQIAQQKAD
                     IRSLDLEKKPEKPQTTAGAANGGLDPDFDTSKLATNSDLEQLVEELQGQLDYLEERSI
                     RRVSNNNKRNPEDLIGPLPNADGELPEDYQLPFPKTVQDFIDIKDLDLCKIAEFYGVL
                     PFPLSDLEAITKGLQNAEEVTIPTFNDDTAEEQLKKYSKVEMDAIFDTVARYLGLNNR
                     RTKDTW"
     gene            complement(<858528..>860012)
                     /gene="LTV1"
                     /locus_tag="KLMA_70419"
                     /db_xref="GeneID:34718161"
     mRNA            complement(<858528..>860012)
                     /gene="LTV1"
                     /locus_tag="KLMA_70419"
                     /product="protein LTV1"
                     /transcript_id="XM_022821680.1"
                     /db_xref="GeneID:34718161"
     CDS             complement(858528..860012)
                     /gene="LTV1"
                     /locus_tag="KLMA_70419"
                     /codon_start=1
                     /product="protein LTV1"
                     /protein_id="XP_022678018.1"
                     /db_xref="GeneID:34718161"
                     /translation="MSGRSKFSKKNATKFAVVHRPHDDPSYYDADAGDHVLVPVENRN
                     LKKDQKTKAQAQAQEEFEDIPKLVDTAAASPAAAPAAKQEKKNGPINEHVGEAALYGI
                     NFDDSKYDYTQHLKPIGLDPSHSVFIPAKTKSKSKANEKPKKLKDPASLFVEPTYQDL
                     ENKPAEPLFVRGVAKQEYLDQMQEIPEELVGFKPDMNPALREVLIALEDEAYVVNEDV
                     VVDIKAKPEEIPEEVDEDADDIFAELLGSGKADGADEFEDEFDEWDMENLDNYEEDHY
                     KQEMAQFDTIGKLEDLQDIDVSADVRRFKLQQKKERNAWDSDNDFSDEDDLEEEEQET
                     KDVVGKLPSIAGTRSSSKTGGQARKARRKKGAMSDVSGFSMSSSAIPRSEAMTVLDDR
                     YDQIIGGYENYEEELAEEEEKHETFDMLKERSDFESMLDDFLDNYELGSGNRKLVKKD
                     QEIAKLKEAADEVSKGKLSMRRKREKEKKSSVNSITDRLNSLRF"
     gene            <867194..>867781
                     /locus_tag="KLMA_70420"
                     /db_xref="GeneID:34718162"
     mRNA            <867194..>867781
                     /locus_tag="KLMA_70420"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022821681.1"
                     /db_xref="GeneID:34718162"
     CDS             867194..867781
                     /locus_tag="KLMA_70420"
                     /note="DUP super family[cl02924]"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022678019.1"
                     /db_xref="GeneID:34718162"
                     /translation="MTTPDSPLMKERSENPPQFSRSKLGKERYGGSVSYSIAQHPTAF
                     RCLIGTILIIAISVCVIVYNSDSSTSGDAAVFCLFLILMCIIAIFIIMAIMCSPVTSE
                     ILKNPDDALFFLKLIATGHSWDEVGRIMNSYLFERGIWWTNSYFYDSEQCYNLFVSYS
                     KDCADPAIEPFIDQAKSKLTESLTQEWDRIGLSDE"
     gene            <870226..>870465
                     /gene="RPC25"
                     /locus_tag="KLMA_70421"
                     /db_xref="GeneID:34718163"
     mRNA            <870226..>870465
                     /gene="RPC25"
                     /locus_tag="KLMA_70421"
                     /product="DNA-directed RNA polymerase III subunit RPC8"
                     /transcript_id="XM_022821682.1"
                     /db_xref="GeneID:34718163"
     CDS             870226..870465
                     /gene="RPC25"
                     /locus_tag="KLMA_70421"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC8"
                     /protein_id="XP_022678020.1"
                     /db_xref="GeneID:34718163"
                     /translation="MDEDTKLYFDVNEKIRFRVEQEVFVDVKPKSPREKEIEEQLRAK
                     EELTEEEKRILEKPPAYALLGSCQTDGMGLVSWWE"
     gene            complement(<870590..>872005)
                     /gene="RPT1"
                     /locus_tag="KLMA_70422"
                     /db_xref="GeneID:34718164"
     mRNA            complement(<870590..>872005)
                     /gene="RPT1"
                     /locus_tag="KLMA_70422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821683.1"
                     /db_xref="GeneID:34718164"
     CDS             complement(870590..872005)
                     /gene="RPT1"
                     /locus_tag="KLMA_70422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678021.1"
                     /db_xref="GeneID:34718164"
                     /translation="MPPKQDWEKYKAPVEENESPEDEKKVVPLSEGDIEVLKTYGAAP
                     YAKKLKSIENDLKEIEKKIKEKAGVKESDTGLAPSHLWDIVGDRQRLSEEQPLQVARC
                     TKIIKAEKPQGTATGGSAPGNNSSSSSSAAAAAASAPEDDDEDDSKYVINLKQIAKFV
                     VGLGERVSPTDIEEGMRVGVDRSKYQIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGC
                     KEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI
                     RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQ
                     RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANI
                     FRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQA
                     VEKVINGYKKFSSTSRYMQYN"
     gene            complement(<872363..>874057)
                     /gene="AVT3"
                     /locus_tag="KLMA_70424"
                     /db_xref="GeneID:34718165"
     mRNA            complement(<872363..>874057)
                     /gene="AVT3"
                     /locus_tag="KLMA_70424"
                     /product="vacuolar amino acid transporter 3"
                     /transcript_id="XM_022821685.1"
                     /db_xref="GeneID:34718165"
     CDS             complement(872363..874057)
                     /gene="AVT3"
                     /locus_tag="KLMA_70424"
                     /codon_start=1
                     /product="vacuolar amino acid transporter 3"
                     /protein_id="XP_022678022.1"
                     /db_xref="GeneID:34718165"
                     /translation="MSFSTSARRDTGATATDLSRWNDSPVGSVGSHHLAGQRRRSMSF
                     SESIQSSARTGQNPLDMSAQEMRGPNGFRRSFIQHKSLKLHGRRANFLTRNFNEFLSL
                     YGHFAGEDLSEEEEGQEQDQDDEDEESALLHVIRHEYTRQQQNRGDDSASVAIEDDEY
                     GPETMPHHKVKKKTSTTKAVLLLLKSFVGTGVLFLPRAFHNGGWLFSTVCLFFCAIVS
                     FYCFMLLIDTKTKVGVDGYGELGARLFGPKLKFTVLSSIVLSQIGFAAAYTVFTATNL
                     QAFFSHVFRLEYSLVFWIMVQLVFYLPLSLTRNIAKLSATALLADVFILLGLVYVYYY
                     SSYYIFQHHGIASDTMLMFNKSDWTLFIGTAIFTYEGIGLLIPIHESMEHPNQFKPAL
                     LYVILLVTVIFVSCGLVCYAAFGDKVETVILLNFPSDSIFTNAVQLIYALAILLSTPL
                     QLFPAIKILENKLFNKNASGKHNPRVKWHKNYFRSVVVLVTVLIAWLGANDLDKFVSL
                     IGSFACIPLIYIYPPLFHFKVHEHDRALQAVDLAILLFGGAVMAYTSYQTVSLWVG"
     gene            complement(<874649..>874954)
                     /gene="MBB1"
                     /locus_tag="KLMA_70425"
                     /db_xref="GeneID:34718166"
     mRNA            complement(<874649..>874954)
                     /gene="MBB1"
                     /locus_tag="KLMA_70425"
                     /product="uncharacterized protein MBB1"
                     /transcript_id="XM_022821686.1"
                     /db_xref="GeneID:34718166"
     CDS             complement(874649..874954)
                     /gene="MBB1"
                     /locus_tag="KLMA_70425"
                     /codon_start=1
                     /product="uncharacterized protein MBB1"
                     /protein_id="XP_022678023.1"
                     /db_xref="GeneID:34718166"
                     /translation="MLDLPKPSSEIWIGDLSNYRYALRLDREEYRSIIFYDYDSDSTA
                     RYLFWVLFDDERPHWRLLLRDGVFRCYDILNTGGEFDEIRYPGYKVVRNREELSKLH"
     gene            <875895..>878696
                     /gene="FOX2"
                     /locus_tag="KLMA_70426"
