GenomeNet

Database: RefSeq
Entry: NC_036032
LinkDB: NC_036032
Original site: NC_036032 
LOCUS       NC_036032             939718 bp    DNA     linear   CON 23-OCT-2017
DEFINITION  Kluyveromyces marxianus DMKU3-1042 DNA, complete genome, chromosome
            8.
ACCESSION   NC_036032
VERSION     NC_036032.1
DBLINK      BioProject: PRJNA264644
            BioSample: SAMD00067077
            Assembly: GCF_001417885.1
KEYWORDS    RefSeq.
SOURCE      Kluyveromyces marxianus DMKU3-1042
  ORGANISM  Kluyveromyces marxianus DMKU3-1042
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1
  AUTHORS   Lertwattanasakul,N., Kosaka,T., Hosoyama,A., Suzuki,Y.,
            Rodrussamee,N., Matsutani,M., Murata,M., Fujimoto,N., Suprayogi,
            Tsuchikane,K., Limtong,S., Fujita,N. and Yamada,M.
  TITLE     Genetic basis of the highly efficient yeast Kluyveromyces
            marxianus: complete genome sequence and transcriptome analyses
  JOURNAL   Biotechnol Biofuels 8, 47 (2015)
   PUBMED   25834639
  REMARK    DOI:10.1186/s13068-015-0227-x
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 939718)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 939718)
  AUTHORS   Yamada,M. and Kosaka,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2011) Contact:Mamoru Yamada Yamaguchi University;
            1677-1 Yoshida, Yamaguchi, Yamaguchi 753-8515, Japan URL
            :http://ds22.cc.yamaguchi-u.ac.jp/~jo-sei08/index.html
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP012220.
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps and the
            genomic and proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: SPS phrap v. 0.990329
            Assembly Name         :: Kmar_1.0
            Genome Coverage       :: 8.4x
            Sequencing Technology :: Sanger ABI3730
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..939718
                     /organism="Kluyveromyces marxianus DMKU3-1042"
                     /mol_type="genomic DNA"
                     /strain="DMKU3-1042"
                     /db_xref="taxon:1003335"
                     /chromosome="8"
     gene            <2277..>3569
                     /locus_tag="KLMA_80001"
                     /db_xref="GeneID:34718203"
     mRNA            <2277..>3569
                     /locus_tag="KLMA_80001"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821727.1"
                     /db_xref="GeneID:34718203"
     CDS             2277..3569
                     /locus_tag="KLMA_80001"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678059.1"
                     /db_xref="GeneID:34718203"
                     /translation="MASNDIISTNVPSKVPTTDTEEYPVQHGSAAKTPIVPSDNQASP
                     EESGSIDVEHKANADDEASGSHEGHHENFSKDSTKTGTPQDTLHKEPVDGSPVPNYAQ
                     QSWYYHTQPPPQFYSSPYANYGPGPYTPPWANMNMPIPGANTNPDKTGGHYQTTGPSG
                     DSSQYNPAYYFPYQLEPKPGLQSQTTTECTFGQLHNPRKTFTLSKVNSPHYYDSWVRE
                     MCQAMLEQNLGHLIPTEDNKTPETPEPAEKRYIKEIHIACVPEEKYPKWLKSSYDEGE
                     ALIDCFKEGIRRIKAEEDPEAIVLALAGLTLDYRESIPNFAKRLRKIHQRTVNAKFPM
                     AEKIVISRALKALPERYEKVDINFTKSNDQSFNNFINILLTTEPRMKSSNQYDNQRFY
                     TNSERKQVDRRPNRKTVHHIGSKTVEGDLRPDTEVQEE"
     gene            <3598..>7620
                     /gene="TY2B-C"
                     /locus_tag="KLMA_80002"
                     /db_xref="GeneID:34718204"
     mRNA            <3598..>7620
                     /gene="TY2B-C"
                     /locus_tag="KLMA_80002"
                     /product="transposon Ty2-LR1 Gag-Pol polyprotein"
                     /transcript_id="XM_022821728.1"
                     /db_xref="GeneID:34718204"
     CDS             3598..7620
                     /gene="TY2B-C"
                     /locus_tag="KLMA_80002"
                     /codon_start=1
                     /product="transposon Ty2-LR1 Gag-Pol polyprotein"
                     /protein_id="XP_022678060.1"
                     /db_xref="GeneID:34718204"
                     /translation="MLDGGATVSVIYDKRLIHNFTSESNQILVDVQQNEVAVKGEGNL
                     ELKFKGKRISLPAIYAPSTHTNIISVEDLTKSQAYLDLRRNCLLSKNGKTIAPTHKFA
                     GLRWLSRKNAIELPNQTQSVYAITPRSVRSAPDKFSLTSIHNMFGHMNINYIRESFRK
                     GLIQGVKEDDVDWTGVSSFQCQYCMEGKAKRNNHYVNARKDYTKEYLPFEYLHTDVFG
                     PVRVQRTRTTPRYFIAFIDEVTKYIWTFPLLHKTAEEVAPTFKEVVMLIYTQFNTRVK
                     TIQMDKGSEYLNTKVQKFLRERGIVSRETTVADSKANGAIERQHYTLLNDCRTFLRQA
                     NLRPRLWYHAVVYSTVMRNSLLNRSIGTSPRNRAGMSGLSFRDILPFGQPVIVHLPNP
                     KSKLQARGVLGYALHPSTRSYGYIIVVGKKKKIPIDTRNYRVLNYPPGATISEDEVQY
                     MIDRMENNDAESQDDIESNFEPNYTDMEQPIHHTADYFPNTTAPNIETDQYNNDSFGL
                     HYGGDSVPPESSSSEDELFPTDESENDSDSSDQSFNDDGDPMSPPYSGGEEQIVPTPA
                     PIRRVPPMEPPSPVEDSPPPLSGTDLDDLFGESNINNYIPEDTDLLALNHESVPEPDT
                     AVPETTNIEQDNVLPLETNENSNPPNDNSDQSGEGSGEESGEESGEESGEESGEESCD
                     ESGDESVDNRLKSIPIFNGNKHKDARTAEADLDSLYGGGDNTENNNGPTLEEVFRSIE
                     EDPFMLTQKRPRSRARYRESNQDSCDSGGDYESDSDSDGSSDESPQKGRKIQRVNYVN
                     AVLKPVNVIPLNMSLNYSQAISRNRNEEEKDAFQKAYQKEIAQLTKMNTWNEELIDAS
                     TLPKKKILNSMFIFTTKRDNSKKCRLVARGDQQAADTYDTELKANTVDNLALMTVLAL
                     TLDYNLTAFQLDISSAYLYADLKEELYIRAPPHMNAKNKVLRLNKSLYGLKQSGANWY
                     ELIRSFLIKKCDLFEDRMWKCVFRDKEPLKLIICLFVDDMLVVGNDVKYIKKFISKLS
                     KRFDTKIVNDGSHRPEDGVNEYDILGIELEYKKKEYMKFGMQKSLEDKLPQLGIPLLP
                     NTKIRKVPGVPGDYIFSGKELTLNEREYKSKVKHLQKIVGLASYVGHKFRFDILYYVN
                     ILAQHQLYPSAKVLDRAAQLCQYLWDTRDKKLVWHYSGPKENNVTAVSDAAFAGNQDF
                     KSQSGTLFLRNNKPIAAKSRKIKLTCISSTEAEIYAISQSLPILRGLEHLVNKLQDTK
                     VTVKVKTDSQPSMAIINGTDDSACLKKHIGSRAMRIRDECDDLGLTLEYIPTKENNAD
                     ILTKPLSVKLFKLLTEDWIQ"
     gene            <8130..>11102
                     /gene="TY2B-GR1"
                     /locus_tag="KLMA_80003"
                     /db_xref="GeneID:34718205"
     mRNA            <8130..>11102
                     /gene="TY2B-GR1"
                     /locus_tag="KLMA_80003"
                     /product="transposon Ty2-DR2 Gag-Pol polyprotein"
                     /transcript_id="XM_022821730.1"
                     /db_xref="GeneID:34718205"
     CDS             8130..11102
                     /gene="TY2B-GR1"
                     /locus_tag="KLMA_80003"
                     /codon_start=1
                     /product="transposon Ty2-DR2 Gag-Pol polyprotein"
                     /protein_id="XP_022678061.1"
                     /db_xref="GeneID:34718205"
                     /translation="MRNSLLNRSIGTSPRNRAGMSGLSFRDILPFGQPVIVHLPNPKS
                     KLQARGVLGYALHPSTRSYGYIIVVGKKKKIPIDTRNYRVLNYPPGATISEDEVQYMI
                     DRMENNDAESQDDIESNFEPNYTDMEQPIHHTADYFPNTTAPNIETDQYNNDSFGLHY
                     GGDSVPPESSSSEDELFPTDESENDSDSSDQSFNDDGDPMSPPYSGGEEQIVPTPAPI
                     RRVPPMEPPSPVEDSPPPLSGTDLDDLFGESNINNYIPEDTDLLALNHESVPEPDTAV
                     PETTNIEQDNVLPLETNENSNPPNDNSDQSGEGSGEESGEESGEESGEESGEESCDES
                     GDESVDNRLKSIPIFNGNKHKDARTAEADLDSLYGGGDNTENNNGPTLEEVFRSIEED
                     PFMLTQKRPRSRARYRESNQDSCDSGGDYESDSDSDGSSDESPQKGRKIQRVNYVNAV
                     LKPVNVIPLNMSLNYSQAISRNRNEEEKDAFQKAYQKEIAQLTKMNTWNEELIDASTL
                     PKKKILNSMFIFTTKRDNSKKCRLVARGDQQAADTYDTELKANTVDNLALMTVLALTL
                     DYNLTAFQLDISSAYLYADLKEELYIRAPPHMNAKNKVLRLNKSLYGLKQSGANWYEL
                     IRSFLIKKCDLFEDRMWKCVFRDKEPLKLIICLFVDDMLVVGNDVKYIKKFISKLSKR
                     FDTKIVNDGSHRPEDGVNEYDILGIELEYKKKEYMKFGMQKSLEDKLPQLGIPLLPNT
                     KIRKVPGVPGDYIFSGKELTLNEREYKSKVKHLQKIVGLASYVGHKFRFDILYYVNIL
                     AQHQLYPSAKVLDRAAQLCQYLWDTRDKKLVWHYSGPKENNVTAVSDAAFAGNQDFKS
                     QSGTLFLRNNKPIAAKSRKIKLTCISSTEAEIYAISQSLPILRGLEHLVNKLQDTKVT
                     VKVKTDSQPSMAIINGTDDSACLKKHIGSRAMRIRDECDDLGLTLEYIPTKENNADIL
                     TKPLSVKLFKLLTEDWIQ"
     gene            complement(<15376..>16410)
                     /locus_tag="KLMA_80004"
                     /db_xref="GeneID:34718206"
     mRNA            complement(<15376..>16410)
                     /locus_tag="KLMA_80004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821731.1"
                     /db_xref="GeneID:34718206"
     CDS             complement(15376..16410)
                     /locus_tag="KLMA_80004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678062.1"
                     /db_xref="GeneID:34718206"
                     /translation="MSYTVITGANGFIAQHIIKILLSNGHKVIGTVRTQEKADTIAKL
                     FDNENLILEIVPDLNAVEAFDPLFKKYNTQIKYVLHTASPADSTLTDLQNDYINTAIT
                     GTLSVFNAIKSYAADSVESVVYTSSSLAGANLKTIFDKTAIINEESWNPDGRGDAVDS
                     FSAYSISKKLAEQAIWKFKEDNKDAIKFRLSTINPFFVTGPQAFDETAKGKLNETASY
                     FEQILASKPGGDLAPFFGVPALDVRDVARAHYLALTESRFDGQRIFLDADVYTTQQWY
                     DVIHEKFPELNGKIAKGQPGTNKFKEGSIAKIDVSKSKKLLGFDQIPLKQTITDGIAQ
                     LLRVRRIPQN"
     gene            <19184..>20551
                     /gene="LAC12"
                     /locus_tag="KLMA_80005"
                     /db_xref="GeneID:34718207"
     mRNA            <19184..>20551
                     /gene="LAC12"
                     /locus_tag="KLMA_80005"
                     /product="high-affinity glucose transporter"
                     /transcript_id="XM_022821732.1"
                     /db_xref="GeneID:34718207"
     CDS             19184..20551
                     /gene="LAC12"
                     /locus_tag="KLMA_80005"
                     /codon_start=1
                     /product="high-affinity glucose transporter"
                     /protein_id="XP_022678063.1"
                     /db_xref="GeneID:34718207"
                     /translation="MDWKGRKPAILLGCFGVVAASVVTAATSTKSALIGGRWMLSFFA
                     TIACSAAPAYCVEVSPVHLRGKVAGLYNTLWYCGSIVAAFTTYGTNKHLPNSANGFKI
                     PLYCQTIFPGLVCIFGWLLPESPRWLVGVGREEEAREFIAKYHFNGNREHPLIDFEMS
                     EIIESFHGINMSAPLEVLDLRPLFRKRSDRYRLGLVIAMAWFGQFSGNNVCSYYLPTM
                     LTSVGMKSVSVNVLMNGVYSIVSWVASIIGSFCHDKVGRRKMFMISTLGAALALSGLA
                     ICTARYQAGSKGASKGTLVFIYLFGVIFSFAFTPMQPIYPSEVSTNLMRSKAQLVNNV
                     VAGVAQFVNQFAAPKAMKNIKYWFYVFYVFFDIFEFIIVYFFFVETKGKTLEELAAVF
                     EAPNPRKASTDPVFAAQVREQILRDNNQRQLEAMGIKNSVTNNMDDVKANVNHVEKVS
                     DLESV"
     gene            complement(29564..29638)
                     /locus_tag="KLMA_R801"
                     /db_xref="GeneID:34718787"
     tRNA            complement(29564..29638)
                     /locus_tag="KLMA_R801"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34718787"
     gene            <36287..>38002
                     /gene="UGA4"
                     /locus_tag="KLMA_80006"
                     /db_xref="GeneID:34718208"
     mRNA            <36287..>38002
                     /gene="UGA4"
                     /locus_tag="KLMA_80006"
                     /product="GABA-specific permease"
                     /transcript_id="XM_022821733.1"
                     /db_xref="GeneID:34718208"
     CDS             36287..38002
                     /gene="UGA4"
                     /locus_tag="KLMA_80006"
                     /codon_start=1
                     /product="GABA-specific permease"
                     /protein_id="XP_022678064.1"
                     /db_xref="GeneID:34718208"
                     /translation="MSDSNSTSTGSEKNRYVVTSNEIQKAAPITSLRTITSRNVGEVN
                     YINAKTAHDDTELLAEIGYKQELQRHFSKIQVFGVSFSIMGLLPSIASILVTALPGGM
                     VSLVWGWFIAGFFVLTNGLAMSELASAIPTSGGLYYYTYHYAPPKAKRLLSFVVGNSN
                     SLALIAGLCSVNYGLAGEILSIVVIAKDGNFEITNAKTYGVYAGCTIAVGIVTSVATV
                     AVSRLQTFSIVSNLILIAIFFVALPVGVAKSDHMDFNSASYIFGNWENLSDWTDGWQF
                     MLTGFTPVIWVIGAFDSCIHMSEEAKNATASVPFGIIGSITVCWILGFLICIVLAACS
                     SKDIAGILGGKFGQPFAQIIFDAMGKNWAIALMVLIAFCQFLMASSILTAISRQIWAF
                     ARDDGLPFSRIIKVVNVKLSSPIRATWFGAICALAIGCLCLIGTQASSALFSLYISAN
                     YFSWMVPNLLRMTFGQEIFTPGAFYMGKTWSPIINWTSIAFELFIIILMQFPSMQHHI
                     TPKTMNYTVVFTGTVWIGSVLYFKFYKKRIFVGPKSNLTDAEYEENVGQDVLDAILSK
                     QQEQE"
     gene            <39835..>41535
                     /gene="UGA4"
                     /locus_tag="KLMA_80007"
                     /db_xref="GeneID:34718209"
     mRNA            <39835..>41535
                     /gene="UGA4"
                     /locus_tag="KLMA_80007"
                     /product="GABA-specific permease"
                     /transcript_id="XM_022821734.1"
                     /db_xref="GeneID:34718209"
     CDS             39835..41535
                     /gene="UGA4"
                     /locus_tag="KLMA_80007"
                     /codon_start=1
                     /product="GABA-specific permease"
                     /protein_id="XP_022678065.1"
                     /db_xref="GeneID:34718209"
                     /translation="MSETGSSASGKNNFEINTKEVPHAAPITSLRTITSRRVGEVNYI
                     NAKTAHDDTELLAEIGYKQELQRHFTKIQVLGIAFSIMGLLPSIASILSMSLPGGTVS
                     LVWGWFIAGFFVLTNGLAMSELASAIPTSGGLYYYTYHYAPPKAKRLLSFVVGNSNSL
                     ALIAGLCSINYGLAGEILSIVVIGKNDDFEITNAKNYGVYAGCVVATGLITSVATVAV
                     SKLQTFSIVSNLLLIALFFVALPVGVAKSNHMDFNDASYIFGHWENLSDWPNGWQFML
                     AGFQPITWVIGGFDSCIHMSEEAKNATASVPFGIIGSISICWILGFFICIVIAACSSK
                     DIPGIIGSKFGQPLAQIFFDALGKKWAMAFMVLIAFCQFLMAASMMTAISRQIWAFAR
                     DDGLPFSKVIKVVNIKLSSPIRATWFGAVCALAIGCLCLIGTQASSALFSLAISANYF
                     SWMIPNILRMTIGKEIFTPGAFFMGRISPIINWISISFELFIIVLVCFPSIQHHIKPK
                     EMNYSVVFIGAVWSLSAVYFLVYKYKFYSGPKSNLTDEEYEEKVGQDVLDAILSKHEE
                     "
     gene            complement(<43751..>44914)
                     /locus_tag="KLMA_80008"
                     /db_xref="GeneID:34718210"
     mRNA            complement(<43751..>44914)
                     /locus_tag="KLMA_80008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821735.1"
                     /db_xref="GeneID:34718210"
     CDS             complement(43751..44914)
                     /locus_tag="KLMA_80008"
                     /note="GAL4-like Zn2Cys6 binuclear cluster DNA-binding
                     domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678066.1"
                     /db_xref="GeneID:34718210"
                     /translation="MLKPLRSCSRCRKNKIKCDSAETRPRPCSSCSKRGLTCTLDYVV
                     PPKRSDELKKLHQSVSCVKHSVDRLLQNAVETASYAAASMGRLDMGMGLGLELEGNGS
                     VGVGGNKDVQVLGGSETGSEYGSENEIGWDGGSSGGGNSSRSSPEVTWSSIKKSLSGV
                     IPSRIIKVNESKFLRLMLNRDCLMFNNFELDIHDLEEVLLEFCFIVRSVLQSADKSEE
                     ELPPLDNIGQLLLSKEGSVYLVSIINFYFDIPNFDYLEFYDHVTQGDSQMHVSELWLF
                     CNVILYGPAYFSPKVSHYSLPSICIPLQLQCIGDSMSNDLRPAFAKLYYSSQFKFQCP
                     KLYLLQEKFSNFQDDPLLQLIQFRCKPQRIVPGHSSTKMSLSQLSICQYNDQR"
     gene            <46083..>46790
                     /locus_tag="KLMA_80009"
                     /db_xref="GeneID:34718211"
     mRNA            <46083..>46790
                     /locus_tag="KLMA_80009"
                     /product="peroxisomal biogenesis factor 2"
                     /transcript_id="XM_022821736.1"
                     /db_xref="GeneID:34718211"
     CDS             46083..46790
                     /locus_tag="KLMA_80009"
                     /codon_start=1
                     /product="peroxisomal biogenesis factor 2"
                     /protein_id="XP_022678067.1"
                     /db_xref="GeneID:34718211"
                     /translation="MSRVSQLDGASLDAQLAQALQTELPVPCPSLVIETLVFVLGTRR
                     WHQDSVGTYGSVLTGVGYRCSRWRLFAATVLLRQLLRQVRFGRTDVVYEVLDLVHLLG
                     FLASGRGGPSLLHRVLGISAVFDPGFDYAALSSSSSSSSEVQMLWNAAVEMIAGMSYR
                     PIRRVQAANASGSSSGSNKSTSSSSGICPACGETATNAQNAGCCSAKYCYICALELEH
                     SRCLACNAKNITFVCTG"
     gene            complement(<46819..>47844)
                     /gene="NUC1"
                     /locus_tag="KLMA_80010"
                     /db_xref="GeneID:34718212"
     mRNA            complement(<46819..>47844)
                     /gene="NUC1"
                     /locus_tag="KLMA_80010"
                     /product="nuclease 1"
                     /transcript_id="XM_022821737.1"
                     /db_xref="GeneID:34718212"
     CDS             complement(46819..47844)
                     /gene="NUC1"
                     /locus_tag="KLMA_80010"
                     /codon_start=1
                     /product="nuclease 1"
                     /protein_id="XP_022678068.1"
                     /db_xref="GeneID:34718212"
                     /translation="MSLSLSRNALGAIVGVGTASYFWGKSSSGNGSGSTSTVTGPGSS
                     SGVPAVNGGSGQGDGKLSLTGSNVDPGAFFKYGFPGPIHDLETRQEFISCYDRKTRNP
                     YWVVEHITPESLKARGGDRKNSVFKEDERIPDMFRARLRDYFRSGYDRGHQAPAANAK
                     FSQEAMDDTFYLTNICPQVGEGFNRDYWAHLEYFCRQLVDKYNSVRIMTGPLYLPKKD
                     PKDGKFRVTYEVIGNPPNVAVPTHFFKLVVAEKPKNQANSDELHVAAFVLPNEPISNS
                     TKLTEFEVPVNALERSSGLQLLQNVRPNKKKELCKQVSCQITVREFNKQVLALPPPKD
                     VPALPGK"
     gene            <48626..>50341
                     /gene="PHR1"
                     /locus_tag="KLMA_80011"
                     /db_xref="GeneID:34718213"
     mRNA            <48626..>50341
                     /gene="PHR1"
                     /locus_tag="KLMA_80011"
                     /product="deoxyribodipyrimidine photo-lyase"
                     /transcript_id="XM_022821738.1"
                     /db_xref="GeneID:34718213"
     CDS             48626..50341
                     /gene="PHR1"
                     /locus_tag="KLMA_80011"
                     /codon_start=1
                     /product="deoxyribodipyrimidine photo-lyase"
                     /protein_id="XP_022678069.1"
                     /db_xref="GeneID:34718213"
                     /translation="MKQTMKRQSIRKTNRSQELAECLKPNPVYYPNPITFQKANQFNN
                     ASRKRPLELLEDFISLDNDDDDDNQGSHGNGKESGTSTGCDSYVHWFRSDLRVNDNRG
                     LAYAYRKARAEDRPIHGLYVINEHDWVAHMESGWKLTFIVEALKELGSSLSKYGIELH
                     VRQFEPDTPLLSNSKAFSEWFVHTVEEITGTGNSTLVTANLQYEVDELYRDGRIARLG
                     NTRNNFKLRLFHDQCIVRPGALTTGKGSQYTVFTPWYKKWVSYIEHDIDGTLKTPHGL
                     NHPTDTKDFQQLPIDYHLPERFTSYIPEQHLHTPPATEAAALEAMKNFIEGRGTKYNE
                     NKDLLATDGTSLLSGYITIGIISTRTIVLSAYLANNRHIMNKNKDVKNNNSLETFIKE
                     IAWRDFYKHVLCHWPFLSMDLPFKFETLNIKWQQDTTHFEQWCYGETGVPIVDAIMLQ
                     LLHTGYINNRARMITASFLAKNLLVDWRYGERWFRKHLIDYDVASNIGGWGFCSSTGV
                     DCQPYFRVFNMTLQSQKFDPDGKFIRRWLHLPHTTDVHQPSNTAIVDLKESRERALEK
                     YREVM"
     gene            <51158..>54058
                     /locus_tag="KLMA_80012"
                     /db_xref="GeneID:34718214"
     mRNA            <51158..>54058
                     /locus_tag="KLMA_80012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821739.1"
                     /db_xref="GeneID:34718214"
     CDS             51158..54058
                     /locus_tag="KLMA_80012"
                     /note="GAL4-like Zn2Cys6 binuclear cluster DNA-binding
                     domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678070.1"
                     /db_xref="GeneID:34718214"
                     /translation="MEGQENREIGVANNLDYVSDDKNGLKKRKSTYSRKGCLQCKKAH
                     TKCDERKPQCTRCAKRAINCTYKNHFVFQKNEFSSSSPGLEYVQSGLGTDNLNNCIDT
                     QHTATATTITNTTNTNTNTNINNNADINTTNNNNRLDQQHQQQHNLNSHAHVVNNIHN
                     NNSGQADKSSDPNAYGVGPTPMGIPVPAGYHNASMPLQMVGTTPSLQLPISPTPGSTI
                     NSPIGNANIPVSNNVGAYVPTHHGPMNLGTHYPQNLGNPSGVTTLPPLNVELTQGMGN
                     QPKKTDDSPGMPDHAAAQQMKGINGLQQQQQPSQQYPDQRVYHQTVSPGSKPYPYPSL
                     QYQRQKSGGLMASDTNFNTHLYNNGKLSNDPPGTFPTDIGFDQRKLYQSVKQSLAPNA
                     NKNNLYTTTAPSPSTNNVPLEKSTSNLDYRLMSDSKNNGTSNDSFSISREKSGSALGT
                     DTDGNNLDSDIVNIRDYIYISPTDWNFLNLLRFDQNDTRDNTPELEQSMQTNLFQLCW
                     RGASSSEIHSVFNSYDPIQILYATENPSTATTIPLDDPKLLNFIWTVVRTTLLCGNLI
                     LFPFKDHFDLLLDIFISMGRKYPLMKDVFVYVASLFMKDTYYNSNLKYFAHIWDRYVR
                     MPTLKRCLDQLTVLIRKSNDYCDNISLAFTVTLLFAANSANKSTEWRTHLRGVHDLFQ
                     RVERLKPSQIKDEHTEKNAHECYLFVKDWFCHAEVLAWITSDNGGCFSSQEDLEKLLN
                     QAAYSKYNLLNGRLDLIRGYTADYYPIFTMLSSNLLKSKKQGKPLSGTNMLRSYFLES
                     DSEVLNSLKNVGLNALALLRNIPIDDEYLNQATIGLSDVRLKLSMKNCTRMYHYALEL
                     YLEIFFLRKQIVSQYVQRRLEKMLECLFSIPFQSTCSITCHWPIYLGALISLLIKDQT
                     LYSHYTSVLKSFVTNGMNVASNSLERLSHISKALSYGDYNSLVDPAHDYIVY"
     gene            complement(<54381..>55604)
                     /locus_tag="KLMA_80013"
                     /db_xref="GeneID:34718215"
     mRNA            complement(<54381..>55604)
                     /locus_tag="KLMA_80013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821741.1"
                     /db_xref="GeneID:34718215"
     CDS             complement(54381..55604)
                     /locus_tag="KLMA_80013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678071.1"
                     /db_xref="GeneID:34718215"
                     /translation="MDSYKARLDALLEHTPIVDTHNDFAWLIRMQLHNQIHKFGFNFN
                     SENITCHTSIPKLRKGRVGIQFSSGFVECKDPDQYSHDFNLKSSVIRDTLEIFDLTKR
                     ICSEYPNDLKFVTSCDEAIAAYHEGKIAMPLAIEGLHQIEGSLSVLRQYYELGIRYAT
                     LNHNCDNPFSTAASSITAGLPDLGLTPLGVECIKEMNRLGIMVDLSHTSYKTMHDVLK
                     VTQAPIIFSHSCAWSLTHHERNVRDDVLLRVKENGGVVQVCFFGNFLAQDPSKPTEAT
                     IDDLVDHIFYIASLIGWEHVGFGGDYDGMEETPKGLEDVSKYPDVIYKCMERGASDED
                     IRGLMGSNLLRVWKSVEIISQIIQGRLPRGRAVEAEWEGRVWEYYDYLKDVNEVFPGS
                     KDIYFDSHVWLPSNH"
     gene            <57336..>60326
                     /gene="hyuA"
                     /locus_tag="KLMA_80014"
                     /db_xref="GeneID:34718216"
     mRNA            <57336..>60326
                     /gene="hyuA"
                     /locus_tag="KLMA_80014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821742.1"
                     /db_xref="GeneID:34718216"
     CDS             57336..60326
                     /gene="hyuA"
                     /locus_tag="KLMA_80014"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678072.1"
                     /db_xref="GeneID:34718216"
                     /translation="MTNRKLLIGVDVGGTNSDLVVVDPLQLEEEHRGVLAWHKAVTTP
                     DVCVGIKKAIKTVLEDPQNDIQKSEIVSVTIGTTHFINAVIERDSNRLEKVAVIRLCG
                     PYGKDMPPFGDFPEDLKLIINGFWCSLDGGYRVDAKEIRPLDEDGLRAACGKIRALGI
                     SAVALVSTFANMNNEHELRAAEIVREEIPDVDVVMSHTISGIGFIERENASILNASIK
                     KFGRKIISSFTQATKSIGLNCTVLLSQNDGTVLSTKDALEMPIRTFSSGATNSMRGAA
                     ILCSRDPDVKGKSVIVCDIGGTTSDVGQLLPSGFPRQSSSYSYIGGVKMNFSMPHVES
                     IGLGGGSIVRDQNGELTVGPDSTGSEIVSKAIIFGGDVITTSDVSIGETIDKFGIESL
                     DRDLLQMGDVNKVKDLFTPDFKQRYDFAIAKKLENIIDRMKTSPDPIPVIFVGGGSFI
                     APPELKGTSKVITPPFYQVANAIGAALGKISSTVAEVKTFENFDQERDAYIQSLIDRA
                     TSEAIEKGALASSITVVTIISDAVPYVDKVYRLEVKVVGDIDYDSTFKVTKGTMEQIS
                     NGVDDDEENDEYISEEVFKSAQVSRIQKEAINYAEYRPTVVDGEWILSETDIDFISAG
                     AYILGCGGGGDPNPDAIELKRLIREGARLRVMTLDEFEKKTEGKGTAINVGYCGSPLI
                     SGERLHGNEMLEATSLIERWEGKKTDGIFMFEIGGGNGLSGIWTAYHKDVPCIDLDLM
                     GRAYPTQWQSLPSVVHDLHGYPYVALSDGNGMSMILTSTTDDIQMEDIIRDAMYHHGV
                     QCACVEPSMTCNQMRNETVANPISNSWRIGRAVHIARTNSDMDSIPSRIIEAVGGPSA
                     AKCLLKGKIIQVEKKMKRGYGFGVAVIEGVDDSTGTTIRIPFKNENIVCYKVNEDGTE
                     TALCSVPDLITLVDDDGHAVGTQDYRYGLIVYVMVFAPSDKWTTPKGIEIGGPKGFGE
                     VFANIEYTPIGKYVEPIPITEEFA"
     gene            complement(<60695..>62446)
                     /gene="THI72"
                     /locus_tag="KLMA_80015"
                     /db_xref="GeneID:34718217"
     mRNA            complement(<60695..>62446)
                     /gene="THI72"
                     /locus_tag="KLMA_80015"
                     /product="thiamine transporter THI72"
                     /transcript_id="XM_022821743.1"
                     /db_xref="GeneID:34718217"
     CDS             complement(60695..62446)
                     /gene="THI72"
                     /locus_tag="KLMA_80015"
                     /codon_start=1
                     /product="thiamine transporter THI72"
                     /protein_id="XP_022678073.1"
                     /db_xref="GeneID:34718217"
                     /translation="MTFLGKLHRLVVLDESDRTKNRDLVPMPVSRRRWGVYGYTSYWT
                     LLCLCISTWSGGSSLLLFDVGTDGSVSVLGMNGQQTIGCIVLANFFISVAAILNSVYG
                     SKYHIGYSVFQRIIFGVRGSAFGVLIRAILSVVWFASQSWLGGLCVNVVLSSWSRRFL
                     NMKNTFPESVPMTSQELVGFVVFLVINVPVLMIRPEYYDHILAAGSFCMFFVGLGITI
                     WAVKANGWSNGPLLTAPITASSSQLGWSWMANLNAWYSFIVAGIANQSDYARFNRRPR
                     DSYIGTMIGVNVMGIVLPLMGIVTASAMLERYKQTFWMPNDICMFWLQEHYDAKSRAG
                     AFFAGLGLLISQLGVNCASNAISGGMDLASIFPEYINIRRGALLIMLLAWPTQPWLFY
                     NTSSTFITVMSSFTVFITPLTAMFMCDYYVIRKQVIKLSDLYVDSPKSIYWYQKGVNW
                     RNMLCFLFGAAPGLPGLIHAANPKIHINSGINHFYQGSFVFQFVITFALYYIINTVFK
                     PEVGQRDHVDYYHTFTEKELREWDMVPADDYNYPSIEFTNSSSKEVHYENPHADGSLQ
                     HLKMGYNETSKESMEES"
     gene            complement(<63128..>64114)
                     /gene="DIM1"
                     /locus_tag="KLMA_80016"
                     /db_xref="GeneID:34718218"
     mRNA            complement(<63128..>64114)
                     /gene="DIM1"
                     /locus_tag="KLMA_80016"
                     /product="dimethyladenosine transferase"
                     /transcript_id="XM_022821744.1"
                     /db_xref="GeneID:34718218"
     CDS             complement(63128..64114)
                     /gene="DIM1"
                     /locus_tag="KLMA_80016"
                     /codon_start=1
                     /product="dimethyladenosine transferase"
                     /protein_id="XP_022678074.1"
                     /db_xref="GeneID:34718218"
                     /translation="MGKAAKKKYSGASTSGKEVDAEKHLTTVFKFNTDLGQHILKNPL
                     VAQGIVDKAQIKPSDIVLEIGPGTGNLTVRILEQARKVVAVEFDPRMAAELTKRVHGT
                     PVEKKLEIMLGDFMKTELPYFDVCISNTPYQISSPLVFKLINQPKPPRVSILMFQREF
                     AMRLLARPGDSLYCRLSANVQMWAHVTHIMKVGKNNFRPPPKVESSVVRIEIKNPRPQ
                     VDFNEWDGLLRIVFVRKNRTIAAGFKSTTVLEILEKNYKAYLAATATGGQSESDAAMG
                     DARGDSLIPQVKAKIEQVLAETGLAEKRAGKCDQTDFLRLLYAFHQVGIHFA"
     gene            complement(<64530..>68315)
                     /gene="plc1"
                     /locus_tag="KLMA_80017"
                     /old_locus_tag="KLMA_80018"
                     /db_xref="GeneID:34718219"
     mRNA            complement(join(<64530..65217,65557..>68315))
                     /gene="plc1"
                     /locus_tag="KLMA_80017"
                     /old_locus_tag="KLMA_80018"
                     /product="APC/C-CDH1 modulator 1"
                     /transcript_id="XM_022821745.1"
                     /db_xref="GeneID:34718219"
     CDS             complement(join(64530..65217,65557..68315))
                     /gene="plc1"
                     /locus_tag="KLMA_80017"
                     /old_locus_tag="KLMA_80018"
                     /codon_start=1
                     /product="APC/C-CDH1 modulator 1"
                     /protein_id="XP_022678075.1"
                     /db_xref="GeneID:34718219"
                     /translation="MSEQQLNKVQIRRSDSNSDPDGSTSKLSHSDGQGSQPMVRNKSG
                     SSGSSECNSVGGEDLCVYDHIYKGIKGFLSRRTSLGGSYSSSNSSSNKVGERELCGPL
                     TYALSSNLRIESINSQLGSFPSSGGAMDFPLVKVTRRKRVKYTFHIDENVISWNNSKK
                     EIFVDSIKDIRIGDLATNYMDMYDIRGPMRELWCTIIYSVSKNKLKALHVVADNKVVF
                     QSFYDSVVYLINSRRRLMEEIALPNNEQFANIHWQTNVSTKKEDQEKDSLSFPDVKRL
                     CNRYHIYCSDAYLRVLFERADTNHNGLLNFAEFQDFVRYLRFRPEVQIIHDEMKDADS
                     GMVGFESFYRFLNNVQGEVMSRTYAYKVFRKFCTSPLDDSMDMNGLLEFLTKQPFLKF
                     FEEDYSRPLNEYFISSSHNTYLMGKQLVDEVSVEAYTRALQQGCRCIEIDIWQGDHGP
                     VVCHGLFTQSIPLEDVIKTIRKYAFITSPYPLIVSLEIHCKKDFQAMIFDIMKEILGD
                     LIYVIPPNSQQLLSPMELKNRIILKSKKTQAFESDSAMSTTSGGATSSSPYDTLSESG
                     DSIIESGRRTGSFGNTNLSPTVSRKSVNGASSTSGRSLRLSSKVEISEQILEISGIHG
                     VRFRNFSLPESKTTTHCFSLNEKKFLALYKDEIQRLAINKHNRRHLMRVYPHVWRYKS
                     TNFNPIQFWVEGVQMVATNWQTYDLGQQLNHAMFQVSLDRNSIWHSGYVLKPPHLRRE
                     VHKMKDIPAIVERVKRQKINVQVDILSGQMLSLQHSKVIAPYVEIEIYTDNGVESLKL
                     TNCIQDEGCTSTCTSTTTTGGGAGSDCSGSDPNKEDRWSTGGTPLFATKYVRDNGFNP
                     VWNASFQCTLTNTTFNFVRFTVKNGGQVVATSCIRLHYLKQGYRHLPLYNSKGEKFIF
                     STLFIRMNGRSPLKKRNVLSSKNVNVNATGHAKLVSKPGVSGSRGSPVRSRTKIDVEQ
                     ALQSSPVRQVRSGSKSPIKCGTTSTTTSTTFTFYEESEEDRAAALVRHMTLRRSAVHD
                     ENETEQENQNQNQKLEPSRVHTQDTQKHRKPLQDLDIDKYPGTVQYAGGREQRLTLQL
                     GHQRALPVGVTPPRDKKVRDFFGGKQGGALEAATPSSSTTDDIPLNKVVRKLEFRIAE
                     GE"
     mRNA            complement(<65535..>68315)
                     /gene="plc1"
                     /locus_tag="KLMA_80017"
                     /old_locus_tag="KLMA_80018"
                     /product="1-phosphatidylinositol-4"
                     /transcript_id="XM_022821746.1"
                     /db_xref="GeneID:34718219"
     CDS             complement(65535..68315)
                     /gene="plc1"
                     /locus_tag="KLMA_80017"
                     /old_locus_tag="KLMA_80018"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4"
                     /protein_id="XP_022678076.1"
                     /db_xref="GeneID:34718219"
                     /translation="MSEQQLNKVQIRRSDSNSDPDGSTSKLSHSDGQGSQPMVRNKSG
                     SSGSSECNSVGGEDLCVYDHIYKGIKGFLSRRTSLGGSYSSSNSSSNKVGERELCGPL
                     TYALSSNLRIESINSQLGSFPSSGGAMDFPLVKVTRRKRVKYTFHIDENVISWNNSKK
                     EIFVDSIKDIRIGDLATNYMDMYDIRGPMRELWCTIIYSVSKNKLKALHVVADNKVVF
                     QSFYDSVVYLINSRRRLMEEIALPNNEQFANIHWQTNVSTKKEDQEKDSLSFPDVKRL
                     CNRYHIYCSDAYLRVLFERADTNHNGLLNFAEFQDFVRYLRFRPEVQIIHDEMKDADS
                     GMVGFESFYRFLNNVQGEVMSRTYAYKVFRKFCTSPLDDSMDMNGLLEFLTKQPFLKF
                     FEEDYSRPLNEYFISSSHNTYLMGKQLVDEVSVEAYTRALQQGCRCIEIDIWQGDHGP
                     VVCHGLFTQSIPLEDVIKTIRKYAFITSPYPLIVSLEIHCKKDFQAMIFDIMKEILGD
                     LIYVIPPNSQQLLSPMELKNRIILKSKKTQAFESDSAMSTTSGGATSSSPYDTLSESG
                     DSIIESGRRTGSFGNTNLSPTVSRKSVNGASSTSGRSLRLSSKVEISEQILEISGIHG
                     VRFRNFSLPESKTTTHCFSLNEKKFLALYKDEIQRLAINKHNRRHLMRVYPHVWRYKS
                     TNFNPIQFWVEGVQMVATNWQTYDLGQQLNHAMFQVSLDRNSIWHSGYVLKPPHLRRE
                     VHKMKDIPAIVERVKRQKINVQVDILSGQMLSLQHSKVIAPYVEIEIYTDNGVESLKL
                     TNCIQDEGCTSTCTSTTTTGGGAGSDCSGSDPNKEDRWSTGGTPLFATKYVRDNGFNP
                     VWNASFQCTLTNTTFNFVRFTVKNGGQVVATSCIRLHYLKQGYRHLPLYNSKGEKFIF
                     STLFIRYRETDV"
     gene            <69431..>70144
                     /gene="HSP31"
                     /locus_tag="KLMA_80019"
                     /db_xref="GeneID:34718220"
     mRNA            <69431..>70144
                     /gene="HSP31"
                     /locus_tag="KLMA_80019"
                     /product="probable chaperone protein HSP31"
                     /transcript_id="XM_022821747.1"
                     /db_xref="GeneID:34718220"
     CDS             69431..70144
                     /gene="HSP31"
                     /locus_tag="KLMA_80019"
                     /codon_start=1
                     /product="probable chaperone protein HSP31"
                     /protein_id="XP_022678077.1"
                     /db_xref="GeneID:34718220"
                     /translation="MVKVLIALTSYNEQFYADGAKTGVFVIEALHPFNFYKEQGCEVD
                     FVSENGKFGWDEHSMIPDFLSGKDKEDFEDKNSAFNQALSKTKSAAEVNASDYQVFFA
                     SAGHGTLFDYPKAAGLQKIASEIYAQNGVVAAVCHGPAIFDGMVDKATNKPLIEGKAI
                     TGFTDVGEVVLGVDTLMKEKKLSSIEDIAKKYNAKYLAPIGPWDDFSVADGRIVTGVN
                     PASATSTAKRSLQVLEAAK"
     gene            complement(<70380..>72224)
                     /gene="KAR9"
                     /locus_tag="KLMA_80020"
                     /db_xref="GeneID:34718221"
     mRNA            complement(<70380..>72224)
                     /gene="KAR9"
                     /locus_tag="KLMA_80020"
                     /product="karyogamy protein KAR9"
                     /transcript_id="XM_022821748.1"
                     /db_xref="GeneID:34718221"
     CDS             complement(70380..72224)
                     /gene="KAR9"
                     /locus_tag="KLMA_80020"
                     /codon_start=1
                     /product="karyogamy protein KAR9"
                     /protein_id="XP_022678078.1"
                     /db_xref="GeneID:34718221"
                     /translation="MDAGQIFSDQKLSDLLSKSAGQYQNLLSFFDDYEFDLEGTNHQL
                     LELAQLLLDSYTLLNELFTDDINVSQLLPYFDWIQEGKNEFYQLNNGIKTVEKILLHL
                     MKIIEEEFETNEDEQFRKDLSVLFDLIEELSDTLVSLKPITVSLKNLFDTAVEFNEIF
                     KDHMNSLDMEIESNLKKCIELQEKTFISPVRHNKLTFSLDQLIKLLSSSNTPTKGLCV
                     PAFSPLEQSIHDKLVELEEASSPIELSLNSVLSQRLDSFETRDVVNLEYLMRLLRKKY
                     HYIIEKYDLLQHEIEDLKHAIIDEKWRLIFINLNDELRIMLRDTEKLLIKIANPDLSD
                     EITSRFKEQLQVKTQTIDKTFTVIYTAIESLVLSESIATVTNEYAEKWLQLKTQYEEY
                     IPEDNTKDEEEAQKTINALSDNISELKLNDGPTEKPGSNRSSIGALIFKKMNIRPVIV
                     QEKDERKYGDESYESSRSSRSTSSTSSTSSTASNGLNPFYEPTSSHESKAPKVLNLSK
                     VPPLSFDEPSGLMSSLKTIKTPTVPLSPSATPTTITKDTNSSSSAASPYEVERLISYG
                     MIPTRIPSLYPSTLPPPLHLTVLFKLNSGWIKQRHHKLKAPRNYTIIS"
     gene            complement(<72647..>75004)
                     /gene="MDL2"
                     /locus_tag="KLMA_80021"
                     /db_xref="GeneID:34718222"
     mRNA            complement(<72647..>75004)
                     /gene="MDL2"
                     /locus_tag="KLMA_80021"
                     /product="ATP-dependent permease MDL2"
                     /transcript_id="XM_022821749.1"
                     /db_xref="GeneID:34718222"
     CDS             complement(72647..75004)
                     /gene="MDL2"
                     /locus_tag="KLMA_80021"
                     /codon_start=1
                     /product="ATP-dependent permease MDL2"
                     /protein_id="XP_022678079.1"
                     /db_xref="GeneID:34718222"
                     /translation="MATIMRPYWALGGGIARNFVVVSSRTFHVGSRSAMLSEGVARPF
                     CFPNSQMKHLSRFNRVTEFGIGIRRFGVSVRVRNTSDKDQQISKETAKNAKGSGSGSG
                     SSIKGVSAGFAEVKRLFYLARHDWKMIVVAVALLTVSCTIGMAVPRIIGLVLDATKSA
                     ITKRNDEDGENRTLSLDDLPPIVGDLRLYDFFLIFGGALLVGTMANFGRVVLLKILGE
                     RLVARLRSSVIKRTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALIC
                     GGAGIGMMVHISSSLASVLFLFVPPLLIGATIYGNKIRAISRELQQASGNLTRVGEEQ
                     LSGIKTVQSFVAEGKEVHRYNDAVRQVFKVGKKEAFTNATFFSGTNIVGDFSFLLVLA
                     YGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELIDYKP
                     TIRSTSGETFKPINGKVEFKGVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGK
                     STIASLLLRFYDPTSGQILVDGQDITKLSSKSLRRHLGVVQQEPVLMSGTIRENITYG
                     VNRETTMEEIRSVAKKCFCHGFISKFPNGYDTVIGPRGALLSGGQKQRIAIARALLKK
                     PKILILDEATSALDVESEGAINYTLGRLMRSKEMTIISIAHRLSTIRRSENVIVLGLD
                     GSVVEMGKFKELYANHESALYKLLTEPSEQHHAQQHNLNFAAGTEAAKASTQDGQNVK
                     TADQNGDVDEDQRSQDETDKRVKEEVIHQVLEDISHDQKSSTLRP"
     gene            complement(<75459..>75644)
                     /locus_tag="KLMA_80022"
                     /db_xref="GeneID:34718223"
     mRNA            complement(<75459..>75644)
                     /locus_tag="KLMA_80022"
                     /product="ATP synthase subunit epsilon"
                     /transcript_id="XM_022821750.1"
                     /db_xref="GeneID:34718223"
     CDS             complement(75459..75644)
                     /locus_tag="KLMA_80022"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="ATP synthase subunit epsilon"
                     /protein_id="XP_022678080.1"
                     /db_xref="GeneID:34718223"
                     /translation="MSTWRKAGLTFNNYAAIAAKTVRAALKPELQTNAVLSRSKSEAK
                     FIKIENGNQSEPVALKN"
     gene            <76480..>79548
                     /gene="POL5"
                     /locus_tag="KLMA_80023"
                     /db_xref="GeneID:34718224"
     mRNA            <76480..>79548
                     /gene="POL5"
                     /locus_tag="KLMA_80023"
                     /product="DNA polymerase V"
                     /transcript_id="XM_022821752.1"
                     /db_xref="GeneID:34718224"
     CDS             76480..79548
                     /gene="POL5"
                     /locus_tag="KLMA_80023"
                     /codon_start=1
                     /product="DNA polymerase V"
                     /protein_id="XP_022678081.1"
                     /db_xref="GeneID:34718224"
                     /translation="MQETVERVNRDLFYKVASELEKERLEAAIQLINEISSVDPESGA
                     KEWEYVLDRLIKGLASNRGGARLGFSMCLTEVVALALDKGALLSSIDEFLDRLDQTLG
                     GKDGVKNGKEERGLLFGQMFALQALLNEPVFSKVFLTKSNSGLNIEFLLKFLEKLIHL
                     ALLKTWLREPCLYSVYQTIRKCEQWLREDPVSIKLILGLLDENKLTLTNEGLSIYLMF
                     NNMRSKYASSLSLKNAGWKNNDPLSKGNVQLLATVLKDVVPVEKSDLKQKGNWSPRLH
                     YVWDMLLPLLEGEEDQEEETGHVSKKRKKNSKSGSSSSVSGDRSGRILFPEFWQAVVD
                     ESFFNEKASNERKYLGFLILEKAVQICSAKHVSVLLSQNIVRCIINQSQNSQRMLNKI
                     ANQTLKTITAECEKTPDKVEPLVRVLWFGKNGTINFDKLSKRKFVDTLLTTSTLDKHN
                     LMDLVTLLISQLPEDQSTNEKLNLSRFIFDTLLHLTRAHKARAESRWVKPILSTIVDA
                     AFFNSSENTKLSELAKERLYSILGELINTSVTEGDDTTSWPYIALQTILEKQSSGSTL
                     STDLDEELKAISNSAVQTLTDIHSKNKKMKNSKLGGLELLLSMAILQLYTGDEESVSI
                     LQDLISFYEQSNEESTDLVGITEILLSLVAQRKSLLKRLSLIVWESFVQDIGEPELDV
                     LLQTLTARENKQGFAALFEGEGEGDESNEEEDDDEEEIEEDGLEDEDEDEDMEDDDSS
                     NDDEISSDDASGDLEKIEKETTSALAKALNLPESIVGENGEVQLGQIDDEDDDNDDLS
                     EEEEEESMDDEAMMQLDDQLSQIFKRRKEALNTIPTGNKRKLEVQESRENVISFKHRV
                     VDMLEIYVKSVEQLEDKTEKLQNILMIIMPLLECLKQTLDKSLADKCARLMKLRISKL
                     KIHNNKGSTAEGDAQSLAPAIWDLEEDVHKLMLTSKPGQFQQLFFSTCSLSSLFLAKL
                     YVTYDGPIDELIDLYAETSKVWMKKGKFAVNFFIDFANWLQSKREVKGED"
     gene            complement(<79631..>80860)
                     /gene="HAT2"
                     /locus_tag="KLMA_80024"
                     /db_xref="GeneID:34718225"
     mRNA            complement(<79631..>80860)
                     /gene="HAT2"
                     /locus_tag="KLMA_80024"
                     /product="histone acetyltransferase type B subunit 2"
                     /transcript_id="XM_022821753.1"
                     /db_xref="GeneID:34718225"
     CDS             complement(79631..80860)
                     /gene="HAT2"
                     /locus_tag="KLMA_80024"
                     /codon_start=1
                     /product="histone acetyltransferase type B subunit 2"
                     /protein_id="XP_022678082.1"
                     /db_xref="GeneID:34718225"
                     /translation="MAEVQEEEQPTTIEEEYDLWLSNVPMMYDFVSETRLTWPSLTVQ
                     WLPTELKPREVNGIQLQRQELLIGTLTADDEPNYLKIAAIDLPESVVSSSSPPQGESD
                     EKNHHNSKIKITKKFKHDFEVTRARFMPQSPNIFATLNGKGTISVFDRNSPEKDAAAI
                     SSYSYHKENGYGLAFNSNVSGQLLSCSDDSTVALWDISSSSDSSNKSPLQTFTNHTDI
                     VNDCKWHEFKQTVFGTVSEDKTLLIHDTKSKSPVSELKVSSAFNTLAFSKHSHNLLAA
                     AGTDSNVYIYDMRNISKPLHSMSGHEDSVTSLEFSPHQDGLITSSASDRRVIMWDLFN
                     IGAEQQQDDAYDGVPELFMMHGGHKSPVNEFSYNLNVPWLMCSVEEDNVLQIWKPASK
                     IVHPPKPPADLDVRTLE"
     gene            complement(<81227..>83188)
                     /gene="KEL3"
                     /locus_tag="KLMA_80025"
                     /db_xref="GeneID:34718226"
     mRNA            complement(<81227..>83188)
                     /gene="KEL3"
                     /locus_tag="KLMA_80025"
                     /product="kelch repeat-containing protein 3"
                     /transcript_id="XM_022821754.1"
                     /db_xref="GeneID:34718226"
     CDS             complement(81227..83188)
                     /gene="KEL3"
                     /locus_tag="KLMA_80025"
                     /codon_start=1
                     /product="kelch repeat-containing protein 3"
                     /protein_id="XP_022678083.1"
                     /db_xref="GeneID:34718226"
                     /translation="MAKKKDKESKKARAEAKQKKALEKAAVKDKKKAKKLSQDDEEDD
                     LDVEEMLANFKREQENFERINVENVDRPGQRVNPCIFVNPTQGKRELMMFGGESTSAE
                     TGTTHFHNDMFIYSLDTDAWKRVTSQNSPMPRSSAACAAHPSGVALIHGGEFSSPKQN
                     TFYHYSDSWLFECSTREWTKIEQKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYL
                     NDLWVFDITNYKWKQIEFPPTHPVPDARSGHSLIPTAEGAVLWGGYTKVKAGKGLQKG
                     KILSDCWHLKMKSDLGAIRWERRKKQGPQPSPRVGCSMVYHKGRGVLFGGVYDFEETE
                     ESLRSVFYNDLYTYQVESNRWYSMSLRAQRKKAKVAQSKSSRNKDKELEDILNQILDK
                     ANLRDADDEEDTRAIEEQLNQLKIAEDRENGDVDGTDDNEDKERAAAKTYEVRNTFPH
                     TRFNASTAVVDDTLFIFGGVVEIGEKDYPIDSFYSIDMNKLDGCKVYWENLEDVVKAE
                     KLGEQDSDDEFDDEDDDDEDDGEEEIADRKLESEDEGEDEDEEEEEEKEEEEYEIPDP
                     RPWLPHPKAFESLRSFYVRTGATFLEWAISSNRDSKGKHLKTKSFELCQDRWWERREQ
                     VRIEEDKLEEMGGVEDVIEKDTSKSQKRR"
     gene            complement(<83436..>85064)
                     /gene="PCM1"
                     /locus_tag="KLMA_80026"
                     /db_xref="GeneID:34718227"
     mRNA            complement(<83436..>85064)
                     /gene="PCM1"
                     /locus_tag="KLMA_80026"
                     /product="phosphoacetylglucosamine mutase"
                     /transcript_id="XM_022821755.1"
                     /db_xref="GeneID:34718227"
     CDS             complement(83436..85064)
                     /gene="PCM1"
                     /locus_tag="KLMA_80026"
                     /codon_start=1
                     /product="phosphoacetylglucosamine mutase"
                     /protein_id="XP_022678084.1"
                     /db_xref="GeneID:34718227"
                     /translation="MSLQELYNKHCSQGNKYSYGTSGFRMHNSVLDTVMFSTGIVVVL
                     RSLYLKSQYVGVMITASHNPPQDNGVKIVEPHGEMLVQDWEPIATQLANAAATSFQEF
                     ESTLHSIAKKLDIDLATDERANVVVARDSRESGPRLLAALKAGISVFANTNVVDFGLL
                     TTPQLHFLTHILNSEEPGSSVDESQYYSYFLSKWDQLAELYHLESLPFHLTIDCANGV
                     GAEKAQQLIQLAKPLLQKSLSTTNGQTDKPELLNESCGADFVKTNQFFPANCTPEPGQ
                     LYCSFDGDADRVVFYYCDSSAEKKFHLLDGDKIAILLAKLLAKLLQDAQLTAALSVGV
                     VQTAYANGSSTKYIQETLQIPVSCTKTGVKHLHHEAVSKYDIGIYFEANGHGTAVFSP
                     KFHSLVEESLATTQEKSESQIKALKSLQLFSQLINQTVGDAISDMLAVIAALCIMKLT
                     PEQWDSWYQDLPNRLTKAIVPDRSVFVSTNAERQLVSPEGLQAKIDAIVAQYPQGRSF
                     VRASGTEDAVRIYAEADTTENAVELSSRVAELLK"
     gene            <85284..>85502
                     /gene="SOM1"
                     /locus_tag="KLMA_80027"
                     /db_xref="GeneID:34718228"
     mRNA            <85284..>85502
                     /gene="SOM1"
                     /locus_tag="KLMA_80027"
                     /product="protein SOM1"
                     /transcript_id="XM_022821756.1"
                     /db_xref="GeneID:34718228"
     CDS             85284..85502
                     /gene="SOM1"
                     /locus_tag="KLMA_80027"
                     /codon_start=1
                     /product="protein SOM1"
                     /protein_id="XP_022678085.1"
                     /db_xref="GeneID:34718228"
                     /translation="MAPPTKILGHDVQQRMLERSQECALKSLTQNECAFNGHEYMCVP
                     FKRLFQQCVMRDGRRLNIEVTDEATNGR"
     gene            <86694..>88145
                     /gene="FUM1"
                     /locus_tag="KLMA_80028"
                     /db_xref="GeneID:34718229"
     mRNA            <86694..>88145
                     /gene="FUM1"
                     /locus_tag="KLMA_80028"
                     /product="fumarate hydratase"
                     /transcript_id="XM_022821757.1"
                     /db_xref="GeneID:34718229"
     CDS             86694..88145
                     /gene="FUM1"
                     /locus_tag="KLMA_80028"
                     /codon_start=1
                     /product="fumarate hydratase"
                     /protein_id="XP_022678086.1"
                     /db_xref="GeneID:34718229"
                     /translation="MLRSSVLGRTLLNRQSVRMVSYRVETDAFGEIKVPADKYWGAQT
                     QRSFQNFKIGGAREKMPEPIVKAFGVLKKSAAIVNENLGTLDPAVAEPIKKAADEVAQ
                     GKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSN
                     DTFPSVMHIAAVTEITRHLLPELVALKDALKKKSDEFQHIVKIGRTHLQDATPLTLGQ
                     EFSGYVQQVENGIIRVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGID
                     FKTAPNKFEALAAHDAIVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENE
                     PGSSIMPGKVNPTQNEALTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSI
                     RLLGDASNSFRIHCVEGIQANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKK
                     GITLKESALELGVLSSEEFDEWVIPEKMIGPKE"
     gene            complement(88464..88578)
                     /locus_tag="KLMA_R802"
                     /db_xref="GeneID:34718788"
     tRNA            complement(join(88464..88508,88542..88578))
                     /locus_tag="KLMA_R802"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34718788"
     gene            <89638..>91299
                     /gene="PRB1"
                     /locus_tag="KLMA_80029"
                     /db_xref="GeneID:34718230"
     mRNA            <89638..>91299
                     /gene="PRB1"
                     /locus_tag="KLMA_80029"
                     /product="proteinase YSCB"
                     /transcript_id="XM_022821758.1"
                     /db_xref="GeneID:34718230"
     CDS             89638..91299
                     /gene="PRB1"
                     /locus_tag="KLMA_80029"
                     /codon_start=1
                     /product="proteinase YSCB"
                     /protein_id="XP_022678087.1"
                     /db_xref="GeneID:34718230"
                     /translation="MKFETTLLSVTALSSLAAALVIPEFREDKGVEKSETSKSKSKGI
                     SGYVKSEKKKPCGHANSLGSVRDTPEQQEVAPLSVNGDISTRVPHKYIIVFKKDVSAD
                     EVDFHKELVSLEHAKALGSLSQDDPFFSATAGKTNEYGIKAHSLEGGIQDAFKIADSL
                     SGYIGYFPEKVIDFIRRSPLVEFVEEDSMVFSNSFNTQNGAPWGLARISHREKLNLGS
                     FNKYLYDDDAGKGVTAYVVDTGVNVDHKDFGGRAKWGKTIPQGDPDVDGNGHGTHCAG
                     TIGSEHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVADAHKKASSNPAKGFKGST
                     ANMSLGGGKSPALDLAVNAAVTAGVHFAVAAGNENQDACNTSPAAAENPITVGASTLS
                     DERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQP
                     TSDSEFFHAAGGITPAQLKKKIVDFSTKNVLTDIPEDTVNYLIYNGGGQDLDSFWGKS
                     MSEEDSPAASAPSDFSLENLINSLDSKTDAIFEDVRHLLDQFNII"
     gene            <93523..>94371
                     /gene="UTP23"
                     /locus_tag="KLMA_80030"
                     /db_xref="GeneID:34718231"
     mRNA            <93523..>94371
                     /gene="UTP23"
                     /locus_tag="KLMA_80030"
                     /product="rRNA-processing protein UTP23"
                     /transcript_id="XM_022821759.1"
                     /db_xref="GeneID:34718231"
     CDS             93523..94371
                     /gene="UTP23"
                     /locus_tag="KLMA_80030"
                     /codon_start=1
                     /product="rRNA-processing protein UTP23"
                     /protein_id="XP_022678088.1"
                     /db_xref="GeneID:34718231"
                     /translation="MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFD
                     LVKGLKRTLQAEVKPMITQCCMQQLYESRNQGAIDAAKEFERRRCNHNPKDPKSAEEC
                     LLSVVNVNGKNKHRYVVATQDVEIRRKLRKVPGVPLVYMNRSVMVMEPLSTASEKVSQ
                     EVENAKLYKGLNDAKYAGIAHNEEEAEEKGDGSQENKPKKRKGPKEPNPLSMKKKKKV
                     ASTSGSGEAGDHNGDSNTASSANGETSSAKRRRRRHRKASEEAAAAEAAQAAQEAAAT
                     ATADQS"
     gene            <94897..>97692
                     /gene="CIN8"
                     /locus_tag="KLMA_80031"
                     /db_xref="GeneID:34718232"
     mRNA            <94897..>97692
                     /gene="CIN8"
                     /locus_tag="KLMA_80031"
                     /product="kinesin-like protein CIN8"
                     /transcript_id="XM_022821760.1"
                     /db_xref="GeneID:34718232"
     CDS             94897..97692
                     /gene="CIN8"
                     /locus_tag="KLMA_80031"
                     /codon_start=1
                     /product="kinesin-like protein CIN8"
                     /protein_id="XP_022678089.1"
                     /db_xref="GeneID:34718232"
                     /translation="MNSKTYTVDKVFGPSADQSLVFKEIAEPMFYDFIKGYNCTMLVY
                     GMTSTGKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLDIQESDYMVKCSFIELYN
                     EELKDLLDDSQDSAGNNRKLRIYDSVSNSNGNGNGVNASSRSSSRSNSPTISLEAKKR
                     VRMGALYKPKPKLPMQAQPFSHGQQSQQQNQNGQQSSQQSLSYSQQQQQQQQHQQQQQ
                     QQQQQQAHANEQGSAIYIQHLQEFHITDAKEGLRLLQKGLRHRQVASTKMNDVSSRSH
                     TIFTLTLYKNYNGESFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRV
                     INSLADKNTHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA
                     KNIKNKPQLGSFIMKDVLVKNISHELAKLKSDFLSTKSKDGIYMSHAHYKEVMNDIEN
                     YKTEIQESRREVEKLSSQNQLLLKDKKSSQDTMESQKLQIRNLQSSMDYLYEKIDLKH
                     KNELELTNMIMNLKNAVRNMQGALKSHEDHEQRLQSDIQKMLYENIVQYRTNIEKKLG
                     NLKRQALESSSTIDEDIDNVKGSLETLLENVKTDAINMCQDLAQKVVEEQPKFYSIIV
                     SELNCISSKIDMHTDQLKDGLSRITAENNNLKDYLDTHFFKNNHQEILNVHADKTYHQ
                     LKMSSKDLMSKITKIIGEHVEQNRNLLMETLNTATSDVISHEMSLFEPVKKTWETSFD
                     QINACDSLGNKFKDSTSESLNSLRKHVDKTVHESSEIADSIKDSIASFQKRNDIYTMG
                     TNINKTVDDIKNKHSQLRSQLEKNVSFIHDSSEEFKSIDESLRKIIDSKMPEFEADSV
                     VDELIQNIDSKSVAPIAPSGKTPLRPLLKTEVKQRSLSKSVSPIKSLNTNVTTISPLK
                     RKSLDSKVLPTTVKKQK"
     gene            complement(<97791..>99764)
                     /gene="NPR2"
                     /locus_tag="KLMA_80032"
                     /db_xref="GeneID:34718233"
     mRNA            complement(<97791..>99764)
                     /gene="NPR2"
                     /locus_tag="KLMA_80032"
                     /product="nitrogen permease regulator 2"
                     /transcript_id="XM_022821761.1"
                     /db_xref="GeneID:34718233"
     CDS             complement(97791..99764)
                     /gene="NPR2"
                     /locus_tag="KLMA_80032"
                     /codon_start=1
                     /product="nitrogen permease regulator 2"
                     /protein_id="XP_022678090.1"
                     /db_xref="GeneID:34718233"
                     /translation="MSNTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNNLEHGGIDFD
                     TIKNYIIPKPQLCNKLLTFKYANYRLVCYPVNVNARYYARNSFNFNFVFVFPYDCATS
                     PYEPAIARLGKMFKVLEEQSQILSKAERDPVYFQLKSQDASTVEQNAEKGSMTLGEHS
                     DIKPPGDDGEKYQKIMMDLASDTKNLCIEDLLMKLFLDLNNYSECLIPIDDGNSIDIK
                     LFPVRIPPTAKISVEDVPIAIVNLTDIIDVNWDPTMIKIVPYIDGINSIDQIASCAES
                     DVGLVQECIKHLMYYKCVILSDIFQFSNIYAPTSEIHTFLTNPAIANACQFYVQIDSL
                     GEYQLPFDRRPHEVFSSGKKHASSSTVHSKRRDSIDTSTTGSVGSNMELHRNYLSTSS
                     TPSYLKAHTLESGSLGTNEKINRRVLPTKSCIFDLYRSLCQGKTIKEWYKQNFDIIRD
                     NRIDVRRLIMFGVTRRLIYRVNSYPIVKNISTWDILKSLVANEPKTKHKAVGDSENIF
                     SAADIKVVDNKDDSYVEDNSDAADKLLKSLYKKLSLKQDSSSGGTSKITRYYDDSPQK
                     DGETNSRKSSSGSQQKVSFDVSAPTETSNIAEIHNPNQNGIWKKRKEEELILMDCLKN
                     AETFDKICTKLKRSRKEVEVMLKELGHYNIVNS"
     gene            complement(<101612..>104332)
                     /gene="LIG4"
                     /locus_tag="KLMA_80033"
                     /db_xref="GeneID:34718234"
     mRNA            complement(<101612..>104332)
                     /gene="LIG4"
                     /locus_tag="KLMA_80033"
                     /product="DNA ligase 4"
                     /transcript_id="XM_022821763.1"
                     /db_xref="GeneID:34718234"
     CDS             complement(101612..104332)
                     /gene="LIG4"
                     /locus_tag="KLMA_80033"
                     /codon_start=1
                     /product="DNA ligase 4"
                     /protein_id="XP_022678091.1"
                     /db_xref="GeneID:34718234"
                     /translation="MSECRNFSPSPEFKWLCDELFQKIHDTSVNRHLIGKPVTVRFLE
                     IIANFIKLWRSTVGNDIYPALRLIIPYRDKRVYNIKENTLIKALCHYLRLPKNSDTEK
                     RLLRWKQRAPRGVKLSDFCVEEIRKRQKDYEGPTRITIDQLNGHLDEIAQAGNGKRMG
                     HMALLDSRAFNYCLKHMTFEELKFFFDILLKTRVISGLEVKFLNAWHPDAQDYLSVVS
                     DLYVLSQRLYDPNERLRKVDLSINISHAFEPQLAKRTHASYEHVASSLGKNFIIEEKM
                     DGERLQIHYMNYGEQIKYLSRRGVDFSYLYGENISKGPVSSSIKLHPNVKDCILDGEM
                     ITFDIEKDMVLPFGLVKNSAMNHVQAEITGVSLTESHRPLFIAFDLVYLNGKSLTSLE
                     LWRRKDYLSKILTPVEKKVEIIQYHKSDDAMDIKNSLEHAISVGSEGIVLKNLQSKYN
                     IASRNSDWIKIKPEYLEQFGENMDLLVIGRDQGKKDSFLCGLSVNNTENPTERPKFLS
                     FCTIANGFSQEEFKDIERNTRGKWHIFSEEPPDKRIFEFGTKLPYEWIYPEDSVVLEV
                     KARAIDNKDSEKKRYRTGCTLHFGYCKQIRYDKSWKDATSLADFEEMKEARNFYHKRT
                     QHEVSKEKRKSSKRARINIVNISEPRRLDDPISYIFQRCKFRIISDFFYQSRRKRISQ
                     EDLCSLVLENGGEVIYNNVDSITPEENLYIISDRLTYECKVLVDKGLVIVNPLWIFKS
                     IEAGAKLPLTDEDIFAATRKEHERVMPQPNNITEKYTGYSKIAYPESSYYNNNMNISS
                     MPIFRFDRLKIAMIDSPSVSRAYLRKVEFTIKCHGGTIENMENADIIVVVNELISKKE
                     LLSIRKKIAARAVNESVDSTPRIPRIVDVSWIFDSIKGHHLVDAENYQCL"
     gene            complement(<104495..>105427)
                     /gene="TSR3"
                     /locus_tag="KLMA_80034"
                     /db_xref="GeneID:34718235"
     mRNA            complement(<104495..>105427)
                     /gene="TSR3"
                     /locus_tag="KLMA_80034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821764.1"
                     /db_xref="GeneID:34718235"
     CDS             complement(104495..105427)
                     /gene="TSR3"
                     /locus_tag="KLMA_80034"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678092.1"
                     /db_xref="GeneID:34718235"
                     /translation="MGKGKNKESREGSTRTRPGKGSNGHSSRLNHKRMEMKHAGPTSS
                     KFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKTVVCPNDKE
                     IVEEHGASVVECSWARLEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAA
                     CFAIVGRTDLAADLLSNFSWGPEFLELNKELLELYQQCTDHDSVKAAEEKWLQQIEEE
                     ARQRKEMAKTEDIWMIGNVNRATQDSEEEYSEEEDLSTDEIAVSKEVKYDSLGNVIPS
                     DEEAEEESSEEVESEEDTDEAESLHVPLNSLSVK"
     gene            <105718..>108927
                     /locus_tag="KLMA_80035"
                     /db_xref="GeneID:34718236"
     mRNA            <105718..>108927
                     /locus_tag="KLMA_80035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821765.1"
                     /db_xref="GeneID:34718236"
     CDS             105718..108927
                     /locus_tag="KLMA_80035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678093.1"
                     /db_xref="GeneID:34718236"
                     /translation="MPYHLPVLLNPLLNAVFNCPSPKVSSLKQVFSQLEKEKFFILVP
                     NSQCLLEFQDLDSGLELAELCYHYDFVASHIVVIGKDTNTSSAGQKSFYNKEFKTLNG
                     KKIVIRYQNSSVVTSDGFSDRKRVDIEEINVIPTFNDYLSGSRYTPVVYINKPLCGDL
                     VAKEDYQVFSKVSGNKYAVPPVAPLSFDVAQKQVLQFEQRIQSLPDVAERLALTFHLT
                     KAKIKKANDIESIKNEWKSAQDSIHQIVSFDKRLNKTENLDSVIYDYTELKLFTDIQQ
                     QLSEITHHNELEHKFDFSALKSISLNQVSTMFYQKQMKSFSLKNVIKLEQSVHSALEC
                     FKTIDLKNNHAGKLDVLSSTMKILGTEIDGRAIDADTLLSLVVLLICRSQVSGLMRTL
                     AYLNNFAFNETAIKFGIQGYVLSTFEAALSYFHDDTVKSLLAKCLENRYIWDHIQNDK
                     TIRHERLKSNLYLRTDNGESLLSLCIQAHANETLEYLLTNFENEYPLEDIIEDRDFTS
                     STLLIQALQAQNSVAVEIISTIVLNSCTQSEIEEFLNSPNLHNRTAAHYIMQEVSLVE
                     TVGEYLNWEHTDINGHSPLFAVFRSYDTPNYEEMVTKILDEVIKWYKLKGKPLNFRHH
                     EDPKGNTLLHVMKSGIHLLLKLPGINVNKPDLKGLTPLMTYAKYNRLDNIETIMRDSR
                     LLWDSIQQPLFMTCIDFTKSPQVTDKILEVKYEKSDVIIHSLRFEDGKWKIWITFNGT
                     ANKYSLALIRQYLRYFKIKYPWSFQPIEALTEELKNLGMLGVPSILRLQSYHTLRKLS
                     LVFTYMNTRGELWLDKEEKELKSLLDVPTPRLTETERFVKLEPEEINGIQGFLKYNVT
                     EFVKLKSCLTFLKKLSIVQFVKSRDVKNSQKMLFSLGNQFTDTEIADCFSDFHLNGNF
                     DLSYHEFIRNLGFLEDAVSSLLNHIEALLAKVNLWWKHYGEFMELKKEWNKNFPKDVT
                     PPSTSSMSFIDTYIEGKRSRFKSKLSNQMKMSSLNLKKLGGEIKGTNENLAVEINLFI
                     EYKDQFYEKHLIRSVVDRKIREYKQIIQQLTETTIGHHV"
     gene            complement(<109031..>110029)
                     /gene="SGT2"
                     /locus_tag="KLMA_80036"
                     /db_xref="GeneID:34718237"
     mRNA            complement(<109031..>110029)
                     /gene="SGT2"
                     /locus_tag="KLMA_80036"
                     /product="small glutamine-rich tetratricopeptide
                     repeat-containing protein 2"
                     /transcript_id="XM_022821766.1"
                     /db_xref="GeneID:34718237"
     CDS             complement(109031..110029)
                     /gene="SGT2"
                     /locus_tag="KLMA_80036"
                     /codon_start=1
                     /product="small glutamine-rich tetratricopeptide
                     repeat-containing protein 2"
                     /protein_id="XP_022678094.1"
                     /db_xref="GeneID:34718237"
                     /translation="MSPSNKDIAALIVDFLSSSAAEANEDNRDSLNVAIDCITEVFQF
                     EKSESDSLIKNTFKGKKLAELLESASVSAGASGEPVKVHIPVEDAEAKAKAEELKLQG
                     NKAMAAKNFDEAIAKYTAAIEVSPSNAVYYSNRAAAYSSLKKYEEAVKDAEQAIKVDP
                     TYSKGYSRLGFAKYALNEPEEALEAYKKVLDIEGDKATDVMKRDYETAKKKVENSMNL
                     EKSAFNEPTDKSATEAPGAGAGPGGMPDLSSLLGGGLGGGLGALLNNPQVMQAAEKMM
                     QNPGLMQSMMQNPALKDMANQFSSGGGMPDFSQMMNDPAIRDMAKNMFGGSGEPPK"
     gene            complement(110431..110520)
                     /locus_tag="KLMA_R803"
                     /db_xref="GeneID:34718789"
     tRNA            complement(join(110431..110468,110486..110520))
                     /locus_tag="KLMA_R803"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34718789"
     gene            complement(<110973..>112697)
                     /gene="ALG6"
                     /locus_tag="KLMA_80037"
                     /db_xref="GeneID:34718238"
     mRNA            complement(<110973..>112697)
                     /gene="ALG6"
                     /locus_tag="KLMA_80037"
                     /product="dolichyl pyrophosphate Man9GlcNAc2 alpha-1"
                     /transcript_id="XM_022821767.1"
                     /db_xref="GeneID:34718238"
     CDS             complement(110973..112697)
                     /gene="ALG6"
                     /locus_tag="KLMA_80037"
                     /codon_start=1
                     /product="dolichyl pyrophosphate Man9GlcNAc2 alpha-1"
                     /protein_id="XP_022678095.1"
                     /db_xref="GeneID:34718238"
                     /translation="MAVKKRSPAKNSSKKAGNTSTNNDGLSSLSSEVNSSNHKKGIEK
                     ESLEAFFASPLYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGLQTPPMFGD
                     FEAQRHWMEITQYLPIREWYWYDLQYWGLDYPPFTAYHSYVLGKLGSFFHKEWFELDS
                     SRGYESLDLKSYMRFTVIISELLLYIPAVIYFTKWVGRYRSQSPIGQYIAAAAIIFQP
                     ALILIDHGHFQYNCVMLGMTVYALNNFLDGFYAMGAICFVLSICFKQMALYYSPIIFA
                     YLLSKSIYSPRFNFPRLFAVAISTILAFIGCFGPIYVFGGYKNLVQSIHRIFPFARGI
                     FEDKVANFWCVSNILIKYKNLFTQNDLQLYSLIATVVGLLPSFIITFLYPKKHLLPYA
                     LAACSMSFFLFSFQVHEKTILLPLLPITLLYCSNDWNVLSLVCWINNVALFTLWPLLK
                     KDGLQLQYGVLLVFSNWLIGNFSFVTPRFLPKFLTPGPSISNIDEDYRRSILLPNSIF
                     WRIIIVSSYVAMGVIHILDHFFTPPAKYPDLWVLANCSLGFASFMVFWIWNNYKLFSM
                     RNKTLHHL"
     gene            complement(<113104..>114171)
                     /gene="Pir"
                     /locus_tag="KLMA_80038"
                     /db_xref="GeneID:34718239"
     mRNA            complement(<113104..>114171)
                     /gene="Pir"
                     /locus_tag="KLMA_80038"
                     /product="pirin-like protein"
                     /transcript_id="XM_022821768.1"
                     /db_xref="GeneID:34718239"
     CDS             complement(113104..114171)
                     /gene="Pir"
                     /locus_tag="KLMA_80038"
                     /codon_start=1
                     /product="pirin-like protein"
                     /protein_id="XP_022678096.1"
                     /db_xref="GeneID:34718239"
                     /translation="MVLRLDFRLITLLILIISVGVVHISSKKRIIDQLEPNTSGSAVM
                     SNESTMNTVNKVRSVLKHFVAMEQSEGAGALVKRSIGTMQMRNFPPFLMLDHFDVAPP
                     AGFPEHPHHGQETITYVLRGMMAHEDFTGSKGVLRPGDLQFMTAGKAIVHSEIPVKMN
                     NGESTNGLQLWVDLPNDMKNVAPRYRDLRREEIPIATPSDNLTVKVISGESYGVKSVA
                     ELAYTPVEFFHFIANKKGTEFSQPFKDDFSSFLYVLKGSIDISGKNYPEFSAIFFKND
                     GDGIKGVTTSDNAEFAIIGGKYFNQKIVQYGPFVDASREKIVDVIDNYQNAINGFENA
                     RTWSPVIKNGVTEDEVQQYLP"
     gene            <114988..>115611
                     /gene="YPT7"
                     /locus_tag="KLMA_80039"
                     /db_xref="GeneID:34718240"
     mRNA            <114988..>115611
                     /gene="YPT7"
                     /locus_tag="KLMA_80039"
                     /product="GTP-binding protein YPT7"
                     /transcript_id="XM_022821769.1"
                     /db_xref="GeneID:34718240"
     CDS             114988..115611
                     /gene="YPT7"
                     /locus_tag="KLMA_80039"
                     /codon_start=1
                     /product="GTP-binding protein YPT7"
                     /protein_id="XP_022678097.1"
                     /db_xref="GeneID:34718240"
                     /translation="MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADF
                     LTKEVIVNDDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFDNIKSW
                     RDEFLVHANVSSPETFPFVILANKVDVEESKKVVSSRSAQELAKSLGNVPLFFTSAKD
                     AINVQDAFEEIARSALQQSQSDADAYEDDLNEAINIQLDGEPSSCSC"
     gene            <116698..>117765
                     /gene="PHO80"
                     /locus_tag="KLMA_80040"
                     /db_xref="GeneID:34718241"
     mRNA            <116698..>117765
                     /gene="PHO80"
                     /locus_tag="KLMA_80040"
                     /product="aminoglycoside antibiotic sensitivity protein 3"
                     /transcript_id="XM_022821770.1"
                     /db_xref="GeneID:34718241"
     CDS             116698..117765
                     /gene="PHO80"
                     /locus_tag="KLMA_80040"
                     /codon_start=1
                     /product="aminoglycoside antibiotic sensitivity protein 3"
                     /protein_id="XP_022678098.1"
                     /db_xref="GeneID:34718241"
                     /translation="MESTDKSNPQEDLGALQVIPLPEEYLRCSRTHLVILISRMLSFL
                     IQINDSNNSGKETMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS
                     AVYPQFTLNSLTVHRFLLTATTIASKGLCDAFCTNTHYSKVGGVQCSELNILENEFLE
                     RVKYRIIPRDENIENCKLEYKLGLNAFIPPKENSRRGSNDGFNVLQNYYKKIVQLVGD
                     PTNSPDKTSNCFFKLAIPTPSKENRNSIHAGISMAPVTPSRSRLRNDSSIPPNMGERY
                     VKDKTPTISTPNTVAFNKNTTNVSYSGEEEHGSDNENNNNIPISLPQKRNIKDDEPIQ
                     QHGVNSNFIPSTKKISSRFDS"
     gene            <119237..>121477
                     /gene="RRP6"
                     /locus_tag="KLMA_80041"
                     /db_xref="GeneID:34718242"
     mRNA            <119237..>121477
                     /gene="RRP6"
                     /locus_tag="KLMA_80041"
                     /product="exosome complex exonuclease RRP6"
                     /transcript_id="XM_022821771.1"
                     /db_xref="GeneID:34718242"
     CDS             119237..121477
                     /gene="RRP6"
                     /locus_tag="KLMA_80041"
                     /codon_start=1
                     /product="exosome complex exonuclease RRP6"
                     /protein_id="XP_022678099.1"
                     /db_xref="GeneID:34718242"
                     /translation="MTSNEQDALLSSLMQTVRSSSALAAQDIDFYRSLDSDVNSSLQD
                     TSSKMLSLINEVLLSIDPNNDTIEEGKDEFLDSWKSISNIMDNLFEKSDHALDNIKNK
                     TSNSATDSGFKYLNDDDRSNSNPSKRLAKPQLDFKIPVDNTELHPFKPLLKEKPNSLK
                     PLELSLKMLPEEENIPAHYPNPYEYEIENQKYDDSILVPREPIPSRDWDNTTAIWVDT
                     VEELTKMIEVLKKSKEIAIDLEHHDYRSYYGIVCLMQISDRENDWIVDTIALRDDLKV
                     LNEIFTDPGVVKVLHGAFMDIIWLQRDLGLYIVGLFDTYHASRLLGFPKHSLAYLLER
                     FANFKTSKKYQLADWRIRPLSKPMFAYARADTHFLLNIFDQLRNMLLEQNKMSEVLHE
                     SRKVAKRRFEYSSFRPKIGSQNVYSPIESAEPWRNLMFQYNIPPSKEQLLRKLYEWRD
                     MIARRDDESPRYVMPNQLLVSLVAGTPTEPINVLSVSSYVSEHVRMNSKAIANLIKKT
                     LEDMKQGTSGKKNPLSVPSISEEGDKDLSEILTISQIKSIQNMFNSVAKQINAGSSES
                     NVDINVPSLLFNGVPNAEYNSAVVYTSKGKTVVTKDELSKRQKLITDTLEQEYTEKHT
                     QSIQIPSLQTSETTETTTEHPSNEIEEQPEETQEQEDKDEIVTLRKRQAQNAKKRKAV
                     ELPSDSEIVDYTSGENLLVSNRKNTDHEKNKKRKFDPYSIENTGPKAIKKKAKPTKGK
                     NVSFKR"
     gene            <121962..>122882
                     /gene="IZH2"
                     /locus_tag="KLMA_80042"
                     /db_xref="GeneID:34718243"
     mRNA            <121962..>122882
                     /gene="IZH2"
                     /locus_tag="KLMA_80042"
                     /product="ADIPOR-like receptor IZH2"
                     /transcript_id="XM_022821772.1"
                     /db_xref="GeneID:34718243"
     CDS             121962..122882
                     /gene="IZH2"
                     /locus_tag="KLMA_80042"
                     /codon_start=1
                     /product="ADIPOR-like receptor IZH2"
                     /protein_id="XP_022678100.1"
                     /db_xref="GeneID:34718243"