                     /db_xref="GeneID:34718167"
     mRNA            <875895..>878696
                     /gene="FOX2"
                     /locus_tag="KLMA_70426"
                     /product="peroxisomal hydratase-dehydrogenase-epimerase"
                     /transcript_id="XM_022821687.1"
                     /db_xref="GeneID:34718167"
     CDS             875895..878696
                     /gene="FOX2"
                     /locus_tag="KLMA_70426"
                     /codon_start=1
                     /product="peroxisomal hydratase-dehydrogenase-epimerase"
                     /protein_id="XP_022678024.1"
                     /db_xref="GeneID:34718167"
                     /translation="MSLRFDNRVVVITGAGGGLGRVYALEYAKRGAKVVVNDLGGSLQ
                     GSGANSRAADTVVQEIQALGAHAVANYDSVTENAERIVQTALDSFGRIDIVINNAGIL
                     RDASFAKMSDQEWDSVIQVHLRGAYKLTRAAWPHMRSQKFGRIVNTCSPAGLYGNFGQ
                     ANYSAAKLGLLGFAETLAKEGHKHNINVNCIAPLARSRMTEGLVPEHVLRDLGPEKVA
                     PMVLYLTHEHSTVTNSVFELAAGFYSQIRWERSPGQLFYPDVQTLTPEVILSKFDEIL
                     KFEGPSVQHPVQLNDYNELITRARRLPRSLGGSASGPPIQSLRGKVAIITGAGGGLGR
                     SHAEWFAKYGCKVVVNDIKDASAFVQELNDKYSSSSGGGRGIVAVADTHDIVHEARAV
                     VQTAIETFGRVDILINNAGILRDRSFAKMSDQEWDSVIQVHLYATFALSKAVWPFFVK
                     QKSGFIVNTTSTSGIYGNFGQANYAAAKAAILGFSKTLAIEGAKSGIVVNAIAPHAET
                     AMTKTIFSSKELGNHFDPGLVSPFVVLLCSDELQQKQGKTAPAAAAARGLLLEVGGGW
                     CGSTRWQRSRGIVSVDANPTPEYLRDHWSELTDFTQGGAVYPSSTQESSMLILQAVHM
                     AKSRAKSRAKAGAKAKSQAKSNSPGFKFTSRDVILYNMGLGSTTRELQYTYENHPQFQ
                     VLPTFATIPFLADESVDIGMDRLVDNFNYSMLLHGEQYFKIKKFPIPTSGELKTSAKP
                     LQVLGKRGKSKASAAVVVAAYDTVDANTNEPVFYNEATFFIRNAVVPENKTINKLKQR
                     SPFALKKFETSGLGATPDFEAEISTFEDQAALYRLSGDYNPLHIDPQLARAVKFPKPI
                     LHGLCTLGVSCKRLVEKYGPFDELKTRFTNVVFPGDRLKVRAWERENGTVIFQTVDLN
                     TGQVVLDNAAIKLVGKPKL"
     gene            complement(<879679..>880938)
                     /gene="KTR1"
                     /locus_tag="KLMA_70427"
                     /db_xref="GeneID:34718168"
     mRNA            complement(join(<879679..880566,880669..>880938))
                     /gene="KTR1"
                     /locus_tag="KLMA_70427"
                     /product="alpha-1,2 mannosyltransferase KTR1"
                     /transcript_id="XM_022821688.1"
                     /db_xref="GeneID:34718168"
     CDS             complement(join(879679..880566,880669..880938))
                     /gene="KTR1"
                     /locus_tag="KLMA_70427"
                     /codon_start=1
                     /product="alpha-1,2 mannosyltransferase KTR1"
                     /protein_id="XP_022678025.1"
                     /db_xref="GeneID:34718168"
                     /translation="MYFRNRFTRRVLRNVLIPTVLIVLIMFGTVMYFDVDTDTIIRNI
                     SRPGAELGSMQNQSQTKPEVPQPEVVQPEVAQLYNDGRGNDIILSLPFTQEFIDATTE
                     KVSGRTRYITIPEQFWSYPENIDREKAKEEMEKMSKEGISYGDSESYRFMCRFNSGLF
                     YKLPELEHIEHYWRVEPYVKFKCDINYDVFQYMRNNNKLYGFSMSLGEDHRTIPTLWE
                     HTYEYFFQLHPELVSPHNNLDFISDDNGTTYNGCHFWSNFEIANLKIFRDPSYGYESY
                     FQYLDSKGGFFYERWGDAPVHTLAFSLLLDADQLHFVPNTGYAHNPNQDCPRDEPLNE
                     ALKCSCSPSRDFTWHRWSCVPKFFDVHHLPRPDTMAHVREHYSYLVEGTGL"
     gene            complement(<882327..>887228)
                     /locus_tag="KLMA_70428"
                     /db_xref="GeneID:34718169"
     mRNA            complement(<882327..>887228)
                     /locus_tag="KLMA_70428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821689.1"
                     /db_xref="GeneID:34718169"
     CDS             complement(882327..887228)
                     /locus_tag="KLMA_70428"
                     /note="PRK12704[PRK12704], phosphodiesterase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678026.1"
                     /db_xref="GeneID:34718169"
                     /translation="MEQSNLIESKSSKRRSRIFTSDGHKRAALKGYFGSGKETGQNKS
                     DVYVFSSLEDMKLLTPPSSMREKNSASAKIGKVKKPKQLSPSKWGSDNLAMINPYATP
                     LSPNEKQKEQKEPKEPKEQEKQSTRDKIRNRLSLCSRKSEIFDLDEPEESPFFELPIG
                     SQAEQMEHQMEEEHHPIPIEHRFGRGWLKRSLSSASNKVVDTFKRISRSEDGNDISIL
                     YATTYDNGNDELQPKEKEQLCIEDTEESFHFNTKKAPAAADTSNHLNQDFIDFENLYY
                     YGQPDGTDSTTMALDLTEELGSGPSGYANANANANANANANANMNLNLNVNVNNDELA
                     TRKPIIDQSTYAINENQVSQATVKPDSHFFIENGKEDNCANYADSSLSPSSASSSFID
                     YPSSTQKNNGGFEVADEKSTSLKDVSKGFESHEPAVEIFEKPILQKKVTLQQVPKSIL
                     KNSPTKPTCETNRKTKKSNSKSNSNSKAKAKAKATAEANAKANSNAKIVDSGLITKFN
                     LLDTTKTEPKDDSISNADLNNVFTELDNLETNSSETSEGKGKRKSKKPLVTKQQSLLE
                     KFAESIISSNKTISDYCRLSYMFMNENPSYFDEYNDYLQTRGADGVPYEVRGPGFMED
                     LQKMFSSDLLKSDTFVVTKPTVTGKGSVNFASADEDGVEIQEIDVQEPPSTTKKSKNA
                     EALLDGTRSDVVIDNNAEIFDDRVSIAGSTSCYSEMSNMSSSSSVYSCGAVEFPDKST
                     RNLVNGLLELLGAPLDVRDGNDLKVSLLSLHAYLSKAITFLWKVSKIAMDETRVCKNQ
                     YKILSEQATFYEMGVDFMQLRINSLERTQEKRIDAMQKEINELQGMLAYYRAYSETRY
                     TWIDLDMMATNSLVRDLIEQHREDAQIQIEALKAALDRSFVTILELKEEIHGTLKELD
                     LKEERSRENELNMKEYRAMAKECEKLRSLGGIYDDLTQSVYTKQMQYQEVKDKLTVAE
                     GQLKVKDEQLASLKRSHEQQLQEMSELTPDNRQRTLGFWDRSKYEAALLEKDDIIQQL
                     RYELSNKDEVIDNLEAELHNTHIRYDQCKFEKYCNINENKLLHCYIDDQKVEFEEKID
                     SMSSKYKSEIAELSRMLEQRTKYFNREIQIHKVNCQKSVEEALKAALKSDISLSVVSG
                     QKRFVASRAMSYLMNKRRNIRKCFEALNVANIPMNDKYLTWESIPKCESYRVRKQKAE
                     DLLSIKNPLHFVANPGPQQGEEGADDYATSEAMSGLILEPSTDGRRVPNLDNVTGLLT
                     DNGDDDNDHNASRKKSSAFAPSPSSLFNEQTLTVGMSGNGNGNGNGLSAATAFNDDIK
                     SLNSDVESKLIEDIQYINDKFKQFSSQIFDDEDFGLGQEQEQEQEQVRQEEDGNGCDV
                     RIEPKNNNSSISSALLLDEPVGVYGRSCGARFIRDKMRSGTSLNDSALGPKIVDSLNA
                     GSRSSRSSSYSASSPRPDSETKRSSVKSKAGFAQLGENITELFSTVASSFSKKSVPID
                     TEDQDEEGTDSESGEEVEGQGQGQGPENHEEDYKELKQYFDSVRYGSTGGAKSLEVSP
                     ITPLTTGCPATFSTRFNDDMNTDTGAFASGVVSSTTPLSINSSTVQTPASEKSAGWFD
                     FSKKNSSWCSFKFAQASKQSNAA"
     gene            <889130..>890848
                     /gene="ICL2"
                     /locus_tag="KLMA_70429"
                     /db_xref="GeneID:34718170"
     mRNA            <889130..>890848
                     /gene="ICL2"
                     /locus_tag="KLMA_70429"
                     /product="mitochondrial 2-methylisocitrate lyase"
                     /transcript_id="XM_022821690.1"
                     /db_xref="GeneID:34718170"
     CDS             889130..890848
                     /gene="ICL2"
                     /locus_tag="KLMA_70429"
                     /codon_start=1
                     /product="mitochondrial 2-methylisocitrate lyase"
                     /protein_id="XP_022678027.1"
                     /db_xref="GeneID:34718170"
                     /translation="MMSVNALNLSRKCGVPVMTRGFSSISKFPKVKDGQVEEFLDTQA
                     KEISEWWESERFKNIKRTYTPLDVAKHRGSFGNDVTYPSSIQAKRLFDTLEYKFQNRL
                     PVHTLGVIDPVQMSQLARCDGIDVAYISGWACSSTMVGSTNEVSPDFGDYPYDTVPNQ
                     VERIFKAQQMHDRKQLLKFSETGEASNRVDYLKPIIADADMGHGGTTTVMKLAKLFAE
                     KGAAGIHLEDQLHGGKRCGHLGGAVIVPTSTHISRLVATRLQWDIMGTENLVIARTDS
                     CNSKLLSSNVDPRDHEHIQGVITKDAKPWSEILCELENADASSAEISQAEASWYANNK
                     LFTFEEAVEQQLSESKVSAFKKECEKFLQSNNKGYISIKEYKSIARSVNGGSDIVFDW
                     DAPRTKEGFYMFKGGMKAAIQRSLAFSPYADLLWLETKTPDLAQAKSFSKLIHDKYPH
                     AKLVYNLSPSFNWSAHGYNDQQLQSFIWDLAKEGFVLQLVSLAGLHTDASSFWKLAKR
                     YQTEGMRAYVEEVQRPEKESGCDVLTHQQWSGAEYVDSIMQLVQNGSSSQTLSTKGDS
                     FTETQF"
     gene            <891904..>893043
                     /locus_tag="KLMA_70430"
                     /db_xref="GeneID:34718171"
     mRNA            <891904..>893043
                     /locus_tag="KLMA_70430"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821691.1"
                     /db_xref="GeneID:34718171"
     CDS             891904..893043
                     /locus_tag="KLMA_70430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678028.1"
                     /db_xref="GeneID:34718171"
                     /translation="MIWTYEMDLALCKLVYMNSPEILIEGIRDRRKNYHSVLNEFNKQ
                     FRLQVKQPRTVRARFERLLLDYKSRAKTKFAPKGRESEIDMLMKTLVTMEAEYYENNK
                     LPVSRPSSVESINVLTSGAMMEKAIDALKEVSQDELGAKNAAAATQISPKLKDITKSQ
                     NTLRSKKSSGTTNSNASGTNTNDWSNDNEENNIFANYASSGRSFGTKKGINVTKNKYQ
                     DSMNGDNGTSDGNLDENDDDDDDDDDDGEDENEDEYSTPTLQPKLKKVRHNTVPESQP
                     FTITNYFSDNKTFIMNGDGGTQQWAGKSDLHQVTQRVQGDLENVKHDVQELSVLSKRI
                     AAILERVTGMDSTGTSNNNGAHTASLNGTGTGTGNGNPSPNSSPQ"
     gene            <894292..>895644
                     /locus_tag="KLMA_70431"
                     /db_xref="GeneID:34718172"
     mRNA            <894292..>895644
                     /locus_tag="KLMA_70431"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821692.1"
                     /db_xref="GeneID:34718172"
     CDS             894292..895644
                     /locus_tag="KLMA_70431"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678029.1"
                     /db_xref="GeneID:34718172"
                     /translation="MQVPCELRSGLETYRLKSVLGNDNGSVIYCAQNSNGSNLVLVET
                     NKLLAANQKKQRRDGYKDRFYDEQRTRTFTVYGQEYLSMEGDNYFDYSTDDVSSSGSR
                     DTYDSDHSRSPVGDAKGQGAGKGKGTVGQLEDVAGDQHIVFNDSAEMKPCNNVLARLK
                     CKHVMRTPMQKISRPEEEEEEDDDDDDDDDDEEDEDQEEEEDEDQEEEDDDDDDGQSG
                     SLPKFKGYEPTSILSKSTDAQASINIAEASHPKASNETKKRAMSFPRTPIPKVFSESE
                     QSEEEEEEEEEEEEEDIDDSSLEMKRTVKKKLNDSREYITKSLKDDDDDLSEFSSTSN
                     INHTGGDSATDINFVSPSVFLSEIPHRRPVESRFQVRHVDRVEDEPVRPYPRPSFLEH
                     VRRSSSNNTNTHIPESDNSSRNRSKSLNTKCGMELNFHLDSSKMLNRRKTKASLERLT
                     "
     gene            complement(<895926..>896996)
                     /gene="YFH7"
                     /locus_tag="KLMA_70432"
                     /db_xref="GeneID:34718173"
     mRNA            complement(<895926..>896996)
                     /gene="YFH7"
                     /locus_tag="KLMA_70432"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821693.1"
                     /db_xref="GeneID:34718173"
     CDS             complement(895926..896996)
                     /gene="YFH7"
                     /locus_tag="KLMA_70432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678030.1"
                     /db_xref="GeneID:34718173"
                     /translation="MENVHSLADQALDLLHQNIDKNYRVLIGIVGAPGSGKSTIAERL
                     QDEINERYYEYLRSHDITETHVKELKEDIHLVDDLAEADAKTREEIDHGFYSHVEDTS
                     FKPVKISNVDGSITVMGRGGKDNAFKIRTRHNISTLTVAKPAIAQTVVMDGFHLSRKH
                     LDCFRDPEMAHRRRGSPPTFDSNNFLELCRVLCKTCTLHDDNNSSSSEKISRTPPVKD
                     DLFAKVTSSFVNVPEVVFPGFDHALKDPTPEQHSVPNYTRIVIIEGLYLLLDQENWSH
                     IYENIASTDAYLFWNIVTDEEVIEQRVAKRHVKAGICSTIQEGIERFRSNDLLNGRLI
                     QSKSLRDKIPDKQNHIIDIRND"
     gene            complement(<897309..>899381)
                     /locus_tag="KLMA_70433"
                     /db_xref="GeneID:34718174"
     mRNA            complement(<897309..>899381)
                     /locus_tag="KLMA_70433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821694.1"
                     /db_xref="GeneID:34718174"
     CDS             complement(897309..899381)
                     /locus_tag="KLMA_70433"
                     /note="Fungal_trans super family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678031.1"
                     /db_xref="GeneID:34718174"
                     /translation="MVMLSKGKETANKGEDEGAMAERDSLVKKEAREQEVEVEVEGEE
                     DKSRDKHSGSDSNSSSSSSSSSKVIGNGRTKEDGVVKKRRKNHGVACCFCKKRRKRCD
                     GGFPRCGACVNAGIPCTFVDSVTGRELPRDYIEKLEAKVARLESEGERRDQSPRQNVE
                     LLIPKLFTKTYWHVNNVPSFGIGTGSTGGAANPKPSYETGHKLLELYKDRVQRRYPFL
                     DWPWVLECFKKVFQQETVEAEATTFVYLILAIAAEMSEVPEERNSASKFYSIALEHGY
                     STLDGNSVRSVQLCLLLTIRLLVKPTDKLDESYDKLWHLAGVTVRTAVALDLHRKLGS
                     PRGMVDGLEQHVLQNLRSTVFWCAYSIERLIAMTVGRPFCISDVDIDAPLPEEEPEEE
                     EEAQQEGGKAPSSSNSGVIQMFKLRRIQSSICMCVFGPRKFLDNEDEVNQTRQQILLE
                     LGEWKNAVPNTKDLNKWARISYHQSVIWLLRPVLLQIEQNTLTNEAVEWFQVLRNSAS
                     EISSCYNDVLCPSLLPLSNNLDPLTTVHSLFVAGVTYMYCIWLDRKLKLTPSKNQLHD
                     LEISIAVIKLYERMLLNLAEQFPIAIMQKEIFMLLSERILESISGNADSVSGTGTTLT
                     IGTSTLVNDPNSDCESNSSIQSFVKPLNNRKLSLNSIKESHLYSFKHLNGDTILRTLL
                     CDLLEQLI"
     gene            <900016..>901059
                     /locus_tag="KLMA_70434"
                     /db_xref="GeneID:34718175"
     mRNA            <900016..>901059
                     /locus_tag="KLMA_70434"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821697.1"
                     /db_xref="GeneID:34718175"
     CDS             900016..901059
                     /locus_tag="KLMA_70434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678032.1"
                     /db_xref="GeneID:34718175"
                     /translation="MTADGEKANVLLIGSGGVGTIVAYGIDYVGKSRLDLVVRRDYET
                     VKESGYDIDSCDYGEITGWKPDNIFPSVEDAGQAAVSDGFKYDFIVICTKNLPDVLKL
                     EDLIEPVVVPGYTTIVLMQNGFDLARPFFQKYPENVVVSGVSHIGSHNHNGKVKQTQQ
                     DRTYIAYFENPNLSAEVQESRTKGFIAIYSNDKNSCKYYPSAKETRYMKLVYNATMNT
                     VCSLTGVDTGRLELCGGLEAISIPAMREVVAVAKADGVDLPADCISNAIHSDDGDWFT
                     PSMAVDVAKGNPIELEVILGNLLTVARELKVETPTLSLLYELLKVVQFRLKEKQGLVT
                     LPEKRPIHDKFWS"
     gene            <901327..>902361
                     /gene="AIM45"
                     /locus_tag="KLMA_70435"
                     /db_xref="GeneID:34718176"
     mRNA            <901327..>902361
                     /gene="AIM45"
                     /locus_tag="KLMA_70435"
                     /product="probable electron transfer flavoprotein subunit
                     alpha"
                     /transcript_id="XM_022821698.1"
                     /db_xref="GeneID:34718176"
     CDS             901327..902361
                     /gene="AIM45"
                     /locus_tag="KLMA_70435"
                     /codon_start=1
                     /product="probable electron transfer flavoprotein subunit
                     alpha"
                     /protein_id="XP_022678033.1"
                     /db_xref="GeneID:34718176"
                     /translation="MLRASVRRFTGIRGSGLRNASTLAFVETSKGAIAPASLNTLYAA
                     TKLGNPIDAVIVGSNASEAVSELQKLDVASLNKIIVVAEERLNDLLPEKLTPVFYELL