                     /translation="MSARKRMSVTEETPLTENASGLKKKVVYERRLYSWDEIPEWQKD
                     NEHILTGYVRETQSWRELFWSLFYLHNESVNIYTHLIPAVLCFLTIVFATNHIIYEYP
                     TTSTVDYCVINLFFLGCATCLSMSSFFHCVKCHSLPVSVFGNKLDYLGIVVLISTSMI
                     SILFYGFYDNSMLFYSFAGLTSFFGVVCGYVSLKSKFRTREWRPYRAAMFVLFGISSI
                     LPIIAGFVVYGKDETWQRIQMTWVIWEGALYIFGAFLYGVRFPERISPGKFDIWGNSH
                     QIFHVLVVVAALCHLRALLYSYDLTHQNMM"
     gene            complement(123088..123160)
                     /locus_tag="KLMA_R804"
                     /db_xref="GeneID:34718790"
     tRNA            complement(123088..123160)
                     /locus_tag="KLMA_R804"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:34718790"
     gene            <123479..>124945
                     /gene="RIT1"
                     /locus_tag="KLMA_80043"
                     /db_xref="GeneID:34718244"
     mRNA            <123479..>124945
                     /gene="RIT1"
                     /locus_tag="KLMA_80043"
                     /product="tRNA A64-2'-O-ribosylphosphate transferase"
                     /transcript_id="XM_022821774.1"
                     /db_xref="GeneID:34718244"
     CDS             123479..124945
                     /gene="RIT1"
                     /locus_tag="KLMA_80043"
                     /codon_start=1
                     /product="tRNA A64-2'-O-ribosylphosphate transferase"
                     /protein_id="XP_022678101.1"
                     /db_xref="GeneID:34718244"
                     /translation="MNKDVLQDFKEINKSLRKEDKSLRNRLQSIIFDNQFLERQVFPT
                     FNYPIIPNERCGLWYCNPSKYENTSYFKSTDGHVNQWDFSTRRLNFHLLPIIGREGGV
                     IVLDSTRRGKKIPDALSKTVPIWCAVLNYLILEDEGKTWPFEEKILFVPPNTVPASEH
                     DMILSKIPALVEKLKKIDIINAKKLKESLNMSNPKRKLLRPLWVYPGSSLLQMNHDMF
                     TGEELTDNQWLPPDDIIPIILCTVSYQCQDGTDKRHGFTYVQGAADDHELWAADLTPQ
                     LFWENIDTLGDITKSDQELTEIYNDIISKKSQHNINNDTKDFNKLIQTDSITDDLRLG
                     VLSSEISFSEDVVNILKQRYRMSIICDEKTFKEVENIELPDNVHIYPLSSGSKKSSRD
                     LRTHLISINALLKRSLATTNPKLPVLIACNNGKDMSVSVLIVALCLYYNLQWELQPQD
                     SVNKTIIKKHLAKIIDSLHGKNVNPSRATLNSVNSFLM"
     gene            125090..125204
                     /locus_tag="KLMA_R805"
                     /db_xref="GeneID:34718791"
     tRNA            join(125090..125126,125160..125204)
                     /locus_tag="KLMA_R805"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34718791"
     gene            <125580..>127160
                     /gene="AEP2"
                     /locus_tag="KLMA_80044"
                     /db_xref="GeneID:34718245"
     mRNA            <125580..>127160
                     /gene="AEP2"
                     /locus_tag="KLMA_80044"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821775.1"
                     /db_xref="GeneID:34718245"
     CDS             125580..127160
                     /gene="AEP2"
                     /locus_tag="KLMA_80044"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678102.1"
                     /db_xref="GeneID:34718245"
                     /translation="MLRNSASRYPITRCSSLKTVVNSRPFSASTSVSSPLKTTTLDDS
                     LETFVSAFPVETVSEPNRYVNNNNNTLTSNGPISVLKYLQQQTNLNPREAATLLEFST
                     ENFTAEDYSTFVNRLFDLYKKGDRRLKSLRTWNSLYHIYRVFIVNNIGLQGLNAMMLH
                     DMNEFIKILMDLGDLPSARGVFQLILKNSENGEIPNDTEIINTFLRLYCGALNNKWRD
                     ESTKTRAFYQHLILSVSKSESNSVYYPTIGVPQFQSLLRKLLEQPEYATLRNTEMDSL
                     IIKALGHHKEVSFLKKYLTLLYGVGENGKTIAVDASSHRLTPDSKLLSSILIAFAHNK
                     ELGSGIRVVEELLSKNPDIALDAYFWRTLMKCSIRSWNKLKDKQGTLPTKAWNMMKSY
                     YTSRGKPVPFDRKTMLLRFYFVKSTKNSAAAMDDVKQVFQTIFYKTEKNTFMVERVAL
                     YQYQKFILKDLVECSENSKCIDFINEWKIDHENGVYLENYFKELTEAKANEDSDANKL
                     NDGDDDDFNFPMLGTNIL"
     gene            complement(<127319..>128116)
                     /gene="GPI12"
                     /locus_tag="KLMA_80045"
                     /db_xref="GeneID:34718246"
     mRNA            complement(<127319..>128116)
                     /gene="GPI12"
                     /locus_tag="KLMA_80045"
                     /product="N-acetylglucosaminyl-phosphatidylinositol
                     de-N-acetylase"
                     /transcript_id="XM_022821776.1"
                     /db_xref="GeneID:34718246"
     CDS             complement(127319..128116)
                     /gene="GPI12"
                     /locus_tag="KLMA_80045"
                     /codon_start=1
                     /product="N-acetylglucosaminyl-phosphatidylinositol
                     de-N-acetylase"
                     /protein_id="XP_022678103.1"
                     /db_xref="GeneID:34718246"
                     /translation="MVWFLRGLNKLLLWYIGFLVLYGSLTRTIQGHNKWYLEELVPKR
                     VAESLSSVTLVVAHPDDEVMFFSPTLAQFNEYLPLNVPVNVVCMTSGDADGLGHIRRQ
                     ELVKSLEVLFHGREFSSHVLDFEDGMEVSWDSGKVSEELARYIKDSNPLLVSFDEFGV
                     SGHVNHISCAKAVQDMPHKHKLFLRSDQPIYVKYSAFVTGLFKLLMNKYKQDYERPRF
                     FMSTLPQYFLSVSAMSMGHASQMVWFRVGWWLFSRFCFINELVGSLN"
     gene            <129313..>133551
                     /gene="CAT8"
                     /locus_tag="KLMA_80046"
                     /db_xref="GeneID:34718247"
     mRNA            <129313..>133551
                     /gene="CAT8"
                     /locus_tag="KLMA_80046"
                     /product="regulatory protein CAT8"
                     /transcript_id="XM_022821777.1"
                     /db_xref="GeneID:34718247"
     CDS             129313..133551
                     /gene="CAT8"
                     /locus_tag="KLMA_80046"
                     /codon_start=1
                     /product="regulatory protein CAT8"
                     /protein_id="XP_022678104.1"
                     /db_xref="GeneID:34718247"
                     /translation="MVLSGSGSGSGSGSGSKGSNNGEQRSGDCQGAGDNQSTVVKKES
                     PGENVSSSQMEDNSGVFGGRSNISALQQIQQGPSPNLSNSDSPMNGALLASITSPLLA
                     HGSGNGSNGQSGIGRASNSHPPSNAGSSTNGTSTPSYRVAQACDRCRAKKIRCDGKRP
                     QCTQCVAVGFDCKISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLHL
                     VSRFSSKDEDADQNSSGVANTEEEQILHELSKTNGGSLRVSSTNLYLLNKKATPSGTD
                     NDGLSDPVPVAKVATTTAAPRIISPRNSVAESDPSQMSIASQEPDFNATAKGKQDADL
                     KTDPYGISFEQNEAPGLPTLKALSSLSRYKQGTQLATLVAVSVPRTTEEILFVPQLLA
                     RIGQVHGYTSKQCIYTATVLASLKETSISQIPPELEVLKNRNLWEIDDVLHFWKNVFK
                     LDFMKYTAVDHSSTHLNFTEVEELMQLFFEDWYELIPLFDKNEFNSYYEKFKTNVTDP
                     NFFIRKDDTVFNNRTRSISYKIFSCMLIIIVQMGLLSKIKRENITSGKASDLMKYYDK
                     LMAHIWLNPYFNSRNTSIQVLQSLSLLLFYMLNVGDIPSIYELRGKVVSMSQQLRLHR
                     CPSAVLGGDGSTVSKIQQGERRILFWSIYYLDVFSALQLGVPRLVKDFEIECALPVTS
                     DDDKQVNLAGQMIALEGKVSPFSLSVIRFAKVMGNILDSTFKRGMTTQLTKQAALVHE
                     NALDNWRHGLQDELFFQLDVNGTINMDEFNQQKKYSQSISSESSIFTQKSLILMTLYF
                     IAKCMVHLPVVATKPLVYEVAKSSNSEEAEKVSVDRSLSSYVLLQQATNTLLNVLTAL
                     NNQYLPLPINLARTKIRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELEADRKLGL
                     PSTMSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGHPSVNVKRKRDG
                     KSTTNTSKKVKVEEDQTTDNMQNVGTGETTDTAHSEDLVKDVPREFDVLPENYTTIQE
                     AFQLDPVLNTNPFSNTDLKALFNTGMMEASSGNEKSANYAENVVGDSNQPLTLKGNGT
                     SLLNLNGLTNENNEGVQTDGLKANPSMSNLLNLSNSDSLFRVPSNGDFLKDYYINNMS
                     NTGLSNANSAGMKNAPSLSQLSSLFMSSGSGNNASYNNVRGNAKQETGNNFNTQRNQP
                     TLDGVSFAADASLGLAPLLAWSPDSKSHLNSGSNNGNGRSDTSTTGIVLDTGEQTATS
                     PYIAQLQQQQQQQQQQQQQQLHNSEQGYNSHVSASIPKRKLSVTADLQKNHPTRVSNF
                     NQMNSPATAHHPLMLIHGGLSTYDNATPPVMPSSSAVDGVSNANSNSNSTPSASGSNR
                     RGPRRRWNNNAGTSNTYSNEDQSVSDLLRWQNGP"
     gene            <134890..>137940
                     /gene="NAB6"
                     /locus_tag="KLMA_80047"
                     /db_xref="GeneID:34718248"
     mRNA            <134890..>137940
                     /gene="NAB6"
                     /locus_tag="KLMA_80047"
                     /product="RNA-binding protein NAB6"
                     /transcript_id="XM_022821778.1"
                     /db_xref="GeneID:34718248"
     CDS             134890..137940
                     /gene="NAB6"
                     /locus_tag="KLMA_80047"
                     /codon_start=1
                     /product="RNA-binding protein NAB6"
                     /protein_id="XP_022678105.1"
                     /db_xref="GeneID:34718248"
                     /translation="MRKSKNSLNLEDSNAEDEGVEVPYLGSGTGIRSQSIPISTTSSF
                     SAERRNTGESLQSEQRYNNTLVDPDTPVRLSYTILPKGSDIYRSRSLLFTNVNPEVDL
                     LEFLQKVSKNYLVESVYSIPQAGESKEKTKAEITTNDKNKNHTDINTENEDKDDASPQ
                     SSYLLSFLSKETCLDFYNNLLQRYAEIKQSVKSEKLSMNFVKIQDDEEWVEGLKVSAL
                     SMGATKSLYVEFRDDKISSESFYERLPFLKDSPRYIVLHVDIVDTDEKRKHFGSNYCL
                     LHFLSLSAALEVKDLLETTHETVSRVSFVIPTNQLEGEAKRSSSTISLKQENFPGSVS
                     ESRSRASNTSLPLSEQMGSATTSDPNLPLYEGAGKSLSWITLTVNHSDYKEPSMNEHS
                     HHLSAWSMSKPTMVYLREPRIANFSSSNLSDEVDPLSVSGQEPASQSMMINEYPYVME
                     QLMPPQITQTIQSQYNKSIQAVSAGMEHRTVFIGNINPRSKPEDICNVVRGGILQHVK
                     WVAHKRICFVTFIETAAAVQFYANAILEPIVLHGNVLKVGWGQNPGTLPKKIALAVTV
                     GASRNVYISLPDKAFKDKYMNDPEFEEYRNKYKLPDVNQLKEDFGMYGAMEQINFHPD
                     GHCCWINFMNINSAIKLVEEYSDVKRNVFNKKTQGRYEGLIIGYGKDRCGNVNKNLAA
                     NKNSKGNQRFKAQSNSGFGKGRRNHRQSFDSSKNSNGNSRFKAASDAQVEHSNFLTLN
                     GGMDFSEGLGITVSPERERSHVLSDVEKDIDDENDVDKDADLDHSIGENKSARITSAI
                     KQENGSKMESKGNDEVQIRNKEHVSKEEDGEEEEGDDQKADFDSESSYSGSSSSDIDI
                     IVDAPSPNMNDINAFAFQSEEGDGNQHYYYDNSYSTRHSPHHSGQYYISNHYQFQHVP
                     QQQYHQNQHHHHHHQHHNHHQQHQQQPFIPQTPYRFSNSFTTQNNHRRGSAHGKSKKS
                     AAKPIAGSDVMTRYLEQLHHNTFVYAANILGATQDPVFYDENNL"
     gene            <138649..>140208
                     /gene="CTSD"
                     /locus_tag="KLMA_80048"
                     /db_xref="GeneID:34718249"
     mRNA            <138649..>140208
                     /gene="CTSD"
                     /locus_tag="KLMA_80048"
                     /product="plasmepsin-2"
                     /transcript_id="XM_022821779.1"
                     /db_xref="GeneID:34718249"
     CDS             138649..140208
                     /gene="CTSD"
                     /locus_tag="KLMA_80048"
                     /codon_start=1
                     /product="plasmepsin-2"
                     /protein_id="XP_022678106.1"
                     /db_xref="GeneID:34718249"
                     /translation="MTSGHLSRGPLRVILFIFLTFYSICANAFYPCSKDRYLKPKSSF
                     EVEIKNTGYAAQLAHINKGDDDSSLPESEPQSRFSQESGRVEIPLKPGMSILSTDENN
                     LSYFVNVTIGDEEYPLVIDSGSAYLWVYGDSCKSDSCSSKKLFATKNVNKANGDQTFS
                     LTYSSGVASGDVYEDRIIVNKLATTQNFTFGVADQVPGLFMNYPVSGIFGLPSNNSQN
                     IESIISILSDSHAISTEKFSMIIGPVNAADNSTSPDSNDNTALTKNSGVFVIGDLQDN
                     LYSGEVSYTPLLQNDNHYWQMKIDSVYVGSQLVNFSIAENVTGSQSRNTRSGIVDSGT
                     TLLILPTQDALDLHTFFPKSVSDGTNFAIFCNSTMDIFLELNGVKWSISPKDYLGEPY
                     SSDSYYQGYCVSNIQGANIDKSWILGDVFLKNKYAVFDVEKQLFGLANVNENAILVPY
                     SNGVSNTSGDNNINSTKTTLSSIASSTATSRKNSTSASTSTSSSKGSGSANENPKSFL
                     IGCLALFLLAF"
     gene            complement(<140990..>142498)
                     /gene="VAN1"
                     /locus_tag="KLMA_80049"
                     /db_xref="GeneID:34718250"
     mRNA            complement(<140990..>142498)
                     /gene="VAN1"
                     /locus_tag="KLMA_80049"
                     /product="mannan polymerase I complex VAN1 subunit"
                     /transcript_id="XM_022821780.1"
                     /db_xref="GeneID:34718250"
     CDS             complement(140990..142498)
                     /gene="VAN1"
                     /locus_tag="KLMA_80049"
                     /codon_start=1
                     /product="mannan polymerase I complex VAN1 subunit"
                     /protein_id="XP_022678107.1"
                     /db_xref="GeneID:34718250"
                     /translation="MAIFVKDKVLELPRHRDSKEPSHFRPKNGFGGFKGLKYTKKDLF
                     RKRNVLTGILGFVSLYTLFVLLFRENYGTFNVSGLNPMSLEDQEYYDYDFKGLDPNTI
                     KKFDEGVSHYIISKGGMEALSPEDKELYEQEVEMLIASTTDVYDLSEYSGHKDGAPQR
                     DHVLLCVPLRDAAPMLPLLFKNLMNLTYPHELIDIAFLVSDCTDAGHTMNSLIEFSKE
                     LQNGTLSKTLEAFESEQDKKNSADKLYLKYMKKEYLDMVKTAFSPPFHDMYDKPFRSI
                     QIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVE
                     LCPGSVIEDLMKFDYDVMVPNVWRPLPTFLGGEQAYDLNSWMESNEALKLAKTLDEDD
                     VIVEGYAEYPTWRVHLGYLRNENGNPNELLDLDGVGGVSILARAHLFRKGIHFPAFTF
                     ENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLREIAKLERENKRD"
     gene            complement(<142967..>143965)
                     /gene="SAM4"
                     /locus_tag="KLMA_80050"
                     /db_xref="GeneID:34718251"
     mRNA            complement(<142967..>143965)
                     /gene="SAM4"
                     /locus_tag="KLMA_80050"
                     /product="homocysteine S-methyltransferase 2"
                     /transcript_id="XM_022821781.1"
                     /db_xref="GeneID:34718251"
     CDS             complement(142967..143965)
                     /gene="SAM4"
                     /locus_tag="KLMA_80050"
                     /codon_start=1
                     /product="homocysteine S-methyltransferase 2"
                     /protein_id="XP_022678108.1"
                     /db_xref="GeneID:34718251"
                     /translation="MRIPIKQYMKENPDVVLVMDGGQGTELENRGIDVANPVWSTVPF
                     INESFWCDNSSRDRVIVKQMFEEFIEAGSDILMTITYQTSFKSVSENTPLKSLEEYNG
                     LLDRIVSFSRGCVGEDKYLIGCIGAWGAHVCSEFTGDYGPHPEEIDYLEYFKPQLENF
                     VHSSDIDIIGFETIPNIHEVRAILSWDESVLSKPFYIGLSVHEYGVLRDGTSLQQVAD
                     LIHGLRDEGKLNPNLVSIGINCCAFNQSPMILESLHNSCPELPLVVYPNSGEIYDTVK
                     KVWLKNENQTSTWDDVVKSYIENGARIVGGCCRTTVSDIKEVRAAVDKYAKATVKH"
     gene            complement(<144279..>146120)
                     /gene="PGM3"
                     /locus_tag="KLMA_80051"
                     /db_xref="GeneID:34718252"
     mRNA            complement(<144279..>146120)
                     /gene="PGM3"
                     /locus_tag="KLMA_80051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821782.1"
                     /db_xref="GeneID:34718252"
     CDS             complement(144279..146120)
                     /gene="PGM3"
                     /locus_tag="KLMA_80051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678109.1"
                     /db_xref="GeneID:34718252"
                     /translation="MSMTDLTGIVSGLPADLQDKVRDWLRFDDVKETRDEIIGLCVQG
                     NVEELHKRLDTRIAFGTAGLRGRMEAGFSRMNALTVKQASQGLAKYIKAQFPENLTCV
                     VGHDHRFNSKLFARTTIDVFLQLGFKVYDLNVVVGKEEDSYVHTPLVPFTVNAKGASV
                     GIMITASHNPKMDNGYKVYYANGCQIIPPHDSLIAQSIAENLEPFQSPKTGTVVDCKK
                     EMTAAYIKAIREKLVHDDLQNTAAAGGPWFIYTPMHGVGFEIFEQIAKQAMSLEENRD
                     YVVVQEQKYPDPAFPTVPFPNPEERGALDLAIEYGKAESHSGADLIIANDPDADRFSV
                     AVRDKASSTWRQLTGNEIGFLFAFYEFEKYKASNIQEPLAMINSTVSSQMIKRMAEIE
                     GFHYEDTLTGFKWLGNRALQLENENYYVPFAYEEAIGYMFSSVVHDKDGIAAAVVFLQ
                     AYSKWRQSGIEPLQILKQASEKYGHFKEFNGYYTVPDTSLTKKVFDTIRSIESPFPTK
                     LGTKFKIEKFRDLTTGYQSDTPDHVPLLATDPNSQMITCEMVLVEQPTSRVRFTIRGS
                     GTEPKLKVYIEARTTTEQASIALAKFTWDVLKQEWFKPEFTGLVTPF"
     gene            complement(<146385..>146729)
                     /gene="FPR1"
                     /locus_tag="KLMA_80052"
                     /db_xref="GeneID:34718253"
     mRNA            complement(<146385..>146729)
                     /gene="FPR1"
                     /locus_tag="KLMA_80052"
                     /product="FK506-binding protein 1"
                     /transcript_id="XM_022821783.1"
                     /db_xref="GeneID:34718253"
     CDS             complement(146385..146729)
                     /gene="FPR1"
                     /locus_tag="KLMA_80052"
                     /codon_start=1
                     /product="FK506-binding protein 1"
                     /protein_id="XP_022678110.1"
                     /db_xref="GeneID:34718253"
                     /translation="MSETIEGNVQILRLSPGDGTNFPKPGDLVTIHYTGTLENGQKFD
                     SSVDRGSPFQCNIGVGQVIKGWDAAIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNA
                     TLVFDVELLKIN"
     gene            <148252..>149460
                     /locus_tag="KLMA_80053"
                     /db_xref="GeneID:34718254"
     mRNA            <148252..>149460
                     /locus_tag="KLMA_80053"
                     /product="DNA-directed RNA polymerase II subunit RPB1"
                     /transcript_id="XM_022821785.1"
                     /db_xref="GeneID:34718254"
     CDS             148252..149460
                     /locus_tag="KLMA_80053"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB1"
                     /protein_id="XP_022678111.1"
                     /db_xref="GeneID:34718254"
                     /translation="MINQIVLSFIAISGVANAQAGPFANTTLGFGSPSGSNSSIDSVS
                     ASVSASAPALYLNSTRSVLQTETFAPTTLPKKKSSTTYVLTTSSSSSSAVSAPQESFA
                     PTTSPADTSVSSPAVSSPQESFAPTTSPADDAAAAESYAPTTSPEETSSASTSAPEES
                     YAPTTSPEETSVPTTAPADTGAPQESYAPTTSPEESYAPTTAPADTGAPQESYAPTTS
                     PSESFAPTTAESYAPTTAPAQTFTRGNTPFFKYNTTATVPTPAYNTTLLPPTYNATSA
                     LNGTLPTPALNATLPTPALNGTVPLPLNTTSVVVKRDVAPVSQIGDGQIQATTGTPAS
                     PAAPTTPAPVGSSTLVSQITDGQVQATASANGTNSQSIHTYEGGAQAQFLTSTNGLLA
                     VLCLVASLAI"
     gene            <150558..>152294
                     /gene="HIP1"
                     /locus_tag="KLMA_80054"
                     /db_xref="GeneID:34718255"
     mRNA            <150558..>152294
                     /gene="HIP1"
                     /locus_tag="KLMA_80054"
                     /product="histidine permease"
                     /transcript_id="XM_022821786.1"
                     /db_xref="GeneID:34718255"
     CDS             150558..152294
                     /gene="HIP1"
                     /locus_tag="KLMA_80054"
                     /codon_start=1
                     /product="histidine permease"
                     /protein_id="XP_022678112.1"
                     /db_xref="GeneID:34718255"
                     /translation="MIDKSQDKIPLQDISMQSFSKEESWSVEDKETSPKSAVPQKRYE
                     DMNDVEKAIFNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGSSLSTGGPASLVIA
                     WTIISTCLFTIVNALGELSATFPVVGGFNVYVTRFVEPSLGFAVNFNYLAQWAILLPL
                     ELCAASITIRYWNKNINPDAWVSIFYVAIALANMLDVKSFGETEFVLSMVKILAIIGF
                     TILGIVLICGGGPNNHFIGGKYWHDPGAFVGETSSQQFKGLSAVFITAAFSYSGLELV
                     GVSAAESRNPRVTLPKAAKRTFWLITFSYLIILTLVGCLVPSNDPLLLNGTSSVDAAA
                     SPLVIAIQNGGIKGVPSLMNAIILIAVLSVANSAVYACSRCIVSMAEIGNLPRTLAHV
                     DKKGRPLYAIAVTLFIGLLSFVAASDKRDDVFTWLSALSGLSTLFCWLAINIAHLRFR
                     HAMKLQNRSLEELPYVSMTGEWGSWYGCAVIGLVLIASFWTSMFPAGSHGADAKSFFE
                     SYLSLPIFIVCYVGHKIWKRNFTLVNKLSEIDVDSGRVDIDIETLKKEKEAEDLLMKS
                     KPFYIKFWNFWC"
     gene            <152762..>156808
                     /gene="tsc2"
                     /locus_tag="KLMA_80056"
                     /db_xref="GeneID:34718256"
     mRNA            <152762..>156808
                     /gene="tsc2"
                     /locus_tag="KLMA_80056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821787.1"
                     /db_xref="GeneID:34718256"
     CDS             152762..156808
                     /gene="tsc2"
                     /locus_tag="KLMA_80056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678113.1"
                     /db_xref="GeneID:34718256"
                     /translation="MSESVLSNGRNSVRNSVFREFSLLLKRHNSDLRVQTSGEYKTWL
                     DHLDKSQDVKTRRRDILNITKNIEKYEKREVPLIWGKVTELLKEDLEGSEIRMLLVLL
                     SKCCAHCGQDNSVRLMFYFTLIDLCCNLDDKITLDDKSFGVSLDLIFDCINELTHQGT
                     DIEFLEQEETMNLDHFLKLCLKSLSKFDYPVCLSFLSLLNNCLRVPSFYIGGFDAIMN
                     CAQNTPNREVLASCLHTVDILIHKGKEDMSDDSMQVLVKLITGAINLNAKLTQQLLKT
                     LDTLIESPYWPQFWEQLKQMIEDPGTPFLNLRGAVSILTDLAQQDKEDWLIWLTKIFT
                     RGTSMYGQILECIKTLINDDHFNNNNAENHGYIWFNEENMCLLKMLRIVLDIDAIKQN
                     NPLTIASIYDKLLDGLISGKYGIYGFKDSVSFLSFIMEHKDVLSEDQLLELTKYFDSC
                     DVPLPMNALSQVISILDPSKDFSTNIIRYITRIYKSLESAQLDSENIVIINSILSLLT
                     TEESRPVFASCVEFLVAISGSLPPDTLLEYVEVYLVPKEPRRRSIVSIGIEHVKNKWK
                     AEEQSIGLAKLFQRNLDIFPYMISMWKYAVKIKDESALMVLVRVLMKMRVDRNENFYF
                     CEEIDMDGLTATFRRNSNIQSIPEEQKLLWKYPEDDTVPYIDGNLLNQRFDNEGNSNW
                     RKYIDISLWSELLIETLRKPLDWEVYTYTLSHLCPQLANFDLFKTDLANIETLHDVIL
                     HQLREGAPIKMSNGGANKSDVQLAIVRTCSSLFPYYRYLGKSKADEMIQLSLGVLETS
                     FEKTIIPLLHNFTISCYEIPSSIKRYLNPLLDTISIRLTKKQAIPSILEFFIALSDSP
                     TIISTLTLDQLKKVFAIAFKLIEVSRDLKQESEKEQNVTFFKKAGYRDEQEASYFPST
                     IAFEVTKPMAHFYLTVSYHIISHWFIRISLENRPMIAPFLLGKLSMLEDCDDTRAYKD
                     LITRFNSTDLELRVETVTTDVPHGGDPRYSHEYWYHDGRIVSIETNRETGESLVVMRG
                     ASGNSVFRVSPVVKREPVAVDLFGLRKQAAAGSPKNGNNIFTPGYIAAQFIGNKSLGD
                     MVRIEDEHLARSVQLLDTIPVVEFHKVGLMYMGKGDKCERDILSHSIWDDKQQEGGEE
                     EGGAQFKWFINELGTIVKLRENERSFYFGGLDADTDGEYALIWHDQKCQIVFHAVSLM
                     PNNDTDPEFTMKKRHVGNDFINIFWDERDEDTFPFDIIKSQFNFMNVVIRPVSVSEDL
                     FKVKVYRARGVPGIFSTCHFKIMHGNRLGAYVRHLVTLTNTFAHIWHETSALDHCSTW
                     SRRAGHIESIRGKAGALAMGASHQYPVT"
     gene            <157328..>158236
                     /gene="SUI2"
                     /locus_tag="KLMA_80057"
                     /db_xref="GeneID:34718257"
     mRNA            <157328..>158236
                     /gene="SUI2"
                     /locus_tag="KLMA_80057"
                     /product="eukaryotic translation initiation factor 2
                     subunit alpha"
                     /transcript_id="XM_022821788.1"
                     /db_xref="GeneID:34718257"
     CDS             157328..158236
                     /gene="SUI2"
                     /locus_tag="KLMA_80057"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 2
                     subunit alpha"
                     /protein_id="XP_022678114.1"
                     /db_xref="GeneID:34718257"
                     /translation="MSTSNCRFYENKYPEVDDVVMVNVQQIAEMGAYVRLLEYDNIEG
                     MVLLSELSRRRIRSIQKLIRVGKNEVVVVLRVDKEKGYIDLSKRRVSAEDVIKCEERY
                     QKSKAVHSILRQCAEKYQVSLEDLYKAYAWPLSRKYGHAYDAYKMSIVDPNVWDGIES
                     ISDEIFAELKGQITRRLTPQAVKIRADVEVSCFSYEGIDAIKEALKAAEALSTEQAQI
                     KVKLVAAPLYVITTQSLDKDQGIALLESAIARIEEVTSKYNGVCNVTMAPKAVTATED
                     AELQALLESKELEGRSDSEEDESDYE"
     gene            <158589..>159512
                     /locus_tag="KLMA_80058"
                     /db_xref="GeneID:34718258"
     mRNA            <158589..>159512
                     /locus_tag="KLMA_80058"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821789.1"
                     /db_xref="GeneID:34718258"
     CDS             158589..159512
                     /locus_tag="KLMA_80058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678115.1"
                     /db_xref="GeneID:34718258"
                     /translation="MSMKIRPATHAGSWYPDETGLLNTLHKLLARNDVVAGTRHLISP
                     HAGYTYCGDTMSQGYSKVDFTNVKRCIIMGPSHHVYFKNKVQLSGFDALETPFGHFPV
                     DVKLRDELVKGGSESESESWSRYFTVMDSDVDMDEHSLEMQFPMLWAAATLRGADPSK
                     IAVLPILVSHNSSKVDAVVGKVLARYLADESTMVILSSDFCHWGRRFGYTRVMKSEGP
                     IYKSIEKMDHEAMEILEKKSTNSNSKYSLWKKYIEDTGNTICGERPIGLFLCAMESVN
                     KSTAFQWAHYSQSSKCTSPNDSSVSYAAGYF"
     gene            complement(<159680..>160675)
                     /gene="GAP3"
                     /locus_tag="KLMA_80059"
                     /db_xref="GeneID:34718259"
     mRNA            complement(<159680..>160675)
                     /gene="GAP3"
                     /locus_tag="KLMA_80059"
                     /product="glyceraldehyde-3-phosphate dehydrogenase 3"
                     /transcript_id="XM_022821790.1"
                     /db_xref="GeneID:34718259"
     CDS             complement(159680..160675)
                     /gene="GAP3"
                     /locus_tag="KLMA_80059"
                     /codon_start=1
                     /product="glyceraldehyde-3-phosphate dehydrogenase 3"
                     /protein_id="XP_022678116.1"
                     /db_xref="GeneID:34718259"
                     /translation="MVRIAINGFGRIGRLVLRIALSRKNIEVVAINDPFITVDYAAYM
                     FKYDSTHGRFDGEVSHDGKALIIDGKKVLVFQERDPATLPWGAEKIDIAIDSTGIFKE
                     LDSAQKHIDAGAKKVVITAPSSTAPMFVVGVNEDKYAGQTIVSNASCTTNCLAPLAKI
                     INNAFGIEEGLMTTVHSITATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVL
                     PELQGKLTGMAFRVPTVDVSVVDLTVKLAKPATYEEIKAVVKKASENELKGVMGYTED
                     AVVSSDFLGDTHSSIFDAAAGIQLSPQFVKLVSWYDNEFGYSTRVVDLVELVAKN"
     gene            complement(<161876..>162907)
                     /locus_tag="KLMA_80060"
                     /db_xref="GeneID:34718260"
     mRNA            complement(<161876..>162907)
                     /locus_tag="KLMA_80060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821791.1"
                     /db_xref="GeneID:34718260"
     CDS             complement(161876..162907)
                     /locus_tag="KLMA_80060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678117.1"
                     /db_xref="GeneID:34718260"
                     /translation="MAYTVVTGANGYIAKHILKSLLEDGHRVIGTVRNSKKAEELKRT
                     VNDENLIVELVPDMLVENAFDELFKKYNTQIKYVFHTASPVLETSKDYEKSLIEPAIT
                     GAKSMVEAIRKYSLTSVEHIVYTSSIAASSLESEFTDPTLVVSEDSWNPQGLKEAKKE
                     FFTAYSYSKKIAEKTMWDFVEEYKGTEHEIKLTTVNPCFNIGPQAYEADVTEIMNFTA
                     ELINHVVKSKVGDPLPPTRIAPYVDVRDTARAHVDALKNEKLAFQRLLVVGPFLSSQQ
                     IYDIVNERFPGIKIARGEPGSDRLDPAKLAKFDHARTTRNLGWEFTPIEKAIADEVDQ
                     ILRVGAYRG"
     gene            <164182..>165690
                     /gene="MET3"
                     /locus_tag="KLMA_80061"
                     /db_xref="GeneID:34718261"
     mRNA            <164182..>165690
                     /gene="MET3"
                     /locus_tag="KLMA_80061"
                     /product="sulfate adenylyltransferase"
                     /transcript_id="XM_022821792.1"
                     /db_xref="GeneID:34718261"
     CDS             164182..165690
                     /gene="MET3"
                     /locus_tag="KLMA_80061"
                     /codon_start=1
                     /product="sulfate adenylyltransferase"
                     /protein_id="XP_022678118.1"
                     /db_xref="GeneID:34718261"
                     /translation="MPAPHGGTLQDLVARDAPKKNELLQEATDGSLVSWALTERQLCD
                     LELILNGGFSPLDGFLTERDYNSVVEKSRLADSGLVWTMPITLDVSSEFASQLTEGQR
                     IVLVQDNEFPLAILTVADVYQPNKQVEAKKVFRGDPEHPAVKYLFEQAGDFYVGGSLE
                     AIQLPVHYDYPGWRKTPAQLRSEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNC
                     KVLIHPVVGLTKPGDIDHHTRVRVYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHA
                     IIRKNYGASHFIVGRDHAGPGKNSKGVDFYGPYDAQELVENYKNELEIEVVPFRMVTY
                     LPDEDRYAPIDEIDTDKTRTLNISGTELRKRLRDGGEIPAWFSYPEVVRILRESNPPR
                     PSQGFALVLSPALPSQLKTALLSTFLQYGGGRHYKVLERSDVPEVLDLVPDFIRSGTG
                     LILQGDLAPATNVFKVGSEQDSDIELESDEQNVLHIVQKVVLFLEDQGFFQF"
     gene            complement(<165935..>168226)
                     /gene="MNN1"
                     /locus_tag="KLMA_80062"
                     /db_xref="GeneID:34718262"
     mRNA            complement(<165935..>168226)
                     /gene="MNN1"
                     /locus_tag="KLMA_80062"
                     /product="alpha-1,3-mannosyltransferase"
                     /transcript_id="XM_022821793.1"
                     /db_xref="GeneID:34718262"
     CDS             complement(165935..168226)
                     /gene="MNN1"
                     /locus_tag="KLMA_80062"
                     /codon_start=1
                     /product="alpha-1,3-mannosyltransferase"
                     /protein_id="XP_022678119.1"
                     /db_xref="GeneID:34718262"
                     /translation="MTIRRLISSGSRTRTRTRTRTHLGWVRYRYVMYGFVITCIGTLV
                     YLLVDRTGMDVEKWHRAARMADKMLESYSWDLISDAKIKAIEEIPVSPLELIPDIELN
                     TKKRYDASWDLLFRGRKYKSFSEYDLSTKCEFYFQNLYNLDEEWTNEIGMFTFDIKDI
                     KSDSRMSELKDDDGVKLIDEKALRYYKRKHNIALGMERFRIYDRCFVGNNNNKHDSLK
                     MNELFEQGGSEGSTSTASKLDKTVIGNKDSLRPTRKASFLSELDSGKFSKFNQWDFEH
                     RMFPFIPYFEQHNFTQVMPIFTGPGSHQPLPQGKFPVFNRDTGELSTVESFNYDETKS
                     LWDNWNDLSARCSHKGIVMSAGNGQVDQTMRLIAVLREQHNRMPIQIIHNDQLSDNSV
                     ALLSEAAQSTDFSNGPKQSVWFLNVKPTLSESEKGRFDRYKNKWLSVIFNTFEEFIFI
                     DSDAISYIGLEEYFKFDEYSATGTLMFKDRSLKFGAEQKCPVLFETLQPKILERYYFD
                     TVPQINAEFVEQACMKELTPEERVYKRFFELGQQHHLESGLLAINKRQHIMSMIISTV
                     LNISPKIGGCAWGDKEFFWLGLLVSGHRYSIYDVAASAVGIPSMKERERGDELKEAQE
                     ICSTQVGHTSYDKHLLWLNGGSQLCKFEGTFDSDWEQFENIRKEFHDNKDKARQAYKD
                     VMPIEAAIIPDINVGRWAHKDRRCSGYVWCGEYFEKIKPYTYSKKIVKGELIHFDQKE
                     IEHIRHLNTIWNKASLLPIDKKE"
     gene            complement(<169334..>171565)
                     /gene="MNN1"
                     /locus_tag="KLMA_80063"
                     /db_xref="GeneID:34718263"
     mRNA            complement(<169334..>171565)
                     /gene="MNN1"
                     /locus_tag="KLMA_80063"
                     /product="alpha-1,3-mannosyltransferase"
                     /transcript_id="XM_022821794.1"
                     /db_xref="GeneID:34718263"
     CDS             complement(169334..171565)
                     /gene="MNN1"
                     /locus_tag="KLMA_80063"
                     /codon_start=1
                     /product="alpha-1,3-mannosyltransferase"
                     /protein_id="XP_022678120.1"
                     /db_xref="GeneID:34718263"
                     /translation="MSMRRMLGVVRARYVVYGLMVTCFIAVGYLLAQARDADAEEWHR
                     AARIASQARAREFADDYVSNVKIKPIEEIPVSPLELIPDIEVETRRRYEASWDLLFRS
                     HKHKSFKHYDLSTKCEFYFQNLYNLNEEWTNEIGMFTFDIKDIKSDNKMSELKDDDGV
                     KLIDEKALRYYKRKHNIALGMERLRIYDRCFVGNSNNRDSLKMNELFQQHGSEGSTSK
                     LDQKVIGNKDNLRPTRKASFLSELDTGKFSKFNQWDFEHRMFPFISYFEQHNFTQVMP
                     IFTGPESLEPLPQGKYPVFNRDTGELDSVETFHYDETKSLWDNWNDMSSRCSHKGIVM
                     SVGNGQVDQTVRLLAVLREQHNRLPIQIIHNDQLSNDSIALLSDVARSSDLFNGPKQS
                     VWFLNVRPTLSQSAKDRFDRFKNKWLSVIFNTFEEFIFVDSDAISYIGLEEYFQFDEY
                     TATGTLMFKDRSLRMESGQKCPVLFETLMPKILERYYFDTVPQVDPDFVEQACMKELT
                     PEEKVYKRFFENGYQHNLESGLLAINKNEHIMSMIISTVLNISPKIGGCGWGDKEFFW
                     LGLLVSGHHYSIYDVDASAVGIPDLKDREKEDELKEAQEICSTQVGHTSYDKHLLWLN
                     GGSQLCKFRDKFDSDWEEFENIRKEFHDNKEKARQAYDSVMPIEAAIIPDVNIGRWAH
                     KDRRCNAYVWCGEYYEKIKPYTYNKKIVKGELIHFEQDEIEHIRRLNTIWNNAIIEVR
                     KEE"
     gene            complement(<173413..>175662)
                     /gene="MNN1"
                     /locus_tag="KLMA_80064"
                     /db_xref="GeneID:34718264"
     mRNA            complement(<173413..>175662)
                     /gene="MNN1"
                     /locus_tag="KLMA_80064"
                     /product="alpha-1,3-mannosyltransferase"
                     /transcript_id="XM_022821796.1"
                     /db_xref="GeneID:34718264"
     CDS             complement(173413..175662)
                     /gene="MNN1"
                     /locus_tag="KLMA_80064"
                     /codon_start=1
                     /product="alpha-1,3-mannosyltransferase"
                     /protein_id="XP_022678121.1"
                     /db_xref="GeneID:34718264"
                     /translation="MSVRRTLSMLRVRYAVYGFIIMCLIGVGYLLAQASAADVEEWHR
                     AAKVASQARSREFAHEYVTDVKIKPIEEIPVSPLELIPDIEVETKRRYEASWDLLFRG
                     RKFKSFKQYDLNTKCEFYFQNLYNLNEEWTNEIGMFTFDIKDIESDSKMAELKDNDGV
                     KLIDEKALRLYKRAHNIALGMERFRIYDMCFVGKNSNNKHGSLKMNELFEQGGSEGSK
                     STASKLDKKVIGNKDNLRPTRKASFLSELDSGKFSKFNQWDFEHRMFPFIPYFEQHNF
                     TQVMPIFTGPESLEPLPQGKFPVFNRDTGEATGVETFHYDETKSLWDNWNELSTQCGH
                     RGIVVSAGDGQVDQTVRLLAVLREQQNRMPIQIIHNGQLSNDSMALLSEVAQSKDFSN
                     GPKQSVWFLNVKPTLSESVKDRFDRFKNKWLSVVFNTFEEFIFIDTDAISYIGLEEYF
                     NFDEYSATGTLMFKDRSLRIDSAQRCPVLFETLQPKILEQYYFDTVPQINPDFVEQAC
                     MKELTSEEKAYKRFFELGHQHNLESGLLAINKKEHIMSMIISTVLNISPKIGGCAWGD
                     KEFFWLGLLLSGHRYSIYDVEACAVGIPEVKPNENENENDLKKAQQICSLQVGHTSYD
                     KHLLWLNGGSQLCKFPEKFEIDWESIESIRKEFHDNKEEARKAYTDVISIEAAVIPDS
                     TTGMWGHKDMRCKGYLWCGEYFEKIKPYTYNKKIVKGELIHFEQDEIEQIRRLNTIWS
                     NAVFPVRKE"
     gene            complement(<176780..>178033)
                     /gene="PDX1"
                     /locus_tag="KLMA_80065"
                     /db_xref="GeneID:34718265"
     mRNA            complement(<176780..>178033)
                     /gene="PDX1"
                     /locus_tag="KLMA_80065"
                     /product="pyruvate dehydrogenase complex protein X
                     component"
                     /transcript_id="XM_022821797.1"
                     /db_xref="GeneID:34718265"
     CDS             complement(176780..178033)
                     /gene="PDX1"
                     /locus_tag="KLMA_80065"
                     /codon_start=1
                     /product="pyruvate dehydrogenase complex protein X
                     component"
                     /protein_id="XP_022678122.1"
                     /db_xref="GeneID:34718265"
                     /translation="MFRSVIRNRVLVRQLQHCRVLMKAEAFGMPAMSPTMEKGGIVDW
                     KFKVGEPFSAGDVILEVETDKATIDVEAQDDGKFAKILKENGAKDVPVGETIAYIAEV
                     DDDLATLELPEGSSTPKKEAAAPAAAPASTPAPKKEEPKAAPKATASKNAASSNGTSA
                     NTSQTFFPSVATLLQENSISPEEAFAKIKATGPNGRILKGDVLAYLGKISQESLDKVT
                     SYIKSHEKLDLSNIELRKEQPAAEQPATASSEATQAAAAAAAAEARQPLVLSEQITLR
                     VPVSVSYEQLAEAVRSYVKESTFLAHEEPLTNSASDLYDPLFEELLVQEPHKPRFKVT
                     YNLVSVDDAPAASHHYHPDIFELLAGTTNSANSNNTAAAASPAQADARHEYVLNVSVA
                     VDESLSDAKERAESFVSRISSLELF"
     gene            complement(<178384..>180192)
                     /gene="XKS1"
                     /locus_tag="KLMA_80066"
                     /db_xref="GeneID:34718266"
     mRNA            complement(<178384..>180192)
                     /gene="XKS1"
                     /locus_tag="KLMA_80066"
                     /product="xylulose kinase"
                     /transcript_id="XM_022821798.1"
                     /db_xref="GeneID:34718266"
     CDS             complement(178384..180192)
                     /gene="XKS1"
                     /locus_tag="KLMA_80066"
                     /codon_start=1
                     /product="xylulose kinase"
                     /protein_id="XP_022678123.1"
                     /db_xref="GeneID:34718266"
                     /translation="MSTPYYLGFDLSTQQLKCLAIDDQLNIVTSVSIEFDRDFPAYNT
                     KKGVYIKNGGVIDAPVAMWLEAVDLCFSQLAERIDLKRVQSMSGSCQQHGTVYWNCEH
                     LPSNLDPASTLREQLQGSLSRPVAPNWQDHSTKKQCDELAESVGGPEELARITGSGAH
                     YRFSGSQIAKIHETEPEVYEATKRISLVSSFLASVLVGDIVPLEEADACGMNLYDLSK
                     HDFDETLLAVVDHDTARLRRKLSDPPVGAPTGESPLTSLGKVSKYFQDKYGVNCECEI
                     FPFTGDNLATICSLPLQKNDVLISLGTSTTILLVTDQYHSSPNYHLFIHPTVPGYYMG
                     MICYCNGSLARERVRDDLAGPQASQAPGEQVPWTQFNDALLDDSLSNDNEIGLYFPLG
                     EIVPNVDAVTKRWTFERKGDHPNKTIVLHELDQFTPKRKDAKNIVESQALSCRVRISP
                     LLSDETDALSETQVLSKKENTQVTFDYDAFPLWTYAKRPNRAFFVGGASKNDAIVRTM
                     ANVIGARNGNYRLETPNSCALGGCYKAMWSWLKVHEPTTTPSFDVWLNASFNWQRDCE
                     FVCQSDAAKWEQCNGKIQALSEAEAYVKALAQSQGQ"
     gene            complement(<180466..>180744)
                     /locus_tag="KLMA_80067"
                     /db_xref="GeneID:34718267"
     mRNA            complement(<180466..>180744)
                     /locus_tag="KLMA_80067"
                     /product="signal peptidase complex subunit SPC1"
                     /transcript_id="XM_022821799.1"
                     /db_xref="GeneID:34718267"
     CDS             complement(180466..180744)
                     /locus_tag="KLMA_80067"
                     /codon_start=1
                     /product="signal peptidase complex subunit SPC1"
                     /protein_id="XP_022678124.1"
                     /db_xref="GeneID:34718267"
                     /translation="MDVLQDLGRHLVFPIDFESQAYTERISKLGLYAATIISCVAGYA
                     SNSLKICAAVFVAGVIGVMAAVLPAYPAYNKNRPKWVSSGPKVVLADE"
     gene            <181652..>182596
                     /gene="mcfL"
                     /locus_tag="KLMA_80068"
                     /db_xref="GeneID:34718268"
     mRNA            <181652..>182596
                     /gene="mcfL"
                     /locus_tag="KLMA_80068"
                     /product="mitochondrial substrate carrier family protein
                     L"
                     /transcript_id="XM_022821800.1"
                     /db_xref="GeneID:34718268"
     CDS             181652..182596
                     /gene="mcfL"
                     /locus_tag="KLMA_80068"
                     /codon_start=1
                     /product="mitochondrial substrate carrier family protein
                     L"
                     /protein_id="XP_022678125.1"
                     /db_xref="GeneID:34718268"
                     /translation="MSKPSSSSSSSAIVQPVNSLISDETYSRIMGFVAGVFSGVAKNA
                     VGHPFDTIKVRLQTSQTEAKTRFSGPLDCVYKTFKTQGIRGFYLGFTPPLVGWIMMDS
                     VMLGCLHNYRMLLRKYVYTEEEKLPLSGCILSGVMAGWSVSFIAPPIELAKAKLQVQY
                     DQTTTRYKGPLDVIKKVYSQQGIRGLYKGLISTLIFRTHFVYWWGSYELLTRWFREHT
                     NMSETAINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQAR
                     GVKGFFKGFVPSFLRSFPANAAALAAFEFVLRTSGAKS"
     gene            complement(<184121..>185283)
                     /gene="SAG1"
                     /locus_tag="KLMA_80069"
                     /db_xref="GeneID:34718269"
     mRNA            complement(join(<184121..184162,184225..>185283))
                     /gene="SAG1"
                     /locus_tag="KLMA_80069"
                     /product="alpha-agglutinin"
                     /transcript_id="XM_022821801.1"
                     /db_xref="GeneID:34718269"
     CDS             complement(join(184121..184162,184225..185283))
                     /gene="SAG1"
                     /locus_tag="KLMA_80069"
                     /codon_start=1
                     /product="alpha-agglutinin"
                     /protein_id="XP_022678126.1"
                     /db_xref="GeneID:34718269"
                     /translation="MVTLSLLQTLAFVSFVSVTSAKDVTSNIKLSNPSVVAAPGSNSF
                     PHQGWVATLDWSVDDTSNVKAKDYFSISMPHVYKVKFNDGDTSFNVTLDNNENVFECY
                     APQQAAYKYDSTTLQCYALTDFSSYKSLSGSLKTTLVLSDGGSAYTPEINNAKYFSAG
                     EGKISFNDLEASINLDAYPETNDFYFSGRSTAYGSLESYFLGFKCPNGYVLGAKQQIQ
                     YDINNKGYGIDCSSVQVYQSKNYNDWLFPTDYENLDGTVSCGDNELEITVNKLEPEYR
                     VWVNALQSLDSDVATVRNSVYYDYTCTNTLQNSTYTTSTHYVPVYIITEAVYTGEAIT
                     TLAPQSQVSTLTTSTDVSTFEFDYEYKYDYEF"
     gene            complement(186541..186613)
                     /locus_tag="KLMA_R806"
                     /db_xref="GeneID:34718792"
     tRNA            complement(186541..186613)
                     /locus_tag="KLMA_R806"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34718792"
     gene            complement(187102..187176)
                     /locus_tag="KLMA_R807"
                     /db_xref="GeneID:34718793"
     tRNA            complement(187102..187176)
                     /locus_tag="KLMA_R807"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34718793"
     gene            complement(187685..187759)
                     /locus_tag="KLMA_R808"
                     /db_xref="GeneID:34718794"
     tRNA            complement(187685..187759)
                     /locus_tag="KLMA_R808"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34718794"
     gene            complement(<188190..>189956)
                     /gene="HOL1"
                     /locus_tag="KLMA_80071"
                     /db_xref="GeneID:34718270"
     mRNA            complement(<188190..>189956)
                     /gene="HOL1"
                     /locus_tag="KLMA_80071"
                     /product="protein HOL1"
                     /transcript_id="XM_022821802.1"
                     /db_xref="GeneID:34718270"
     CDS             complement(188190..189956)
                     /gene="HOL1"
                     /locus_tag="KLMA_80071"
                     /codon_start=1
                     /product="protein HOL1"
                     /protein_id="XP_022678127.1"
                     /db_xref="GeneID:34718270"
                     /translation="MDQYTNRHHPDFVPGTFNIYHSESLESGLGHGLGHGPALKKDKH
                     GIVLFPQPSDSPNDPLNWSKYRKLAHFALMAFITAFTAATSNDAGAAQDSLNEIYNIS
                     YDSMNTGAGVLFLGIGWGTLFLAPFANLYGRKITYLICTAFGLIGAVWFGRASRTADT
                     IWSQLFVGMSESCAEAQVQLSLTDIYFQHQLGSVLTVYILATSIGTFLGPLIAGYISG
                     LTSFRWVGYCAAIISGALLVWILLGCEETYFDRSQYMTPLASQKGYEGVEDDSSYHND
                     AEVDSSEKKICLVEKFPEKEKLPSSLENRFPGKRENSPEVYETGEELIDGSKEPLKPY
                     WQRIRIITKSTALRGYGFRQYVKYIAFNMRMFLFPPVWLSGLFWGMQDVLLSFYLTTE
                     DNDFYDAPWNYSDYGVAIMNVPTLIGAVIGCLYAGIISDYFVLWMARRNNGIQEAEYR
                     LYFTVAAALICPAGLLMFGIGTAKEMSWPVIYIGLGFIGFGWGCSGDIAMSYLMDCYP
                     EMVLEGMVCTAIINNNMSCIFTFTCSYWLDASGTQNTYIALAVLSFGISCLAIPMYFY
                     GKRIRLWTRKWYNESIDIREGL"
     gene            complement(<190930..>192591)
                     /gene="SSL1"
                     /locus_tag="KLMA_80072"
                     /db_xref="GeneID:34718271"
     mRNA            complement(<190930..>192591)
                     /gene="SSL1"
                     /locus_tag="KLMA_80072"
                     /product="suppressor of stem-loop protein 1"
                     /transcript_id="XM_022821803.1"
                     /db_xref="GeneID:34718271"
     CDS             complement(190930..192591)
                     /gene="SSL1"
                     /locus_tag="KLMA_80072"
                     /codon_start=1
                     /product="suppressor of stem-loop protein 1"
                     /protein_id="XP_022678128.1"
                     /db_xref="GeneID:34718271"
                     /translation="MAPVIGSDSEEEAIVGVSSKKHVRIKTLRESEEEEEEEEDEEEE
                     DEDEDDRVNSEFKKRHGTGGQPRGQTPSQIVEARRLLKEKKLNKKKRLDKKKMKKKKK
                     LSNANLQGANGGYAWEDDIQRSWDLVKVDEEGNIAALVASIVEARKKRAAEKTVTPYQ
                     RGIIRTLVLVLDCSEAMMEKDLRPTRYAMTVQYAIDFIHEYFDQNPISQLGIVVMKNG
                     LAHLISQVSGNPQEHIDALKQLRKEDSQGNASLQNALEMARGLLLHVPAHCTREVLIV
                     FGSLSTTDPGDIHQTIASLVHENIRAKVIGLSAQVAVCKELCKQTNYGDGSYYEVILN
                     DHHFKELLTGCVTPLPVSKVNKGFTLVKMGFPTRVFEETPSFCACHSRLVHGGYVCPN
                     CNTKVCSLPTVCPSCDLMLILSTHLARSYHHLMPLKTFQEVPVPATPPAAPAGGGGAA
                     ATTTGTTTITTGKTTGKTDADAGNTTASGTSTTVSGTDSVTFPTSHCFGCQRRFPVLR
                     NNKTGELLTSSRYRCEECTRDFCIDCDVFIHESLHNCPGCEARPM"
     gene            complement(<192826..>195360)
                     /locus_tag="KLMA_80073"
                     /db_xref="GeneID:34718272"
     mRNA            complement(<192826..>195360)
                     /locus_tag="KLMA_80073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821804.1"
                     /db_xref="GeneID:34718272"
     CDS             complement(192826..195360)
                     /locus_tag="KLMA_80073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678129.1"
                     /db_xref="GeneID:34718272"
                     /translation="MYGYWILLIGWLVVQLVQGLVILREGILDHLSNDLLKITQSYYH
                     QNEGEDRTEELELGIEYYGKSGNGKEPGSRFGKQFGGEYGFVKWVDVFYGTFEGHTFP
                     GTAVPFSMCKMGVDVVNSRKGDAYAGWQPDGDVVGVSMLHESGTGGAPTYGIVSQLPM
                     MGSSAAEVDVSEHIMFKRSRADVAHVGYYDVALENGVEIEFSSMDRSGLYQYTFPEVE
                     GEKPIVMVNVSQHLHCFGRPWWTQNFRGGFIKVDSNMKSYHGRVTIGGGWTDRSDYTI
                     SFYGEFDKPARRVVSFRNGKKLSGLRTMYSRTGVSDIGVLFEFDEGTTLLKSHVGISS
                     SKRNGFKVAKQNLLNDYPTEEARFNLTWSVEHALALWNDKVFDKVVLDTSVEDPILVS
                     KLYNSLYGTHLMPSNKSGADAPWKGDEPYYDDWFTLWDTFRCLHPLINIMSQDYGAEM
                     VRSLINIWEEEGFTPDGRSGDRSGRTQGGSNSDVMMADAFVKNITEGIDWEKGFQAMY
                     TNAEVEPPYVEDPMANDSTNKFGRGALKEWLSLGYVTRNYSRSVTRTMEYSYNDFSLY
                     MVAKGLGKNELAKRYLARSKNWRNIWNPEARSVNVQYNYTGFVQPRNADGTFASEKYD
                     PFSCFGCYWRDDEYEGKPVEYGWTVPFDMGTLLEYIGSRETFERRLDDMYKLNGHENV
                     VDIGNEPSFLTPYLYTYINKQDKTSELVNWIIDTKFKSGCDGLPGNSDAGAMQAWLTF
                     ALYGFYPIAGTDIYILTSPKFSRVVLQRMPNVPDVHIVAHDLYKDGGIVRSNYIREVV
                     LNGERLNRSWFRHDELFGQGGTLEFYMSDVPLGWDHAAQTPPMGWE"
     gene            <195892..>197439
                     /gene="THI73"
                     /locus_tag="KLMA_80074"
                     /db_xref="GeneID:34718273"
     mRNA            <195892..>197439
                     /gene="THI73"
                     /locus_tag="KLMA_80074"
                     /product="thiamine pathway transporter THI73"
                     /transcript_id="XM_022821805.1"
                     /db_xref="GeneID:34718273"
     CDS             195892..197439
                     /gene="THI73"
                     /locus_tag="KLMA_80074"
                     /codon_start=1
                     /product="thiamine pathway transporter THI73"
                     /protein_id="XP_022678130.1"
                     /db_xref="GeneID:34718273"
                     /translation="MSSVSEFSSSSLSEEEDVARKFLRERKECEDLKGEVECSSSSNS
                     VTQLDEKNTFFGTHELPSKVLRKLDLFVLPFLCLTYLFMFLDKALLNYAASMGIKKHL
                     KGDEFSNLGTIFSASYIFAEPIASFLLQRYPVSRVFGGFIIVWGIVLACHCACKSYAS
                     LMIVRVLLGMFESCSAVGCITVNAMYYTKSEQAQRIGYWAAQAGTGYIIGGLMSFGFL
                     HYHGKEFTSWQIMFLVVGLVTIVFGLCTLFYLPDNVTKAWFFTEEEKAQVIEHIRSNQ
                     TGLETKKIKMHQVRELLLHDKLTWPMLLLTGCSQISTGSIGTFSVTITGTFGFDSYQT
                     ALLQLPIGAVTIMIIIITTQLIGRFSNFTWITTSMFIPAIIGCIVMIALPLSNKIGNL
                     LSLYLLYSGSCTITNIYIWNTCNTSGYTKRLARNALTMIVYNISCIVAPQMFREYSYP
                     RYIPAKISLLVTQCVCVPLQLYIGYISYQENRKRDLEQLESQTKPAQYQFLDQTDIEN
                     RTFRYIY"
     gene            <197782..>198732
                     /gene="CMS1"
                     /locus_tag="KLMA_80075"
                     /db_xref="GeneID:34718274"
     mRNA            <197782..>198732
                     /gene="CMS1"
                     /locus_tag="KLMA_80075"
                     /product="protein CMS1"
                     /transcript_id="XM_022821808.1"
                     /db_xref="GeneID:34718274"
     CDS             197782..198732
                     /gene="CMS1"
                     /locus_tag="KLMA_80075"
                     /codon_start=1
                     /product="protein CMS1"
                     /protein_id="XP_022678131.1"
                     /db_xref="GeneID:34718274"
                     /translation="MSYAADDLDDGLDYAVEEDHVVVEEAEDGDVVESDDNHLENEET
                     DKKRPLEEDKKDDDGEGKTLSKRQKKLAKSSLHQKKLERMEYERSQKKNLPKSSVDQI
                     VEYLATLIREKNPDLSALELDELYFKKQDFLSTERYEKERSLSNFQDFINTFSKAPRA
                     IILSLSNLRVADVYRSVNGHQNAVKLFSKNKFKDDLTRVEDLLGSSSKDAKGNNNNNN
                     NNNKKNNKNNKKGKGAAAADKGKPQDIKYFISTPTRLLKLIENTELFFQGKEKLDIFI
                     DASYLDPKNNTIFTADDFAVLCKVLKEFRKKKSSVKILLF"
     gene            complement(<198823..>200916)
                     /gene="APL1"
                     /locus_tag="KLMA_80077"
                     /db_xref="GeneID:34718275"
     mRNA            complement(<198823..>200916)
                     /gene="APL1"
                     /locus_tag="KLMA_80077"
                     /product="AP-2 complex subunit beta"
                     /transcript_id="XM_022821809.1"
                     /db_xref="GeneID:34718275"
     CDS             complement(198823..200916)
                     /gene="APL1"
                     /locus_tag="KLMA_80077"
                     /codon_start=1
                     /product="AP-2 complex subunit beta"
                     /protein_id="XP_022678132.1"
                     /db_xref="GeneID:34718275"
                     /translation="MSESKVFYKYKAHELRGELASDSGKLKVSMRRKLFLKKVIANLV
                     MGNYFEMGQLFVDVMRVWNSESDLEIKRMCHQYMCTLMPSNPEQLDMILPLILNDLRS
                     NSEALCIIALRTLTTFNEPSYLQEASQNIKKLIMATNDVSVPLRKTALFSLVKLDQKD
                     HERAMELYYFIIDMLDYGKEDPTILVAAATVIDDIHQRHPDMKPFDITHNICFNLMEL
                     LGKINEWDTAKIFDILTVNYVPKSHDEAHQLIEMSVPKLLNLNSSVVLNAMKFIFYVT
                     NYVDSIDEKVLKKLSSSITALLNKPPETQFLVLRNVILLLLAREEPLIKLEPSYFFVE
                     YSDPTYIKDTKLEILYLLADEEHTPHILDELKSQATDIDIQMSKKSIRAIGNLAVKYE
                     HASQYSVDVLLELLEFGVDYISQEVISMLKNVLRKYPNQFSYIVPTVVKYVDSTQDSE
                     SKCAMIWIVTNYYKYLERPLDVFRIFSDNFAEETLEVQLILLNSVVKFFCTHQSKETE
                     KLCLKVLKEATEVNDNPDLRDNAYLYWRLLSLSGNPSETMFNNDVVKDIINGELPIIE
                     INTKLDPAVREELELNIGSILSVYLKPVSQVFRGATPKRLPLSDILNVDKSDLSVISD
                     PSSGNFVGIFSGSESSRKSSSPVKKMSDYDKPAENVIPLKDRKKSSLSVSANKLAKKP
                     SMLVRRLTLKKPFSG"
     gene            complement(<201492..>203678)
                     /gene="SSK1"
                     /locus_tag="KLMA_80078"
                     /db_xref="GeneID:34718276"
     mRNA            complement(<201492..>203678)
                     /gene="SSK1"
                     /locus_tag="KLMA_80078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821810.1"
                     /db_xref="GeneID:34718276"
     CDS             complement(201492..203678)
                     /gene="SSK1"
                     /locus_tag="KLMA_80078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678133.1"
                     /db_xref="GeneID:34718276"
                     /translation="MHETLARMRPSSPLNMHRSVNQGNTRRLWVRLDGNGSGNSGEDE
                     NEGGEFEERQLFNQPTYVDIDVRDLVDDVKGRILGKLSRTHWGQNRDNTSVCLGFYYY
                     SAEALNIVNEPSSGALEQQVKGRALIMTYREYQNLIKRNQIRSGRWSQLHSSFSRFIG
                     RAGSAQGSMLDSSRQEAAADDRAHSIGPGAANGAANGRLSPSAERNNEYIYKVIIEPD
                     MPIMTVYREMFGSIQRSEDALVVFYPKESSYTTPSVGIAMDQQHQQLQQLKISSSSLT
                     NAQMAQAPPSTPIDHRQVLSPATLLDPVHVLTNDAMEQHDKNLKPQPPLARLENEMQL
                     DTTLAPVPIPAPAVLVQDQDQDQDQDQLPLFDGLSLARQNTGILLLPKGVNPEDIESD
                     VMMEMGELKIGQQDGEEEVQQQEHEHEQSLSPHVESHGIGGRMATNHYAFSSETPLTE
                     EEVGLSLSKTLSYQELPKPMSRMTTPSLDKQDELPRYKVFPRINVLIVEDNAINQAIL
                     ALFLKKNGISYKVAKDGVEAIEKWKEGDSHLILMDLQLPKLSGLEATKRIRELERINE
                     VGLFGHKPKRPKVSPSSSDEKQETDPHHDQDQDQDFDSDRPNTVELNEDTKLDKSKFR
                     SPVIIVALTASYEQSDRTAALLAGCNDYLTKPVNLDWLGKKLTEWGCMQALIDFDGWN
                     NGQRRMTDNIILRPKLSIARKSQNTSSRSVPRAGSTPIGLDHATTN"
     gene            <204354..>205391
                     /gene="NSE1"
                     /locus_tag="KLMA_80079"
                     /db_xref="GeneID:34718277"
     mRNA            <204354..>205391
                     /gene="NSE1"
                     /locus_tag="KLMA_80079"
                     /product="non-structural maintenance of chromosomes
                     element 1"
                     /transcript_id="XM_022821811.1"
                     /db_xref="GeneID:34718277"
     CDS             204354..205391
                     /gene="NSE1"
                     /locus_tag="KLMA_80079"
                     /codon_start=1
                     /product="non-structural maintenance of chromosomes
                     element 1"
                     /protein_id="XP_022678134.1"
                     /db_xref="GeneID:34718277"
                     /translation="MSESPSITPRMSQGAYGTPEDTSNGGHSAVVSVSDLDVRRCLMQ
                     FILQCNGVVSESWLLSCFLALEYDAKRLSRGDVESLEPWRQKLGEHIRALNVQLRLMN
                     YKIAIINHPMGRRYVGRNFQNPVQDLVDTNWTESGKLYVYVNLKYDGQLTLATLFSAK
                     EIAFVKWAIEMMFTSGSYAQPFERGDYGDGNGNGNGDEDAVVNEVDQVLREKYGDMEY
                     KGLATFVSYRIGSGALMHTEQIPPSRIEQILAELYEKKWVNRYPDGKIGLAVRFMVEM
                     KDYLVENFDIPLCITCKEVVLQGVICLNCREEFNHGWHVGCLAHHVQHVNEKCPSCNT
                     SLQESCAYVLG"
     gene            complement(<205486..>205998)
                     /gene="PAM18"
                     /locus_tag="KLMA_80080"
                     /db_xref="GeneID:34718278"
     mRNA            complement(<205486..>205998)
                     /gene="PAM18"
                     /locus_tag="KLMA_80080"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM14"
                     /transcript_id="XM_022821812.1"
                     /db_xref="GeneID:34718278"
     CDS             complement(205486..205998)
                     /gene="PAM18"
                     /locus_tag="KLMA_80080"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM14"
                     /protein_id="XP_022678135.1"
                     /db_xref="GeneID:34718278"
                     /translation="MAQQNLEIPQLPIPGEDNSKRVAEQVAIGASGVQSTPGGPVGGP
                     VSSQKSGMDLYFDQAVNYMGEHPVISGVGGFFALYFAAGAYKSISKRMGGGAQSSQFL
                     KGGFDPKMNAKEALAILNLNESTLTKKKLKEVHRRIMLANHPDKGGSPYLATKINEAK
                     DFLEKKVVRK"
     gene            <206495..>207103
                     /gene="RLP24"
                     /locus_tag="KLMA_80081"
                     /db_xref="GeneID:34718279"
     mRNA            <206495..>207103
                     /gene="RLP24"
                     /locus_tag="KLMA_80081"
                     /product="ribosome biogenesis protein RLP24"
                     /transcript_id="XM_022821813.1"
                     /db_xref="GeneID:34718279"
     CDS             206495..207103
                     /gene="RLP24"
                     /locus_tag="KLMA_80081"
                     /codon_start=1
                     /product="ribosome biogenesis protein RLP24"
                     /protein_id="XP_022678136.1"
                     /db_xref="GeneID:34718279"
                     /translation="MRIYACHFCSSPVYPGHGMMFVRNDAKEFRFCRSKCHKAFKQRR
                     NPRKLRWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQR
                     RERAFYKNRMKGNKERDFLRDKKLVESNPELLRLREVEMARRAAKEEERQQMEDGESE
                     MEDDDEMDIESESEAESEAEEQLEKQKILLKNKKKNAKKIAF"
     gene            complement(<207355..>207783)
                     /locus_tag="KLMA_80082"
                     /db_xref="GeneID:34718280"
     mRNA            complement(<207355..>207783)
                     /locus_tag="KLMA_80082"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821814.1"
                     /db_xref="GeneID:34718280"
     CDS             complement(207355..207783)
                     /locus_tag="KLMA_80082"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678137.1"
                     /db_xref="GeneID:34718280"
                     /translation="MSQIVTDLSTIPIKINEHAGETFLRLRIFAQFQSISGTDVSSTD
                     SIYLKVTNVPGFGGSQGQAQAQEFSFLIDETIYDEMFIRNRSRRPHRGDILDLRCCYR
                     KYDDVIEIMHLKQVSIADLDALRQFVMKSHDDSAIHSFLH"
     gene            complement(207957..208038)
                     /locus_tag="KLMA_R809"
                     /db_xref="GeneID:34718795"
     tRNA            complement(207957..208038)
                     /locus_tag="KLMA_R809"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:34718795"
     gene            <208331..>209815
                     /gene="AHC1"
                     /locus_tag="KLMA_80083"
                     /db_xref="GeneID:34718281"
     mRNA            <208331..>209815
                     /gene="AHC1"
                     /locus_tag="KLMA_80083"
                     /product="protein AHC1"
                     /transcript_id="XM_022821815.1"
                     /db_xref="GeneID:34718281"
     CDS             208331..209815
                     /gene="AHC1"
                     /locus_tag="KLMA_80083"
                     /codon_start=1
                     /product="protein AHC1"
                     /protein_id="XP_022678138.1"
                     /db_xref="GeneID:34718281"
                     /translation="MTENRSSQQQQQVLFMDGDEVDPLTGSNHSMTNHTATYYQVATP
                     KSPHELSSLAENEDDPAQDAERLKFVKAKKDILDQLNLQIMLTHKEMEHLIEENEQVS
                     GQLEVLKILHGDSKLSEKVEAFQEKRAKEVEESIRSGLSRQGSRQSQDATGSGYYYHT
                     RSKSGSNVSGLRLANDNVIDIRMRGAKTLPQQQSDTSVSTGHSTPGVTPPGSAGSVQP
                     GVISKIPYHNHQRNFSSTCATSNSGVVGTTEGGQPIFRRPDGVLIIITCSVCKREGFT
                     SAQGIVNHMRLKHFLHYQSQPLAVLSNQVLLPDDKQDPEILAKFKEKNKSPTDSYLSS
                     TVPLPNNEKRQHGKETVSSVSTGFESANGSSQASTASSSSSSDTLQQSTAHLQKLYPK
                     DDFKEIINYVKEAKTDLETIMKCEDEEAAAAAAAVGTAGAASEEESKPRKRSLANERA
                     RPAEKKARPDVIHVTENYIPEEDKRSRHYNLRAKSKLRSHNRDD"
     gene            <210131..>212089
                     /locus_tag="KLMA_80084"
                     /db_xref="GeneID:34718282"
     mRNA            <210131..>212089
                     /locus_tag="KLMA_80084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821816.1"
                     /db_xref="GeneID:34718282"
     CDS             210131..212089
                     /locus_tag="KLMA_80084"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678139.1"
                     /db_xref="GeneID:34718282"
                     /translation="MINGVLVFRTSRRYFSSRWFYAIDIPKTKPFEPSYVPATAPTKF
                     QPFSKVDSKRIEENYVRGRLSKRVDVNEDHLFEVNLQDFSMNPIYWEGPSYEIRRGIW
                     FDDQNNPLTHELTNYVEDLYRKWLARGGRGSPGDIGPEKKNADDDDHEQEVLDTFRLP
                     KGSRWKYIMFTEDNKTAFLLPDVYGGNLHLNLLRSSVAQLVQIGASKITRGYEQKSVS
                     LKGKAKELEGQVLDHAIGLSKISDMISWEFKDLMNASNAQGVVNSNASQNASGMMKDE
                     ISKDYQNNDGGERSHYRRIKHLVFCVHGIGQTLGKKYEYVNFAHTVNLLRNNIKSLYQ
                     SNGQLQELNALNEFPDPKNNSAIQVLPITWRHAIGFSTDDANVNTDNEDLPTLNDVTV
                     DGIKPLRKLLADIGLDILLYGDNYYVDKILKYVCAELNSVYEKYCDHNPEFDGKVSLL
                     GHSLGSLILFDMLSQQSKYRLNFEVENFFTIGSPVGVFKLIQRTKIGESDSLLKQQTP
                     ACKNYYNLYHPCDPVAYRVEPLIEKSMAKYEAKWISHANGSDFIADTVKNLILDKNSK
                     KKEQMSSRVLKRMLQFNDNGRVDYSFQPNLLDVDVWSAIKSHVSYFEEMDTAGFLLKE
                     LLKKHVKAKSCEVTVLKSTETTQDTGKS"
     gene            <212339..>212977
                     /locus_tag="KLMA_80085"
                     /db_xref="GeneID:34718283"
     mRNA            <212339..>212977
                     /locus_tag="KLMA_80085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821817.1"
                     /db_xref="GeneID:34718283"
     CDS             212339..212977
                     /locus_tag="KLMA_80085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678140.1"
                     /db_xref="GeneID:34718283"
                     /translation="MKYIIEHMEQGFSEWVTLEYAQIIRDIGAENLIISSLPVGTKES
                     DIPEKLRAMGLQWTTANLDKINEAFPELPALKSQRVCLLDPRAKTDLVPADAQQYDYF
                     VFGGILGDHPPRDRTRELMEQYPDLLVGKRLGDKQMTTDTAIRTTQIIIEKQTKFEDI
                     KFIDYPEFRFNKNEATEMPFRYVLNSEGKPILPEGMLELIKRDSEQSLDDLF"
     gene            complement(<213135..>213362)
                     /locus_tag="KLMA_80086"
                     /db_xref="GeneID:34718284"
     mRNA            complement(<213135..>213362)
                     /locus_tag="KLMA_80086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821819.1"
                     /db_xref="GeneID:34718284"
     CDS             complement(213135..213362)
                     /locus_tag="KLMA_80086"
                     /note="containing DUF2611 super family domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678141.1"
                     /db_xref="GeneID:34718284"
                     /translation="MGAAYKIFGKNVQPHVLAITTLATVIGGTAFALSGPKKAENPVA
                     TATPAAATAGSNSDDIDVEKLLGDFLKEESK"
     gene            <214182..>214499
                     /gene="HSP10"
                     /locus_tag="KLMA_80087"
                     /db_xref="GeneID:34718285"
     mRNA            <214182..>214499
                     /gene="HSP10"
                     /locus_tag="KLMA_80087"
                     /product="10 kDa heat shock protein"
                     /transcript_id="XM_022821820.1"
                     /db_xref="GeneID:34718285"
     CDS             214182..214499
                     /gene="HSP10"
                     /locus_tag="KLMA_80087"
                     /codon_start=1
                     /product="10 kDa heat shock protein"
                     /protein_id="XP_022678142.1"
                     /db_xref="GeneID:34718285"
                     /translation="MSTLLKSAKSIVPLLDRVLVQRVKAEAKTASGLYLPEKNVEKLN
                     QATVLAVGPGFTDSNGNKVTPSVKPGDQVLIPQFGGSTIKLGKDDEVVLFRDSEILAK
                     IVE"
     gene            complement(<214617..>215903)
                     /gene="PRP3"
                     /locus_tag="KLMA_80088"
                     /db_xref="GeneID:34718286"
     mRNA            complement(<214617..>215903)
                     /gene="PRP3"
                     /locus_tag="KLMA_80088"
                     /product="U4/U6 small nuclear ribonucleoprotein PRP3"
                     /transcript_id="XM_022821821.1"
                     /db_xref="GeneID:34718286"
     CDS             complement(214617..215903)
                     /gene="PRP3"
                     /locus_tag="KLMA_80088"
                     /codon_start=1
                     /product="U4/U6 small nuclear ribonucleoprotein PRP3"
                     /protein_id="XP_022678143.1"
                     /db_xref="GeneID:34718286"
                     /translation="MSGNKEDPSRRKGRGLNRELHSVLTLDNVNLLKFQGRRGGNPYL
                     QDLQQGPVPKKRVSSHWYAPGEVVSHAEELRRQEAERLEEEKRSQEVQRQQELEHARL
                     VEAGEIPAKHEEVYLKDLSEVPEVEWWDLPFIGSDGQPHKKYAMDYSGLDPEEESDSE
                     EEADEDMYPSIRYIQHPVPIEKPRDTAGMTARIFLTKKEQRKARRNNRKLLRQEKEEK
                     IKLGLEPKPEPKVKLANMMSVYENDANVADPTQWEAIVRQQVADRKRKHMEENERRHQ
                     ESVKRRKQASDSSSSSSSLHEYTCVVYMFDEIKNPSVRYKLKMNAKQLKLKGCCLHID
                     DGRGILIALGDEKSIRFFDKLVTRRINWNESYTDKTTNEVVHWNGNLKKVWNGLIGPD
                     ECKFRGWFMLKCNDSNQLTDVLRQQDATVFLPSGVF"
     gene            <216787..>217239
                     /gene="TMA17"
                     /locus_tag="KLMA_80089"
                     /db_xref="GeneID:34718287"
     mRNA            <216787..>217239
                     /gene="TMA17"
                     /locus_tag="KLMA_80089"
                     /product="translation machinery-associated protein 17"
                     /transcript_id="XM_022821822.1"
                     /db_xref="GeneID:34718287"
     CDS             216787..217239
                     /gene="TMA17"
                     /locus_tag="KLMA_80089"
                     /codon_start=1
                     /product="translation machinery-associated protein 17"
                     /protein_id="XP_022678144.1"
                     /db_xref="GeneID:34718287"
                     /translation="MVTATGIRRPVQIQEFSVAIREASNDELEKIRSEINNAVRHLER
                     SNTRLAAYIKKLKGEEVNNRQELDLDGNFSDDEIDEKDLNVFQESLAENEKVLSNYHE
                     RLNAIDQEELHRSSSSKVPETTGSGSAQDKSNAIDSDNTAYEPNSIYL"
     gene            <217817..>218608
                     /locus_tag="KLMA_80090"
                     /db_xref="GeneID:34718288"
     mRNA            <217817..>218608
                     /locus_tag="KLMA_80090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821823.1"
                     /db_xref="GeneID:34718288"
     CDS             217817..218608
                     /locus_tag="KLMA_80090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678145.1"
                     /db_xref="GeneID:34718288"
                     /translation="MRMLLFAAWLALCVTRVVCESIKVPINPTRLEFDLWPYKKWEID
                     NASNSSDYMTCFEMSTPFKSRDLQFVIEIEEFTKWKVNVDRFGPTTSSKGKQIINLDI
                     YDKDKNLVRSRHGLENGETILYESVYEQQEFQFCLINFSLDSSWNAIDTIKQVSISIS
                     SNDIVKQQPWDLITDQSLELLSESKEDLYSLVNAESGHKLVELDAEHRDLNEGTFSCI
                     IYQTVGILTVIIVGQFVVVPAFLYRLLRKNKHGQTHPHIKNKLKE"
     gene            <218986..>219780
                     /gene="RRP42"
                     /locus_tag="KLMA_80091"
                     /db_xref="GeneID:34718289"
     mRNA            <218986..>219780
                     /gene="RRP42"
                     /locus_tag="KLMA_80091"
                     /product="exosome complex component RRP42"
                     /transcript_id="XM_022821824.1"
                     /db_xref="GeneID:34718289"
     CDS             218986..219780
                     /gene="RRP42"
                     /locus_tag="KLMA_80091"
                     /codon_start=1
                     /product="exosome complex component RRP42"
                     /protein_id="XP_022678146.1"
                     /db_xref="GeneID:34718289"
                     /translation="MSLSIAEKSFLYDSLALNPPLRPDGRALHQFRPVEVSTDFLPNS
                     NGSSRVILSGGSECIVSVKAKVVDHTVESELLVVEVDIQGHRDDSPLVQSMSSLLSKL
                     LKQTINSDKLMLTKRYSFKLFIDVLVLASKSYPVSMISFAIFSALKNTWLPKLISNDD
                     DLEVEELPTFHDYDMVKLEADAPLLFTFAIVGDNVLVDPTYEESLVSNNGLVVTWYQN
                     EVRSPIRSVGLNDDSTKGFKQAHLEKAFEVIRQYAPDVEKALESSN"
     gene            complement(<219866..>224086)
                     /gene="TRM3"
                     /locus_tag="KLMA_80092"
                     /db_xref="GeneID:34718290"
     mRNA            complement(<219866..>224086)
                     /gene="TRM3"
                     /locus_tag="KLMA_80092"
                     /product="tRNA guanosine-2'-O-methyltransferase TRM3"
                     /transcript_id="XM_022821825.1"
                     /db_xref="GeneID:34718290"
     CDS             complement(219866..224086)
                     /gene="TRM3"
                     /locus_tag="KLMA_80092"
                     /codon_start=1
                     /product="tRNA guanosine-2'-O-methyltransferase TRM3"
                     /protein_id="XP_022678147.1"
                     /db_xref="GeneID:34718290"
                     /translation="MTSSKEILGRYITVGVQEEILLGLIEDADYDGVASIIGTIKLAD
                     GVAENVGKKMCEKLEESLLSFVSVDDDADRQEDEVKQLWKLLGVCVQLQGSRDFVIEY
                     LSGILLAFIDSGKNHLFYGGSSADLAATRACAMERKSNIDVNKSLDGTKILEVIENLV
                     LQMGTQDEVEHTIGSDSSIGNLLFLLSVCKEEQLANKATSLFKWWVPAFSNTCQRDSQ
                     FDNDVWGLVESTLQDSNMTSSAATVRNVFVFWLRMLLENGFSDASRAFVQKNEYWRII
                     QYGLGHEVHEIKKVVLSIMRLSLKLIRQESMSVDCSLLVFSGEETQMNSWKRFTTIYE
                     IVGIDTALNQCEAAAPDILDTFQDENIHASWGLIILSTGLRATMESVRKFTLRLMLQI
                     ENKNVFQSNLSLLQTVFLPATMQASFFNVSGDRCNYADALVEFVSEIVQTSVDKEAIS
                     QLILQTLYDCRTMFDAARVFIAYGLLSGLQKNKSRILTSESVSMIKLLFMGECEESVL
                     QTTMQCTLLKLLLYTNISAFEFLQVLVAHVKSVDTYEYATSVIGIFRDFCIVNYPQGL
                     EVHEVPQEPLYQVFAYELFDTQPLEFSNEFLKELIKSGSNCSNLSEKYHSFLTELVDM
                     KTVDYKDSKVVLDLEQFTPPVYSAINPLPLLQALLDQFDAAKFDFFVALFSKVMQSTS
                     TLTLSFDQLIAIYDVIKQHVSSHNQSSFRYKDEIYANFFKLAGVCIKSTHLDDNQIEE
                     LITLIIKNVDNDNGNYAGNLEVSYLCQSILDLYVLPTLHTLSGKEERIVERILGLQCS
                     MWDSLIEERLVLNQQPLHLAIIKGIFHHAVFLAALSDEFTFSLLLKYGNAILDQSFSR
                     RTLKPCLSHQIVSFMELYGKSLPDRDYSDFVTLLVNIFIHESMNLNIFTLKPVIAKLY
                     DKKLRLYVQGGLYKHIYGDDEIVTRANIVKSLLLSTKEFKQHFLMSMLENDRNILKAK
                     KKTDGPEEIQRLLKWQLCLLSIKSVNNKTLTELCAEYIIPSLVGESSPLVRVYSEWFV
                     AYNIWQSHEEGTENPNEETLLGLLEDSSRPAVQTSIERLLFLAVKASKESGKFTSLTE
                     KFLAQLVTNCSSNKPLIRHFSNSLMLLFWPTFQDDIKDDTLKSVIFKLYSDAKKIQVQ
                     GQFRAGDANTWSILDDLKLTSIFGGVLLKIMDHDVPYIPSKVFNQVNIQEDEYPVGSE
                     ENQLWLSKRNNNVASKTELQKNSPLQTKSGAWEVVLDFDNEKSAENVKRSELIVIASL
                     VDKAPNLGGICRLCDVLGVGTMTVHDIRVKQHPQFKNVAVTADNWMPIEEVPVDQIVT
                     YMNTKKLEGYTLIGLEQTDSSIELNSEYRFPSKSVILLGTEAHGIPGHLLKELDLCLE
                     IKQSGVIRSMNIQTATAVIVHSYSIQHL"
     gene            <224564..>226363
                     /gene="ATG20"
                     /locus_tag="KLMA_80093"
                     /db_xref="GeneID:34718291"
     mRNA            <224564..>226363
                     /gene="ATG20"
                     /locus_tag="KLMA_80093"
                     /product="autophagy-related protein 20"
                     /transcript_id="XM_022821826.1"
                     /db_xref="GeneID:34718291"
     CDS             224564..226363
                     /gene="ATG20"
                     /locus_tag="KLMA_80093"
                     /codon_start=1
                     /product="autophagy-related protein 20"
                     /protein_id="XP_022678148.1"
                     /db_xref="GeneID:34718291"
                     /translation="MPKVKLGSQEDEFSTKNGEEYGSEGSQEQDAIHTRIVRKDNPFF
                     SDNDEADGEVDSEEQLLNRGRNGRSRSFNSNGNGSSSNGNGSRRRSSGTTSKDSSPDV
                     PFQNRESGDGSRSSSDSSRSSKKAQILEASKVSEGQGRTYIAYAIKYKDSVVKRRYSD
                     FESLRKVLVKLFPMTLIPPIPEKQSLKSYGKAITHSKTNYLLPMESGDSVDLSLSVIN
                     GPVTSNDEKLIRHRIRMLTSFLNRLLRNEEIMKTSIVYDFLDPNNKNWNDLITSSLTI
                     SSLPKSVLQCNPIDPTNTTKAHTYLPIPSSSNQLLSSKDHNNPTDTDEFSKVEAEYKH
                     YEQLLHSGMYKYSRATTKELNHVREEMKGISSQLAQFSVDEAKYDNGLAELLSHSSDT
                     YDALYDNLETLVGNLHYNINEPLGECAHMATAVRELIQYRRLKMVQKELLERSILYKR
                     AQLKKFQQQESNNKQIGDMVNKDLATSGTVNLENPNGPRSYTGKMMNKFNQIASIIKD
                     TVTYPEQDPATAVKTLEKELAQLEESLKVATSDLVVITKTLKDNELPRFTKERNEELI
                     QIFKNYSKYMKENAIKNLKVWKELQQKMQEEEA"
     gene            complement(<226631..>227437)
                     /locus_tag="KLMA_80094"
                     /db_xref="GeneID:34718292"
     mRNA            complement(<226631..>227437)
                     /locus_tag="KLMA_80094"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821827.1"
                     /db_xref="GeneID:34718292"
     CDS             complement(226631..227437)
                     /locus_tag="KLMA_80094"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678149.1"
                     /db_xref="GeneID:34718292"
                     /translation="MLSDFHTKVVERITSHVGVPLCPQRDLVLITGGSKGVGMELAQL
                     FDTLHYKVVILDRRYPEDLRSCKNVSFYKCDVSDFEFTNVILDDIRLKFGIVSIYVNA
                     VGLKVITDKDIRGEFHMTSLMKSVYVGNLNILQSIVPNMIRQKRGYIVDIASTEGVFT
                     TSGNGFYGCLQATKFQLHQGLVEDLSKQFVVSKYFGNGSVRCLLMVSSKPLNVTAKHD
                     IQHARYISNAMFHNRQGITGASVVSNLKLSFRDVDWHWYQLLKHLLPKVK"
     gene            <227711..>228835
                     /gene="IWR1"
                     /locus_tag="KLMA_80095"
                     /db_xref="GeneID:34718293"
     mRNA            <227711..>228835
                     /gene="IWR1"
                     /locus_tag="KLMA_80095"
                     /product="putative transcription factor IWR1"
                     /transcript_id="XM_022821828.1"
                     /db_xref="GeneID:34718293"
     CDS             227711..228835
                     /gene="IWR1"
                     /locus_tag="KLMA_80095"
                     /codon_start=1
                     /product="putative transcription factor IWR1"
                     /protein_id="XP_022678150.1"
                     /db_xref="GeneID:34718293"
                     /translation="MAENDRVNDRISGVECIRVKRRRDEDSVKALLLEEERNAKKGKF
                     VFKLSKTVELESRSDDSKSPLLKLSGTRSDKKMVYVLERGQERDQEGDSGSNQQADQQ
                     ELPESIAEMLNDYLKIKPSPSSQQPAKKRKASRKHSVTSSSITEPTLPTSDYVYDVYV
                     KESIPEDEDEFVFDGSTIGYIRIVEHSGDLIPEEDEDPEKTMLTDDEDSNEEDYYQND
                     YPEDEDDDRSIVIGSDEDFSNSEDVVYLDQVDVDGYQDGVPDDEQQDDEFESLFQTYG
                     NSSNLLSSLNAHNYVDLDYDDDDVDDNVPDGYDYDGDYTNGTANHGTTNHNHVTNQSR
                     DTDDSDLEQRHIFFPSDEHDETAIHRDRIFNKLQNMIDKS"
     gene            <229316..>229891
                     /gene="RPL9B"
                     /locus_tag="KLMA_80096"
                     /db_xref="GeneID:34718294"
     mRNA            <229316..>229891
                     /gene="RPL9B"
                     /locus_tag="KLMA_80096"
                     /product="60S ribosomal protein L9-B"
                     /transcript_id="XM_022821830.1"
                     /db_xref="GeneID:34718294"
     CDS             229316..229891
                     /gene="RPL9B"
                     /locus_tag="KLMA_80096"
                     /codon_start=1
                     /product="60S ribosomal protein L9-B"
                     /protein_id="XP_022678151.1"
                     /db_xref="GeneID:34718294"
                     /translation="MKYIQTDQTLDIPEGVTVQIKSRIVKVTGPRGTLTKNLKHIDVT
                     FQKVSNKQIKITVHNGDRKHVAALRTVKSLISNLITGVTKGYKYKLRYVYAHFPINVN
                     VIEKDGAKFIEIRNFLGDKKVREVPVREGVSVEFSTNVKDEIVLTGNSVENVSQNAAD
                     IQQICRVRNKDIRKFLDGIYVSEKGVVVEEE"
     gene            complement(<230127..>232295)
                     /gene="NUP84"
                     /locus_tag="KLMA_80098"
                     /db_xref="GeneID:34718295"
     mRNA            complement(<230127..>232295)
                     /gene="NUP84"
                     /locus_tag="KLMA_80098"
                     /product="nucleoporin NUP84"
                     /transcript_id="XM_022821831.1"
                     /db_xref="GeneID:34718295"
     CDS             complement(230127..232295)
                     /gene="NUP84"
                     /locus_tag="KLMA_80098"
                     /codon_start=1
                     /product="nucleoporin NUP84"
                     /protein_id="XP_022678152.1"
                     /db_xref="GeneID:34718295"
                     /translation="MDIDLGRSQEAHVKFGQVLKDYQSELLKENTSVNPFNIVNEFRA
                     IASEEALNLVGSSDDKDKIEFENWELEAKLWDLVSLLVEYRTSDIAQEDINVHSYNSN
                     VVYQRQLLQSNKGLYEIWLIKSWLESNMRVPERPASLATTKWTNSMLAGTISSMDSDS
                     TLRDPSAQVQPEDRKNDHEFFVYAFRLLLSGQFEKLTEECQYTDNLTLNLILRGMETY
                     LDPQIDSDMADEYASQQGIKKHALWRRSVYALSQDSRLDPYEAAIYTYLAGDSPNNLR
                     IDDLDWETELLMYLNQIWNVTMENYLLEHGRVDKTELICSMDTTCPSLSHVLNVLASK
                     YPNESEHPIRILAASVLLNTTGSVLQSSTEMLLDVITGEDQDNALFNESYILRVLTNL
                     TVFFDIVCPEVVDASSKSNLLTTYISLLSYHKLYDIVPVYVSFLSDDEILETYSFFLS
                     NLVDTDIREKQVKLSKYLGLPIANILRRTAQRVFEETEEYYTVNNDVELTNEISEFDQ
                     RLINGVDWLIQNELYLDSVDTIIALSRRFLINGKVKALELFIDGHDMPNILKEYQLEK
                     LSMKEEGRDFKIEELQQYMSLISTFKRQEDWERTSETFNTTDNLSLFIKQFKEYSDTI
                     INLVTKFLVDLLSNENVDDSDVLYEIRALYTPFLIMELHNTLIRASEKHNVSTFIQEA
                     IDLSILVANETDKIYLLFQSNDKLTTYLQMVAKAAALFGK"
     gene            <232938..>234068
                     /gene="ARO2"
                     /locus_tag="KLMA_80099"
                     /db_xref="GeneID:34718296"
     mRNA            <232938..>234068
                     /gene="ARO2"
                     /locus_tag="KLMA_80099"
                     /product="chorismate synthase"
                     /transcript_id="XM_022821832.1"
                     /db_xref="GeneID:34718296"
     CDS             232938..234068
                     /gene="ARO2"
                     /locus_tag="KLMA_80099"
                     /codon_start=1
                     /product="chorismate synthase"
                     /protein_id="XP_022678153.1"
                     /db_xref="GeneID:34718296"
                     /translation="MSTFGQIFRVTTYGESHCKSVGCIVDGVPPGMSLTEEDIQPQLT
                     RRRPGQSKLSTPRNEKDRVEIQSGTEFGKTLGTPIGMLVKNEDQRPHDYSDMDNFPRP
                     SHADFTYMSKYGIKASSGGGRSSARETIGRVAAGAIAEKFLKQVSNVEIVAFVSQIGS
                     IKMNRDAQDPKFQHLLNTITREKVDAAGPIRCPDSSVSEAMVKEIEKYRGEKDSIGGV
                     VTCVIRNVPVGLGEPCFDKLEALLAHAMLSIPASKGFEIGSGFEGVSIPGSKHNDPFY
                     FDEETKRLRTKTNNSGGIQGGISNGENIYFSVPFKSAATISQEQPTATYDGKDGVLAA
                     KGRHDPSVTPRATPIVEAMAALVLADAFLIQKSREAAFSIVS"
     gene            <234676..>237192
                     /gene="CYK3"
                     /locus_tag="KLMA_80100"
                     /db_xref="GeneID:34718297"
     mRNA            <234676..>237192
                     /gene="CYK3"
                     /locus_tag="KLMA_80100"
                     /product="cytokinesis protein 3"
                     /transcript_id="XM_022821833.1"
                     /db_xref="GeneID:34718297"
     CDS             234676..237192
                     /gene="CYK3"
                     /locus_tag="KLMA_80100"
                     /codon_start=1
                     /product="cytokinesis protein 3"
                     /protein_id="XP_022678154.1"
                     /db_xref="GeneID:34718297"
                     /translation="MAQPLPVSFTVKTNFAWSGEKKDDLGFLEGDYIDVTKVAGDWYY
                     GRLIRNKKQGYFPSNYVTILEEKYNNHVPSKQAIQQQQQKKQQHKQRLPYREEELASR
                     SFERYPGHTSSSPNIRNNVGFSLRKSHTNEELTTYSQGKRFSADVIPTVPEYGNRKYV
                     VSQSYSTSNLASVNNRSGRSRDIPSQPPLPPIPKSPSMPMFNNNMSSRHSFQSMSDRS
                     TDSFGKYSNTKYMEDSLASSEESFAIMSDFSATSAGSFARHNLARSFQDSLDRSIVSE
                     SKDTTGNGASSGGHPLKESKFGDMFKKWLPKSNNDYNNGNKDYPKLPNIQNLNISSNN
                     HDANSWMEAEAQLRRAVTITANERRERGMRATSKNVDLLLYPHSVVNKDLYSNEVLHT
                     RQPGIVDEFLAAADFKKVDRSARQLFKEKLPAQLSVESFAQYSFPSQYFTPLEQLRGL
                     FTFCTELFRLIDDNGKTDFNKPPENLEKVLERRYCTPYELTWLFKRMSRALKINSEIV
                     FGFLKTPHADNTTFKLNHCWLQVCFYEEWRFVDVILGNVTNPIHEYLNNKPAKRCESF
                     YFLTSPMNIINTHVPREYSKQHIAPELDLNIILSLPVVFPSFFKNRLRLYRFSNGLCD
                     LEDNEIFECTLRIPNDIEVFSNVVVDGDNSLEYRTMNLSLVQVLSHNKRNAVIKAVLP
                     PGASKGTLYIHSGVKGTQTSIENVHPISMIVPLTSSGTSSSFEFVSRIPSESVQRVEI
                     YIKEPQNKYLSCKRKYKFEIIQNPADGIIHQSMERNLSRSMLILSPSGKHYKLSKNDP
                     HLPFGTWSAPIEVNETGRWSAMVTSDTGSGWCEFAQWESS"
     gene            complement(<238033..>239748)
                     /gene="ywtG"
                     /locus_tag="KLMA_80101"
                     /db_xref="GeneID:34718298"
     mRNA            complement(<238033..>239748)
                     /gene="ywtG"
                     /locus_tag="KLMA_80101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821834.1"
                     /db_xref="GeneID:34718298"
     CDS             complement(238033..239748)
                     /gene="ywtG"
                     /locus_tag="KLMA_80101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678155.1"
                     /db_xref="GeneID:34718298"
                     /translation="MSSSSISEKIAVNELERKDTGLLKEMSSSSNSVHEVEAGFKVGE
                     DEEVYVISEEQIREQMKIYEDDIANRPLSATLKQRFVRLELVEVNFKNKRNMVLMLGT
                     FAAFAGILSGIDQSIISGASIGMGKTLHLTSHENSLVSSLMPLGAVAGSILLTPLSEY
                     LGRKFALVVSCIFYTIGAILCAAAHSVHTMYAGRFLIGVGVGIEGGGVGVYIAESVPS
                     SVRGSLVSLYQFNIALGELFGYLIGVIFFDVKGGWRFMVGSSLVFSTILLVGLFFLPE
                     SPRWLIHKGHSTEAYKVWRRLRDISDLSTMREFLEMQQAAEQDKELKKHESKYQSMFD
                     LVRIPRNRRALVYAIMMVSLGQLTGINAIMYYMSTLMKHIGFSQKRSVAMSMVGGAAL
                     LLGTIPAILYMDRFGRRPWSMTILGFIIGLILVGIGYKINLKTHLAAAEGVYLSGQIL
                     YNMFFGTYATLTWVVPSESFSLATRSAGMTVCSAFLYLWAFTVTYNFNRMQQAFTYTG
                     LTLGFYGGIAVVIGIPYQLFFMPETKDKTLEEIDDIFNMPTRKLVAQNARNLRDFFAG
                     KRKSI"
     gene            <242146..>246585
                     /gene="INO80"
                     /locus_tag="KLMA_80102"
                     /db_xref="GeneID:34718299"
     mRNA            <242146..>246585
                     /gene="INO80"
                     /locus_tag="KLMA_80102"
                     /product="putative DNA helicase INO80"
                     /transcript_id="XM_022821835.1"
                     /db_xref="GeneID:34718299"
     CDS             242146..246585
                     /gene="INO80"
                     /locus_tag="KLMA_80102"
                     /codon_start=1
                     /product="putative DNA helicase INO80"
                     /protein_id="XP_022678156.1"
                     /db_xref="GeneID:34718299"
                     /translation="MYIDKVVNREENRVVGVAEDLKRKWELRMARICERDDREMDYQN
                     WKFLSYQEFELINEWNQQGKELTKDGCVKLLANMKQTHQEWEDYQKVKEQKDSIIEEL
                     KESIQIIKQEPAVPSNSNSNSNSTSDGGDKNTNDDDDENHHHNHRENGFGGVGKTAGK
                     SPTKSPAGSPVPSSGSTPNKRRARPANANANHRPKRPSNLSKSVRNRNSSKDTETSVS
                     KKRRTPASAANESNTPRKRPASASVSSSPSVARKGGSKSSPLTPDSAKNAEDADLSQA
                     EEDNLSSSMADDEDLSHKNTEEPQDEEEEEEGEGEGEDDDEEGEGEEDEAAAKAEEDV
                     DEEEDDIDDIKVPEDDGDDDDFAPSYSAISKVKVNKKVTLDSPMPAIQKELRKMAIKS
                     SIAKAMKRKFTNCKVQTYAPDTELEIKITLKQLHIRKYKRHLAEIERKRKAEEAALKA
                     EEEAKKRKLAPPPPPPQQVKSKDHDLPTYGMKITLKEARAIQRHYDQTYITIWKDMAR
                     RDSGRISRQLQQIQSIRSQNFKKTSSLCAKEARRWQMRNFRQVKDFQTRARRGIREMS
                     SFWKKNEREEREMKKKAEKEALEQAKKEEEERENLRAAKKLNFLLTQTELYSHFIGSK
                     IKTNELEGNMTDESLAAMQNNNKNKGIDISKTAASKTDIQSIDFAEEDDDNLTLMAAQ
                     NASNALRETQEKARKFDEEDEADGELNFQNPTSLGEITIDQPKMLACTLKEYQLKGLN
                     WLANLYDQGINGILADEMGLGKTVQSISVLAHLADRYNIWGPFIVVTPASTLHNWVNE
                     ISRFVPQFKILPYWGNANDRKTLRKFWDRKHLRYGKDAPFHVMVTSYQMVVSDANYLQ
                     KMKWQYMILDEAQAIKSSQSSRWKTLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMP
                     SLFDNHDEFSDWFSKDIESHAESNTELNQEQLRRLHMVLKPFMLRRIKKNVQSELGDK
                     IEIDVLCDLTFRQAKLYQILKSQVSGGYDAIENAAGADDVTSDQKLVNLVMEFRKVCN
                     HPDLFERADVSSPFSFVSFGESSSLLREGDFVEVNYSAKNLINYKLPRLIYDEFIVPN
                     YNNDVDVRAKLLYHSMNIFHPSNSIELCNTLSKLTGMSASTFTKLLEKDVINRAIDLA
                     RENNSIMEKCEVAYDHGEKALPSCLLISNKLKYMDHLKNVTTGGVLQDLLEIQSSVFE
                     NEYLNSLSPAYHPAAAAPPINIEIMGSNNFVQKKQRELFNPRISSALSSIPPSIQHKL
                     LVEQNIPIEELPITELAPRALNNSHTSYITMPSMDRFITESAKLKKLDELLVKLKEED
                     HRVLIYFQMTKMMDLMEEYLTYRQYKHIRLDGSSKLDDRRDLVHDWQTKPDIFIFLLS
                     TRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLIRGTIEER
                     MRDRAKQKEHVQQVVMEGKAKQNKVKIVEVEKEKEKEQDSAPA"
     gene            complement(<246689..>249967)
                     /gene="NUT1"
                     /locus_tag="KLMA_80103"
                     /db_xref="GeneID:34718300"
     mRNA            complement(<246689..>249967)
                     /gene="NUT1"
                     /locus_tag="KLMA_80103"
                     /product="mediator of RNA polymerase II transcription
                     subunit 5"
                     /transcript_id="XM_022821836.1"
                     /db_xref="GeneID:34718300"
     CDS             complement(246689..249967)
                     /gene="NUT1"
                     /locus_tag="KLMA_80103"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 5"
                     /protein_id="XP_022678157.1"
                     /db_xref="GeneID:34718300"
                     /translation="MESFVQLVENCCARGIAAQQFLNFYHEFINEKYEASLNNGNEER
                     EVESRKQVFQHVSEELLTVLQSCSGNQETLLAEYMVHLVFINYDTDLSSALLPRIYSI
                     QSEQLLLHFHSLATSFIGRLEDNLIKDQMRQDLSTFIIPSCLRIDMSTFSNQLFIAVV
                     KYLQALLSLVDGVLEVEMDKEKMKLALSSILTRANKLNRIMGKRVCRDFETKLNVSLA
                     SEPSSNKLAAMSSPAIFSPSLGNGIGSGAGMGSLASRLVGTPGSVRPMDMSASSSGPS
                     APSAASRIQDLKLIRFYKNLWLNNKIHNFNTTDAQFLEKFSSINYRLSSTGMEEHMME
                     EKITDLIETAYTSFAQLVNNKLYHQTNTHFNLLERKYVHFITKRLPLIIRDFLPQNPS
                     VIVNALQNMDDKVKKAIKSYYSNKNDSPESNEDLFDDYSGNNFDIRHDFLKNLIMLNL
                     RPPSVLNVFLREDQMVDTKTLKTDDSLSIVNSQGVQEKITDLHGTLKSLLSDLDIENQ
                     YIGNGTNYQFSPDNSLLKLLMSFDTIAPTKQVEISSAFVQILQTSIENSDLKTLGKVL
                     WVLTTNIGHVTTSMLCCLSPDPFMSTVIGFIDKRQQSSSMSASDEPDFESLHGYITFG
                     MALSFIVFMNKTYGVNVEQYVDNYDTSYAIKFLSTIQEIPNSFVLQHGSPEESNSYLQ
                     NWLKDLFINGSISDTQMKNADIKDLINLVPFIFKQSLVAVQSGSVQNMSNISSGSEYF
                     LQPFILPGLIKIMFWLEYYLKSLKSNNPPPQILSSCWELLNIIISPSSLDDDAKGLHF
                     VILKLNCVRLLNVLHMFRNDESNSGQYGVYATHESIDPKLESLISKFEYVASISNIYD
                     VDPKFYETTKEGYSHGTLFSSKIPITNDMPVDKIMTNQLNSFWNLHSSTYYNYDYLLE
                     LVKLITPEKFLLDSIKTLTYKVAAYGVPGIQGKLNTSAIEQVANFFAYFMVLHDVQTE
                     EQRLALLNYIETGVIATNKDIEAKPEPETKIDDDFDMLFGEPFNNTVEDTSVVFSQND
                     QPKGNSFSTVYPVFVGTFGVIIAEMKNRFDKSKAQGILTEEEYQKSTTFTRKYLDNLK
                     NSVV"
     gene            complement(<250247..>251299)
                     /gene="PEX14"
                     /locus_tag="KLMA_80104"
                     /db_xref="GeneID:34718301"
     mRNA            complement(<250247..>251299)
                     /gene="PEX14"
                     /locus_tag="KLMA_80104"
                     /product="peroxisomal membrane protein PEX14"
                     /transcript_id="XM_022821837.1"
                     /db_xref="GeneID:34718301"
     CDS             complement(250247..251299)
                     /gene="PEX14"
                     /locus_tag="KLMA_80104"
                     /codon_start=1
                     /product="peroxisomal membrane protein PEX14"
                     /protein_id="XP_022678158.1"
                     /db_xref="GeneID:34718301"
                     /translation="MTEKVSEDRKELYDSAIAFLRDPNVASAPLAKKIEFLEGKGLTQ
                     DEIEKAIKEASSSSVTGTETSNTSQTEASSNASTGRPLNTVYEAVPPAIPNRDWRDYF
                     IMATASAGLFYGVYQITKRYILPQILPESKSKLEQDKELIMEQFDKVEKLLSQIEQEH
                     EEYKQKEEAKLDDVDRTILQLQNTLDETATLKQRMEAEFTAIKKEFNNMQSSIDTFVR
                     SAGNDQELKKLQDEIQSLKNLIKSSLGTTGGPGGPGVPGSLSQTVSPNSTGFIPGADS
                     IPSAADILANMELGKTKAKSKSPEAPGPEPASAAQVPAWKKAREENMSKSSVTSNSAI
                     PEWQRAMNTGNSYESN"
     gene            <251515..>252282
                     /gene="LYS5"
                     /locus_tag="KLMA_80105"
                     /db_xref="GeneID:34718302"
     mRNA            <251515..>252282
                     /gene="LYS5"
                     /locus_tag="KLMA_80105"
                     /product="L-aminoadipate-semialdehyde
                     dehydrogenase-phosphopantetheinyl transferase"
                     /transcript_id="XM_022821838.1"
                     /db_xref="GeneID:34718302"
     CDS             251515..252282
                     /gene="LYS5"
                     /locus_tag="KLMA_80105"
                     /codon_start=1
                     /product="L-aminoadipate-semialdehyde
                     dehydrogenase-phosphopantetheinyl transferase"
                     /protein_id="XP_022678159.1"
                     /db_xref="GeneID:34718302"
                     /translation="MIQEQTDVNIQPQIHICDVEDGWLADDFNFESAMRLLSLEEQSQ
                     VLRKRSKKLQRMALGNRLLQLHGCSSILGVKPEDLEFSRGSFGKPMIKGMEFSMSNGE
                     RHCVMGIHFKPVGVDIASTTDCNGMSSDYVAEFRDIFTDSEFRWLSDSTHRDVLFSLL
                     WSMKEAYMKLIGTGLNTDIQAIDVGSVPVYLAQQEVVTTQRTINGELITFSSRWITDT
                     EVVSTAERTTAAQCGIENYRIVRLTPQAIVDALLATH"
     gene            <252475..>253359
                     /locus_tag="KLMA_80106"
                     /db_xref="GeneID:34718303"
     mRNA            <252475..>253359
                     /locus_tag="KLMA_80106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821839.1"
                     /db_xref="GeneID:34718303"
     CDS             252475..253359
                     /locus_tag="KLMA_80106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678160.1"
                     /db_xref="GeneID:34718303"
                     /translation="MTDQQRKPTTHLIGGFCGGLVSAIILQPFDLVKTRLQQDNSSTL
                     WSTLKKIETPGQLWRGALPSCIRTSVGSAIYLTMLNSVRQAMSKGKSKAHGSSYLPQL
                     NMYENMISGALTRALTGLLTMPITIIKVRYESTMYNYTSLSDATRHIFATNGIRGFFT
                     GFGATALRDAPYAGLYMLFYDRLKEIVPTLLPNSLVKLNKNQHYSTYTSTLINGSSAF
                     SAAVIATTITAPFDTVKTRMQLDPSKFNRFTSTFWYIASKEGIRHLFDGLSLRLTRKA
                     FSAGIAWGIYEEIIKRFV"
     gene            complement(<253431..>254573)
                     /gene="CDC43"
                     /locus_tag="KLMA_80107"
                     /db_xref="GeneID:34718304"
     mRNA            complement(<253431..>254573)
                     /gene="CDC43"
                     /locus_tag="KLMA_80107"
                     /product="geranylgeranyl transferase type-1 subunit beta"
                     /transcript_id="XM_022821841.1"
                     /db_xref="GeneID:34718304"
     CDS             complement(253431..254573)
                     /gene="CDC43"
                     /locus_tag="KLMA_80107"
                     /codon_start=1
                     /product="geranylgeranyl transferase type-1 subunit beta"
                     /protein_id="XP_022678161.1"
                     /db_xref="GeneID:34718304"
                     /translation="MSETNQNKPIEWSAALVGKHLKFCQRHLHLLPPHHQDKDPNRLA
                     VIFYALTSIQLLSERDADVGKQYGYSLEWLRSCYVECEGVEGGGILSGFAVCSMKEAR
                     LLSTLSLPNTLFGLISLMLLRDGEFVRSRVCLRSLGALVSRCQLRDGSFVSFLREDGS
                     PARVDAHDLRFCYVAVAILRLVGCRTRADFERYIDVGGVVEFICSRECSVGGFGECDE
                     PHGGYTSCALSALAILGELDQLDLAFRERTVRWLVDRQVREDATTMTSGDSVENEDYD
                     PDDCGGFNGRENKLADTCYAFWCLNALSILCPDDWRQLVDLGRVQSYLMDQTQNKLIG
                     GWAKNDQDDPDIYHTMMGIAALKLIDGELDGVLCMPTSIVHEFGLR"
     gene            complement(<254940..>255203)
                     /locus_tag="KLMA_80108"
                     /db_xref="GeneID:34718305"
     mRNA            complement(<254940..>255203)
                     /locus_tag="KLMA_80108"
                     /product="protease B inhibitors 2 and 1"
                     /transcript_id="XM_022821842.1"
                     /db_xref="GeneID:34718305"
     CDS             complement(254940..255203)
                     /locus_tag="KLMA_80108"
                     /codon_start=1
                     /product="protease B inhibitors 2 and 1"
                     /protein_id="XP_022678162.1"
                     /db_xref="GeneID:34718305"
                     /translation="MLRKAQPLYRRAMSSYIITFKDHVKEADASKIKSAISSLGGSIV
                     HEYSLIKGFAVKLPESVHIDKIKQLYGHSFANVEEDKEVKASS"
     gene            complement(<255563..>256189)
                     /gene="YFH1"
                     /locus_tag="KLMA_80109"
                     /db_xref="GeneID:34718306"
     mRNA            complement(<255563..>256189)
                     /gene="YFH1"
                     /locus_tag="KLMA_80109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821843.1"
                     /db_xref="GeneID:34718306"
     CDS             complement(255563..256189)
                     /gene="YFH1"
                     /locus_tag="KLMA_80109"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678163.1"
                     /db_xref="GeneID:34718306"
                     /translation="MIGLSKRLDKGSVASQAKRLAKGLLLAQGSAASRTLAPASTRLI
                     YTSTQSSVFTTSSSSAAAAIAKGKLLSNKTLPAATTTIQRMHNHISASTDGRDIPEEV
                     LDLPIDEYHEISDEFMENLLEQLETLSDEQPNLVNDVELSQGVMNIEVPGKGVYVINK
                     QPPNKQIWLASPISGPNRFDYYKNEWVSLRDGSKLLEVLGNELETSLH"
     gene            <256489..>256905
                     /locus_tag="KLMA_80110"
                     /db_xref="GeneID:34718307"
     mRNA            <256489..>256905
                     /locus_tag="KLMA_80110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821844.1"
                     /db_xref="GeneID:34718307"
     CDS             256489..256905
                     /locus_tag="KLMA_80110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678164.1"
                     /db_xref="GeneID:34718307"
                     /translation="MDPFVYLILFVLVIIFVVLLPLLGGIGSYSVKKNDARGSNKGRS
                     GTDKKRLKLEKEDIPLKFKVGLEKDGKKEGKRFEIDGKTGLKRRVIGKYSNNENEFDY
                     DVDELIAEDLKEQQEEESARYEQFLGKENETQELLV"
     gene            complement(<257000..>259375)
                     /gene="UBP1"
                     /locus_tag="KLMA_80111"
                     /db_xref="GeneID:34718308"
     mRNA            complement(<257000..>259375)
                     /gene="UBP1"
                     /locus_tag="KLMA_80111"
                     /product="ubiquitin carboxyl-terminal hydrolase 1"
                     /transcript_id="XM_022821845.1"
                     /db_xref="GeneID:34718308"
     CDS             complement(257000..259375)
                     /gene="UBP1"
                     /locus_tag="KLMA_80111"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 1"
                     /protein_id="XP_022678165.1"
                     /db_xref="GeneID:34718308"
                     /translation="MISVVLERLGLEGKRVLKAVVIGLFASLYLLYKNEFSIERSIRS
                     LVKSGQEISQVIRERVMLGRWAPRTSEQEEVILKRGGYVGGLVNDGNTCFMNSVLQSL
                     ASSKELDRFMEVLVADAQESEEKPEEEEEEVEEAPKPETKAKPNGKKKSYGKRKKLAA
                     RAADEKLLEATSSAAAVEPNVKFTLALQELLSKLNDKHYRNRPWFKTNKLLKTMTKAP
                     NKNIILGYDQEDAQEFFQTILSELEKNVESIYGKPEKDPKPVKEEDLPEDAIIGQASL
                     GEIGDVFIPTAQIDPNSVLNSDQKLFSPFKIVTPLDGITAERIGCLQCGENGGIRYSV
                     FSGLSLNLPSDNIGSPIKLSELLDEWAKPEIIEGVDCNRCALCAVVEHLEGQLRTIQE
                     QADVNQKLVALIENRIKEVKNVLSKPVIDDEDYKKLHTENMVRKASKSKQILISRPPP
                     LLSIHINRSVFDPRTYMIRKNNSRVIFKSRLNLSPWCCDHDEINLDARLPMSKKQEKW
                     QESSEDDNNGNEYYSKLHRRFEREFEDSEEEGEDGEGGVNGNSNGNARTVENYDPLNG
                     ELGSASFSSSEDELDEIEEVELDALGNTIVKKRSSAGADTNVKEPLRGGGTDLAGSGP
                     NLDDEEEEEEGDEEDEDEDDDLEDEDEDEVDDDSEESDSEDSDDSLLAPPVPPAQPIV
                     SNVPAGPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDESVYIVDEQEVLSTPG
                     VFMLFYEYDYDPETGKMKDDLEYQESENINTNTNTTVSPVTADAPAATVTE"
     gene            complement(<259981..>261372)
                     /gene="PUB1"
                     /locus_tag="KLMA_80112"
                     /db_xref="GeneID:34718309"
     mRNA            complement(<259981..>261372)
                     /gene="PUB1"
                     /locus_tag="KLMA_80112"
                     /product="nuclear and cytoplasmic polyadenylated
                     RNA-binding protein PUB1"
                     /transcript_id="XM_022821846.1"
                     /db_xref="GeneID:34718309"
     CDS             complement(259981..261372)
                     /gene="PUB1"
                     /locus_tag="KLMA_80112"
                     /codon_start=1
                     /product="nuclear and cytoplasmic polyadenylated
                     RNA-binding protein PUB1"
                     /protein_id="XP_022678166.1"
                     /db_xref="GeneID:34718309"
                     /translation="MSEETKNNEQEVQQEVQAGEVEGSVEANVEVNVEKGNEESVEVS
                     EEVSGEENAAEGTSEKEEESGAAPVLATQGGREKSDKILYVGNLPKNIDDDLLKQYFQ
                     IGGAISSVKIIPDKNSQECNYAFVEYFQPHDASVAYETLNGKEVEGKVLKINWAFQSQ
                     QVNSEETFNLFVGDLNVDVNDATLADTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGQ
                     QEQAQLAMETKQGFELNGRALRINWASKREPQQNQNQNQNGARRYGNGPSGGRGNFRG
                     HNNNHHHHNNNSNRHPGAGGPPPPPPHHQMQAHLPPQLQQQPPMGMPPMHQAPLVPPP
                     VDPEAVEDMMRGAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFI
                     KYDTHEQAALCIVALTNFLFQGRNLRTGWGKEKPTFIRPQQQLGPMPPVSMQVPVPAE
                     SSVEPQLENDQEQ"
     gene            <262266..>263345
                     /gene="CAB2"
                     /locus_tag="KLMA_80113"
                     /db_xref="GeneID:34718310"
     mRNA            <262266..>263345
                     /gene="CAB2"
                     /locus_tag="KLMA_80113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821847.1"
                     /db_xref="GeneID:34718310"
     CDS             262266..263345
                     /gene="CAB2"
                     /locus_tag="KLMA_80113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678167.1"
                     /db_xref="GeneID:34718310"
                     /translation="MPNSRIHTSITEVSKAIDRSVDESSLPVAHLTDEDNYFTTNPKP
                     PYLDELLRETTEFINYQRANGRENIVLVTSGGTTVPLENNTVRFIDNFSAGTRGASSA
                     EQFLFHGYSVIFLHREFSLTPFNRPFIHNTETNFLDYFDENGQLSEQYRDVILENKRH
                     YDRFMYQEKRLLMLPFTTVNQYLWSLKTIATLMNDNGCLFYLAAAVSDFFVPYSRLPQ
                     HKIQSQEANRKLNESSSDGQCNSSTTVEGKLVVNLDPVPKFLRRLVESWATQAMIISF
                     KLETDDKILIHKARQALDRYNHQLVIGNLLQTRNKEVVFVSENNRDGDWIRTGGGANS
                     NIEELIVQEVVKRHDAWRKDARKTG"
     gene            complement(<263424..>264926)
                     /gene="SAM50"
                     /locus_tag="KLMA_80114"
                     /db_xref="GeneID:34718311"
     mRNA            complement(<263424..>264926)
                     /gene="SAM50"
                     /locus_tag="KLMA_80114"
                     /product="sorting assembly machinery 50 kDa subunit"
                     /transcript_id="XM_022821848.1"
                     /db_xref="GeneID:34718311"
     CDS             complement(263424..264926)
                     /gene="SAM50"
                     /locus_tag="KLMA_80114"
                     /codon_start=1
                     /product="sorting assembly machinery 50 kDa subunit"
                     /protein_id="XP_022678168.1"
                     /db_xref="GeneID:34718311"
                     /translation="MDNTLLNSGSSGLEDSVHGGNVPVGQNQEELEQQQLQLQNQYLL
                     DLFKKNKSTPIHVSQVVINGSELVRDDILQSYLAETIHKADTFEQLCRYSDWFNYKMV
                     GNGMANSVAMSLDSRGSYPVQISERDYGSWKYSSGAPETISVVDVVPIVQLHPVKRFS
                     AKTGTNIGNGEGDGYIQFQLRNILHGGERLTLDATKGTKTHSSYLLNYFQPLHSPWWC
                     TDTSIFKNARELGRCELFVRGFSSSLKSGYFHEGAVNHEYKWESLLRSCDVKSDLASS
                     HLLLCAGDSVKHSITHSMTRDTRDNHIAPSNGSLLKFSNELALGKFYKATLECNLTKS
                     WFKRDFVTVSSTLKAGYIHNFHANKYPLHVMDKFYNGGSNDVRSFQVMGLGPKSVHDY
                     VGGDTSLAYGVSVFSRLPIRKFYDSNFRLHAFFNGGRLINREYNGSSSSMNMDLVREM
                     LSQHSCSTGFGIVFRHPVARFELNFTVPLTAHASDATRKGFQYGIGISFL"
     gene            complement(<265161..>266969)
                     /gene="CRZ1"
                     /locus_tag="KLMA_80115"
                     /db_xref="GeneID:34718312"
     mRNA            complement(<265161..>266969)
                     /gene="CRZ1"
                     /locus_tag="KLMA_80115"
                     /product="transcriptional regulator CRZ1"
                     /transcript_id="XM_022821849.1"
                     /db_xref="GeneID:34718312"
     CDS             complement(265161..266969)
                     /gene="CRZ1"
                     /locus_tag="KLMA_80115"
                     /codon_start=1
                     /product="transcriptional regulator CRZ1"
                     /protein_id="XP_022678169.1"
                     /db_xref="GeneID:34718312"
                     /translation="MDEYLNMNGSSPADGSFYGLGQGQGVGQDGVVESGQDPGHMDVG
                     FSDFSRDILSGFKGPEDEGSGLQQQQQQQQRPQLSIPHTDPSLLFPELNLANRGAPAG
                     AAGASQQQQQQEHSRSRSRSSSHVTQSYYGNSNSNSNGHGHGYDQLSTANSPYMHPSD
                     ALSPGMGYLGLDSDIDELLSVHSDLSDVSKDYEYISTLSELQELTGESFDPLPDFVDS
                     QFAQLQLQLPESSMAQVQSHIQPVQPSPPPQVTPPQIRIEQFEPAGAPPKSGHAGTFD
                     LDLDLGQSPDYQDQSHGLLSVDAAHDQQQQQHHQQHQHQQLPTLQNDHISDSFDRMML
                     TGHRNSIRNRSHSLSQTQTPSQSQGQSVTKPRSNTRSRSRANSSSTTTVARSPSRSRS
                     RSRNVSSRSLSPDERARSLSSDREHLLKLGGIIPRDSDQNSDQDNSPDNNNGNGNGNG
                     TGTSTGDDSHDNHSSTTLNLIGTTKKKLAQKHPSVYACDICDKKFTRPYNLKSHLRSH
                     TDERPYLCSVCGKAFARMHDKNRHEDLHTGKKRYVCGGTLKNGQPWGCGKKFARSDAL
                     GRHFKTELGKRCIMPLFEEAEMEKRAAAGGANDNVS"
     gene            <268012..>269022
                     /gene="SDS3"
                     /locus_tag="KLMA_80116"
                     /db_xref="GeneID:34718313"
     mRNA            <268012..>269022
                     /gene="SDS3"
                     /locus_tag="KLMA_80116"
                     /product="transcriptional regulatory protein SDS3"
                     /transcript_id="XM_022821850.1"
                     /db_xref="GeneID:34718313"
     CDS             268012..269022
                     /gene="SDS3"
                     /locus_tag="KLMA_80116"
                     /codon_start=1
                     /product="transcriptional regulatory protein SDS3"
                     /protein_id="XP_022678170.1"
                     /db_xref="GeneID:34718313"
                     /translation="MPLKRNVEQDSLTPGTPPSAGASAIAGQGPAIAAAPGQAPAQPL
                     DLSRKDKKRIQFESKVTKIKSSFTKDKDSHYRDRLTLLQTDLTTLHQGNNLEFLRKLR
                     DLEEDRDLELVRLRLYEEYRVYRSGLEFQEDIEKTKAEHERMIKLCKEMLYESLQKTI
                     KKLQEERLLLDVANAQSYSMDYSRGKFQKQTRSYTQNSSNNTFSAWDSSPNDVSQTES
                     GNETGGNATDRRSLRRRAATNQNQLQNQNQLQNQNQTQGPGGKPQGNSDSELMQYLSD
                     SSELQALLFGGKEKEKKMGRGHQRLSTKSAPVLQSLTQDEVTDDISLIRKLTGQPPAP
                     FR"
     gene            <269213..>270802
                     /gene="KTR5"
                     /locus_tag="KLMA_80117"
                     /db_xref="GeneID:34718314"
     mRNA            <269213..>270802
                     /gene="KTR5"
                     /locus_tag="KLMA_80117"
                     /product="probable mannosyltransferase KTR5"
                     /transcript_id="XM_022821852.1"
                     /db_xref="GeneID:34718314"
     CDS             269213..270802
                     /gene="KTR5"
                     /locus_tag="KLMA_80117"
                     /codon_start=1
                     /product="probable mannosyltransferase KTR5"
                     /protein_id="XP_022678171.1"
                     /db_xref="GeneID:34718314"
                     /translation="MAAGADNSMNKNGLGLGFAKAKARIKAFALILARILVKILGLRT
                     VQVLIGMLVLTGVVIQIVEMEDRAAGMNKAYFSPYNMASDIDRPFFEGCVDTEEYKRD
                     PEYERQNATFVMLTRNEEIKGVVHTIRSVERHFNQWFEYPYVLLNDKPFTQEFQDQVR
                     SLTNAQVTFGTVDESQWNFENEDTDEFREYVESQGDRGIMYGNMVSYHKMCRFYSGMF
                     YKHPAVQQHEWYWRIEPDVEFFCDLTYDPFLEMKRSGKKYGFTMFIKELYWAVPNLFR
                     ATKAFIREREAQAQAQGQGNIKVGSLWKVFVKDYNVLPEDEYLNKFANYPAEAAEEIR
                     HEDTIASLKQRWQRDGTIDDQLVEELLFRAQRKVPVIEDKFEQEEFNLCHFWSNFEIA
                     RVDVFDNDIYDAYFQYLDQWGGFWKERWGDAPVHSLGLGLTLDLQDVHYFRDIGYQHS
                     TLFHCPFNKKGHQLPYKGTPDTRDTVFTNIFYRKSESSHTSDTGSGCRCRCPTGRDVE
                     DNAFYCLVQWFDNVFPLPNNT"
     gene            complement(<270973..>271284)
                     /gene="HHF1"
                     /locus_tag="KLMA_80118"
                     /db_xref="GeneID:34718315"
     mRNA            complement(<270973..>271284)
                     /gene="HHF1"
                     /locus_tag="KLMA_80118"
                     /product="histone H4"
                     /transcript_id="XM_022821853.1"
                     /db_xref="GeneID:34718315"
     CDS             complement(270973..271284)
                     /gene="HHF1"
                     /locus_tag="KLMA_80118"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_022678172.1"
                     /db_xref="GeneID:34718315"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRNVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <272023..>272433
                     /gene="HHT1"
                     /locus_tag="KLMA_80119"
                     /db_xref="GeneID:34718316"
     mRNA            <272023..>272433
                     /gene="HHT1"
                     /locus_tag="KLMA_80119"
                     /product="histone H3"
                     /transcript_id="XM_022821854.1"
                     /db_xref="GeneID:34718316"
     CDS             272023..272433
                     /gene="HHT1"
                     /locus_tag="KLMA_80119"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_022678173.1"
                     /db_xref="GeneID:34718316"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <272761..>273174
                     /gene="AIM19"
                     /locus_tag="KLMA_80120"
                     /db_xref="GeneID:34718317"
     mRNA            <272761..>273174
                     /gene="AIM19"
                     /locus_tag="KLMA_80120"
                     /product="loss of respiratory capacity protein 2"
                     /transcript_id="XM_022821855.1"
                     /db_xref="GeneID:34718317"
     CDS             272761..273174
                     /gene="AIM19"
                     /locus_tag="KLMA_80120"
                     /codon_start=1
                     /product="loss of respiratory capacity protein 2"
                     /protein_id="XP_022678174.1"
                     /db_xref="GeneID:34718317"
                     /translation="MNAYDYSQTPYLAWLNGAMLLTTPVVSPAMQTPASVAAQNQSIF
                     SAFTKPKFYGPTKTTSLMFGLANAIGGYMIYDGDLESGTGFLAAWNTLYLLVGGRGSV
                     KALRYGKVWPLLLSTVSGSSALLYGRRFISAGFEA"
     gene            complement(<273227..>274087)
                     /gene="SIW14"
                     /locus_tag="KLMA_80121"
                     /db_xref="GeneID:34718318"
     mRNA            complement(<273227..>274087)
                     /gene="SIW14"
                     /locus_tag="KLMA_80121"
                     /product="tyrosine-protein phosphatase SIW14"
                     /transcript_id="XM_022821856.1"
                     /db_xref="GeneID:34718318"
     CDS             complement(273227..274087)
                     /gene="SIW14"
                     /locus_tag="KLMA_80121"
                     /codon_start=1
                     /product="tyrosine-protein phosphatase SIW14"
                     /protein_id="XP_022678175.1"
                     /db_xref="GeneID:34718318"
                     /translation="MNQSFDEDETGGEESRSMPLDKRLETELRIVEKLGINRVLSVHN
                     LGSILDEDEAMMQRVEDIKAQFHEKARTPFSTEEDVDDIYDAEEHAARSQQVRAQSEA
                     HAKAMQGLNNKAVVMPREVIPPENFSHVCGEIYRSSFPRPENFEFLRDRLKLRSILVL
                     IPEEYPAENMRFMEETGIKLFQVGMSGNKEPFVNIPSDLLTKALAVVLDPSNHPILIH
                     CNRGKHRTGCLVGCIRKLQNWSLTMIFDEYRRFAFPKVRALDQQFIELYDDREIIRLA
                     RERNWLSVEW"
     gene            <274719..>275888
                     /gene="AVT7"
                     /locus_tag="KLMA_80122"
                     /db_xref="GeneID:34718319"
     mRNA            <274719..>275888
                     /gene="AVT7"
                     /locus_tag="KLMA_80122"
                     /product="vacuolar amino acid transporter 7"
                     /transcript_id="XM_022821857.1"
                     /db_xref="GeneID:34718319"
     CDS             274719..275888
                     /gene="AVT7"
                     /locus_tag="KLMA_80122"
                     /codon_start=1
                     /product="vacuolar amino acid transporter 7"
                     /protein_id="XP_022678176.1"
                     /db_xref="GeneID:34718319"
                     /translation="MFIQCFGVGLSYLILVGDLFPSLFGGSRTLWTLLSGVIIVPLTL
                     LRHLDSLRYTSILGLAALGYITLLIVATYFWGRYPSPKVHWVSVYDSTGVLTTFSIII
                     FAFTGSMNLFSIINELKENSMTNIKSIINRSIVISGFFFVVVGLFGYLTFGETTLGNV
                     LLNYNSDKFAVKFARFNLGLMVVLSFPLMFHPCRIACNNMIHWLQINYGPRKDMLQEN
                     QNLGPITLEIEDETDREFLQQEFGTGDITDTAAAGTGSGSTEDNSFANTYQSLPRATD
                     EDDEDATHESTEAVPLSDKRFYTITAVLLTVLYGLALNVQSFALVLAVVGATGSTAIS
                     FTLPGLFGWKLIGTESLMNGERISTWENIHRYGSLALTWYGIIVMVSCLYITLFL"
     gene            complement(<275976..>277202)
                     /gene="lag1"
                     /locus_tag="KLMA_80123"
                     /db_xref="GeneID:34718320"
     mRNA            complement(<275976..>277202)
                     /gene="lag1"
                     /locus_tag="KLMA_80123"
                     /product="sphingosine N-acyltransferase lac1"
                     /transcript_id="XM_022821858.1"
                     /db_xref="GeneID:34718320"
     CDS             complement(275976..277202)
                     /gene="lag1"
                     /locus_tag="KLMA_80123"
                     /codon_start=1
                     /product="sphingosine N-acyltransferase lac1"
                     /protein_id="XP_022678177.1"
                     /db_xref="GeneID:34718320"
                     /translation="MGSELRYRVATNVMENASAARLAMESETRLQCSKSQTESSKVEV
                     KREVKERRKARSGSGMSANERISRVDRCSVAVSSVLLAVLFWANKNFDSRYTDKFLKL
                     QYEYETSRGSYDIGVDDVYIVLTFIVVFCLSRSFLLEFMLKPVARKRFGLTSNKALQR
                     FGEQGWSLVYYTFSWSVGFYLYYYSPYFLDIDHIYQGWPHDRMSGLFKTYYLFQIAAW
                     FHQIIVLNVEERRKDHWQMFAHHIITVALTTGSYYYYFTRIGHVILILMDIVDVMLSS
                     AKMLKYCGFSTLCDVMFVVFLFWWIMLRHVAYNYIVYRSVSIIDGLLDGSRCVAGVVQ
                     KRCLTPVVNNTFITLLCGLQVITCIWMYLILKVFVKVITGTGAEDVRSDGEESSTSEE
                     TSDDIELMDEKEEDED"
     gene            complement(<277720..>278631)
                     /gene="SSN8"
                     /locus_tag="KLMA_80124"
                     /db_xref="GeneID:34718321"
     mRNA            complement(<277720..>278631)
                     /gene="SSN8"
                     /locus_tag="KLMA_80124"
                     /product="RNA polymerase II holoenzyme cyclin-like
                     subunit"
                     /transcript_id="XM_022821859.1"
                     /db_xref="GeneID:34718321"
     CDS             complement(277720..278631)
                     /gene="SSN8"
                     /locus_tag="KLMA_80124"
                     /codon_start=1
                     /product="RNA polymerase II holoenzyme cyclin-like
                     subunit"
                     /protein_id="XP_022678178.1"
                     /db_xref="GeneID:34718321"
                     /translation="MSGSYWDSSQRNKWKCTRESLAKEKQKLWQLECQLFPQGLNITI
                     HDSKTNKQVTTNIPVTQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLS
                     RFLIRASVREVNLYLLITTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTE
                     FEFYLIEELQSYLIVHHPYRSLEQIERALASPKYNYKLSDDELQKIWSLINDSYTTDV
                     HLLYPPHVIAVACLFAVSCILHKSEDTTKRDKINRFIAESQVNLEQVMFILQELITLY
                     DHWDKYNELRIRALLHELYLRQPTVIQ"
     gene            complement(<279827..>281182)
                     /gene="ICE2"
                     /locus_tag="KLMA_80125"
                     /db_xref="GeneID:34718322"
     mRNA            complement(<279827..>281182)
                     /gene="ICE2"
                     /locus_tag="KLMA_80125"
                     /product="protein ICE2"
                     /transcript_id="XM_022821860.1"
                     /db_xref="GeneID:34718322"
     CDS             complement(279827..281182)
                     /gene="ICE2"
                     /locus_tag="KLMA_80125"
                     /codon_start=1
                     /product="protein ICE2"
                     /protein_id="XP_022678179.1"
                     /db_xref="GeneID:34718322"
                     /translation="MPLIKKSVLQTVRMFLTTMYLFLILITIPISFQVGGLNCGLSFT
                     VTLFALYFVSTTFKLVLLERGSAVSTLIYYLQHLLIPSILFMFLSYFEGVERGEVVES
                     ECFKVFWKVVVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKRTRRSNLWVI
                     VSLLISGGVITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGINNGSGSV
                     MESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWQMHQTNLTQKDNLLQLMTKNY
                     RVIWSQIMEHTTLPRNHKYAKLVQEMQRALNPLWLSLKNFTKSVPISIQEIFVVTFKM
                     AKESIIPAVVINLVFRLLIFYSATRIIPTLQRDTKERRSFRRIMNFVYWYSPCIIIAM
                     YTHLILRYSGQLKNELCIWGCFPYESENKIVVDSWSFWNWCNIYSTMLLYALELIGGR
                     N"
     gene            <281746..>283860
                     /gene="UTP25"
                     /locus_tag="KLMA_80126"
                     /db_xref="GeneID:34718323"
     mRNA            <281746..>283860
                     /gene="UTP25"
                     /locus_tag="KLMA_80126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821861.1"
                     /db_xref="GeneID:34718323"
     CDS             281746..283860
                     /gene="UTP25"
                     /locus_tag="KLMA_80126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678180.1"
                     /db_xref="GeneID:34718323"
                     /translation="MSNTGVRQRGAFKTGRKGLREITRPGQKRGRNEVEESVENAEDS
                     EDEEGSDGVPDEEEDPEQRKGQVYDALLTLLKSEHPEKRAKKKKTEQKSTKTKPSPKD
                     EDESEDEEESEDEQQAIEGGLEDEMSGEEADSDVSDLEDSEDESDPFESHFNKYDEKH
                     LEALDKGLTARTVKYKTIKKDVTESESVIFSKPCLEGEEMEPLKGKQSLNSYFVKQKL
                     KIASGFHDTELPLTPIQKELVDPMFQYKDVLYEYENYADEEEYRELYSLHVLNHVYKT
                     RDRILKDNQKLQDNADLELLDQGFTRPKVLIVVPTKDVAYNVVKKIMNKSGLDQFDKK
                     SKFEDQFFEDALPPASKPKSFQHIFKGNTNDFFVLGLKFTRKSMKLYANFYQSDIIIC
                     SPLGIQLILENTDKKKRQDDFLSSIEVMVIDQLHSIEYQNVMHISTIFQHINKIPEQQ
                     RDTDFSRIRMWYINEQAKYFRQTMVFTKYISPYANSILNGKCRNLAGRWKNHRKILPE
                     NSSIGKLGLKVRQIFQRFDLAGGSALDEPDYRFKFFTSVIIPSIVKSTGYEDGILLYI
                     PEYTDFIRVRNYLKERTTILFGEINEYSDQKQLTSNRARFQQGKIKVLLYTERLHHFR
                     RYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTVRCVYSKMDSLSLE
                     RIVGSRRAAVLTHGQNEVYEFK"
     gene            <284879..>285661
                     /gene="RSM25"
                     /locus_tag="KLMA_80127"
                     /db_xref="GeneID:34718324"
     mRNA            <284879..>285661
                     /gene="RSM25"
                     /locus_tag="KLMA_80127"
                     /product="37S ribosomal protein S25"
                     /transcript_id="XM_022821863.1"
                     /db_xref="GeneID:34718324"
     CDS             284879..285661
                     /gene="RSM25"
                     /locus_tag="KLMA_80127"
                     /codon_start=1
                     /product="37S ribosomal protein S25"
                     /protein_id="XP_022678181.1"
                     /db_xref="GeneID:34718324"
                     /translation="MKVQQDAVNVLERTSAYLKSGILKKTPAWYNVVAKVPPTKKFAR
                     NPQLTDPKNGKSRTDMPDFSNWKANSAGLYKTRPNSVDKKSGASKLYQSPKLVYIEDK
                     LRKLFYQQHPWEFSRPKVLVENSMEVQKYDWSHLQQLDRPLDGESVVQRTLYLLKTAE
                     KKELIDAYDQARFEFYRLRMQEEVETQVAQEEAEMFGSIFSETAIQYGISREQKVIDT
                     WRRKATQEAELMAARSSNPSAAWSAETETSKDEEPEVEEIQL"
     gene            complement(<285831..>286580)
                     /locus_tag="KLMA_80128"
                     /db_xref="GeneID:34718325"
     mRNA            complement(<285831..>286580)
                     /locus_tag="KLMA_80128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821864.1"
                     /db_xref="GeneID:34718325"
     CDS             complement(285831..286580)
                     /locus_tag="KLMA_80128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678182.1"
                     /db_xref="GeneID:34718325"
                     /translation="MSAPVIEEVPFSSSFEDLVPARPIEHLGKTDLTFNGKLASPLVI
                     NEDGGESGCGGKVWIAGELLCDYILTGSNEDHLLAKLYPNRDFKRVLELGSGTGLVGL
                     CVGLMDKVNPHSYRQIYVTDIDPLMGLIEQNIVSNGLEDTVHGEVLWWGEPLPETFVE
                     KPVDLVLAADCVYLEAAFPLLEKTLLDLTDVDDPPVILMAYKKRRKADKHFFQKIKKN
                     FKIVEIQDFAKYGYYLKQRTHLFELIREKHN"
     gene            complement(<286949..>289645)
                     /gene="FAP1"
                     /locus_tag="KLMA_80129"
                     /db_xref="GeneID:34718326"
     mRNA            complement(<286949..>289645)
                     /gene="FAP1"
                     /locus_tag="KLMA_80129"
                     /product="FKBP12-associated protein 1"
                     /transcript_id="XM_022821865.1"
                     /db_xref="GeneID:34718326"
     CDS             complement(286949..289645)
                     /gene="FAP1"
                     /locus_tag="KLMA_80129"
                     /codon_start=1
                     /product="FKBP12-associated protein 1"
                     /protein_id="XP_022678183.1"
                     /db_xref="GeneID:34718326"
                     /translation="MTGESEEIHDVPYYEQTIREIKNGDEYVCMICTVEMDAACRMYA
                     CDKCYRVFDYDCVREWALKSTGKTLDKSWKCPNCYKVNHKVPPAGRSTCWCGKVVEPE
                     VNELDPNSCGQTCNAKKCIHGCSKICHLGPHPECLIPVTVSCKCGKHTKQVPCSSSRK
                     VGKHFNCGNVCGLLLPCGKHTCQKKCHTGFCGPCETEITSELPCYCGLETKKGIKCSS
                     IKVVDYSKNSKGDKWIGVFACDKVRTLHYACGEHSYTETCQAPVSIDKSKPCPFSPKA
                     LHTCPCGRTALAELETPRKKCTDPIPTCENTCGKPLSCGKHKCPFTCHTGDCMDPCLI
                     IEKKPCSCRSNNFLVPCQFHESPRCKIKCESNMSCRRHKCFKICCEGKPAAKVREKSL
                     FLKKDRNDETLVEPQHICLKQCNKKLSCGIHDCTWKCHPGKCPPCLESDSNDLVCPCG
                     KTCVPAPVRCGTKLPPCPHPCVKISQGPAPCGHRRGPHKCHPLEEECPPCTVQVTKKC
                     RCHKQQNVLTLCMVSQDQVSCGTECGLPLANCHHKCRNKCHVSGQCDAKCNQICGLRR
                     TSCAHKCKEKCHGKLPCPEKECKEKVAIYCDCNRRTKMVECGATLNNPSRAVTEKLPC
                     DEECAKLKRHMELMEAFGMNDKLLTSKEKMESVVNVAKTFDDLGMPYSEICLNVYNYQ
                     TSWCSQIIEVFDKFLDDSTKISLHLKPMRAPQRQFVHELAAAYGLYSESQDPEPNRSV
                     YLKKIKSQSKIPTISLKDASNVYQKFKVLQKERKQAHYESTVTKTLVNIEVQQTANDQ
                     TTYDGPNAILISGVGDKSRLDTLKPIAHEYLKYTLVKSPQYKYQSESKSVVIYPEDFE
                     NISMNAVKDMEKVIPFIKDSLENHLMATEVRMCKLLKDLTLA"
     gene            <290277..>291386
                     /gene="LYS12"
                     /locus_tag="KLMA_80130"
                     /db_xref="GeneID:34718327"
     mRNA            <290277..>291386
                     /gene="LYS12"
                     /locus_tag="KLMA_80130"
                     /product="homoisocitrate dehydrogenase"
                     /transcript_id="XM_022821866.1"
                     /db_xref="GeneID:34718327"
     CDS             290277..291386
                     /gene="LYS12"
                     /locus_tag="KLMA_80130"
                     /codon_start=1
                     /product="homoisocitrate dehydrogenase"
                     /protein_id="XP_022678184.1"
                     /db_xref="GeneID:34718327"
                     /translation="MLRSRVLQVSRRAYATNGKQLTIGLIPGDGIGKEVIPAGKKVLE
                     SLNARHGLSFKFIDLQAGWETFQNTGKALPDETVEVLQKQCQGALFGAVQSPTTKVEG
                     YSSPIVALRKSLGLYANVRPVKAVEGTKDRPVDMVIVRENTEDLYIKLEKSYIDEATG
                     TRVADATKRITEVATKKIATIALEIAQQRLEQRGHATLTVTHKSNVLSQSDGLFREVC
                     RETYEANKDKFGKVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS
                     LGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPDAAKDIH
                     KAVDANIREGKYLTPDLGGNSTTQEVLEDVLSKLD"
     gene            complement(<291442..>292926)
                     /locus_tag="KLMA_80131"
                     /db_xref="GeneID:34718328"
     mRNA            complement(<291442..>292926)
                     /locus_tag="KLMA_80131"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821867.1"
                     /db_xref="GeneID:34718328"
     CDS             complement(291442..292926)
                     /locus_tag="KLMA_80131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678185.1"
                     /db_xref="GeneID:34718328"
                     /translation="MEFYRDATWVLEYVEKELSNEKRTAGSLQTLVVSSCKRYKLKTN
                     PRHIYAIVSSTWQYREYLDKIIKKSRILEDIPKKKGKPLFNKDTIRLLVHDLLLSKSK
                     RIQMGKHPIKSFILKHQTRLKAELTKLKVKLKVASLSQLVKNENDAEDVTPVRWIRIN
                     PILVKDKYEEVLSELNKKFPQRVDSWTDIVPGSIYYDEYIPNLFGVHPGDKITSHEQY
                     KRGKIIIQDRASCFPSHILNPGKDDVVIDACAAPGNKTTHVAAHIFGDSDTTIDKVQI
                     HAFEKDPERAKTLQKMITTAGCSKGIKIHVGDFTKIGKPEQFPNVTGFIVDPSCSGSG
                     IFGRKAIDRVNLNKKASDGEVDADTDEPADSVEQEKEIIMKEQDLKNRLAKLSSFQYQ
                     IVKHAMSFPSAKKICYSTCSIHAEENERVVVDLLLDSKVKEWGWRVRKRSGVIPTWPR
                     RGFVSEFEEVFPKEDAQEIAEGCIRALPKEDGGIGFFAVCFERD"
     gene            <293442..>295562
                     /gene="HDA1"
                     /locus_tag="KLMA_80132"
                     /db_xref="GeneID:34718329"
     mRNA            <293442..>295562
                     /gene="HDA1"
                     /locus_tag="KLMA_80132"
                     /product="histone deacetylase HDA1"
                     /transcript_id="XM_022821868.1"
                     /db_xref="GeneID:34718329"
     CDS             293442..295562
                     /gene="HDA1"
                     /locus_tag="KLMA_80132"
                     /codon_start=1
                     /product="histone deacetylase HDA1"
                     /protein_id="XP_022678186.1"
                     /db_xref="GeneID:34718329"
                     /translation="MENKNAAEEPLERPNVKEVKRESPKDEVKVKVQNQGQRPVIVPA
                     TKPNIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQ
                     DPTLSGADSIGDLMEKIPVREAEEEEILQVHSREHLEFITKTEQLERERLLKETEGGD
                     SVYFNNDSFLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEVAGGFCLFSN
                     VAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKTFYEDDRVLYVSLHRFQLGKYYPG
                     TIHGNYDQTGEGKGEGFNCNITWPSGGVGDAEYMWAFEQVIMPLGREYEPDLVIISSG
                     FDAADGDTIGQCHVTPACYGHMTHMLMSLAKGNLCVVLEGGYNLDAIAKSALGVTKVL
                     LGEPPDELPNPKKQPTPEAIKIIETVIKTQSKYWTCFKNRHGNDGINFKDAVTSSLDT
                     RNFPLLNAIRDYQVNQLSSQYGFSQLPILDMDLPANTMLCTSGIQDSDTLIVIVHDTP
                     EIWSERDSQTGIIDPSSSIIVDNALKMIKWSIDRKYGIIDINIPQTIFEQANYPGVVS
                     SQEILIYLWDNYLKFFQNLQKLAFVGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKP
                     LKVMVPLIDESLGDWYFKNSLVFTSNSHSCWGSAANDTKKLRKKYGRVLKADCDGMTN
                     IFDERFEEATDFILDSFEEWSESE"
     gene            complement(<295619..>298114)
                     /gene="PRK1"
                     /locus_tag="KLMA_80133"
                     /db_xref="GeneID:34718330"
     mRNA            complement(<295619..>298114)
                     /gene="PRK1"
                     /locus_tag="KLMA_80133"
                     /product="actin-regulating kinase PRK1"
                     /transcript_id="XM_022821869.1"
                     /db_xref="GeneID:34718330"
     CDS             complement(295619..298114)
                     /gene="PRK1"
                     /locus_tag="KLMA_80133"
                     /codon_start=1
                     /product="actin-regulating kinase PRK1"
                     /protein_id="XP_022678187.1"
                     /db_xref="GeneID:34718330"
                     /translation="MNQPHIEKYAPGTVLPVGSHQVKILKYLASGGFAHVYSVQISPP
                     DPVCPDNIACLKRVVVPDKANLNTLRAEVDTMKTLRGNQCVVSYIDSHATKSPVNPGM
                     YEVYLLMEYCSRGGLIDFMNTRLQHRLTESEVLNIMSQVCQGVAAMHALQPPLIHRDI
                     KIENVLISKNGQFKLCDFGSVSGVIRAPRNTEEFNYVQYDVMKNTTAQYRSPEMIDLY
                     RGLPIDEKSDIWALGVFLYKVCYYTTPFEKNGESAILSSTFQFPSYPQYSDRVRNLIS
                     VMLRVDPLKRPNICQVLEEVSRIQGVPCPIKNFYLLRVMDKHSPKNLSPVPPQLLSSP
                     SHMAMPNQHQHQHQHQHQHQHQNQHQPELQPSSINAVPAQNMNHMPFLHISKSQPSIG
                     QMDYAPFVPNVVHTSMKSSNKDYSTSDPFLKIDKSALLTQTPSKIDGMPKGFKGPSLE
                     YQQPPPQQYQQQTQPQPQPQPQRLTRAQTVTPRNSVSPVRVGGGRGAIASIVASNKTS
                     IDKPRYVDSETQTSEIPSELNLSRSTSKKSIASSTLSLSSTESLEAISTGGSLTRRMS
                     NTLKKVVTGEKRGFSPIRSAQNTGESVKSAFNALRKGISTLQFTGDGNSRKNSQEFRK
                     YRNASNTSIPERSESNNKAHRRSTSSFSFVPENGEHDPKRDSNIDVTPVSLRRSSSLK
                     ASSSIQKRVKDLINAKDIPNNSTATGYGKYTDSMRKKELDHRKSKSVIFNNNKKIDGN
                     NNSKTNDERKSSVVLTPLKVSTKTKPVPPPKPAHLKPNLPPKPKHLKSKSTVSTPSIG
                     KKSDQETDIDSEESDFPTPDTIRDFERRFPSAL"
     gene            298642..298717
                     /locus_tag="KLMA_R810"
                     /db_xref="GeneID:34718796"
     tRNA            298642..298717
                     /locus_tag="KLMA_R810"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:34718796"
     gene            <298920..>300203
                     /locus_tag="KLMA_80134"
                     /db_xref="GeneID:34718331"
     mRNA            <298920..>300203
                     /locus_tag="KLMA_80134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821870.1"
                     /db_xref="GeneID:34718331"
     CDS             298920..300203
                     /locus_tag="KLMA_80134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678188.1"
                     /db_xref="GeneID:34718331"
                     /translation="MSFNKYKCHYFEENNWCLKLSPLYQHGLVTSLSNGSIHLMDWNN
                     LKTISSIQCHGSSINDMKVINSDFDAGSLIATAAEDGVKVWDVRSKSNVALLQNEKSS
                     PFYSLDSRHNLLACGTELKDYDAELHIYDIRNWSKPVRSFIDSHHDDITDIKFHPCDP
                     NLLMSGSTDGYVNIYDLTQPEEEDALHQVINFASIHSCGWLAPNRIWSLSHMETFAVH
                     ELNDKSNDMVEPKPLEFGDIREKWGCDYVIDVYPSFIATGKSHDTRGELKIIPFQNER
                     ADVENALVIPDAHGNEVIRDVLIPKNSNNLLYSCGEDGYVNVWKDTTNSLNVPSEFWD
                     YTQPFVAFANSVAEVDMDMDETMETGATHTQESSDSSSSSSSSDEEDKKKKKDKKDKK
                     SKKDKKDKKKKDKKTKKERKEKKSKKDKEHRYKPY"
     gene            <300511..>302322
                     /gene="BDP1"
                     /locus_tag="KLMA_80135"
                     /db_xref="GeneID:34718332"
     mRNA            <300511..>302322
                     /gene="BDP1"
                     /locus_tag="KLMA_80135"
                     /product="transcription factor TFIIIB component B''"
                     /transcript_id="XM_022821871.1"
                     /db_xref="GeneID:34718332"
     CDS             300511..302322
                     /gene="BDP1"
                     /locus_tag="KLMA_80135"
                     /codon_start=1
                     /product="transcription factor TFIIIB component B''"
                     /protein_id="XP_022678189.1"
                     /db_xref="GeneID:34718332"
                     /translation="MSSVVNKSAKRFVPKLRERRQISSAQTSSAQKPVGPAGPGETPE
                     TVVSANKASEVENAEPSEASNQGEVEKSETQNENENESGKVLSGSAVETTGSGENQDN
                     IGKNGGVTFEEDDPLSQTTMARDLGPSRTSTQIPVVAVSSTASRRRSSRLDSLSAAKP
                     TFKSGFMGANPANGSVSGSVPEKSRRLSTISTGSLRKKSLSINSENDSSLQAIKRRRM
                     SSRSSVGKGSGKVQRISIVSRMSSPDDDSLTAKPAGDAENTDDIFQRTDDLYQKYTIA
                     NLKMIPKKIADTDSSKYLIDEENFTMADLCKPTLPIGEISENFTRAKEAARLKAERRK
                     KRRELRETARREFKSLNDLVTEEESKLKEERKKAAQELLNTEVPDEKPRQGIQLKMSA
                     DGSMVVDEESTVVDRHKNASLENSSKEKIQNNPFENLYNSATYGRQQFTDPWTTEEMI
                     KFYQALSMWGTDFNLISQLFPYRTRRQIKSKFVNEEKKHPIMIELALRSKLPPNFDQY
                     CQETRKTIGTVHEFNKRLDQLQVEHEEHLKQIEVERQNAREQDIKQQSVKEHERAQRG
                     KQGGRQEQLREYRKSEIVLGSIDDLKKKRAEEVTEET"
     gene            <302583..>303065
                     /locus_tag="KLMA_80136"
                     /db_xref="GeneID:34718333"
     mRNA            <302583..>303065
                     /locus_tag="KLMA_80136"
                     /product="conserved hypothetical protein containing PIG-H
                     super family"
                     /transcript_id="XM_022821872.1"
                     /db_xref="GeneID:34718333"
     CDS             302583..303065
                     /locus_tag="KLMA_80136"
                     /codon_start=1
                     /product="conserved hypothetical protein containing PIG-H
                     super family"
                     /protein_id="XP_022678190.1"
                     /db_xref="GeneID:34718333"
                     /translation="MPIVVTELGTEHIVQFVSKDRSVGHFLSRQIPLICMYALLIISS
                     HIYQLQNVNSAVVYGVVLLLCVRAPITDYVQSIPCQGIQIASSGGLLLLPQSINKALF
                     STVKFIPQDQIEDVFINEAFKGLLVVSYLALVVKDQYELQVLFEVCHVIFITLHHIIV
                     "
     gene            <303348..>304322
                     /locus_tag="KLMA_80137"
                     /db_xref="GeneID:34718334"
     mRNA            <303348..>304322
                     /locus_tag="KLMA_80137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821874.1"
                     /db_xref="GeneID:34718334"
     CDS             303348..304322
                     /locus_tag="KLMA_80137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678191.1"
                     /db_xref="GeneID:34718334"
                     /translation="MARKLKGKSSSKGLKGALLRHQEIEKKTIKLKKRQQHELAKGKP
                     TKQPERQRELQKERGSGFIPFKKDSTVLLVGEGDFSFAKSIIEEGYVAPEKLVVTSYD
                     SGVKELQLKYPNSFDENYNFLKENNVTVLFGVDATNLIKTMKITKKTPWHKVAGSQWA
                     STKLEFIVFNFPHTGRGIKDQDRNIFEHQQLMHKYFASCKQLFQLVNNNQQGKASTES
                     MGGYLTNSDANVDDKGFGKVCLSLFTGEPYDSWQIKILAKDNGWKVQESGKFDWNKFP
                     AYRHRRTNNEMTTTKPAEQRDARMYVFEMFNKRKHSKKPLKGDDSDSD"
     gene            complement(<304358..>305767)
                     /gene="FYV10"
                     /locus_tag="KLMA_80138"
                     /db_xref="GeneID:34718335"
     mRNA            complement(<304358..>305767)
                     /gene="FYV10"
                     /locus_tag="KLMA_80138"
                     /product="protein FYV10"
                     /transcript_id="XM_022821875.1"
                     /db_xref="GeneID:34718335"
     CDS             complement(304358..305767)
                     /gene="FYV10"
                     /locus_tag="KLMA_80138"
                     /codon_start=1
                     /product="protein FYV10"
                     /protein_id="XP_022678192.1"
                     /db_xref="GeneID:34718335"
                     /translation="MTSLNEPSVDFHLKLNQQQFNIPSELLKRNWDKCNKLYSSYSQE
                     LQEQFGVLETLLEDPANDEKSIEKLNDIINTVGVLQKRLTHLHDYEMKILNRIEKRVA
                     YFKEFQRFKDESNNDGILKWYKSYTDILISDYLVRHGSNFTNCNDNEGKVNPGIEFIR
                     NRGLEDLIDYEILVESNKISIELLANKNLGPLLEWIENNQDYLVKKGSHLQFQALLQQ
                     YIELVRSSDYRGAIRCFQKHLFKFVDVYPMELKLAAGILAFFKSCLSDSKEDEMDNGQ
                     RLFQSYFRKPMYKTTPLSSLSANNVVRNAELHRYGPLLSSERWESLNEMFLHEFYSLY
                     KISYHDPLLIYVSLGISSLKTKDCGHTLSNQLIPHSNVDLNEYVKSNVVNTDCPVCNP
                     DIHPLSENLPYAHHVQSSLFENPIMLPNGNIYDSDKLVLLSKKLNKLGYTNLNDNQVM
                     DPIDKSIYSVTDFITMYPT"
     gene            complement(<306330..>307415)
                     /gene="IDH1"
                     /locus_tag="KLMA_80139"
                     /db_xref="GeneID:34718336"
     mRNA            complement(<306330..>307415)
                     /gene="IDH1"
                     /locus_tag="KLMA_80139"
                     /product="isocitrate dehydrogenase [NAD] subunit 1"
                     /transcript_id="XM_022821876.1"
                     /db_xref="GeneID:34718336"
     CDS             complement(306330..307415)
                     /gene="IDH1"
                     /locus_tag="KLMA_80139"
                     /codon_start=1
                     /product="isocitrate dehydrogenase [NAD] subunit 1"
                     /protein_id="XP_022678193.1"
                     /db_xref="GeneID:34718336"
                     /translation="MFKQSIASQKKSFATLAAEQLLPKKYGGRYTVTLIPGDGVGKEV
                     TDSVVKIFENENIPIDWETVDISGLDNTENVQKAVESLKRNKVGLKGIWHTPADQTGH
                     GSLNVALRKQLDIFANVALFKSIPGVKTRLSDIDMVIIRENTEGEYSGLEHESVPGVV
                     ESLKIMTKAKSERIARFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNTVNEIGASEY
                     PEVDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGSALIGGPGLVPGANFGR
                     EYAVFEPGSRHVGMDIKGQNVANPTAMILSSTLMLRHLGLNAYADRISKATYDVIAEG
                     KATTKDIGGSASTSEFTNAVIEKLSKL"
     gene            <308321..>308806
                     /locus_tag="KLMA_80140"
                     /db_xref="GeneID:34718337"
     mRNA            <308321..>308806
                     /locus_tag="KLMA_80140"
                     /product="ATP synthase assembly factor FMC1"
                     /transcript_id="XM_022821877.1"
                     /db_xref="GeneID:34718337"
     CDS             308321..308806
                     /locus_tag="KLMA_80140"
                     /codon_start=1
                     /product="ATP synthase assembly factor FMC1"
                     /protein_id="XP_022678194.1"
                     /db_xref="GeneID:34718337"
                     /translation="MSSTTTVSTYRALLKSLVRSGKHNRLQQLEQERKKQIAMLTYQR
                     MQLVRDQQSFKGKSSLEQSKLIKQLNAVGKKIEELKKEDLSKSKQLLFYSHSGHLKEI
                     VKSLKDDARSLEHLKDISAFVINQSEYEELIERYNPGLKMSQDEKVQRTANRVGLQVP
                     E"
     gene            complement(<309160..>310947)
                     /gene="SGA1"
                     /locus_tag="KLMA_80141"
                     /db_xref="GeneID:34718338"
     mRNA            complement(<309160..>310947)
                     /gene="SGA1"
                     /locus_tag="KLMA_80141"
                     /product="glucoamylase"
                     /transcript_id="XM_022821878.1"
                     /db_xref="GeneID:34718338"
     CDS             complement(309160..310947)
                     /gene="SGA1"
                     /locus_tag="KLMA_80141"
                     /codon_start=1
                     /product="glucoamylase"
                     /protein_id="XP_022678195.1"
                     /db_xref="GeneID:34718338"
                     /translation="MGGATMMLGSKYRGENKVTKTTHFFVSFVCISSFLVYYFLFSPL
                     RAGYYENQFSDGSGQYIQVIDFNKVSDFQLQPIPFSKNISRTDFNQWLKDQERVSFER
                     MFDNICNEESSGKFDNCFPGVVFASPSKSKPDYFYHWIRDGAITINTLINTYSEVDKE
                     RTLKTVLNYVNASIDLQHRSNPSGPVDDPLLRNLGEPKYHVDNSPFEQVWGRPQNDGP
                     PLRAIALLNFLNSMNVSSSSDANSDYQWIFDDLITLDLKFVLYNWHVSSFDLWEEVDA
                     YHFFTSMVQLKALVDGRAFILKKLSSGIALTSAEDDLLKDLEAGIDKVESFIKSSSSG
                     FINHEKGYIVETPSNLDQRSGLDIAVIMASTLTHDSEDENDGYFTNYDQFSFLSAAPG
                     PSSSSFTSADKTDTPFLFDIDDPLILNHFNELVEKMAILYPINHNRLGTNMGVAVGRY
                     PEDIYDGIGISEGNPWFISTLTSAELIFKLVHKMHITQEPLIIEPLKNKFWHKIFAFG
                     NLQNTSVMIPYNSLAFNQTLYTIFKYGDSFLSKVNEHVSDQGHMSEQFNRYHGYNQGA