                     GKSESDYSHLVVPASSAGKGFLPRVGALLDLQPICEVTQILSPTTFVRPMYAGNILAT
                     VESQQSKKLISVRSSAFPAVGSGSNNATVETISSGSATSVNGQEIPEVRVEASNLVTS
                     ERPELGSASKIVSGGRGLKNKETFESLVTPLADTLGAAIGATRAAVDAGFCDNSLQIG
                     QTGKIVAPDLYIALGVSGAIQHLAGIKDAKTVVAINKDPEAPIFQVADYGLVGDLNEI
                     VPELTKKLKQ"
     gene            <902829..>904949
                     /locus_tag="KLMA_70436"
                     /db_xref="GeneID:34718177"
     mRNA            <902829..>904949
                     /locus_tag="KLMA_70436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821699.1"
                     /db_xref="GeneID:34718177"
     CDS             902829..904949
                     /locus_tag="KLMA_70436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678034.1"
                     /db_xref="GeneID:34718177"
                     /translation="MRQDESGTLLLDSVANARYHEGSRDRDRDFVASSSSKDADVRSA
                     STTPAGLGYSTVSFPENERISWKSTIPYYLPCFSWIPSYSLKKCMGDFVAGLSLASFQ
                     IPLAMSYATSVAHVPPLCGLYSLVFAPTVYTILGSVPQMIVGPESAISLIVGQAVEAR
                     HSKDPTVKAINICLVVTFISGLVLLVGGLLRLGFLENVLSRALLRGFISGVGIIMVIT
                     SLVIELKLEHVTPIKQEHYHSPFEKVIFIVKYGPQNYHKPTALVSLAAFVLLMGMRIS
                     KKHLSKRFKWLILFPDILTVVLLSIIISYKMHLKSKYGIEIVDDIPNNSLKHLKNPLS
                     SANLSSFKDLFSTGFMVAMLGFFESTTASKSLGTSYNLAVSSNRELIALGSTNVVGSV
                     FAILPAFGGYGRSKINAYSGAKTTMSGLFMGIVTLFTIQFLLPVIRYIPVCVLSVITT
                     VVGLTLLEEAPHDLKFHWRCKGYPELIIFTVTLLATLFYSLQAGIYIGCACSIINVIK
                     HSAKSRIQILGRITGTDTFVNADEYLASTSEYCVSSQVEEIEGCLIVRIAEPLTFTNA
                     DDLKMRLHRLEKHGSAVTHPAAPRSRKEEMTENIIFDLKGMTNIDSSAAQTLQEIVMA
                     YKRKNVHIFLRGVRMSEKVRGRLLNSGIAEMVEKNPATNTYYFDTIEDALAAVDNLSQ
                     RHNHQSHTPPISTFSDTLLNSSMP"
     gene            905256..905329
                     /locus_tag="KLMA_R709"
                     /db_xref="GeneID:34718785"
     tRNA            905256..905329
                     /locus_tag="KLMA_R709"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:34718785"
     gene            complement(<905584..>907026)
                     /locus_tag="KLMA_70438"
                     /db_xref="GeneID:34718178"
     mRNA            complement(<905584..>907026)
                     /locus_tag="KLMA_70438"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821700.1"
                     /db_xref="GeneID:34718178"
     CDS             complement(905584..907026)
                     /locus_tag="KLMA_70438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678035.1"
                     /db_xref="GeneID:34718178"
                     /translation="MSSSSNVIPALVGHKYPAKEHCLKVKGHFLQKKGLAKDSASAIF
                     IAGGEIEPVKYCDQTKLFRQNRYFFYLTGCNIPGSSVLFDLKSEKLTLFLPDVDAEDI
                     MWSGLPMSVDQARAKFDVDEVLYSSDLAGVFDDKMSDHKIYTIDLDNVHDPKIEAKLI
                     SGDEDLFYALDESRLIKDWYEIELLRKACQVTDTCHKAVMSALPIEKTEGHIHAEFTY
                     HALRQGSKFQGYDPICCSGPSCSTLHYVDNDADMDGKHSVLIDAGAEWENYTADVTRC
                     FPISGKWTKEHREIYDAVLDMHSTAMEQIKDGASWEEIHLSTHRVLIKHLLKLGIFKS
                     SFTEEEIFERKASVAFFPHGLGHLLGMDTHDVGGRPNYEDPNPYLKFLRLRRTLQNGM
                     VITNEPGCYFNPFLIEEFLRKYPERSEVVDYEVIEKYSYIGGVRIEDDVLVTKDGYEC
                     LSKITTDPEEIEKIVSDGIAKGRSHFHVLA"
     gene            <907808..>909250
                     /gene="SAD1"
                     /locus_tag="KLMA_70439"
                     /db_xref="GeneID:34718179"
     mRNA            <907808..>909250
                     /gene="SAD1"
                     /locus_tag="KLMA_70439"
                     /product="pre-mRNA-splicing factor SAD1"
                     /transcript_id="XM_022821701.1"
                     /db_xref="GeneID:34718179"
     CDS             907808..909250
                     /gene="SAD1"
                     /locus_tag="KLMA_70439"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor SAD1"
                     /protein_id="XP_022678036.1"
                     /db_xref="GeneID:34718179"
                     /translation="MNSETKRPLEDSNSDDDDDYSGDEHIEVVKRVRRTEKVTLPNAY
                     IDEINIKRLDFDKERICCVTLSRSNIYCCLSCGKYLQGRGRSTVMFKHSIEQKHHVFL
                     NVTNLKVYLLPEGSEVETSADPLLRDILYAVYPTFTAASVKEFPKVCRDLDDRAYLNG
                     FIGLNDLNSNGYMNVVILALSHIPPLRDHFLLSNNYSGTDSPVDTDLTASVALVVKKL
                     WNCRLLRRNVSPQQLMNVVSSVSKTKFSSDAHEDPRLFLLWLLSKLSTNGDDRILQKT
                     LMKQLQGQIEIKSTEIETITNEADQTVKFKRLESESTIKKTKFWLLSLDLPEMKVFKD
                     GNDVNSVPQVRIEELLSKYTEQMEHHTKDSVKTYKVVKYPNFLILYYNRFNNGFTSLK
                     DRNQTIVEFSNEMDFQGNRYRLLSNITHDCITKGKLSDTEDLLVSKWKINVLNTKDND
                     WYEIDDIEIRKVEEEFIFLKECYIQIWQRL"
     gene            complement(<909291..>910226)
                     /gene="RPN11"
                     /locus_tag="KLMA_70440"
                     /db_xref="GeneID:34718180"
     mRNA            complement(<909291..>910226)
                     /gene="RPN11"
                     /locus_tag="KLMA_70440"
                     /product="26S proteasome regulatory subunit RPN11"
                     /transcript_id="XM_022821702.1"
                     /db_xref="GeneID:34718180"
     CDS             complement(909291..910226)
                     /gene="RPN11"
                     /locus_tag="KLMA_70440"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN11"
                     /protein_id="XP_022678037.1"
                     /db_xref="GeneID:34718180"
                     /translation="MESLQRMMMSQRAGMMGANATEVPLDDTKETVYISSLALLKMLK
                     HGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQ
                     TGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDA
                     FRLIDPSTVMRNQEPRQNTSNIGLINKPNIQALIHGLNRHYYSLNIDYHKTKAEMNML
                     MNLHKEQWQSGLKMHDFKDREQHNLGETQKMIKIAEQFTKRIEEERELSEEELKTRYV
                     GRQDPKRHLAETAEKLLEENIVSVLTAGVNSVAIK"
     gene            <910653..>911108
                     /locus_tag="KLMA_70441"
                     /db_xref="GeneID:34718181"
     mRNA            <910653..>911108
                     /locus_tag="KLMA_70441"
                     /product="type 1 phosphatases regulator YPI1"
                     /transcript_id="XM_022821703.1"
                     /db_xref="GeneID:34718181"
     CDS             910653..911108
                     /locus_tag="KLMA_70441"
                     /codon_start=1
                     /product="type 1 phosphatases regulator YPI1"
                     /protein_id="XP_022678038.1"
                     /db_xref="GeneID:34718181"
                     /translation="MNEGSPSVPEGSHTITISQAPALLQLRADDSKKDTKAKKKAKSK
                     VRWDEKVVDNEFMNKKKTKICCIFHPNTPLDSDEEECEHDHGHDSSSSSSSSSSSDED
                     EGKSFDERRKARLERRKKKLEQQRTPSPNAYEIQPDYSEYRDKIRSKGA"
     gene            complement(<911289..>913685)
                     /gene="NIC96"
                     /locus_tag="KLMA_70442"
                     /db_xref="GeneID:34718182"
     mRNA            complement(<911289..>913685)
                     /gene="NIC96"
                     /locus_tag="KLMA_70442"
                     /product="nucleoporin NIC96"
                     /transcript_id="XM_022821704.1"
                     /db_xref="GeneID:34718182"
     CDS             complement(911289..913685)
                     /gene="NIC96"
                     /locus_tag="KLMA_70442"
                     /codon_start=1