                     ENLTWSYGTFANALRWRQIVDNLIHPTNI"
     gene            <313419..>314072
                     /gene="NCE103"
                     /locus_tag="KLMA_80142"
                     /db_xref="GeneID:34718339"
     mRNA            <313419..>314072
                     /gene="NCE103"
                     /locus_tag="KLMA_80142"
                     /product="carbonic anhydrase"
                     /transcript_id="XM_022821879.1"
                     /db_xref="GeneID:34718339"
     CDS             313419..314072
                     /gene="NCE103"
                     /locus_tag="KLMA_80142"
                     /codon_start=1
                     /product="carbonic anhydrase"
                     /protein_id="XP_022678196.1"
                     /db_xref="GeneID:34718339"
                     /translation="MSPVASDFVPFKLHASSSVDEYLKANEEWRKQMQNEHPTLFTLN
                     GQGQDPHTLFIGCSDSRYNENIIGVLPGEVFTFKNIANKVNPEDMTCLATLEFAINVL
                     KVNKVVICGHTDCGGIKTCLKDQRKDLPAIECSHLHHYLQDLDDLCHENKALLNSPEY
                     QNSLEKQSRLLSILNVKKQFKNLLSIDTVQKALANNSIQTYGMLYNVDSGKVELVDV"
     gene            <316305..>317930
                     /gene="XBP1"
                     /locus_tag="KLMA_80143"
                     /db_xref="GeneID:34718340"
     mRNA            <316305..>317930
                     /gene="XBP1"
                     /locus_tag="KLMA_80143"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821880.1"
                     /db_xref="GeneID:34718340"
     CDS             316305..317930
                     /gene="XBP1"
                     /locus_tag="KLMA_80143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678197.1"
                     /db_xref="GeneID:34718340"
                     /translation="MPSATRDVSFQVHSLDGIPLQLSTDPLDDYQRYLFQEVYELMKP
                     SLSQFPHALQSQLSIEQKEYKTNTVFEPEQLMEDDGSIEKRRNSGDRLLMDYGLRRAK
                     NPGQADKDTANSVHKKDFRRYSHNYAPVGSGHYVMKARPKKSVSLLCNEYTIPDISRN
                     PMTQSTFDPNYQPYLQITPYNILALNEEQQQQQQQQQQPDENRLPRHEQSGGSVSPTD
                     QDLEHVISMSNKPGSNVTKNQEFRMMKLKAKSNQSMIINRNNCVIWDRETGYVFFTGI
                     WRLYQDVMKCLCTTNRMYQQDQSSRVHCCKEFQKVLGQVVYGKLGKPGKRETAGKWNK
                     WSQKDMFASYNDLHWHKLDPALSSLLAESYNSAIPFEDMVKRIRGGYIKIQGTWLPFP
                     VSKELCSRFCYPIRYLLVPVFGEDFPKKCEFWYMQRCEQSPSLSSSLSPVSNPSLTTS
                     TLTSDEKDSLNTAQDLLNISRRYSWNEVKNPSIVQHIHLPNRHYRSQSWTGIVQSSNK
                     PYYQQEERRKSSDVTLPPIQYLFDDLRKSYLDD"
     gene            <318651..>320999
                     /gene="COG6"
                     /locus_tag="KLMA_80144"
                     /db_xref="GeneID:34718341"
     mRNA            <318651..>320999
                     /gene="COG6"
                     /locus_tag="KLMA_80144"
                     /product="conserved oligomeric Golgi complex subunit 6"
                     /transcript_id="XM_022821881.1"
                     /db_xref="GeneID:34718341"
     CDS             318651..320999
                     /gene="COG6"
                     /locus_tag="KLMA_80144"
                     /codon_start=1
                     /product="conserved oligomeric Golgi complex subunit 6"
                     /protein_id="XP_022678198.1"
                     /db_xref="GeneID:34718341"
                     /translation="MDFLDFPALVATEEPAALPQPASRLSLETLGIQGDQEEQTFVLP
                     SIDNDEAEFSDLHSKMKHFASVSLQELKHDSLEDKSNKTSTSAILANIEKPVSTNQLL
                     SKKINDIVNSSNYSSFSSDSEVRHALQILEKNHSNIAVQYDQLVASDFVGVLHRKSLR
                     SKLENSMLNSHSEILSNFHFVARRIKRLSEPLERINKAMEHINEADTPKVFEFDQIRE
                     KLEKLKARREVVVKLRDSLTLNQLELDNLQNGNIDESFFKILDKINFIKEKATYLLSD
                     EKTTAAGTSLLKSMNNYLMISNKRMYNYLLNFIDEYDTLSRQYGERTIGDEALSKFQT
                     SLVHLSSDVQFLQDFLSRISTLRSKRLLDDFLSQFDIDNKKLERPIILSAHDPVRYLG
                     DVLAYLHSMIVNELEFLKSIFKLNPELITSDSILKDNMEYVQDLHLKLLNKIFASLSN
                     TVRIRLEQIVRFENDPLLNLDIVQCLSLYQMMFTRSGISESSILITSIHDLENLARSK
                     VITTLSTYLNDLNKDQMVPNDLLPPDWFSDYLSKLSQIMSKIDQQNETKILTKDFYDK
                     LIVEPVDQMLTKTIHDWFPNSKKDKSEKINMLIAQINSLDLIKSKIGAFHNTLFADGY
                     GANVYDKINSQYTSFASKLKDLMMTYLLDSTGMEIYYNLFNMIFPIVSVQDELDHEMY
                     LSAIENPIMKLPTVSENVHHKLNEYIPFALTDFQDAKLYNLMPPSIEEDIVSSCFDTF
                     IKFYIIFKSVLFKLYPDRVEDVSTTLNFSGDEVATLLAVKEE"
     gene            complement(<321039..>322319)
                     /gene="DPH1"
                     /locus_tag="KLMA_80145"
                     /db_xref="GeneID:34718342"
     mRNA            complement(<321039..>322319)
                     /gene="DPH1"
                     /locus_tag="KLMA_80145"
                     /product="diphthamide biosynthesis protein 1"
                     /transcript_id="XM_022821882.1"
                     /db_xref="GeneID:34718342"
     CDS             complement(321039..322319)
                     /gene="DPH1"
                     /locus_tag="KLMA_80145"
                     /codon_start=1
                     /product="diphthamide biosynthesis protein 1"
                     /protein_id="XP_022678199.1"
                     /db_xref="GeneID:34718342"
                     /translation="MSITNEETAVKTKPRRRFVGIKKTVGESTENSSGSDLVRKSRPK
                     TNIRHAINQIPAEILEDEDLNSAIKLLPSNYNFEIHKTVWNIKKHNAKRVALQMPEGL
                     LIYSLVISDILEQFCECEIVVMGDVSYGACCIDDYTARALGCDFIVHYAHSCLVPIDI
                     TAIKVLYIFVTINIDETHLMKTLQKNFDRGSRIATFGTIQFNPTIHSIKDKLLESEEK
                     MLYIIPPQIKPLSKGEVLGCTSERLDKEQIDAMVYVGDGRFHLESAMIHNPEIPAYRY
                     DPYSRKFTRERYDQKQLVEVRASAIDQARSSKKVGLILGALGRQGNLATVENLEQKLK
                     DSGRTVVKIILSEIFPQKLAMFDDIDAFVQVACPRLSIDWGYAFNKPLLTPYEANIML
                     ENDRMFNEKYYPMDYYHVDGYGRGKVPNHDNVTI"
     gene            <322690..>324111
                     /gene="SHQ1"
                     /locus_tag="KLMA_80146"
                     /db_xref="GeneID:34718343"
     mRNA            <322690..>324111
                     /gene="SHQ1"
                     /locus_tag="KLMA_80146"
                     /product="protein SHQ1"
                     /transcript_id="XM_022821883.1"
                     /db_xref="GeneID:34718343"
     CDS             322690..324111
                     /gene="SHQ1"
                     /locus_tag="KLMA_80146"
                     /codon_start=1
                     /product="protein SHQ1"
                     /protein_id="XP_022678200.1"
                     /db_xref="GeneID:34718343"
                     /translation="MITPRFTIIQDEEYINVQIKVSSIRFNASTMELVIDGCMFIFHL
                     SPYYLRLRFSDELVEDETLNKVEYDSKHESINCKILKAVKGTEFKDLDLPVKLLAAKN
                     EQPKPTSGPLIQELDAKEETIADIREEGQQFDWEIKQEITSDDTPITKYGFNNSYSGY
                     MNVSISNGNDINELDDPEHTNAEDRVKERLKKENLKFDPEYFAAEYMTSKYGDEEELQ
                     INGIKQLLNYTPPLCQSYRTWYSQLDPEQKEMNVSFPVEFTEKEQNQMHEHLPRKTYL
                     VNDIKTQYLTILSILYSYTFEQIENEGNHTTESHWTIGKLTPQIAMLDQQILLSESMS
                     EFSQIKAIIVTAIRRTLSYPLHRNYDLCIKAWNDTIDLLLGGKRLVIKALLDVHELYR
                     YHDVYYVYNKILLDDLCAWFISQGNDNVIKSLALQAKKELSNVDKSSIEFECVSGINE
                     ETGEVEWETLTVAEIEQLVEQEK"
     gene            complement(<324229..>325317)
                     /gene="BOP3"
                     /locus_tag="KLMA_80147"
                     /db_xref="GeneID:34718344"
     mRNA            complement(<324229..>325317)
                     /gene="BOP3"
                     /locus_tag="KLMA_80147"
                     /product="protein BOP3"
                     /transcript_id="XM_022821885.1"
                     /db_xref="GeneID:34718344"
     CDS             complement(324229..325317)
                     /gene="BOP3"
                     /locus_tag="KLMA_80147"
                     /codon_start=1
                     /product="protein BOP3"
                     /protein_id="XP_022678201.1"
                     /db_xref="GeneID:34718344"
                     /translation="MSNDRLPEVPALAVLLGSNVKTWPYSEETLVQALQLRSQQEQTK
                     RQYYKLEQVNQSLELLKTAVNAGIPAPQIPLLFNSETAPTNEAESTDVRQMIYAKEQS
                     PISSIPDKQPRNYKFPPTNQPAKQQVKPLVGSEMKTHRRTHSPARIGAEAVAALNSNM
                     LLKEEDSHGSSKASTPQTNTHKRMQSLPTLKNEPTTGVLNFSAWHTYSAQGSGNNGFP
                     KRPSTISPTTGASGPSSFPSSVRKHRRTSSTNSAFGVIDLNSINQISFKQSHSRSASV
                     QDPRINTHSNSNSNHNSNINSNVDTKKSAGSAKVDINSTGSSEGTNDDTFSEPGSNDT
                     SLEQVRKNPNSPKLLLKGPNYVDNLLNT"
     gene            complement(<325823..>326483)
                     /gene="YIP3"
                     /locus_tag="KLMA_80148"
                     /db_xref="GeneID:34718345"
     mRNA            complement(join(<325823..326329,326460..>326483))
                     /gene="YIP3"
                     /locus_tag="KLMA_80148"
                     /product="prenylated Rab acceptor 1"
                     /transcript_id="XM_022821886.1"
                     /db_xref="GeneID:34718345"
     CDS             complement(join(325823..326329,326460..326483))
                     /gene="YIP3"
                     /locus_tag="KLMA_80148"
                     /codon_start=1
                     /product="prenylated Rab acceptor 1"
                     /protein_id="XP_022678202.1"
                     /db_xref="GeneID:34718345"
                     /translation="MSNLSQLSQISSFAQNLSFDRIKSEIGSFQNKLSSVRPPQEFFD
                     LKRISKPQNFGEVQSRVGYNLGYFSTNYALIVGALSVYSLLTNFLLLIVIVFVFLGTM
                     GINKLNGADLVTPFGSFKTSQLYTGLLCVAVPLGFLASPISTLMWLVGASIVSVFSHA
                     AFMEKPIETVFEEETV"
     gene            complement(<326890..>328857)
                     /locus_tag="KLMA_80149"
                     /db_xref="GeneID:34718346"
     mRNA            complement(<326890..>328857)
                     /locus_tag="KLMA_80149"
                     /product="leukotriene A-4 hydrolase"
                     /transcript_id="XM_022821887.1"
                     /db_xref="GeneID:34718346"
     CDS             complement(326890..328857)
                     /locus_tag="KLMA_80149"
                     /codon_start=1
                     /product="leukotriene A-4 hydrolase"
                     /protein_id="XP_022678203.1"
                     /db_xref="GeneID:34718346"
                     /translation="MICKRFPRAIVSSNLITTRYLHASSKIAMPLPPVLESRRPKQAP
                     EFDYSTVSNYKSFLVKKSQLDVTVDFDKKTISGRVSYEIEKRNADETAIKLDTSFLDV
                     SKVQVNDEENVKFEILPRSHPLGSQLVATPSVLPEQFKLSLEFSTTDKCTALQWLDVH
                     QTSGKPYVFSQLEAIHARSLFPCFDTPSVKSPFVANIKSELPVVFSGIQTGFDEATKT
                     YTFEQNVPIPAYLIGVASGDLVSASIGPRSKVYTEPYRLKDAVWEFDGDVEKFITTAE
                     EIIFKYEWGTYDILVNPNSYPYGGMESPNMTFATPTLIAHDKSNIDVIAHELAHSWAG
                     NLVTNCSWDHFWLNEGWTVYLERRITGAIYGEATRHFSALIGWNDLDNSISAMKNPER
                     FSCLVQNLKDGADPDDAFSTVPYEKGSNLLFHLENVLGGKEAFDPFIKHYFSKFARQS
                     LDTWQFLDTLFEFFHDKRAILEAVDWETWLFTPGMPPKPELITDLADNVYSLANKWIA
                     AAQEFSDPQQFLKTFSANDVASFSSNQIVLFLDTLVQGGQPENSAFSWSSHRDACEAF
                     CSIYDEKIGKSQNTEVIFRKFRLQIKSHDTTAYNALAEWLGTVGRMKYVRPGFRLLNE
                     VDRDLAIRTFEKLQDTYHPICKALVKQDLDL"
     gene            <331216..>333198
                     /gene="SLM1"
                     /locus_tag="KLMA_80150"
                     /db_xref="GeneID:34718347"
     mRNA            <331216..>333198
                     /gene="SLM1"
                     /locus_tag="KLMA_80150"
                     /product="phosphatidylinositol 4"
                     /transcript_id="XM_022821888.1"
                     /db_xref="GeneID:34718347"
     CDS             331216..333198
                     /gene="SLM1"
                     /locus_tag="KLMA_80150"
                     /codon_start=1
                     /product="phosphatidylinositol 4"
                     /protein_id="XP_022678204.1"
                     /db_xref="GeneID:34718347"
                     /translation="MLSQNQFSLQQLQHIQQQPTRSLTSTDNTNVNMNFQQIPQGQPV
                     QQVAQGQQPGNRASQSVPYPTDNISIDANQPRLSINADAGVAGNSGILDEGLSFHHVT
                     SGGNLSLQQLQQQQQQQQQLRQQTNSLTSAQTQASRNRQSLQMHRSNNQLDPRSPLVV
                     LMPTNANPTEVLAQRFAAWRSIIRSLLVYLQETVSIQDELVRQHLRLQHAINFPFFTI
                     DNQYQPTTPEEKNMQRFFVPLGHGSIQDLPTLFNQYHTQMVHAASKASKELNTEVIPR
                     LEDMRRDLLVKIKEIQSLESDFKNSCSRELQETKIRLKAFQDSLEAAKYGSVKEDPYL
                     TKILLEKQIKKQLTEENFLHEAFNNIQTSGKELEKVVMMEIQNALTIYARLLGQEAQL
                     VFDTLITKLDSGFFSKDPVFEWENFVAKDSNFIDPNLPMRRIKEIVYKNQNDPFTYEI
                     KSGVLERRSKFLKSYSRGFYVLTPSFLHEFKSGDRKKDLVPVISLSLNDCTVAEHSKK
                     GSSDFKFILHTKQNGIIHRGHNWVFRTDSYESMMDWFNNIKKLTSISNPVEKARLVNE
                     KLVQDREGPKSNLDQSQSTPQNNQAPRISFDNEDSMLATPKTENEVNAFSETTGNTTL
                     NNSVVEHMNKGANFTTPKNPRKSAQYSLDSRTANGT"
     gene            complement(<333450..>335162)
                     /gene="ALG11"
                     /locus_tag="KLMA_80151"
                     /db_xref="GeneID:34718348"
     mRNA            complement(<333450..>335162)
                     /gene="ALG11"
                     /locus_tag="KLMA_80151"
                     /product="alpha-1,2-mannosyltransferase"
                     /transcript_id="XM_022821889.1"
                     /db_xref="GeneID:34718348"
     CDS             complement(333450..335162)
                     /gene="ALG11"
                     /locus_tag="KLMA_80151"
                     /codon_start=1
                     /product="alpha-1,2-mannosyltransferase"
                     /protein_id="XP_022678205.1"
                     /db_xref="GeneID:34718348"
                     /translation="MMSLAKFITFFLGLLLFLLVSLRVLSEFIPSLLVSLPPKLRLRV
                     NNSLLRCSNNLNRIPVLNFGWKNASVRRAFVLAAIRPSDYTNKIYGDRVAISYYDRKD
                     RESFVGKLGQETKRKIFGFFHPYCNAGGGGEKVLWKAVESTLNHDENNICVIYTGDND
                     VSGIDILKSVERRFEYRLDSNRIVFIFLTKRNLVEAKRWPKFTLLGQAIGSIILSIEA
                     LSILTPDYWVETMGYPFGYPFVSWFANIPIITYTHYPVISTDMLNKLKNMSGFRTNIK
                     LNIKYLYWKMFMLIYRFAGSFVDIATTNSTWTYNHIKSIWPSTRNIQIIYPPCSTESL
                     IEGSNKIDNKDRKNQIVAIAQFRPEKRHDLILSSFSSFIKTNDNKLSVPKLILIGSTR
                     NQSDRDFVESLKKFAFEELKILPEYLEFKTDCKYEDMKNILYSSWFGINAMWNEHFGI
                     AVVEYMASGLIPLCHASAGPLYDIVVPWDDKKNEQTKDEAKYTGLFFKDKSDPDFSSK
                     DASKYSTLSDLFAEAAKLGLSERIEVSKRGKQCALTKFSDAKFEKSWHAVLDEIKTIQ
                     SLNV"
     gene            complement(<335523..>336677)
                     /gene="MOB1"
                     /locus_tag="KLMA_80152"
                     /db_xref="GeneID:34718349"
     mRNA            complement(join(<335523..336450,336658..>336677))
                     /gene="MOB1"
                     /locus_tag="KLMA_80152"
                     /product="DBF2 kinase activator protein MOB1"
                     /transcript_id="XM_022821890.1"
                     /db_xref="GeneID:34718349"
     CDS             complement(join(335523..336450,336658..336677))
                     /gene="MOB1"
                     /locus_tag="KLMA_80152"
                     /codon_start=1
                     /product="DBF2 kinase activator protein MOB1"
                     /protein_id="XP_022678206.1"
                     /db_xref="GeneID:34718349"
                     /translation="MSFLQNFHLSPGQTIKSTRGFKWNTAKNNKTGNTDASTLGDGNG
                     LQANTFNSELNLQRSDDALQQQQQQQQHLHQQQFSTPQKQATNFFQQGIEHGPTPVTD
                     FNYTPSHQRPYIQPTSGTVVSSHQDLRQIVETTLGSKGVLNQAVKLPKGENIDEWIAV
                     HCVDFYNQINMLYGSITEFCSPQTCPRMIATNEYEYLWNVHPGKPPVSLPAPKYVDYL
                     MKWCQQQFDDENYFPSKPGVPFPKDFKDNIARPILKRLFRVYAHIYCHHFNEILELNL
                     QTVLNTSFRHVCLFSEEFHILKTNDYGPLLELVTEFKDR"
     gene            <337958..>339706
                     /gene="PFK26"
                     /locus_tag="KLMA_80153"
                     /db_xref="GeneID:34718350"
     mRNA            <337958..>339706
                     /gene="PFK26"
                     /locus_tag="KLMA_80153"
                     /product="6-phosphofructo-2-kinase/fructose-2"
                     /transcript_id="XM_022821891.1"
                     /db_xref="GeneID:34718350"
     CDS             337958..339706
                     /gene="PFK26"
                     /locus_tag="KLMA_80153"
                     /codon_start=1
                     /product="6-phosphofructo-2-kinase/fructose-2"
                     /protein_id="XP_022678207.1"
                     /db_xref="GeneID:34718350"
                     /translation="MYYCKVFNVGNTRRQFAKEHNMKEQDSKFFDPNDEHSKMLREKW
                     AMDTLDQLLDYLLKGPGSVGIFDATNSTRERRKKILQKIHEKNKFIKVLYLESICSDK
                     ETVEKNIRLKLLGPDYKGKDPDSSLIDFKERLSNYMKSYQTIEDDENVPYIKMIDIGK
                     KIVSYDIQGFLASQTVYYLLNFNLAERQIWISRSGESEFNVQGRIGGDSLLTQRGWKY
                     AKALARFMEEQKKLFNERQMKEHLKVCSDEGSKRDFTPTEFFVWTSMKKRAMATSSTF
                     NDAHFDIKQMKMLDELSAGDFEGMTYEEILRNHPAEYEERLEDKLRYRYPGIGGESYM
                     DVINRLRPVITEIERITDSLLLITHRVVARVLLGYFLNLSKDVISNLDVPLHSVYCLE
                     PKPYGVSWYLYEYDEEKDTFFKVPQSELNTMKVKEVGLVHQERRYSIIPTAPSTGGKS
                     RSGSHSSNNTSSSSTAASSARMPSFNPPFSASAHMNAASRFIHPGRQHPAYQTHPSLL
                     ARTMSRNHSSDHVGIIKKSVSPRELSNSIELDKLNEKLSKLASSDESKNGESDDTPAG
                     VPLTRSQSESYSPKAS"
     gene            complement(<339869..>341923)
                     /locus_tag="KLMA_80154"
                     /db_xref="GeneID:34718351"
     mRNA            complement(<339869..>341923)
                     /locus_tag="KLMA_80154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821892.1"
                     /db_xref="GeneID:34718351"
     CDS             complement(339869..341923)
                     /locus_tag="KLMA_80154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678208.1"
                     /db_xref="GeneID:34718351"
                     /translation="MSEITFYNVKSGDEVHTPALIIHGTIKSKATAIQVHHPQLPALT
                     FPVNSHGFKTMVALTPGENSLWFTGDDNTRAQLTLTYVPLLQNPPIHLCLLVGKDSQM
                     TFDSPASQVRKEGGNGLDLAVRKLRMGARIMQAFTNEQMVRNGFGQRTFRFVEEYTRD
                     TLLNDDEMRNTVKIHILRSEKTVAELRDANIAQQNPNAKDGGALFGIAMRELERYGAP
                     FNDNSKTSQAAVMFLDTHWDKKLNLITAHAALGGGTDKIKLAIFGSHGLYSWPTCFQN
                     VVPYLMDDTRTSKAEVANDCNECSTHWECLTVTLGAFMHEIGHLLGCPHQENGVMLRD
                     YVTMNRSFLTREAFSVRTNSYGAQPPILPKNECSWNRLDIVRFLFHPSFSLPQDFYDP
                     EMLRPGQLDRWKYQRPSVFPMGNSTASIRAESGIYCIEIVCGDLARAHLEYLPKQYGG
                     PGPQKEVVVSLDQLRALIPPAQKREYADKFAIKVHAINASTGEFNDFPKIISTQPVPM
                     KQYGFASNVVGIKSTALGNPARGPSTGIIPLKIELCYMVRVYYGSAVDGLRFYTKDAA
                     APPPQLPPRTYLGKVSNMLKGVKDAFPTGPSVLFGNENSTYADLKLEPDEVIAGFNLR
                     SGAWVDGIQIVTSKGRMSEMFGNKNGGSLGSLMPPANKKILGVFGNVSHWVDAFGIVY
                     EA"
     gene            <342908..>345661
                     /gene="SEC24"
                     /locus_tag="KLMA_80155"
                     /db_xref="GeneID:34718352"
     mRNA            <342908..>345661
                     /gene="SEC24"
                     /locus_tag="KLMA_80155"
                     /product="protein transport protein SEC24"
                     /transcript_id="XM_022821893.1"
                     /db_xref="GeneID:34718352"
     CDS             342908..345661
                     /gene="SEC24"
                     /locus_tag="KLMA_80155"
                     /codon_start=1
                     /product="protein transport protein SEC24"
                     /protein_id="XP_022678209.1"
                     /db_xref="GeneID:34718352"
                     /translation="MSHHKKRVYPQAQYQLAEGLAQPMAGAGAPTQPVAPGQQPFLTP
                     AQQHLHQQIDQATAGLGNMQLHNVPVVDPNSFQQAGAPMGQAYPQAYQQPVQPMQQQQ
                     QLPMQPQQPMQQQTYQQQQYQQPGVGVGAGMGVSVGKPMNQLYPVDLFQELPPPITDL
                     SLPPPPLMVPPEKMIVPNETVNHCSEHLRCTMNAIPKNGSLLKKSKLPLAMVIRPYTK
                     LIDADAPTPTTPDGVVVRCRRCRAYLNPFVQIIENGLRYRCAFCNLANTFPQQIDMNG
                     NRYERPEFNSSIVDFVAPKEYAVRPPPPSTYAFVLDVSQAAIKNGLLATTARTLLESL
                     DTIPNHDERTRISIICVDQSLHFFRIPLDEEGDNIKMYDVADLDEPFLPSPSGLLVPL
                     IEARNNIEKLLTSLPEIFQQSIQPKFALAPALKSALNLIRAQGGKIIVVGATLPNVGE
                     GTLHKRNEKAVANTSKEASTLLNTGDAFYKSFPIECNKFQVAVDVFMASDDYVDIASV
                     SNLGRFTGGQTHFYPGFSALNLIDVTKFSKEFSKHVSMDLSFETVMRARASSGLKMTG
                     FYGHFFNRSSDLCALPAIPRDQSYVFELGIDEQLTKEYVYLQVALLLTSNVAQRRIRV
                     ITLAIPTTDKLTDVYASADQLAITAYYAQKGVERAPSSGFEDTREFLNKSVQEVLATY
                     KKEVLTSNTGGAAPLMLCANLRMWPLLMHSLTKHMAFRSGIVPADHRAHALNNLETLP
                     LPYLIQNIYPTVYSLHDMPDEAGLPHEETGEIVLPQPINSTSSLLERYGLYLIDTGLD
                     MFLWIGGDAVPELVTDVFGTPDIMEIPIGKNELPVLDATEFNLRVRNVISKIREHDDV
                     IFYKTLHIVRGASPSEPMNHVSAREVASLRLWTASQLVEDKVQNSWNYREFLQNMKTR
                     ISK"
     gene            <346100..>346918
                     /locus_tag="KLMA_80156"
                     /db_xref="GeneID:34718353"
     mRNA            <346100..>346918
                     /locus_tag="KLMA_80156"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821894.1"
                     /db_xref="GeneID:34718353"
     CDS             346100..346918
                     /locus_tag="KLMA_80156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678210.1"
                     /db_xref="GeneID:34718353"
                     /translation="MVADLKVVSRDELFNERNEEPEAEDSVILPKLEFEFIEVNNAEG
                     STADIDRNTENVDTNNTQEDDEFDFPLFSFGAAAPLDEADNGKAQEEKEEGESRGRSV
                     TKLMKVSLREPSPEVINITRPRSYYFSEYSEAEKQQFRESALDVDSILKEYKLGPYKG
                     WPEYRGKVIDLNEHNAKIDLEQQRMKKLQKKRPSKKQRIARKLGKERELQRIQKDKEI
                     KMMIKKRFHKRGGKKNKKKVPNPLENAGATPKNKPKTSTNSKPKSAPKPKFRTE"
     gene            complement(<346979..>348163)
                     /gene="COG5"
                     /locus_tag="KLMA_80157"
                     /db_xref="GeneID:34718354"
     mRNA            complement(<346979..>348163)
                     /gene="COG5"
                     /locus_tag="KLMA_80157"
                     /product="conserved oligomeric Golgi complex subunit 5"
                     /transcript_id="XM_022821896.1"
                     /db_xref="GeneID:34718354"
     CDS             complement(346979..348163)
                     /gene="COG5"
                     /locus_tag="KLMA_80157"
                     /codon_start=1
                     /product="conserved oligomeric Golgi complex subunit 5"
                     /protein_id="XP_022678211.1"
                     /db_xref="GeneID:34718354"
                     /translation="MSLNDPLQNYEDFLEPDFRPLQFANDILKVTNNGTDGEVLDLKT
                     CLKRCAYDLQELDRRIDHTIQNNPGQVLEQIEKRKAEKEIVGSTLKSNTEYLSMSYNR
                     LQKDVLEPYETALKLQSVSSKIHQTTTLLRTSLLYIHMVSQLQSISLETQSVDDEQLS
                     RGVKVAAIHSQLKANIEQNPNLSTLQFIKSCENNIVAPKRQELLRYLSTNLTRDCMNN
                     VQIEHRSQRITTLMKALHTLSSVDLFDTINSILSSKIQGSSQTLIKTITSIKTFNLAL
                     GDVMDNRNTLLKLENLMKECETSGTSNIFRDYLSQKKNKSLIDQFWTEVSKNFKREFE
                     MSYNRGGPVGKSLQNNAQFIEETIKKCFEVSESESSANDSLKTEQNYMRNAVSILNRS
                     RK"
     gene            complement(<348408..>349685)
                     /gene="HPM1"
                     /locus_tag="KLMA_80158"
                     /db_xref="GeneID:34718355"
     mRNA            complement(<348408..>349685)
                     /gene="HPM1"
                     /locus_tag="KLMA_80158"
                     /product="mitotic exit network interactor 1"
                     /transcript_id="XM_022821897.1"
                     /db_xref="GeneID:34718355"
     CDS             complement(348408..349685)
                     /gene="HPM1"
                     /locus_tag="KLMA_80158"
                     /codon_start=1
                     /product="mitotic exit network interactor 1"
                     /protein_id="XP_022678212.1"
                     /db_xref="GeneID:34718355"
                     /translation="MAYEGLNQEKKKEPEKKKRRLLYNRSSQDSSSHRCEGQKRRYSG
                     RTERLHRGKMSFAFGFSNADLSDDELEAVDQTTQQQQPASVSNVVNPLDSQALLGEHV
                     SQPKYVNVDDLLRSLVNVRLSFEEFVTPGTNSVLYRRELFDVKHQLMSEVDSQSDENN
                     VELEILMGETNEDLRRNIYEGGLKSWECSIDVVDSFVEKNPIPDFEFKNVIELGCGTS
                     LPSEFVFMQYLRSGSTNGICFTLCDYNESVLRLVTLPNFIIGWAKTVLTEEQFAQLQT
                     TDDPNVPVLNDELLLTKALLDAFKADLESKNISLSFISGSWGRAFMNIVSQHQISPKE
                     NTLILTAETIYQPDTLPVISETLIELLLQNKQHASPVKCLLAAKDIYFGVGGSIVEFE
                     DYMTKRIQHSNLPLKLHKFKVNAGLKRSIVLIE"
     gene            complement(<350501..>350953)
                     /gene="COX5A"
                     /locus_tag="KLMA_80159"
                     /db_xref="GeneID:34718356"
     mRNA            complement(<350501..>350953)
                     /gene="COX5A"
                     /locus_tag="KLMA_80159"
                     /product="cytochrome c oxidase polypeptide 5A"
                     /transcript_id="XM_022821898.1"
                     /db_xref="GeneID:34718356"
     CDS             complement(350501..350953)
                     /gene="COX5A"
                     /locus_tag="KLMA_80159"
                     /codon_start=1
                     /product="cytochrome c oxidase polypeptide 5A"
                     /protein_id="XP_022678213.1"
                     /db_xref="GeneID:34718356"
                     /translation="MLRSSVSRVARVTPIRFAQTQALSKASIVDLPNRWEDLPAAEQQ
                     DIVSKLAERQKLPWTELSDVEKQAAWYISYGAWGPRRPVHGKGDAAYIAKGVAAGLVI
                     SLAIFAGIRQLSGEPPKTMTKEWQLKSDEYLKSKNANPWGGYSQVQSK"
     gene            complement(<351627..>354674)
                     /gene="HOS4"
                     /locus_tag="KLMA_80160"
                     /db_xref="GeneID:34718357"
     mRNA            complement(<351627..>354674)
                     /gene="HOS4"
                     /locus_tag="KLMA_80160"
                     /product="protein HOS4"
                     /transcript_id="XM_022821899.1"
                     /db_xref="GeneID:34718357"
     CDS             complement(351627..354674)
                     /gene="HOS4"
                     /locus_tag="KLMA_80160"
                     /codon_start=1
                     /product="protein HOS4"
                     /protein_id="XP_022678214.1"
                     /db_xref="GeneID:34718357"
                     /translation="MSEPVKKRSLGSYLSRIGERRKERERLEQKQNELKSKEEEGNSQ
                     RGSEAGSGAGTPNDAGSEQEKIADRAVIEEPAAQTTKTEAEAEAEPTPAPAAASSETV
                     VPLKEEKVITTEEEEKITTTDPAPAAPEDEVPVPKVGKQKGKSKSDEDSSALSEIESD
                     APTEPASPPRPRKGRLIRGDQLESANNSRQSSVPVLGRDGHDGMSESELSDLSDTNAG
                     KISSSIIHEDSSPVKHYENKRRASGHIEHQNSTHKRMKHVGTSKVPKHKKSVHRDAGG
                     RTKLQIACDKGKYDLAKRLIEEEGYDVNDQDNAGNTPLHEAALNGHLSIVKLLVKHGA
                     DVNRQSYDMFLDTPLIDASANGHLPVVKYLLDHGADPTMVNAKGLSAIESIEEESDMD
                     TEDRKIVYDMKDLLKRAARKYMKHSHRSIQSSSLSRHSDDTEKQLNHDDDFYWTDISS
                     KTGKSKLLRASKEGKLAYVGSYLENGGRPDFKCFLESCMYGHDDVVSLFLAFGAQVNM
                     SNKEGQTPLMLSVGRGHVNVVKLLIEAGADPGKKDKNHKTALNYAKHSSLGLTDPEEI
                     TLLKETIKKQYGYVVSDTNDEDDEEEEEEEEEEEEEEEKKNKKRKKVQEDKQEIKAEA
                     KAKSKPKPESEKESSYGTSREPSSVPVPIKTEKRQEEPEHSEKTPPVVATEPHTKHES
                     RTASPEALSLTGSALEKFDTRSSSSVSTHAQARSVSVPHQTSTPPPLPKETEEEKAER
                     LKSEEEYRQKRLLQKKRKEQEFLNKLAEDERKRIEEKEKLKQQELERQEKARQEQLLK
                     EEELRNKAEIQRRIKIRESYPMGLRSIDFKDLANYQNFGPVYYFTDANSSSTWVLDLQ
                     MSVITKENVESLQQACSNVQPVQQQQYPQLWNLYKHIFLYGGTNNSDLFNALPWKQRL
                     QIEQQEYKKFAALPLHWIDLTQLLDSNFLTDHQQPVGNWISSNLIEFVPVSTTSTSTT
                     TPSYKRTHARDPAKDASTKRLVPPKYLLRSKVQPWLNSTKALW"
     gene            complement(<355032..>356198)
                     /gene="MSG5"
                     /locus_tag="KLMA_80161"
                     /db_xref="GeneID:34718358"
     mRNA            complement(<355032..>356198)
                     /gene="MSG5"
                     /locus_tag="KLMA_80161"
                     /product="tyrosine-protein phosphatase MSG5"
                     /transcript_id="XM_022821900.1"
                     /db_xref="GeneID:34718358"
     CDS             complement(355032..356198)
                     /gene="MSG5"
                     /locus_tag="KLMA_80161"
                     /codon_start=1
                     /product="tyrosine-protein phosphatase MSG5"
                     /protein_id="XP_022678215.1"
                     /db_xref="GeneID:34718358"
                     /translation="MNSQGIGTRSHKSMQNKNSKNLSLQIGDSPTRNKLIIVEPKPNN
                     SISNGESCGGSGNAFAVPPLTKRASEAQIYSLPPKLKSTRSTPCTPQLATTGCSSGFN
                     SAVSPTSSASSSSPFNKPQLPTINTKVLCRPRASTIAAGTAMTLGAQSQGQGQGQGQA
                     QVQTPSNEFIENMSRYWVFQENTPMSSNNYEPDAKDRTNINAVLSDDELDSYSESYKE
                     NCYPSGPLLVIPPYIYLYSEPSLKEVLDFDLIINVAKEITNYKEQLPAEKQVNYYHLT
                     WSHTSQITKNLPQLTELIHNAYVNHKKVLIHCQCGVSRSASLIVAYMMRYDNLSLNDA
                     YNKLKLIAKEISPNMSLLFQLMEWEDWLKNHDPINRTCRKQSFESISELGELTL"
     gene            complement(<357028..>360399)
                     /gene="VAC7"
                     /locus_tag="KLMA_80162"
                     /db_xref="GeneID:34718359"
     mRNA            complement(<357028..>360399)
                     /gene="VAC7"
                     /locus_tag="KLMA_80162"
                     /product="vacuolar segregation protein 7"
                     /transcript_id="XM_022821901.1"
                     /db_xref="GeneID:34718359"
     CDS             complement(357028..360399)
                     /gene="VAC7"
                     /locus_tag="KLMA_80162"
                     /codon_start=1
                     /product="vacuolar segregation protein 7"
                     /protein_id="XP_022678216.1"
                     /db_xref="GeneID:34718359"
                     /translation="MGVGQGSEDDGNRMIVETELVKTEKQNILPVTQQPAVMQQQQND
                     QDGDNSTITQHKLMGINGNKREDLPGSPTRKEPHDAVDNRDRELQDDGNVTLKPLQNQ
                     HRLNSLQMQEASLQNGGNLQDKDMAAPYSNPLSTQALFSGALRNKKSSLLIDCAVDEG
                     KDFSSLPPLAASEQMLDLSLTSADASQSSFGPSLTKQKNKPGLSKLSSYNEESYDSRG
                     DSDSQHLTNSQESRPLDLDMKHGVLKTSTPTAPLLMSQMPAGTGVDSKLNNTGSVLPL
                     STLASQGQSSQQQQQQQQQQQDLQADVQQQQTQTKKNQKELLDQQSQNHHQTLNRDQT
                     QPQSQAQSQSQSQAQSQPQPQPQPQPQPQLQNNQPKSATPLTISQQPSTSVLTDSESV
                     RRLNKESSSKADFFAARLATAVGENEISDSEETFVYQSTANSVKNASLNDASSMQNNT
                     LNSLQHVNAKPYGIPAKLSAPQLKQNEKLLNRLKNTRHTSIAAIPNSQGPVSSNSEKD
                     DIASLKSMNKSSLQEIQSIKSHRTQLSVSPRKRLSTASLQNVQNRQQKNQQQSTGTGN
                     GVVPKTLSTPTRSTYGVSAKKGGKPPPTYQNQKNSGKQPLLQNSVANGQNIAGAKGHN
                     RTSSRPGENKKGVTTLRTRSSKVFDPNGSSLRRYSGVPDDVNLEDFVDQYDGEFDLTV
                     SRQQKGNDKKALKYYHPSNAASQREISSGIRHDQYDTNETISDYADDGTEAGPDDMES
                     ASDNSAVHALGYHEVPNYDELSYVDEDADDIESMFYYNGSNVGPSHTRVGRRFSELDE
                     SGAEDIESDSQGFFYRDPNQLERGVGGAGNNNNNNNNGIPNNGPLLQSNFHQATEFTP
                     LKNKKLTRKRSDFYSDYSPHNFYTKKSSWVKFKNFIYFSFVVASLLTLGFISGFLLAT
                     NKDLHDFQLIAMDNVLVSLDELVFDITATAFNPGIFTIGIKDVELDIFAKTNHLKVDV
                     QADVHEDPHQPPPPPGETTATTNGVFTNPYQTILLGTVYNLETELQFRGRLLNRNYDV
                     SVASVKLLNPGAPKNSDDRDDDDDDDDDGRDNDADDKNNHKLEDDIDRWKQLIKHEFE
                     LIVRGNLYYTIPFFKNEKVIPVQQQIVVDPNKSPY"
     gene            <362528..>363376
                     /gene="POR1"
                     /locus_tag="KLMA_80163"
                     /db_xref="GeneID:34718360"
     mRNA            <362528..>363376
                     /gene="POR1"
                     /locus_tag="KLMA_80163"
                     /product="mitochondrial outer membrane protein porin 1"
                     /transcript_id="XM_022821902.1"
                     /db_xref="GeneID:34718360"
     CDS             362528..363376
                     /gene="POR1"
                     /locus_tag="KLMA_80163"
                     /codon_start=1
                     /product="mitochondrial outer membrane protein porin 1"
                     /protein_id="XP_022678217.1"
                     /db_xref="GeneID:34718360"
                     /translation="MAPPFFSDISKDINGLLNKDFYHATPASVDVKTTAPNGVAFTVK
                     GKTSPKDGSIAANVEVKASDKSTGLTFTQGWNNANALDTKIELAELTPGLKTELITSG
                     VPGVSKAAKLNVNFVQPLFAARGFFDLLKGPSFVGDLTLAHEGFVGGAEVGYDISAGA
                     VSRYALALGYNASGTYSVGLSVNNAQLITASFFQKVSPLLQVGAKAALNPQAGSNVNI
                     EFATKYSLDAVSQVKAKVADSGIVALSYQQVLRPGVTLGLGASFDALKLSEPVHKLGW
                     SLSFAA"
     gene            <363975..>368318
                     /gene="NUP159"
                     /locus_tag="KLMA_80164"
                     /db_xref="GeneID:34718361"
     mRNA            <363975..>368318
                     /gene="NUP159"
                     /locus_tag="KLMA_80164"
                     /product="nucleoporin NUP159"
                     /transcript_id="XM_022821903.1"
                     /db_xref="GeneID:34718361"
     CDS             363975..368318
                     /gene="NUP159"
                     /locus_tag="KLMA_80164"
                     /codon_start=1
                     /product="nucleoporin NUP159"
                     /protein_id="XP_022678218.1"
                     /db_xref="GeneID:34718361"
                     /translation="MEVETTESLGFKFLFSKPLLPGVDETIPFSKLSNVSIHPVEKLL
                     CVASAKTTSVYDLQSIRDGSYDAVNTKEFPSNVVGVFFVASTLCAVLEDGVIWVTEVP
                     DYSWKEHSSTDSNPVSCTVFNGKLFVLGENNILNQVDLSTKGTTKQLTSIEKCVDLAS
                     TEDKLYVLHKNGNVTVLNKSLVESSTIEKPSLDDPSEPISINVLSSNHLLVSYGEPVD
                     TVEEEDIMYDLTAYIVDLNTKQFTPSMDIAPPYSTVKRNPSYYTQTLFEITKKLPYLF
                     VVGSACASEISIATSSQVFKPDQDAACAILPINPNSDNDTQPVGIALDLFSKGTVFEP
                     CSGVDSADNLPLLYVLTNLGELYCWALYHHTALQDASFSLDQSRSHYLKLFKDLSVAD
                     GSLLSAKVEAQSSAGDIIEESSKSETKEAPTSQGGSSILGTTDAFSKGFSFGTPTLTP
                     SPVGSSNSGSSNNNTIANSSSAFGKPAFGKPAFGSSAFGQNDTAPKFGESISAPTSSG
                     AFGKPTFGNSTFGANTTPSATESAFGKPAFGASTTTGTNDSPFGKPAFGASTTESSFG
                     KPAFGASTTTGTNDSPFGKPAFGGSTTTSTNESPFGKPAFSAGSTTSTNESPFGKPAF
                     GAGATTGTTESPFGKPAFGASTTDSPFGKPAFGANATTGSTDSPFGKPAFGATATTGT
                     TESPFGKPAFGTSATTGTTESPFGKPAFGASSTTSTNESPFGKSAFGASTTESPFGKP
                     TFGASATTSTKESPFGKPALGGSVFGAAAAAASLSSPFSTDNDSKSPQKTPIPDPFGH
                     LKSSKESSNTFSFTDVADAITDTSETAKKDTEFSGVSKAEYTSDSSIEEDNSLESESS
                     EEESSSTAEITSINSNFRNLGSNTEGGSNDLDESEAHIATEPEPEDKAEVKAEEEVEM
                     KSEEDVEAKEEAETKEEAETKEEAETKEEAETKEDVEAKEEAETKEEAEEEEETEEEA
                     EEEEEAEKATEEETKEETEEKVEEKAETKESSEDQIESEEETKASVASLTDRIKKAAN
                     VSTAEIPVTFSQNTKTESKDQSPFSAFSNFQNKETAVPPTFSFGKHNDSQKSKDSPFS
                     FPQKSVESNNPKDELMKFSKKPSTLDNETHVTDSSPPSKVDVALTPSKTAYESKEMQT
                     DVVLKNNSTQTDSKDKTDKSQQAFENDEQHLASIYESQHLPDFFNAAQLRDFKPLSSD
                     QVIQAIERTHAEVLGNIQVLKANINNIGDFVNDQTQHPFQRTEATINNVSSWRIDEAQ
                     DLLEILTSKKKDISKLKESSKYLEDNCSEDLDLDVLLNNLKRQFDALSICNEHYNNPK
                     RKLSWSQHHISAVVKKKLETTSLRLDKIKETIRVLKLYNLSDNKETINIIKQLTANGG
                     SGRTNLLREIKALREEVSNLKISMEKNQSVDSKKVLLSNSASPVPLVETTLELNIRSQ
                     LGDFFSSRVGC"
     gene            complement(<368405..>369574)
                     /gene="HIS5"
                     /locus_tag="KLMA_80165"
                     /db_xref="GeneID:34718362"
     mRNA            complement(<368405..>369574)
                     /gene="HIS5"
                     /locus_tag="KLMA_80165"
                     /product="histidinol-phosphate aminotransferase"
                     /transcript_id="XM_022821904.1"
                     /db_xref="GeneID:34718362"
     CDS             complement(368405..369574)
                     /gene="HIS5"
                     /locus_tag="KLMA_80165"
                     /codon_start=1
                     /product="histidinol-phosphate aminotransferase"
                     /protein_id="XP_022678219.1"
                     /db_xref="GeneID:34718362"
                     /translation="MTLQFDITQVVRPKILNLEPYRCARDDFKEGVLLDANENPYGPT
                     LEDYDVDSLLHRYPDPHQIDFKQRMAEYRNTKSIFKDQQLTPLDSDNLCLGVGSDESI
                     DALIRACCVPAKEKILIAPATYGMYTICSEINDVEYVEVPLLTSDKELFQINEDEIIK
                     TLENDPTIKLVFITSPGNPTGTYIEYNRIEKILSRWQRGIVVVDEAYIDFVEGPNKGS
                     LAPLATKYENLAVLQTLSKSFGLAGVRLGITYSSKQISRILNSMKAPYNISHTTSEVA
                     LKAVEPENLERMEQNAKSINKEKLRVLKELTSLPLVKQLGGLDANFILLRINNGDNDL
                     TKKLYYDLATKSGVITRFRGNEPACSGGLRITIGTVEENDVLIREFKKHLSALTA"
     gene            complement(<369902..>370438)
                     /gene="OCA2"
                     /locus_tag="KLMA_80166"
                     /db_xref="GeneID:34718363"
     mRNA            complement(<369902..>370438)
                     /gene="OCA2"
                     /locus_tag="KLMA_80166"
                     /product="tyrosine-protein phosphatase-like protein OCA2"
                     /transcript_id="XM_022821905.1"
                     /db_xref="GeneID:34718363"
     CDS             complement(369902..370438)
                     /gene="OCA2"
                     /locus_tag="KLMA_80166"
                     /codon_start=1
                     /product="tyrosine-protein phosphatase-like protein OCA2"
                     /protein_id="XP_022678220.1"
                     /db_xref="GeneID:34718363"
                     /translation="MKFIPPLGFAPVVSTDVDLYRSGYPMPLNYSFIKHQLHLKTVIY
                     VGDKEILPEYATFLETEGIQFHHIPMTSTKDENIQKEMETVLRLVLNVDNYPILIHSN
                     KGKHRVGVVVGIIRKLLLGWSMTGIYQEYDLFTGGQKGDIDLEFITMFNTSLTVPLDR
                     IPRFVNCKPLPGSRKLES"
     gene            <370716..>371879
                     /locus_tag="KLMA_80167"
                     /db_xref="GeneID:34718364"
     mRNA            <370716..>371879
                     /locus_tag="KLMA_80167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821907.1"
                     /db_xref="GeneID:34718364"
     CDS             370716..371879
                     /locus_tag="KLMA_80167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678221.1"
                     /db_xref="GeneID:34718364"
                     /translation="MKLVTIGTHAILGERDLPALKTATKQDATTTEQATSKNDDQTKT
                     TTTNDKPKSTNTGKDDQTTTKKKAMPHLTSKTTSTIDSAQTSFSYSSSSSSHYTTPTI
                     DIPSAKGNPYVWSSDKPTGTVFIAVGAVAGFLFLAVLIFLLVNSWITYSQAKQLKRFN
                     NIEKQFQNPFIDDIDFGSSGGYYKADADEDDASVAGGSPAKKNKSKHNKHSRNNSSYA
                     PYKRASHSMIRLLGGSTDELTNQTSPSVGGNNIYMHQHGMDSLNGLERVEAIDVANLE
                     QRKSLYISPTMEVVNQQRRSTLFNNLNQSVLSMDTPDSRETEPVKEPPRTVSPERRTY
                     KHEKNASSLSKLVDSTIDLTAATTSQQNRVKTHKKNTSITPSEFLEHMLEDDD"
     gene            complement(<372227..>372910)
                     /gene="RHO3"
                     /locus_tag="KLMA_80168"
                     /db_xref="GeneID:34718365"
     mRNA            complement(<372227..>372910)
                     /gene="RHO3"
                     /locus_tag="KLMA_80168"
                     /product="GTP-binding protein RHO3"
                     /transcript_id="XM_022821908.1"
                     /db_xref="GeneID:34718365"
     CDS             complement(372227..372910)
                     /gene="RHO3"
                     /locus_tag="KLMA_80168"
                     /codon_start=1
                     /product="GTP-binding protein RHO3"
                     /protein_id="XP_022678222.1"
                     /db_xref="GeneID:34718365"
                     /translation="MPLCGSSSSRQPIERKIVILGDGACGKTSLLNVFTRGYFPKVYE
                     PTIFENYIHDIFVDNQHISLSLWDTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLE
                     NVKNKWVGEIADHCEGVKLVLVALKCDLRNLEEFGNESTAITPGNIHNKNAAAGQQAK
                     DNGLISYEEGLEMAKQIGALRYLECSAKMNRGVNEAFTEAARCALTATPKGANDSIPQ
                     DKGSSCTIM"
     gene            <373438..>375687
                     /gene="ARP5"
                     /locus_tag="KLMA_80169"
                     /db_xref="GeneID:34718366"
     mRNA            <373438..>375687
                     /gene="ARP5"
                     /locus_tag="KLMA_80169"
                     /product="actin-related protein 5"
                     /transcript_id="XM_022821909.1"
                     /db_xref="GeneID:34718366"
     CDS             373438..375687
                     /gene="ARP5"
                     /locus_tag="KLMA_80169"
                     /codon_start=1
                     /product="actin-related protein 5"
                     /protein_id="XP_022678223.1"
                     /db_xref="GeneID:34718366"
                     /translation="MTNTRDSSLQPLPVYPLEEPPLSNEPEPFDDPSNYDPETPIAID
                     FGSYEVRAGFGSQEEPSHVFPTKIVRYKERKIQKALTFIGNDCSLDNAVRSHSRSPFD
                     GSLITNWEYVEDMLAYTFHHLGVQGEDRVSNPIILTEKMAALQAQRSNWYQLLFECYG
                     VPQVTFGIDGLFSFYANNPQGKASGLIINSGHEDTSVIPVVQGRGILSEAKRIDWGGN
                     HSIGYLKSLLSLKYPYFPAKLNDYHFQSMYQDHCYFANNYEEEVSSMFKLDVLEKKDV
                     VLEAPFTEVIQPQKTEEELRIQSEKRRETGKRLQEQAKQRRLEKLRQKEEEYQYYINI
                     REELRDQPKRQVLITLQNAGFEDERDFEDYITNLEKVLKRSRILDVDDDEQDDSNSQE
                     SKFDLVDVPDEELNDEQKKEKRKQRLLKANLEARQKAKEEKLQMQKAEEEAKERDRQW
                     REQDLQGWIKDKRAKLAKLIKSRKDKLKLKEEMKDRKSQATQRRMKNLASLAEDNIGV
                     GKRSRQATIDNDPMDTFGANDDDWMIYNDISITPEALDESIEEEYRDIVELEKALLEF
                     DPSFTEEDTLDAQYDWRNSILHLFLRGPRPHNSEDVHQQHQLHLNIERIRAPEIIFQP
                     SMGGLDQAGVAELAEDLLTKKFGSVPSKLSQTSLDMASNVFISGGNAKIPNLRQRIVN
                     EFTEFLPVGTPLNVNCAKDVSKDAWRGMAKLSRSDYYKDTYVTKKEYEEFGTEYIKEH
                     NLGNVQYVD"
     gene            complement(<375919..>377802)
                     /gene="NOP2"
                     /locus_tag="KLMA_80170"
                     /db_xref="GeneID:34718367"
     mRNA            complement(<375919..>377802)
                     /gene="NOP2"
                     /locus_tag="KLMA_80170"
                     /product="putative ribosomal RNA methyltransferase Nop2"
                     /transcript_id="XM_022821910.1"
                     /db_xref="GeneID:34718367"
     CDS             complement(375919..377802)
                     /gene="NOP2"
                     /locus_tag="KLMA_80170"
                     /codon_start=1
                     /product="putative ribosomal RNA methyltransferase Nop2"
                     /protein_id="XP_022678224.1"
                     /db_xref="GeneID:34718367"
                     /translation="MGSRRLKHMQAAPPSLEEFQAKKERNQQRKEKKTKRPADGERSE
                     DKRVNKKVKKSKSKKSQEDEEEAEQLSKLKEAEKDLPEVDLKELAAAKKTLFDDDEED
                     EGEDEDEDLKDEFDLEQEYENDEDEDVQERPLFSDDEDADIEDLNAANMEALSMKLDE
                     EAQLEQEEAEAELVEGDKMQPRAEVLPTPEQEAIEAQGPPDLTAVRTRMIEIVKVLED
                     FKQLGAEGKSRAEYVDRLLKDICQYFGYTPFLAEKLFNLFSPAEAMEFFEANEIARPV
                     TIRTNTLKTRRRDLAQTLVNRGVNLQPIGTWTKVGLQIFDSQVPIGATPEYLAGHYIL
                     QAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGCVFANDANKARTKSLI
                     ANIHRLGCTNTIVCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDF
                     MQIPHLQKQLLLSAIDSVDCNSKTGGVIVYSTCSVAVEENEAVVDYALRKRPNVKLVE
                     TKLAIGKEGFTSFRGKTFHPSVKLTRRYYPHTYNVDGFFVAKFQKIGPSKFDDNQASA
                     KEKEAAARQEALEEGIIKDDFASFDDEDDKKYIEKSKKVSLLKKGINPHSKKPAHSKS
                     DKE"
     gene            <378133..>379557
                     /gene="TRM6"
                     /locus_tag="KLMA_80171"
                     /db_xref="GeneID:34718368"
     mRNA            <378133..>379557
                     /gene="TRM6"
                     /locus_tag="KLMA_80171"
                     /product="tRNA (adenine-N(1)-)-methyltransferase
                     non-catalytic subunit TRM6"
                     /transcript_id="XM_022821911.1"
                     /db_xref="GeneID:34718368"
     CDS             378133..379557
                     /gene="TRM6"
                     /locus_tag="KLMA_80171"
                     /codon_start=1
                     /product="tRNA (adenine-N(1)-)-methyltransferase
                     non-catalytic subunit TRM6"
                     /protein_id="XP_022678225.1"
                     /db_xref="GeneID:34718368"
                     /translation="MDVVRDISANQHVLIRLPSDNLKIVELKAHSIVSLGKFGAFRVN
                     DIIGYRYGTTFEIVYDGIKEEFVKGTQTLIGKVKVLESRSKASSPPIENSSESNRGLI
                     NLGSDVQEMSMEEIEAMKREAASGDAIISKMIESHKSFHQKTVHSQEKYLKRKKQKFA
                     KFFTVEYLDSSGLLHYLIDKGDILRVMDISQESMGMALNLANVSSNGEYLCIDETGGL
                     IVYAMLERMFGGNSKSTATGSIVVVHENEHPNLDLLKFSNYPESFIQKHVKTISVLDF
                     FEPPSEETIKDSFHPLSQEEINELKSNRKSAYFRRLKWYNNQLANIKVAHKIYDGLLV
                     ASTLYLPTLIPRLGSRIHGSRPIVCYSQYKEPLLELSHSLYDNLNYLAPTLIETRCRP
                     YQTVRGKLHPLMTMKGGGGYLMWCHRVIPAIEPKMNPETQVKENSDTAVVEEEGEEVE
                     EKVMKEKQEEQVEQEEPALKKIKV"
     gene            complement(<379578..>380498)
                     /gene="MTQ1"
                     /locus_tag="KLMA_80172"
                     /db_xref="GeneID:34718369"
     mRNA            complement(<379578..>380498)
                     /gene="MTQ1"
                     /locus_tag="KLMA_80172"
                     /product="mitochondrial N(5)-glutamine methyltransferase
                     MTQ1"
                     /transcript_id="XM_022821912.1"
                     /db_xref="GeneID:34718369"
     CDS             complement(379578..380498)
                     /gene="MTQ1"
                     /locus_tag="KLMA_80172"
                     /codon_start=1
                     /product="mitochondrial N(5)-glutamine methyltransferase
                     MTQ1"
                     /protein_id="XP_022678226.1"
                     /db_xref="GeneID:34718369"
                     /translation="MPRISPKLFRLASQIDARLPFLLRESKGNVQQAQTELRWITDEL
                     RSPLLVKKACLQRFEHVPLQYILKNQPFGDLEVLTRRGVLIPRWETEEWCLDLIRNVI
                     GPSKEKNMKVADLCSGSGCIALQIAFSKPDAEVIAVDISSKAVRLIGENVEHNGLQDA
                     KVQVVQADILKTPCEVVPGCRFDLITCNPPYIPENEFVAECTTSVKMYEPRSALIGNL
                     EFYRNLVEYWVKEGRTDSFVYEVGSIEQCNYVMNAIDETVKEKWHVGVKYDSNNQARC
                     VYGYLAEGKKDYHSMFERFKIKSNDICTII"
     gene            <381177..>382409
                     /gene="DNAJA1"
                     /locus_tag="KLMA_80173"
                     /db_xref="GeneID:34718370"
     mRNA            <381177..>382409
                     /gene="DNAJA1"
                     /locus_tag="KLMA_80173"
                     /product="mitochondrial protein import protein MAS5"
                     /transcript_id="XM_022821913.1"
                     /db_xref="GeneID:34718370"
     CDS             381177..382409
                     /gene="DNAJA1"
                     /locus_tag="KLMA_80173"
                     /codon_start=1
                     /product="mitochondrial protein import protein MAS5"
                     /protein_id="XP_022678227.1"
                     /db_xref="GeneID:34718370"
                     /translation="MVKDTKLYDLLGVSPDADDNQIKKAYRKSALKYHPDKNPSAEAA
                     EKFKEITSAYEILSDSQKRDIYDQFGEEGLSGQGGGAGGFGGFGEDLFSQFFGGGGSS
                     RPRGPQKGRDIRHEVPATLEQLYKGRTAKLALNKQVICKGCEGRGGKPGSVKKCTSCN
                     GQGVKFVTRQMGPMIQRFQVECDACQATGEIIDPKGRCKECNGKKVNNERKILEVNIE
                     PGMKDGQRIVFQGEADQAPGIIPGDVVFVVSEQPHPLFKRDGNDLSYEAEIDLLTAVA
                     GGEFAIKHVSGEYLKVEIVPGEVISPGLIKVLEGKGMPIPKYGGYGNLLVKFNIKFPP
                     SHFTSEENLKKLEEILPPRTLPSIPSNAEVEECVLTDYDANKHRSKSGANGRGQSYDS
                     DDEEGGHHGAEGVQCASQ"
     gene            complement(<383227..>384873)
                     /gene="AQR1"
                     /locus_tag="KLMA_80174"
                     /db_xref="GeneID:34718371"
     mRNA            complement(<383227..>384873)
                     /gene="AQR1"
                     /locus_tag="KLMA_80174"
                     /product="probable transporter AQR1"
                     /transcript_id="XM_022821914.1"
                     /db_xref="GeneID:34718371"
     CDS             complement(383227..384873)
                     /gene="AQR1"
                     /locus_tag="KLMA_80174"
                     /codon_start=1
                     /product="probable transporter AQR1"
                     /protein_id="XP_022678228.1"
                     /db_xref="GeneID:34718371"
                     /translation="MRRASIRDQGSSLEGPECKNTTLKKNDSGAVEDNVIFRSVTREL
                     ADSGDDVDATQFDSDMESSPGYSKQDAEVEKEVPYSLLTYRQKWIMVALLTSAGFWSS
                     LGSPIYYPALKELEKQFNVDEELINVTVVVYLLFQGIAPTVSGGLADVYGRRPIILMG
                     MLVYVVGSIALACAQSYGVIVFLRCLQSAGISPIIAINAGVAGDFTVKAERGTFVGAV
                     SGFTLMGQAFGSLIGAALTAAYDWRAIFWFLSIGCGSCMIILCFLLVETKRTIVGNLS
                     IKPKRFINKAPVIYLPMFQKQFKFDNPDYESLDTSIVKLDLTAALRIVALPEITLSLL
                     PAAFQFALWTLSLASLSSELAKAPYNYKLTIIGICYLPSGIGGLLGSFCTGKIIDVFY
                     RYDHGKFMQKMKNGLIDENTRYNIFKARLVSGMPQNFIAVVSFTIMGWAYQERWNVAV
                     ILVTSFFGSFCAMSTLSTSSTLLVDLYPSKSSTATSCYNFIRCVLGAIFMACYAKMKK
                     SMTIGGTFTFISGLVLIGNFIVFIPMKYGMKWRYERGMKG"
     gene            complement(<385591..>387510)
                     /gene="QDR2"
                     /locus_tag="KLMA_80175"
                     /db_xref="GeneID:34718372"
     mRNA            complement(<385591..>387510)
                     /gene="QDR2"
                     /locus_tag="KLMA_80175"
                     /product="quinidine resistance protein 2"
                     /transcript_id="XM_022821915.1"
                     /db_xref="GeneID:34718372"
     CDS             complement(385591..387510)
                     /gene="QDR2"
                     /locus_tag="KLMA_80175"
                     /codon_start=1
                     /product="quinidine resistance protein 2"
                     /protein_id="XP_022678229.1"
                     /db_xref="GeneID:34718372"
                     /translation="MMHSSSDQSADQSIDQEMAKLGLHEDKEHDGEHLAGSGSESVSG
                     SVSMSVDEDSSVLEEQHAFDPQHLYTDHVETRDTRGERKFGRVVSDRAASVQSSSKLE
                     AVDANGVPYTRFSKNDKFLLVVICALSGFYSTIAQTIYFPALSVIEKEFNVSDGLVNI
                     TVVVYSLCQGIFPVIMGGLADQLGRRPIVLCCIAVYCAACIGIARCQTYGEMLFLRCL
                     QGGGISPIIAINSGIMGDITVKSERGGYVGLTSGFQVLGSAIGGLLGALFTARWGWRS
                     IFWFLAAGSGVTLAFVVLSLPETKRSIVGNGSIKPPRFINKSFLFYLPYYRRKLHLDN
                     PDYSTKAETIKYDPKAPYKILTRPELISLLAVQGLQYTTWICHMTVLSQQLTKKYKLK
                     MVIVGVCFLPAGLCTLTSIVTAGRFLNWNYRRRYRRHKEFVRAEKERLLKEHNYDTHV
                     VDEIMENDIKYKFDLFKTRLDWIYMPIFISNAGFVTFGWCIGEKQPLAAVLVMSGLGS
                     LTCNCIISICNTLVVDLYPDTSSTAAGCVNLVRCVFSAIILAALAKMDKSMKIGGTFT
                     FLTATAITCSTLLIIPLRYGLQLQLAREQRENAKKPNEEELDENNIDPDDSEEEQELY
                     DLRRAATAQSNFSAL"
     gene            complement(<389155..>390027)
                     /locus_tag="KLMA_80176"
                     /db_xref="GeneID:34718373"
     mRNA            complement(<389155..>390027)
                     /locus_tag="KLMA_80176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821916.1"
                     /db_xref="GeneID:34718373"
     CDS             complement(389155..390027)
                     /locus_tag="KLMA_80176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678230.1"
                     /db_xref="GeneID:34718373"
                     /translation="MLKQAMEGSVPKFYKLSSGYTIPSIGFGTYEISPSKTADVVYNA
                     LKCGYRHFDTAVLYGNEFEVGQGICRWLKEDPANNKREDVFYTTKLWDSQKGYNKAKK
                     AIDHCLQEVEDLGYIDLLLMHSPLGGTQARLETYKAMQEAVDEGKVRSIGVSNFGPLH
                     VDELLKWDGLKYKPVVNQIEISPWVMRQELADFCKSKGILIEAYAPLTHGQKLKDPDL
                     LRISNEVGCDPAQALIRWSLQKGYIPLPKTQSISRLASNLNVFSFELTPDQISQIDKP
                     FSYEPTDWDCTNAP"
     gene            complement(<392594..>393508)
                     /gene="SFC1"
                     /locus_tag="KLMA_80177"
                     /db_xref="GeneID:34718374"
     mRNA            complement(<392594..>393508)
                     /gene="SFC1"
                     /locus_tag="KLMA_80177"
                     /product="succinate/fumarate mitochondrial transporter"
                     /transcript_id="XM_022821919.1"
                     /db_xref="GeneID:34718374"
     CDS             complement(392594..393508)
                     /gene="SFC1"
                     /locus_tag="KLMA_80177"
                     /codon_start=1
                     /product="succinate/fumarate mitochondrial transporter"
                     /protein_id="XP_022678231.1"
                     /db_xref="GeneID:34718374"
                     /translation="MSKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKRSA
                     DSGVKPPGFIKTGAQIYRNEGFLAFYKGLGAVALGITPKMAIRFSSYEFYRGLLTNKE
                     TGKISTGNTFIAGVGAGITEAVIVVNPMEVVKIRLQAQALNPAEGVPKYRNAIQACYV
                     IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGL
                     ISGAIGPFSNAPLDTIKTRLQKDKSTKDMSGFKRIVFIGKQLIKEEGFRALYKGITPR
                     VMRVAPGQAVTFTAYEFIRKKLENTGVF"
     gene            <395628..>398981
                     /gene="CPA2"
                     /locus_tag="KLMA_80178"
                     /db_xref="GeneID:34718375"
     mRNA            <395628..>398981
                     /gene="CPA2"
                     /locus_tag="KLMA_80178"
                     /product="carbamoyl-phosphate synthase arginine-specific
                     large chain"
                     /transcript_id="XM_022821920.1"
                     /db_xref="GeneID:34718375"
     CDS             395628..398981
                     /gene="CPA2"
                     /locus_tag="KLMA_80178"
                     /codon_start=1
                     /product="carbamoyl-phosphate synthase arginine-specific
                     large chain"
                     /protein_id="XP_022678232.1"
                     /db_xref="GeneID:34718375"
                     /translation="MSTGIYSSIEPTLSAFNTEEYSPQLVEGVDSVLIIGSGGLSIGQ
                     AGEFDYSGSQAIKALKEANKKTILVNPNIATNQTSHSLADEIYYLPVTPEYITYIIER
                     ERPDAILLTFGGQTGLNCGVALDKAGVLAKYNVKVLGTPIKTLETSEDRDLFAQALKE
                     IDIPIAESIACDTIDAALEAAETVGFPVIVRSAYALGGLGSGFANNAQEMKQLASQSL
                     SLAPQILVEKSLKGWKEIEYEVVRDRVGNCITVCNMENFDPLGIHTGDSIVFAPSQTL
                     SDEEFHMLRSAAIKIIRHLGVIGECNVQYALSPDSLDYRVIEVNARLSRSSALASKAT
                     GYPLAYTAAKIALGYTLPELPNPITKTTVANFEPSLDYIVAKIPRWDLSKFQHVNRNV
                     GSSMKSVGEVMAIGRNFEEAFQKAIREIDPSFIGFQGSDEFDDLDDALSEPTDRRWLA
                     VGQALIHEGYTVERVHELTKIDSWFLYKCMNIVDMYKDLEEVNDLHSLDKDLLQDAKK
                     LGFSDAQIALCLNKNSTNKTNELEVRKYRKSFGIVPFVKRIDTLAAEFPAQTNYLYTT
                     YNATKSDITFTDNGVLVLGSGVYRIGSSVEFDWCAVNTTKALRKEGKKTIMINYNPET
                     VSTDFDEVDRLYFEELSFERVMDIYELENSEGCVISVGGQLPQNIALKLLHNGASILG
                     TSPEDIDNAENRHKFSTILDSIGVNQPEWSELTSVEDAKTFANQVGYPVLIRPSYVLS
                     GAAMSVVEGEHELEVKLTSASDVSPDHPVVMSKFIEGAQEIDVDAVAHNGKVIVHAIS
                     EHVENAGVHSGDATLVLPPQNLSQDIKDRLKDIADKVAKAWNITGPFNMQIIKDDRDA
                     GTSLKVIECNIRASRSFPFVSKVLGINFIEIAVQAFLNKHVPEPTNLMDKKYDYVATK
                     VPQFSFTRLAGADPYLGVEMASTGEVASFGKNALESYWTAIQSTMNFNVPLPPSGILF
                     GGDLSKNYLGEVVKYIAPLGYKLYATNEETKKYLESYSKDAKVDLIEFPKNDKRKLRE
                     LFQAKDISAVFNLAAKRAETLEDVDYAMRRNAIDFALPLFNEPQTAMLFAKSLNLKLK
                     EKLMVLESKDVVVPKEVRTWSEYLHGKPL"
     gene            complement(<399903..>401444)
                     /gene="MCH4"
                     /locus_tag="KLMA_80179"
                     /db_xref="GeneID:34718376"
     mRNA            complement(<399903..>401444)
                     /gene="MCH4"
                     /locus_tag="KLMA_80179"
                     /product="probable transporter MCH4"
                     /transcript_id="XM_022821921.1"
                     /db_xref="GeneID:34718376"
     CDS             complement(399903..401444)
                     /gene="MCH4"
                     /locus_tag="KLMA_80179"
                     /codon_start=1
                     /product="probable transporter MCH4"
                     /protein_id="XP_022678233.1"
                     /db_xref="GeneID:34718376"
                     /translation="MGSKTITTSTFNEGPSQSDFVNENVIELTDAEHRKPRKNVDIKD
                     MFNSTELEPIKSFEGLEEDSDYDDDGFTYAEGGLEAWIVVLGSFLGILPTWGLYFSAG
                     VIQSYVSEHQLKDDSTSSVSWIFSISSCLLLGTSVFSGMYFDRYGARKPLVIGTVMTV
                     GGVLAVAQCTKVWQFILALSICVGTGSGITSSPLLGCVCHYFYKRRAFATAVAINGGS
                     IGGVVFPLFLEHSFKNLGFIWSMRIMALICGVCLTLSIFLIKEDPTKRAPVEPKNEDI
                     SFAKNLLLNIRDSFDYMSLISDYKYLFCVFASCLAEVSTGAVLTYIPSYCTTVGYSEN
                     TSFLVITVLNTLSIAGGYLFSFLADKIMGRFNVMIMINFFLGIVPLIFWLPFGNKGKS
                     IMYGFSAVYGLFYGSLINLAPVCCGQISRTDEFGKRYATMYCIVGLSFLVALPVSGVI
                     IGKGTLESYKNFIIFVSILSMLSGSLYCLSKCFAVKQKLSKLPRKETSNTTLSSTFKI
                     ITKRF"
     gene            <402206..>403873
                     /locus_tag="KLMA_80180"
                     /db_xref="GeneID:34718377"
     mRNA            <402206..>403873
                     /locus_tag="KLMA_80180"
                     /product="uncharacterized sulfatase PB10D8.02c"
                     /transcript_id="XM_022821922.1"
                     /db_xref="GeneID:34718377"
     CDS             402206..403873
                     /locus_tag="KLMA_80180"
                     /codon_start=1
                     /product="uncharacterized sulfatase PB10D8.02c"
                     /protein_id="XP_022678234.1"
                     /db_xref="GeneID:34718377"
                     /translation="MTKKPGNKKPNFLVIVADDLGFTDIGSFGGEIETPNLDSLTKDG
                     FRFTGFHTAAACSPTRSMLLSGTDNHLAGLGQMAEFNRRYPDMFKGKPGYEGYLNSRV
                     AALPEILHPEFYTLISGKWHLGLEKPYWPSDRGFEKSFTLLPGAGNHFKCQLDSELVL
                     PWIYQENGERIDHHNFPDDFYSTKYFTDKFLQYLRDEEARDGRPFFGALTYTAPHWPL
                     QAPSETIEKYKGKYDGGPLALRKQRLARAKELGVVPPGAVAHLVETKNDKTWDELNDD
                     EKAYSSKTMEIYAAMVDELDKNIGRVIEHLKETGEYENTVIFFMSDNGAEGMMMEALP
                     FGGKTFKEVMTKGYNNDFDNIGKSNSFVYYGDLWAQAATAPNYMYKMWATEGGINCPL
                     ILHAPQLTKKWDKSQIIDQFITVMDILPTILELAKIPHPGTSFQGRQVYKPKGLSWIP
                     FLNKESEKIYDDTIVTGWELFGQRAIRQGPYKGVYIPPPYGTGKWLLYNIESDPGETT
                     DLSEDLPEILEEIVDQWTVYKAETGLIEIDDSIFLDHRYKRTIIEDS"
     gene            <404212..>405513
                     /gene="ZUO1"
                     /locus_tag="KLMA_80181"
                     /db_xref="GeneID:34718378"
     mRNA            <404212..>405513
                     /gene="ZUO1"
                     /locus_tag="KLMA_80181"
                     /product="zuotin"
                     /transcript_id="XM_022821923.1"
                     /db_xref="GeneID:34718378"
     CDS             404212..405513
                     /gene="ZUO1"
                     /locus_tag="KLMA_80181"
                     /codon_start=1
                     /product="zuotin"
                     /protein_id="XP_022678235.1"
                     /db_xref="GeneID:34718378"
                     /translation="MFELPSLSGPVGATVESGAKLSPAVRRPIEPVGKFFLHHAQRTL
                     RNHTWSEFEKIEAEKNVKNVEESNVDPDELLFDDELADESLLTHDPRDWKTADLYAAM
                     GLSKLRYRATEQQIIKAHRKQVLKHHPDKKSASGAGLEQDGFFKIIQKAFETLTDSNK
                     RAQYDSCDFVADVAPPKKGTDYDFFEAWAPVFESEARFSKKKDIPSLGDMNTSKEDVE
                     KFYSFWHRFDSWRTFEFLDEEVPDDSSNRDHKRYIERKNKAARDKKKTADNARLVKLV
                     ERAMNEDPRIKKFKEEEKKEKERKKWEREAGARAEAEAKAKAEAEAKAKAEAEAANAE
                     AAKADKKKAKEAAKAAKKKNKRAIRNAPKEAEYFGDADKSATIEEQTGLIVDSLDDQQ
                     LVDVAEKIKNNAADAKNILAEAAKALSDAGKLPASVVSYYL"
     gene            <406187..>407104
                     /gene="ERV29"
                     /locus_tag="KLMA_80182"
                     /db_xref="GeneID:34718379"
     mRNA            <406187..>407104
                     /gene="ERV29"
                     /locus_tag="KLMA_80182"
                     /product="ER-derived vesicles protein ERV29"
                     /transcript_id="XM_022821924.1"
                     /db_xref="GeneID:34718379"
     CDS             406187..407104
                     /gene="ERV29"
                     /locus_tag="KLMA_80182"
                     /codon_start=1
                     /product="ER-derived vesicles protein ERV29"
                     /protein_id="XP_022678236.1"
                     /db_xref="GeneID:34718379"
                     /translation="MSFRGNNLGGFPNSQPGFQNPVYGVSPHANNESAKVKYGRIFEQ
                     FSKKVENLTDHPLVMKLKPYTPTIARFFIVATFYEDSFRIMAQWSDQVFYLWNYRHFP
                     YYFVVFFLFCVVVSMMIGATLLILRKQTVYATTALICTVVLQGLVYGLFTGSSFVLRN
                     ISVIGGLLIAFGDSIVTNRATFGMLPELDSKDGKFKNYLLLAGRILMVLLFITFTFTK
                     SWLTVILTLAGTVCIAIGYKTKFASISLGLILAFYNITVNNYWFHGSSKRDFLKYEFY
                     QNLSIIGGLLLVGNTGAGQLSIDEKKKIY"
     gene            <407880..>408485
                     /gene="GLC8"
                     /locus_tag="KLMA_80183"
                     /db_xref="GeneID:34718380"
     mRNA            <407880..>408485
                     /gene="GLC8"
                     /locus_tag="KLMA_80183"
                     /product="protein GLC8"
                     /transcript_id="XM_022821925.1"
                     /db_xref="GeneID:34718380"
     CDS             407880..408485
                     /gene="GLC8"
                     /locus_tag="KLMA_80183"
                     /codon_start=1
                     /product="protein GLC8"
                     /protein_id="XP_022678237.1"
                     /db_xref="GeneID:34718380"
                     /translation="MGGILKNAIPDDQSPTSEPESISQFRKQVLKNTELNAKLTSNSK
                     LTHHNHGIPRDVLSMKLDEQHPETLKWNKKNLEENEITKQEFGDIHIDEPKTPYQGAV
                     DPAGEYYRVDDDEDDLGGFTLGAPEVELKDEKEPVTLLNNENADNDGDQDEESGEEKT
                     EEDDAAARHRRFEEMRKKHYNIKEALKDRKNLPDDEDEDEE"
     gene            <408864..>410339
                     /locus_tag="KLMA_80184"
                     /db_xref="GeneID:34718381"
     mRNA            <408864..>410339
                     /locus_tag="KLMA_80184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821926.1"
                     /db_xref="GeneID:34718381"
     CDS             408864..410339
                     /locus_tag="KLMA_80184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678238.1"
                     /db_xref="GeneID:34718381"
                     /translation="MKSRGHYTYCTGKIFQKKKKRREQALGIGYIKYIGSLAHRIASV
                     LLELEKIERNTEEHTVLIKAHESIGGRRLAMSTKKRTSSQAAAKNNQKAKKAKKALDV
                     ERKESRVPARRAKKVVKVSSKTVDYSICIPTTILDNCKNLEQITYAVYQVARSACLFN
                     VAEIVILEAETDATPDQKKDRDQKKGSKIKFDDSDLKEEQTETESENKGQGKGHDQDK
                     SRLSKPMLIASLLQFFVTPPYLVNSVFKKQYMKYFKYAQQLPRISSLPFMRYYAENDG
                     RYREGLAIRMSKPGERGKSKKSFDQTKYINIGKGQNLELKGQLVPVNVRVTVDTVENK
                     VVSPEEAYGDFVGAKASFGYHVRIAKSFADLFTKSPFPQGYTQTVWINSGDYYFDDKI
                     KKNVKVQSKIPAIEKVVRPSQQEIEHEDPSKTGPANLLAVFGKWDTIKKSFVSCQDQF
                     EGATGAFQFFDGELLLPGATPQGQIRTEDACMIALSLLSTY"
     gene            <410809..>411747
                     /gene="BGL2"
                     /locus_tag="KLMA_80185"
                     /db_xref="GeneID:34718382"
     mRNA            <410809..>411747
                     /gene="BGL2"
                     /locus_tag="KLMA_80185"
                     /product="glucan 1"
                     /transcript_id="XM_022821927.1"
                     /db_xref="GeneID:34718382"
     CDS             410809..411747
                     /gene="BGL2"
                     /locus_tag="KLMA_80185"
                     /codon_start=1
                     /product="glucan 1"
                     /protein_id="XP_022678239.1"
                     /db_xref="GeneID:34718382"
                     /translation="MRYSTLVSATLLAAASSVAAIGDLAFNLGVKKNDGTCKEKDDYL
                     SDFQTLKAYTSKVKVYAASDCNTLQNLGPAAEEAGFTIFLGVWPTDASHFAEEKAALS
                     QYLPNLKTSTIEAFLVGSEALYRDDLSASDLANAINEIRDYVKDIKGSDGNSFGDKQV
                     GTVDSWNVLVDGGSAPAIQASDFVMANAFSYWQGQTMENSSYSFFDDIMQALQTIQSA
                     KGSTDITFWVGETGWPTDGTNYESSYPTLDNAKQFWAEGICAMRGWGINVAVFEAFDE
                     DWKPNTSGTSDVEKHWGVWTSDRDLKYSLDCNFSSN"
     gene            <412509..>414968
                     /gene="NIP1"
                     /locus_tag="KLMA_80186"
                     /db_xref="GeneID:34718383"
     mRNA            <412509..>414968
                     /gene="NIP1"
                     /locus_tag="KLMA_80186"
                     /product="eukaryotic translation initiation factor 3
                     subunit C"
                     /transcript_id="XM_022821928.1"
                     /db_xref="GeneID:34718383"
     CDS             412509..414968
                     /gene="NIP1"
                     /locus_tag="KLMA_80186"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3
                     subunit C"
                     /protein_id="XP_022678240.1"
                     /db_xref="GeneID:34718383"
                     /translation="MSRFFLKTYEYDSTSSGEEEDLLSQSEEDLLSSSSDEELSDDSF
                     FNDSSDSSDNDEDNDSDSKPYGPDWFKKPEFRKGGASGVNKFLKSTNYSSDEDSSDEE
                     DGKKVVKSAKEKLLDEMKSIYQKIDGAEAQQDWESLLNYLESVLKLYTRAQQQNYGTP
                     NIYVKTLARFEDAVSATSQDEIKNKAVARAYNTTRQRVKKLVRENEESLKAYRESPES
                     FDKEPVLNNEADSREVSATPFSLSTNKKLDLASMASNISEMDFFKTLNIIIDSRGKKN
                     TDHQAQIRTTEELLKVASTPYEKICTYLNLIPIRFDASVSLSYQPLDQWKASKENLDG
                     LLDLLEKEVDHYQVTEFAPRNDFIEDEPEANENGVKEILGSIFSMVERLDDEFTKSLL
                     NIDTRSSEYMERLKDEQSMYNLIIRAQLYFERVTPEEHRDRVLSRVFIRRLEHIYYKS
                     SKLISIMETVAWKHIRDNTSASESSFIFLKESDVANEDYTFNVISELSDLLIKQKSNN
                     FTGYQKGTLYKTYYIGLNKDYEEAKKLMLSSDITKSISGSDASLQILYNRCVIQLGLA
                     AFKAGLINECHQVLNGLCINPHLREILGQQSLQRASANSNVVQGAPVEQLCIPFHQHI
                     NLDLIDTVYMTCSLLLDVPHMAAYYSGIKVQRIPVFQKSIRRILESSEKAIFHGPPET
                     LRDHILYAAKSMQKGDYLQSIEYLRKISVWSLLSKTDDIINQLSEKVQIETLKTYIFT
                     YKRFYTKISISKLSKLFDLDVEKVLEVAQSIINDYEVKAKLDENNEYIVFERGEEITK
                     LEEVAIKLVKETKYHSERLRQ"
     gene            complement(<415746..>417689)
                     /locus_tag="KLMA_80187"
                     /db_xref="GeneID:34718384"
     mRNA            complement(<415746..>417689)
                     /locus_tag="KLMA_80187"
                     /product="conserved hypothetical protein containing
                     HMG-box super family"
                     /transcript_id="XM_022821930.1"
                     /db_xref="GeneID:34718384"
     CDS             complement(415746..417689)
                     /locus_tag="KLMA_80187"
                     /codon_start=1
                     /product="conserved hypothetical protein containing
                     HMG-box super family"
                     /protein_id="XP_022678241.1"
                     /db_xref="GeneID:34718384"