                     /product="nucleoporin NIC96"
                     /protein_id="XP_022678039.1"
                     /db_xref="GeneID:34718182"
                     /translation="MKKRAQEMRKTIPHESNHTKAHYLLAGSGLGIHEIESSLNNLKA
                     SELLSEQRVAQGYNDGDLDTYLNIRKDENILSAIEQSLSLAAKDFDNFVNQNFNLDWK
                     QRKDEVRESFGILIKKRQDTSNYDTKNLAPLDPNSGSFWGKPGRGLLDGDSRLNVNEN
                     YIVREKFEKYARIIYRLNNARQSHSGDFELAKEFISTFQNTTDSKYRQLLEGWEIIDN
                     AKGKSSVVDSSKKYLERQFLNYVDNLYSKNPSEGLPTNVNKIRAFIDMKLKTGKNTWK
                     FNNLTIVNGIPVWALIFYLLRAGLPQDALEVVVNNKLSFKKVEQSFLTYFKAYVTSSD
                     NRLPQEFVSRLHTEYNQHIKNALDSDPFRLAVYKIIGRCDLTRKNISAITLSVEDWLW
                     VHLMLIKDDMDVDDPVYERYTLNDFQNTMVSYGESRFNNYYLQVLLLSGQYELAVQYA
                     YKISEMDAVHLSIGLAYYNMLHVSTYKEDELISVTDGQTQLNFVKVLGNYTKSFKYSD
                     PRIAVEYLILIALSNQSEQIELAYEALRELILETKEFTILLGKVNAEGIRIPGIVEER
                     QSLLQLQDQKDFLYKITEQAARRADEEGRVQDSLLLYQLSEEYDIVMSIVNKLLGELL
                     STTEINQPLFGLDDNNETNPVLIAKRLIEVYINNIEISKKVQQKNKETCITLLKLVDI
                     RSSFLARQWQSTLQKIEELDLIPFADENSTRKRAQEFAHLDENILKNIPNLLIITMLC
                     ISNIVKQLNESDYQSLTKKQQIDSLKRVAKNCMIYAGMIQYKMPRETYSILINIEVSL
                     "
     gene            complement(<914331..>915917)
                     /gene="PDH1"
                     /locus_tag="KLMA_70443"
                     /db_xref="GeneID:34718183"
     mRNA            complement(<914331..>915917)
                     /gene="PDH1"
                     /locus_tag="KLMA_70443"
                     /product="probable 2-methylcitrate dehydratase"
                     /transcript_id="XM_022821705.1"
                     /db_xref="GeneID:34718183"
     CDS             complement(914331..915917)
                     /gene="PDH1"
                     /locus_tag="KLMA_70443"
                     /codon_start=1
                     /product="probable 2-methylcitrate dehydratase"
                     /protein_id="XP_022678040.1"
                     /db_xref="GeneID:34718183"
                     /translation="MLRQSARTTVKNVVNSSYLKSTPFMLREVNMRKNFYSTPSINID
                     NKRPEPDEVLRNIASYVHNQGITSGEAYDTAKLCLLDTLGCGLAALKYDQPKNLIKPI
                     VPGTIVPNGTKVIGTKYRMDPVKGAFAIGTLIRWLDFNDCWLAAEWGHPSDNLGGILA
                     VADHLTRLSKATGGDEGRLFTIKDVLEAMIKAHEIQGVIALENSFNKVGLDHVVLVKV
                     ATTAVVSKMLGLTEAQTVEALSQAFVDGQSLRTYRHAPNTGSRKSWAAGDAVSRAVNL
                     AYLVKNGSPGTIPSVLTAKTWGFYDVLFKGKPFTFEQRNTFGSYVMENVLFKISFPAE
                     FHAQTAVEAALKVNKELADLGKTYKDIKSIRIRTQEAGARIIDKEGPLYNYADRDHCI
                     QYMTAIPLIHGRLTADDYSDEVASNPDIDELRAKMYCVKDDQFTLDYHDPAKRSIPNA
                     LLVELNDGTKLEEVVVEYPIGHRLRRKEGVPLLMQKFYGHLREHFKGDIEKVETIMQA
                     STDDDFLNMTVDKYVNMYCE"
     gene            complement(<916924..>918348)
                     /gene="CIT3"
                     /locus_tag="KLMA_70444"
                     /db_xref="GeneID:34718184"
     mRNA            complement(<916924..>918348)
                     /gene="CIT3"
                     /locus_tag="KLMA_70444"
                     /product="citrate synthase 3"
                     /transcript_id="XM_022821706.1"
                     /db_xref="GeneID:34718184"
     CDS             complement(916924..918348)
                     /gene="CIT3"
                     /locus_tag="KLMA_70444"
                     /codon_start=1
                     /product="citrate synthase 3"
                     /protein_id="XP_022678041.1"
                     /db_xref="GeneID:34718184"
                     /translation="MLRTISQTRLFSTSRRLLSLKAALSEVIPEKREEFLRIKKDYSN
                     VKVGDITVGSIINGMRGNQSMYWESTTLDPAEGIRFHGKTIAECQECLPGAPEDNGKG
                     EFLPESMLWLLMTGKPPTPEQAQELTKELAVRGENIPHHTDKLLSSLPHDMHPMTQLA
                     IALASMNQNSLFAQEYQKGTIGKSDYWYYVYEDVLNLIAALPKLTGKIYSNVTNGGEP
                     LGCYNVNKDWSYNIASLLGMTVSDSVNTHSLTPERSNDFVNLVRLYCGIHVDHEGGNV
                     SAHTTHLVGSALSDPYLSYSSGIMGLAGPLHGLAAQEVVRFLAEMEKSVGSGENVKQV
                     QDYLWSVLNSHRVIPGYGHAVLRKPDPRFDAMLNFAQSRPKEFENDSKVQLMKRLSEI
                     APGVLKEHGKTKNPYPNVDSASGILFHHYGIDQMLFFTVIFGCSRSMGPLTQLVWDRI
                     LGLPIERPKSLDLNSIKKICNISS"
     gene            complement(<919473..>920096)
                     /gene="LOC1"
                     /locus_tag="KLMA_70445"
                     /db_xref="GeneID:34718185"
     mRNA            complement(<919473..>920096)
                     /gene="LOC1"
                     /locus_tag="KLMA_70445"
                     /product="60S ribosomal subunit assembly/export protein
                     LOC1"
                     /transcript_id="XM_022821708.1"
                     /db_xref="GeneID:34718185"
     CDS             complement(919473..920096)
                     /gene="LOC1"
                     /locus_tag="KLMA_70445"
                     /codon_start=1
                     /product="60S ribosomal subunit assembly/export protein
                     LOC1"
                     /protein_id="XP_022678042.1"
                     /db_xref="GeneID:34718185"
                     /translation="MAGKQSLTAKRAKRQNGTREVRSEVFEDSVARNQLANASTLTEK
                     STTRKPSKLQVKKENFKARLYGSQKKKEKHYTEKELNIPSLNRAIIPGVKIKRGKKGK
                     KFIDDHDLITLNRLISTIGDKNDEVTESKLEKARRLEQIRDLRRQEIERKEAQKKEQL
                     EGVKEDIKKKASVARTLRRKNKRQELKVESKKTEPDSGKKKKSVSFA"
     gene            complement(<921356..>922531)
                     /gene="HAT1"
                     /locus_tag="KLMA_70446"
                     /db_xref="GeneID:34718186"
     mRNA            complement(<921356..>922531)
                     /gene="HAT1"
                     /locus_tag="KLMA_70446"
                     /product="histone acetyltransferase type B catalytic
                     subunit"
                     /transcript_id="XM_022821709.1"
                     /db_xref="GeneID:34718186"
     CDS             complement(921356..922531)
                     /gene="HAT1"
                     /locus_tag="KLMA_70446"
                     /codon_start=1
                     /product="histone acetyltransferase type B catalytic
                     subunit"
                     /protein_id="XP_022678043.1"
                     /db_xref="GeneID:34718186"
                     /translation="MSVDLRPETWTTSTNDALTISLVDENGAVKFKPAFTYPIYGDAE
                     QVFGYKNLQIFLAFDSITMKPFLNVKYDEKLNTDIPDVQKALLAKLPKDDVILKDEAK
                     WVDAFTKEQETFSLPDKDTIIDEYNIGDESFTVYKVSLQVDAVKRIHRRLQIFTLLFI
                     EAASYIDESDPSWEVVITFNKRTKQCIGYATTYQFWRYLGSETFDMSSVDDRKSRAKI
                     SQFLILPPYQGKGHGKYLYTAIFKHWLADQSIIEITVEDPNESFDDLRDRCDLERIIN
                     ERLLSDCPNDLPLKQGWLDRKRLELKLEQRQFMRIVEMYLLFSKSSNYRLQLKSRIYE
                     KNYEALMDMDESTKKDKLQTAYQSLTDDYKRILSKVNVSKRTKLSSTGSVPVKKIKT"
     gene            <922794..>923492
                     /gene="SNF8"
                     /locus_tag="KLMA_70447"
                     /db_xref="GeneID:34718187"
     mRNA            <922794..>923492
                     /gene="SNF8"
                     /locus_tag="KLMA_70447"
                     /product="vacuolar-sorting protein SNF8"
                     /transcript_id="XM_022821710.1"
                     /db_xref="GeneID:34718187"
     CDS             922794..923492
                     /gene="SNF8"
                     /locus_tag="KLMA_70447"