                     /translation="MQLPNSKSSLPKSSEEIDNPSNFNDQRPNLHTNQGTSLPVSPSL
                     FSTVELTSQSKMEENNRNFEGDATHFSSFQENTTLNINMNVSGSSTSGMPADVNAIHN
                     MFTLFPGYQLYGNDHAVNYPISQAEPARQMIDTKPSFDISQAFEVAPPGSGSGSASHT
                     GPASEYYGLGVGVGVGVKIEPAEFQCHDNTNANANYNANADANANANAIANNSFFSGS
                     TEFPPQYETGPSRTTNKTIPTPPCSKQTALLQRNPSSNPRSKSWSGRATKERSGANSN
                     SSVLPLDNLPYFKYVKQAQLSQQPDVVKQQIENKFQWLPLSEMTEARKDAIVDALRKK
                     GVSTDTAFEVFESLNQSNISAKLELLALELGPYYAMREGTMKEFALLNEKDLEGLNSY
                     IWLKQHIKRTDEQLKTFPRCIIADSVSCTENPSFVVQVRTSSGYNDFTKELLNSDDIN
                     LLKLRHMVLLRESDDRRRKNRYYQFTENKLKRPLNNFMIYRSAVIKSLSILRVINLAT
                     KLVKETNSVFQNWNEKQCIAAIKMVIQLRGNSDLKDRIKLPEQTVNYISQIIDKTLYE
                     YPMANSAGQYAVANTHQPKEPIYSNNTVLSHVVTEMWKTEGEEIKKRFAAFSKVEKAH
                     HNSVFPKYKFIPVKKVCLDDNFE"
     gene            complement(<420151..>424512)
                     /gene="YOR1"
                     /locus_tag="KLMA_80188"
                     /db_xref="GeneID:34718385"
     mRNA            complement(<420151..>424512)
                     /gene="YOR1"
                     /locus_tag="KLMA_80188"
                     /product="oligomycin resistance ATP-dependent permease
                     YOR1"
                     /transcript_id="XM_022821931.1"
                     /db_xref="GeneID:34718385"
     CDS             complement(420151..424512)
                     /gene="YOR1"
                     /locus_tag="KLMA_80188"
                     /codon_start=1
                     /product="oligomycin resistance ATP-dependent permease
                     YOR1"
                     /protein_id="XP_022678242.1"
                     /db_xref="GeneID:34718385"
                     /translation="MAVSSSESTSSYSDVVHLQKETIPDTEIEILPDDLHSSSTGRRR
                     TGSGAGSLKSASHVKENSVQIRNMYEIDKSKPETYLNHDDLEKVTESKIYEQKRLFRW
                     FHSRKVPPIPETLEERPVYPFRRANVISQLFFIWILPIVSVGYKRTLQPNDLWRMDDK
                     MSIETLYERFDSHMKEFIEKARLEYRKEHPEATDQEVLKNAKLPKAALLKCLFYTFRY
                     QYVTAFIFVLISNAASALTPLLTKKLIAFVEKKSRFHDTKINSGVGYAIGSVLLMMIN
                     GIAFNHFFHLSALTGAEAKSLLIKTILHKSMKLSAYSKHKFSNGKITSLMSTDVSRLE
                     LAITFHPFLYAFPMVFVIALVLLLINIGVICLVGFAIFFAITFINFGAFKKILQFRLA
                     ATSITDKRVAMMREILNSIKMIKFYAWEDAYEENVKKVRAIESRLVKMMQLVRNTLVS
                     LTMAFPNLASMVTFLAMYKVNKGGRSPANIFSSLSLFQIMMIQMFFIPMSISTGIDAY
                     VGLGRVQELLEAEEESDRYIENEEDLVLDDDTVFKVKNASFEWENFEFEEAKELAKEK
                     GESMSFSDRSVDTEKEDPGAEKTRFNGFHDLNFEIKENEFIIITGAIGTGKSSLLNAM
                     AGFMSRTSGSMAVNGDLLLCGYPWVQNATVRDNITFGSPFDQEKYEKVLEICSLEADL
                     DILPAGDNTEVGERGITLSGGQKARITLARAVYKDMDIYLFDDVLSAVDSRVCQHIVE
                     HCMMGYLKDKTRILATHQLSLIGQASRVIFLGTDGSFDIGTVEELLSRNKGFHKLMQF
                     QNSKPVDGDEHSTNDENVFSEEDEESILKKQKSLTVGKKEEDGRIIEKEERAVNALSF
                     KVYKEYVSSGLGKYALMMIPIFLFIVASATFCNLFSSVWLSFWTENKFKHRTTGFYMG
                     LYVMFVLLGIIFMWIEFVSVGTMAVNASKWLNLKALHRLLHAPMGFMDVTPIGRVLNR
                     FTKDTDALDNEISESLRLFIYQTANLTGIIILCIIYMPWFAIAMPFMIFAYVFIADHY
                     QASGREIKRMDAIQRSFVFNNFNEVLGGIDTIKAYRSQERFLMKSDFLINKMNEAGYL
                     VASIQRWVSITLDLLAVVFALIIALLCVTRQFHISPGSVGVLLTYVLQLPGLLNGLLR
                     SQTQTENDLNSAERLVNYAYDLPMEAQYRKLETQPNESWPSEGRIKFEHVSLSYRPEL
                     PLVLKDVSIDIKGSEKIGICGRTGAGKSTIMSALYRLTELRSGKITIDDIDISTLGLY
                     DLRKKLAIIPQDPVLFKGDIRKNLDPFQECTDEQLWDALVRGGAIEKSELETVKLQKK
                     DSHGLSGNMHKFHLDQSVEENGSNFSLGERQLLALTRALVRGSKILILDEATSSVDYE
                     TDAKIQSRIVEEFSRCTILCIAHRLKTILNYDRILVLDQGEVVEFDKPETLFNDHSTI
                     FYQMCCGAGITAEDFSS"
     gene            <426772..>429906
                     /gene="RDS1"
                     /locus_tag="KLMA_80189"
                     /db_xref="GeneID:34718386"
     mRNA            <426772..>429906
                     /gene="RDS1"
                     /locus_tag="KLMA_80189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821932.1"
                     /db_xref="GeneID:34718386"
     CDS             426772..429906
                     /gene="RDS1"
                     /locus_tag="KLMA_80189"
                     /note="containing GAL4 binding domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678243.1"
                     /db_xref="GeneID:34718386"
                     /translation="MTSTKSNVTQEAVPKVNTNMNVNNMNVGSIPESSGVRHDQTNNN
                     GNRRVLKRNRVSYVCFACRKRKTRCDRGNPCGRCVALSTECVYAIPELNVTKKLNVAE
                     PAVPGKGPTQQPPLPTGEVFITTPHNGTGSIPVAHEHGGLHSMNPMQQLSPAMPSIQS
                     QGTSTNLKPGIPSPTTTSMLHPVHQQPSLLQQNSNADMMKIAKLEEELMYWKKKAMSF
                     GPGSSLHPTTGSYSDMTSTQSYSSTFMESPGVGNGANLSGADGCDNQIINNQSFNNVR
                     LSLDDCESTYFVHEYLRALHPPFSFPSLIFRDRHLTCMFASIFGFTYTDIIKYVGENE
                     ELTIQNLMKYGNSALISNEHTILYYYEPILIKHVQQARNQNQLKSVPVIIFTKGDRIE
                     ELVETEFPPALTSLLDEILEKLPPTETGLQLYINHFLKCIYPFYPFLNVETFLEAIGR
                     LITYDPNVINAGGKPSWNIKKETLRKDLEYLTLLMIVIQISHDLLSVSLDEDVKMDVK
                     TLDLTPLSIHSESWLSFSKRLFLILNVSRFHSEDVFCCMLYQRICYSFSPRESNLLLD
                     PHPLVHSSQLLQEALVLGLHKDPTNYKSLSNHSVQPTEISNYRRKLWLGLCNIIFQET
                     LPLGSTAKVEEYHSYFFKNLDNISFMEAVRFSLTPANTFDYRLIDMAIKKYQIGLLMA
                     KIQKACTGLTPSPISEILFLISKLEAEVLKFEKLKLTSEGIKETIKFHSLECSMDISS
                     VIRCEIIIMKLVSNSLIHNVLWSLFLKVEEKVNADESYNYYTLHAKLFEKMMLHSFKF
                     YGLMSQLFSNDFEKDTVKYRYSLTKQIQQSYLRISLWFISILLKLSLVQKDLETNGST
                     PNSVVTNSNIEIHDSKLMVIKDLYKISENAFISLVRQSKKYSILKTSMLFNKTQCLFS
                     YFVQILQMDRLLAISTRLWDMKIENKEIPQRVIQSLRKKWSINIEDAEVMRSNFFASS
                     SLHLLDYETWSNIQKYIHSMNIPLAQQSSAQFAKDAPLYQGSSALDTSIDLNLDFSSF
                     FDLDSNFGLPSLSF"
     gene            <430192..>432780
                     /gene="RDS1"
                     /locus_tag="KLMA_80190"
                     /db_xref="GeneID:34718387"
     mRNA            <430192..>432780
                     /gene="RDS1"
                     /locus_tag="KLMA_80190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821933.1"
                     /db_xref="GeneID:34718387"
     CDS             430192..432780
                     /gene="RDS1"
                     /locus_tag="KLMA_80190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678244.1"
                     /db_xref="GeneID:34718387"
                     /translation="MENNGKVHKRNRISFSCISCRKRKSKCDKLKPTCTKCNQLNVPC
                     VYDAEHQPAPRKPTKGAELIHELQKELDYWKTRAQEVGTTEKLPVLSKNEFIWNSAFA
                     PEILDLPINICTFHDKLIIHKQMKYYHKPFSTLALLQRDPFLNILTGSLYGSTFTDLH
                     IKSKIRQTGVILQEPESVEKPVHTFLEKIISKTLTERKKITNTTDPTILFASSFILED
                     CAEEDYPPVLRLLIDEIEQNLPDIEAITFYMSTFYKTIYPMFPYLNVTQFEGILDIIL
                     VRNGSRYRINLGSSSLRIKLEMLCIMMAALLLTYTSLTIKIDDSTVIPATYDIFEKNR
                     VTENVLVCCERCLCLLNSSLFTNENVLCCLLYLKVIENLRPEIGDMVISQELIITLSS
                     ISEMSLVIGLHKDPGFYVQLKDSRIIDRSIQNYRRKMWLNVVAFTSHMLLTNGSDGRI
                     TLDHLICFDKTRNGNYLSIVKEQMTQADTFDFIHHDILYKQYQVTVSLSELVSESSHL
                     YKTTTIRRLLELHRRSKTILESNFPLSSLKNNDVNVNTTTENDEYYKTKITGLRPELG
                     VISYNSDYVRKWKTFEVHIMARIVYLNICWGVCNFFETQERDTIPRYMKLFELYLIES
                     HTECFELAKLAINYMTEEYDPGIAKNFHYSSDMSVVTLLVRLYLFLTSSILRCQKAED
                     HLTISPTSSSPDILKVRQAKDIMLKLLRNLVRISNKRLAHIYLTCQKANCLFEYIIHV
                     IDIGKLSELSERFWNYYLEAKSIPQTISNNVLFKWGLDVEESKDLKQYLNKINAYNSL
                     DDGFYDRIHEAALKISTPKEDASSTAQQSDEQIFTNPNAEDILDFFDTFSMNSFEGAS
                     VIYPSL"
     gene            <433038..>434069
                     /gene="mug70"
                     /locus_tag="KLMA_80191"
                     /db_xref="GeneID:34718388"
     mRNA            <433038..>434069
                     /gene="mug70"
                     /locus_tag="KLMA_80191"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821934.1"
                     /db_xref="GeneID:34718388"
     CDS             433038..434069
                     /gene="mug70"
                     /locus_tag="KLMA_80191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678245.1"
                     /db_xref="GeneID:34718388"
                     /translation="MGLEMGIPTVANLPLEQPLFCSGDDSIHSVAKIMMSKRKYCVLV
                     KENDVVEGIVTTKDLAFRQGATARDVLSRTPVLTPSSMQVSAALQLMVEKKIRHLPIV
                     APGTDQIVGILDITKCFHQAMRRLEIMAQDSMKLNNALQDVIENEATITRQKVLQDIA
                     TLIESMETPVLESILDSELYNTTPLFASPTTTVADAIKMMSDNNSTAVLVHDSSMKSN
                     SKSSHDCNIIGIFTSKDFVCRVLSQGVGVDPSKFTLTRVMTTRPNFAFKSLGIHSALR
                     MMYEGHFLNLPVIDDTGNILGLISVLQLTHAALSSQLATRSRISGSQSTIDEPYLKIS
                     SVESPSESM"
     gene            <434142..>434792
                     /locus_tag="KLMA_80192"
                     /db_xref="GeneID:34718389"
     mRNA            <434142..>434792
                     /locus_tag="KLMA_80192"
                     /product="conserved hypothetical membrane brotien"
                     /transcript_id="XM_022821935.1"
                     /db_xref="GeneID:34718389"
     CDS             434142..434792
                     /locus_tag="KLMA_80192"
                     /codon_start=1
                     /product="conserved hypothetical membrane brotien"
                     /protein_id="XP_022678246.1"
                     /db_xref="GeneID:34718389"
                     /translation="MNYFWKSFDVSDNESASSSQLSLVDLSQTVNNFNAGKGVQEHFS
                     GRRSSTLLQKKFFENGKPSKCRLKVTVLKEDGKNHQYVLGSMKFKTASAPNPESNTLK
                     EIVEKAKDTFDIGIESQSAYSVKYMNVEVTNNEKLYEIYNEFICVNGSRHYMPLLCIA
                     NQKKTGLLYKTRQLFATAITPISAIFQTQFQIQSWKIYMQACIVFFTGIMVGKVLK"
     gene            <435340..>438612
                     /gene="PSE1"
                     /locus_tag="KLMA_80193"
                     /db_xref="GeneID:34718390"
     mRNA            <435340..>438612
                     /gene="PSE1"
                     /locus_tag="KLMA_80193"
                     /product="importin subunit beta-3"
                     /transcript_id="XM_022821936.1"
                     /db_xref="GeneID:34718390"
     CDS             435340..438612
                     /gene="PSE1"
                     /locus_tag="KLMA_80193"
                     /codon_start=1
                     /product="importin subunit beta-3"
                     /protein_id="XP_022678247.1"
                     /db_xref="GeneID:34718390"
                     /translation="MSVLPDEVNSTLVKLLQGFASPDNGIRSAAEEALNTNWITPEHM
                     EVLLMFLAEQAAYSDDLTTAGLSAVLFRKLALRAPPSSKTIIIAKNVTHISNEALTQI
                     RNTLLKGFISERPNNIRHKLSDAIAECALEELPDWPELLQTLFEAIKNPDPNFRESSF
                     RIFSSMPHLINNIDINNALPIFEGGFTDPSDEVKIAAVTAFVGYFKQLPKNNWAKLGV
                     LLPSLLNSLPKFLDDGKDEALAAVFESLIELVELAPKLFKDMFDQIIQFADMVVKNKD
                     LEASARTTALELLTVFSECAPQMCKNNANYAQSVVLDTLVMMTEVSIDDEQALEWQNS
                     NDIEEDNEENTYDMARQALDRVALKLNGKYLAAPLFQFLQQMITSSEWRERFAALMAL
                     SSAAEGCRDVLMTEIDRILDMVLPLIDDPHPRVQYGCCNVLGQISTDFAPLIQSTSHE
                     RILPALISKLTSASVDRVQTHAAAALVNFSEQATQSIMEPYLDSLLTNLLSMLQSSKL
                     YVQEQALTTIAFIAEAAEKKFIKYYDTLMPLLINVLRTDTGSESRVLKGKCMECSTLI
                     ALAVGKEKFASYSQELIQLFIQYQNEGIADDDPIKSYLEQSWSRVCRILREDFVPLLS
                     IVIPPLLETAKATQDVSLIEEEEAANYQQYTDWDVVQIQGKHIAIHTSVLDDKVTAME
                     LLQVYATILKSFFASYVKEILTEVAVPSIDFYLHDGVRARGATLIPALFTSLISAVGQ
                     ENEMVLQLWQIASNKLISGIISEPMPEVTKTYHYALVDCLGIVGDKGLSPDQLTQFTQ
                     GVNNNLTDIYERTKSRYDQDDEYNEDVDDDLDEYTDEDLLDEINKSLAAIFKSAGVAY
                     LPHFQTLWPIIHSYLQETEVFILLFALIAIADMIEYTGDNSAPFKEHFVQKMKECLTF
                     PEPSIRQGTAYLLGICAQFAPNTYSDVCLGSLETLFQIVNMPEARSEDNVNSTENASC
                     AIAKILSSYGPNIPNFEQYTANWLKTFPIIHDEECASFNYRMLAQLIEHNSPVVQGNV
                     PEIVDHVIQALHQKSIAGENAATIVQSTKKLLGTLPQDQATTLLQRYPPEIMQTIQKW
                     FA"
     gene            <439074..>439943
                     /gene="PXR1"
                     /locus_tag="KLMA_80194"
                     /db_xref="GeneID:34718391"
     mRNA            <439074..>439943
                     /gene="PXR1"
                     /locus_tag="KLMA_80194"
                     /product="protein PXR1"
                     /transcript_id="XM_022821937.1"
                     /db_xref="GeneID:34718391"
     CDS             439074..439943
                     /gene="PXR1"
                     /locus_tag="KLMA_80194"
                     /codon_start=1
                     /product="protein PXR1"
                     /protein_id="XP_022678248.1"
                     /db_xref="GeneID:34718391"
                     /translation="MGLAAARTKQRFGLDPRNTAWSNNTSRFGHQYLEKLGWKPGSGL
                     GMMSDATTTHIKVSIKDDNLGLGAKLKKKDKQDEFDSGECTGLDVFQRLLGRLNGNEE
                     TISKELDRQKTENIINGKWGIHFVKGEVLSSTWDAETKQLISYAMVKKRKADDSDNSE
                     DEHKKSKKSKKDKKEKKDKKEKKDKKEKKEKKEKKDKKDKKEKKEKKEKKDKKDKKDK
                     KVKSSKDKSSKKGKDSNGITRDEMLKPRATAASVPDAVTTRLSVRSKWIKQKRAAVMD
                     AKALNEIFMVKDS"
     gene            complement(<439992..>441617)
                     /gene="GAS1"
                     /locus_tag="KLMA_80195"
                     /db_xref="GeneID:34718392"
     mRNA            complement(<439992..>441617)
                     /gene="GAS1"
                     /locus_tag="KLMA_80195"
                     /product="beta-1,3-glucanosyltransferase"
                     /transcript_id="XM_022821938.1"
                     /db_xref="GeneID:34718392"
     CDS             complement(439992..441617)
                     /gene="GAS1"
                     /locus_tag="KLMA_80195"
                     /codon_start=1
                     /product="beta-1,3-glucanosyltransferase"
                     /protein_id="XP_022678249.1"
                     /db_xref="GeneID:34718392"
                     /translation="MSHHILYFLCSVLSLFGNAFVHAASSDDDSKTPPIEISGNKFFY
                     SNNGSQFYIRGVAYQADTANSTASSQINDPLADIDSCKRDLPYLKELLTNVLRVYAIN
                     TSLDHTECLNLFQDNGIYIIADLSEPQESISRTSPSWDLDLYKRYTSVVDALHNYTNV
                     LGFFAGNEVTNNSTNTDASAFVKAAVRDTKKYIKDKGYRQIPVGYSSNDDDETRVPMA
                     DYFACGDEDTKVDFYGINMYEWCGKSTFQSSGYADRTKEFSNLSVPIFFSEYGCVEVK
                     PRQFQEVSALYGKDMTDVWSGGIVYMYFEEENNYGLVSVDGNDVKTLDDFNNLKSALA
                     SASPTSATKSQASSTSLSCPATGEYWKVSTDLPPTPEKDTCDCIKGSLSCIVADDVAS
                     KDYSKLYGVVCADIDCSDISSNATDGKYGPYSFCDEKTKLSYLLNKYYEKNDKNESAC
                     SFSGSATLVSATGKSSTCAAASATGSNDSDSTASGSGSSATGSSSSSSSSSKSSSSSS
                     AKKSAGTVLRPSSSTIKALTILFIAMECSLVFM"
     gene            complement(<442755..>444461)
                     /gene="GAS1"
                     /locus_tag="KLMA_80196"
                     /db_xref="GeneID:34718393"
     mRNA            complement(<442755..>444461)
                     /gene="GAS1"
                     /locus_tag="KLMA_80196"
                     /product="beta-1,3-glucanosyltransferase"
                     /transcript_id="XM_022821939.1"
                     /db_xref="GeneID:34718393"
     CDS             complement(442755..444461)
                     /gene="GAS1"
                     /locus_tag="KLMA_80196"
                     /codon_start=1
                     /product="beta-1,3-glucanosyltransferase"
                     /protein_id="XP_022678250.1"
                     /db_xref="GeneID:34718393"
                     /translation="MLFNKLAAVSLASLFSSVVTADDVPAIEVKGSKFFYSNNGSQFY
                     MKGIAYQADSVNATAGATIVDPLADFDTCSRDIPYMEKVATNVVRVYALNTTLDHSKC
                     MQALNDAGIYVIADLSEPSASINRDSPKWDLDLYKRYTSVIDKFHNYSNVLGFFAGNE
                     VTNNSTNTDASPFVKAAIRDTKQYMKDKGYRQIPVGYSSNDDEDTRVPMADYFACGDD
                     DVKADFYGINMYEWCGKSTFQLSGYADRTKEFSNLTIPVFFSEYGCNEVQPRQFQEVS
                     ALYGKDMTDVWSGGIVYMYFEEANKYGLVSVDGNDVSTLADYSYYSEEINSVSPTSVQ
                     SSTYSPSATSLACPTTNKYWKAATALPPTPNEDLCECMSSSLSCVVADDVDSDDYQDL
                     FNYICGQVSCDAISGNGTSGKYGSYSFCSSKDQLSFVMNLYYEAQGGSSDACDFSGKG
                     HLVDKTDVQSGCSAALSAIGASGTGTFTGSVTFTGATSRSDASATGDSSDDNQSSGSA
                     SGSATASKSGSKSSSSSSSSSSSSSKPKNAAGSTKASMTSVLGACVITIFTIAGASLV
                     VV"
     gene            complement(<445763..>451090)
                     /gene="FKS3"
                     /locus_tag="KLMA_80197"
                     /db_xref="GeneID:34718394"
     mRNA            complement(<445763..>451090)
                     /gene="FKS3"
                     /locus_tag="KLMA_80197"
                     /product="1,3-beta-glucan synthase component FKS3"
                     /transcript_id="XM_022821941.1"
                     /db_xref="GeneID:34718394"
     CDS             complement(445763..451090)
                     /gene="FKS3"
                     /locus_tag="KLMA_80197"
                     /codon_start=1
                     /product="1,3-beta-glucan synthase component FKS3"
                     /protein_id="XP_022678251.1"
                     /db_xref="GeneID:34718394"
                     /translation="MNSPQISMSEIEFPAWYQDEEVPVTKQEIKDIFNDLTRKFGFQQ
                     SSKENVYIHLLTQLDSRASRTTAQQALISLHASYIGGDCSNYKKWYFAAQLDLDEEIG
                     FPYMKLHGKSKKRNAKIASEKGISIKEQQRQWKLKQEEFLENYPKIILSENDRKTGSS
                     YNAADYKWKLKMNSLTPSQMARQIALYLLIWGEANQLRFTPECLCFIFKCALDYDSSL
                     QDVEASTQEEFTFLNNIITPIYKFLRDQVYTIDSQGRLTRKEKDHKDIIGYDDVNQLF
                     WYPEGIERIILRSGERLVDHKLEQRYGLLKDVDWDVVFYKTYYETRTWLHTLTNFNRI
                     WIIHFASFWFFTSFNSPTLYTKNYIQTLDNPPTPQSRFSAIALGGAITCLVQILATLA
                     EWSFVPRDWPGAQHLSKRMVGLLFCFIVNFAPSVYVFGFFELDVHSRSAYIISIIQFT
                     IAIFTTVFFSIKPLGGLFGSYLQRGKAKRTYVSSQTFTASFPELTGRSKWFSRGLWFC
                     VFLCKFIESYFFLTLSLRDPIRALSTMDMSRCVGDRILGRFVCKWQSSITLFLMLITD
                     LILFFLDTYLWYIICNCLFSIMLSFSLGTSILTPWKNIYSRLPRRIYTKILATAEMDT
                     KFKPKILVSQIWNAIVISMYREHLISIDHVQRLLFQQVESTFHEGRALKSPTFFLAQD
                     DSNFKSMEFFPRNSEAKRRISFFAQSLSTPITEPIPVECMPTFSVLIPHYSEKILLSL
                     REIIKEESPNNKITLLEYLKQLHPTEWECFVRDSKLLAIENGHLSKEIDEPDYNSSNN
                     NNDGSNVESNASKKDDSYIQEKISDLPFYSVGFNDSDPRYTLRTRIWASLRTQTLYRT
                     ISGFMNYGKAIKLLYRIENPSMVHMYADNIDGLESELESMARRKFKMVVAMQRYTDFN
                     QSEREAVDFILKVFPSISISYLIKEKDPNNVTGEPVYYSCLCDGMCEVDVVTGLRKPR
                     FKIRLSGNPILGDGKSDNQNHSIIFYRGEYIQVIDANQDNYLEECLKIRSILSEFEEL
                     EMENFMPYIPGIEYSEQSPPVGIVGAREYIFSENIGVLGDIAAGKEQTFGTLFARTLS
                     EIGAKLHYGHPDFLNAIFMTTRGGISKAQKGLHLNEDIYAGMNVLCRGGRIKHSDYFQ
                     CGKGRDLGFNSILNFTTKIGAGMGEQLLSREYYYLGTQLPIDRFLSFFYAHPGFHLNN
                     LFITMSVQLFFILLLNLGSLNHEVTSCIYDHNKPITDIPTPIGCYQLNPVLHWVTIFV
                     LSIFIVFFIAFAPLLIQELLEKGIWKAFSRFNHHLVSLAPVFEVFVCQIYSHSLSADI
                     TFGDAKYIPTGRGFAITRLDFHDLYSRFAVSSIYSGSMVFLMLLFATLSIWQPALLWF
                     WITVISLCLAPFIFNPHQFSFTNFFVDYRNLIRWFSAGNSTYEPVSWANFVKENRSRF
                     TGYKRKMIQDKSESKSKTQRRPPLTNLFISEVLTPFFLVVFSLSAYCFINSQTGVKNE
                     RPTQLLIRLAIVTLFPIIGNIVSLSCLFMLSCFAGPILSCCCIQSSGTTAAIAHGFSV
                     VLYLLDFEIMWFLEGWNFTRTLVMTIAVINIQNFIFKLFTIVVLSREYLNNKSHLAWW
                     SGKWYNTKIGWSVVFQPGREFIVKVIESSLFAADFILCHFLLYAQTPIILIPFIDYWH
                     STMLFWLRPGSFLSRTTIYSAKQKKIRRSIVRRYFLLYVLILIIFLTLLVVPMVTQSY
                     LPIGEELFTDDLLSGLIQPRKQENNDTGPNAPSTILRTTPQRPVFKTVA"
     gene            <452704..>453837
                     /gene="SCW4"
                     /locus_tag="KLMA_80198"
                     /db_xref="GeneID:34718395"
     mRNA            <452704..>453837
                     /gene="SCW4"
                     /locus_tag="KLMA_80198"
                     /product="probable family 17 glucosidase SCW4"
                     /transcript_id="XM_022821942.1"
                     /db_xref="GeneID:34718395"
     CDS             452704..453837
                     /gene="SCW4"
                     /locus_tag="KLMA_80198"
                     /codon_start=1
                     /product="probable family 17 glucosidase SCW4"
                     /protein_id="XP_022678252.1"
                     /db_xref="GeneID:34718395"
                     /translation="MRFTSLIASASILGAAVSTPIHGHKDNKRDVEYVTNRITSTVVV
                     NGNAPMTLAGASTTLALDSDHIPAAATAAASPVSDVTRENAAPTEAVSTTAAAPSTTA
                     SSSAAASSSSSSAPSSSDLGSGFQGITYSPYSSNGACKSAEEVASDIAALSSYGTIRL
                     YGVDCNQVENVFKAKAKDQKLFLGVYFMDQIEAGVKQIADAVSSYGSWDDVVAVSIGN
                     ELVNSGAASVETVGSYISTGRSALTGAGYSGPVVSVETFTALINNPGLCEYNDFVAVN
                     AHAYFDQNTAAEDAGPWLMNQIERVWGACNGNKKVTITESGWPSQGQTYGKAVPSKEN
                     QQKAIESIKQSCGSATILFTAFNDYWKADGPWGVEKYFGVLSN"
     gene            complement(<454347..>455936)
                     /gene="CWC22"
                     /locus_tag="KLMA_80199"
                     /db_xref="GeneID:34718396"
     mRNA            complement(<454347..>455936)
                     /gene="CWC22"
                     /locus_tag="KLMA_80199"
                     /product="pre-mRNA-splicing factor CWC22"
                     /transcript_id="XM_022821943.1"
                     /db_xref="GeneID:34718396"
     CDS             complement(454347..455936)
                     /gene="CWC22"
                     /locus_tag="KLMA_80199"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CWC22"
                     /protein_id="XP_022678253.1"
                     /db_xref="GeneID:34718396"
                     /translation="MSSQEEQLEEWHASKDVIEYAIKSLDSKNILQSVEALIDVNLLR
                     HQRLLVATVLGVQCETDKAAALAALVKILNGFIPSIGYMTGRECVLRLVDGIFRKDST
                     VYYNMIELLSFLIRDEVMSEGVAFALIYFLLGEANDESISIVCYIMCSFGKLLQEFDK
                     ESEADIAEKLRVIYENPHTNKETYSALSKFFDKRRLMYNGQQWNIDFPFVESNVHNIV
                     VDFSTQTPCIDLDTFKVDEDPEQTNVKYSGIRAEIIEAFFEKKENKSSINDMTDADKT
                     AFKKKIYLILKGSLSGDEAAHKILKLKLKAPEKTLVADIVARACSQEATYSKFYGILT
                     ERLCSFHDSWRNSFANTFYNDYECMSDNDPSNIRNLGKFWGHALATDCIPFEVFKAVH
                     MNERDSNAANRVFLKFLFHELVLDMGIDKLKSKFDEPDLQDHLVNLFPNKEYDDIMFS
                     INYFTAIGLGPLTDRMRSTLQKFEEERRERYSNAIRNSELEDKENVRTPRMHPDRLRR
                     NRSRSPIGRRNRSRTPPRRRR"
     gene            <456156..>457028
                     /gene="CAB4"
                     /locus_tag="KLMA_80200"
                     /db_xref="GeneID:34718397"
     mRNA            <456156..>457028
                     /gene="CAB4"
                     /locus_tag="KLMA_80200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821944.1"
                     /db_xref="GeneID:34718397"
     CDS             456156..457028
                     /gene="CAB4"
                     /locus_tag="KLMA_80200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678254.1"
                     /db_xref="GeneID:34718397"
                     /translation="MGARIAIVLHDSNGIEFNNEFAAVVERTLEFLEDSVDYSLDIIL
                     EEKFTDAYHLDSILGHIYSIARDVLITKDLFFTSINVLFNVQEHSGLYDVLFLGESCD
                     GTKLNYKRLETFKLHSVVDHTEEQKQQSLGEGQYRVSAVGGTFDHIHDGHKILLSIAC
                     FITSEKLIIGLTDQELLMNKKHKDMLEPFAVRSANVEAFLKALKPTLKIEMIAIRDVC
                     GPTGTVPDIEALVVSRETLAGGEVVNKTRKEKGLSTLDIVIVNVLGGREEDGWKEKLS
                     STELRERSSKKVSQ"
     gene            complement(<457098..>460610)
                     /gene="UBP15"
                     /locus_tag="KLMA_80201"
                     /db_xref="GeneID:34718398"
     mRNA            complement(<457098..>460610)
                     /gene="UBP15"
                     /locus_tag="KLMA_80201"
                     /product="ubiquitin carboxyl-terminal hydrolase 15"
                     /transcript_id="XM_022821945.1"
                     /db_xref="GeneID:34718398"
     CDS             complement(457098..460610)
                     /gene="UBP15"
                     /locus_tag="KLMA_80201"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 15"
                     /protein_id="XP_022678255.1"
                     /db_xref="GeneID:34718398"
                     /translation="MSEVKTVGKIRSAVDLGTRFSDILPENKELQTKAEGSFTWSIDN
                     WFQLIEDKYYSGRYKFDGWEWDLLIFPQGNHSRGVSIYLAPHPDPELVSSEETPDWHV
                     CAQFAIVFSKPNDDKAVQLSNKASHRFTATDKDWGFSNFVELEYLKHYARNRPSGFLN
                     QGALNITVLIRTIEDPTGVLWHNFMNYDSKKMTGYVGFKNQGATCYLNSLLQSYHFTK
                     LFRKLVYQIPTENENPTDSVALALQRAFYLLQTSKEPLDTLELTKSFGWDTGDAFTQH
                     DVQELNRILMDRLEHRMKGTAVEGKINELFVGKMKSYIKCINVDYESSRVEDFWDIQL
                     NVKDMKNLQESFEQYTEVELMNGENQYAAQRFGLQDAEKGVVFESFPPVLHLQLKRFE
                     YDFNYDQLIKINDRYEFPESIDLSPYLDADAPKDTPAEFVLHGVLVHSGDISTGHYYT
                     MIQPDANGLWYRFDDDRVIKATKTQVFEENFGKKKLSDEELQTLTKEEYQNYLLARQT
                     SAYMLVYIRKDMEETILKEVERSDVPKHVVSSIDEELEKREIRRKELEDMHLYANIHL
                     HTQRNFIHASTHDLSPNKRAIDFSPELYNENEFALEKKVLKSTKIRDLIQSLNNDLGI
                     KNPELVQYWCMTYRLNETLRLDDIIPDSIMDSTVEELMKEKGRTSAFDLYLEEPYFEL
                     TYLTELVKNGLITFKVMNEEFLSSVEDAVANKSFPAPSIDKSANSNTLLLLKQFNPKE
                     QKLSGFTYVRLSMWEKVNRIFELLQILDLDVDTTSIYEEANTNEVFPLKASDEIIQCE
                     LKNGDIITFSVKSSSPVTTIPYYPDIPSYYSYLSNRIKLTFTRAADSDEDYVITNDED
                     REPFTFWLSAKSSYNELAKVISKHVKVKPEYLRLYAVYPSRKFVMNSNSVLTDYLIKN
                     FTKETIPNFEYEVLSIELNQLEHLRSIKFVWLTNSYVHFQCYEFRVPNSSTVRDFIEK
                     LQARIGFSDEDKQNILLWTNSSFEFEGILTPNMIFDSMKSSLVVFGRVLPEELQIIKQ
                     IEVDSGYDDQPIDENRTMAEDSKSLQNGKVVIVNQYFRELENSHGISFLFVLFPGEKF
                     KDTRSRLHERFGLGRKEFAKIKLGAYYQTEKGATYLSLEENETTNNLVLYDKLNNLDH
                     LCMDHPDRSRTQNTYSDRPMVIKN"
     gene            <461244..>463688
                     /gene="YME2"
                     /locus_tag="KLMA_80202"
                     /db_xref="GeneID:34718399"
     mRNA            <461244..>463688
                     /gene="YME2"
                     /locus_tag="KLMA_80202"
                     /product="mitochondrial escape protein 2"
                     /transcript_id="XM_022821946.1"
                     /db_xref="GeneID:34718399"
     CDS             461244..463688
                     /gene="YME2"
                     /locus_tag="KLMA_80202"
                     /codon_start=1
                     /product="mitochondrial escape protein 2"
                     /protein_id="XP_022678256.1"
                     /db_xref="GeneID:34718399"
                     /translation="MLLSRFAATSVKPSHIVALSRFGKVALWAGASKRFVSSEIQQKD
                     EQAGEASTATATGIIHKTEEETLLYFDNVYPRAMSLWRPTQWYNLLLSNQSREAVRAK
                     IFNYASPESNPIHGLELRSTIPIKRDGGVFATFLVPPNYTKAALNTLIQKNTEEESSK
                     SWFSYFTKVSVFPVKGSPWIEDLRRLPSNQIKVKFEGGFLTEEEVYALFRRYGTIVNI
                     FPNPQEKTYGIVYRSFRGAICAKNCVSGMEVHNSIIHVQYKQLAQGHVIRDFFVNHTR
                     IAVPVLLALLSIVAVIIFDPIREFTIEQKITHRYSLSWDNHFLKKLLSLTSSTMSSVK
                     HYWGISDNQVQKRQLWEERQEKVGDLKLWLQENNNTFVVLRGPRGSGKHELVMQHALH
                     DRPNVLYLDCDKLIKSRTDAKFLRNAASQIGYFPIFPWVNSVTNLLDLAVQGLTGQKS
                     GLSESKETQFRNMLSTAVMSIRHIALKGYKPVIGSGDNAITVKEEDYLQQHPEKKPVI
                     VIDRFTNKAEMNGFVYKELSDWAAMLVQMNLAHVIFLTETVAPNQLLAESLPNQVFKM
                     MSLSDASKKSARSYVLAQLKETNEEEDEGSVSPINLDMNEKFVEEIDDSLDPIGGRML
                     DLQAFVRRVKSGEQPKEALEKMVEQASEQITQIFLNGSADPLRGAQAWELIELLSAKE
                     SITFRDIIYRPLFKAAPEDALLELEKNGLVSMKRDRGVLTDILPAKPLFRAAFNYLLE
                     NKDIYNVLRTSYLLRMITFETGRIKKWEEELKALSKVSDQKSFRSRLNYLGGKIEGSS
                     AVINNCEEEIKKLSKQ"
     gene            complement(<464102..>466456)
                     /gene="MKT1"
                     /locus_tag="KLMA_80203"
                     /db_xref="GeneID:34718400"
     mRNA            complement(<464102..>466456)
                     /gene="MKT1"
                     /locus_tag="KLMA_80203"
                     /product="protein MKT1"
                     /transcript_id="XM_022821947.1"
                     /db_xref="GeneID:34718400"
     CDS             complement(464102..466456)
                     /gene="MKT1"
                     /locus_tag="KLMA_80203"
                     /codon_start=1
                     /product="protein MKT1"
                     /protein_id="XP_022678257.1"
                     /db_xref="GeneID:34718400"
                     /translation="MPVRSLEAYLFERGVVGSASIDILQNCTLGIDVNHYVSRLLTSK
                     REQYLDAIGGPPTSLRMYIDSDLEVFQENNVTPVFLFPGSLTSNQLDYQSYSTAGADL
                     LNSMGSQTGNPGSGKSPLASAIAQRNRAWAQWTNLLNQNKSTYIDQPLVPNEVFRHGA
                     PIDLKRFQADLIHYFIEKDVRFQVAPYCSWMQLAYLYEMEYIDAIYGPTELLMLKNVP
                     KFIVGMEFPNKEFRFVDSQRVLHELKCNLEDFIDICMAIGNDLQPKTLPPLQVYPSVQ
                     LFETALDMSVNGGTNYYTYLLTNPVKIDMSQEIESYQKGVSSLKYMPVLTESGRVELY
                     TPDSHNPIATESESSKSSSPEPIPNDVHEFIQQRLPHEYNFYRSIGLIGNDLLTTLAT
                     GIYAEYAPLDGGSSESYKELVKKSIDIFKTKAVNLLTSPINRYYQIKQMKYISWFNPG
                     NEVVSSGRILPTIFESVNRIAVCTKETEEFSISKLVNLLSGTKDLSRFITDKVLFPAS
                     VPADEKLTTPFDLLATNFLRFLTILGFYELDIESKKLTPSKYGILLSELNELDVSPEN
                     LESVLILIVFIKLGVLSLSEETHPVTPPALSAATLRSYPKESQYILVLTRVLTMYQLS
                     QKPVNYYGPIDKKLLIFRDHLDLVKKNLCQLFESVTVSSLVTGEFDRLSLDNDGWINS
                     IVKLMPFKLSSPNTIMAMMWEFYLQKWLHNGHDKEDAMNLISVTFSAYKSVPKLEEEF
                     RKSFELIEQVGTVYARMAELGLIKQSDLETYENAYRFITETYSQ"
     gene            <467105..>468142
                     /gene="OST3"
                     /locus_tag="KLMA_80204"
                     /db_xref="GeneID:34718401"
     mRNA            <467105..>468142
                     /gene="OST3"
                     /locus_tag="KLMA_80204"
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit 3"
                     /transcript_id="XM_022821948.1"
                     /db_xref="GeneID:34718401"
     CDS             467105..468142
                     /gene="OST3"
                     /locus_tag="KLMA_80204"
                     /codon_start=1
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit 3"
                     /protein_id="XP_022678258.1"
                     /db_xref="GeneID:34718401"
                     /translation="MKFSALFLGCIVWLFSIVEAISNKKLLELSKKNGNVINLNSRNY
                     EKILNSPRKSDIVVMFTASSTQFSCTLCNEMSPSFDVVANSWFYDHKDGISKDLKEEG
                     HGLFFARADFGPDSKQLFSRFQLTSVPAFFVFKAGGKTADEFEKITITSELGGNHLGF
                     LAGQIKYLTEVADLVVYEPINWGSTVITTVTVGVLTFVIRKFTSTVVGILTLRPLWGV
                     LCSFAVITLISGNMFVKIRKPEFSGMSSNSVVYFLGGQLQNQYAIESQIVTILYSVLA
                     SAMVGLICVVPGIQKWYKNKNQEGKAAFVFFSLALAFSLCIYIFYSALVAVFALKNSG
                     YPFKLFKNPLK"
     gene            complement(<468256..>468555)
                     /gene="SNN1"
                     /locus_tag="KLMA_80205"
                     /db_xref="GeneID:34718402"
     mRNA            complement(<468256..>468555)
                     /gene="SNN1"
                     /locus_tag="KLMA_80205"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821949.1"
                     /db_xref="GeneID:34718402"
     CDS             complement(468256..468555)
                     /gene="SNN1"
                     /locus_tag="KLMA_80205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678259.1"
                     /db_xref="GeneID:34718402"
                     /translation="MNIDTQEVTNSGLHPIELCVYSLLSNNLESIYQSINELRESQAV
                     LILQLKKLREKCKDEQDQLNKELTLGDETLRLEKLQRKVDALLKRYERMVSAVSK"
     gene            complement(<468835..>472356)
                     /gene="TCB1"
                     /locus_tag="KLMA_80206"
                     /db_xref="GeneID:34718403"
     mRNA            complement(<468835..>472356)
                     /gene="TCB1"
                     /locus_tag="KLMA_80206"
                     /product="tricalbin-1"
                     /transcript_id="XM_022821950.1"
                     /db_xref="GeneID:34718403"
     CDS             complement(468835..472356)
                     /gene="TCB1"
                     /locus_tag="KLMA_80206"
                     /codon_start=1
                     /product="tricalbin-1"
                     /protein_id="XP_022678260.1"
                     /db_xref="GeneID:34718403"
                     /translation="MSAGTEIVNPPPAEEVAVVNGVDKLAPKALLATSNESSENKEVD
                     EKATSAEIRPVMDATYVGWKQIGGWEESDRLTLQDQIIGANDETFLDNVIPDVAYGDW
                     YHSVGIFFIGGFLSFLLGKFKFSLGPVFFIIIVTAIFYRTSIKKYRSALRELVQKEFT
                     VDKIEDDYESMEWLNTFLDKYWPVLEPSVSTMVVDQVNVELAKNEAIPGFIKALWIDR
                     FTLGVKPPRVELAKTFQNTDLDVAVMDFALSFTPHDLSDMTAKQLRNYVNQTVVIKAK
                     MFGITVPVVVSDVSFRAHVRIRTKLMTAFPHIENVNIQLLDVPDVDFVCKLLGGTVFN
                     WEIMNIPGLYPLIRELAKKYMGPMFLPPFSLQLNIEQLISGAAMSIGALELTVKNAKG
                     LQRSSSLNVSVDPYLEFSINNTVLAQSRVVKDSLNPVWNESLFLLVGSFTDPLTITVY
                     DKREKLKDKVLGRMYYNLSSLHDTPLQKNLSSFFLRNSKPVGELFFEMKFHRTLEPKK
                     LPDGSVEEAPDLNTGITKITILEGKDFSETTTPVNCYVELYVNSKLVLTTSTVKGKEI
                     PAWGTPYEAVVTNRRKTRVKLVVKNSKGEIITNTVQTLNDLIDRSLVEKEWIPLKNGR
                     SSLKINTVFKPVSLDIGSNSVSYTPPAGVIRVLINKAHGLKNLERFGTIDPYARVLVN
                     GQARGRTTDKESTTNPVWNESIYVSVTSPNQKITIECLDVETAGEDRTLGKFDIATAD
                     MFQKGPDDKYIAHIDEEPKTGKLISKKGGSKGEVTYYVSFYPAVPVLSLEEIQEVDEI
                     AERKAKLEKEKKEMEESEELKNNSVLKKKLESEADELKELDDMYSAKLKLDLDELVQY
                     NSGVLSVYILSAELPQQGCYIQAFFDSNGYPRFHTPRSPTRSFREGMVGDVMIKELEW
                     SITTLRVTKNKDQNKAEDCICEVTIPTIELVRNCYYKPSIVNLKGNADAKVMLQVSWF
                     PINTTKLPSSDLITNNGDLTVNIKGASNLLAADRNGKSDPYVKLYLNDNDTPFYKTKT
                     LKKTLSPTWNESCTVQVVNRVNNYLKIKVMDWDAGNADDAIGEAVVPLSKIDPESPTD
                     LDIPLILPPEKKDAGVIHLSFNFEPRYVLAVTRKETKIGDLAGKGLSAGIQAGTTVIG
                     TGLGAVGKLKKGIFGSSKKRDEQIEEV"
     gene            complement(<473161..>477510)
                     /gene="TOP2"
                     /locus_tag="KLMA_80207"
                     /db_xref="GeneID:34718404"
     mRNA            complement(<473161..>477510)
                     /gene="TOP2"
                     /locus_tag="KLMA_80207"
                     /product="DNA topoisomerase 2"
                     /transcript_id="XM_022821952.1"
                     /db_xref="GeneID:34718404"
     CDS             complement(473161..477510)
                     /gene="TOP2"
                     /locus_tag="KLMA_80207"
                     /codon_start=1
                     /product="DNA topoisomerase 2"
                     /protein_id="XP_022678261.1"
                     /db_xref="GeneID:34718404"
                     /translation="MTQSKSVSERYQKISQLEHILKRPDTYIGSVETQESVQWIHDEA
                     TDCMIEKTVNIVPGLFKIFDEILVNAADNKVRDPSMKKIDVTINQEENLIEVRNDGKG
                     IPVEIHEKEGIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETA
                     DPSKGQKYVQKWENNMSVCHPPSITSYKRGPSYTKVSFRADLQRFNMEKLDDDIVGVM
                     RRRVYDINGSVRDVNVSLNGKPLKIKNFKNYVELYLKSLEKIKLNRLQELTNPDEPAQ
                     EPTNIPAILYEKINDRWEIAFAVSENSFQQISFVNSIATTSGGTHVNYVTDQIVKKVS
                     DRLKKQKKSIKPFQIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSKCEVPNDFV
                     NKVMKTDLATRIFDIADENAEKQLKKTDGSRKNRITEYPKLEDANKAGTKEGYKCTLV
                     LTEGDSALSLAVAGLAVVGRDYYGCFPLRGKMLNVREATPDQITKNAEIQAIKKIMGL
                     QHKKRYEDATSLRYGHIMIMTDQDHDGSHIKGLIINFLESSFPGLLDIPGFLIEFITP
                     IIKITITRPKKQTISFYNMPDYEKWREEESHKYTWKQKYYKGLGTSTQQEAREYFSQL
                     DLHLKKFHALQGDDCQLIDLAFSKKKADDRKEWLKLYEPGTVLDPKLTEIPISDFINK
                     ELILFSLADNIRSIPSVLDGLKPGQRKVIYACFKRNLKSEIKVAQLGGYVSEHTGYHH
                     GEASLYQTIVGLAQDFVGSNNIYLLKPNGAFGTRATGGKDSAAPRYIFTELNKITRKI
                     FNSLDDPLLTYIQDDEQTVEPEWYLPVIPMILVNGCEGIGTGWSTNIPPFNPVDIVNN
                     VKRLLKGEEMEPMAPWYRGWKGSIEKIDTQKYRTYGRIEQIDECTLEITELPPKTWTC
                     VIKEYLLLGLSGNDKVKPWIKDMQEQHGATIKFIVTLSPEEMEKTRKIGFYERFKLVS
                     TVSLSNMVAFDPQGKIKKYDDVRDILSDFYYTRLEYYQKRKDYISERLKWEVDKLSFQ
                     VKFIKMIVEKELTVSNKPRPVLFKELESLGFPTFNKEGKPTYGKVSDIASIEEIKKDE
                     DEDDDDEDDEKEDPDESEDVVNGPEEKFGNYDYLLGMKIWSLTKERYEKLLEQMQEKQ
                     TELERLLKLSAKDLWNIDLDDFMAQYERFIELDEEIRNNIVPDAATKKKGKRTRRKDD
                     DDYDPKKPKKRSRKTIKHDYSEFERVLIEPKIIEKVKRVPKIKTENNDITKKLSKASK
                     SKQSTPEVVVPAETVPKKEPSSSSSTTTIFSKPSNSASTKQENGEKDEFSVFSSKFKK
                     LSSDFNANSEESLTSTSTVPSLSASASDATKTPPPAPAQNTASKSDDEDEEISLRKNK
                     KPAKKPSSAQMVSLSDESDLEILENLPSQPRKRAARAAKAKPSAYSQDISDDSFLDDD
                     DDANSDGSFHASE"
     gene            complement(<478187..>478750)
                     /gene="RHO2"
                     /locus_tag="KLMA_80208"
                     /db_xref="GeneID:34718405"
     mRNA            complement(<478187..>478750)
                     /gene="RHO2"
                     /locus_tag="KLMA_80208"
                     /product="GTP-binding protein RHO2"
                     /transcript_id="XM_022821953.1"
                     /db_xref="GeneID:34718405"
     CDS             complement(478187..478750)
                     /gene="RHO2"
                     /locus_tag="KLMA_80208"
                     /codon_start=1
                     /product="GTP-binding protein RHO2"
                     /protein_id="XP_022678262.1"
                     /db_xref="GeneID:34718405"
                     /translation="MSTSPVKRKIVIIGDGACGKTSLLYVFTLGQFPEEYHPTVFENY
                     VTDCRVDGIKVQLTLWDTAGQEEYERLRPFSYSKADIILIGFAIDDPESLGNARNKWA
                     EEVLRYCPEAPVVLVGLKKDLRTIGDQSQMVTQEQAEQVARAIGAKKYMECSALTGEN
                     VDDVFEVATRTSLLVNKQPGHGCCVIS"
     gene            complement(<479364..>483170)
                     /gene="NST1"
                     /locus_tag="KLMA_80209"
                     /db_xref="GeneID:34718406"
     mRNA            complement(<479364..>483170)
                     /gene="NST1"
                     /locus_tag="KLMA_80209"
                     /product="stress response protein NST1"
                     /transcript_id="XM_022821954.1"
                     /db_xref="GeneID:34718406"
     CDS             complement(479364..483170)
                     /gene="NST1"
                     /locus_tag="KLMA_80209"
                     /codon_start=1
                     /product="stress response protein NST1"
                     /protein_id="XP_022678263.1"
                     /db_xref="GeneID:34718406"
                     /translation="MVAHKKGKKKSKKQHGSGSEKEVKDSKIHAEIIDEESEYPTSRV
                     IKRAPNGDVIVESLPEQDSGDGSDSHNDRTGPGGALGDTVEDVEDTKWPIKLDTHWES
                     LSLEERRNILRISKDELFEMIKSYKNVHSCDCSMCGRNNNMNIEQEIEQIYAELYESA
                     KYEDAETDFIQFHLKLIKEYQSKGNDSSYFHSHHRKHSNHKEGDSVDTANSGDHIDNS
                     SNNEEQSTVKLPKNSNTDSAQDDSNDPFLKSLHADYPIKYYLPEEVLAAEEADELKYM
                     DKADANTNSHPTFSPPSKHSPASLDWKQEIKQFKSSKQKQLTETDIQPSGDLQRLQEV
                     EQISASPSYGEVDSKLLSFAKTLVSSHPHIAEEFINRAIMYPHIKAITEDMMNNEGEG
                     LKNAMESLVLQQQQHQQENEDALSQYEATSSDGGDLENSSQDNNNSDENEDDDSKQKN
                     DGKTIDTVSATGSTEIEALINNVNFDFVKDPTSVSSLIGACYDVINNKDKRLEIDKDN
                     REHKEELERLRHEISAAESHESYDWSNDEYEEGSERNEPDEDYIDDEDIDDHHLDSDY
                     DDDDVIYDDIDENVKSNKESYSTDHGHGSLVDRHHKSSMPNDSEECIDDDYDSEIDHA
                     ERLEEGRRLIQIAITKLLQKKLIASYQEKEAEKNRERLLMELEAEENQKKEREKRKQK
                     KKEKEKEKKRLQQLAKEEEKRRQEEEELRLKKEAEEKELARREAQRKKVEEAKRKSDE
                     KRKKKLAEQRRREEEQERIRKEKEELKRQREEEQKQKKLEKEKKQRELEEQRQQKKRL
                     EEIEKQKQQQQQQQQQTEATIKSQEHASMDISRAEATPYNLITNDVFHSNTTLNDDIF
                     NMINQASKSMSSSPSRTQDSALDASMLASRGIHNPMSTEDVLLPPSSTYSLPNTSPHT
                     QTAFSQQGSSLPLNSLGSWEQSQSSQAYYNAQNPSVEVPNTLPSYADGNVNVSNEVNS
                     ITNFLKDTTINDIPISSKNSLPSQSLEPLSISPRPQSVVYNRPALWSNDTTQRINRFN
                     HQQAQPNQLSSSQQRRSIWDSSSDSAFAVNSTNGFGSSIWGSATPIQAPATTILPSPQ
                     ATEPSNESYMDILTNCYKLLSPDNSFVPLDKLYQASLTQINAKSVLSYSQFVSTLMSM
                     KKLNKCELLNDNTGMLAYCRMGGPMSAGLSAYSQGSYSGAPSHATADTQSLGAIPTTA
                     APTNPLAQSLNSIFGDVSFSQAIPAVPAPVSQIDGMSNTNPDPANYLNYDQSFPVSYQ
                     GSNIWS"
     gene            <484587..>486617
                     /gene="YVC1"
                     /locus_tag="KLMA_80210"
                     /db_xref="GeneID:34718407"
     mRNA            <484587..>486617
                     /gene="YVC1"
                     /locus_tag="KLMA_80210"
                     /product="calcium channel YVC1"
                     /transcript_id="XM_022821955.1"
                     /db_xref="GeneID:34718407"
     CDS             484587..486617
                     /gene="YVC1"
                     /locus_tag="KLMA_80210"
                     /codon_start=1
                     /product="calcium channel YVC1"
                     /protein_id="XP_022678264.1"
                     /db_xref="GeneID:34718407"
                     /translation="MEQSVLPCTSQEYWEDPANTSNCIAPNSRQILKIATNLKYLIDE
                     VIPIAYDESSITCEHSRIINAKVIKLAREACGGDRKNRDSVKKYESVIVFALLKVCGW
                     YWGLAESELHNSEVYNARAVAAQQLSKLIIEETEQEDYHYTFMQLLLRRYVINENEVD
                     SVPTSALELAMDMHCTIVIGSSGYQRCLKWLWRGWIVQNKYDPETFTLCSIVPRCELR
                     KHFTPDRLRAPVYQNLLQIIFSLFYLMFYTIVVNQKDSVNVEPIGFWESWFYVFTLGH
                     IIDEVVKCYHIGWAYLGFWNVYHDFMFSIIVWSIVLRIMSVCPWKTNMPAEHWDTVSY
                     RILSCAAPLVWSRLLLYLESERFVGALLVVLAHMMRESIYFFFLLILVMIGFLQGFLG
                     LDSADGKREITWPILTNLLTTILGGGGFDMFEKFAPPYAAVLYYSYCFIVTIILLNIL
                     VALYASAYQKVIDNATDEYLALMAQKTLRYIRAPDEDVYVPPLNLIEICITPVLWLLP
                     KRQARGLSNIVMTIIYSPILCYIAVVETVQARRIMYNRLNKLPDDANEDDVAWDLTDG
                     FQEEDVSLLDSNVVKSFKVTKRRNERAQQIQREAENVDPRFAVRKEWFKEVKQVVQPV
                     TEGFETGIGWEHYRIFNELTERQVESDKKIDELTDMVNNLTSLIKELKIKED"
     gene            complement(<486667..>487881)
                     /locus_tag="KLMA_80211"
                     /db_xref="GeneID:34718408"
     mRNA            complement(<486667..>487881)
                     /locus_tag="KLMA_80211"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821956.1"
                     /db_xref="GeneID:34718408"
     CDS             complement(486667..487881)
                     /locus_tag="KLMA_80211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678265.1"
                     /db_xref="GeneID:34718408"
                     /translation="MDLPEEAISDQVLLERTANSFYHYKDFCLQEIWKPRILKWKSLS
                     TYQKQLIPWYEDYLNNIRDCIESNSIFYMNLLEKCVGIWGLGSDPNKWATPNNVDMGK
                     TVSILNQIAREWSADCSEERDRFLALLKDFLDSKFPHDRRDVKVLVPGAGLARLAVDI
                     ARMGFSTEANEVSYHMIMVGQFIMDSGLQKDQVGIYPFVHSFSHHLNRREQLRRVNIP
                     DINISEELGGKGLLSMVTGSFPDLYGPNTNIKQSDSYSNSAYIREIRARNRSTKDLVV
                     TNFFIDTASNVLDYLETISHVLKDGGYWINFGPFMYHFEQDPQTEITADFNPYTGEVS
                     NMFVTPLKGLELSHEDILSVASTKFPFKIIHEQSHISSGYGTNKMDISMQGYQCSFWI
                     LQKSCDKVNNNI"
     gene            complement(<488237..>488863)
                     /gene="VPS21"
                     /locus_tag="KLMA_80212"
                     /db_xref="GeneID:34718409"
     mRNA            complement(<488237..>488863)
                     /gene="VPS21"
                     /locus_tag="KLMA_80212"
                     /product="vacuolar protein sorting-associated protein 21"
                     /transcript_id="XM_022821957.1"
                     /db_xref="GeneID:34718409"
     CDS             complement(488237..488863)
                     /gene="VPS21"
                     /locus_tag="KLMA_80212"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 21"
                     /protein_id="XP_022678266.1"
                     /db_xref="GeneID:34718409"
                     /translation="MNSNITSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAF
                     LTQRVNMADHTIKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWV
                     KELHEQASKGIVIALVGNKMDLLESEDDRKVAREEAEKLAQEENLLFFETSAKTGENV
                     NEVFLAIGEKIPLKKANGAGNGELNAVDDRRIDLNNSTNPENVSNCAC"
     gene            complement(<489281..>490933)
                     /gene="PTC5"
                     /locus_tag="KLMA_80213"
                     /db_xref="GeneID:34718410"
     mRNA            complement(<489281..>490933)
                     /gene="PTC5"
                     /locus_tag="KLMA_80213"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821958.1"
                     /db_xref="GeneID:34718410"
     CDS             complement(489281..490933)
                     /gene="PTC5"
                     /locus_tag="KLMA_80213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678267.1"
                     /db_xref="GeneID:34718410"
                     /translation="MPPPSLLQVRTFRALSRCLSRNDLTRMLFLSQRRSASSTSNQRR
                     QGGILRSNELKYAVLGGTLILGYSYFSSYVSSDSIYGLKQYSTSKSAATNINANTNSN
                     SNSNTVSLLNDKQVEAILHKSEESYFVNRGKGVLRYDVSQLPSNAPIEDNRVEQIITV
                     PTESSESLEDLYFFGIFDGHGGPYTSAKLSQELVPYVAYQLGQIYNKGAAFLTSESID
                     EAITQGFIQLDNDIVYGSLGKLFEDPSKENLVESLPAVSGSCGLLSMYDSNNCTMKVA
                     VTGDSRAILAKQSDDGSWTVKSLSTDQTGDNEQEVERIRKEHPDEPNCVHRGRILGSL
                     QPSRAFGDYRYKVKEINGKSVHDLPDHLKIYFRREPKDFLTPPYVTAKPEITTTHIDD
                     STKFMVLGSDGLFELLSNEEIAGLVIKWMEKHPIKKNFKVLKEQSPYGKLPALEDISP
                     DKESQRPAFRYKTSSNKGKASKSEYLMEDENVATHLIRNALSGGGNKDYVSTLVSIPP
                     TKSRRYRDDLTVTVVFFGNETEGTDGKLEINHVATKAETPKL"
     gene            <491813..>492859
                     /gene="TMA46"
                     /locus_tag="KLMA_80214"
                     /db_xref="GeneID:34718411"
     mRNA            <491813..>492859
                     /gene="TMA46"
                     /locus_tag="KLMA_80214"
                     /product="translation machinery-associated protein 46"
                     /transcript_id="XM_022821959.1"
                     /db_xref="GeneID:34718411"
     CDS             491813..492859
                     /gene="TMA46"
                     /locus_tag="KLMA_80214"
                     /codon_start=1
                     /product="translation machinery-associated protein 46"
                     /protein_id="XP_022678268.1"
                     /db_xref="GeneID:34718411"
                     /translation="MPPKKKQQQQPVKKKKDNVDKTFGMKNKNKSTKVQKFIKQVESQ
                     QDPKKEELKRKKLEEKRLKEAAEAERRALFNPVDQRVKAGVDPKTVLCAMFKIGNCNK
                     GARCKFSHDLNIGRKVEKKDLYQDTRAEKESDTMDNWDEEKLRSVIKSKHGNPRTTTD
                     KVCKYFIEAVENGKYGWFWVCPNGGDKCMYRHSLPEGFVLKTKEQKRLEREALENKPK
                     ITLEEFIETERERLDKSNLTPITMENFAQWKKNHKIERLNQEKENASKKKPTGREVVL
                     KKFAENKKFDMLEETDATNGSAWDLTEFTTALKEVDGSSSSGIKDYGDGSNPTFEIPK
                     KNDEPSKQNAELTA"
     gene            complement(<493137..>494837)
                     /gene="APP1"
                     /locus_tag="KLMA_80216"
                     /db_xref="GeneID:34718412"
     mRNA            complement(<493137..>494837)
                     /gene="APP1"
                     /locus_tag="KLMA_80216"
                     /product="actin patch protein 1"
                     /transcript_id="XM_022821960.1"
                     /db_xref="GeneID:34718412"
     CDS             complement(493137..494837)
                     /gene="APP1"
                     /locus_tag="KLMA_80216"
                     /codon_start=1
                     /product="actin patch protein 1"
                     /protein_id="XP_022678269.1"
                     /db_xref="GeneID:34718412"
                     /translation="MELHAAPDGSKYGSQFGSNVQSGRRQRLYNMVKQTKDTYFNAAK
                     NSLKNYYGNDLTPAEARALEFEMFPPKLLCYPSYARPLPDGGYVTEVRGLLYSTGQKS
                     KRNSLLLSICRQFLRNEPPENVEQSLESLKNDSTLSLESTSTTSSSVSSSFSERSVTG
                     APPTQEQVLRERIAGFMNKNIPNAPLQAVLYGSRNETLDTQTVSDASGAFNISMKSDF
                     RPAAAKVKCLETGLVNDCPVFFVENQGVGLISDIDDTIKHTGVVGDKRSMFLNVFVSS
                     FDEWQIKDMPLWYKTLRDSRNVDFFYVSNAPAQIFPILSEYIRGNYPLGPMFLKQYSG
                     NLLSSIMKSSAQRKLTAIIKICNDFPNKKFILVGDSGEQDLEAYTSTAIQFPNQIIGI
                     YIRCCKNSMSDEYDGESRVMNSLNQYIEKHYHSQFKEKAIPDLIQFDSDSDSELPTSE
                     KKKPPEVPKRKPVISEDLRKEITESKSVRSQQPPLPPRKPTRLKMRSMEDAVYSLPSS
                     QNDYGTYPEFFDKKAENWNERVRTTVDKFKAHNVNTRFMFFNDPIACLEDSLKKIDKL
                     "
     gene            <496534..>498174
                     /gene="ECM3"
                     /locus_tag="KLMA_80217"
                     /db_xref="GeneID:34718413"
     mRNA            <496534..>498174
                     /gene="ECM3"
                     /locus_tag="KLMA_80217"
                     /product="protein ECM3"
                     /transcript_id="XM_022821961.1"
                     /db_xref="GeneID:34718413"
     CDS             496534..498174
                     /gene="ECM3"
                     /locus_tag="KLMA_80217"
                     /codon_start=1
                     /product="protein ECM3"
                     /protein_id="XP_022678270.1"
                     /db_xref="GeneID:34718413"
                     /translation="MGLSVGQAIWISIKPMIKIYFIIGTGFALAKGNIMTVAATRTLS
                     DVVLTVLLPCLSFNKIVSSIEDKDIKDVGIICLSSLLIFGTGLFFAYVCRRLLPVPKQ
                     WYGSILAGGMFPNISDLPIAILQTMDQGSLFSQEEGNKGVASVIIFLAMFMICLFNLG
                     GFRLIENDFNYSDEENATHSEESTVGEPVRPNVSHRASQFNIPNDSQSLSSKEEGPIP
                     LSNVSDQGSGGTVRQYDDETSAISRRTTNISQASAAQSVVSSLRSIDLRSMPAQGVDD
                     LIREYSNVDQYGDRRPSFSSSALSGIDQTESTTLKRELTNLKRIITSDATVNKKDIQE
                     SGNWLPKSIAKFPGVNFLVFFLKNCLRPCSIAVILALVIAFIPWLKALFVTTSSTPHI
                     RQAPDGQPALNFIMDYTSYVGSASVPFGLMLLGATLGRLKLQKLYPGFWKTAVVLVLL
                     KLCIMPIFGVLWCDRLVKAGWLDWKHDRMLLLVIAMDWGLPTMTTIIYFTASYTPPDL
                     ADTTRMDCVAFFLILQYPLLLITMPFLVTYFLLVQMKV"
     gene            complement(<498408..>503306)
                     /locus_tag="KLMA_80219"
                     /db_xref="GeneID:34718414"
     mRNA            complement(<498408..>503306)
                     /locus_tag="KLMA_80219"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821963.1"
                     /db_xref="GeneID:34718414"
     CDS             complement(498408..503306)
                     /locus_tag="KLMA_80219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678271.1"
                     /db_xref="GeneID:34718414"
                     /translation="MASTSSSLDLSVPENLPPALRSQLEELIADYQEENLTSKGYQRK
                     RKQLLERYATTTQNPLVNSPRSSVDVGRSHRHTKSMASMSMAGRSIGMDNQSITSSTA
                     HHYKDTSSFYRVTTTHSHSLMKRSASTMVSLPVKHVDLIEDENGVSGFDPMVPLLPRF
                     NNQASKDWDSIPSILRGRFQIYGAETAMIRINAKGKETSISWEKLYLRAEKIAHELQA
                     GKYKLYKMDKVLLWYDPDESIEFTVCLLGCFIAGMIAVPVSFSTYSLNEIIQIIKSTN
                     SKFILISEQCYASLDDLYADENTKLKLIKSEFFSKITFLKTDDLGTYSKAKKKAPTFD
                     IPNVSYIEFTRTPLGKLSGVIMKHQVLAGQFDNMASILDSRESTSKKSSKIIRNFRQK
                     KSLSKHIILNSLDPTRSTGLVFGVLFNIFTGNVLINVDRDLLKAPGFYESLISKHKVN
                     ILLNDQLQLKQVVINYLENPESATSKKSKIDFTHIKHCLTSCTTIDTDVTDMVVHKWL
                     KNLGCMDASQCYTPLLTMLDFGGIFISTRDQLGNLQNFPLHDGKLKLQDELFVDKEKL
                     KLNIVRPSILAMMNSISSKKDFLRVASFGFPLPDSTICVVNPDTQTLVPDLTVGELWI
                     SSPSMTDEFYQMDRINDFVFQARINYKRMFAEINEEFKDPKQYTEKLNMIMSMCPSET
                     TFTRTKLMGFIHNGKIFILSLIEDMFLQNQLIRLPNWSHTSDISRSKGNKIIQNLRTN
                     SKDTTSDLQPNRIVQSFYLQHITENIVRTVDTVSEVAAFELPHNRQEHFLVVVVESSA
                     ANNAALNPGAFNTSPQKYRSVEKTMNTLTEQIYKMLWIFHKIQPFCVMIVLPGSLPRR
                     YCSLEIANSTVEKQFLDGKLRSKFVKFQLDNVILDFVPHSSYYNESIFSEHLSNLRHQ
                     SIGDNIELNYGLSPRETWQTSGIDYRHSSTDSRTRKDFSTFKSIIEILQFRIKQQPND
                     FAFSNGGGSSTNSTNINYSWKAFDRILAAYAKKIVESKTPLKKGDRVIILCQNSVEYV
                     AIVMICFICSLVVIPLPPLLESHAEQEIDFLLNVIECYNVKRIFIDSKAHNSFEQNSK
                     LSQALKHSKHSLPKMTNTSKIKVKSSMNLSQFWPLIKSKFGEPGAKPQDPCLIWINRD
                     RDAFKDIHIVMNHNLLLNQCKVLKETLRLNPLNRIFSVVNYHYGLGFVQTCILGIYTG
                     ATTSFFNSSDILLDPKDFLLGLQNLSVKDLYLTPELLYLVMDKAAELLASQSNLTAAV
                     KKKEISLRNGSTISPGFMASIQNIMVPFYGRPKFMAIEALVTKYPFLGVSTSQLSYVY
                     EHHFNPFISMRSYLGIPPTDIYLEPVSLREGIINEVDPTTIPASELEAFIHVQDSGIV
                     PVCTDVSIINPETQEPCYENEIGEIWCCSEATVFDHYIPLTSSQFSLKPNGSNRTKPK
                     SRKIKRDPFIAEQFKAKINNSVDNGLTYLRTGDLGFIKTVSRIDSQGNNITLSLLYVL
                     GSISETIEVLGLTHFVTDLETTVRRCHISINNCMIVKTGGLITCLIECNNKMKTEYSN
                     LTPLIVSTLLKNHGIVVDMCTFIKPGSLNYMYRDWSKNRKQILTDWLSKKMTIDSQFC
                     VSFGENNSIYLLSDFEKNQEGL"
     gene            <505007..>505555
                     /gene="ARF3"
                     /locus_tag="KLMA_80220"
                     /db_xref="GeneID:34718415"
     mRNA            <505007..>505555
                     /gene="ARF3"
                     /locus_tag="KLMA_80220"
                     /product="ADP-ribosylation factor 3"
                     /transcript_id="XM_022821964.1"
                     /db_xref="GeneID:34718415"
     CDS             505007..505555
                     /gene="ARF3"
                     /locus_tag="KLMA_80220"
                     /codon_start=1
                     /product="ADP-ribosylation factor 3"
                     /protein_id="XP_022678272.1"
                     /db_xref="GeneID:34718415"
                     /translation="MGNSISKVLGKLFGSREMKILMLGLDNAGKTTILYKLKLNKIKT
                     SAPTVGFNVETLTFKNVKFNMWDVGGQARLRPLWRHYFPATNALIFVIDSSDRDRMLQ
                     AKEELFSIIGEKEMEKVVLLVLANKQDLPGAMTPNEVSDFLQLGENLKNQLWSVIGSN
                     ALTGQGLIEGLSWIAKNTSDSH"
     gene            complement(<506118..>506936)
                     /gene="RKI1"
                     /locus_tag="KLMA_80221"
                     /db_xref="GeneID:34718416"
     mRNA            complement(<506118..>506936)
                     /gene="RKI1"
                     /locus_tag="KLMA_80221"
                     /product="ribose-5-phosphate isomerase"
                     /transcript_id="XM_022821965.1"
                     /db_xref="GeneID:34718416"
     CDS             complement(506118..506936)
                     /gene="RKI1"
                     /locus_tag="KLMA_80221"
                     /codon_start=1
                     /product="ribose-5-phosphate isomerase"
                     /protein_id="XP_022678273.1"
                     /db_xref="GeneID:34718416"
                     /translation="MYCAVSRRVHRLILPSFPHVFKMPLSDLSKLPPLSDQLEQAKRT
                     AAYRAVDENFDAKIHKVVGVGSGTTVVYVAERLGEYVNDSSNFVCIPTGFQSKQLILS
                     NRLQLGSIEQYPEIDIAFDGADEVDENLQLIKGGGACLFQEKLVSTSAKKFIVVADSR
                     KRSPKHLGTNWKRGVPIEVVPSSYVHVLTALKDRLHCKSAIVRQGGSAKAGPVVTDNC
                     NFIIDADFGEIADPRKLHQDIKMLVGVVETGLFIDNAEKAYFGSPDGSVELQVL"
     gene            <508351..>509340
                     /gene="RPS7A"
                     /locus_tag="KLMA_80222"
                     /db_xref="GeneID:34718417"
     mRNA            join(<508351..508488,508912..>509340)
                     /gene="RPS7A"
                     /locus_tag="KLMA_80222"
                     /product="40S ribosomal protein S7-A"
                     /transcript_id="XM_022821966.1"
                     /db_xref="GeneID:34718417"
     CDS             join(508351..508488,508912..509340)
                     /gene="RPS7A"
                     /locus_tag="KLMA_80222"
                     /codon_start=1
                     /product="40S ribosomal protein S7-A"
                     /protein_id="XP_022678274.1"
                     /db_xref="GeneID:34718417"
                     /translation="MSQAKILSQAPTELELQVAQAFIDLENNSPELKADLRALQFKSI
                     REIDVAGGKKALAIFVPVPSLAAYHKVQIKLTRELEKKFQDRHVIFLAERRILPKPSR
                     KSRQTQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYLVGGNKIQKILLNSKDVQHI
                     DNKLESFQAVYNKLTGKQIVFEIPSETH"
     gene            complement(<509823..>510116)
                     /locus_tag="KLMA_80223"
                     /db_xref="GeneID:34718418"
     mRNA            complement(<509823..>510116)
                     /locus_tag="KLMA_80223"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821967.1"
                     /db_xref="GeneID:34718418"
     CDS             complement(509823..510116)
                     /locus_tag="KLMA_80223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678275.1"
                     /db_xref="GeneID:34718418"
                     /translation="MKSFTISMQRHIKVTPYNQLHIPSFLLGCCATILISSLQSLFSS
                     LLGDVVIGILRLTKYAVMMEGIVLIIKILMADEQDRVMNSSSANSHTNPKHNN"
     gene            complement(<510582..>513623)
                     /locus_tag="KLMA_80224"
                     /db_xref="GeneID:34718419"
     mRNA            complement(<510582..>513623)
                     /locus_tag="KLMA_80224"
                     /product="nucleoporin NUP1"
                     /transcript_id="XM_022821968.1"
                     /db_xref="GeneID:34718419"
     CDS             complement(510582..513623)
                     /locus_tag="KLMA_80224"
                     /codon_start=1
                     /product="nucleoporin NUP1"
                     /protein_id="XP_022678276.1"
                     /db_xref="GeneID:34718419"
                     /translation="MSVGISEKQKPKRSISSTLVSLFSKHSEDDGGSQFNKDDSRDDP
                     GEVSDSGSVVIKGKKRRLGAYDNLVWNDEELDNNSSSMNLANLDDDREADKRPSIFLY
                     EGDSSGYDLRPPVLTIEPKQRLRLLRMQQLRRARQYPLLQRHLLSLDYNYSYDHDHDH
                     DHGLLTDGKPAASGRKHQLKSTTAASTSLKKNSAVKKSKTKRWKGDFQYDLSEYDILK
                     NNVKAKQSSAATAGNMDSPKLSRALLKQSSSLKKPSSSASDQSETSVGSTLTGIQSKL
                     LQGKSLFKENESNKKESAAAAAAAAAPLSLKPLVKESISEKKPLFVNAPSIGFDFVTS
                     DTNSPDATDTPTKPAASRAFTFGGKPDTNTGANKLAPAQVSKRGDDDNDNDDIEELPR
                     KKRELGTSEDNEVGSKTAASASAVAAPKPFSFGNPIAAKPSDTPKFSFGGASSNTSKP
                     DPVVPSFSFGATKSSKDESKKELPTLFSKPSDDSSSKDKSVPISGLVSTADKTENNSV
                     GKTNSLFKFGAKTNSTKPDETTKQIPSFTFGKAKESTDEPQVGNTAEISKTPKPLFQF
                     GSTTSNDNEKQKDVVNKEVAVPTFSFGKTNENNKTESANTTNPSAEDQAKPAFSFGKP
                     SSEATKATTPTFSFGKEAGAETKATSGSDPSAIKPAFSFGSTTSQATQPSKPAFSFGS
                     APAATGANDQAKEKTPTFSFGGTATKKIETVTDNNATKPSFTFGTSAPTANGTNNTST
                     QGTPSFSFGASSANKPAETAATSKPSFSFGSTTVNDDKQNTAKPPVFGSQTQNEQKTS
                     GGFKFDLSGLKNDNKQSSPTPFSDGSNVASAAGSNGSAGGFSFGNNTLQPTGQNNISA
                     PQPSQSAFNFSAQQTQKPFAFGGSGPSTTNNSPAFGASSNQPNVPFTFGGSSASSTPQ
                     IQSLGSAGFPNPGPSAVPPTQSFNPSNVVNFNFAGQQPQNPSTIFGSPAPQGNSPSMF
                     SSGPQNPASIFNSQPAGTPQGNPQFPPQRKIAMPSRRRRRA"
     gene            <514594..>515823
                     /gene="KTR1"
                     /locus_tag="KLMA_80225"
                     /db_xref="GeneID:34718420"
     mRNA            <514594..>515823
                     /gene="KTR1"
                     /locus_tag="KLMA_80225"
                     /product="alpha-1,2-mannosyltransferase"
                     /transcript_id="XM_022821969.1"
                     /db_xref="GeneID:34718420"
     CDS             514594..515823
                     /gene="KTR1"
                     /locus_tag="KLMA_80225"
                     /codon_start=1
                     /product="alpha-1,2-mannosyltransferase"
                     /protein_id="XP_022678277.1"
                     /db_xref="GeneID:34718420"
                     /translation="MGETWINKQRSVRVIAVCLIALTALLVLFQGASYNGEAGIGAAA
                     GSGSGKSNQYETVRAKTDSRVSVDPNTGFKYTYIDSGKYPGSKVKATFVTLARNSDLE
                     ELLGSIRSVEDRFNKKFQYDWVFLNDDEFTQEFKETVAALISGNVKFGLIPEEHWSYP
                     EWIDKEKAARVREEMREKKIIYGHSESYRHMCRFESGFFYRHPLMDEYEFYWRVEPGV
                     KIYCDIDYDIFKFMKDNNKKYGFTISLKEYEATIETLWQTVSSFTKENPQYLHKNNMM
                     KFVSDDGGHSYNLCHFWSNFEVASLDFLRSEAYSKYFDYLDHAGGFFYERWGDAPVHS
                     IAAALFLDRNEIHHFYDVGYYHVPFHSCPISAEYRQQHKCVCSPQDDFTWKGYSCTTH
                     FYTTNNLKKPEGWQNYT"
     gene            complement(<516031..>517068)
                     /gene="CRC1"
                     /locus_tag="KLMA_80226"
                     /db_xref="GeneID:34718421"
     mRNA            complement(<516031..>517068)
                     /gene="CRC1"
                     /locus_tag="KLMA_80226"
                     /product="mitochondrial carnitine carrier"
                     /transcript_id="XM_022821970.1"
                     /db_xref="GeneID:34718421"
     CDS             complement(516031..517068)
                     /gene="CRC1"
                     /locus_tag="KLMA_80226"
                     /codon_start=1
                     /product="mitochondrial carnitine carrier"
                     /protein_id="XP_022678278.1"
                     /db_xref="GeneID:34718421"
                     /translation="MSDASVEVEVELEQGLLGGVQQHQDQNNQKPHAKSPLVENLQSL
                     VAGGVGGVCAVLTGHPFDLVKVRCQSNQARNATDAVAHILKEARAASGPASVNAVRGF
                     YRGVVPPLLGVTPIFAVSFWGYDVGKKLVTHFPFSASESTAANATKKELSTAQMAAAG
                     FISAIPTTLVTAPTERVKVVMQTTQGKTSFADAARQIVRTQGFQSLFKGSLATLSRDG
                     PGSALYFASYEVCKEFLNKMSGHKSGELSITNVCISGGLAGVSMWAVVFPIDTVKTQL
                     QSSSKRQSMVEVTREIYRTRGGIKGFFPGIGPAMLRSFPANAATFLGVEMTHSLFKKY
                     EQRGRGASTLA"
     gene            <518140..>519369
                     /gene="PHO23"
                     /locus_tag="KLMA_80227"
                     /db_xref="GeneID:34718422"
     mRNA            <518140..>519369
                     /gene="PHO23"
                     /locus_tag="KLMA_80227"
                     /product="transcriptional regulatory protein PHO23"
                     /transcript_id="XM_022821971.1"
                     /db_xref="GeneID:34718422"
     CDS             518140..519369
                     /gene="PHO23"
                     /locus_tag="KLMA_80227"
                     /codon_start=1
                     /product="transcriptional regulatory protein PHO23"
                     /protein_id="XP_022678279.1"
                     /db_xref="GeneID:34718422"
                     /translation="MSVPANLYPGLNDISDVLEELPLEVSRYMTLLYEIDAKCVNIIP
                     ELNKCIQGFLDGRNVDDDKKVPLRVINQWFQELIPSLEEKMHVSSIAYDSLERLTDRL
                     ELAYEVALSNQEIPEKLRLGNDNHPAMHLHRELMAKVDSNAMTKSQQALKSESRREAM
                     AAKRTTAQSSNTVPAAVSSGSNSSNSNSTANNSSNTNSNNNNNNNNSNNNNGASGRTA
                     GGAGPGSNAPNSLGTTTNTTNGHNSGYTTTAGSRATGSTPQQSQIHPNHTIAGDDQHS
                     TTTTTTKKRRNNNGSATTTANGNNNGASASASANASAAADSAAAAIATTGVGAQRRGK
                     KRAQTTTVTAPKYQNRPKTNEYGEALYCYCNQVAYGEMVGCDGENCQLEWFHLPCIGL
                     ETLPKGKWYCNDCLKKQ"
     gene            <519913..>520938
                     /gene="RAS2"
                     /locus_tag="KLMA_80228"
                     /db_xref="GeneID:34718423"
     mRNA            join(<519913..519927,520141..>520938)
                     /gene="RAS2"
                     /locus_tag="KLMA_80228"
                     /product="hypothetical protein"
                     /transcript_id="XM_022821972.1"
                     /db_xref="GeneID:34718423"
     CDS             join(519913..519927,520141..520938)
                     /gene="RAS2"
                     /locus_tag="KLMA_80228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678280.1"
                     /db_xref="GeneID:34718423"
                     /translation="MSLNKNNIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIE
                     DSYRKQAVIDDKVSILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMT
                     YYQQILRVKDSDYVPLFVIGNKSDLEDERQVSYEEGQSLAKQFNAPFLETSAKQNINV
                     EESFYGLVRLIRDGKGYDKSASSGAQNEASQDQNQAPGSVQENGANSDEGFADTGNGT
                     EEAQPNNANVKQKTAKSSTQTKSTPANNQRSTKPNPPKTQSDKGGSGCCIIC"
     gene            complement(<521699..>522073)
                     /gene="OST2"
                     /locus_tag="KLMA_80229"
                     /db_xref="GeneID:34718424"
     mRNA            complement(<521699..>522073)
                     /gene="OST2"
                     /locus_tag="KLMA_80229"
                     /product="dolichyl-diphosphooligosaccharide protein
                     glycosyltransferase subunit OST2"
                     /transcript_id="XM_022821974.1"
                     /db_xref="GeneID:34718424"
     CDS             complement(521699..522073)
                     /gene="OST2"
                     /locus_tag="KLMA_80229"
                     /codon_start=1
                     /product="dolichyl-diphosphooligosaccharide protein
                     glycosyltransferase subunit OST2"
                     /protein_id="XP_022678281.1"
                     /db_xref="GeneID:34718424"
                     /translation="MVKKQTAVGNASSLTQFSESLTTAYQSYVKNVKNNKQLLLIDSF
                     LAFLVALGVLQFIFVLVIRDNFPFNAFLSGFVLCVGQFVLLVSLRLQLNSPFKGISKP
                     RAFGEFVIASLILHFISLHFIN"
     gene            <522418..>523071
                     /gene="OCA1"
                     /locus_tag="KLMA_80230"
                     /db_xref="GeneID:34718425"
     mRNA            <522418..>523071
                     /gene="OCA1"
                     /locus_tag="KLMA_80230"
                     /product="putative tyrosine-protein phosphatase OCA1"
                     /transcript_id="XM_022821975.1"
                     /db_xref="GeneID:34718425"
     CDS             522418..523071
                     /gene="OCA1"
                     /locus_tag="KLMA_80230"
                     /codon_start=1
                     /product="putative tyrosine-protein phosphatase OCA1"
                     /protein_id="XP_022678282.1"
                     /db_xref="GeneID:34718425"
                     /translation="MSDTAKYVDETEDVEAEEDDDSVVVDEEIETGHPKFTILHPPDE
                     RIVPPLNFCPVERYLYRSGQPSNVNFPFLLNLKLKTIIWLANEEPQDALLEFCDDHNI
                     QLQFAAINPDGGEDDNPWDGLTEHSIRNALHTIVNSENYPLLVCCGMGRHRTGTVIGC
                     LRRLMGWNLASVSEEYRRFTGSRGGRILVELLIEAFDISTVEIDREKAPDWLVTALS"
     gene            <523568..>524446
                     /locus_tag="KLMA_80231"
                     /db_xref="GeneID:34718426"
     mRNA            <523568..>524446
                     /locus_tag="KLMA_80231"
                     /product="[PSI+] induction protein 2"
                     /transcript_id="XM_022821976.1"
                     /db_xref="GeneID:34718426"
     CDS             523568..524446
                     /locus_tag="KLMA_80231"
                     /codon_start=1
                     /product="[PSI+] induction protein 2"
                     /protein_id="XP_022678283.1"
                     /db_xref="GeneID:34718426"
                     /translation="MDVDVLEEFANRQLYVRGFFHDVKNTTRSFKSWDKCMDDKPCKI
                     IAIVGIVLAAIFGMYLVGGLLYFLRSGVTNISEFICWCCFCKNRSGGAAPGNDGYRGQ
                     PPAPPMVVYQPIRDPDPGYGGYDGYRGGPDVRRGRGNKGYYDERLSRSSDLDVAESYD
                     LEAQKDPFNKKGNYRQSEDTIPMQSYHPNLASPNQYQEPSPSHSPVRGNTGSTYFQPS
                     TNYYVPKSNSHGADNGNVFYENTAYQPDRTMSTATANANANPPPAGGYQNFTSRAPFP
                     QDDDRDTPGFNRYGGY"
     gene            complement(<524624..>525346)
                     /gene="AIM37"
                     /locus_tag="KLMA_80232"
                     /db_xref="GeneID:34718427"
     mRNA            complement(<524624..>525346)
                     /gene="AIM37"
                     /locus_tag="KLMA_80232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821977.1"
                     /db_xref="GeneID:34718427"
     CDS             complement(524624..525346)
                     /gene="AIM37"
                     /locus_tag="KLMA_80232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678284.1"
                     /db_xref="GeneID:34718427"
                     /translation="MGRDFYGEFDEKVLKKAEPYVPEFIKNNTEIHTATLPNGNTVTE
                     PVAVTSWISQLRKKLIGQKEYVEAEIATQKSAARNEVESVKQYWRENVLSDKKEIEDH
                     FVTASVLSLGGWFFGSVISSRRNWGFSSPWNSEQAGILKRTPTVFSKLITSLPVRLTL
                     PWILAGAAYQQLTPNTWNNALAAIKNDFLPKELVEQSAALYDSAIENGLKAQMKSLNK
                     ATHEGLESSIGAIREAIAERTQ"
     gene            complement(<525750..>527924)
                     /gene="AVT4"
                     /locus_tag="KLMA_80233"
                     /db_xref="GeneID:34718428"
     mRNA            complement(<525750..>527924)
                     /gene="AVT4"
                     /locus_tag="KLMA_80233"
                     /product="vacuolar amino acid transporter 4"
                     /transcript_id="XM_022821978.1"
                     /db_xref="GeneID:34718428"
     CDS             complement(525750..527924)
                     /gene="AVT4"
                     /locus_tag="KLMA_80233"
                     /codon_start=1
                     /product="vacuolar amino acid transporter 4"
                     /protein_id="XP_022678285.1"
                     /db_xref="GeneID:34718428"
                     /translation="MANPVDNRNVGDSSGILIPAADKRRRQSMMLLSESAKSRRSMAS
                     RSKSVAVGGSPPLGKSTDSRTFIDVGSPSFKLPNVEKEAEIIHSLKQNYLRDNFTKSN
                     SFSQLSKKSHSSVTGESDIPSETEVSIPEHDTNLNTEGGDMIRDFYKLTSPLEQSVKK
                     GKNKSADDLSFADAHRRKGSTASALNVPGGFRREYIVQKIRNEMPKMNGNNDLSSHNT
                     TPSYGSVISSNNNESQSISGEKVPFLTRNFLEFLYVYGHFAGETFNDDFAVGEDDDAF
                     DDDVDRPLLNRAGMEDYGFPKSPAARPSQVKTTTFKAFLLMLKSFIGTGVLFLPSAFA
                     NGGLTFSIIMLSFFGVYSYWCYYILIKSKVATGVSSFGDIGTKLYGPWMRYTILASLI
                     LTQLGFSAAYVVFTSKNLLAFFDNVFRLPNLRIEHFLVLQTIIFIPLAFIRNVSKLSL
                     TSLLANFFTMAGLMIIVFFIFKHLVFDLNLHPAEGIVYGFNPSKWSLFIGTAIFAFEG
                     IGLIIPVQDSMRKPEKFPMVLGLVIITATVLFISIATLGYLAYGKYIETVILLNLPQD
                     NIFVNLVQFFYSLAILLSTPLQLFPAIGIIESKLIPKFKKTVSPTNSNEVQYYPNSGK
                     LNWKVKWSKNFLRSIIVIFVIGLAYFGSAKLDVFVSFIGCFACIPLVYMYPPMLHLKS
                     CSQPNFETNKTLQNKLMILLDYVLIIFGGISMLYTSYQCIMG"
     gene            complement(<528638..>532939)
                     /gene="POL1"
                     /locus_tag="KLMA_80234"
                     /db_xref="GeneID:34718429"
     mRNA            complement(<528638..>532939)
                     /gene="POL1"
                     /locus_tag="KLMA_80234"
                     /product="DNA polymerase alpha catalytic subunit A"
                     /transcript_id="XM_022821979.1"
                     /db_xref="GeneID:34718429"
     CDS             complement(528638..532939)
                     /gene="POL1"
                     /locus_tag="KLMA_80234"
                     /codon_start=1
                     /product="DNA polymerase alpha catalytic subunit A"
                     /protein_id="XP_022678286.1"
                     /db_xref="GeneID:34718429"
                     /translation="MSSKNKLEQLRRLQQARKHKSSKDILDEQLEEENVYDLIDEDQY
                     RNRKRQELLRDDFIEDDDGSGYVDRGVDEWNEQEEYYSDEDIYNGKGEKQGKKGSSKN
                     GNKGKDTISDIIKQQNVKRKIAAPEKKQRKVALDEFDDILNEFDSEPLVKKPKLVIPK
                     KQLDSSPSVSFKTSQPDTSPLKGKETVLSRMSSVVPSGSDGIEEDNDIASLLENVGSS
                     PSMKKQKAYDSVEDEDDEDDEDEIHFNRRKVKSVAAQRQLNIHAKAAVPVTSSPTYVT
                     APNTPISSSVRPSSGVEISRTSMRQRIPTEDIVDSDTGKFKFFWTDFSEIESSLILFG
                     KVRTKKDQFVSAMVQVSGFNRELYFLPREGKTPSDVHKEIIPLLLDKYGLESLRAKPE
                     KKKYAFELPGIPHEAEYLKVLLPFNTPKCKSSAIPSDLQGDTFKHVFGGNTTMFENFV
                     IQRKIMGPCWLEISDGDFDSVQGASHCNVEVTVKSPNSITPTNEKQSPALNCVSLAIQ
                     TVMNSKENKQEIVSISMAVFKNLPQDSSIPKDLKPNEVVTLVRPPQGSTFPPLLGAKS
                     KKELPGNVRLFNNEKTLLNCFCALLKVNDPDVIIGHRLESVILDVLAHRAHELNIPQF
                     SVFGRRMRKAWPDRFGKYNNNMTQFIIRDLFAGRLLCDISNEMGQSLTQKCQNWELNE
                     MYQISCGIERKSLEINYLSPIYQEDESQMILALGENIENSIITAEVAFRIQILSLTKQ
                     LTNLAGNGWRQTLGGTRAGRNEYILLHEFNRNGYILPDKETKQMKQERQQKTEDLEEP
                     VVSSKKSKYQGGLVFEPEKGLHKNYILVMDFNSLYPSIIQEFNICFTTVTRDPNNIEE
                     LPDVPSQDNPQGVLPRLLANLVQRRREVKNLMKNENDPAKRAQYDIRQQALKLTANSM
                     YGCLGYVNSRFYAKPLAMLVTNKGREILMNTRQLAESLGLTVVYGDTDSVMISTGCDN
                     YKDAIKIGENFKKLVNERYSLLEIDIDNVFKRLLLHAKKKYAALNVTIDKQNNEKTTL
                     EVKGLDMKRREFCPLSKEVSTHVLNILLSDKDSETALQEIYAYMEDIRQKVENNEIRM
                     DKYKINTKLSKDPKSYPGGKNMPAVQVALRMREAGRVVKAGSVITFVITKGNNETSQE
                     ADQASVAERARALNEVMNKKNGLHPDPVYYLGKQIFSPVERLLERIESFDIVRLSEAL
                     GLDSRKYINRGGTNGELNGNGIDNLQPLETTISDEERFGDSVSLELACPSCSAKFAFG
                     GIVASNDYRVVYSGIQCTKCSHILTPIQVTSQLERVIRAHISLYYASWVRCDDSTCGN
                     VTRQISVFGKRCLMDGCTGVMSYKYSDKRLYNQMLYFQSLFDLNKNKTQALKPLYHPG
                     DKNAPEKPLSHSEIQALAEQNRSLFETAKQVVEKYLSDCGRAYVDMGSIFDFMQQ"
     gene            <533468..>534253
                     /gene="VAM3"
                     /locus_tag="KLMA_80235"
                     /db_xref="GeneID:34718430"
     mRNA            <533468..>534253
                     /gene="VAM3"
                     /locus_tag="KLMA_80235"
                     /product="syntaxin VAM3"
                     /transcript_id="XM_022821980.1"
                     /db_xref="GeneID:34718430"
     CDS             533468..534253
                     /gene="VAM3"
                     /locus_tag="KLMA_80235"
                     /codon_start=1
                     /product="syntaxin VAM3"
                     /protein_id="XP_022678287.1"
                     /db_xref="GeneID:34718430"
                     /translation="MSFYQKNSNAREERNVESGESNTVPLLITLEQNIQLLKRKTHQV
                     GTHKDSRALRDEVNNEIIPKIQKIIRTLSDSTSTESQDKFTRDFQALMKRYNEIKAEY
                     ETRAVQHLIPEEDHNSEQDHLESQYESMPIQDSIDRREQVSEETPLLLSAQQQEAMLN
                     QDELDFHTIIQHERAQDISKIHSAVQEVNAIFKQLGTLVQEQGDQVDTIGENVVGLSH
                     NVQNANKELNKANEYQKKKNRCGTIVLVAIIIITLITLIATLS"
     gene            complement(<534343..>536463)
                     /gene="MET4"
                     /locus_tag="KLMA_80236"
                     /db_xref="GeneID:34718431"
     mRNA            complement(<534343..>536463)
                     /gene="MET4"
                     /locus_tag="KLMA_80236"
                     /product="transcriptional activator of sulfur metabolism
                     MET4"
                     /transcript_id="XM_022821981.1"
                     /db_xref="GeneID:34718431"
     CDS             complement(534343..536463)
                     /gene="MET4"
                     /locus_tag="KLMA_80236"
                     /codon_start=1
                     /product="transcriptional activator of sulfur metabolism
                     MET4"
                     /protein_id="XP_022678288.1"
                     /db_xref="GeneID:34718431"
                     /translation="MNNINSSSSNTAHHSTSNNSQGMENIWGGSPDLSMRSPSTSSNH
                     NHLQSLVNPNPSADSNSNTNDITPSILLEQLAFVDNFMTDFNSDFGSGGVGNAFYNGA
                     SSGDMAAGSVFGGGALNDPNQHHTGLMNAETQLAMDERLAAELSVFADETFIFPDEDK
                     ADRNDGDENSNSNNNNNMFGDSNNNNNNNNKPSSEKRNLFDRKTNLLGNQYDHTRQRF
                     SKKRSSAQNSPIADHGGFTNFDVQDHHHTSNSNNNPSNSAPGRPREPQFVPSPLTNLL
                     AAHDLTTAMSSTSTASPAVNTAHSGYQSSTAVSSGGYESNIQMPDYSNIQTSTLVSLL
                     PRINVPRGAYQSLYNVGFKPDQIDAIAAIIAYYERERDKFDPPVKSSNNNNSTAHSSS
                     RKPAASSSSSSAAVRSHPIAASPPEQVQSSVTMLLDFLNEKPPAQQTVIHSPASVLTP
                     ASAPAQLPVQRRPDQTSEPAAKRMKKTDSAKKDLNTSSNKNSNGNNSVIDRYLEDSPR
                     PRAETATGKLQGNSDSRAHKDQRGDNARPLSSTTTTTNNNNNNNNNTSSTLLNKNKQE
                     DGKTSSIDASHIKNEPTENKSVEKESSGDDSGVNSESDSKSKSKSNSTSKSQPQPQST
                     SIQPRPKLPNLDLTKKLKEKEMETWVQELSELARDLKQRINTLEMENKLLKNLVVERG
                     DVKDLKVFEKTNKEAENSEKNTSQ"
     gene            <539828..>540877
                     /locus_tag="KLMA_80237"
                     /db_xref="GeneID:34718432"
     mRNA            <539828..>540877
                     /locus_tag="KLMA_80237"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821982.1"
                     /db_xref="GeneID:34718432"
     CDS             539828..540877
                     /locus_tag="KLMA_80237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678289.1"
                     /db_xref="GeneID:34718432"
                     /translation="MSTVPTPNTPSADAANDHDINDISEDEILQLDLNPDLDDTDDVK
                     MEEDNEDAANGNSLKRTFIDDQIDNAGFDDMEDFQPVVDLKSPFESYSDLQQAPQKSA
                     ENGHHTHQARRLSLSQQSKFVAYIDNELLQIQRKFVQSRGLNVSHGYNNLSEVLHDFK
                     KLVDFIWYSIDGISNTDSLLQEDLDDSEIYKRFEGSQSTNFGQSYYLIRIADDLLDFL
                     DKFPLTDEEENGDLEKNTENADAASSNEPNLKTAGSNESRVPGTKEDVETTTPAPLRK
                     LFKMLSILDNIFARLIDGKVPGNFKLSGTEIVRLIGIAERTRILLPQLMEKNDIHGYH
                     YEISRVYLETLERGT"
     gene            <544500..>545363
                     /gene="CYC3"
                     /locus_tag="KLMA_80238"
                     /db_xref="GeneID:34718433"
     mRNA            <544500..>545363
                     /gene="CYC3"
                     /locus_tag="KLMA_80238"
                     /product="cytochrome c heme lyase"
                     /transcript_id="XM_022821983.1"
                     /db_xref="GeneID:34718433"
     CDS             544500..545363
                     /gene="CYC3"
                     /locus_tag="KLMA_80238"
                     /codon_start=1
                     /product="cytochrome c heme lyase"
                     /protein_id="XP_022678290.1"
                     /db_xref="GeneID:34718433"
                     /translation="MGWFWADKVNTSSGTKAAAKADVSACPVMHKPASDKNDISECPV
                     MHGNSGSEGGCPVISKHGDQLNPLNNIPVGLTHAKQAGQKLDLPTERTVSSIPKGKAS
                     DEEFWEYPSPQQMYNAMVRKGKIDPYTGEEIPEDAVESMVFVHNFLNEGCWQEILDWE
                     KKYVQQTQSYPKLLQFTGKPDQLSPRARCFNILGTLFPGHFSSELPFDRHDWVVLRPD
                     PTSSDSENPGYRKVRYVIDFYGGPDDEDGLPTFNLDVRPALDNFTNAKDRFERWITPT
                     LDKYFNSDDKK"
     gene            complement(<545667..>547781)
                     /gene="MSC6"
                     /locus_tag="KLMA_80239"
                     /db_xref="GeneID:34718434"
     mRNA            complement(<545667..>547781)
                     /gene="MSC6"
                     /locus_tag="KLMA_80239"
                     /product="meiotic sister-chromatid recombination protein
                     6"
                     /transcript_id="XM_022821985.1"
                     /db_xref="GeneID:34718434"
     CDS             complement(545667..547781)
                     /gene="MSC6"
                     /locus_tag="KLMA_80239"
                     /codon_start=1
                     /product="meiotic sister-chromatid recombination protein
                     6"
                     /protein_id="XP_022678291.1"
                     /db_xref="GeneID:34718434"
                     /translation="MLSVRSSIRGLATQVNQASSTIQQNVEATQSVKEERNDKTSKPK
                     RLQPNALLHIVKTNVNNELDQHIPVQKIYSQLQSELQELVSQNRINTRAFGNINLFNT
                     ALSRLIRQSKLELESQNLGDSNSIPPAPYDILQTSLKYNLARHQHFTLVMRQYLNEKK
                     FEEVMNLWVTFLEHAKKIPLNTAATKQIQVLTSISYLMLCCQSKAKPEAKVITQLLNT
                     TLDEIPFLVMEQEMKSLKLDSSAEEALFKCYSDLLLEWFVSDKDAFINGFLKRSNDYK
                     LLSYLWNQYLKFGAADYTSSDLQIPSAFIVRFAELNKSLDSMKIVAQLKEASPDFKPN
                     VQIYNALLEAVAYTPAFGRQATTVKLDRIQAIWNSCIKTQENIGVDSYKSMLRALNNL
                     GNVKTAESFWALDVPNDMKSNKELSEVFSMIYFNSDECKDYSKLKQKIPKKIDNLELA
                     NTILLAMVKVGAPASDVDSFYDRIFLSTTGIKPNDTTLATRLLANIKLSKLSDEADIL
                     STIGVSHSSERVVPIIEEYLKLCTDEESATALLKALKLDFKGDRFAMKVSKFLNFYLE
                     HGQWEVAEDLFKQALTENAKSPTLINFRMFNSMFQGFSELSISRNDTGFISKQQVYWE
                     LCDQIHHKIFKESIISTLKSIAELSRRKADFSESELDFINNTVLPYLVKAKANNEFVV
                     QNPRLLKNIKTNDKIHIPKELL"
     gene            <553060..>554313
                     /gene="CLN3"
                     /locus_tag="KLMA_80240"
                     /db_xref="GeneID:34718435"
     mRNA            <553060..>554313
                     /gene="CLN3"
                     /locus_tag="KLMA_80240"
                     /product="G1/S-specific cyclin CLN3"
                     /transcript_id="XM_022821986.1"
                     /db_xref="GeneID:34718435"
     CDS             553060..554313
                     /gene="CLN3"
                     /locus_tag="KLMA_80240"
                     /codon_start=1
                     /product="G1/S-specific cyclin CLN3"
                     /protein_id="XP_022678292.1"
                     /db_xref="GeneID:34718435"
                     /translation="MTVSTQEMSNYNYMNCIRRSVWNEKASNPKLIEMELKSHKATIN
                     ENASTIFSKLVENEANTKISMKCFKSQPEITYQMRSLIFDFIMCCHIRLKLSTPTLFL
                     SFNIIDRYCSKIIVKSSTYQLLGLCSLWLASKYTDKKQKIPSLPTLQSLCCDQYTKEQ
                     FKEMELHICQSLNWTMCHGPSLDSFLDILIRSRTFQNENTDCVAMKLGALILSQLVCF
                     NLSITFNHSPSSIALACLFITKFSLLSSRFNTFMNFETMVSNEKLDPQLVTLMKTILE
                     SINESEIPSSFRLRYYSNDVQHPVMKCLFSYKASWTEHLSRNAVYSTLLSPLVPDFNQ
                     ETSPSSKTQQMDSTKWMQIPPTPSTTPSTPTFSKATKPAASLSHNGTGLSFRRHSKRD
                     SSLMDIDFFEEETIQYAKKGRVGEC"
     gene            <555465..>557021
                     /locus_tag="KLMA_80241"
                     /db_xref="GeneID:34718436"
     mRNA            <555465..>557021
                     /locus_tag="KLMA_80241"
                     /product="jmjC domain-containing protein 4"
                     /transcript_id="XM_022821987.1"
                     /db_xref="GeneID:34718436"
     CDS             555465..557021
                     /locus_tag="KLMA_80241"
                     /codon_start=1
                     /product="jmjC domain-containing protein 4"
                     /protein_id="XP_022678293.1"
                     /db_xref="GeneID:34718436"
                     /translation="MSKRATIAVESNELKKLKDANSLLDSNYNGFKVLEDGIELDTIP
                     IPKTPTEIRQFYNEYVKKRKPCRFSERVDSFDWDLLKPENIKNLLDNTTLQIEKKTDG
                     GFGSGSKRLAMDFYDFLDSLAAGNYDLYLTTQYAEHEVIDKCPKNQNTDEGSEEEIEG
                     EEEDDDEEEETGVYAFPDNASDVSSTDSINFNDLHDDFEEMEEEDEGFEDLSYLVKEL
                     YQPPLDTLISSIPEQLPFLKLIPQQINLWIGAAKEQEDNQAFLKDFDPDDKKLGLGRN
                     VPGGGSSSGLHHDHADNIYIPIKGHKRFTLFAPSDVSKMYTVGDVDELYDTGIINYKR
                     NEKSPQWNKLRRDGAIETLYAEHRLEDPNISEEERKIMENILNDDNANQKDLSSSENV
                     NHLDPPSFSTIPPTVVHLDKVVDEVTRKNIEKVSRKKWPEFFNAHRITVDLKPGEMLY
                     LPTGWFHEVTSFGFREPSEDSSDIHVAVNYWLMPPTGDSIESMYSDDYWQTYFQSVSN
                     ALKEARRGAH"
     gene            <558182..>559540
                     /gene="GDS1"
                     /locus_tag="KLMA_80242"
                     /db_xref="GeneID:34718437"
     mRNA            <558182..>559540
                     /gene="GDS1"
                     /locus_tag="KLMA_80242"
                     /product="protein GDS1"
                     /transcript_id="XM_022821988.1"
                     /db_xref="GeneID:34718437"
     CDS             558182..559540
                     /gene="GDS1"
                     /locus_tag="KLMA_80242"
                     /codon_start=1
                     /product="protein GDS1"
                     /protein_id="XP_022678294.1"
                     /db_xref="GeneID:34718437"
                     /translation="MSIPTVDDDIIANSKSPLFDASTLGGNTQPSVKSESGKTKPGKT
                     ESKVKKNGSSSFTSSQLTETVSISKTIPVTGERPKPGNEGPILNEDDVLYAIFVILWE
                     SDPNQQGMTVKQLCDLLLEKHPDMNNLSTKLSNLISAKLNAYVKKVEKGEKGLVYSLS
                     REWSDASPRRMVYIYRGILAPDYEKHAQAAAALVAASSNLSDQGSGSLGKNKLKGKKH
                     SNKNSQDMSFESDGTQRVDIKDGIVPRSSSALGGMKSSNFSTGNFVNDFNIPYMSSPV
                     SVSLAPKLGELPLSTMNHELDIDSHSSHAGKRLSSMYQNRAYKKQKTDAMKIHETPGS
                     VQNVQGQPQAYLTIAGSTPRLSKSSLKHNDGISTAAASEAAQTVAEILRTAITQNPIV
                     ISPKSSKSSSPFSSTSQDSDKSSVDNNNCKWLQSLREGFLLKEIPTPESLSPDDFDEF
                     FA"
     gene            <560414..>562180
                     /gene="CIR2"
                     /locus_tag="KLMA_80243"
                     /db_xref="GeneID:34718438"
     mRNA            <560414..>562180
                     /gene="CIR2"
                     /locus_tag="KLMA_80243"
                     /product="probable electron transfer
                     flavoprotein-ubiquinone oxidoreductase"
                     /transcript_id="XM_022821989.1"
                     /db_xref="GeneID:34718438"
     CDS             560414..562180
                     /gene="CIR2"
                     /locus_tag="KLMA_80243"
                     /codon_start=1
                     /product="probable electron transfer
                     flavoprotein-ubiquinone oxidoreductase"
                     /protein_id="XP_022678295.1"
                     /db_xref="GeneID:34718438"
                     /translation="MTHEQQEMLTMERPVDKVDICIVGGGPAGLAAAIKFKQLDNERG
                     NGDLRVVVLEKAPDMGSHIVSGVILEPKALRELFPESEYYDENGEGIPLPEELVTKVE
                     SEQLKYLMGNMAFPVPEPPQMVNKNKNYIASLSQVVRYLAEQAEELGVEVFPGISVSE
                     VIYGEDGKSVLGVATKDMGISKTGEPKDTFERGMEFHARQTFFAEGCHGSLSKEVINK
                     FKLREGRNNQTYGLGIKEVWEVKPENFHKGFVAHTMGYPLSNYVYGGGFMYHFGEGLV
                     TVGLVVGLDYKNPYVSPYQEFQKMKHHPYYKKILDGGTCISYAARALNEGGLQSVPKL
                     HFPGGCLIGASAGFMNVPKIKGTHTAMKSGMLAAEKAFEEIIKLPSLSELEESETEQL
                     VEKPINLVSYETAFRESWIYQELNEVRNIRPSFGNPILGGYGGMVYSGLESFILKGRV
                     PWTFNHHASDATLTKPADQCKPIDYPKPDGKISFDILTSVSRTGTYHDDDEKCHLRVP
                     EQDLEKHAKEAYPKWKGIESRFCPAGVYEYVEDEASPLGVKFQINSQNCIHCKTCDIK
                     VPTQDINWEVPEGGDGPKYTIT"
     gene            complement(<562477..>564768)
                     /gene="CDC24"
                     /locus_tag="KLMA_80244"
                     /db_xref="GeneID:34718439"
     mRNA            complement(<562477..>564768)
                     /gene="CDC24"
                     /locus_tag="KLMA_80244"
                     /product="cell division control protein 24"
                     /transcript_id="XM_022821990.1"
                     /db_xref="GeneID:34718439"
     CDS             complement(562477..564768)
                     /gene="CDC24"
                     /locus_tag="KLMA_80244"
                     /codon_start=1
                     /product="cell division control protein 24"
                     /protein_id="XP_022678296.1"
                     /db_xref="GeneID:34718439"
                     /translation="MVVNSNPSVSNVSLSSTRSSNTQLLMNKRVTAQDSLYFMCKCVK
                     KRLEYLPQLQPYLNLAHSSAEILTEHQALLLSQKQQQQIQQQSQSKSQRGSQYEVGSG
                     NGNGRSSSSSTLHRDSSFSATSFGDDSEQSQSFNMEDTLLTFSVGIAPISVDCDPVTQ
                     LSKLFQQGSPLCIIFNAVRPQNKLTVVSSDDMKICKKSIYDFILGLKQHFAFNDEELF
                     TISDVFSNSTDHFLKVLDVVNTLLNAAPEIFPAISTDSLLEAQRLAKPQTEYDKIVKE
                     FIETERKYVHDLEILNKYRKQLLDNQVINSEELYMLFPNLNDIIDFQRRFLVSLEVNG
                     QVPPQKQRIGALFLHSKYFFKLYEPWSIGQNAAIDFISSSFDKISPGNTNFVIGNKME
                     LQSFLLKPVQRLCRYPLLLKDLLENAESETKELELALSIAKSIARNINENQRRTENYE
                     VVKRLYGRVVNWKGYRIAKFGELLYFDKISISTSSGNEPEKDFEVYLFEKIILLFSEV
                     TQKKGSSISLKKKNNSSSMLHLPSSSNNNSNDFAKNSGKLDLRGRIMIVNLTQVTPIE
                     NHSLNIIWESTKEKGNFILKFKNEETRNNWENCLHQLLRQIRSESFKSINTNSDMSSM
                     SSPVQYSHNSVASIGSTLTRQISEVLPKSHMSNARQSFASEYRSISENYKNSIPETML
                     LLRVSFNNDFYTVLVNLEFSADEVLQAIKKKLTHLGTITKVKYQDEDGDFVMLESDDD
                     WYVVKDMLKESNERLLNVWAYTN"
     gene            complement(<565286..>566509)
                     /gene="ERV46"
                     /locus_tag="KLMA_80245"
                     /db_xref="GeneID:34718440"
     mRNA            complement(<565286..>566509)
                     /gene="ERV46"
                     /locus_tag="KLMA_80245"
                     /product="ER-derived vesicles protein ERV46"
                     /transcript_id="XM_022821991.1"
                     /db_xref="GeneID:34718440"
     CDS             complement(565286..566509)
                     /gene="ERV46"
                     /locus_tag="KLMA_80245"
                     /codon_start=1
                     /product="ER-derived vesicles protein ERV46"
                     /protein_id="XP_022678297.1"
                     /db_xref="GeneID:34718440"
                     /translation="MIKKSTLLSVDAFGKTEEDVRVRTRTGGLITVSCIFVTLILLIN
                     EWKNFNTIVNRPELVVDRDRHLKLDLNLDVTFPNMPCNVLNLDILDDSGEFQLNLLES
                     GFTKIRISPEGKELNKQKFEVGENSPTKDTSTEEGYCGPCYGARDQSKNDELPADQRV
                     CCQTCEDVRNAYSENGWAFKDGQGVEQCEREGYVQSINKRINEGCRVQGRAQLNRIQG
                     SIHFGPGKSMHNFRGHFHDTSLYEKHSHLNFNHIINKLTFGETPSQADSLLLNSVSLS
                     PLDGREVLPERDTHLYEFSYFCKIIPTRFEFLDGKKVETTQFSSTYHDRPLRGGRDED
                     HPTTVHSAGGVPGLFFNFEMSPLKVINREEHAISWSGFLLNCITSIGGVLAVGTVVDK
                     ITYRAQKTIWGKKSS"
     gene            complement(<567089..>568834)
                     /gene="HRP1"
                     /locus_tag="KLMA_80246"
                     /db_xref="GeneID:34718441"
     mRNA            complement(<567089..>568834)
                     /gene="HRP1"
                     /locus_tag="KLMA_80246"
                     /product="nuclear polyadenylated RNA-binding protein 4"
                     /transcript_id="XM_022821992.1"
                     /db_xref="GeneID:34718441"
     CDS             complement(567089..568834)
                     /gene="HRP1"
                     /locus_tag="KLMA_80246"
                     /codon_start=1
                     /product="nuclear polyadenylated RNA-binding protein 4"
                     /protein_id="XP_022678298.1"
                     /db_xref="GeneID:34718441"
                     /translation="MSLSDEEDFNDIYGDDNTAQTTSSSNAANNESKPSTNTTTTTST
                     DNNQSNQNNNVSNSTKDDQNDQASAANNDTTSSSTNATSQLDQLAALQALSSNLSQLQ
                     QQVSSSSNNDKTDSSAAATSNSSAATATAPNTGSDMPQMPQMPQMPQMPQMPGMPDMS
                     QLQQLQQTMSQLQQTASQHEPKTIKADLSRDINKMFIGGLNWETTEDGLRDYFSKYGT
                     VAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQHILDGKVIDPKRAIPREEQDKT
                     GKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRV
                     CQNKFIEFKGKQIEIKRAEPRQLQKQKQPQMSQPMGGQGFANPMQQYQMFQNPMMATG
                     FNPMMAAGFNPQSMNDYYTKMQEYYQQMQQQTGIDYTQMFQQQMQQMQQMMGMMGGAA
                     PAGQPAQSGAGSPPSHSSTPQHNDDSNGITTIGGSNNGSGSNNGQESGDDSRFENSSS
                     HREDSRRSGGNRFYDRNSDRNSGYGNSNRDRDSRRGPSSNYRSGGGRDRDSRRGDRGY
                     GGNGRDRRGYHPYAR"
     gene            <569888..>571201
                     /gene="TRM11"
                     /locus_tag="KLMA_80247"
                     /db_xref="GeneID:34718442"
     mRNA            <569888..>571201
                     /gene="TRM11"
                     /locus_tag="KLMA_80247"
                     /product="tRNA guanosine-2'-O-methyltransferase TRM11"
                     /transcript_id="XM_022821993.1"
                     /db_xref="GeneID:34718442"
     CDS             569888..571201
                     /gene="TRM11"
                     /locus_tag="KLMA_80247"
                     /codon_start=1
                     /product="tRNA guanosine-2'-O-methyltransferase TRM11"
                     /protein_id="XP_022678299.1"
                     /db_xref="GeneID:34718442"
                     /translation="MAGKQYLVFMVQVHLNFRLAELESLADLYGIDVDFSQYRSDSPF
                     MVVTLKDDQQAQDWIKRSILTKGIYEYWGEGTDYESLHASVRGNARFEQMKKENENRS
                     FKFEFEKYGGNAKMDMSKRVSIIESFKYLELKGPIRMKNPDEVYTIIEEYKAISDNIG
                     GETPVKVYFGRQVQLSDRVRGALEKYDLKKRPYKGTTSFEAELSLVSANIAQVKEGHI
                     MYDPFVGTGSFLVAGGHYGALVMGSDIDGRMIRGKGKQTITANFKHYKESIQFLDVMT
                     MDFTHNALRSDLVIDTILCDPPYGIRESIKVLGAKDPERFIGKENVEIDGKKAYLHRD
                     YIPTKKPYSLDSLLDDLLHYASKRLPLNGRLAFWMPTANDENVATIIPLHSNLELKYN
                     CVQDFNKWSRRLLVYINRGPDFNGPTNAGLHRTSNFRERYFNGFN"
     gene            complement(<571478..>572575)
                     /gene="YPT11"
                     /locus_tag="KLMA_80248"
                     /db_xref="GeneID:34718443"
     mRNA            complement(<571478..>572575)
                     /gene="YPT11"
                     /locus_tag="KLMA_80248"
                     /product="GTP-binding protein YPT11"
                     /transcript_id="XM_022821994.1"
                     /db_xref="GeneID:34718443"
     CDS             complement(571478..572575)
                     /gene="YPT11"
                     /locus_tag="KLMA_80248"
                     /codon_start=1
                     /product="GTP-binding protein YPT11"
                     /protein_id="XP_022678300.1"
                     /db_xref="GeneID:34718443"
                     /translation="MNRPKRHSLIISAPSSPIIGDEPKFFSSAPNTAQLGLGLNSSGH
                     SKESRHSFLRINPGDSRNVSFDSLTDSSNIKLLLIGDAGVGKTAMILSYCNELPRVST
                     KVNKDESQKKLPQTSAVNRVKNIEQRKRYSLNDFENSVASGSDTEFEINTTSTIGIDI
                     KTNLVNIDNRFFRVIMWDTAGQERYRNAMISSLYKGSNGVILSYDICDFNSFLNCLNG
                     WLLESIENIPNLDHTRFYLVGNKLDLYKERKVTHEDVLNFISKIEKDYHVKISGNFEV
                     SCKWENIVERTFNIIIKDLVESGCYEDDRELRVLQSDTSDTYDSSAEEEPSTMRHRAG
                     KSSSKTVDLTKPLHLSSQDKSNPYPRTSCCS"
     gene            <573379..>574737
                     /locus_tag="KLMA_80249"
                     /db_xref="GeneID:34718444"
     mRNA            <573379..>574737
                     /locus_tag="KLMA_80249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022821996.1"
                     /db_xref="GeneID:34718444"
     CDS             573379..574737
                     /locus_tag="KLMA_80249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678301.1"
                     /db_xref="GeneID:34718444"
                     /translation="MSAGTGDIPRVFSTGDKGTFGWYTAEVRWPIIVQNAIDDTQAAI
                     DESTSELKKQQGAVIKGQLAQLKQDIEQNRKPPMLPEDVKEYEPFNVTLRENDSQTWL
                     NGDWLFLEVLMYRIINVYFKAQSEWTQFDIFERLKDSTFKSSKSGVLDLALYYHGLAE
                     KFNGQPEAIPPLFQEFMEISLWGNATDLSLLANASLDDISAIQNAAHRLKQKSNILID
                     DTNKTFEYLKSFKGDARVDFVLDNSGFELYTDLLFSLFLLDFKLASKVVMHGKNIPYM
                     VSDVMIKDFENIIKQLEDPEFFPTDDRTHLDYVASKIKGYVADNKLSIEAHPFWTGPL
                     DYWHLDPSETKYGGAECHKVLSQAQLNIFKGDLNYRKLTGDRVWPRTTSWERSIGPLS
                     HNGLVTLSLRTAKADVIVGLPEGKDEELSKYWVEQGNEYGSWWAASGKWAVICFNDGT
                     SK"
     gene            complement(<574837..>576183)
                     /gene="MPE1"
                     /locus_tag="KLMA_80250"
                     /db_xref="GeneID:34718445"
     mRNA            complement(<574837..>576183)
                     /gene="MPE1"
                     /locus_tag="KLMA_80250"
                     /product="protein MPE1"
                     /transcript_id="XM_022821997.1"
                     /db_xref="GeneID:34718445"
     CDS             complement(574837..576183)
                     /gene="MPE1"
                     /locus_tag="KLMA_80250"
                     /codon_start=1
                     /product="protein MPE1"
                     /protein_id="XP_022678302.1"
                     /db_xref="GeneID:34718445"
                     /translation="MSSSIYYKFRSQKDTLRVGFDGTGITVFDLKREIINDNRMGDGT
                     DFQLKIYNPDTLEEYEDDTTVIGRSSMVIVKRSPSVKLSVNGKSVIGNATRYVAGKPR
                     LMSKRNGGPSSIGSAAGVRNGRPNALANVEGQTEEERIANMFANQETQWEQTQQEMSQ
                     AQPIFQQRNGPGSSQHDLEPPPPGYMCYRCGGRGHWIKNCPTNNNPNFEGRRIKRTTG
                     IPKKFLKSIEIDPSSMTPEEMAEKKIMVTDEGKFVVHMADQTSWEDYQRRQQQQNYMM
                     SQEDKLYMKGQFPDLPDELKCPLTGGLLREAVKCSKCCGKIVSRLAMEDALLESDFVC
                     PLCHSPDVLLDSLEPVDDVQEKVNAFIKENKKRVLEDDQNRQNSGAANDNGEAIVSEA
                     VENDAKKPKLMAPPPPPVPFMPFMFPMNPFFGVPPASQQSQLSNQQPGSSDSKESG"
     gene            <576431..>576772
                     /gene="TOA2"
                     /locus_tag="KLMA_80252"
                     /db_xref="GeneID:34718446"
     mRNA            <576431..>576772
                     /gene="TOA2"
                     /locus_tag="KLMA_80252"
                     /product="transcription initiation factor IIA small
                     subunit"
                     /transcript_id="XM_022821998.1"
                     /db_xref="GeneID:34718446"
     CDS             576431..576772
                     /gene="TOA2"
                     /locus_tag="KLMA_80252"
                     /codon_start=1
                     /product="transcription initiation factor IIA small
                     subunit"
                     /protein_id="XP_022678303.1"
                     /db_xref="GeneID:34718446"
                     /translation="MSTTGYYELYRRSTLGATLMDSLDTLISDGRIEASLAMTILETF
                     DRVVSDTLRDKTSSKLTFKGHLDTYRFCDDVWTFIVKDCLVKLDGQDQETELKCDKLH
                     IVACNSKKNAE"
     gene            <577027..>578196
                     /gene="TAP42"
                     /locus_tag="KLMA_80253"
                     /db_xref="GeneID:34718447"
     mRNA            <577027..>578196
                     /gene="TAP42"
                     /locus_tag="KLMA_80253"
                     /product="type 2A phosphatase-associated protein 42"
                     /transcript_id="XM_022821999.1"
                     /db_xref="GeneID:34718447"
     CDS             577027..578196
                     /gene="TAP42"
                     /locus_tag="KLMA_80253"
                     /codon_start=1
                     /product="type 2A phosphatase-associated protein 42"
                     /protein_id="XP_022678304.1"
                     /db_xref="GeneID:34718447"
                     /translation="MDINQEYDKILKEFSLVEQSSLRQDSKEYQEQLTKCLAHGLNFK
                     TFIQTKSALFSSNETLDDLSTRSLRFLSLDYYLAQMMSRKQAVVSRNGGGPGGAGAES
                     GSIPMATNDRNILRLKFLQKVVQLLVQFLISLQDYGILQESLSKKLDKFESTYQPKLN
                     ELYASSKDDELKDATLKRQEKIEMYRSNKELEAQIKILESKLRDNGDDDGDNNTDDEE
                     TLRTLTLTKLKQLASQSWNQLEQILMEIDLLQNFTASAPQLESNRPENNSQTEDAGKE
                     DPTGYTDKLESLNKPLISKSGKVLRNFTLLDKKDQLKSKVFGYGQYGPTMTVEEFLAK
                     EFEENRVLQGGPEDVEEEPDEDDEEANDRATYKARAWDEFVEANPKGSGNTMNRG"
     gene            complement(<578206..>581244)
                     /gene="NUP120"
                     /locus_tag="KLMA_80254"
                     /db_xref="GeneID:34718448"
     mRNA            complement(<578206..>581244)
                     /gene="NUP120"
                     /locus_tag="KLMA_80254"
                     /product="nucleoporin NUP120"
                     /transcript_id="XM_022822000.1"
                     /db_xref="GeneID:34718448"
     CDS             complement(578206..581244)
                     /gene="NUP120"
                     /locus_tag="KLMA_80254"
                     /codon_start=1
                     /product="nucleoporin NUP120"
                     /protein_id="XP_022678305.1"
                     /db_xref="GeneID:34718448"
                     /translation="MSSFSRLNTNLLQLKPANAQIKTTHLYFDGKVRSSHEEIFSVDY
                     NKCFQLTNSDEHISYQWCNDFTVLVIYTMKDTFSRSVIYVHLPKPLLNKQFTSTVFEC
                     NGDINYPSLGFDLILKDGIFVNITLPLDFILSRIHLNEYPDNWARVLNPYDFSIRSPQ
                     YLFHVDNRFSVVFLKDGGLLGLKRVPLEVLNDFELQPVLFNDSSYLQSFTRIFSKFDN
                     QNSAVVSATLLNENLLVTLTNDAAIKIWDLNSFHLAGHYDLNSKGRHMNYGTVGNYML
                     LLNSLLFVYLPTGNGCFQVLELDSLQSTEKISIKPISAEIPVNLSSYSIWSLLDMQIL
                     SQNAVSNSDINLVVLWKSNMVTKVQLLSFQQPTFEEYTWTDCNNTYLSDLLDGEDLIT
                     NGSMEKSLLNLKSHYSQTTYDDAQNILNKNNLVVQVNDPQNQAYLTNLESVLKELHKQ
                     RQEPSSVTILNDEIILVNNLYAFHHSAYKLEEKIESIFFKILENNNVSSSPLEEFLSV
                     LHGFSSTISSDTLTKVSERYLDIVNGSINPSLSLKDKITTVFQDCLQNGFQAANLSKL
                     LEGLNSIDVIDVLDQFLHEHNKGTTEAIIDSLNTDVLSSTICMESITQYLSVFDKFII
                     DILLIFTILDIDFDTFEGRLTELINLHFNISMWLQISQIDKILAISETFKHTSKYGYG
                     IRLRSNSDLTNFTNKMFEFVKTRVSDEPPLLIRAFNDFILNGQNMSLAKQFLHFVIKP
                     YHISKKVNDEFLYALSLLKCEENDASLDIFLSNNFCQDLSLPSYLNVSENHPWFNLFQ
                     TIQNSNEAEYFYQLSILYSKMSSYSNALKTIKKSISLGGSSKDQLVQYIDILIVFGDY
                     KEILDVLRLEQKTLDVASREKYYHKLLTDQKCSDLFTATLFQQCSVANIKNDSIFLSV
                     EDNKIIASVLTSLVDLSDWTTFKKLFSYRILTQHERKACEVLFDYVLLGSDPTVKQRC
                     LLLISNVLKTFTDVKDRWFVNSNGQIIHLYEITDKLSKYN"
     gene            complement(<581786..>583519)
                     /gene="FAR8"
                     /locus_tag="KLMA_80255"
                     /db_xref="GeneID:34718449"
     mRNA            complement(<581786..>583519)
                     /gene="FAR8"
                     /locus_tag="KLMA_80255"
                     /product="factor arrest protein 8"
                     /transcript_id="XM_022822001.1"
                     /db_xref="GeneID:34718449"
     CDS             complement(581786..583519)
                     /gene="FAR8"
                     /locus_tag="KLMA_80255"
                     /codon_start=1
                     /product="factor arrest protein 8"
                     /protein_id="XP_022678306.1"
                     /db_xref="GeneID:34718449"
                     /translation="MNSPSAHYTLPGVMHYLQTEYTKNERDRINWELERCEMKSRIAK
                     LEGENRDLRTELAKLETKLQSLDSNNDNAIGEPEKCVPAESWEQEQELLDSKLSVQEN
                     IKEIVYLLKSPPVMEQLDSWNNKEDPVKRLEALNLFNNKGGENGENGSNLANGNHGGE
                     LNGNGNNNDKSNDSASGNTADFNTAGSGSCSTGGNDSSGNAKTSNDGENDSSILFSRD
                     WSDVPNSNMSSLGDNSDAETVVNTRRSRSSSLFSTGSNEAITFHTYRFLQYHLSAISG
                     LKAMGNNLLSFGSDGLLKHWLIEPNLNSNEKATKAFHSVPNLLGIFWLNKTRFMTVDE
                     MSVKLWNIDQSEPLVSWDALKDLVDLQSVDFKNGWLILTFVNEIKVWEIKVGEASIEK
                     LNEYIISVPNKILNCLLGLTEKSLIILNGDSKHNVKVSIFEFQGSLLQQIDLSHTLSQ
                     FHATNNELALNRSTSKLLIRFESETLIYSFDQKKTILVFSTPQPAVSSIFLNDLDYTA
                     TALKDGTIIVKSIKEGGKQVKIYNHYEHPEKTPAGVQPITISSTVIDKTPVIISGGYN
                     GVIRLEKVMNL"
     gene            complement(<584020..>584523)
                     /locus_tag="KLMA_80256"
                     /db_xref="GeneID:34718450"
     mRNA            complement(<584020..>584523)
                     /locus_tag="KLMA_80256"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822002.1"
                     /db_xref="GeneID:34718450"
     CDS             complement(584020..584523)
                     /locus_tag="KLMA_80256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678307.1"
                     /db_xref="GeneID:34718450"
                     /translation="MIIYTDIISGDELLSDAYDLKEVDGVIYEADCDMIKVGGDNIDI
                     GANPSAEDGDEELEDGTEMVNNIVHTFRLQQTAFDKKSFLTYIKGYMKQIKAKLQESN
                     PDEVAVFEKGAQAYVKKVIGSFKDWEFFTGESMDPDGMLVLLNYREDGTTPYVALWKH
                     GLKAEKI"
     gene            complement(<586143..>588158)
                     /gene="DEF1"
                     /locus_tag="KLMA_80257"
                     /db_xref="GeneID:34718451"
     mRNA            complement(<586143..>588158)
                     /gene="DEF1"
                     /locus_tag="KLMA_80257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822003.1"
                     /db_xref="GeneID:34718451"
     CDS             complement(586143..588158)
                     /gene="DEF1"
                     /locus_tag="KLMA_80257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678308.1"
                     /db_xref="GeneID:34718451"
                     /translation="MSQFKRNSSSKKLDSETKFKLETLTELFPDWTNDDLIDLVREYD
                     DLETIIDKITTGAVTKWDEVKKPSKKEKPASHIDHQSHSGSHQQQQQQQHAASHLDPE
                     DSPSLINQHHSHQRQSRSNAKFSNNNSNGGKSLQQRQQSSKDSGKKQPSKDSLKPAPL
                     PSKSSAAGKNSSSWAAVLAEKKKAHEKKLEHTKSSATSSSSTSQESHNELSNVQTEQN
                     DGEVASPNTTKTTTTTTTESSPKKQEAPKLEQPSTTNANSDNKPKSWADIASAKSRQR
                     QLQQQQQQNKKQQQQKTKPLDNLEVVTPETEEKPVDEKENVNSEQEAVDQEAEQQQQQ
                     QETFAEESKVEESSQLQEQEEARVEASEPVQQQQEQQQQQQQQQQQHVSQVQESAPVS
                     LPEDNNGVAAAANGIANIQFGSEGKGAQQNPASQNYYQQQPNQQYAPQQVPQSAAAAA
                     AAQAQAQQYYMYQNQFGYSYPGMFDSQSYPGYAQQFGVPQVPQGQQGQPQHPQQPQQA
                     SGSPTAQPGQTAYVAPSGTGYQSQEVPQQSPAQQHVQPQQYGGYGMPYMYYQQSFPYG
                     QPQYGIAGQYPYQMPKAGYNYYPPQPQSQQQGGQAQGSTQSQPDEEPANGTQAGANAN
                     AANASQQYQQYYQYQQAQTQPQQQVQQGMPYGYSSYDYSSQTSRGFY"
     gene            complement(<589188..>589442)
                     /gene="MDM35"
                     /locus_tag="KLMA_80258"
                     /db_xref="GeneID:34718452"
     mRNA            complement(<589188..>589442)
                     /gene="MDM35"
                     /locus_tag="KLMA_80258"
                     /product="mitochondrial distribution and morphology
                     protein 35"
                     /transcript_id="XM_022822004.1"
                     /db_xref="GeneID:34718452"
     CDS             complement(589188..589442)
                     /gene="MDM35"
                     /locus_tag="KLMA_80258"
                     /codon_start=1
                     /product="mitochondrial distribution and morphology
                     protein 35"
                     /protein_id="XP_022678309.1"
                     /db_xref="GeneID:34718452"
                     /translation="MGNVMSASFAPECTPLKEKYDKCFNSWYSEKFLKGLSVENECQI
                     EWYEYMECVQASLVKQGIKPALDEARKEAPFENEGKPVNE"
     gene            complement(<589666..>590388)
                     /gene="ASK1"
                     /locus_tag="KLMA_80259"
                     /db_xref="GeneID:34718453"
     mRNA            complement(<589666..>590388)
                     /gene="ASK1"
                     /locus_tag="KLMA_80259"
                     /product="DASH complex subunit ASK1"
                     /transcript_id="XM_022822005.1"
                     /db_xref="GeneID:34718453"
     CDS             complement(589666..590388)
                     /gene="ASK1"
                     /locus_tag="KLMA_80259"
                     /codon_start=1
                     /product="DASH complex subunit ASK1"
                     /protein_id="XP_022678310.1"
                     /db_xref="GeneID:34718453"
                     /translation="MDNTSSAMNLEQIDQEITLHLQKIDSDLAYCFTKITKDIIPYVT
                     QYGQTCEEISYSCAWLKEMFQQSANVQLVTDQGAESAGQVLEPRASLFPEVDNKPDNK
                     ANNKVDHQMDNNNNNNNNNNTTMDGFHTAEHPLGMGMGMGSDTDEMTQDSTMEKQRKK
                     RKISLQIQQQFNSSSSSSSSSTNSTLHKDFQENSSPIKMNPVDKGTETNNTLGKEGNQ
                     PGPQPADGQPTVIHFNSNNTRR"
     gene            <591561..>592571
                     /gene="SFK1"
                     /locus_tag="KLMA_80260"
                     /db_xref="GeneID:34718454"
     mRNA            <591561..>592571
                     /gene="SFK1"
                     /locus_tag="KLMA_80260"
                     /product="protein SFK1"
                     /transcript_id="XM_022822007.1"
                     /db_xref="GeneID:34718454"
     CDS             591561..592571
                     /gene="SFK1"
                     /locus_tag="KLMA_80260"
                     /codon_start=1
                     /product="protein SFK1"
                     /protein_id="XP_022678311.1"
                     /db_xref="GeneID:34718454"
                     /translation="MKSFPRPGNWLFIVPWIAFIPWYGMLITMLICWAAEGHPVYWFM
                     HTHQFPVYISDIGATNLKPLFISCCAWQGLGYAITVALEYFQRSGHWPFALPHVTDAD
                     VLESEHVSRDRASSTSTSSTGGSSSPTKHPKNTYYVEALVQHKYVMPPFFTKHERNLV
                     WASFVLACIGELALLMCTIFSTNTYPKVHRSMVGIFCAGFGLSAVCNIAQYTTMGRHY
                     AVVHPLCAAEDLGAETRWNHWRGHVWNKYTISGCVKSFWLVAAFTWAICFCAVPNDST
                     NACFEWLLAFWFGLYFMVVSVDWYIGGRYRVSKYFNQIIISDNLSFYKYEQLKEKGVE
                     SV"
     gene            complement(<592767..>595250)
                     /gene="EIS1"
                     /locus_tag="KLMA_80261"
                     /db_xref="GeneID:34718455"
     mRNA            complement(<592767..>595250)
                     /gene="EIS1"
                     /locus_tag="KLMA_80261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822008.1"
                     /db_xref="GeneID:34718455"
     CDS             complement(592767..595250)
                     /gene="EIS1"
                     /locus_tag="KLMA_80261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678312.1"
                     /db_xref="GeneID:34718455"
                     /translation="MSLVSAIPGDEASEESGSEQHASVYQRSGKPLSREALYRAKLKY
                     GVYQSPAQGLKAGVVDSKQASDAAANIANKNKTTIEAYKRLLNPNASKAASALSASVI
                     GEQKSAPVQHNDVPSVAASSAAVAAPKKVSSRASSHVGPAPNLGVGRSRASSNAAASA
                     TATASLTANSPAPVTQSPTSKMNFTKVLAGAERNAAEMVHNRINPDKVTYVKGISDRN
                     VGKAADASFSLTSDFVSRLPTKLDYVEAAEKESHSVEWAQKAVAALKDFNPDDVTDPH
                     WREREEQRNKLIKSLSSEAVLNKARYNAQQRLDTIDRETSYKAIFRNDEYNRAAVAVA
                     QENLKKTRSADAVTANKVNLGGGLWLAPGDIDNIAKGLIAPVLDEVDQRTGAQRAMDA
                     DIAKRDQEYRVQYAEWVNIQTEKHTNDTLLQAKAFERRNKEAADLEAVLNKKYADLCT
                     KKDAEVLEMEKLLESKKAELVKLKEDLEEELRKEDERNAAECAELERNNQLDLENSTR
                     EQEELLAPFKAELAAAEQYHEDLKSQKADIEKNIEELRASIEAHKQHVEELNVTIAEH
                     EQKLQAEGEELNNLADSHQVLKEDLDTNYVAVLEKSKEEAKISSEEARLKQLEVDALM
                     NERQTELSNTEIQLKKEKLNLIDALKEVAEVKNEGQIDEEKAKAFLGTTSSEFVASQQ
                     KKEVKPVATAAIPEQTTAPAPTAAPAAKETHEDDKVLNGVGFIPLKSKKGLVQRGNSI
                     KKFFGIKKSSHSSAASPAEKPEAAASTEKQEPVPAEQPTAAEQPAATELEPTFSGFSQ
                     GSVENRPTDESDDAINKKENRKSLFKEVF"
     gene            <596670..>598580
                     /gene="HOF1"
                     /locus_tag="KLMA_80262"
                     /db_xref="GeneID:34718456"
     mRNA            <596670..>598580
                     /gene="HOF1"
                     /locus_tag="KLMA_80262"
                     /product="cytokinesis protein 2"
                     /transcript_id="XM_022822009.1"
                     /db_xref="GeneID:34718456"
     CDS             596670..598580
                     /gene="HOF1"
                     /locus_tag="KLMA_80262"
                     /codon_start=1
                     /product="cytokinesis protein 2"
                     /protein_id="XP_022678313.1"
                     /db_xref="GeneID:34718456"
                     /translation="MAQIYNYQESFWDEADQGAGVLLQHVGRGICTCELLLDCFTKRG
                     ELEMDYARRLGALSSRLMSNLDRYADYNNMAESLKYFHESQQSVAKSHSKACERLSRE
                     NINTMSDFLRQFKARWTTIKGNVENLKKLKDEKKKALKALDQELQSAEDKLRECKINR
                     DTALGQYQKGEYSREVDKWSSIVDESHRRKTVLHHEYKSARNHWFEEWRRISGELQEL
                     ETQRIQVSRELLQQYAEFTSQPSEIELSLMEQLKQKLSSFTPELEISHFSYHHGTGRI
                     KIKGSSNSLGGHKGSINSYASKDDRSISSRRVIDLTKNDRYVQNVKRLSTQLKNTRLS
                     SINGVSADDKEQTQGRVRPQIITSTATASTSASTPIVDLEPVELRAFNNSSTDSPESP
                     GRYSDPDMAADHKPTQYSDSSEETCSNPTDFTHKKNKPSYDSMTTSLSSMASSVDDSQ
                     RFAKSWNSQNRRKSRPSSVYSPKMDMDARFNEKNNTSNTDGKLQVPYGRRRKSLASDV
                     ESALEILEKEEPRPATSRTSSGASSSLTVSRTVIPLNKSLNIMRCKRLNVDGEQLTLP
                     IVDSNRATVIKYAKAIYSYKEPNENNILNFNVGDILLLVECINDDWYVGEVYQGNKQH
                     GLVPMNYVKTIG"
     gene            complement(<598739..>599317)
                     /gene="CSE4"
                     /locus_tag="KLMA_80263"
                     /db_xref="GeneID:34718457"
     mRNA            complement(<598739..>599317)
                     /gene="CSE4"
                     /locus_tag="KLMA_80263"
                     /product="histone H3-like centromeric protein CSE4"
                     /transcript_id="XM_022822010.1"
                     /db_xref="GeneID:34718457"
     CDS             complement(598739..599317)
                     /gene="CSE4"
                     /locus_tag="KLMA_80263"
                     /codon_start=1
                     /product="histone H3-like centromeric protein CSE4"
                     /protein_id="XP_022678314.1"
                     /db_xref="GeneID:34718457"
                     /translation="MEQSVRSIDGARSVAGAGRTIIDRESINQRALQLLQRNRQRRLL
                     LKRSEDRARYIPERREQKRELDETLETRNVPQHHISAHERITKAKSHGSKYKPSDLAL
                     AEIRKYQRSTDLLISRMPFARLVKEVTDQFASDEEPLRWQSMAIMALQEASEAYLVGL
                     LEHTNLLALHAKRITIMRKDMQLARRIRGQFI"
     gene            <599589..>600953
                     /gene="ARP9"
                     /locus_tag="KLMA_80264"
                     /db_xref="GeneID:34718458"
     mRNA            <599589..>600953
                     /gene="ARP9"
                     /locus_tag="KLMA_80264"
                     /product="actin-like protein ARP9"
                     /transcript_id="XM_022822011.1"
                     /db_xref="GeneID:34718458"
     CDS             599589..600953
                     /gene="ARP9"
                     /locus_tag="KLMA_80264"
                     /codon_start=1
                     /product="actin-like protein ARP9"
                     /protein_id="XP_022678315.1"
                     /db_xref="GeneID:34718458"
                     /translation="MAPLRQDSYLIIYPGSTRTLVQFGIGEDTLQPPTISIPTKVYRD
                     ANGSFTSKETEDVVFPIEDGSIVDIDAFQYLLKLIYKSVLKQQSEDSPIAWDTTLSNI
                     PFLLISHHSWTQFQEELLCRHVFESMKLNHFAILPSSLASSFAFGSLQNCIVLDIGKQ
                     HTDVIPIMDYTPLTCFTRQIPVGGDLINEHLSDVLPNLSKSQIEDLKRSDIYEILPQD
                     ILDQYGVNKKDEDDGALDVAAIVTSGRDTREILEERENSKTHEKKENSELESNTFFDS
                     NGNSITVGRQRFTGYEELISKISKATGEVMNQIDDIPKLKSMWENVIIVGGTTHIKGF
                     REALLAQLLSDHIVTEPEEERLQREEEEKKKNSANQKKFGKVANLPSLNQIEYVQPPS
                     IILTPKFPDYFPEWKKIGFTDVTFLGAQILTKQVFGHSNTSFYVTREKYEELGPEAIW
                     EVSF"
     gene            complement(<601118..>604039)
                     /gene="PKH1"
                     /locus_tag="KLMA_80265"
                     /db_xref="GeneID:34718459"
     mRNA            complement(<601118..>604039)
                     /gene="PKH1"
                     /locus_tag="KLMA_80265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822012.1"
                     /db_xref="GeneID:34718459"
     CDS             complement(601118..604039)
                     /gene="PKH1"
                     /locus_tag="KLMA_80265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678316.1"
                     /db_xref="GeneID:34718459"
                     /translation="MSSGQSYNRPILERPVSGSFNVHRPTPPPISVNFQQSPLVSSKT
                     TNDLSESAEEKPFENGAPPILKRALTSADNYISLDQMYPGRSNSGIQSSSDSLPSMES
                     IGSEEEQSELQSQSQSRLYSESPLQSPRGEDSVSIPRELPISEAMQRRQKEWADRGAA
                     VIVKDVKDENTGQVTKQVIKKGINDFKFGETLGDGSYSTVLLATSIESGKKYAVKVLN
                     KEYLIKQKKVKYVNIEKNTLQRLKNTRGIISLFFTFQDETSLYFLLEYAPNGDLLSLM
                     RKFGSMNEKSAQYYSAQIIDALDFMHKKGVIHRDLKPENILLDKDMKVKLTDFGTARL
                     LEGSSTPEGPKYDLLTRSNSFVGTAEYVSPELLNDNYVDFRCDIWAFGCILFQMIAGK
                     PPFKANNEYLTFQKVMKVQFAFTAGFPMVIRDLVKNILIKNPDRRLVIDQIKAHLFYS
                     DINFNDGSVWTNDPPELGPYKISARALQKQVPKVPSSPASPLPQDPSGNSGISSAKYL
                     HKSPRTHSSTSQRSSPDSLSGPKKREIDQRTQKILNNVKMKITQRNEKRAAIQQQQQQ
                     QQQQQSSNAQTQGQGDNSLNPATAAAAALHIINKPSNGAIRRQSASSSSAGSLRTQRK
                     TNVPSRTSSAHSSTHSKSAPTTPSSQARKESLSLPPMSKLDILWSYYLKNINERVIKM
                     GDLYVATAKSHNLENRINKARLHFLDADGRLQKKNTLLSQVVRGGGNVTGFRQETSNL
                     VEEDFYHEFLIDEDSLERSFKKKVEQDESSAEGISKLKHFFSNPSENSAEFLSQTEFV
                     KRTCVITTFGRFLLFAKRNTINHATELYYDIEYDIDLAQLGVKIKEIIPEKKLNSKDT
                     FVIQTPFKSFVLQSEESETLVWLSSLLSAVKIKNERHVHKEAPINAIANKAALLAEHE
                     HESNTKAIDSLAISPNIRRTSSFTTQRQKNSHNGHHPSRPISGSSRMLSRSEQIFRPS
                     K"
     gene            <604774..>605430
                     /locus_tag="KLMA_80266"
                     /db_xref="GeneID:34718460"
     mRNA            <604774..>605430
                     /locus_tag="KLMA_80266"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822013.1"
                     /db_xref="GeneID:34718460"
     CDS             604774..605430
                     /locus_tag="KLMA_80266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678317.1"
                     /db_xref="GeneID:34718460"
                     /translation="MTHTTATNTYHVFMLPDLEAYVHGLKFKNKLKRWGKSQGFKELS
                     PDNLKEWCTDSFVLDSLLKVNNYKTSPLNSPISPMTPEFPHALWQVPPCRGNLLDECK
                     LSGPSSCRCPHHQHHHSSTGTLGTLGTVGSQSSQGSQAPQRHKSAKIKRFWHKMTGQK
                     NGETHCPISHSLSLARSGDQRSLRLSSTKVLQTTSTKTLPYPSTFQGSTNVLRLLELI
                     "
     gene            <606171..>607118
                     /gene="IZH1"
                     /locus_tag="KLMA_80267"
                     /db_xref="GeneID:34718461"
     mRNA            <606171..>607118
                     /gene="IZH1"
                     /locus_tag="KLMA_80267"
                     /product="ADIPOR-like receptor IZH1"
                     /transcript_id="XM_022822014.1"
                     /db_xref="GeneID:34718461"
     CDS             606171..607118
                     /gene="IZH1"
                     /locus_tag="KLMA_80267"
                     /codon_start=1
                     /product="ADIPOR-like receptor IZH1"
                     /protein_id="XP_022678318.1"
                     /db_xref="GeneID:34718461"
                     /translation="MSATTTLRHRKSISVKLEKLTPVVVTGSEKRLYKFDELPEWQQD
                     NEMIITGYIRETRSVKKCLKSLFQFHNESINIYTHLIPTITYLLLLVGLANAYLIPRF
                     PDSTMTQYLMINFFLLGAVLCLGCSSFFHCLKQHSESHCHIWSKVDYMGIIIMITCSM
                     ISILYYGFHDHIFHFKCFTVFTVVLGTICTVFALHDKFDSKTFRPFRAMFYVTFGLSG
                     VVPILTGFYKFGAYEAIRRTQLKYILFEGMFYIAGAVIYGFRFPEVLAPGKFDFVGHS
                     HQIFHIMVVLGSICHFRAIIGSYIFMHTGLHHSSFVLSR"
     gene            <607542..>607889
                     /gene="MZM1"
                     /locus_tag="KLMA_80268"
                     /db_xref="GeneID:34718462"
     mRNA            <607542..>607889
                     /gene="MZM1"
                     /locus_tag="KLMA_80268"
                     /product="protein FMP36"
                     /transcript_id="XM_022822015.1"
                     /db_xref="GeneID:34718462"
     CDS             607542..607889
                     /gene="MZM1"
                     /locus_tag="KLMA_80268"
                     /note="mitochondrial"
                     /codon_start=1
                     /product="protein FMP36"
                     /protein_id="XP_022678319.1"
                     /db_xref="GeneID:34718462"
                     /translation="MSRALAAYRNGLRAARVAFGGDTRMLVAARQKMREGMINPPNPE
                     LSPDEQIKHMNDVAQFLRQNIVQGKKAEGDKYHLNIHKDTELGDNETIKTAKKTLVAQ
                     GGGCCGGGSGLYK"
     gene            <608251..>608964
                     /gene="TPT1"
                     /locus_tag="KLMA_80269"
                     /db_xref="GeneID:34718463"
     mRNA            <608251..>608964
                     /gene="TPT1"
                     /locus_tag="KLMA_80269"
                     /product="tRNA 2'-phosphotransferase"
                     /transcript_id="XM_022822016.1"
                     /db_xref="GeneID:34718463"
     CDS             608251..608964
                     /gene="TPT1"
                     /locus_tag="KLMA_80269"
                     /codon_start=1
                     /product="tRNA 2'-phosphotransferase"
                     /protein_id="XP_022678320.1"
                     /db_xref="GeneID:34718463"
                     /translation="MEPKNREVSISKALAYLLRHGAVKEKLPIDYNGYIELDSLLQHN
                     RLKSLKATVPEIEHIVASNDKKRFHLKEDPDTGKLMICAVQGHSLKQIKPSEEVLEPI
                     TKTDQLPDHLVHGTNIKNCIQILESGYIKKMNRNHVHLSPGITGKHSEVISGMRYSSN
                     VFIHVKRTQEAVDKLKIFKSLNNVFLSSLDIPLEYIELIQVRPPNAQVSNESNSPKNH
                     QLKLLEELASNNSIKVEYM"
     gene            <609332..>610279
                     /gene="RSM28"
                     /locus_tag="KLMA_80270"
                     /db_xref="GeneID:34718464"
     mRNA            <609332..>610279
                     /gene="RSM28"
                     /locus_tag="KLMA_80270"
                     /product="37S ribosomal protein RSM28"
                     /transcript_id="XM_022822018.1"
                     /db_xref="GeneID:34718464"
     CDS             609332..610279
                     /gene="RSM28"
                     /locus_tag="KLMA_80270"
                     /codon_start=1
                     /product="37S ribosomal protein RSM28"
                     /protein_id="XP_022678321.1"
                     /db_xref="GeneID:34718464"
                     /translation="MIGSFVSRRAYGTVSPDFLASVLQRVKDVPQRLAEAQKAEAKKF
                     SQRKNSRGDRRRDGRPSNRDSSWRNNESREPAVQTGAFKKRGAKLENTNEYNEISGKV
                     DNFAARKSRRSTEKRTRRTVPGLKLSSTLGSSSRNVTQTVSNSSTYVPQDPTPLSLLK
                     YRPNLAPTFTSKALKYTISTLKESNFPLNRSFNDGIIVDGKVVNKRLTANMENFGEFI
                     PASDLKLQLEPLTKNFKVVSDLEKLEQSVKGKFHTLKPFAKKDFAKLSKSEEKRTQLF
                     NNSETVRNSLNQSSTLDAAEKELLYKCCSGLAPISELRN"
     gene            complement(<610372..>613002)
                     /gene="VPS3"
                     /locus_tag="KLMA_80271"
                     /db_xref="GeneID:34718465"
     mRNA            complement(<610372..>613002)
                     /gene="VPS3"
                     /locus_tag="KLMA_80271"
                     /product="vacuolar protein sorting-associated protein 3"
                     /transcript_id="XM_022822019.1"
                     /db_xref="GeneID:34718465"
     CDS             complement(610372..613002)
                     /gene="VPS3"
                     /locus_tag="KLMA_80271"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 3"
                     /protein_id="XP_022678322.1"
                     /db_xref="GeneID:34718465"
                     /translation="MDNDTTSNVVSTSFDVIGSLYAIAPLIENVPEEYDYSCIEYYDK
                     HIYLGTTSGKLLHYFELDAGNYTLISQLEFNDSEDSSIDRITLLPEIDRALVLSEGEV
                     KLFLLPEFAPATNVYSIKNITDFCPLNYSKTSNAYPCFMFSNDTIIGVSVSPKQMKIE
                     KTYGVKGIQVALPITDKRKLMGAVDNTYSIIDPQKESTIPLFKVCEEDAKELTPTIAN
                     FGKNEYIVICGISNEESCMGLILNDEGEITQGTIVIEKYPTRIAVEYPYVFAELHGSK
                     TVNIHMLKENDDPEVVQSISREDPFHISKTQRSFPAKYYNKQLVELLRYVPLTGEKLQ
                     FREDQEKAYVERNIDIETDMLLYGKDGISYLQQKPNLLNITSFGEETIPTLEKYISLN
                     PLSNYSKLEHNYFHILYILMLVFHCNSIDETLIEKWLRCADVVDIRILLYFFDFKIYG
                     DLWIPNGLLEFTEKLHQLKLIHKCKDVPKVLHFLKRRLKEESADGLKDSANIYLSLDI
                     ILLHMDMKERKVNIKNYEDTSYHVIIEELSKEEDDYAEVLLELYEQLNDIEGILKILR
                     RKDSRRLIKFMKDNVDKLPETYSEEDMIKDISTALKSNHEFENNEVVYDVLELMKILS
                     IDTTKFTSRIEDSEMKAFLLEKLGVTTTKDLDFLYQYYKTKLTNCNTKLMDSMNIRIT
                     SYVTNLNYDKPTLKKYLQTKLDDSDDYSTLLDVGRKLIDVEKRLNETKDSFLDEIDAT
                     YILRLLLVETEDLEATLGSEKLLELYLSWNDFSAVDTIVEGNEESILQILDHYVSLKN
                     ETVLCRFLVRNKTQISSMHSNREVFEKIPPTIPLNLLQELLFPVFRRNNNTMQNLHIE
                     KGILKHYLQALKGIERRLEP"
     gene            complement(<613215..>615188)
                     /gene="PUF6"
                     /locus_tag="KLMA_80272"
                     /db_xref="GeneID:34718466"
     mRNA            complement(<613215..>615188)
                     /gene="PUF6"
                     /locus_tag="KLMA_80272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822020.1"
                     /db_xref="GeneID:34718466"
     CDS             complement(613215..615188)
                     /gene="PUF6"
                     /locus_tag="KLMA_80272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678323.1"
                     /db_xref="GeneID:34718466"
                     /translation="MAPTTKKVNKRQSASKDSGKIVKRAKNISVYSSDEESDAALHGL
                     SSEDELDDASEDELDNASEESEDSDESDALDEDSEANSDEEDNEETGADEKKEGNGVS
                     QHAEQRKTLKERKLQRKSGERVQQIKSLWEKLRVKSPPIPKPVREKLCNEIWELSSDC
                     IEDLVLKHDASRIVQTLVKYSSKERREQITLALKDKIYVLATSSYGKYLLVKLLHYGS
                     RSSRQLIIDQLHGSLRKLMRHREGAYVVEDLFVLYASQEQRNQMIREFWGSEYAAFRE
                     THKGLTIEQVCETSVEKRNIIARNLIGTITASVEKGSAGFQILHAAMREYVKIANEKE
                     ISEFIELLEEHFAELVHTPEGAEVAATLIAKANAKERKAIIKNLKEHTLKLIQNEHGA
                     VVFITLLMTVDDTVLVSKAFAPSIKEELATLIVDKFGRRPFLFLLLGLDGKYFGPNLK
                     KELEKYIKMSENTSKKPFDQRRLELLKRFAPMILSTTNEHYKEILNENIGSQFVADLL
                     VNDEVYEQLSEADQKLFAELVDTVAIYFKGDISDYDHPINKPFSARLLKSLIQNGRYN
                     VKAKKLEPLQKVQGLGVPFAQRFYEDIIDSSNLLDWINKPSSSFTIVALYEALHGTKE
                     GKQFDKDLKKVIKEISADESNKGAHLLLKLIKQ"
     gene            complement(<615721..>617439)
                     /gene="ITR2"
                     /locus_tag="KLMA_80273"
                     /db_xref="GeneID:34718467"
     mRNA            complement(<615721..>617439)
                     /gene="ITR2"
                     /locus_tag="KLMA_80273"
                     /product="myo-inositol transporter 2"
                     /transcript_id="XM_022822021.1"
                     /db_xref="GeneID:34718467"
     CDS             complement(615721..617439)
                     /gene="ITR2"
                     /locus_tag="KLMA_80273"
                     /codon_start=1
                     /product="myo-inositol transporter 2"
                     /protein_id="XP_022678324.1"
                     /db_xref="GeneID:34718467"
                     /translation="MNQITENSSGSSPILFDDVSNTKLKDSYEDNSSDRSDRIIIKPV
                     NDEDDTSVMITFNQKMSPFILILTFTASISGFMFGYDTGYISSALVSMGTDLDHKKLT
                     YANKEMITAATSLGALISSMFAGISADIFGRKPCLMFSNVLFIIGAALQVGAHTYWLM
                     VAGRLVMGFGVGIGSLLAPLYISEIAPKHMRGRLTVINSLWLTGGQLIAYGCGAGLDK
                     IHNGWRILVGISMVPTVIQFTCFAFLPDTPRFYVMKGNYTKAAEVLQKSYVSAPPELI
                     EQKIRELTELNESIPGRTPVHKFVNTVKELHVVPSNFRALVIGCALQGIQQFCGWNSL
                     MYFSGTIFETVGFSDSTAVSIIVAGTNFVFTLVAFFAIDKVGRRAILLIGLPGMMVSL
                     IVCAIAFHYLNIKFTGDGSSEVAHGGFSTWGIIVIVFIMTYAAFYALGIGTVPWQQSE
                     LFPTAVRGVGASFCTATNWAGSLIIASTFLTMLQNITPTGTFALFAALAFVSTVFCYL
                     CYPELSGLELEEVQTILKDGFNIKASKQLAKKRKQQNSDQQRKYRERDLEASHKDKPS
                     DELVES"
     gene            complement(<618845..>619894)
                     /gene="SEC20"
                     /locus_tag="KLMA_80274"
                     /db_xref="GeneID:34718468"
     mRNA            complement(<618845..>619894)
                     /gene="SEC20"
                     /locus_tag="KLMA_80274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822022.1"
                     /db_xref="GeneID:34718468"
     CDS             complement(618845..619894)
                     /gene="SEC20"
                     /locus_tag="KLMA_80274"
                     /note="containing Sec20 super family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678325.1"
                     /db_xref="GeneID:34718468"
                     /translation="MIPTCESLAGKRKALHSLFIQSLENDESINDKVINEFLSYEDMI
                     RSFQKVIELKYNVKIRYEPQFTIVGTPCGIEKDDSLWIDEMNELLKNIDFRKEFTQKY
                     EVSLIESRLMLKDLLKEKLEAKLQERRGSTSSMDDDLNRSEVINTTDSKDMLLPNAAS
                     NIKGKTLQVNKKITSNLLRTNQILRSSVLQSELNLDELTQQTDTLMLVNDKFDRFKAM
                     SQASLKLIKAINSSSYQEKRKVYAAITFFCCCILWVLWRRIFKYPVKLVFWLCFRIFK
                     SMLYTVGLVKNSASFGNATDNYDHDSYDIYSNTATALTATLETLIANASESSSTTLDL
                     ENAISSSFDKLMDEL"
     gene            <620487..>621482
                     /locus_tag="KLMA_80275"
                     /db_xref="GeneID:34718469"
     mRNA            <620487..>621482
                     /locus_tag="KLMA_80275"
                     /product="non-disjunction protein 1"
                     /transcript_id="XM_022822023.1"
                     /db_xref="GeneID:34718469"
     CDS             620487..621482
                     /locus_tag="KLMA_80275"
                     /codon_start=1
                     /product="non-disjunction protein 1"
                     /protein_id="XP_022678326.1"
                     /db_xref="GeneID:34718469"
                     /translation="MNSPSDTEEFYDCQGDDTFLPGKLSLFKGSLLTANNAPSINPSL
                     PPSSFKNTFRTKVARECHNYALLLWLLNSEQVNLTYHSDYQVNAFQVFKHNEQKLYQR
                     HLDIRQMPLDIGDISMDATLVPGDTDGFDTSKFECSIYPILLQKTNYDHFQMDRLAED
                     YRSQFVKILENFEYQKVKHPKFAMLYLQQNLTLLTRAYIRDLFYDITFKYSSWSSAGS
                     SEKVHLLKSLQRYHKEHTFIISHETIASFTEKLDHLTCLNYASSDEINTTLTYGVWID
                     TERGIILLCNGIAHTWDIMQIPSYSYKQSDDITAFVTKYMLFCNMSALETCMWFL"
     gene            <621903..>623213
                     /gene="ERG24"
                     /locus_tag="KLMA_80276"
                     /db_xref="GeneID:34718470"
     mRNA            <621903..>623213
                     /gene="ERG24"
                     /locus_tag="KLMA_80276"
                     /product="delta(14)-sterol reductase"
                     /transcript_id="XM_022822024.1"
                     /db_xref="GeneID:34718470"
     CDS             621903..623213
                     /gene="ERG24"
                     /locus_tag="KLMA_80276"
                     /codon_start=1
                     /product="delta(14)-sterol reductase"
                     /protein_id="XP_022678327.1"
                     /db_xref="GeneID:34718470"
                     /translation="MSTLNPRTTHYEFSGPIGALAITVFLPALAILLNQMIRPDYYIK
                     GLFSNFSWIEVWNRLDPLSSYLFNGELWTYYTTWYFSLALLDVILPGTKLYGVELRDG
                     SKLPYKINGISMSAALCLVLAARYQLTNGEMPELEYLYTHQTDLCIITILFSFALATA
                     VYIASFIPLVKPNKSGTNERILALGGNSGNIIYDWFIGRELNPRLGPLDIKLFSELRP
                     GMLLWLLLNLSCLHHSYKEHGKIIDSLLLINVLQGFYIFDGVLNEEGVLTMMDITTDG
                     FGFMLAFGDLCLVPFTYCLQARYLSVSPIVLGPLNCGLVVSVMLLGYWIFHSSNKQKS
                     EFRQGNLPHMKSIQTERGTKLLCDSWWAVSQHINYFGDLLISLSWCLCTGFQTPLTYY
                     YFFYFTALLLHRQTRDEDKCRKKYGKSWEEYEKKVPYKIIPYVY"
     gene            complement(<623342..>624664)
                     /gene="SLI1"
                     /locus_tag="KLMA_80277"
                     /db_xref="GeneID:34718471"
     mRNA            complement(<623342..>624664)
                     /gene="SLI1"
                     /locus_tag="KLMA_80277"
                     /product="N-acetyltransferase SLI1"
                     /transcript_id="XM_022822025.1"
                     /db_xref="GeneID:34718471"
     CDS             complement(623342..624664)
                     /gene="SLI1"
                     /locus_tag="KLMA_80277"
                     /codon_start=1
                     /product="N-acetyltransferase SLI1"
                     /protein_id="XP_022678328.1"
                     /db_xref="GeneID:34718471"
                     /translation="MRELFVLERYYWESSNNRLQQGFILSITLNKPIPDDVLTEAIRL
                     TGLDYPWIFQNIKVKDAQGPDRIEPIKKRLVTEDLIKHVDNDEPNHILETLRLETTDD
                     NCAWVVLVKENRFTLFLNHTFFDGMSAYNLWSSIIKYANQGVRSSDGLIYDGNGQNIL
                     SRHAYEEVEMKLMDKISAKIAPYWIQYVAPSIAKIFPSHLFSIPGFNLQEVLLDKNGN
                     IRQDQKRLKWTIPPTQLKEILAEVRARNLTLTVWICAKLAYQLTKIKSSTKGSTIKLA
                     IPMSMRPFLIEKLGKDPKDIATGNYVSAAYCTLSLDKYGSELWTIADEINKSLQKAKE
                     DPVANINYVKLLDEVDLTKFIKEKYKTTSSPCTLELSNLGMLDPSSPDDEYQLLDAEF
                     QQPMLTSSILCCSSISTRLGGLTVNFSYPIELDKIITPAFEELVNPRN"
     gene            complement(<625150..>625578)
                     /gene="HCH1"
                     /locus_tag="KLMA_80278"
                     /db_xref="GeneID:34718472"
     mRNA            complement(<625150..>625578)
                     /gene="HCH1"
                     /locus_tag="KLMA_80278"
                     /product="hsp90 co-chaperone HCH1"
                     /transcript_id="XM_022822026.1"
                     /db_xref="GeneID:34718472"
     CDS             complement(625150..625578)
                     /gene="HCH1"
                     /locus_tag="KLMA_80278"
                     /codon_start=1
                     /product="hsp90 co-chaperone HCH1"
                     /protein_id="XP_022678329.1"
                     /db_xref="GeneID:34718472"
                     /translation="MVVMNPNNWHWVDKNTLPWTNDYLERRFTNWQHSDDEYVFTVEK
                     LNSCEGDSNVSQRKGKVICYFDLHLKFDAVLTKDGEEISRGVITVPEFMHDEDDFEVR
                     FDSFGEHSALVKKLALEKLVSDLLAYQQDLIDSHSRDLQQ"
     gene            complement(<625859..>626476)
                     /locus_tag="KLMA_80279"
                     /db_xref="GeneID:34718473"
     mRNA            complement(<625859..>626476)
                     /locus_tag="KLMA_80279"
                     /product="ribonucleases P/MRP protein subunit POP3"
                     /transcript_id="XM_022822027.1"
                     /db_xref="GeneID:34718473"
     CDS             complement(625859..626476)
                     /locus_tag="KLMA_80279"
                     /codon_start=1
                     /product="ribonucleases P/MRP protein subunit POP3"
                     /protein_id="XP_022678330.1"
                     /db_xref="GeneID:34718473"
                     /translation="MSSVRKEEKRVAKRRQVYKPILENPFTNEGKYWPHVNEQKLVLE
                     LLEEKVLKKWKLLHEMKSEPEEQLRSVILGFNDIVRKLSDRSENPQKYMLFVCKKDNP
                     AVLSAQIPILCETSVHDVLLVQLPRLSLAKFDDACGDKVHDGMCLVQTNPHFQDLGKL
                     VANNVEPLDIPWLHSAQFTKTPVKLLRTTAPVVKKNPANKTKTKT"
     gene            <627538..>628833
                     /locus_tag="KLMA_80280"
                     /db_xref="GeneID:34718474"
     mRNA            <627538..>628833
                     /locus_tag="KLMA_80280"
                     /product="cell wall integrity and stress response
                     component 2"
                     /transcript_id="XM_022822030.1"
                     /db_xref="GeneID:34718474"
     CDS             627538..628833
                     /locus_tag="KLMA_80280"
                     /codon_start=1
                     /product="cell wall integrity and stress response
                     component 2"
                     /protein_id="XP_022678331.1"
                     /db_xref="GeneID:34718474"
                     /translation="MVKIQLVLLSGLVQLAQVASAQYSYQGCYSEDSLESSLKSVGKY
                     EYQSVSYCEEQCSGSVIAALIDGNTCYCGDSSSLSGASSTSDSNCQVPCVGYPFEKCG
                     GEGYFAVYASGDISSSSGASSSSTSTSASSSTSSSSSSFSSSSSFSSSSSISTSSSST
                     STSSSSSSSSSSSTSTTSSTPSSTSTSSSSSSSSSSISPSTTSSSTSSPTTRVKIITT
                     QVSVVTLSDQSRSTVAVTTTRTVVPTGQDIGASSSRKSSSSSSLSSGAIAGIVVGVVF
                     GVLLIAAVIAVLLWQRHKKNKKPDFEESKQHQPYSFGQEEELIVPPVPGIPNSHSSSS