                     /codon_start=1
                     /product="vacuolar-sorting protein SNF8"
                     /protein_id="XP_022678044.1"
                     /db_xref="GeneID:34718187"
                     /translation="MKRFGVAAFGESKQYDLASNKLGSQSNEIKEQLSIFQEKLVEFA
                     KHHNEELRDVPQFRAKFMRMCSAIGIDPLSLFDKNSHLFHIDDYYYQICVKIIEICRN
                     TKDVNGGVISLEELHVNYFKKMNIEMEDIQKGIKMLEPLDGGFELFAIRQKQFLRSVP
                     TELTDDQTKILEICSIMGYASIALLRANLNWKRIRSQSLLDGMVASGLLWVDTQSPEE
                     DVIYWDPSWIINLE"
     gene            complement(<923588..>924940)
                     /gene="DEG1"
                     /locus_tag="KLMA_70448"
                     /db_xref="GeneID:34718188"
     mRNA            complement(<923588..>924940)
                     /gene="DEG1"
                     /locus_tag="KLMA_70448"
                     /product="tRNA pseudouridine synthase 3"
                     /transcript_id="XM_022821711.1"
                     /db_xref="GeneID:34718188"
     CDS             complement(923588..924940)
                     /gene="DEG1"
                     /locus_tag="KLMA_70448"
                     /codon_start=1
                     /product="tRNA pseudouridine synthase 3"
                     /protein_id="XP_022678045.1"
                     /db_xref="GeneID:34718188"
                     /translation="MMSFLLKLFKLDRKTSVSTMPSDKSPYNKWTKEQLIERLLQLEK
                     KINENSIEEASTKNTVGARKRAADNNGSENERNSVKKTKKSREFDFSKYNTRFVAFRF
                     AYLGWNYNGLAIQKDKTPLPTVEGTILETMVRCKLVPSMVPQEYKFSRCGRTDKGVSA
                     MNQVISLKVRSNLTPEQQLDPSYDDQEIQYVNILNQLLPEDIRVSAVCLRPPKGFDAR
                     FSCISRHYKYLFSPEGLDLDKMKRAAKHFEGEHDFRNFCKLDGSKQITNYKRTIISAK
                     ITKINEDIYCFDLIGSAFLWHQVRCMMANLFLVGQGLEEDTIILEMLNVEDMPRKPIY
                     EMASDIPLVLYDCKFPAMEWIIPDQTTDKASRSSAVVNSVELNYKLKASVSMMYRDIL
                     PKAEIKNKTVINVGDGIGKVVNVYQKLADRSLMDSFEVVNEKYRQRKIRNPKEVKSST
                     "
     gene            <925296..>927089
                     /gene="SPB4"
                     /locus_tag="KLMA_70449"
                     /db_xref="GeneID:34718189"
     mRNA            <925296..>927089
                     /gene="SPB4"
                     /locus_tag="KLMA_70449"
                     /product="ATP-dependent rRNA helicase SPB4"
                     /transcript_id="XM_022821712.1"
                     /db_xref="GeneID:34718189"
     CDS             925296..927089
                     /gene="SPB4"
                     /locus_tag="KLMA_70449"
                     /codon_start=1
                     /product="ATP-dependent rRNA helicase SPB4"
                     /protein_id="XP_022678046.1"
                     /db_xref="GeneID:34718189"
                     /translation="MARSLSWDDLKCDIEPWIRTAIDAMGFETMTPVQASTIPLFSGN
                     KDVVVESVTGSGKTIAFVIPVLERLIKEEANSPKFKKSHFHSLIISPTRELASQIQSV
                     IEEFLKYYPDDQYPIRSQLIVGTGDSTVRDDINRFMDNRPQILVGTPGRILDFIQKSN
                     VKTSSCGTVVLDEADRLLDLNFQKDVETILKLLPKQRRTGLFSATIESAGAQIFKTGM
                     RNPVKVAVKSHSSAPSSLSINYIVTPPEDKLQLLLTLLNNYRFKKCIVYFPTCISVTY
                     FYAFINYLKSIDLITEDISIFSLHGKLQTQSRMKTLNSFTTSLKNSVLFTTDVAARGI
                     DIPDVDLVIQLDPPTDSDIFIHRCGRTGRANRVGKAIVLLNEGREEDYIPFLEVKNVI
                     LEEESVKITPIDTLSQTFKEWIMQDRARFDHGIRAYVAFIKYYSKHSASSIFRLQTMN
                     FVGIAKFYGLLRLPKMPEITQYALASSIPEGGWLVSPPIDLDTFSYMDKRKEKERLQE
                     LKNIQHINDKKKLKSELKKKNMAWSDKKLSKDAKIERKAAMAAKRKAIEEKLLQEGNE
                     SEGEVEQDWKDLVRQNKKKKHNIIQGSFGDL"
     gene            complement(<927124..>928491)
                     /gene="ULA1"
                     /locus_tag="KLMA_70450"
                     /db_xref="GeneID:34718190"
     mRNA            complement(<927124..>928491)
                     /gene="ULA1"
                     /locus_tag="KLMA_70450"
                     /product="NEDD8-activating enzyme E1 regulatory subunit"
                     /transcript_id="XM_022821713.1"
                     /db_xref="GeneID:34718190"
     CDS             complement(927124..928491)
                     /gene="ULA1"
                     /locus_tag="KLMA_70450"
                     /codon_start=1
                     /product="NEDD8-activating enzyme E1 regulatory subunit"
                     /protein_id="XP_022678047.1"
                     /db_xref="GeneID:34718190"
                     /translation="MHQNSDKKQHNSVGILDRYDRQLMIWGESGQEILSNSHVCVLHY
                     KLDLMVVECLKSMVLMGIGKITLIGEFGLEKLALFDIEGLQSMNPHVQLDIQDHTGDD
                     CNYEDIPNFRTPHFWAPFDAVIGISAGGPLLQCINELWLKWEHCLPTLILSYAFDAYG
                     YVRLIGNEPSCVINSHAHSNPDLRLTCMWPELEKYHESFQFDKLSQHELSAVPYSVLL
                     STVSKELRKSKIALNRNSVKAALIRLHDKYMSGSFNDDVNFIEADRYSFLLFNESNPF
                     PDNLTKILQTIHSEPKSIINKWVYHFVQSVEKFYTLNGCLPVRSAIPDMECSTLMFNE
                     QKAIYARKSAQDVAELMEILSPHSIPEYFVRYLLQNLRTLDVVKLSSITREDVKEQSA
                     RMTDLLIHQKDHLYTADPNPAISAILGSLTAQECVKLLTHQFVPLQNTLIYDGLSNTT
                     EIISI"
     gene            complement(929464..929563)
                     /locus_tag="KLMA_R710"
                     /db_xref="GeneID:34718786"
     tRNA            complement(join(929464..929522,929528..929563))
                     /locus_tag="KLMA_R710"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:34718786"
     gene            <929476..>930432
                     /gene="LSP1"
                     /locus_tag="KLMA_70451"
                     /db_xref="GeneID:34718191"
     mRNA            <929476..>930432
                     /gene="LSP1"
                     /locus_tag="KLMA_70451"
                     /product="sphingolipid long chain base-responsive protein
                     LSP1"
                     /transcript_id="XM_022821714.1"
                     /db_xref="GeneID:34718191"
     CDS             929476..930432
                     /gene="LSP1"
                     /locus_tag="KLMA_70451"
                     /codon_start=1
                     /product="sphingolipid long chain base-responsive protein
                     LSP1"
                     /protein_id="XP_022678048.1"
                     /db_xref="GeneID:34718191"
                     /translation="MHRTYSLRNKKPPTAAELQTPPPPQSTTKSKFFGKSSLASTIRK
                     NTAGQFGPLLSRKLSALIKTEKGYLRALEVVASERRVAAKQLSLWGSENDDDVSDVTD
                     KLGVLVYELAELQDQFIDKYDQYRITLKSIRNIEASVQPSRDRKQKITDEIAHLKYKD
                     PQSTKIPVLEQELVRAEAESLVAEAQLSNITRERLKAAFNYQFDSVRELAEKFALIAG
                     YGKALLELLDDSPVTPGEARSAYDGYEASRQIIMDAESALESWTLDVAAIKPTLSFHQ
                     TVDDVYVDEDEEEGEHEAAEEEWAGEHEGGQEEQTLEGNDQK"
     gene            <932696..>935095
                     /locus_tag="KLMA_70453"
                     /db_xref="GeneID:34718192"
     mRNA            <932696..>935095
                     /locus_tag="KLMA_70453"
                     /product="ice-structuring glycoprotein"
                     /transcript_id="XM_022821715.1"
                     /db_xref="GeneID:34718192"
     CDS             932696..935095
                     /locus_tag="KLMA_70453"
                     /codon_start=1
                     /product="ice-structuring glycoprotein"
                     /protein_id="XP_022678049.1"
                     /db_xref="GeneID:34718192"
                     /translation="MYFFTLAALLLFSSRLIAAQNAAAAAAAAVTPTTTETGFTTWTG