                     SSGRSNVSHPNEKIGEPPAGMYNSEQPVSPFEPENDEPMLRPPAVHPTLGNPRFSNGS
                     LPDVTQQRQPLRIANPDSSDNDDDDDAEFNSIIENLRVD"
     gene            complement(629359..629431)
                     /locus_tag="KLMA_R811"
                     /db_xref="GeneID:34718797"
     tRNA            complement(629359..629431)
                     /locus_tag="KLMA_R811"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:34718797"
     gene            <630287..>632120
                     /gene="rplO"
                     /locus_tag="KLMA_80281"
                     /db_xref="GeneID:34718475"
     mRNA            join(<630287..630689,631267..>632120)
                     /gene="rplO"
                     /locus_tag="KLMA_80281"
                     /product="54S ribosomal protein L10"
                     /transcript_id="XM_022822031.1"
                     /db_xref="GeneID:34718475"
     CDS             join(630287..630689,631267..632120)
                     /gene="rplO"
                     /locus_tag="KLMA_80281"
                     /codon_start=1
                     /product="54S ribosomal protein L10"
                     /protein_id="XP_022678332.1"
                     /db_xref="GeneID:34718475"
                     /translation="MLDWAIKDVVSSGSTKPDSNKIFEQYETNSLYLDVNSTWSWSAF
                     ITSYTTGKKHDKTANLAKIRDAIKTTLLSDIQQGKSAFCITVNNGATWRLEARFMDGY
                     SAAPFQPGGGWTIPCIENDNVLKRRLPGRNWPDIQAMFSINKVVNPFGSLIERSFVRH
                     ISILSSLKPSEGSIKGYKRLGRGPSSGKGKTSGRGQKGQKARGHVKSWFEGGQTPIYK
                     LFPKLGFTNVTSLDLKELNLERIKWFHDKGRLNLLPGEVLTMKKMKDLGLVTGPIRDG
                     VKILGDGKISFNLPIKIEATRASQGAIAAIEKAGGSFTARYFSRLGLRAHLSPNWFIQ
                     KRGRVPLQARPTKRKDIEFYSSEEKRGYLVMENDPYYQILKGAKEEGGKSSATRKTKK
                     TKLELQMEQLENDFVPPQPKSGIIQE"
     gene            complement(<632310..>633356)
                     /locus_tag="KLMA_80282"
                     /db_xref="GeneID:34718476"
     mRNA            complement(<632310..>633356)
                     /locus_tag="KLMA_80282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822032.1"
                     /db_xref="GeneID:34718476"
     CDS             complement(632310..633356)
                     /locus_tag="KLMA_80282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678333.1"
                     /db_xref="GeneID:34718476"
                     /translation="MKISSRHLDFYLPDNALNLTELPPATATLTAAYVCWTIVLSIVR
                     RRYIKDSALEDIDSRLVVVPFLQMIPNKIFFYPLSLVFSNLIDVEPWKFILNFANLLI
                     GGAYIEILWQSPLELLKFVLGIGSLANLIVVLITICLHIIWPSIRLDLPLDGNYTLIV
                     GFPIIYKQLFPETTIFETKQLPFISKNFRFKLLPIFTLIALTFIQLVWFHHFSQLLSI
                     WITFFTCYFYLRFYQELPRTMAEGTDYKVIGDASETFQLIYFFPDLLKPVLSPIFDFV
                     YEKFVVEWHLATPFRMYDIEQANISAQKRGAKPVGSSNAEERRKQLALQVLEERLVDE
                     DGTELGDISAENRV"
     gene            complement(633808..633880)
                     /locus_tag="KLMA_R812"
                     /db_xref="GeneID:34718798"
     tRNA            complement(633808..633880)
                     /locus_tag="KLMA_R812"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:34718798"
     gene            complement(<634273..>635334)
                     /gene="VID24"
                     /locus_tag="KLMA_80284"
                     /db_xref="GeneID:34718477"
     mRNA            complement(<634273..>635334)
                     /gene="VID24"
                     /locus_tag="KLMA_80284"
                     /product="vacuolar import and degradation protein 24"
                     /transcript_id="XM_022822033.1"
                     /db_xref="GeneID:34718477"
     CDS             complement(634273..635334)
                     /gene="VID24"
                     /locus_tag="KLMA_80284"
                     /codon_start=1
                     /product="vacuolar import and degradation protein 24"
                     /protein_id="XP_022678334.1"
                     /db_xref="GeneID:34718477"
                     /translation="MITEETHVNAGSPSFKQVSLPLREEQAQAEAQAEAQVQVQVQAP
                     VPGQGPSQGLGQALGQAQGGPVHSPSPALAFPAPLTPFLHRNPYFRLHRTASQESIRR
                     SHENVTVTDTTDDYYDPHSPPRSRPATPTRTPSRKSHERTHWLAPRKRFVGYQISGYK
                     KFQVTITIQSVSLPNNNESNCTSPHLTGFLSIKGLTVQNPEITTFFESITVTDSLGFL
                     SKDIPIDYDSYKATDQTDLEHWLNFPSFKELCMQNDPKNPSKNILQSIIDGTYAHTDY
                     LNQRFLYMRWNEKFLVPDADLESIDGASYDGYYYIVHDQLLGNILGFYYHQHAERFQQ
                     LELQPLVEPSIGDCSFEFA"
     gene            <636616..>637188
                     /gene="PHO88"
                     /locus_tag="KLMA_80285"
                     /db_xref="GeneID:34718478"
     mRNA            <636616..>637188
                     /gene="PHO88"
                     /locus_tag="KLMA_80285"
                     /product="inorganic phosphate transport protein PHO88"
                     /transcript_id="XM_022822034.1"
                     /db_xref="GeneID:34718478"
     CDS             636616..637188
                     /gene="PHO88"
                     /locus_tag="KLMA_80285"
                     /codon_start=1
                     /product="inorganic phosphate transport protein PHO88"
                     /protein_id="XP_022678335.1"
                     /db_xref="GeneID:34718478"
                     /translation="MNAQITNLAIMLIMMQISRRLDMEDPTIILYVRIAYVASVVITW
                     SIYSYARAQIVKKNDLTTLKYVTPPNPLGGQTEEKLEVTTVRDYDLQQIDSAIKSIYT
                     GLAMMGFMHLYMKYTNPLFMQIVSPVKSALEHNEVQIHVFNKPATGDLKRPFKAPSMF
                     GAATGGSDPKTDKKSIETAEKAGKGGVKAE"
     gene            <637442..>638374
                     /gene="UBA3"
                     /locus_tag="KLMA_80286"
                     /db_xref="GeneID:34718479"
     mRNA            <637442..>638374
                     /gene="UBA3"
                     /locus_tag="KLMA_80286"
                     /product="NEDD8-activating enzyme E1 catalytic subunit"
                     /transcript_id="XM_022822035.1"
                     /db_xref="GeneID:34718479"
     CDS             637442..638374
                     /gene="UBA3"
                     /locus_tag="KLMA_80286"
                     /codon_start=1
                     /product="NEDD8-activating enzyme E1 catalytic subunit"
                     /protein_id="XP_022678336.1"
                     /db_xref="GeneID:34718479"
                     /translation="MSLDNVKILILGAGGLGCEIVKTLALFGIPLLHIVDMDTIELTN
                     LNRQFLFTDADIGKPKAHVAASAINNLSNQNKLPRPVHVVGHNQDLTSFQDDFIAQFD
                     IVISGLDSIEARRWMNYKLHELALKSNYKTLIPFIDGATEGLMGNCKLIVPGFTACYE
                     CSLTTLPQHTDTYPLCTLASNPRSIAHCVQYASIILWPRHFNRPHDLDNSEDLDWLYE
                     QALQRAQQFNIDHSELSPRFVLGVLKSIIPSVTTTNAIIAGQCCKLAIELLTDIIDIQ
                     TCPTFTMYNAEAGATMFSYRHERDPQCSVCCMTA"
     gene            <638590..>639177
                     /gene="ISA2"
                     /locus_tag="KLMA_80287"
                     /db_xref="GeneID:34718480"
     mRNA            <638590..>639177
                     /gene="ISA2"
                     /locus_tag="KLMA_80287"
                     /product="iron-sulfur assembly protein 2"
                     /transcript_id="XM_022822036.1"
                     /db_xref="GeneID:34718480"
     CDS             638590..639177
                     /gene="ISA2"
                     /locus_tag="KLMA_80287"
                     /codon_start=1
                     /product="iron-sulfur assembly protein 2"
                     /protein_id="XP_022678337.1"
                     /db_xref="GeneID:34718480"
                     /translation="MMLGSRLFARCRGTLGAVPLRYGVSRVSGTPRSINVVRWQSSMD
                     SPIKPAKIINAVPDLHFSITNRAANRLADIYKTSHEILRVTVESGGCHGFQYNLKLVP
                     ESDKKGVEEAEGASENQNDDDLEDDFDDVKDIVYVLPDSNAQVVIDEQSLKILNNTTL
                     TYTTELIGSTFKITGGNMTSSCGCGSSFGLDEQAL"
     gene            complement(<639188..>639802)
                     /locus_tag="KLMA_80288"
                     /db_xref="GeneID:34718481"
     mRNA            complement(<639188..>639802)
                     /locus_tag="KLMA_80288"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822037.1"
                     /db_xref="GeneID:34718481"
     CDS             complement(639188..639802)
                     /locus_tag="KLMA_80288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678338.1"
                     /db_xref="GeneID:34718481"
                     /translation="MSYSERWYFYDSPDGMRIDTLDDDLRVFCTVEVADYNGIQGIWV
                     TDESNEEIKMFLSELVCCGTTRDDNRITKVLSKHKVFLVPHVFRNDEIYDLIPRLAPL
                     DSEILKVDYSVSETRLLNQFQIEIRPGDFPEGQGSLPRLLSEKFGIVDTLPIKAVSVA
                     SQRTTLTPMHLEQPGPSSSSSRAAGCLVVLEYLFTHTSSLHHHK"
     gene            <640198..>642888
                     /gene="AIM3"
                     /locus_tag="KLMA_80289"
                     /db_xref="GeneID:34718482"
     mRNA            <640198..>642888
                     /gene="AIM3"
                     /locus_tag="KLMA_80289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822038.1"
                     /db_xref="GeneID:34718482"
     CDS             640198..642888
                     /gene="AIM3"
                     /locus_tag="KLMA_80289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678339.1"
                     /db_xref="GeneID:34718482"
                     /translation="MSNFWENNKGTIVSGLATAGKYSYKGTKVVAKAGYQAGKTQYKN
                     SQARRKNGHGNSNGTGSDSEYYGDSTSSMSSSVKDPSSFPPPPLRAGQKQISADGNVV
                     EAVDAPIVYQSSPVATGQNHASAQTMPNQQYSYQRSPLPQPPQPQPTYYNQAPQGPQG
                     PQGPQGPQGPSLYGNQPPQPPQPPQPPQPSYGYQAPQGPQGPQGPQGPQGPSLFGSQP
                     PQPPQPPQPPQPPQPGQPSYGYQTGQAPAALAAPPEPPAPAAPQAPPAPPAPQAPQQQ
                     LPARNYQVNDGTNQAQMYYEQKAFQPQPIAMQFQQQPPPEYQLSSGQPETQQYYNQQQ
                     GAYQQMYQPQAVQPQQSHQPVMQQSPSMVAARPNLSNKPDSDPVMGGNYAQPNNISSS
                     STPSSITVKPYVWMDPEERKEKEKIELPQVNPEAVNLPPPLHRDRSTSSSLQSSSRDA
                     SVLERGKSSSPGVSSYHSSQTRGPDNDEKKPTEGIAGVYHASSVSFPPPPKPTSSSTL
                     SQQNSGQHSSSGKVPPAVPSKPKISQGPTYRSTGVNKSNENAPKAAVLGAYNSNVEVG
                     FAPPPKPHRAVEQQQQPTAGSSRGPPPPVPGRSSEVNSTSAKNGAGAGARGGAAGAYN
                     SNVEVGFAPPPKPHRSVAEPPTATRTSAMPAVGATPATPATPATPATPATPATPATEA
                     TPANSAAGVYNSNVDVGFAPPPKPYRRAPSPSASVSTTSSASSGSFRQPNTTTTQNPA
                     LPRRHTTQNSAPAPAPAPAPQLPSRTFEPLPRYSTIESIPPVYDDLEQALQARGGPEG
                     AGPTPASKKTGKKAPPVVPKKKDSLRTSTNGPPPVPAKKSSLSRMSTTFLDTPSTTGA
                     SASASASATTEDPDSDDDMNSFKTYLKKAVPAQNDHIHKY"
     gene            complement(<642980..>643423)
                     /gene="CMD1"
                     /locus_tag="KLMA_80290"
                     /db_xref="GeneID:34718483"
     mRNA            complement(<642980..>643423)
                     /gene="CMD1"
                     /locus_tag="KLMA_80290"
                     /product="calmodulin"
                     /transcript_id="XM_022822039.1"
                     /db_xref="GeneID:34718483"
     CDS             complement(642980..643423)
                     /gene="CMD1"
                     /locus_tag="KLMA_80290"
                     /codon_start=1
                     /product="calmodulin"
                     /protein_id="XP_022678340.1"
                     /db_xref="GeneID:34718483"
                     /translation="MSQNLTEEQIAEFKEAFALFDKDNSGSISASELATVMRSLGLSP
                     SEAEVADLMNEIDVDGNHAIEFSEFLALMSRQLKTNDSEQELLEAFKVFDKNGDGLIS
                     AAELKHVLTSIGEKLTDAEVDEMLKEVSDGSGEINIKQFAALLSK"
     gene            <643879..>645426
                     /gene="ALG1"
                     /locus_tag="KLMA_80292"
                     /db_xref="GeneID:34718484"
     mRNA            <643879..>645426
                     /gene="ALG1"
                     /locus_tag="KLMA_80292"
                     /product="chitobiosyldiphosphodolichol
                     beta-mannosyltransferase"
                     /transcript_id="XM_022822041.1"
                     /db_xref="GeneID:34718484"
     CDS             643879..645426
                     /gene="ALG1"
                     /locus_tag="KLMA_80292"
                     /codon_start=1
                     /product="chitobiosyldiphosphodolichol
                     beta-mannosyltransferase"
                     /protein_id="XP_022678341.1"
                     /db_xref="GeneID:34718484"
                     /translation="MIRSEKFKKKKKKKKKTLQAVPVKYNAQTNTGSSTGTTAKCTLY
                     WQVWQVWQVSVSYGSSIGADMSWLYFESVPRWVWWLLAVYVATPFVVYVVQPYLFYAG
                     KSTKKRIMILVLGDLGHSPRILYHARSFSEAGFQVELCGYVDSDIPKDILAEDAIELH
                     ALKKCSTFRGGLIGKALVQGVQLCLMFWEMRGVDYILLQNPPTIPVLPIAVVVKTFTR
                     AKLIIDWHNLGYSILQMKFNGNFWHPLYVVAYVIERVFSRFANYHLTVTAAMRTYLIS
                     KFGINASKIAVLYDRPGSQFRPLKDGDGVEARAELLREPFIEKLVPPEFDPAKDKIFV
                     TSTSFTPDEDISVLIGALKIYENSYRKFDHTLPRILCFITGKGPMKDKIVKQVEDYKW
                     DRVHIEFVWLSSEDYPKLLRLCDYGVSLHTSSSGLDLPMKILDMFGSGLPVICMNYPV
                     LDELVQQNVNGLKFADRRELHEALIFAVKDEKVQKQIKEGALQESKSRWEQSWESALS
                     QLKIIHK"
     gene            complement(<645417..>646730)
                     /gene="HOS1"
                     /locus_tag="KLMA_80293"
                     /db_xref="GeneID:34718485"
     mRNA            complement(<645417..>646730)
                     /gene="HOS1"
                     /locus_tag="KLMA_80293"
                     /product="histone deacetylase HOS1"
                     /transcript_id="XM_022822042.1"
                     /db_xref="GeneID:34718485"
     CDS             complement(645417..646730)
                     /gene="HOS1"
                     /locus_tag="KLMA_80293"
                     /codon_start=1
                     /product="histone deacetylase HOS1"
                     /protein_id="XP_022678342.1"
                     /db_xref="GeneID:34718485"
                     /translation="MKFFICTSAFQSQVADLLPCNNGQKSQLIYTLLRSYKLLEHFND
                     VIGTSLAGIEDMKRFHSEKYLKLILNQDYSIDDQDSNPVLQLADIARRFYQNSGTDVE
                     EHWFDNEHDLYRYYAASFVGESDEDSKEEYLEEVDSELLEKYGLQHDCPLFPYLSMYV
                     QVITGATLSLLQFTQREVPSIAINWDGGRHHALKEYASGFCYVNDIVLLIQSLRRKGW
                     NKVTYVDFDLHHGDGVAKALQFSKNIQTISVHLYESGFFPGTGSLNETRNAKEMVNVP
                     VLHGMDDEYLKELMCKIVNPLVESFDADCIVIQCGADGLGGDKYNEWQLTIGGLTQAI
                     ISVMRLFKHKQIFLLGGGGYNPLLVARFYTFLTAKVLETFGDIPCAIDENDEDLLIRD
                     HEFIELYEKENYRYWSYDNEGELKRGLRNDNKKSYVQELKEFYHL"
     gene            complement(<647158..>648039)
                     /gene="SPE3"
                     /locus_tag="KLMA_80294"
                     /db_xref="GeneID:34718486"
     mRNA            complement(<647158..>648039)
                     /gene="SPE3"
                     /locus_tag="KLMA_80294"
                     /product="spermidine synthase"
                     /transcript_id="XM_022822043.1"
                     /db_xref="GeneID:34718486"
     CDS             complement(647158..648039)
                     /gene="SPE3"
                     /locus_tag="KLMA_80294"
                     /codon_start=1
                     /product="spermidine synthase"
                     /protein_id="XP_022678343.1"
                     /db_xref="GeneID:34718486"
                     /translation="MSELTHPTIVDGWFREISDTMWPGQAMTLRVEKILHHEKSKYQD
                     VLVFKSTDYGNVLVLDNVIQVTERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVL
                     REIVKHESVEEAWLCDIDEAVIRVSKEYLPEMAKSYSHPKVKTHIGDGFQFLRDYQNT
                     FDVIITDSSDPEGPAASLFQQSYFELLSSALTEKGVISTQAESMWIHLPIIKDLKKAC
                     KEVFPSVGYAFTTIPTYPTGQIGFMVCSKDPNVDVTKPLRSISDEEEDSRYRYYNKKV
                     HEAAFVLPTWVAKELDL"
     gene            <648887..>650188
                     /gene="MED1"
                     /locus_tag="KLMA_80295"
                     /db_xref="GeneID:34718487"
     mRNA            <648887..>650188
                     /gene="MED1"
                     /locus_tag="KLMA_80295"
                     /product="mediator of RNA polymerase II transcription
                     subunit 1"
                     /transcript_id="XM_022822044.1"
                     /db_xref="GeneID:34718487"
     CDS             648887..650188
                     /gene="MED1"
                     /locus_tag="KLMA_80295"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 1"
                     /protein_id="XP_022678344.1"
                     /db_xref="GeneID:34718487"
                     /translation="MSDTFVETLNEMIQMLLNYKPGNRTLSNVIKLCQTLGLESFVDQ
                     VDTNKSRLSIASNIVVIDIDYENEMETILDVKLVLASNFDKFNYFNEQGENILLTSLS
                     NVQDLKAFHHNLNFLVFLDSFSNIDIESGHTSLDLFKYYSDLPKMLQDYLQDQHLPFQ
                     VKVNENSTFGIVIYDANGENAIGTVCLERAPNSDSPFYEYIYDPKLKEWVNESSDAST
                     QGINLVLKFADVIGFPETWITQELRVDNSTPLKTFAIPQQPQLKNSVKLQNELTSELL
                     LMDTFRISNEDISLLPDFLKWYLWHKLVLEEMLKAITLDPSSSGNALNAGNSGTMQAK
                     PRRRSSIMGNRKPSMSESMMLRDSGISQFTLKEIMDQPAVSDTEGDDMMDIDNDDNNK
                     LVCITLNEEYICVGKTQKCSYQDDSQETWVSVIEFLKSKLL"
     gene            650404..650487
                     /locus_tag="KLMA_R813"
                     /db_xref="GeneID:34718799"
     tRNA            650404..650487
                     /locus_tag="KLMA_R813"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:34718799"
     gene            complement(<650665..>651339)
                     /gene="YSA1"
                     /locus_tag="KLMA_80296"
                     /db_xref="GeneID:34718488"
     mRNA            complement(<650665..>651339)
                     /gene="YSA1"
                     /locus_tag="KLMA_80296"
                     /product="ADP-ribose pyrophosphatase"
                     /transcript_id="XM_022822045.1"
                     /db_xref="GeneID:34718488"
     CDS             complement(650665..651339)
                     /gene="YSA1"
                     /locus_tag="KLMA_80296"
                     /codon_start=1
                     /product="ADP-ribose pyrophosphatase"
                     /protein_id="XP_022678345.1"
                     /db_xref="GeneID:34718488"
                     /translation="MYKSRVLQLITRRTFNMSKNKPELAKLLSSRPVTNTEECKWIGL
                     TKLTYQDPNGKTREWDSAIRMTRSEGGVDGVGILAILRFKDKPDEILLQKQFRPPVEG
                     VCIEMPAGLIDGGEDIETAAMRELREETGYVGKILHSSPVIFNDPGFTNTNLSLVTVL
                     VDMSLPENQNPVTELEENEFIECFSVPLASMADELAKLDKEGYKLDARVQNVALGIKI
                     AQDFRL"
     gene            complement(<652347..>655760)
                     /gene="CYC8"
                     /locus_tag="KLMA_80297"
                     /db_xref="GeneID:34718489"
     mRNA            complement(<652347..>655760)
                     /gene="CYC8"
                     /locus_tag="KLMA_80297"
                     /product="general transcriptional corepressor CYC8"
                     /transcript_id="XM_022822046.1"
                     /db_xref="GeneID:34718489"
     CDS             complement(652347..655760)
                     /gene="CYC8"
                     /locus_tag="KLMA_80297"
                     /codon_start=1
                     /product="general transcriptional corepressor CYC8"
                     /protein_id="XP_022678346.1"
                     /db_xref="GeneID:34718489"
                     /translation="MLNSMSGPAMAVSLQQQQQQQQQQQQQQQQQHMMPGLPHNMNGS
                     QMPLQLQTQGQTPGQGQNQGQTQGQGQGQTTGQDKNGLAPGQDQSQLPMEVRAQDLLP
                     MKQPAKPLDPLAQSTAETWLSIASLAETLGDADRAAMAYDATLQHNPSSTKALTSLAH
                     LYRSRDMFQRAAELYQRALSVNPEMGDIWATLGHCYLMLDELQSAYAAYQQALYHLSN
                     PNIPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWN
                     QALECFRYILPQPPAPLQEWDVWFQLGSVLESMGEWQGARDAYEHILSQNDRHAKVLQ
                     QLGCLYGMNNVSFYDPQKALNLLLKSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQ
                     QAVNRDSRNPTFWCSIGVLYYQIAQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCN
                     NQVNDALDAYKQAARLDPNNIHIRERLDALTAQIMNQQHQGNDQQQKADQHQQNTLPL
                     PPQLHHQQQQQQQPQQHQLSHQLVQQQQQQQQQPVMLQPSLANNSQLFNPLNKQSNSQ
                     DPGNGQQYHQQPQFQSTSMAPVLQRNEQPQLLHVQQAQQQAQAQQLQQAHQLQQAQQL
                     QQAQAQAQAQQLQQAQAQQLQQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
                     QAQAQAEAQAQAQQAQAQQAQAQAEAQAQAQAQAQAQAEAEAQAQAQAQAQAQAEAQA
                     RVQAQAQAQAQAEAQQAQQAQAQAQAEALQLQQAQAQAQQAEAEAQAQAQAQQQQPNQ
                     QTEEAQQLSAQPQVPNQQSLPAQPVAQSSGESKIEEGQKQQPSTTQQVAVSENLEKTI
                     PQKRPLEGGMNTLFNAISQQEEQQKIQKAAEAQNVEATSSSTSTNQTTNSVSSLISPP
                     EPKEQVNETAPADSKDDNSSAVTQTEDAKIGLSTSETPVTNEVTQEAQTSEKSSETAS
                     ASETKQIQDPSVLSPAGTKEPSSTDIEEKKVESNENSTNSNAQTSENEEKKNEAEITT
                     NSKDEFNVDTSKNIVDNNTVTTSTDSITKNESEMDSQDEPALKKQKVDTEETVIKPSA
                     DAIEIIKEQEKLRQEEENEKLDKEDKTVEPSIPKEKVIRQVEEDEDYDD"
     gene            <657212..>659461
                     /gene="RAD16"
                     /locus_tag="KLMA_80298"
                     /db_xref="GeneID:34718490"
     mRNA            <657212..>659461
                     /gene="RAD16"
                     /locus_tag="KLMA_80298"
                     /product="DNA repair protein RAD16"
                     /transcript_id="XM_022822047.1"
                     /db_xref="GeneID:34718490"
     CDS             657212..659461
                     /gene="RAD16"
                     /locus_tag="KLMA_80298"
                     /codon_start=1
                     /product="DNA repair protein RAD16"
                     /protein_id="XP_022678347.1"
                     /db_xref="GeneID:34718490"
                     /translation="MTAEEGGFIRKRQTRASTRTRSRTAKKNVVYVVESGSDSENEPL
                     VKGEDQEFQDEKVPIVEVLSSSSDEDEPLQESKPKRKKRQASKKQKEKKPKLTPFERN
                     TAKLFEQHPELVNVFKKLQEEPPRPVQRAPQPDGMAVRLLPFQLEGLHWLQQQEDSEY
                     NGGVLADEMGMGKTIQTIGLLMSDVTKRPSLVVAPTVALMQWKNEIQQHTNGQLSVYM
                     YHGANRTTNIGDFKGVDVVLTTYAVLESVYRKQVYGFKRKAGTVKEMSVLHSIDFYRV
                     ILDEAHNIKDRQSNTAKAVNTLKTQKRWCLSGTPLQNRIGEMYSLIRFLNIEPFTRYF
                     CKACPCNSENWQFSDYLHCDKCGHVGMQHTNFFNHFMLKNVQKHGIEGPGLESFQNIQ
                     TLLGKIMLRRTKVERADDLGLPPRIVTVRKDFFNDEEKDLYKSLYSDVKRKYNSYVEE
                     GVVLNNYANIFTLITRMRQMADHPDLVLKRLHDSNGNSNSTGVIICQLCDDEAEEPIE
                     SKCHHKFCRLCINEYIDSFMADEKKLTCPVCHIGLSIDLQQPALEVDEEMFKKQSIVS
                     RLNMGGKWRSSTKIEALVEELYNLRSDKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTV
                     KLQGSMTPTQRDQTIKYFMENIHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVE
                     WQSGDRVHRIGQFRPVKITRFCIEDSIESRIIELQEKKASMIHATINQDEAAINRLTP
                     ADLQFLFNN"
     gene            complement(<659594..>663754)
                     /gene="LYS2"
                     /locus_tag="KLMA_80299"
                     /db_xref="GeneID:34718491"
     mRNA            complement(<659594..>663754)
                     /gene="LYS2"
                     /locus_tag="KLMA_80299"
                     /product="L-aminoadipate-semialdehyde dehydrogenase"
                     /transcript_id="XM_022822048.1"
                     /db_xref="GeneID:34718491"
     CDS             complement(659594..663754)
                     /gene="LYS2"
                     /locus_tag="KLMA_80299"
                     /codon_start=1
                     /product="L-aminoadipate-semialdehyde dehydrogenase"
                     /protein_id="XP_022678348.1"
                     /db_xref="GeneID:34718491"
                     /translation="MTALSAWASKLDNPTISVLPHDYLRPQQEPFVKQDELAFQLPQL
                     EAASANSNSSAYEIVLAAWASLIYRLTGDDDIVLLVRDGKVIRFTIQPTWSFEELCKT
                     VSEELAAVASLDSVDFDELSQHIKTQNELEVQPQLFRLGFVTEPGFSLATYKSSILDV
                     ALTLTGNQAQIVYNSLLYSKDRIAILADQITQFVSQVLENPQDIITKVSLITSSSESI
                     IPDPTKNLGWCDFRGCIHDIFQDNAEKFPERTCVVETPATGSNESRVFTYKDINYASN
                     IVAHYLINTGIKRGDIVMIYSSRGVDLMVCVMGVLKAGATFSVIDPAYPPVRQTVYLD
                     VAKPKGLIVIKAAGTLDQFVEDFITEKLNVVSRIPSIAIQNDGSILGGKLPQQDQDCL
                     APYEHLKTKRTGIVVGPDSNPTLSFTSGSEGIPKGVLGRHFSLAYYFDWMAKEFNLSE
                     NDKFAMLSGIAHDPIQRDMFTPLFLGAQLLVPTQDDIGTPGQLASWMAKYGATVTHLT
                     PAMGQLLAAQATTPFPKLHHAFFVGDILTKRDCLRLQTLAENVNIVNMYGTTETQRAV
                     SYFTVKSRSEDANFLKKLKDVIPAGKGMYNVQLLVVNRYDRSQICGVGEVGEIYVRAG
                     GLAAEYRGLPELNKEKFVNNWFVEEGHWKSLDKDNGEPWREFWLGPRDRLYRTGDLGR
                     YLPDGNTECCGRADDQVKIRGFRIELGEIDTHISQYPLVRENITLVRNNSDNEKTLIT
                     FMVPRFDKPDELSKLSSDVPEGVANDPVVSGMIRYRHLVKDIKEFLKKRLASYAIPTV
                     IIVLNKLPLNPNGKVDKPKLQFPTVKQLNLVAENSSVEVNDADFTKTEKEVRDLWLGV
                     LPSRPASISPEDSFFDLGGHSIIATRMIFGLRNTLQVDLPLGTIFKYPTIRAFAGEID
                     RVKNSGLSSSDEVKTADYANDAKQLTESLLPKRFESRDALISSSANTGKTDLNVFVTG
                     VTGFLGSYILADLLNRPTDSFSIKVFAHVRAKSEEAGLERLKQAGITYGTWSDKFTDK
                     IEVVLGDLSKEKFGLDTEKWSKLTDQIDVIIHNGALVHWVYPYSKLRDPNVISTINVM
                     SLASSGKAKYFTFVSSTSTIDTEHYFSLSDKLVAEGKTGILESDDLSGSATGLTSGYG
                     QSKWAAEYIIRRAGERGLRGCIVRPGYVTGNSSNGSSNTDDFLLRFLKGVVQLGKIPD
                     IENTVNMVPVDHVARVVTATAFNPPNEKELVVAHVTGHPRILFKDYLYQLKKYGYNVE
                     VQPYSEWKISLEHSVISRGEENALYPLLHMCLDGLPENTRAPELDDTNATLSLKKDEK
                     LTHVDVSSGKGATPEQIGIYIAFLNKVGFLPPPPSKGELSLPEVSLSEEQIKLVSSGA
                     GARSSAAA"
     gene            <664649..>666445
                     /gene="NOT5"
                     /locus_tag="KLMA_80300"
                     /db_xref="GeneID:34718492"
     mRNA            <664649..>666445
                     /gene="NOT5"
                     /locus_tag="KLMA_80300"
                     /product="general negative regulator of transcription
                     subunit 5"
                     /transcript_id="XM_022822049.1"
                     /db_xref="GeneID:34718492"
     CDS             664649..666445
                     /gene="NOT5"
                     /locus_tag="KLMA_80300"
                     /codon_start=1
                     /product="general negative regulator of transcription
                     subunit 5"
                     /protein_id="XP_022678349.1"
                     /db_xref="GeneID:34718492"
                     /translation="MSQRKLQQEVDKVLKKVKEGLEEYEEIYEKFQNTESDNQSYREK
                     LESDLKREIKKLQKHREQIKNWLSKDDIKDRADVLMENRRLIESGMERFKSIEKIMKT
                     KKFSTEALTNPDLIKDPRELKKRDQFLFVEECLEELQKQLDAFEVENNEEQIEKHTFH
                     ISNLENILKLLQNDDLDPETVQDFQEDIRYYVDNNDDPDFVDYDTIYQDMGCEIQPED
                     LLKEQSTPSKPKRSERSPRKKASPAPASLKSSTSSPRVTATSTVPSAQQQQESDNQDN
                     ASGAADTSDAATAAATAAAAAASNSSSAQNNDTNNDEKGNSNVDESNNASSKGTDSPS
                     SAAVAAAVAATNGSAQSAGSTSATQTTTTPTTSSSTKSKKDKEPTPIPQAEDLPPPKD
                     LSQEIEEILAKDLENKLAFKDPLFKEELPYWLETKKKLIQPPKEIDDFTLKHLESSLL
                     NCPDSLDADTPRLFENPLSLPHPTSIFFPHEPIRFMAQDLPAKGDDLYGKISVAKIMS
                     KFALDTLFFIFYHYQGSYDQFLASRELSLRGWKFNKVNHCWFHKEVEKLPPGIEGKEE
                     VTWRYFDYQKAWLSRRCGADFEYKEEEFEKLW"
     gene            complement(<666622..>667098)
                     /gene="LTP1"
                     /locus_tag="KLMA_80301"
                     /db_xref="GeneID:34718493"
     mRNA            complement(<666622..>667098)
                     /gene="LTP1"
                     /locus_tag="KLMA_80301"
                     /product="low molecular weight phosphotyrosine protein
                     phosphatase"
                     /transcript_id="XM_022822050.1"
                     /db_xref="GeneID:34718493"
     CDS             complement(666622..667098)
                     /gene="LTP1"
                     /locus_tag="KLMA_80301"
                     /codon_start=1
                     /product="low molecular weight phosphotyrosine protein
                     phosphatase"
                     /protein_id="XP_022678350.1"
                     /db_xref="GeneID:34718493"
                     /translation="MTVKLSVAFVCLGNICRSPMAEAVFKHTVKQKGLEDRFERIESF
                     GTAGYHVGEDPDPRSSATCRKHGVPVSHSAQQIKAKHFDEFDYIICMDESNLRNLKRL
                     QPKNSKAQVSLFGKWNTDGKFREIVDDPYYGGNEGFEYNFKQVQYFSEQFLEKELK"
     gene            complement(<667466..>669505)
                     /gene="TKL1"
                     /locus_tag="KLMA_80302"
                     /db_xref="GeneID:34718494"
     mRNA            complement(<667466..>669505)
                     /gene="TKL1"
                     /locus_tag="KLMA_80302"
                     /product="transketolase"
                     /transcript_id="XM_022822052.1"
                     /db_xref="GeneID:34718494"
     CDS             complement(667466..669505)
                     /gene="TKL1"
                     /locus_tag="KLMA_80302"
                     /codon_start=1
                     /product="transketolase"
                     /protein_id="XP_022678351.1"
                     /db_xref="GeneID:34718494"
                     /translation="MSQYSDIDRLAINTIRLLSVDQVASANSGHPGAPLGLAPAAHVV
                     WKQMRLNPKNPEWINRDRFVLSNGHACALLYSLLHLFGYDFSIEDLKQFRHLGSKTPG
                     HPEFELPGVEVTTGPLGQGISNAVGLAIAQANFAATYNKPDFELSDSFTYVFLGDGCL
                     QEGVSSEACSLAGHLKLKNLIAFYDDNKITIDGNTNVSFDEDVGKRYEAYGWEVLSVE
                     NGNDDLDSISKALEQAKRSDKPTLIKLVTTIGFGSLQAGTHAVHGAPLKADDIKQLKT
                     KFGFNPEESFVVPQEVYDLYNKSTIEPGIEANNKWNALFEAYSAKFPELGAEIKRRLA
                     GELPTGWENKLPTYTPKDSAVASRKLSELLLQNIFEDIPELIGGSADLTPSNLTRTKE
                     VVDFQAPSSGLGDYTGRYIRYGVREHGMGAIMNGISAFGANYKPYGGTFLNFVSYAAG
                     ALRLSALSGHPVIWVATHDSIGLGEDGPTHQPIETLAHFRALPNLQVWRPADGNEVSA
                     AYKVALKSKHTPAVIALSRQNLPQLEGSSIEKAAKGGYVLQDVEQPDIAIVSTGSEVG
                     IAVEAAKVLAEKNIKARIVSLPDFHTFDQQPKEYQLSVLPDGVPILSVEVLSTSGWAK
                     YSHQQFGLNRFGASGKGPAVYEKFDFTPQGIASRAEKTVEFYKGKQVYSPLNTAF"
     gene            complement(<670369..>671715)
                     /locus_tag="KLMA_80303"
                     /db_xref="GeneID:34718495"
     mRNA            complement(<670369..>671715)
                     /locus_tag="KLMA_80303"
                     /product="protein OPY2"
                     /transcript_id="XM_022822053.1"
                     /db_xref="GeneID:34718495"
     CDS             complement(670369..671715)
                     /locus_tag="KLMA_80303"
                     /note="overproduction-induced pheromone-resistant protein
                     2"
                     /codon_start=1
                     /product="protein OPY2"
                     /protein_id="XP_022678352.1"
                     /db_xref="GeneID:34718495"
                     /translation="MSENSSSSSSSSTSTSSSSAANSSDASKSPDSSSSSSLQNGCVS
                     CDNNVSCPKCADDEYCVTTSLTCTQCPRTYCEKKASSSSGGGSSPASSSLIASPSSSS
                     SSSSNKVGPIVGGVVGGVAGVLIIAVLAFMYYRYYKRKRSALPPDSEYMEKDMHPVVS
                     GGGSPLHPGMLRSGSTNSAHVRARNKRNRSSAATIQTSTASNIIPVAYIPGVTTNLTK
                     KNLRKGPGRGGRKFYQDSDRKSHITLGSSILGDDDDDDDDVDNVDSVRAAATGDKGRD
                     SPGSDGPNLTTAIRARPKLVQIDELAEEEGEEHEQEQGQNQGQEQRQGQRQGQSQGRS
                     QEQRQQEYRQDAAGGSAGGSAGQLSNIQDTSLIGTAGHSNSVLDIEQRQSYAQSHADA
                     ENRDIRRDSYNTMGSYAISESRDPFHSRLSVSSDSNSEGSFILDVEIASNHNHGHS"
     gene            complement(<673138..>673365)
                     /locus_tag="KLMA_80304"
                     /db_xref="GeneID:34718496"
     mRNA            complement(<673138..>673365)
                     /locus_tag="KLMA_80304"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822054.1"
                     /db_xref="GeneID:34718496"
     CDS             complement(673138..673365)
                     /locus_tag="KLMA_80304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678353.1"
                     /db_xref="GeneID:34718496"
                     /translation="MTRRVPLGYPKRTNDWRDGAHCRGITSGVTTDRRGRFAEVPRKT
                     RIQEYKNTRMHTQNKSRDQHPRKSNKQTDSK"
     gene            <673649..>674494
                     /locus_tag="KLMA_80305"
                     /db_xref="GeneID:34718497"
     mRNA            <673649..>674494
                     /locus_tag="KLMA_80305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822055.1"
                     /db_xref="GeneID:34718497"
     CDS             673649..674494
                     /locus_tag="KLMA_80305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678354.1"
                     /db_xref="GeneID:34718497"
                     /translation="MQINSSPLKEDQLSFDERSVRQTAENLIESVKNWKKGKCYKFSL
                     NADNCTEDSKCEVQTYGQTIDGDYWLCRQSQHKISPENYRRFVQVLNGSKWDADAQKW
                     VLADRAARSKMEQQYIETLSKCRVEKLVPPVKEGEEEEEEQQQQPPLDQTVPFGWVLV
                     NLEYELGKPLATREFNEWVCPLLPATVTAPGAGAGAGAGPALETSYVVSAVADHPIRD
                     PVHHTHAYYASVEQLKYDHSSHVLVWTMCTTSDAGGNVPKWIQNATIARTVAKDVPYL
                     INWLK"
     gene            <676009..>677064
                     /gene="ADH3"
                     /locus_tag="KLMA_80306"
                     /db_xref="GeneID:34718498"
     mRNA            <676009..>677064
                     /gene="ADH3"
                     /locus_tag="KLMA_80306"
                     /product="alcohol dehydrogenase 3"
                     /transcript_id="XM_022822056.1"
                     /db_xref="GeneID:34718498"
     CDS             676009..677064
                     /gene="ADH3"
                     /locus_tag="KLMA_80306"
                     /codon_start=1
                     /product="alcohol dehydrogenase 3"
                     /protein_id="XP_022678355.1"
                     /db_xref="GeneID:34718498"
                     /translation="MASVAIPEKQKGVIFYENGGKLEYKDIPVPKPKPNEILINVKYS
                     GVCHTDLHAWKGDWPLATKLPLVGGHEGAGVVVAMGENVKGWEIGDYAGIKWLNGSCM
                     SCEFCELSNESNCPDADLSGYTHDGSFQQYATADAVQAARIPKGTDLAEIAPILCAGV
                     TVYKALKTAGLKAGDWVAISGAAGGLGSLAVQYAKAMGYRVVGIDGGEEKGKLAKQLG
                     AEAFVDFTKTKDMIGEIQEITNGGPHGVINVSVSEAAMNASTQYVRPTGTVVLVGLPA
                     GAVIKSEVFSHVVKSIAIKGSYVGNRADTREAIEFFAAGKVKSPIKVVGLSELPKVYE
                     LMEQGKILGRYVVDTEK"
     gene            complement(<677635..>678057)
                     /locus_tag="KLMA_80307"
                     /db_xref="GeneID:34718499"
     mRNA            complement(<677635..>678057)
                     /locus_tag="KLMA_80307"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822057.1"
                     /db_xref="GeneID:34718499"
     CDS             complement(677635..678057)
                     /locus_tag="KLMA_80307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678356.1"
                     /db_xref="GeneID:34718499"
                     /translation="MESLFTKIDSIEDEIILQDPEWVSELHEDNSSKKWKTFKSVFKK
                     TKSFDMNSGLSVDSQMIKSKDFVLDMNKPGGSPTFGEVQEPFESYVSELKPNKSIKEK
                     YQLISGLSKKYHLSTPKFEDMGKGSLSLFWDYLRGKTH"
     gene            <678912..>679961
                     /gene="MRL1"
                     /locus_tag="KLMA_80308"
                     /db_xref="GeneID:34718500"
     mRNA            <678912..>679961
                     /gene="MRL1"
                     /locus_tag="KLMA_80308"
                     /product="mannose 6-phosphate receptor-like protein 1"
                     /transcript_id="XM_022822058.1"
                     /db_xref="GeneID:34718500"
     CDS             678912..679961
                     /gene="MRL1"
                     /locus_tag="KLMA_80308"
                     /codon_start=1
                     /product="mannose 6-phosphate receptor-like protein 1"
                     /protein_id="XP_022678357.1"
                     /db_xref="GeneID:34718500"
                     /translation="MSIALRSYKLVIGLIVLLGLTGIIEVFLNSSLNTLNDGNSKLDP
                     KPITSPGHDGDNGRGDNGGDDDESLPFCSVVNPITGSFIDLSWLSSNPNESPNGGDRN
                     RQDQSKTRWLVKGWEYNTNFTLGICSSSVGKELEDKLSDTTGAYYVDHNKPDHFISIG
                     EYSSKPRFTGKKLTLTYENGDTCPNGVDKKSTLINFICDKEVPTKAQVSFVGQLHNCS
                     YFFEVRSVHACPISNVGNDINAVGIFASIVIVFLLIEIMRRVVYELLVVERRRHIDMD
                     NMDEVVRWANAEQEPLWKRVLKGIPLFSEKRNSRQAVRLRTRENTALSIDMEQQNELL
                     DSLDVDADADADSTD"
     gene            <681653..>683029
                     /gene="TEF"
                     /locus_tag="KLMA_80309"
                     /db_xref="GeneID:34718501"
     mRNA            <681653..>683029
                     /gene="TEF"
                     /locus_tag="KLMA_80309"
                     /product="elongation factor 1-alpha"
                     /transcript_id="XM_022822059.1"
                     /db_xref="GeneID:34718501"
     CDS             681653..683029
                     /gene="TEF"
                     /locus_tag="KLMA_80309"
                     /codon_start=1
                     /product="elongation factor 1-alpha"
                     /protein_id="XP_022678358.1"
                     /db_xref="GeneID:34718501"
                     /translation="MGKEKSHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK
                     EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNM
                     ITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAYTLGVRQLIVAINKMDSVKW
                     DESRYQEIVKETSNFIKKVGYNPKNVPFVPISGWNGDNMIEATTNAPWYKGWEKETKA
                     GTVKGKTLLEAIDAIEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVV
                     TFAPAGVTTEVKSVEMHHEQLEEGLPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKA
                     AASFNATVIVLNHPGQISAGYSPVLDCHTAHIACKFDELLEKNDRRSGKKLEDSPKFL
                     KSGDAALVKFVPSKPMCVEAFSDYPPLGRFAVRDMRQTVAVGVIKSVEKTDKAGKVTK
                     AAVKAGKK"
     gene            <683599..>684474
                     /gene="MUD1"
                     /locus_tag="KLMA_80310"
                     /db_xref="GeneID:34718502"
     mRNA            <683599..>684474
                     /gene="MUD1"
                     /locus_tag="KLMA_80310"
                     /product="U1 small nuclear ribonucleoprotein A"
                     /transcript_id="XM_022822060.1"
                     /db_xref="GeneID:34718502"
     CDS             683599..684474
                     /gene="MUD1"
                     /locus_tag="KLMA_80310"
                     /codon_start=1
                     /product="U1 small nuclear ribonucleoprotein A"
                     /protein_id="XP_022678359.1"
                     /db_xref="GeneID:34718502"
                     /translation="MVNTLYLSNLPPRPDSFNKFKDILLSTINPSYRAGDSDSRFSLK
                     DAPNKDRVPCIDDSYQIVEISRYRSRKLKRSCFITFKDTENRDRFIKDFKDKLKVRGR
                     KVQIEVAKHESYAELYFNGELEQLKREVQAKKVNKEVSKGNAIVPATKLNRRLRRARS
                     KLRKKNLDEETIRRLLDGQKRPGQAKSSGNTAEGKGKTNDVKKASAKKVVEIISNPPH
                     NILLVQNLPKDITQGELEELFQSSGFKEVRLVGVRNLCFVEYNSSENATNVINRLGHE
                     YSLKDSIIKIGYAKK"
     gene            complement(<684661..>685131)
                     /gene="CBP6"
                     /locus_tag="KLMA_80311"
                     /db_xref="GeneID:34718503"
     mRNA            complement(<684661..>685131)
                     /gene="CBP6"
                     /locus_tag="KLMA_80311"
                     /product="cytochrome B pre-mRNA-processing protein 6"
                     /transcript_id="XM_022822061.1"
                     /db_xref="GeneID:34718503"
     CDS             complement(684661..685131)
                     /gene="CBP6"
                     /locus_tag="KLMA_80311"
                     /codon_start=1
                     /product="cytochrome B pre-mRNA-processing protein 6"
                     /protein_id="XP_022678360.1"
                     /db_xref="GeneID:34718503"
                     /translation="MSQASKESAKNLVRLLEKFPKERVKHLISFRETQLDRFKPLAGI
                     ETAKSSEQTKPSLSEIKDIINRTSGPLGLKKDLLKKVQEALPEEHFNEVEIQEQINSL
                     NAIMSNKYKTYYAVGDKLYKPAGNPNYYQRLDDEIAGKNKETLFTAMRTVVFGK"
     gene            complement(<685444..>687444)
                     /gene="GRS1"
                     /locus_tag="KLMA_80312"
                     /db_xref="GeneID:34718504"
     mRNA            complement(<685444..>687444)
                     /gene="GRS1"
                     /locus_tag="KLMA_80312"
                     /product="glycyl-tRNA synthetase 1"
                     /transcript_id="XM_022822063.1"
                     /db_xref="GeneID:34718504"
     CDS             complement(685444..687444)
                     /gene="GRS1"
                     /locus_tag="KLMA_80312"
                     /codon_start=1
                     /product="glycyl-tRNA synthetase 1"
                     /protein_id="XP_022678361.1"
                     /db_xref="GeneID:34718504"
                     /translation="MSVEEINAARKAVEFSRESLESVLKRRFFYAPAFELYGGVSGLY
                     DYGPPGCAFQANIVDVWRKHFVLEEDMLEVDTTMLTPYEVLKTSGHVDKFSDWMCKDP
                     KTGEIFRADHLVEEVLEARLKGDKEARGLASDANAEAQADADKKKRKKKVKEIKAVKL
                     DDAVVKEYEEILAKIDGYSGAELGELMVKYDIGNPVTGDKLEPPRAFNLMFETAIGPS
                     GQYKGYLRPETAQGQFLNFNKLLEFNNGKTPFASASIGKSFRNEISPRSGLLRVREFL
                     MAEIEHFVDPEDKSHKRFHEIKDIKLKFLPREVQQSGSTVPVETTIGEAVASKMIDNE
                     TLGYFIARIYLFLMKIGVNPDRLRFRQHMANEMAHYAADCWDAELHTSYGWIECVGCA
                     DRSAYDLTVHANKTKEKLVVREALEKPIQVTKWEATLVKKLFGPKFRKDAPKVEARLL
                     ALSQEELESYSAELKKNGKITLKVEGMDADAEVDDKMISIEKVTNTEHIREYVPNVIE
                     PSFGIGRIIYAVFEHSFWSRPEDTARAVLSFPPLVAPTKVLLVPLMNNPELSKITAEV
                     SKTLRKEQIPFKVDESGVSIGKRYARNDELGTPFGVTIDFDSVTDGSITLRERDSTKQ
                     VRGSVADVIKAIRDITYQGVSWEEGTKNLKPFNSQAEAETEA"
     gene            complement(<687921..>688352)
                     /gene="DIB1"
                     /locus_tag="KLMA_80313"
                     /db_xref="GeneID:34718505"
     mRNA            complement(<687921..>688352)
                     /gene="DIB1"
                     /locus_tag="KLMA_80313"
                     /product="spliceosomal protein DIB1"
                     /transcript_id="XM_022822064.1"
                     /db_xref="GeneID:34718505"
     CDS             complement(687921..688352)
                     /gene="DIB1"
                     /locus_tag="KLMA_80313"
                     /codon_start=1
                     /product="spliceosomal protein DIB1"
                     /protein_id="XP_022678362.1"
                     /db_xref="GeneID:34718505"
                     /translation="MGSVFLPHLHTGWHVDQAIVTEKERLVVIRFGTDSNKECMIMDE
                     ILYSIAEKVKNFAAIYLCDIQEVPDFNEMYELYDPMTVMFFYQNKHMMCDFGTGNNNK
                     MNFLVDDKQEMIDILETIFRGARKNKGLVVSPYDYSHKRVD"
     gene            complement(<688645..>689151)
                     /gene="MRPL36"
                     /locus_tag="KLMA_80314"
                     /db_xref="GeneID:34718506"
     mRNA            complement(<688645..>689151)
                     /gene="MRPL36"
                     /locus_tag="KLMA_80314"
                     /product="54S ribosomal protein L36"
                     /transcript_id="XM_022822065.1"
                     /db_xref="GeneID:34718506"
     CDS             complement(688645..689151)
                     /gene="MRPL36"
                     /locus_tag="KLMA_80314"
                     /codon_start=1
                     /product="54S ribosomal protein L36"
                     /protein_id="XP_022678363.1"
                     /db_xref="GeneID:34718506"
                     /translation="MLRTLITKRFASTGAYHGVNQVSLPKRPLRKIRLGKARPAIYYK
                     FDVQVELSDGSVITRRSQFPKNEIRLIQDQRNSPLWNQSRDGMVMMDANSSGRVDKFK
                     QKYGSVYSMEEPAPQTNSKSAKKTEKTPESNTEDDFCMDDYLSLLNSNATQVQKGGKM
                     ATKKRDKK"
     gene            complement(<689479..>691335)
                     /gene="TFC1"
                     /locus_tag="KLMA_80315"
                     /db_xref="GeneID:34718507"
     mRNA            complement(<689479..>691335)
                     /gene="TFC1"
                     /locus_tag="KLMA_80315"
                     /product="transcription factor tau 95 kDa subunit"
                     /transcript_id="XM_022822066.1"
                     /db_xref="GeneID:34718507"
     CDS             complement(689479..691335)
                     /gene="TFC1"
                     /locus_tag="KLMA_80315"
                     /codon_start=1
                     /product="transcription factor tau 95 kDa subunit"
                     /protein_id="XP_022678364.1"
                     /db_xref="GeneID:34718507"
                     /translation="MSESFPKAAITTPNNNDVGNKRLVYAREYTLDLPRISSVEVPLK
                     VSPSPESVAKAVSMCGGLSSIKKALQSQDDTGLELHLNLEEDENGASSFFNEHPIIGR
                     RVPNRDESILLKISLPKGTLAKHNNNLREAIASCSDQKKLRVVPVAIINNTIRFREMS
                     DFQIRLDNVPTAKEYNESFNSLNWDKFKDYVNSIPDFDTKPYENLSSMTVDRTSKIPS
                     RDWQLAPIPRFSMVNIPYIYKFRDNPYAKKSDTGESSVKGTYIKNFQQLVYDFNTQTG
                     IPTHPHPEIVRIFETAKETGVYPGTSKDFKFLEKLQSCLKILNELFEKRPIWVKRHID
                     GIVPLELHMTLKVALSLCSYRFTKGPWRNSYIKLGIDPRTSNEYAKYQTEYFKIERRL
                     LTDPRIKKNLPAPPPKDYQSSVPGEIDPRFEFDGKSIPWYLMLQIDLLLKEPNINEIY
                     SQVEFLPEANELTGWFNELDLTKIRKIVKYELGCMVQGNYEFNEHKLTFFKRMIYVKE
                     SMMKDQDADGDVDMDQDNDDNGVEDGEMDDALLEEAEDEEQEDAEDQAGESALKSEIS
                     DGKQDENSEPDTFDIKTASFNEVMDKIAKHNSESAEYLKDYLKGLVQESSLR"
     gene            complement(<691680..>692894)
                     /gene="PTC4"
                     /locus_tag="KLMA_80316"
                     /db_xref="GeneID:34718508"
     mRNA            complement(<691680..>692894)
                     /gene="PTC4"
                     /locus_tag="KLMA_80316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822067.1"
                     /db_xref="GeneID:34718508"
     CDS             complement(691680..692894)
                     /gene="PTC4"
                     /locus_tag="KLMA_80316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678365.1"
                     /db_xref="GeneID:34718508"
                     /translation="MGQLLSHPLTEKTIIYNDYSTTGNHHHHKAAEHNGSSATEDKPR
                     FSNCIGSMQGYRLTQEDAHMAVTGADSLDVSFYDPFLGKVERYQISVFGVFDGHGDNN
                     CSNYLAGTLYEHPHSNTHSSNGQKYSEHDGLIYFIKSAFESHNYTSSDRPDGNKKQFK
                     TIEGLICQVIKDSFKECDAVFHRHFANEASGSTAIVALIINGSMLYVANTGDSRCILS
                     KKKKGIKTMSYDHKPQHIGELIRINDDGGTVSLGRVGGVLALSRAFGDFQFKRNVKYP
                     NASSIAITSKRKFVPAEEAQVTVEPDVIPHLIDTSQDEFLVLACDGIWDVYSNKALVR
                     FIKYHLALGLKLDGIITKLLDHGISCADSNTGVGFDNFTLIVVALQLPGETLDEWYAR
                     MKFRLEREKGLL"
     gene            complement(<693409..>694926)
                     /gene="TPS1"
                     /locus_tag="KLMA_80317"
                     /db_xref="GeneID:34718509"
     mRNA            complement(<693409..>694926)
                     /gene="TPS1"
                     /locus_tag="KLMA_80317"
                     /product="trehalose-6-phosphate synthase"
                     /transcript_id="XM_022822068.1"
                     /db_xref="GeneID:34718509"
     CDS             complement(693409..694926)
                     /gene="TPS1"
                     /locus_tag="KLMA_80317"
                     /codon_start=1
                     /product="trehalose-6-phosphate synthase"
                     /protein_id="XP_022678366.1"
                     /db_xref="GeneID:34718509"
                     /translation="MTMDKAFSELKLEKSSSATGSGSGSGSISSSPGNVIVISNRLPV
                     TIKKNSKTGEYEYSMSSGGLVTALQGLKKSTTFQWYGWPGLEVPDEDKVKVKRELLEQ
                     FNAIPIFLSDEVADLHYNGFSNSILWPLFHYHPGEINFDETAWLAYNEANQAFADEIE
                     NNIHDNDVVWVHDYHLMLLPEMIRQRITAKKLKNVKIGWFLHTPFPSSEIYRILPVRQ
                     EILRGVLSCDLVGFHTYDYARHFLSAVQRILNVNTLPNGVEFNGRFVNVGAFPIGIDV
                     DTFKEGLKQEAVIQRVKELKECFKGCKIIVGVDRLDYIKGVPQKLHAMEVFLSEHPEW
                     IGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGRINGQFGTAEFVPIHFMHKSIPFQEL
                     ISLYSISDVCLVSSTRDGMNLVSYEYISCQQEKKGTLILSEFTGAAQSLNGALIVNPW
                     NTDELAESINEALTIPQEKRAANWEKLYKYISKYTSAYWGENFVHELYRLGASNQ"
     gene            <696195..>697907
                     /gene="amdS"
                     /locus_tag="KLMA_80318"
                     /db_xref="GeneID:34718510"
     mRNA            <696195..>697907
                     /gene="amdS"
                     /locus_tag="KLMA_80318"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822069.1"
                     /db_xref="GeneID:34718510"
     CDS             696195..697907
                     /gene="amdS"
                     /locus_tag="KLMA_80318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678367.1"
                     /db_xref="GeneID:34718510"
                     /translation="MTYLTENPELFKEYKKKIDAYNKEREDQIKAYDPEFVAKCEKLL
                     PSADVLDSEPIEGLELLDQLLDKSELQIVNEYSIEELVQKQVSGELSAVQIAHAYIKA
                     AIVANYVTNFAMQFLIPEALKQAQELDEYLKKEGKPKGALHGVPVSLKEQMFFGGKPT
                     NASYVSYIDFVPEESAASIQILEKLGAVFHVRTSQPQTIMHLDTWNNIIGRTRNPRST
                     KLSPGGSSGGESACIGMHGSVIGHGSDIGGSIRAPAAFANLFGIRPTTKRFTLLNGLS
                     GGKGQESVVATQGPLARSIDELDYYMNAYLNEGKPWEIDSMVVPLPWRQPSLPDVITI
                     GVLPDDGLVTPYPSISRGIKSVADALSKDPRFKVIDLSENWFTEEEMKELYDTTLALY
                     TCDGNKVQLSMLEPSGEPILPLTRHFLEFGGGKEHTIYSNRMMNALRDATKTTMMKKF
                     FNGLKLDFILSPTNVAPAEIPGESYYWGYTSFWNLLDYPNVVFPTGLKHDVELDSKAP
                     ESLKTNDYEKKVWYNDDGSIRYNSKEYENAPVALQLTGKRYHDEDVVAATKIIAELLN
                     VTRV"
     gene            complement(<698018..>698386)
                     /locus_tag="KLMA_80319"
                     /db_xref="GeneID:34718511"
     mRNA            complement(<698018..>698386)
                     /locus_tag="KLMA_80319"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822070.1"
                     /db_xref="GeneID:34718511"
     CDS             complement(698018..698386)
                     /locus_tag="KLMA_80319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678368.1"
                     /db_xref="GeneID:34718511"
                     /translation="MFRSGVQGLIGKRFSSTFRYKRWEELTTPEKQKFVKSFVENYKE
                     QYPGSKTNVSLKGLALDMDEYNDAPSVFGIFYDDIWRVSKAKKESLYNGKQQMDRSQV
                     IKEHGRFAHETFHDLLIENW"
     gene            <698687..>699319
                     /locus_tag="KLMA_80320"
                     /db_xref="GeneID:34718512"
     mRNA            <698687..>699319
                     /locus_tag="KLMA_80320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822071.1"
                     /db_xref="GeneID:34718512"
     CDS             698687..699319
                     /locus_tag="KLMA_80320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678369.1"
                     /db_xref="GeneID:34718512"
                     /translation="MPLDSKWATSEPIVEEVAEKKPARSAKKVSTSHRFDSKKKRGSK
                     SAGNEPTLSVGSDTDEYTTDSDWSRPNSGRKSAIFDKGKGRENHGSSSLTENPLAKAL
                     GISLDPPAPADREVPTKEPKNRQHQQQQSKNSQHSKAPQESANKAKKPNEKKSQALKK
                     RIEEQKKKLEENKRKAEQKELINSLLDGDISFDWEDDESELMEKLKIQEG"
     gene            complement(<699567..>700616)
                     /gene="AIM39"
                     /locus_tag="KLMA_80321"
                     /db_xref="GeneID:34718513"
     mRNA            complement(<699567..>700616)
                     /gene="AIM39"
                     /locus_tag="KLMA_80321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822072.1"
                     /db_xref="GeneID:34718513"
     CDS             complement(699567..700616)
                     /gene="AIM39"
                     /locus_tag="KLMA_80321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678370.1"
                     /db_xref="GeneID:34718513"
                     /translation="MYLARCPIARFSSSGAIFRISTPLRYSARWKHSDPKHYFTDPST
                     NEAKQPPTFFHDQHYNTQQQQQQQQQISTEDIATAVGESFRKHKRRRQRIIYSALVTA
                     IVGVTFGYSICYKVLYKKEESFIPLMPSQKWHKLSEYDSQRINIEEMKTLGKIRCLSI
                     LTNHEMIRDEFGVPLKTSKGEVPTVKAFDVWCEDQDPGIQGIVMRPLARRLSKTDTSR
                     ERDYHLWHTIPGFLQWRIGTKPINIKNSFNAMLKSLGLNTGDLLEVINPNAEYGEFKH
                     EYPLRKGNRYDVLEDRPMHIWFFGEIDLSEDALIVFKGKYHVNVRMEQVDLLRKENGQ
                     LVRYVLYKRENDNET"
     gene            complement(<701380..>701568)
                     /gene="COX7"
                     /locus_tag="KLMA_80322"
                     /db_xref="GeneID:34718514"
     mRNA            complement(<701380..>701568)
                     /gene="COX7"
                     /locus_tag="KLMA_80322"
                     /product="cytochrome c oxidase subunit 7"
                     /transcript_id="XM_022822074.1"
                     /db_xref="GeneID:34718514"
     CDS             complement(701380..701568)
                     /gene="COX7"
                     /locus_tag="KLMA_80322"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 7"
                     /protein_id="XP_022678371.1"
                     /db_xref="GeneID:34718514"
                     /translation="MPSPQRIIELQKIFQHSKKPLWMRHPRSAFYLYPFWGLFAVAVV
                     SPLLYIPNAIMGIKAKKN"
     gene            complement(<702128..>703189)
                     /gene="PSH1"
                     /locus_tag="KLMA_80323"
                     /db_xref="GeneID:34718515"
     mRNA            complement(<702128..>703189)
                     /gene="PSH1"
                     /locus_tag="KLMA_80323"
                     /product="RING finger protein PSH1"
                     /transcript_id="XM_022822075.1"
                     /db_xref="GeneID:34718515"
     CDS             complement(702128..703189)
                     /gene="PSH1"
                     /locus_tag="KLMA_80323"
                     /codon_start=1
                     /product="RING finger protein PSH1"
                     /protein_id="XP_022678372.1"
                     /db_xref="GeneID:34718515"
                     /translation="MNGQLHTLIPKRPSKDHLKILGRVLDSTVCTICHDYMLVPVMTT
                     CGHNYCYECLSNWLSNNRSSMSELTCPQCRSVLTAEPVLNVALQQIVDLMVDIVTDSG
                     SQSGSEGVKSSISMDLRSLLHQREEAVAEYKSDLAANTLFKSIFKNTAEAIIDEDDDG
                     IARCSNCQWEVEGPVCPNCDATIRNYNSGAQNFDEVDEDEYSDGELEEVERDLDTYRT
                     ESSRIVHDLEAEEGDESLSSEMDEAWPTRRPKDFMHGEREEDEDEEDRGSIDSFIVDE
                     EEEEEEEEGKTTDHEQEVMPNSDESHDSDFYEHNDDGYASGDSLDESTSNDELEPRPD
                     HPSARKKRLIVLDSDESDS"
     gene            complement(<703617..>705953)
                     /gene="PET111"
                     /locus_tag="KLMA_80324"
                     /db_xref="GeneID:34718516"
     mRNA            complement(<703617..>705953)
                     /gene="PET111"
                     /locus_tag="KLMA_80324"
                     /product="protein PET111"
                     /transcript_id="XM_022822076.1"
                     /db_xref="GeneID:34718516"
     CDS             complement(703617..705953)
                     /gene="PET111"
                     /locus_tag="KLMA_80324"
                     /codon_start=1
                     /product="protein PET111"
                     /protein_id="XP_022678373.1"
                     /db_xref="GeneID:34718516"
                     /translation="MSLLGISLKVPRLYNRISIRQGPNICLGCIENIRSFTTRIRVIA
                     SEDTVNSSKDVRSQEIAGWIKQSLFEHNPIQKSSQCGSSGNPTKTTNTVDKKQWEKKW
                     KVRFQNGRIQCVNDVIILKKKGLALFTTSQLLVLLTSLSKLQLFYDIDRVYQVYRSEL
                     ENAETSMNDKQELFELLKIMILTESRLHNYDVVALFFRKYIKQPNLHPTYINMGLKAL
                     LENNDFITARQFFEHMLNNQDVFPVTHRTLQILLTYINHSDDLLALKTVFESWLQKGP
                     SLPNKDSISLVHKQFLKFDEENSNKYWRLLLSHPRLQETKYEKSDRYAILELMRKFKN
                     NLAGMEEVNTLLKNISPEEKSYLYWQVLDRYVEQDNYEMLKLTMDQIKDDPEVTVDQH
                     HHASMLKYFAKTGSLGDFINYVKMVRQSSPESLTFNPFLFFQLWECAFQAHPVLRENM
                     EKKMKKLCNHEWYKRTYPWLVKSVESQVFKRTETTSGDDTFSRQNEKRVDTKLLKRLQ
                     NILRGRRYRRAKSIILDQARLGIRPNFPFYYTLKKFCVNNGHLPMSNMLDNTLRSTYR
                     IIPVKVSILNLRHNLYRLAYQLRKTNQSIEVVRQSSLKLIDSFVKHHSEKLNFQNYLQ
                     LGMLASRYQGRYLCDKMYSKAIQCRDPSDARATYMLYRSLLAYFVRSEEPKKYLSTLR
                     KLNKEPHVILTKYLLNTVKYNIAYFDRKSSDNTDAMLIEFVKLRERYAFIKLEGLDAI
                     KELMTFLKAWLSHESLKQKKLTHRKQLELRKRSKTPSS"
     gene            complement(<706488..>708140)
                     /gene="ROY1"
                     /locus_tag="KLMA_80325"
                     /db_xref="GeneID:34718517"
     mRNA            complement(<706488..>708140)
                     /gene="ROY1"
                     /locus_tag="KLMA_80325"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822077.1"
                     /db_xref="GeneID:34718517"
     CDS             complement(706488..708140)
                     /gene="ROY1"
                     /locus_tag="KLMA_80325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678374.1"
                     /db_xref="GeneID:34718517"
                     /translation="MTLQGSLESIFDNVSFFLNQNDLCALCLVNHRFNELATPKLYAN
                     IVINKNPVYRSNNWWIECGKTYLSGYRSVKKSDDQNDLFLYDRIERLLESQHLELVQS
                     LIVQEDVFNDMKVGAPLLRKLIDKVIELDRVEDLDIRDSILFQHTHNKLKELTNLKDL
                     RIRDIAGLNDISHLRELKSLELFVTLPSFDDVVLSEPIRSLILPNLEELVIEDLEYSS
                     LRVLNYFREQGVVFSNLRSLKFNHVHGIHDYNKTYRELAADLLMGVIPLETIRSLEME
                     ISCEVNDCTCIDDFLADISPHLIRLNNLSLIEKTFVSLGDHYTEENWDLSINRFILHL
                     PNVGQNLKTLAVRHNCPINGLQKDSVEGNYIRRRTLYNEVLPKLVSLRKLIAPTMLKS
                     LCSYEILVCDLLWNGCECDKCVKVLDIFDQFIQNHQYYSSEDGEFKDIIPTVFFAYAA
                     DSLCRRLLTEIDWDLKAMKYAPTQYMWDMHGYENVQHFSDYSCYFDETAYVHLTQVIS
                     HFFNDYMKSLVQMLPNLTACILSGIYYQVMPSREFISLYDDN"
     gene            complement(708337..708410)
                     /locus_tag="KLMA_R814"
                     /db_xref="GeneID:34718800"
     tRNA            complement(708337..708410)
                     /locus_tag="KLMA_R814"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:34718800"
     gene            complement(<708907..>710259)
                     /gene="TY2B-LR1"
                     /locus_tag="KLMA_80326"
                     /db_xref="GeneID:34718518"
     mRNA            complement(<708907..>710259)
                     /gene="TY2B-LR1"
                     /locus_tag="KLMA_80326"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822078.1"
                     /db_xref="GeneID:34718518"
     CDS             complement(708907..710259)
                     /gene="TY2B-LR1"
                     /locus_tag="KLMA_80326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678375.1"
                     /db_xref="GeneID:34718518"
                     /translation="MRKMHVWDENNLIDISEVDRNKVINPMLVFSIKRDGTKKCRLVA
                     RGDQQDLSTYSKDRQQDTINNMALMTVLAVALDHNLIIKQLDISSAYLYADLKEEIYI
                     RAPPHIKQKDKVLRLNKSLYGLKQSGANWQKTIKDYLKGKCELEEMRFWPCVFTKGKF
                     LEIIVCLFVDDIVIAGNNVNTINQFITDLQNRFDTRIVNDGSPNERDAVRYDILGIDV
                     EYKKGVSMKFGMLESLTKKLPLLGVEFKKESRYNIVPGTPNRSLNQDLDIPCDKDYNA
                     KVNWIQRAIGLSNYVAMKYRFDIAYYTNILAQHQLYPSDAVLFETERLLQYLWTTRGK
                     RLVWKRNEKETSELIGLTDASHAKGLKYKSQAGYFCIWNGKKLFARSTRTSYVCESST
                     QSETYAASECLAISRSINYLLSTLTGKKPDQILLTDNTALINSIKGTKTINLDPDIMI
                     "
     gene            complement(<711127..>715356)
                     /locus_tag="KLMA_80327"
                     /db_xref="GeneID:34718519"
     mRNA            complement(<711127..>715356)
                     /locus_tag="KLMA_80327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822079.1"
                     /db_xref="GeneID:34718519"
     CDS             complement(711127..715356)
                     /locus_tag="KLMA_80327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678376.1"
                     /db_xref="GeneID:34718519"
                     /translation="MTVDIISEWKQWLLAYKPSSSVQHGDIEKFLHCFKDIRCILTDS
                     GANDKDRVKCVDVMSILMLKEYQILKKSGKDADNEFVSIIKDKMITIEEGTYLFHYVI
                     DFWTDNTVSMEIPLKNMFEKLLQLMNHLYGQKIMKTVLHQWIKTLISLEDKMKVQYYF
                     LDAFSGQIDLMMLLQWKPNFVEVCFSLVWAETLCTQVGKCLSNVLLNWYKYHFDESSM
                     EKWLDLWKPICCTYLKDPKYTKNIQLYVLSNVFKQLPASFGVFISDHEDFSNAILLSL
                     LKIGQELAIEEEPFHNEKYIKTKDIFSLLQQDKYKLATFELLTYSNKKSKQIQPYIYD
                     ILKDNLTIFFVDYTLQTRNYFCSSLKSFINRIRDSTYSLNRDAMKLKQKNKFPEEQLY
                     KQEHIKLAEDFMKWLVAFLKTQMAPGSQYQRKSLAYQVVTNLLVSGIDSSVPEKFLDT
                     KQRMSYPFNINIFDSTLIRILIDDLTNNYDDIREHSLNLLLIAFSTSGRSNLNIDEST
                     MFGLALDMLLSYKTSDGGAKIMEFVFIVSDNKYKLLRSLMDNLEQLLKEARSNLIENI
                     NLPVSGIFTALSLVITRCNKEEANKEILQRLIDTILLNWENVREIVCHDSPEGNLPIK
                     YLKCGISDQIITSYAFRSIKESSALLKTILVRDSLTIVQIEQCGQILLDQLSHIRHSG
                     AFQSVFPTYVQLCQCARKAYPQLLQVWLEESVSSLRTKSQYVTRRSGGLPFMISAILS
                     SETDQERPLLQSTFEQLFEIASTPILKHEEKLDLPQVHAFNCIRSIFNESKLSLHSAP
                     YVQKTLELCLKNFSSPLWCMRNCSVMLFTSLQNRLFGKMGKTMSARLFFTRFKGIREV
                     LLATLKDSIELFGGKKSAGITIGTNDDIPSYQANIESIFLIFTILGRLKPTLSYDGLN
                     EFEVEIVKALGCPNWKIRELAARTYASLVQNHKEKAYELLSLLTNSPCSEDKIHGFML
                     AIKELVLRSLEEASPISLEVIGQLLNNNYALFISEHPCYAISQKYVEISELLLATGAF
                     SEYDKRSILNILGNAFIRENSEYVVDGSKQLFLASVTRVLLRFENAESICDILELALC
                     SPFFEVQCSALQSLDYDILSSTEQLSVVNSLVEILEDTKQWVQVKADALSALQKSPVR
                     VRLSNYETLVSQKSEILQSSLLENIASFEKVPESKFWDLVDKYSDDERPDQLRLAATK
                     CLINTYNNCSDAKVLFRLYLQLFDESPEIREISARFLNEHIFELQPFELDSSSYSTSL
                     RCVELIPKLPLASKLYPILIDHLQKLYGGLKVMESGNLAENHDLFDVEKDNQYRNELE
                     LGKQIIQMLQNMEYNIPEETVEQVKDCLSELISNMDSKGKDGFLKWGSNPDIFNKLAL
                     QRYLLRSCGKDLSEIDDNLRQLNCHPLLFEI"
     gene            <715823..>716818
                     /gene="TFB4"
                     /locus_tag="KLMA_80328"
                     /db_xref="GeneID:34718520"
     mRNA            <715823..>716818
                     /gene="TFB4"
                     /locus_tag="KLMA_80328"
                     /product="RNA polymerase II transcription factor B subunit
                     4"
                     /transcript_id="XM_022822080.1"
                     /db_xref="GeneID:34718520"
     CDS             715823..716818
                     /gene="TFB4"
                     /locus_tag="KLMA_80328"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor B subunit
                     4"
                     /protein_id="XP_022678377.1"
                     /db_xref="GeneID:34718520"
                     /translation="MDAIADSVIQPTKSKAQEIEDTPSLLTVVMDTSIHSWVQLRKQS
                     SGEGANENQLIEALKSIVVFLNAHLAFNSANQVCIIAAHSKGIKYLYPSADSISSKSM
                     VSSDMYRGFRNVDEIVVEQWYSLFKDEAEGDESKVSMKSSLSGAMSSALTYVNRILKE
                     NENTNLRSRLLVITCGTSQGKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSIESTFL
                     QQATDATNGVYLHVENTRGLIQYLSTAMFIDPSLRNVIVKPNQGSVDFRTSCFLTGKV
                     VAVGFVCSVCLCVLSVIPPGQKCPACDSPFDSKIIARLKRKPVLSNGVPKKKKVQ"
     gene            complement(<716861..>717253)
                     /locus_tag="KLMA_80329"
                     /db_xref="GeneID:34718521"
     mRNA            complement(<716861..>717253)
                     /locus_tag="KLMA_80329"
                     /product="zinc finger protein 511"
                     /transcript_id="XM_022822081.1"
                     /db_xref="GeneID:34718521"
     CDS             complement(716861..717253)
                     /locus_tag="KLMA_80329"
                     /codon_start=1
                     /product="zinc finger protein 511"
                     /protein_id="XP_022678378.1"
                     /db_xref="GeneID:34718521"
                     /translation="MVKRAREEESDRDAVSNINNILCTEPPCINEWVPADLYPSHVDL
                     LHQYICSECFANLTKEYWLKLHIEECHNPFKTDSSLQCLEEDCPVVFTDISRRHDHLM
                     KIHHYSEHFSSDFIRTGYLTRGISNQTV"
     gene            <717496..>718470
                     /gene="BRR1"
                     /locus_tag="KLMA_80330"
                     /db_xref="GeneID:34718522"
     mRNA            <717496..>718470
                     /gene="BRR1"
                     /locus_tag="KLMA_80330"
                     /product="pre-mRNA-splicing factor BRR1"
                     /transcript_id="XM_022822082.1"
                     /db_xref="GeneID:34718522"
     CDS             717496..718470
                     /gene="BRR1"
                     /locus_tag="KLMA_80330"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor BRR1"
                     /protein_id="XP_022678379.1"
                     /db_xref="GeneID:34718522"
                     /translation="MVGVEQKQGPLDPVFGQHRVFSLSDEAVSQEAIKYLMDVRDEAL
                     HSASIYVKSHINNDQDEQVIGMVADTSDLKVKKRILDDSESINMWINELREEMAPLDE
                     TASEIVYTDEMLDILVYEIKKYLEEHPEEVNDSVRRVTKHVQPLSNPAYDVSSELVQN
                     MVKKLKDKRFSDISFLKRYINRPTPIPTNFRQWFGHIKHNEPTRQFMLRLSFDDLMKI
                     QGYMMQWIVSISKNKPDSKQLQKWLLYVWIFMPNELLSQQISQLRELGKKCRTNIKLN
                     TDIEGLDMPKEIQDIPFPNQRSELNAVEITLAVIAHRYGQQDLLNDDH"
     gene            <718806..>719723
                     /gene="YMC1"
                     /locus_tag="KLMA_80331"
                     /db_xref="GeneID:34718523"
     mRNA            <718806..>719723
                     /gene="YMC1"
                     /locus_tag="KLMA_80331"
                     /product="carrier protein YMC1"
                     /transcript_id="XM_022822083.1"
                     /db_xref="GeneID:34718523"
     CDS             718806..719723
                     /gene="YMC1"
                     /locus_tag="KLMA_80331"
                     /codon_start=1
                     /product="carrier protein YMC1"
                     /protein_id="XP_022678380.1"
                     /db_xref="GeneID:34718523"
                     /translation="MTEEFPTPQLIDDLDLESSHDRTRVFKDLLAGTAGGIAQVLVGQ
                     PFDTTKVRLQTSEVNTNAVKVIEDLLKNEGFMGFYKGTLTPLIGVGACVSLQFGVNEY
                     MKRFFRDINGDGSTQLTLIQYYLCGVAGGFTNSFLASPIEHVRIRLQTQTGSGASVQF
                     KGPVDCLKKLWSNGQLMRGLTPTMLRESHGCGVYFLTYEALVSQQVKSGIDRKDIPAW
                     KLCLYGAASGTLLWTMVYPLDVIKSVMQTDNLKAPKSGNNIVSVGRSIISKQGVLGLF
                     RGFGPTMLRAAPANAATFATFETAMRLLG"
     gene            complement(<719883..>720662)
                     /gene="ARO7"
                     /locus_tag="KLMA_80332"
                     /db_xref="GeneID:34718524"
     mRNA            complement(<719883..>720662)
                     /gene="ARO7"
                     /locus_tag="KLMA_80332"
                     /product="chorismate mutase"
                     /transcript_id="XM_022822085.1"
                     /db_xref="GeneID:34718524"
     CDS             complement(719883..720662)
                     /gene="ARO7"
                     /locus_tag="KLMA_80332"
                     /codon_start=1
                     /product="chorismate mutase"
                     /protein_id="XP_022678381.1"
                     /db_xref="GeneID:34718524"
                     /translation="MDFFKPETVLNLQNIRDELVKMEDTIIFNFIERSHFATCPSVYQ
                     NKDPLVNLPDFDGSFLDWALMHLEIVHSQLRRFESPDETPFFPDKILKPIIPSLNYPK
                     ILASYSSQINYNDKIKKIYIETIVPLISKREGNTSENFGSVATRDIETLHALSRRIHF