                     TISSTVTTKLITTTGAKGSPLVIESFLVATPPAPTTTETGFTTWTGTVPTTVATSLIT
                     TTGAKGSPLVIESFLVATPPAPTTTETGFTTWTGTISSTVTTKLITTTGAKGSPLVIE
                     SFLVATPPAPTTTETGFTTWTGTVPTTVATSLITTTGAKGSPLVIESFLVATPPAPTT
                     TETGFTTWTGTISSTVTTKLITTTGAKGSPLVIESFLVATPPAPTTTETGFTTWTGTV
                     PTTVATSLITTTGAKGSPLVIESFLVATPPAPTTTETGFTTWTGTISSTVTTKLITTT
                     GAKGSPLVIESFLVATPPAPTTTETGFTTWTGTVPTTVATSLITTTGAKGSPLVIESF
                     LVATPPAPTTTETGFTTWTGTVPTTVATSLITTTGAKGSPLVIESFLVATPPAPTTTE
                     TGFTTWTGTISSTVTTKLITTTGAKGSPLVIESFLVATPPAPTTTETGFTTWTGTIPT
                     TVATSLITTTGAKGSPLVIESFLVATPPAPTTTETGFTTWTGTVPTTVATSLITTTGA
                     KGSPLVIESFLVATPPAPTTTETGFTTWTGTISSTVTTKLITTTGAKGSPLVIESFLV
                     ATPPAPTSITWDFTRGTNVVKTTISTAFITTTAKDGSPLVVESFLVAVPATTTSAETD
                     FTTWTGTVPTTVATKLITTIGAKGSPLVIESFLVATPPAPTTTETGFTTWTGTVPTTV
                     TTKLITTTGAKGSPLVIESFLVATPEVDSTETSFTTWTGTVPTTVATKFITTKMPRVL
                     L"
     gene            complement(<937626..>938450)
                     /gene="ADY2"
                     /locus_tag="KLMA_70455"
                     /db_xref="GeneID:34718193"
     mRNA            complement(<937626..>938450)
                     /gene="ADY2"
                     /locus_tag="KLMA_70455"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821716.1"
                     /db_xref="GeneID:34718193"
     CDS             complement(937626..938450)
                     /gene="ADY2"
                     /locus_tag="KLMA_70455"
                     /note="accumulation of dyads protein 2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678050.1"
                     /db_xref="GeneID:34718193"
                     /translation="MFTDGSSSEKVNQHEFVERPGRSFDPQDPALYHEDLELQKIHTG
                     GDNHEFLFIGRQKFLKEDLYSAFGGTLNPGLAPPSTHRFANPAPLGLSAFALTTFVLS
                     MVNAGAMGVHIPNVVVGLAAFYGGLVQLVAGVWEIALENTFGGTALSSFGGFWMSFSA
                     LYIPFFNISESYKDHPEEFSSAVGFFLLGWAIFTAGMTLCTMKSTVAFFSLFFLLTIT
                     FLLLSIGSFTQKTGVTKAGGVLGVVVAFIAWYDAFAGLATKENSYVTVRPFALPRH"
     gene            complement(<939445..>941640)
                     /gene="FRE3"
                     /locus_tag="KLMA_70456"
                     /db_xref="GeneID:34718194"
     mRNA            complement(<939445..>941640)
                     /gene="FRE3"
                     /locus_tag="KLMA_70456"
                     /product="ferric reductase transmembrane component 4"
                     /transcript_id="XM_022821717.1"
                     /db_xref="GeneID:34718194"
     CDS             complement(939445..941640)
                     /gene="FRE3"
                     /locus_tag="KLMA_70456"
                     /codon_start=1
                     /product="ferric reductase transmembrane component 4"
                     /protein_id="XP_022678051.1"
                     /db_xref="GeneID:34718194"
                     /translation="MLVKNFVLALFFFKSWCTAAKYTFFSKEESVYWACLDTLNPYIF
                     TNDLGSAYAPNCQPTRNRFLSWLICNFDHQKPEDLDKSLEKIIENCETSVPFYNHTVP
                     ELHQLYEKVHSSAIDIDSDPSFDPTKNQTKPVIPPRRKVERFTRAYYSRARSESRTRL
                     YGGAIFIYFAGCMLIGGIVTWSKILCPRIAQRFVGPKINAFRKLFTIPTVSKKHTENM
                     RWKNFIIGLMPTRAQTYILFGYFALNVILSCVDYDIFPDNFYTSSKHQVATQTADLVQ
                     YRTGVISTIHTPVVFLLSGRNNLLLYLTGWPYETFLVYHKWTARGMWIHALVHSAAYT
                     WLEIDSLAVVWKMQYWYWGGIATIVGGLMLFQASSYFRVNWYEIFKTIHFLFSALYIA
                     GLWYHLRIFNGLWMEYVYASIGLWCGDHLLRICRLLWFGVVKRADCELFEEDGTIKMT
                     IARPSTWKPFPGAFVYIYVLRPYGFWQSHPFTILFDENDADEKKIHIYIKAKKGLTAS
                     LAKSLSKMADKKQSFYVFVEGPYGFEAPLSKYENRLIITGGNGVPTGFSNYSNLTKNL
                     TETSRETVKWIWIIRDCSPLKWFKDDLLKVQDRLGEIDIYITRMNANDTPSSDDIVDL
                     KQEDDLSSSEKKNVAIINQTSEDNAADTNSGTSFSVFKELNKINIYFGRPDIQALVMS
                     EIQNNSKGSTAILSCGPPKMNDEIRDTVANSLNLSDSRVDYFEEAQVWS"
     gene            <943596..>945134
                     /gene="yxeK"
                     /locus_tag="KLMA_70457"
                     /db_xref="GeneID:34718195"
     mRNA            <943596..>945134
                     /gene="yxeK"
                     /locus_tag="KLMA_70457"
                     /product="putative monooxygenase yxeK"
                     /transcript_id="XM_022821719.1"
                     /db_xref="GeneID:34718195"
     CDS             943596..945134
                     /gene="yxeK"
                     /locus_tag="KLMA_70457"
                     /codon_start=1
                     /product="putative monooxygenase yxeK"
                     /protein_id="XP_022678052.1"
                     /db_xref="GeneID:34718195"
                     /translation="MTQKNHGDAQQPKRQKTNDDGKSAPKNIILNAFLMSSPGLQVIN
                     SWRNEKDQTSTSAENPEYWIELAKVLERGGFNAVFFADVLGPYDVYKGPGNFKPVAKA
                     GAQWPLPDPSYYIPLMAAVTKRLAFGITISTISEQPYHLARRLGTLDLITGGRAGWNI
                     VTSYLDSASRNLLNGQNLPDKVERYKKAEEFVDVIYKLFLSSWQDGAVKADKKKGVFT
                     DPEGLRHINHEGKYFNVQGPGLTQPSQQKLPVIIQAGTSPKGKELAARNAEIIFLNNP
                     SKDSLKKNIDSVKYLAQHKFGRDPSKIKFLLQVTIIIGDTAEDVKQQIDTVRALGDDE
                     AALAMFSGWSGIDISAYTDDKPLEDIENVAIASTIQSWKIAYPEVKIWTKKEIIDRVT
                     VSGSGILFAGTPKEVADTIQDWVEYTGVDGFNFAYTNLPGTFKDIADKLVPELRKRGL
                     VPGLDELTRANENGLSFRQQLFGTNELDPTHPASELKWKSNESREEFEHRFSKALEKL
                     HATL"
     gene            <945953..>946609
                     /gene="ywnB"
                     /locus_tag="KLMA_70458"
                     /db_xref="GeneID:34718196"
     mRNA            <945953..>946609
                     /gene="ywnB"
                     /locus_tag="KLMA_70458"
                     /product="uncharacterized protein ywnB"
                     /transcript_id="XM_022821720.1"
                     /db_xref="GeneID:34718196"
     CDS             945953..946609
                     /gene="ywnB"
                     /locus_tag="KLMA_70458"
                     /codon_start=1
                     /product="uncharacterized protein ywnB"
                     /protein_id="XP_022678053.1"
                     /db_xref="GeneID:34718196"
                     /translation="MTKNVALIGATGYTGAAILTELLSRKYHVKAIVRSPEKVKAQDN
                     LEIVKVDVFDEEALTKSLAGVDAVISAYNSGWTNPNIFEDFVKGSHNIINATKKAGIK
                     RFLVVGGAGSLYVAPGVQLIDTPQFPKAIYPGANGARVLLDDLKKETELDWTMLSPPI
                     GYSATNPGTRTGKYRIGTDSPLMDGDKPGAISAPDLAIALVDELEKGDFIKARFTIAN
                     "
     gene            complement(<946754..>948190)
                     /gene="MCH2"
                     /locus_tag="KLMA_70459"
                     /db_xref="GeneID:34718197"
     mRNA            complement(<946754..>948190)
                     /gene="MCH2"
                     /locus_tag="KLMA_70459"
                     /product="probable transporter MCH2"
                     /transcript_id="XM_022821721.1"
                     /db_xref="GeneID:34718197"
     CDS             complement(946754..948190)
                     /gene="MCH2"
                     /locus_tag="KLMA_70459"
                     /codon_start=1
                     /product="probable transporter MCH2"
                     /protein_id="XP_022678054.1"
                     /db_xref="GeneID:34718197"
                     /translation="MIMTEEKLRKVDPKESTIKDSESTASETIEIPDGGYGWVIALCF
                     FLYNFCTWGANSGYAIYLADYLSNNAFPGGGKLDYAAVGGIAFGGGLLFAPVIVHFSR
                     IYGVQIVIGIGIVCQTAALLLAAFSKKLWQLYLTQGLLISFGLASICIPSFTLVPQWF
                     RNKRTLASGIGTSGSGLGGIIFNLGMQRIIEVKSVKWALIVQCIICSVLSCIALALTR
                     TRTKIIHGNAAKAKSSFKELAVEHLEVFKIFGMWLLCLWVAFTMLGYVIILYSLSAFT
                     QSLGYNAKKGSYVSCMVSLGGLVGRPIIGHIADKFGPITVGAIVNLIVAILCWAMWIP
                     CTNFGVAIAFGLLQGALIGTVWVIFASVSARVIGLKRLEKASGVLWVFIALFAIPAPV
                     IGLQLDTDVIGSKTNYVHTAIFTGFAYFGAALLLYLLRIYIITRDEKSRQHSDDHDNF
                     DRDETSYTVDIRSFAKNIFSGNIGGRKV"
     gene            <948795..>950791
                     /locus_tag="KLMA_70460"
                     /db_xref="GeneID:34718198"
     mRNA            join(<948795..948846,948903..>950791)
                     /locus_tag="KLMA_70460"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821722.1"
                     /db_xref="GeneID:34718198"
     CDS             join(948795..948846,948903..950791)
                     /locus_tag="KLMA_70460"
                     /note="Uncharacterized transcriptional regulatory protein"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678055.1"
                     /db_xref="GeneID:34718198"
                     /translation="MKKKAVGVKCRHKPTKSSCLEKGLQCVYNIKLETRLTEGTKQLS
                     KSQLIAQIALLKSELNEGSREIGRNPVLGLQYTSSKQGRVLTYGPTSVRCLIRSSQLQ
                     WCYTAIWKTIKEKRNDWKKNHIHAIKVEEIYSIGNPLSISGGNSILEALCDCLPTMHV
                     LKHSLDRFFNCTLFKEFEILDPLKVATDLEECFISDQEGRIMSINIYEKKNYYRLGII
                     TRILTIVHFKERVPTAVELFHKYLAAFESAKSMHIERAQFFMLKYLFINARGFTAGDG
                     GNSITIINLALSTAMQIGLYRTENLGLFRDRERYIKNLCVLLVQADFESSFSLGSHLQ
                     VSEYFLQDLDGRANPKISEDGNFSTLQYFLFLRQQLAGVSSTHNAPSLPLSISKLKFS
                     LLATFGELKHYLSRTAYDPPIEFQKLYAILLSLQIIANFSLIQTQVSVDGTLELQQQA
                     LICHIASLILVFNYMEALYNDQMLIRGGENHIDACIDIGLGLFLYHNVLPRATHELVL
                     IFSDALNTNEGFGVYSTNSNDVDIKHFNEIVDNFLKSDKDMDFGANVAYKYFERIHEN
                     FKNNRSKKLDNLLHQSYLFIVCDEFSNSLVQAFKEPITLMTNKPDEMSNQNMPFTVDD
                     NDLFLDNALEIFDDEFTSFFFT"
     gene            <953496..>956153
                     /locus_tag="KLMA_70461"
                     /db_xref="GeneID:34718199"
     mRNA            <953496..>956153
                     /locus_tag="KLMA_70461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821723.1"
                     /db_xref="GeneID:34718199"
     CDS             953496..956153
                     /locus_tag="KLMA_70461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678056.1"
                     /db_xref="GeneID:34718199"
                     /translation="MWFFYLTQLTLMCIIPLVNGVSQVVDSGTILGCIPPQGSLAKGF
                     TVSYYHYPMIPNPNSAGCYLINSVFRTDEYQHGGYETLGGGLIGRSNGVTNLTYYSPS
                     TCSPGCCKVQVGNVPPNYNYDSQVALGNLTMLLTGYFLPPKSGNYKFNVDYVDDVTYM
                     NIGAGKAFGCCHINSTVSNPGPFDLTLTYPDSKNSATVNLLEGLYYPVRILYINRYDT
                     GKLLMSFEDPDGVMYQTFDDYVFMAPDGDECPAPVATTTIPWTFQSTTTQTTVVTTSG
                     SDNLPITENLIIVRAPDITFATTINTPWTETFTSTYSTGLTTTSGPDGIKTIFETLFV
                     ETPEIETAVTKVIPWTGKYTTTYSTNIATETGTDGIPTVKTNFLVETPQVETATTVNT
                     PWTGTYTTTYSTGISTETGADGIPIVRTNFLVETPQVETATTINAGWTGTYTTTYSTN
                     IVTETGADGIPTVRTNFLVETPQVETATTVNIPWTGTYTTTYSTDFVTVTVIDGIVTL
                     QAVYHVQTPTVKLSKFDNLSRTSNDTQAYSTDIIATTGADGVSTVHPTFSVNASEIGS
                     ISTVISPWTGTYTTTYSTELVTATGTDGIITVQAVYHVKTPSTGTTNTKKSAWISNYI
                     QTDSTGGIGSSSADGVSNVQTAIHVKTGEAGNAMKINIPWTGTYTTTYSTGAFTSTGS
                     NGIQTVQTAFYVKTPEMGSSTFGYSNTSSTTSHGTDSNGNKNLQSETSKPLVKVSVTS
                     GNVIGHSTAETNLPISQETSSNRPTTSKNDDGPVPERGSTANINTPLGTTMNAVGETS
                     GAVSGIIDTETKGKQSKTMSISVGQPVTVSSATSKATSPQPSLNPSIPTFTPSISGAS
                     QTATFETRLEDKANKILISPLVIILLAFL"
     gene            complement(<956646..>958205)
                     /gene="FCY2"
                     /locus_tag="KLMA_70462"
                     /db_xref="GeneID:34718200"
     mRNA            complement(<956646..>958205)
                     /gene="FCY2"
                     /locus_tag="KLMA_70462"
                     /product="purine-cytosine permease FCY2"
                     /transcript_id="XM_022821724.1"
                     /db_xref="GeneID:34718200"
     CDS             complement(956646..958205)
                     /gene="FCY2"
                     /locus_tag="KLMA_70462"
                     /codon_start=1
                     /product="purine-cytosine permease FCY2"
                     /protein_id="XP_022678057.1"
                     /db_xref="GeneID:34718200"
                     /translation="MSSPVYNEGYLSSDIEKQDPAESHVQELEKDHSVYTTTTEISRL
                     SWVNRLAVRVNAETKGIDPVTENEKDDTDIMNAATMWFSSNMVISAFSLGCLGISACG
                     LNFGTSVLTIFFFTLLGVMPVAFFSVFGVELGLRQMVLSRFLVGNITARLFSFMNVIA
                     CVGWVSVNTMASASLLHMVNPSGHNCPPWAACLILIMCTIVVTFFGYRFIHLYEKWSW
                     VPNFAVFLVIIACLAKSGNFTNGPWGGGSNTAAGVLSFGSSIFGYAAGWATYAADYTV
                     YMPRQTNKKKVFFSVVLGLGLPLLFTMTLASAAMACTQTNKRWAELYASHSVGGLCYA
                     ILVEDSLWGFGSFCCVLLAMSTVANNTPNMYSIALGTQAMWEPLAKIPRVFWTFVGNL
                     AALAISIGAYYKFESFLSKFMDSIGYYIGIYIAISLSEHYIYRRGFTGYTVSDWNRWD
                     RLPVGYAGCAALFIGAFGVAFGMSQSYWKGEIGRHIGSGGADIGFELGAGFAFIAYNI
                     CRPLELKYNGR"
     gene            complement(<959899..>961086)
                     /locus_tag="KLMA_70463"
                     /db_xref="GeneID:34718201"
     mRNA            complement(<959899..>961086)
                     /locus_tag="KLMA_70463"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821725.1"
                     /db_xref="GeneID:34718201"
     CDS             complement(959899..961086)
                     /locus_tag="KLMA_70463"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678058.1"
                     /db_xref="GeneID:34718201"
                     /translation="MTVAEPIPPISDLKPASSTTSSTTSSTTSPIANSSSKSQQYTFS
                     YLNKPKSRFTLPTVQSPWGYKVWLREFCKALRKQGLGYLLPLRDGTFSHVPEDDEKDY
                     ITSIHSACVPPDKCPKWLKLSPEDDASIVDCFLQAVKKINAEEYPTNIVDEMAALSLL
                     PEESLQSFLKRAKDLQRRASNANFPGVDQILIDKTLITLPETYHRATVTFYDQKDRSF
                     KRFMEILSETETKISDGKEIDTNTIKKEVLNLKVDKEERDVLKREEIDVLKREEIDAL
                     KKEEVDSLKNNEIDSLKKEEVDSLKKKEIQTFAKEVSRISMPDEEPIHDFLARMGDLY
                     DRLARADLLQLESQMVANILRALPKKFELMVATFRLGFDQDFPSLVALFSDPEIATRL
                     LGI"
     gene            complement(<962041..>962184)
                     /locus_tag="KLMA_70464"
                     /db_xref="GeneID:34718202"
     mRNA            complement(<962041..>962184)
                     /locus_tag="KLMA_70464"
                     /product="conserved hypothetical membrane protein"
                     /transcript_id="XM_022821726.1"
                     /db_xref="GeneID:34718202"
     CDS             complement(962041..962184)
                     /locus_tag="KLMA_70464"
                     /codon_start=1
                     /product="conserved hypothetical membrane protein"
                     /protein_id="XP_022678480.1"
                     /db_xref="GeneID:34718202"
                     /translation="MFVSLYSCDVTFFMHYPFFFPPAIPASCISHVPFPITVSMLVKR
                     FFS"
CONTIG      join(AP012219.1:1..963005)
//
DBGET integrated database retrieval system