                     GKFVAEAKFQSEKEKYTELIRNKDTEGIMKAITNSEVEEKILKRLQVKAEVYGVDPTN
                     AQGDKKITPEYLVRIYKEIVIPITKEVEVEYLLRRLEDEEK"
     gene            complement(<721200..>722081)
                     /gene="JID1"
                     /locus_tag="KLMA_80333"
                     /db_xref="GeneID:34718525"
     mRNA            complement(<721200..>722081)
                     /gene="JID1"
                     /locus_tag="KLMA_80333"
                     /product="J domain-containing protein 1"
                     /transcript_id="XM_022822086.1"
                     /db_xref="GeneID:34718525"
     CDS             complement(721200..722081)
                     /gene="JID1"
                     /locus_tag="KLMA_80333"
                     /codon_start=1
                     /product="J domain-containing protein 1"
                     /protein_id="XP_022678382.1"
                     /db_xref="GeneID:34718525"
                     /translation="MMVGYVKLLGRPLLVLDRRSNNCVNGLVLRTKQNSDNGGSLRFV
                     HLTASENEVHFDSNWPSDNQPKTPYSLFQLTESSFTKALLKKRFHELARLYHPDHSAN
                     KAILKRNRNTELTSSSVHQNLLTSEDKIQRFKIITEAYELLKDPKRKNQYDRLGLGWA
                     YGPRIQSPAQRYEQSSRYYNAGTWEDYSDLRNDDKQDIGPMTMLIWFFGIFGIIQLTS
                     LLTRWEEAMNKTNFTHDETERDLTLAYINYGLDEDKWSRLRRFLWFRTFGLYRNKEDL
                     DREAKKNEAMINELKNK"
     gene            <722663..>723121
                     /gene="FCY1"
                     /locus_tag="KLMA_80334"
                     /db_xref="GeneID:34718526"
     mRNA            <722663..>723121
                     /gene="FCY1"
                     /locus_tag="KLMA_80334"
                     /product="cytosine deaminase"
                     /transcript_id="XM_022822087.1"
                     /db_xref="GeneID:34718526"
     CDS             722663..723121
                     /gene="FCY1"
                     /locus_tag="KLMA_80334"
                     /codon_start=1
                     /product="cytosine deaminase"
                     /protein_id="XP_022678383.1"
                     /db_xref="GeneID:34718526"
                     /translation="MAEWDQKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGH
                     NMRFQKGSPTLHGETSTLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVI
                     GENVNFKSPGEEYLTSRGVELKVVDDKRCIDIMKEFIEKRPEDWYEDIGE"
     gene            complement(<723301..>723693)
                     /locus_tag="KLMA_80335"
                     /db_xref="GeneID:34718527"
     mRNA            complement(<723301..>723693)
                     /locus_tag="KLMA_80335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822088.1"
                     /db_xref="GeneID:34718527"
     CDS             complement(723301..723693)
                     /locus_tag="KLMA_80335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678384.1"
                     /db_xref="GeneID:34718527"
                     /translation="MTLNNVKRLDLAVTYNHVPAPKSLYTSASGSQGMLNQSMPMAAM
                     FMRNKFLAWFSVLSTWHAILTAMPDPATPGDSPLMKIGMALLALGTNYLNVLLPGSQG
                     PVIDADKTEGAAEAVTEAVTESAASATV"
     gene            <724665..>726320
                     /gene="AIM10"
                     /locus_tag="KLMA_80336"
                     /db_xref="GeneID:34718528"
     mRNA            <724665..>726320
                     /gene="AIM10"
                     /locus_tag="KLMA_80336"
                     /product="probable prolyl-tRNA synthetase"
                     /transcript_id="XM_022822089.1"
                     /db_xref="GeneID:34718528"
     CDS             724665..726320
                     /gene="AIM10"
                     /locus_tag="KLMA_80336"
                     /codon_start=1
                     /product="probable prolyl-tRNA synthetase"
                     /protein_id="XP_022678385.1"
                     /db_xref="GeneID:34718528"
                     /translation="MMIFKRSLFTPSKITSEILQLPTHDLLQQLGYVKQASSGVLHWL
                     PLGLKTLRNIENIIRKRMDQSGAHEVSLSSLSQRALWETTGRWSNTELFKLKDAKKKD
                     YCLVPTCEEEITWLMKNYLTSYKDLPTITYQISRKYRDELRPRGGLLRGREFLMKDAY
                     SFHLNSKDAVETFDKVNLTYNKIFSDIGIPFVSAVADSGDIGGDLSKEYHFIHESGED
                     TLLQCPSCKSVSNVEKCESYPEEANQHLGDVSVKYALNMENDTLVCMYYPANRTLNWN
                     LALEAMDRDLDPQTREMSNEDVLSKFSSNNDPMFSGIIRIMDVRLNSRSNFPDFPLKS
                     YLKINFSQLNDYSIVDAEEGEICAQCEEGHLKSANSIEVGHTFYLGKKYSEKLNATVR
                     QQDNSDVVVEMGCYGIGVSRLVGAIAQVTRDSQGLRWPASISPYKVSLCCNEKKSPEE
                     MKQVLDTLKLEPYTQFDPKTSLGGRIQQSHALGIPMAIIVGHKSWPKIEIEVRAQYKN
                     DSWEESYGDLQSKLDWQYDPATNKHFVDYHNINDVVNILLKSL"
     gene            complement(<726550..>726816)
                     /gene="SBH1"
                     /locus_tag="KLMA_80337"
                     /db_xref="GeneID:34718529"
     mRNA            complement(<726550..>726816)
                     /gene="SBH1"
                     /locus_tag="KLMA_80337"
                     /product="protein transport protein Sec61 subunit beta"
                     /transcript_id="XM_022822090.1"
                     /db_xref="GeneID:34718529"
     CDS             complement(726550..726816)
                     /gene="SBH1"
                     /locus_tag="KLMA_80337"
                     /codon_start=1
                     /product="protein transport protein Sec61 subunit beta"
                     /protein_id="XP_022678386.1"
                     /db_xref="GeneID:34718529"
                     /translation="MDSSIPGGQKTLQKRRNAQLLKEKKANQTPASARQAGFGGSSSS
                     ILKLYTDEANGLRVDPLVVLFLAVAFVFSVVALHVVAKVSGKIF"
     gene            <728199..>730103
                     /gene="PIN4"
                     /locus_tag="KLMA_80338"
                     /db_xref="GeneID:34718530"
     mRNA            <728199..>730103
                     /gene="PIN4"
                     /locus_tag="KLMA_80338"
                     /product="RNA-binding protein PIN4"
                     /transcript_id="XM_022822091.1"
                     /db_xref="GeneID:34718530"
     CDS             728199..730103
                     /gene="PIN4"
                     /locus_tag="KLMA_80338"
                     /codon_start=1
                     /product="RNA-binding protein PIN4"
                     /protein_id="XP_022678387.1"
                     /db_xref="GeneID:34718530"
                     /translation="MSEEQQLKDPVPENEDVSQQSGSNNVTEEVIPTAIVIKNIPFAI
                     KKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTDETTRVVQSLNGKEIGGR
                     KLRVEYKKMLPQAERERIEREKREKRGQLEEQHRSMSNISLQSLGATPSSAQPGGNVG
                     GAPPLASNNSSSQLFNSFINSESTPGAVSMTTVPPSPQQPLHHHHHPQLSAQNTATSM
                     SMMSLQGLPQMSERFYAPLPAAANLMLPPQQLDFNDPDTLEIYSQLLLFKDREKRYYE
                     LAYPIGVSATHKRIINVLCSFLGLIEVYDPSFIIIRRKNLDLATLQSHLQQQGQLDMM
                     QPLQPSSTGGSISRSQSYTSLLQAHASMNHGLLSQTNGSSTNLGNMANGVPQQAGGTA
                     SLANASTNSTTGSNMTNVSNVNNGVGGGTGGVSGSNQQPHSPGTTLLQASSLHQDNNA
                     GLRNQVPTPSIMQNRIPSGFQTNNQQHMTSSSLLRNQGISPPQQQIGINQPNAGRVPS
                     LYQSQPGTPGMNENRFTQLTSSQLQQQQSQQQQQSQQQQQQQGQGQGQGQGQVQQQPL
                     APQHTSESIHSNYSVHSIHDFVPGSSSQGYPPAAGSDMLENSLTRSLSGLDIGKRHGS
                     SAANSNNLWG"
     gene            <731875..>732975
                     /gene="ADH6"
                     /locus_tag="KLMA_80339"
                     /db_xref="GeneID:34718531"
     mRNA            <731875..>732975
                     /gene="ADH6"
                     /locus_tag="KLMA_80339"
                     /product="NADP-dependent alcohol dehydrogenase 6"
                     /transcript_id="XM_022822092.1"
                     /db_xref="GeneID:34718531"
     CDS             731875..732975
                     /gene="ADH6"
                     /locus_tag="KLMA_80339"
                     /codon_start=1
                     /product="NADP-dependent alcohol dehydrogenase 6"
                     /protein_id="XP_022678388.1"
                     /db_xref="GeneID:34718531"
                     /translation="MSYPDSFQGFAVVNDHKNWLNPEKIVYPAKKFGPQDVDVEIEAC
                     GVCGSDVHCANGNWGNQKLPLVVGHEVIGKVIRVGEECTTGIKVGDRVGVGAQVRSCL
                     ECRRCKEDNEPYCPKFVTTYSQPYPEDGYVSQGGYASHIRLHEHFAIPIPESLEAAYT
                     APLLCGGGTVYSPLKRYGCGPGKKVGIVGIGGIGHMGILLAKAMGAEVYAISRSHAKE
                     EAAKKLGADHYIATKDEGWELENFDKLDLIVLCASSLTDVDFTKLPKLLTVGGILASI
                     SVPAAHEKLNLSPFELMGYKITESALASRKELIEMLNLVAEKNIKPWVEKLPISAESV
                     SEAFQRMESGDVRFRFTFTDFDKQFGEFKAQK"
     gene            <733619..>735763
                     /gene="SAS3"
                     /locus_tag="KLMA_80340"
                     /db_xref="GeneID:34718532"
     mRNA            <733619..>735763
                     /gene="SAS3"
                     /locus_tag="KLMA_80340"
                     /product="histone acetyltransferase SAS3"
                     /transcript_id="XM_022822093.1"
                     /db_xref="GeneID:34718532"
     CDS             733619..735763
                     /gene="SAS3"
                     /locus_tag="KLMA_80340"
                     /codon_start=1
                     /product="histone acetyltransferase SAS3"
                     /protein_id="XP_022678389.1"
                     /db_xref="GeneID:34718532"
                     /translation="MTTTSKVHRLIKELLIDDNVHSKVQEDLWNNDGSEPQRKRTRDR
                     ADLKAESEKMEGEEKQPEKKKRTIPVDWNDLNPNVQFSNGHQVITIRYNPLKLLSFDK
                     VLNRDFKIQESMPSSVNDVDFEIYENANLLTSIDNDSNLPYRGAIKIAQEYSTNKTIP
                     RVKDREFFLHLLRKSQPAAQFNGNTLLAYPNDQDHDYDKKRLKSVGPVITPSTSSVEY
                     IYFQNYEIKTWYKAPYPEEYNKNKILYICDKCLKYMSSKYVYYRHQLKCDCSHPPGNQ
                     IYRDDDQGFAIWEVDGRENVIYCQNLCLLAKLFLNSKTLYYDVEPFMFYAITVWENDE
                     WKFVGYFSKEKLNSTGYNLSCILTLPHYQRRGIGHLLMDFSYLLSRREFKLGTPEKPL
                     SDLGLISYRFFWKNKMIQTLYMLFEQLGESFICTINDLSNLTGMNHSDVIYGLEQIGC
                     LYKYKDETDKWNYVVKIKDWSKLAEQYHETKSKMKYTLKSSKLVWKPVIFGPSCGINA
                     VGTMVETNVLPKKTHSSIDTASSRDTFKDSISVLTNFMSDDIADPRTMEEIALDKIKA
                     QKSEINLNDKNFVPAYTLPKPIRDKAIRSSRMKAESSVPESKPAAPTVEEENFVEDVE
                     EDDVEDIEEEENIAEDESFSSADAEAEEEDEDVDEDEEEVEEDEGSQLPSKPLQTESF
                     TISRSLRNSRPKAEQGTETDLSPRPQRVLRHR"
     gene            complement(<736366..>738396)
                     /gene="DOT6"
                     /locus_tag="KLMA_80341"
                     /db_xref="GeneID:34718533"
     mRNA            complement(<736366..>738396)
                     /gene="DOT6"
                     /locus_tag="KLMA_80341"
                     /product="transcriptional regulatory protein DOT6"
                     /transcript_id="XM_022822094.1"
                     /db_xref="GeneID:34718533"
     CDS             complement(736366..738396)
                     /gene="DOT6"
                     /locus_tag="KLMA_80341"
                     /codon_start=1
                     /product="transcriptional regulatory protein DOT6"
                     /protein_id="XP_022678390.1"
                     /db_xref="GeneID:34718533"
                     /translation="MTAPKNVSSRTPSSWEPQDDVLLRHLKEVKHLGWKEIAQYFMNR
                     TPNACQFRWRRLKSGSLKTAKSTDDEDELPELSTELAALQGFTNGNPGAAAGAGNGAG
                     PGAGPGTVPGSGNAQGHSMLSVDPAHAADSTSAKKKSSSVGPMPMPVPMPIPTSKVTN
                     GAVLSSPHGNSFGLLPGNRASVTLGSSVSSSVNGLVHSGSLSKSPFSNASPATTHGKF
                     IKPRSSSHSHDGPLAGGPHFNDQEENFGFIPKVFIKSRRGSAVVMNNSGINNSIGNLA
                     ATGIAATPQSTTLNLSTSNLASTKSRKNSFSSRSRRSSFNVTSDRHFIPLTSNASSRR
                     SSVVALPSASTPQSKPRRDSFTTSQSTSRSNSISQFRRGSIQAGYIDMPSAKQNFASP
                     PPPPIPQQQHQQQHQQHQQPHIHGQSSAIHGPINNPHAKPWSDDEDKLLVEKRQLYHL
                     SIDELSILLPHRSEQEIQWRMESLQISSIDTMNSVPIANEIANSNAVSSPLADDVNSS
                     SYSPDTAVEEQDDIVDDDVDVDIEIVGRMEDSVAPTQLRDNSPTFSQTSSTGSSARER
                     SPVFSPDTHSLRDQSPTISDGNGSSLYSNRAPSHSVPKQIRQVSTSTTQHHQHHNHHP
                     ISNHHANPHHQQHQISELTPNPSQSPQLTHQQLPQPSSQPLPSLNTIFKHII"
     gene            <739800..>741068
                     /locus_tag="KLMA_80342"
                     /db_xref="GeneID:34718534"
     mRNA            <739800..>741068
                     /locus_tag="KLMA_80342"
                     /product="deoxyribonuclease Tat-D"
                     /transcript_id="XM_022822096.1"
                     /db_xref="GeneID:34718534"
     CDS             739800..741068
                     /locus_tag="KLMA_80342"
                     /codon_start=1
                     /product="deoxyribonuclease Tat-D"
                     /protein_id="XP_022678391.1"
                     /db_xref="GeneID:34718534"
                     /translation="MIHRAAAQLLRKYTTANMTAGVSTSPKYFDIGFNISDHMFRGIY
                     HEKQQHESDIPNILNRCVVTNVKKLLITGSSIKESQHSIDVVSQFASSTPVSLYYTIG
                     VHPCHVNEFVPEHGQSYWKPDQTEEAPFEIVDHAFTQGKLRELYDLYKRQEASDAGRF
                     KAIGEIGLDYDRLNYSGIAIQKLFFIEQLKLSCFFPNKPLFLHLRSCTEDFMEILEMF
                     IKGFNDTKDTFNYKELIDGTVAGGPRINEDGSIFYKFTDTRKFVVHSFTGSVSDLRKL
                     RDSSENCYFSVNGCSMRTEESIEMISAMPLDKLLLETDAPWCDIRRTHASFKFLNKSC
                     DATIADSWDHGLSDAYPQLDSWFKSVKKEKLRGIEREKWDEYMVKSRNEPCTMGHVAT
                     AVANIKGVPLSELVDQVWHNSCLVFDVESH"
     gene            complement(<741929..>743242)
                     /gene="PTC2"
                     /locus_tag="KLMA_80343"
                     /db_xref="GeneID:34718535"
     mRNA            complement(<741929..>743242)
                     /gene="PTC2"
                     /locus_tag="KLMA_80343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822097.1"
                     /db_xref="GeneID:34718535"
     CDS             complement(741929..743242)
                     /gene="PTC2"
                     /locus_tag="KLMA_80343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678392.1"
                     /db_xref="GeneID:34718535"
                     /translation="MGQILSNPVIDKEQESGGDALTAFGLCAMQGWRMSMEDSHIVDL
                     NIAKDASEHLAYYCVFDGHGGSSVAQFCGSQFSKILQKQESFKKHAYKQALLECFIAA
                     DEELLKDPVLANDHSGCTATTLLISKLQNVMICANSGDSRTVLSKDHIAKALSYDHKP
                     TLKSEYSRIVAADGFVEMDRVNGNLALSRAIGDFEFKSNPELSPHEQIVTCVPDLIEH
                     SIDYDQDEFVILACDGIWDCLTSQDCVNMVHWGLKKGLTLEEISSKIIDVCCSPTTEG
                     TGIGCDNMSIIIVALLKPGEDEAAWSKRILSKNFEPPISFENQRRAVFHFYDFPENDD
                     HVFEVTNRRESDDLDDNNERKGGAQGRGASSLANLEAILGSGGIQITPGENNLSYIHG
                     TALSEVLASLSGGIRSQIEEDEEDQEGQEENADDSQQQQGKPKKN"
     gene            <744021..>745544
                     /gene="TRP2"
                     /locus_tag="KLMA_80344"
                     /db_xref="GeneID:34718536"
     mRNA            <744021..>745544
                     /gene="TRP2"
                     /locus_tag="KLMA_80344"
                     /product="anthranilate synthase component 1"
                     /transcript_id="XM_022822098.1"
                     /db_xref="GeneID:34718536"
     CDS             744021..745544
                     /gene="TRP2"
                     /locus_tag="KLMA_80344"
                     /codon_start=1
                     /product="anthranilate synthase component 1"
                     /protein_id="XP_022678393.1"
                     /db_xref="GeneID:34718536"
                     /translation="MTETVTIQPSIEVIKECIAANDDSINMYPVYHFMPAMDLTPHVA
                     YLKLSQLNKKDRSASFLFESAIGNQLGRFSFFGQGPRKTIKTGPTEGLSCDPLDILQQ
                     ELSQYKLAENVPGLPKLSGGAIGYVSYDCVQYFEPKTKREMKDTLQLPEAALMLYDTI
                     VAFDHVFQRFQIMYNINIKEVESLEKGYEEATEAINRIASILKDDSQPVPLPEQPPIK
                     MDQTFTSNIGEEGYIQHVKTLKEHIKKGDIIQCVPSQRVARPTSLHPFNIYKHLRTVN
                     PSPYMFYIDYLDFQIIGASPELLCQVDSKNEVITHPIAGTIKRGATPAEDDKLAEELR
                     SSTKDRAEHVMLVDLARNDINRVCDPKTTSVDKLLTVQKFSHVQHLVSQVSGTLRPDQ
                     TRFHALRSIFPAGTVSGAPKVKAMELIAELEGEKRGVYAGAVGHWSYDGKSMDTCIAL
                     RTMVYKNGTAYLQAGGGIVFDSDEHDEYIETMNKMKANHQTILQAEELWAKKVGIQK"
     gene            <745966..>746586
                     /gene="PTH2"
                     /locus_tag="KLMA_80345"
                     /db_xref="GeneID:34718537"
     mRNA            <745966..>746586
                     /gene="PTH2"
                     /locus_tag="KLMA_80345"
                     /product="peptidyl-tRNA hydrolase 2"
                     /transcript_id="XM_022822099.1"
                     /db_xref="GeneID:34718537"
     CDS             745966..746586
                     /gene="PTH2"
                     /locus_tag="KLMA_80345"
                     /codon_start=1
                     /product="peptidyl-tRNA hydrolase 2"
                     /protein_id="XP_022678394.1"
                     /db_xref="GeneID:34718537"
                     /translation="MAPSSLNLAVLFSLSALSLTTGYYLGQVTPSRKDEIQELLKQAK
                     IKAEKEEDQDDGDEDEDEDEDEDDDEGIEVDSICLNDIPGEVRMALVIRQDLGMTKGK
                     IAAQCCHAALACFRLIACDPSKASYNPDMTHRWLARGQAKITLKCPDKETMDELFAKA
                     IALGVNSYVVHDAGRTQIAAGSATVLGLGPAPKAILDQITGDLKLY"
     gene            complement(<746721..>747938)
                     /gene="SHP1"
                     /locus_tag="KLMA_80346"
                     /db_xref="GeneID:34718538"
     mRNA            complement(<746721..>747938)
                     /gene="SHP1"
                     /locus_tag="KLMA_80346"
                     /product="UBX domain-containing protein 1"
                     /transcript_id="XM_022822100.1"
                     /db_xref="GeneID:34718538"
     CDS             complement(746721..747938)
                     /gene="SHP1"
                     /locus_tag="KLMA_80346"
                     /codon_start=1
                     /product="UBX domain-containing protein 1"
                     /protein_id="XP_022678395.1"
                     /db_xref="GeneID:34718538"
                     /translation="MSDESIQQFMALTNASANVASDYLKQFEDMEEAVNAYYAAQQGD
                     FEQHDSTEYGAATTAAEGSSHSEGADEDVSYARTLSGQKIAVPRSTPSPSLNKSKSKP
                     KSKIQSFSDMLRGGDDEDEDRNTFAGGETSGLEITDPHANDSNSLIRDLLEKARRGGQ
                     RAGEGDDSDGNESNGEKQQHHFTGRGYRLGSDLSAPPMVVEDNTPQESERPKKVTREI
                     TFWKEGFQVGDGKLYRYDDPENSFYLKELNQGRAPLQLLDVAFGQEVDVTVYKKLDES
                     YVPPKRKLGGFQGTGKRLGSPIPGDIVQSQSSTPSPAVASESKAATEEPKPEQIGDTS
                     VQIRYASGKREVLRCNSTDTIRFLYQHVKENTEGNRTFTLSHAFPIKSIDAFDSTIKE
                     QDLCNAVVVQRWV"
     gene            complement(<748798..>751104)
                     /gene="MET6"
                     /locus_tag="KLMA_80348"
                     /db_xref="GeneID:34718539"
     mRNA            complement(<748798..>751104)
                     /gene="MET6"
                     /locus_tag="KLMA_80348"
                     /product="5-methyltetrahydropteroyltriglutamate
                     homocysteine methyltransferase"
                     /transcript_id="XM_022822101.1"
                     /db_xref="GeneID:34718539"
     CDS             complement(748798..751104)
                     /gene="MET6"
                     /locus_tag="KLMA_80348"
                     /codon_start=1
                     /product="5-methyltetrahydropteroyltriglutamate
                     homocysteine methyltransferase"
                     /protein_id="XP_022678396.1"
                     /db_xref="GeneID:34718539"
                     /translation="MVQSYVLGFPRIGPNRELKKATEGYWNGKVSAEQLQQVGKDIRA
                     ANWKLQKEAGVDVIASNDFSFYDQVLDVSLLFNVVPQRYAKYELSPLDTYFAMARGLQ
                     RKATETAAAVDVPALEMVKWFDSNYHYVRPTFSNSTEFKLSGQKPVDEYLEAKALGVE
                     TRPVLVGPVSFLHLGKSDKDSLDLKPISLLDKILPLYAEILKKLADAGAKSVQLDEPT
                     LVLDLPAEVQAAFKKAYEYLGAQPGLPEITLATYFGTVVPNLSAIKDLPVAGFHFDFV
                     RNPEQLDDVVSILNDKQTLSVGIVDGRNIWKNNLTKSAQFVESAIAKLSGDRVLVATS
                     SSLLHTPVDLENETKLNPEIKDWFAFATQKVKEVVNIAKKLNGEDVTAEFEANAKSLN
                     NRATSSITNNADVKARVASINEDMGKRAAPFVERIKEQQPILKLPLFPTTTIGSFPQT
                     KDIRINRNKFNKGTITREEYEKFINEEIERVIRFQEEVGLDVLVHGEPERNDMVQFFG
                     EQLEGYAFTVNGWVQSYGSRYVRPPIIVGDLSRPKPMSVKEVVYAQSITQKPVKGMLT
                     GPITCLRWSFPRDDVDQKTQAYQLALAIRDEVADLEAAGIKVIQVDEPAVREGLPLRA
                     GEERTQYYQWSAESFRVATSVVQNKTQIHSHFCYSDLDPNHIKALDADVVSIEFSKKD
                     DPNYILQFANYPNHSGLGLFDIHSPRVPSKEEFIQKMAEFLKYYPAEKFWVNPDCGLK
                     TRGWEETKQSLTNMVAAAKHFREIYAKK"
     gene            <752172..>752525
                     /locus_tag="KLMA_80349"
                     /db_xref="GeneID:34718540"
     mRNA            <752172..>752525
                     /locus_tag="KLMA_80349"
                     /product="ino eighty subunit 5"
                     /transcript_id="XM_022822102.1"
                     /db_xref="GeneID:34718540"
     CDS             752172..752525
                     /locus_tag="KLMA_80349"
                     /note="IES5"
                     /codon_start=1
                     /product="ino eighty subunit 5"
                     /protein_id="XP_022678397.1"
                     /db_xref="GeneID:34718540"
                     /translation="MPSLEVEHKKLLNRREELLKQDVSLRKDYSILLRKISSVCQVLE
                     SLGEPTHLDANGVPEFQAPDYEKFKEWDALIPLLKSVEEVQALPLDQIEVPEALSESY
                     ELFKMTPLLHKDGAE"
     gene            complement(<752586..>756599)
                     /gene="TSC11"
                     /locus_tag="KLMA_80350"
                     /db_xref="GeneID:34718541"
     mRNA            complement(<752586..>756599)
                     /gene="TSC11"
                     /locus_tag="KLMA_80350"
                     /product="target of rapamycin complex 2 subunit TSC11"
                     /transcript_id="XM_022822103.1"
                     /db_xref="GeneID:34718541"
     CDS             complement(752586..756599)
                     /gene="TSC11"
                     /locus_tag="KLMA_80350"
                     /codon_start=1
                     /product="target of rapamycin complex 2 subunit TSC11"
                     /protein_id="XP_022678398.1"
                     /db_xref="GeneID:34718541"
                     /translation="MERQGSNADLYRLRSNTNNTVNGPNGTNGANGPSTGTKRQNLVL
                     STSFVSTRRFDDGTVTPTSPLLMKHRNSTINSLRLEVNQVEQEIERLRKKKLEQERVV
                     QTSNSNDIYVDEYSTEHLENRSLRLRVNNELKETDQRIKRLQDQLSLLRIKLKRSEGG
                     SGEIINSTLNTNHNQSLMVPNGSTINNTMDISDSGSDFEVSDEATYRLTPTRSIPALP
                     FHSDDGDRSSDHLSANVMYESSTKETATWLISDHLQSLQDINASEDFILQKADGLVYL
                     LAKNPEIKEDLVISAFASTIQNLLLHADQKIRSAGYRIVRYLILNETTIDYMLKLHID
                     VFITMSLGKDNAHQEEREQALKLIRRFIDFKGYGINKAITQAIVSCIEQPEDSLRLIA
                     FETLIELTFINPTLVNDCKAFPIIQSFILDPNTKNEELAINSMIEMLSYPEIRPYFVK
                     NFHTGYILSGFSDYQTKLTGSLEKVQRSVRVVIRILQDFNGILLFALNDCQLLNQLIA
                     FAQSPLLFKHIINIFLTSLRIKKNTPERTDCSQVYQYVYLLVVMMNKADFANKMMFYA
                     VECLPKLDPSVRDNTRLVLAKVCDASMQLSTGASNFQAVKFPEQLSQYKLFHETFVFN
                     SAIYSTRSKLATTATQKIMLKSAGEMQLNSSKKDIDDIGFKKMVFDSKVLQTKNYSYW
                     NWQVIGELCRSPLLDRKRLEELSRSTKFIRRMLVFYRPFRFRFTSVASSDPMANTYVE
                     VGCLFFRALLSNNTGLRILADDTKIIPQVASVLYNNMQGHAVNDMLFTERALKEKLCG
                     GYFKIIFGVFTENNNGMSLLEKWNVFTVINLMFSKRSLCTKYLMLTLPELNLGYSRCK
                     MFLNKALLDDREMIRSIGTVTLGKKLQNLDNDDLMLEEYLIKLTCRQLYDLAPNVVAA
                     ADKILYDYCTYHVNSSNVLQPSIKNCLDQLIFIGSPTLLKLMENSEGFQQLNGLNYIN
                     RERIRWKESKNREFVPKVEQFLEQEIRKPDTVSKRSFPLHFYQFLCKLEEGANLLSKS
                     DDIRQFIMVIKRHLNDIRAHKNVTYGEKEMIELKSCMWACGFIGSTDYGINLLDKYSF
                     VSDIVELASESQYTCIKSTSFYVLGLVSYTMDGREMIEEIGWESIMDTRQQPIGVCVP
                     KDARKLLHWSDLGPVQMPPKEIEMEWPVLKRNKSSQGQSQGEEDLSSNVVVCDQEIPL
                     ENLLEWERSEASVNPNQEEEDKQELDRVIREISQSNVQNLPHVFEDDKINDRILRVVS
                     DMGNNILLNGAIKEITSLETKYGPARFQSPEMFEQIFKLMSEYRFKPSVRKFLLELFI
                     NNRSVENLIRAERRRRR"
     gene            complement(<756848..>757370)
                     /gene="AIM11"
                     /locus_tag="KLMA_80351"
                     /db_xref="GeneID:34718542"
     mRNA            complement(join(<756848..757149,757214..>757370))
                     /gene="AIM11"
                     /locus_tag="KLMA_80351"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822104.1"
                     /db_xref="GeneID:34718542"
     CDS             complement(join(756848..757149,757214..757370))
                     /gene="AIM11"
                     /locus_tag="KLMA_80351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678399.1"
                     /db_xref="GeneID:34718542"
                     /translation="MSEVASVTNMQIDKFSQQYKARRKEQMIRFFGVTALTLISARLA
                     FRGVASRKYVPSMFQLNHKPPPFSYKGEVVNALAYGTALSTGGFAMLGFGLCWIWDVS
                     TLPELGTKLKQLMGDESKPVSSATNMELDEDTKKVAEALEAMFSSNNDEK"
     gene            <757661..>757969
                     /gene="CMC2"
                     /locus_tag="KLMA_80353"
                     /db_xref="GeneID:34718543"
     mRNA            <757661..>757969
                     /gene="CMC2"
                     /locus_tag="KLMA_80353"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822105.1"
                     /db_xref="GeneID:34718543"
     CDS             757661..757969
                     /gene="CMC2"
                     /locus_tag="KLMA_80353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678400.1"
                     /db_xref="GeneID:34718543"
                     /translation="MHPQLEAERFHSCIDLIQALDKCHKKEYYKRALGLCNNEKDALS
                     KCLHEARLSGERRAILESREKKKAMEKKWKQLEEEEYGEDAILKKIIQRQVEKRSKPE
                     "
     gene            complement(<758231..>758848)
                     /gene="PUP3"
                     /locus_tag="KLMA_80354"
                     /db_xref="GeneID:34718544"
     mRNA            complement(<758231..>758848)
                     /gene="PUP3"
                     /locus_tag="KLMA_80354"
                     /product="proteasome component PUP3"
                     /transcript_id="XM_022822107.1"
                     /db_xref="GeneID:34718544"
     CDS             complement(758231..758848)
                     /gene="PUP3"
                     /locus_tag="KLMA_80354"
                     /codon_start=1
                     /product="proteasome component PUP3"
                     /protein_id="XP_022678401.1"
                     /db_xref="GeneID:34718544"
                     /translation="MSDPSSINGGIVVAMTGKDCVAIGCDLRLGSQSLGVANNFEKIF
                     HYGHVFLGLTGLATDVLTLSETFRYKTNLYKLREDRPIEPETFTQLVSSSLYEKRFGP
                     YFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASEQLFGMCESLYEPNLEA
                     DDLFETISQALLNAADRDALSGWGAVVYIIKKDKVVKKYLKTRQD"
     gene            complement(<759196..>761160)
                     /gene="YEL1"
                     /locus_tag="KLMA_80355"
                     /db_xref="GeneID:34718545"
     mRNA            complement(<759196..>761160)
                     /gene="YEL1"
                     /locus_tag="KLMA_80355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822108.1"
                     /db_xref="GeneID:34718545"
     CDS             complement(759196..761160)
                     /gene="YEL1"
                     /locus_tag="KLMA_80355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678402.1"
                     /db_xref="GeneID:34718545"
                     /translation="MDTAEEYSTPDKRVLLNGALNQSDSAMVESPKMTNIHAFIDNDD
                     VKKAQQIMQQTFHDGQYTEYANWLGLQENRCVLKEFLNLVRPWPLSLYLSLCKLSRCL
                     YLIAEAGPLDSILEELSMQWMEEHGEDAPYFQGNYKVCHIILFSLLILNSDLHNESFD
                     YKFTADQFVENTIYAVNYEMKEGDVKADEQLMKRDLAAYFVDVTNAPLPLCPRRNTSV
                     LSNGKSNGNGNGAAIASRVVSGERDTTSTVGHSNNMSPPRDNVSLAPTSHGRSSLSVS
                     RKTSIFSLRPGSSILERTMTGQSTMSSASEFSQHVDPTQFYVQEPQDEFYGQQNDSLW
                     LVDHELNFKATKANQFTPPTHEKHPNNGSSHIIMRFFKKNHSPSLSHQHQRIQNANKK
                     MQRTRAVVRMGSLELHLPKQKNKFRNHTYPSSVLKGRSADETVQKLNLFGAFAEPIGE
                     TVIELGGTSKPKCFQITLSEDQHYKNLVFECATPLQCEVYIDSINFWASRITPTPNSQ
                     FEMVSNQEYGWSEKLLNEFKANPKAFEPTKKGIRVFKWEPLYGVDSLYTNFNAQESGK
                     LQMDSQLLDWQIFVSKLRDWIDEHNNLKPTLVDMWSHSPYFELVMDNWNARYLFLNKQ
                     YHKHNEYLTVLKKAYELTNETDNETHEICT"
     gene            <762040..>763170
                     /gene="RAD51"
                     /locus_tag="KLMA_80356"
                     /db_xref="GeneID:34718546"
     mRNA            <762040..>763170
                     /gene="RAD51"
                     /locus_tag="KLMA_80356"
                     /product="DNA repair protein RAD51"
                     /transcript_id="XM_022822109.1"
                     /db_xref="GeneID:34718546"
     CDS             762040..763170
                     /gene="RAD51"
                     /locus_tag="KLMA_80356"
                     /codon_start=1
                     /product="DNA repair protein RAD51"
                     /protein_id="XP_022678403.1"
                     /db_xref="GeneID:34718546"
                     /translation="MSQVEVREEVDEQAQYEVPEAQFTVTPSQEQVESVQQQIQETDF
                     MGDDDDVGLAAFVPLDKLQVNGITTGDIKKLRENGLHTVEAVAYAPRKALMEIKGISE
                     AKADKLLAEASRLVPMGFVTAADFHSRRNEMICLTTGSKNLDTLLGGGIETGSITELF
                     GEFRTGKSQLCHTLAVTCQIPLDMGGGEGKCLYIDTEGTFRPIRLVSIAQRFGLDPDD
                     ALNNVAYARAYNADHQLKLLDAAAQMMSESRFSLIIIDSIMALYRTDFSGRGELSARQ
                     MHLAKFMRALQRLADQFGVAAVVTNQVVAQVDGGMMFNPDPKKPIGGNIMAHSSTTRL
                     GFKKGKGPQRYCKVVDSPCLPEAECIFAIYEDGIGDPREDDE"
     gene            <763741..>765825
                     /gene="SKT5"
                     /locus_tag="KLMA_80357"
                     /db_xref="GeneID:34718547"
     mRNA            <763741..>765825
                     /gene="SKT5"
                     /locus_tag="KLMA_80357"
                     /product="protein SKT5"
                     /transcript_id="XM_022822110.1"
                     /db_xref="GeneID:34718547"
     CDS             763741..765825
                     /gene="SKT5"
                     /locus_tag="KLMA_80357"
                     /codon_start=1
                     /product="protein SKT5"
                     /protein_id="XP_022678404.1"
                     /db_xref="GeneID:34718547"
                     /translation="MAASASQIHPYAQHLGVLNPVGIGRLEVEAQEREQREQREQRER
                     RLSGASSSESKGNGKAGMSLSPTQSGSVSTSTGTGATLRAVSSGGMGHGRRPKSVDLS
                     QLYLGGEKDVRFTSTNETIADESHKIISGYLGNDSAASLLSRQKTIEMYKENVKKSKN
                     PDVLFQYSQYMLQTALTMSADTAAAAADSGQVSGELSVEEQRQQFLKEALHYLKKLSV
                     KGYKDAQYLLGDSYSSGVFGKVNQKEAFVLFQASAKHGHIEAAYRTSICYEEGLGTKR
                     DSRKCIEFLKFAASRNHPAAMFKLGVYAFYAKMGLPDDIITKKNGLKWLSRAAAKANR
                     LTCAAPYELAKIYETGFLDILIADKKYAMELYVQAASLGHMPSATLLGRIYETGNEIV
                     PQDTVLSVNYYTIASHGGDPEAMMGLCAWYLIGAEPAFAADDKEAFEWALKAARLGFP
                     KAQFTVGYFYEKGKGVEPNEEKAAKWYRVAADNKDPRALNKLKMSDRATRKARSLSTF
                     NFSFLMDQKDDKTDTKSFHLNLDDQNDEDHSANSNANANAMNHRRYMSAPVDALPQQY
                     QSTTPNVPESAPAPGHVPGPGEPSLGQGLGQGPGTPSTKYNTNWETPEQYHSHIHQKS
                     LDQHSQKTPNLKPLSMHARNSSQANSSDIFGQSGNVRGKANLNSNSNTTTKEGKEKGK
                     AKNKDKKGCVIM"
     gene            <766554..>767303
                     /gene="PRX1b"
                     /locus_tag="KLMA_80358"
                     /db_xref="GeneID:34718548"
     mRNA            <766554..>767303
                     /gene="PRX1b"
                     /locus_tag="KLMA_80358"
                     /product="mitochondrial peroxiredoxin PRX1"
                     /transcript_id="XM_022822111.1"
                     /db_xref="GeneID:34718548"
     CDS             766554..767303
                     /gene="PRX1b"
                     /locus_tag="KLMA_80358"
                     /codon_start=1
                     /product="mitochondrial peroxiredoxin PRX1"
                     /protein_id="XP_022678405.1"
                     /db_xref="GeneID:34718548"
                     /translation="MLFQRTLLQSKNVMLRQQPLRTSVRFIRTFKQEEQPRLRINSLA
                     PNFTAETTVGKVNFHEYIGNSWAVLFSHPADFTPVCTTELGAFAKLKPEFDKRNVKLI
                     GLSAEGVESHQKWIKDIEEISELDKFTFPIIGDVDREVAFLYDMVDEEGFKNLNNGIV
                     ATIRSVYIIDPSKKIRLIITYPASVGRNSSEVLRVIDALQKGDSKGVVTPIDWQPGQD
                     VIIPPTVSDADASKKFGDFTTVKPYLRFTKA"
     gene            <768305..>771799
                     /gene="SEF1"
                     /locus_tag="KLMA_80359"
                     /db_xref="GeneID:34718549"
     mRNA            <768305..>771799
                     /gene="SEF1"
                     /locus_tag="KLMA_80359"
                     /product="putative transcription factor SEF1"
                     /transcript_id="XM_022822112.1"
                     /db_xref="GeneID:34718549"
     CDS             768305..771799
                     /gene="SEF1"
                     /locus_tag="KLMA_80359"
                     /codon_start=1
                     /product="putative transcription factor SEF1"
                     /protein_id="XP_022678406.1"
                     /db_xref="GeneID:34718549"
                     /translation="MSESKRSASFPNGDSIVPKKKQHQVKVEDSDVDVVVMAKDRSPE
                     AVQLKRSVSEKHDQTQPHEHSDRGRYRTSNGIKNGNEDGHGHGHGHGQSHSMSRSSSS
                     NAAANKGNKPGVNAGHRPVTSCTHCRQHKIKCNASERFPSPCSRCERMGLHCEIDPDF
                     RPKKGSQLQSLRNDVDELKVKIEYLTRNESLIAKALRQSNMGQNLLQAIKSVDFSYRV
                     AGPTQGQASKNKISVQTYLTNEPHLLQDSQPTTTNPTTSTNSKAVTPSGSDQSPGSTN
                     GSAIHNNGKPQLLNDSVPTNNTKDRLPPVLQIALKRLSQQNSQSPQTGSPSAASHSSP
                     TELPSDKQHIVATTNAMPLLPSPHANIDEFVLGDVRISIEKADELHKIFVTRLLPYFP
                     IMQSNSATELYSQSQLLFWTVILTASLSDPEPTMYNKLSSLIKQLAIETCWIRTPRST
                     HISQALLILCNWPLPNQKVLDDCSYRFVGLAKSLSFQLGLHRGKFMTEFTRTQTSMPD
                     AEKWRTRTWLGIFFAEQLWASILGLPPTSQTDYLIEKARLGDDEDLPPRLRKLICLAN
                     FQGKLCNVMGSSVISPDGLMDARERAGSLAILERELERLDVKLKFEEDAAVEIYFLYV
                     KLMICCFAFLPETPTEDQTKYVTEAYLCATKIITLLTKLLETQQLIELPIYIRHSATY
                     AALVLFKLYLTPLLLDKYVDSARQSVVTVHRLFRNQLTAWATSVENDISRTANVLEKL
                     NFVLVTHPEVFIEEDGIISRMRSHLTGTLFYDLVWCVHEARRRQMDPNYDAESVRRNK
                     EKYFKNRRKLYPLPFYNQISKEDFETITQTTPGGTTVTTLVPTKNAIKQAKQLAKSQG
                     DQNGPVTHINGIPLSMLDETGSVNIEGLFANVNLDLSRNNQNGAAGAGAGSGPLDIGA
                     RHNPATGMASGPTNQEKSNSGSQLPAVYAGDIQKSTVASAAGNSTVQLADGKPTSTVP
                     ATLASSDPRSLNHMKPSSSIMSADPNSLFSMNNSLQANIQLNKTLSNDSNSGINNNTN
                     IPNANANTSVINADSTTNNENTNININSADGNTNGNLGLSRPSDAAYPNMNVFYNPGV
                     SANNNVNPNIYSPSMGGQAQNVAGTLPSQQITSMPNANVTSELDDFFLRQSAGWIEGN
                     SSNDDFLGWFDINMAPEF"
     gene            772161..772232
                     /locus_tag="KLMA_R815"
                     /db_xref="GeneID:34718801"
     tRNA            772161..772232
                     /locus_tag="KLMA_R815"
                     /product="tRNA-His"
                     /db_xref="GeneID:34718801"
     gene            <773363..>775753
                     /gene="UBP13"
                     /locus_tag="KLMA_80360"
                     /db_xref="GeneID:34718550"
     mRNA            <773363..>775753
                     /gene="UBP13"
                     /locus_tag="KLMA_80360"
                     /product="ubiquitin carboxyl-terminal hydrolase 13"
                     /transcript_id="XM_022822113.1"
                     /db_xref="GeneID:34718550"
     CDS             773363..775753
                     /gene="UBP13"
                     /locus_tag="KLMA_80360"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 13"
                     /protein_id="XP_022678407.1"
                     /db_xref="GeneID:34718550"
                     /translation="MSTFKKWLGFQQTSSRKSSSSERRSPSHSSVEGPKNGNNVGGAG
                     LDESDGTNGHGSGHAHGHGHSERRVSENSRRESDVRANKQADEDGGDLNGNVNGNGIG
                     VESFGSVKVPSVVSPEVPFGIGATKVFGYENFGNTCYCNSVLQCLYNLTEFRTEILKN
                     PPRDASVPRVRKSSMTGSKPRVFTEASFTPQQPMVFRHAANGTLLSVNNQTLVHGDSN
                     SSSDNHRRGSLKFFKNYTESSASNSSATLACSKTKSAPSSAPGQTTTATQQGSTTASI
                     PAAAASIPIATTTGATGAAAAAATSSASASSSRPVQTVVMPSDPISEKLHENHNKIIV
                     GRTQGTPFQSSACETNNRSNSNSLSDSNSSSSSAIAGLASQTTGTATTSETATAAASN
                     ASPSTTGTITASTAVATNSSTAAHKLHNAEPTIEQRKKAALMKGPIVNIDISVADYLS
                     KGEKPTLYSALKDIFECIAENDSPIGVVSPSNFVNILKQENILFSSSMHQDAHEFLNY
                     LLNELSDSLKRLNCFKEGAHEENITFVEDLFKGSLFNSTKCFTCDNITTRDEPFLDFP
                     IEIQEDEEIKIQDILSNYKHRELLTGANKFYCDKCCGLQEAERIVGLKSLPKTLAIHL
                     KRFKYSEVHNCNAKLFNRIHYPLDLTVCSSFDNAVCKDYELNGIVIHMGGGPHHGHYV
                     AICKNDVFGWLLFDDETVESITEETVLKFIGDSQELTTAYVLIYKEASRSSGPAPNYE
                     KSIEHLIKDDEQYRRKSSAKTSDGVLQDVPEEGSNGDSKHHKTKSKLFNFKRSGKT"
     gene            complement(<775932..>776900)
                     /gene="PRS4"
                     /locus_tag="KLMA_80361"
                     /db_xref="GeneID:34718551"
     mRNA            complement(<775932..>776900)
                     /gene="PRS4"
                     /locus_tag="KLMA_80361"
                     /product="ribose-phosphate pyrophosphokinase 2"
                     /transcript_id="XM_022822114.1"
                     /db_xref="GeneID:34718551"
     CDS             complement(775932..776900)
                     /gene="PRS4"
                     /locus_tag="KLMA_80361"
                     /codon_start=1
                     /product="ribose-phosphate pyrophosphokinase 2"
                     /protein_id="XP_022678408.1"
                     /db_xref="GeneID:34718551"
                     /translation="MCENMSTNSIKLLAGNSHPDLAERIAKKLGLPLANIGVYQYSNQ
                     ETSVTIGESIRDEDVYIIQTGTGEQEINDFLMELLIMIHACRTASARRITAVIPNFPY
                     ARQDKKDKSRAPITAKLVAQMLETAGCDHVITMDLHASQIQGFFHIPVDNLYAEPSVL
                     HYIRHNTDIDNAILVSPDAGGAKRVASLADKLDLNFALIHKERQKANEVSRMVLVGDV
                     TGKSCLLIDDMADTCGTLVKASETLLEHGAKEVLAIVTHGIFSGSAEQKLNNSRLSRI
                     VCTNTVPVDLDINILDQIDISPTLAEAIRRLHNGESVSYLFTHAAI"
     gene            <777598..>778356
                     /gene="UBC6"
                     /locus_tag="KLMA_80362"
                     /db_xref="GeneID:34718552"
     mRNA            <777598..>778356
                     /gene="UBC6"
                     /locus_tag="KLMA_80362"
                     /product="ubiquitin-conjugating enzyme E2 6"
                     /transcript_id="XM_022822115.1"
                     /db_xref="GeneID:34718552"
     CDS             777598..778356
                     /gene="UBC6"
                     /locus_tag="KLMA_80362"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 6"
                     /protein_id="XP_022678409.1"
                     /db_xref="GeneID:34718552"
                     /translation="MASIQANKRLTKEYKNIVNNPPPYIVAAPHEDNILEWHYVITGP
                     PETPYENGQYHGTLTFPSDYPFNPPAIRMITPNGRFTENTRLCLSMSDYHPEAWNPAW
                     SVVTILNGLLSFMTGDEQTTGSISTSDREKRILAKKSKYFNTYKNVKFKNMFPDMVES
                     NIEDLEKEAAMEAQSKMLQQKEESDAQKFAAEKATSLDDISDPEDRVRIQELLKLETE
                     KKRENKDVRENSSIKSLLCLALAIAIFFVGLIMK"
     gene            complement(<778487..>779773)
                     /gene="AST1"
                     /locus_tag="KLMA_80363"
                     /db_xref="GeneID:34718553"
     mRNA            complement(<778487..>779773)
                     /gene="AST1"
                     /locus_tag="KLMA_80363"
                     /product="protein AST1"
                     /transcript_id="XM_022822116.1"
                     /db_xref="GeneID:34718553"
     CDS             complement(778487..779773)
                     /gene="AST1"
                     /locus_tag="KLMA_80363"
                     /codon_start=1
                     /product="protein AST1"
                     /protein_id="XP_022678410.1"
                     /db_xref="GeneID:34718553"
                     /translation="MADKILAKHDPQLEFVAKYNHDSPNPRELPTPIEMRRVARPLRH
                     IKHIPVKSLIFYSNNHPPQFSYETKIKTPIPPDELTVQVEYVGLNPVDLKIFNSYQSH
                     MNYEIGIGREYYGKVSEVGSNLKDVWHVGDEVCGTYWHPNLAKGTCESTILINPKVDV
                     IIPKPVNITEQQASCVFYCLGAAFNILDQLDQEGKLNQESNILINGACTMTGLFALQL
                     LKFHYRILKKVVLVCSTPGMAFIKSNLPELVDELLFIDYIGANGKINKPLEDLVTNNE
                     LVEYSSDTGDMVTQPFGQGKFNLVLDFIGGYSIIEHSNAIMTKGATYVTTVGDYKSNY
                     KKDTFSSWGNPSASMRKVFGKLFWSFDYRMFYFDPNQKLATNDWPKKCHELVESETIK
                     FIPVDKVYDWKDVEKAFRHLRTGRVHGKVVLKVEKF"
     gene            complement(<780249..>780497)
                     /gene="DPH3"
                     /locus_tag="KLMA_80364"
                     /db_xref="GeneID:34718554"
     mRNA            complement(<780249..>780497)
                     /gene="DPH3"
                     /locus_tag="KLMA_80364"
                     /product="diphthamide biosynthesis protein 3"
                     /transcript_id="XM_022822118.1"
                     /db_xref="GeneID:34718554"
     CDS             complement(780249..780497)
                     /gene="DPH3"
                     /locus_tag="KLMA_80364"
                     /codon_start=1
                     /product="diphthamide biosynthesis protein 3"
                     /protein_id="XP_022678411.1"
                     /db_xref="GeneID:34718554"
                     /translation="MSTYDEVEIEDMTFDADTQIFTYPCPCGDRFQISIDDMYDGEDI
                     AVCPSCSLMIQVIFDKEDLIEYYKEANLEPPEPIAVAA"
     gene            <781537..>782423
                     /gene="RPS8B"
                     /locus_tag="KLMA_80365"
                     /db_xref="GeneID:34718555"
     mRNA            join(<781537..781565,781814..>782423)
                     /gene="RPS8B"
                     /locus_tag="KLMA_80365"
                     /product="40S ribosomal protein S8"
                     /transcript_id="XM_022822119.1"
                     /db_xref="GeneID:34718555"
     CDS             join(781537..781565,781814..782423)
                     /gene="RPS8B"
                     /locus_tag="KLMA_80365"
                     /codon_start=1
                     /product="40S ribosomal protein S8"
                     /protein_id="XP_022678412.1"
                     /db_xref="GeneID:34718555"
                     /translation="MNSKTESKSTKMGISRDSRHKRAATGAKRAQFRKKRKFELGRQA
                     ANTKIGAKRIHTVRTRGGNKKFRALRIETGNFSWASEGVARKTRITGVVYHPSNNELV
                     RTNTLTKAAIVQIDATPFRQWYEAHYGQTLGKKKNSKTEEETAVNSKNTERKWAARAA
                     NAKIEHAVEAQFGAGRLYAAISSRPGQSGRCDGYILEGEELAFYLRRLTAKK"
     gene            <783393..>784520
                     /gene="AAR2"
                     /locus_tag="KLMA_80366"
                     /db_xref="GeneID:34718556"
     mRNA            <783393..>784520
                     /gene="AAR2"
                     /locus_tag="KLMA_80366"
                     /product="A1 cistron-splicing factor AAR2"
                     /transcript_id="XM_022822120.1"
                     /db_xref="GeneID:34718556"
     CDS             783393..784520
                     /gene="AAR2"
                     /locus_tag="KLMA_80366"
                     /codon_start=1
                     /product="A1 cistron-splicing factor AAR2"
                     /protein_id="XP_022678413.1"
                     /db_xref="GeneID:34718556"
                     /translation="MNIFLDNVPAGSTIGIDFNHFQLPASKPFHGFKHVPRYNSSNIH
                     IVHFQHDESGIRYGYWINTESIKFCSFSYDSQREIMVFQNGSEPQMEYRFEQCQHLML
                     EYPENEDSDQWRQLVSRIKWKEVCHWVRQEQDDPNFLAFVDSTMTTAEESNLLQQRAS
                     NAQQSTILAPATESTLQYTPIRFKHPESMRPDHKMEDFLDKSYYLTCVILPKYHYSSV
                     HSLMGELQFCYLNSVLFANYGSSMQWHNIIELVCFSQALCEGKYRVIMQELDDMLCMQ
                     TSRIPEEYMEFLINEALMARCQAESPVPLPHWKQMLAARAAEAGGGAGGGGDAAAADT
                     NFMSRDITENNNFASFVDSESEEDEYQPAVASQVVYRRREA"
     gene            <785732..>787684
                     /gene="SSA3"
                     /locus_tag="KLMA_80367"
                     /db_xref="GeneID:34718557"
     mRNA            <785732..>787684
                     /gene="SSA3"
                     /locus_tag="KLMA_80367"
                     /product="heat shock protein SSA3"
                     /transcript_id="XM_022822121.1"
                     /db_xref="GeneID:34718557"
     CDS             785732..787684
                     /gene="SSA3"
                     /locus_tag="KLMA_80367"
                     /codon_start=1
                     /product="heat shock protein SSA3"
                     /protein_id="XP_022678414.1"
                     /db_xref="GeneID:34718557"
                     /translation="MSKAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTD
                     TERLIGDAAKNQAAINPANTVFDAKRLIGRKFDDPEVVNDAKHFPFKVVNKDGKPNVQ
                     VEYKGETKVFTPEEISSMVLTKMKETAEAYLGTTVKDAVVTVPAYFNDSQRQATKDAG
                     TIAGLNVLRIINEPTAAAIAYGLDKKGSSEHNVLIFDLGGGTFDVSLLTIEDGIFEVK
                     ATAGDTHLGGEDFDNRLVNHLANEFKRKNKKDLTNNQRSLRRLRTAAERAKRALSSSS
                     QTSIEIDSLFEGVDFYTSITRARFEELCGDLFRSTLDPVEKVLRDAKLDKSQIEEIVL
                     VGGSTRIPKIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSKTQDLLLL
                     DVTPLSLGIETAGGIMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERTKTKD
                     NNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSALEKGTGKTSKITITNDKGRL
                     SKEEIERMVSDAEKFKAEDEAEAERVQTRNSLEAYAFSLKNTVGESGFKEKVDAEDAS
                     KLEKAVEETISWLDASQAASTDEYKERQKELEEVANPIMTKFYSAGGAPGGAPGAAPG
                     GFPGGAAPGGAAPGGGDSGPTVEEVD"
     gene            <788605..>791826
                     /gene="ILS1"
                     /locus_tag="KLMA_80369"
                     /db_xref="GeneID:34718558"
     mRNA            <788605..>791826
                     /gene="ILS1"
                     /locus_tag="KLMA_80369"
                     /product="isoleucyl-tRNA synthetase"
                     /transcript_id="XM_022822122.1"
                     /db_xref="GeneID:34718558"
     CDS             788605..791826
                     /gene="ILS1"
                     /locus_tag="KLMA_80369"
                     /codon_start=1
                     /product="isoleucyl-tRNA synthetase"
                     /protein_id="XP_022678415.1"
                     /db_xref="GeneID:34718558"
                     /translation="MSAEGSTFFSFPREEEKVLAFWNEIDAFQTSLKLTEGKPEFSFF
                     DGPPFATGTPHYGHLLASTVKDIVPRYATMTGHHVERRFGWDTHGLPIEHIIDKKLKI
                     TCKEDVYEYGIENYNNECRAIVMTYADEWRKTIGRLGRWIDFDNDYKTMYPSFMESIW
                     WAFKELHDKDQVYRGFRVMPYSTGCTTPLSNFEAQQNYKEVNDPAVTIAFNVVGQEKT
                     KLVAWTTTPWTLPSNLALCVNPEFEYVKIYDEKKDTYYILMESLIKALYKKPAQEKYK
                     VVEKIKGKDLIGLKYEPLFPYFVKDFGEIAYRVIGDSYVSNDSGTGIVHNAPAFGEDD
                     HRVCLANGIITEDSPLPNPVDDNGKFTEEVTDFAKMYVKDADKEIIKYLTASGNLLLH
                     SQIRHSYPFCWRSDTPLIYRSVPAWFVRVKNIIPQFLESVKKSNWVPNVIKEKRFANW
                     IANARDWNVSRNRYWGTPIPLWVSDDYEEIVCVGSVAELKELSGVQDITDLHRDTIDK
                     ITIPSKMGKGVLKRVEEVFDCWFESGSMPYASQHYPFENTEKFADRVPANFISEGLDQ
                     TRGWFYTLGVLGTHLFGEVPYKNVIVTGIVLASDGKKMSKSLKNFPDPNIILDKYGSD
                     ALRLYLINSPVLKAEPLKFKEEGVKEVVSKVLLPWWNSFKFLDGQIALLKKNSDVEFK
                     YDPTLKSDNVMDRWILASLQSLVAYIHQEMASYKLYTVVPRLLDFIDELTNWYIRFNR
                     RRLKGEGGVDDCLKALNTLFDALFTFVRAMAPFTPFLSDNIYSKLRPYIPEEVLSKHS
                     TDSRSVHFLSYPEVNEELYDAHIEKAVKRMQSVIELGRNIREKKTISLKTPLKTLVIL
                     HSDPEYLKDVEALKQYIIEELNVRDVVITSEEDKYGVEYRAVADWPVLGKKLKKDAKK
                     VKDVLPTLTSAQVKNYLATGEIEVAGIPLVKGDLSAIRGLPESAVQDGQETRTDNDVL
                     IILDTKIYEELKTEGLARELINRVQKLRKKCGLEATDDVIVKYELVKDTINFEDIVKD
                     HHEMLTKTCRSEISKAEGTETDPLADEELSINDTIFKLKIFRL"
     gene            <792180..>792752
                     /locus_tag="KLMA_80371"
                     /db_xref="GeneID:34718559"
     mRNA            <792180..>792752
                     /locus_tag="KLMA_80371"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822123.1"
                     /db_xref="GeneID:34718559"
     CDS             792180..792752
                     /locus_tag="KLMA_80371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678416.1"
                     /db_xref="GeneID:34718559"
                     /translation="MHEVPSSPLTECSGRNSDFDSLEQEYNDRVGSNITDDILEDRKQ
                     KHHAFKQPLSSSSPIKENLRERRRDRLRELAREKKTNSYRSDIEQFIMRQEYLRHLQE
                     MEREAEKHVISLDEIDRLIDEDLDPVLDKKPSVSIEEKPSNQRSDKEKELEDDDDSEL
                     IRLIEIQQEYEFLMKQEQQELEETLSSFTL"
     gene            <793407..>793781
                     /gene="ATG8"
                     /locus_tag="KLMA_80372"
                     /db_xref="GeneID:34718560"
     mRNA            <793407..>793781
                     /gene="ATG8"
                     /locus_tag="KLMA_80372"
                     /product="autophagy-related protein 8"
                     /transcript_id="XM_022822124.1"
                     /db_xref="GeneID:34718560"
     CDS             793407..793781
                     /gene="ATG8"
                     /locus_tag="KLMA_80372"
                     /codon_start=1
                     /product="autophagy-related protein 8"
                     /protein_id="XP_022678417.1"
                     /db_xref="GeneID:34718560"
                     /translation="MKSAFKSEFPFEKRKAESERIVQKFHNRIPVICERGGKSDIPDI
                     DKRKYLVPGDLTVGQFVYVIRKRIKLPAEKAIFIFVNDTLPPTAALMSSIYQHHKDKD
                     GFLYVSYSSENTFGGAGPLLEK"
     gene            complement(<794759..>799126)
                     /gene="NUP170"
                     /locus_tag="KLMA_80373"
                     /db_xref="GeneID:34718561"
     mRNA            complement(<794759..>799126)
                     /gene="NUP170"
                     /locus_tag="KLMA_80373"
                     /product="nucleoporin NUP170"
                     /transcript_id="XM_022822125.1"
                     /db_xref="GeneID:34718561"
     CDS             complement(794759..799126)
                     /gene="NUP170"
                     /locus_tag="KLMA_80373"
                     /codon_start=1
                     /product="nucleoporin NUP170"
                     /protein_id="XP_022678418.1"
                     /db_xref="GeneID:34718561"
                     /translation="MSIYSTPLKSNWNGNPNFSNPQPNVVNGIGNSSSLFTQHPTSDA
                     NLNTFGTNMTNMLSGLNGNTVNPLNFDASNEHIRISGLGAANPLQLASQYIDHLLRRD
                     SSTPVLDERSYYNNGVNYNFSKEVGGLGPFTPFERLNVINIPDEILQQLSKAEIKSNM
                     GLFPDIERCWITIDNKLILWHYNNPSDFQSIDDIKHTILHVALVKPKPNTFVESINHL
                     MLITTPFDIYLLAVSYDKISGSFNIFNTGMSVSVHGLDVHEIVYYEKTGQIFFSGSNN
                     GTNIWELQYSSSEDWFNNKCSKVCLTQSALLSLLPTNIFAKIPGSALVQSFFEEDSKY
                     AQEHITHLTIDQSRGILYSLTSKSVIRAYKINSKSLDGPTTIEPSYIKRIMGTTPARG
                     AAILGNKYLKVVKIEVVSVQENNNLFLVAITIGGVRLYFNGSVGPNSVEALRLESMKF
                     PPSSVSPETIELELQQQQQQQARKLTPFYSSLNSMESVQLKYQKKSSVLLESSKASSI
                     ISPGIFFSSVIKHPSEQLSNTIETTTPTGKKTPAQHKLFVSVPDYGILKNHGRYVENS
                     VFLDTTAPVKQIVPITPLFNATNKPEGYANAFATQYSVEPLKVAVLTNTSVEIYKYRN
                     PDQVLESLINNPLPFIVNYGLVETCSSALFVTCKFNKSEALRSNALTLFTVGIPNVVE
                     IKPAYNKYANSAVSTLLGKPTLNLMTPQKSSTELAKQSNAISTPNISGANNFNLDDVI
                     LSARFYGTAVLIARLFRDIWDKNVFEVDPRVKFNPDNTVVKSSVKNDSIISKVYVSRG
                     DIEYYLSSVMILNEFFQSYGNSITTISNVSPINGEKTVDKGEDVAHQAENIAMNSIIK
                     LLQSIKESLSFLNVLFEESEVDGYEGQYLAFVDIMKYLNLDIQSDLGRLKFKDIFNPN
                     EQTKTLIREILSSIINRSITKGGSIEYIATALQERCGSFCSTGDVLGFRAVEHLRKAK
                     EIGLRDQETLNYHLTNAAKLFERIVDDISLDKIKEAVNIMLELNYYPKTVEFLLNIAN
                     AMDKGKLAFQYVADGCLDHDERKKYYDARVSIYEIVFETLIKVDQLASSVENVTNQDI
                     QKTRDEVYDVALKYNDKLFHYQMYDWFVQQNSEDKLLQLDTDFILPYLEEKAAKSLKI
                     SNLLWVYQSKRSHFLETAQILYSLAISDFDIDLQTRIEYLSRANGFCNGVCPPSQRQA
                     MIQLSGMIQEVVDVASIQDDIIQTLKDDVRVNPSVRQDALKQLEGKILTVTELYNDFA
                     APLSYHEICLLIFKISDFRNHEEILSKWQELFDSMKENIAESETMDELDRSTTFINLL
                     SSTVVRVGKNVRTSEFVFPVVDLFPLISNLINENLSKEYIKPGSIASIFIKAGVSYDR
                     LYYVLKDLIETTTDHNEIYDNEIVWLIKEWYQSDRKLRDLIPLEEIRSLDKYSIENDP
                     LEKYRKRTGDNVLILNSNA"
     gene            <799818..>800756
                     /locus_tag="KLMA_80374"
                     /db_xref="GeneID:34718562"
     mRNA            <799818..>800756
                     /locus_tag="KLMA_80374"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822126.1"
                     /db_xref="GeneID:34718562"
     CDS             799818..800756
                     /locus_tag="KLMA_80374"
                     /note="containing MAM1 super family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678419.1"
                     /db_xref="GeneID:34718562"
                     /translation="MVAKLRRKTPLYPQDVNANSAKRMCLKNNILLEDLNKENIPFEP
                     NVAWEGPESSGSNLTGFLNEHLERKLAEKDLVTRPKSQGQECLTASSLGNLQSTLKDF
                     ETKLCIQNRDCFIKDAHYSDDNLTQCRINLLFELESLPNLSWAQKGNLRTAKYIPSVY
                     QSLDPDWYLNPAFSIDDFSNLPEEAKLYNVLSPLLEESTLSEEQKSEPEAPDNAKVEI
                     ENIGPSSYVIPSSKLKFRGKSTAFNEDIEYQSLLKVKVLENDNDDDIGEREEDENDNY
                     DQISLPDSLDHCKSIKKRFTNTRKRLNKNSIMFHKK"
     gene            <801089..>802708
                     /gene="PET112"
                     /locus_tag="KLMA_80375"
                     /db_xref="GeneID:34718563"
     mRNA            <801089..>802708
                     /gene="PET112"
                     /locus_tag="KLMA_80375"
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit B"
                     /transcript_id="XM_022822127.1"
                     /db_xref="GeneID:34718563"
     CDS             801089..802708
                     /gene="PET112"
                     /locus_tag="KLMA_80375"
                     /codon_start=1
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit B"
                     /protein_id="XP_022678420.1"
                     /db_xref="GeneID:34718563"
                     /translation="MLSFKRDYTTRAITSKFKLLPEYKLKCGLEIHTQLSTINKLFSL
                     STNNPFADIEKPNYHTSYFDISLPGTQPLLNYEVVLYALRLSLALNCKVNLNSHFDRK
                     HYFYGDQPLGYQITQHYSPFSSAGKLRLFKELDAIDEPFKDIAITQLQIEQDTGKSTY
                     DATDSMTKIDLNRSNVPLIEMVTEPDFTDLKQIRAFIKKYQNLVRHLKISTGDLETGA
                     MRVDVNLSINDHARVELKNLPNTSSINNAIKYEYMRQVKLIQNGEGNKLNHPETRGWT
                     GSETVKLRSKESVIDYRYMPDPELPNISLDNGVVDDVQKTLPLSPDDICNSLLHEPYK
                     LSLKDAKILTFNSNGRDDLYSNEELRDYYLETFKAYKVLCDKQNIQFVRKLPANWIIH
                     ELLGNMNKLEVPLKNLRCILPPEKFADLLVLISDQTLSNSSGKLLLSHILNNFKENPH
                     DLNKNIDFEALIDEYDLHAVSNVNDEELEAICRQITNELNNDKMIRDIVSGKKKGSLK
                     FLVGQGMRLSQGRVSAQKFEQTFKKILNVNW"
     gene            complement(<803144..>804277)
                     /locus_tag="KLMA_80376"
                     /db_xref="GeneID:34718564"
     mRNA            complement(<803144..>804277)
                     /locus_tag="KLMA_80376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822129.1"
                     /db_xref="GeneID:34718564"
     CDS             complement(803144..804277)
                     /locus_tag="KLMA_80376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678421.1"
                     /db_xref="GeneID:34718564"
                     /translation="MPGQLVNVAFFSQVEDMNMYLTDYRSSKQNSQQQVYAQQTAHRY
                     NHQLKMNSTQYLNFNSMQQQGAYPQSQNMHQQHQQQTQQINRKKYNNGTTFAQSSNFN
                     VRSRQQVNSGKYNQPYQQSVTSIYNNAVNQYNFPSGLFGGYTSTPNLPYSKSGINQSG
                     DGPFTNDYNDQLLKEGNYDNLSLLSNNSPNVSNSSLGQFNNSVGNISQIPDSRACFSP
                     NSSITPPPIPPSRLSSTLSSASVTSSICNDLDFVLPNEGGNTHPFVQQQPQQQQQQSR
                     FLSQLPQTSQQSFASFGNQLVEQSFSQDHDLLNSLNQSSSLSTEQHDLHLPYGRNPYQ
                     SDTFPSTFLVSQTNAAWNNDNSSRPTTTTSSNSIWNSDMSVWS"
     gene            complement(<804996..>806108)
                     /gene="GLE2"
                     /locus_tag="KLMA_80377"
                     /db_xref="GeneID:34718565"
     mRNA            complement(<804996..>806108)
                     /gene="GLE2"
                     /locus_tag="KLMA_80377"
                     /product="nucleoporin GLE2"
                     /transcript_id="XM_022822130.1"
                     /db_xref="GeneID:34718565"
     CDS             complement(804996..806108)
                     /gene="GLE2"
                     /locus_tag="KLMA_80377"
                     /codon_start=1
                     /product="nucleoporin GLE2"
                     /protein_id="XP_022678422.1"
                     /db_xref="GeneID:34718565"
                     /translation="MSFYRTSNSSSSSTPSTMATEKDLANDIVLNNAAEDSISDIAFS
                     PQSDFMFSVSSWDSKVRIWDVQNGVPQGRAQYEHQAPVLTTRWSFDGTKIASGGCDNV
                     LKVFDVTTGQAQQIGQHNSAIQSLRFVSCGPTNQQCIATGSWDKTVKYWDLRSPQPIT
                     TLQMPERVYCMDSSQKLLVVGTAERHLVVIDLNNPGQIFKTSLSPLKWQTRSISCYNE
                     GNGFAIGSIEGRCAVQYIDEQEQRKDGFSFKCHRQQVQNNGAAGGRTSTEVQVFPVNS
                     IVFHPIHGTFATAGADGSFHFWDKNHRHRLKGFPRLNYSIPVCQFNRTGSVFAYALSY
                     DWHQGHTGNRPDYPNVIRLHATSDEEVKAKKKTTTR"
     gene            complement(<806816..>809575)
                     /gene="FLO8"
                     /locus_tag="KLMA_80378"
                     /db_xref="GeneID:34718566"
     mRNA            complement(<806816..>809575)
                     /gene="FLO8"
                     /locus_tag="KLMA_80378"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822131.1"
                     /db_xref="GeneID:34718566"
     CDS             complement(806816..809575)
                     /gene="FLO8"
                     /locus_tag="KLMA_80378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678423.1"
                     /db_xref="GeneID:34718566"
                     /translation="MREVYAGQTGITDAGWSASGPGGGGPGRGPGLRSNNGNDGSGIM
                     NNSNENSGMGNTNGVDDHLRGSISGSPGSRYVGENAGGPSPAGKYDDARIKKLLNVFI
                     HDFLIKSELKETAQLFEREASLIGKDKMISASHDVPEGFLYEWWQIFWDVFNARTHRG
                     GSEVARKYFEMQLQRQRQEHTYRGVTMHVARVQQTAEQKGYYQHEILDPMELASVASY
                     GAQSQFNPGGPVPSTVGPSAPAGQAAGSGTNAGTGVPAGSAMPSSATSSTFPGYSSEY
                     PAMQGIMSNNHPSLQTVQQDALHHNMPQHQHPQQQQQQHHHHQQQQQQQQQQQQQQQH
                     QQQHQQQQQQHQQQQQQQQQQQQQQQQQQQQFQAFYNSVHGIPNSGYYASPVNPYVNQ
                     PPQQPLGYNMGANNMTNPVHLKNNNGRPAGTGTGAGNGSGNGPNTFNSNSTDSNNGNT
                     NKANAHLGNSKNGRGPNNNSSESLGNNDHLAGNSAPAYATNMAAPNHIPNSMQGQHPS
                     FTKNASFSQQLGSIPTYINMNIPNSAPVIPTQKNGQVPVNSNNQNPLIQQGVHPNAPN
                     YSNQIPNTSGVNNISMNNMNNIRGSNMMGINQGANPSFEMSSMDGLYNYQKELLMLEK
                     ENKKVLSIAKDGPHSSGSTPHSFTLSNSTNINGKKNSNAMLPPNSSQIASPQNQSPLN
                     GGGASNAGTNNTIPKKRKYTKRSKESKKSQSEPNTPNISALTPGSANGRNANMTSSLN
                     TTHEHYSNNNSPRIKIQKNSSTTDSHSPLTLTTEASVEQNKGSTSSKRSQKSSNASKQ
                     GSTSSNPGSVLASASILSSNKSKKATSKKTPINAATPQNAEDHGSGTTSSKDPGSNNS
                     IGLLPHNVLTDPTPHTDFDPMSIDPALSASSAFEFGDDDDSMLGILDNGAFGKKGDSF
                     PNSHN"
     gene            complement(<810935..>812344)
                     /gene="ALG3"
                     /locus_tag="KLMA_80379"
                     /db_xref="GeneID:34718567"
     mRNA            complement(<810935..>812344)
                     /gene="ALG3"
                     /locus_tag="KLMA_80379"
                     /product="dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl
                     mannosyltransferase"
                     /transcript_id="XM_022822132.1"
                     /db_xref="GeneID:34718567"
     CDS             complement(810935..812344)
                     /gene="ALG3"
                     /locus_tag="KLMA_80379"
                     /codon_start=1
                     /product="dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl
                     mannosyltransferase"
                     /protein_id="XP_022678424.1"
                     /db_xref="GeneID:34718567"
                     /translation="MSQEVDPARQNDAVEPKVEDTVSDGMNKEEKFERPPFTPLQDCI
                     DAFNYIMWNPEAHFITLPLLLILESLAMKIIQKAVSYTEIDYTAYMEQIWMIKNGERN
                     YLNIAGGTGPLVYPAGHVVIYKVMESISDGLEKIPNAQQFFRYLDLVTLFVQFAIYYI
                     LKVPSAYVVFAVLSKRLHSIYVLRLFNDCFTTLFVSLSVLLLITSTKVQRRRRRSIVV
                     CIASVFYSMAVSIKMNALLYLPGVLLSVYLLEKGNLFKTFLNIVIMFTWQVVVAIPFW
                     REYPKEYLKGAFDFGRQFMYKWSVNWQMVEEEVFLNPVFHRALLVSHCVVLLMFIIFK
                     MLPMTVDQTISACKSSLLHPFTSVLPASVNLTATTVAYTLLVTNYIGILFARSLHYQF
                     LAWYHWTLPVILYWSPLPYPVCVAWYAAHEWCWNSYPPNATASALLHFCNATMLVLVW
                     LGRRSTSAVPASVTKDKQE"
     gene            complement(<812774..>816115)
                     /gene="KAP123"
                     /locus_tag="KLMA_80380"
                     /db_xref="GeneID:34718568"
     mRNA            complement(<812774..>816115)
                     /gene="KAP123"
                     /locus_tag="KLMA_80380"
                     /product="importin subunit beta-4"
                     /transcript_id="XM_022822133.1"
                     /db_xref="GeneID:34718568"
     CDS             complement(812774..816115)
                     /gene="KAP123"
                     /locus_tag="KLMA_80380"
                     /codon_start=1
                     /product="importin subunit beta-4"
                     /protein_id="XP_022678425.1"
                     /db_xref="GeneID:34718568"
                     /translation="MDQQFVAQLEQTLGAIVQPAGNLKDATKALQSQFYTQAAALPAL
                     IHILQNSTNDGIKQLAGVEARKQVAKHWGSLDAATQSSIKQSLLNSAFSEEKDAIRHA
                     NARVIASIGSEELDEKKWPELIPNLLQAACDSNPKIRETAVFIILSLLESFNANLSLH
                     IDDFLNLFAQTINDSASLETRSLSAQALSFVSSLIEEEGDINPQYAAKFASLIPSVVQ
                     VLDATIKENDTTNTKLIFNCLNDFLLLDSQLTGNSIADLVKLALQIAVNVDVDEDIRV
                     FAVQFVTSALVYRKSKINQAKLGPEITLAALKVASEEIDVEDELTNEDEAGENEENTP
                     ALTAIRLISNASGELSPSQVGVPIIEHLQTMLSSSNPFERRGILLAISVLVSGSPDYT
                     LSQFDKIIPATITGLKDSEPVVQLAALKCIVQLSTNLQEEVARYHEQYLPLVIDIIDS
                     AKHVVIYKYATLALDGLLEFIAHNDIIKYLEPLMNKLFQMLDTQQSPKLRAAIVSAIG
                     SCAFAAGSGFVPYFKTSVQYLQQFIQNVSQVEGLSEDEIELKALTFENISTMGRAVKS
                     ATFAEVAEPLVNAAYEAIKTDSARLRESGYAFIANMAKVYGKEFAPFLQTILPEIFKT
                     LEQEEYQFNFDGDEDFLEGIEDLDEEELQSKFTVNTGIAYEKEVAAAALSELAIASRE
                     HFLEYVEPSLKVLTEQVNESYGLKETALHSMWAIVKAVLLTANLKEGEYPKGIPSGSY
                     VDASALAVIQSVREVSLNNVIEEVETSMVISVFQDVAEMLRLFGPIIIMDNGNSTQLD
                     QLCREVLAVLKGEHACQTIHFEEDIPQDEDLDASETEATLLDVALDVYVALAANLVGG
                     FAQVFTAAKPVILQLCQSKSKNKRSFAVGALSEMALGMREENPFIQELLEALIISLTS
                     DKSLEVRCNASYGIGLLIEYSSFDVSAVYTPVLKSLYEILSVADEKNLVSEDDEATKE
                     IVDRTFSNVCGCVARMTLKHQNLVPLEHTLPALLNHLPFNTAFEEYDPIFKLFLKLFQ
                     EQNSIIVKEAPKVIEIFGTVFEKEAERIELETNSTLGREENLEKRKQFQTEEIKQQVI
                     ELLKHLNQQFNGAVAQNPVLAQVIA"
     gene            complement(<816692..>819568)
                     /gene="SWI4"
                     /locus_tag="KLMA_80381"
                     /db_xref="GeneID:34718569"
     mRNA            complement(<816692..>819568)
                     /gene="SWI4"
                     /locus_tag="KLMA_80381"
                     /product="regulatory protein SWI4"
                     /transcript_id="XM_022822134.1"
                     /db_xref="GeneID:34718569"
     CDS             complement(816692..819568)
                     /gene="SWI4"
                     /locus_tag="KLMA_80381"
                     /codon_start=1
                     /product="regulatory protein SWI4"
                     /protein_id="XP_022678426.1"
                     /db_xref="GeneID:34718569"
                     /translation="MMDHMLHHGGNVFDKESIMQLEMGSHHSDNDTLMKPFNSEVSIV
                     NMDAEADADGVARDIPLHERSSRSSSSSVLNDENIDTGLKKISEEPTMAETNGYDKES
                     QTYIEIATYAGVDVYECYTKDKPPCLIMRRCADNWLNITQVFKAGSFTKAQRTKILEK
                     EANEIKHEKIQGGYGRFQGTWIPWESTKYLVEKYNINSKVVKRIVEFIPDPNDMPPKR
                     SKVSQIKKLDPNARITSPSAYKKTPKKNSKTPMKKKSVRKSSKKEKTIQPSPLQNIMF
                     QTPQQHQQNQTENQSTEKLSTLPSEQETPMVPVSKVNPGIISQANHPIKYQTTQKPLQ
                     FYPYPQAHQFQQMVPGSSNGAPLQVNTNHSSLNPQGSMKMMKQMMQTNGKSVGHSTGS
                     IVSNITSNGSSMEIFSSHDKSSSSSSESPTPVAQLNEKATASPEHYKELILEVLSSEY
                     DSVEPPLPEALYRPPSNFDINFLIDDQGHTSLHWAVAMSNIPLIKVLLVQNADLFRCN
                     NKGFNCLTKSVFYNNCYKTGSFQQIISMLHPCLITPDANDRLPLHYLVELTVNKSKEP
                     HVIEFYMDTILDTLAKEDEKLLRMSLNHQDTLGNTPLHLAALNKNVDLCQKLVYFGAS
                     PDILNGENQTISMILSRFTVPNIFQPSLPAQFLQSPPKTAFLSNTPRNSQEDHIEDTS
                     KYEFNDTTMDSIQVSATRTGGHHLPDRTNDILSMDKMKGSLTPAIKLHPPSPPTLLKS
                     KNRISKPPHAEKVQKLQEPAYSAQEHEQTAKTSTTKATSQLRDLTGSLTNIIDNSLAN
                     LQYEIQLKEEQINEIEHQLKHTTTKEKSISEANNQKTLASIQHQLKMKNIELDNYMER
                     SQALSLATLVQDEENSFSRTSSAEATSEVEKKEAVRLIVELCYKQFKRRQLIRRIKHA
                     RDQLVSDTKISKFRKLIGMSIDNIDSKLNDIEQDLRSMERTQCS"
     gene            <820211..>820735
                     /gene="LSM4"
                     /locus_tag="KLMA_80382"
                     /db_xref="GeneID:34718570"
     mRNA            <820211..>820735
                     /gene="LSM4"
                     /locus_tag="KLMA_80382"
                     /product="U6 snRNA-associated Sm-like protein LSm4"
                     /transcript_id="XM_022822135.1"
                     /db_xref="GeneID:34718570"
     CDS             820211..820735
                     /gene="LSM4"
                     /locus_tag="KLMA_80382"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm4"
                     /protein_id="XP_022678427.1"
                     /db_xref="GeneID:34718570"
                     /translation="MLPLYLLTNARGQIMRIELKNGETVEGTLSDVDNWMNLMLSDVT
                     HVASGETLKLPSFYLKGSFIKYINLQDDVIDKVKQQWGQNRGGKDDRRRGGNNYNNGS
                     NFHQNRDGGNRRGGRRNYQNSGSRRDYNNNGNNNNSNNNGGGSRRYNKSQYDPATSGA
                     NSQQPKQQQQHPQF"
     gene            complement(<821291..>823318)
                     /gene="TMN3"
                     /locus_tag="KLMA_80383"
                     /db_xref="GeneID:34718571"
     mRNA            complement(<821291..>823318)
                     /gene="TMN3"
                     /locus_tag="KLMA_80383"
                     /product="transmembrane 9 superfamily member 3"
                     /transcript_id="XM_022822136.1"
                     /db_xref="GeneID:34718571"
     CDS             complement(821291..823318)
                     /gene="TMN3"
                     /locus_tag="KLMA_80383"
                     /codon_start=1
                     /product="transmembrane 9 superfamily member 3"
                     /protein_id="XP_022678428.1"
                     /db_xref="GeneID:34718571"
                     /translation="MKLRSRTIVATILVLFTLTWLIPRTRNSRTSTSLPGSSSRKQQH
                     PGLSIKEYGLVGPRFYEYGDKVDVIVNKVESDLTHFSFGYYDLHFTCPPSNNVKALPL
                     TFSDILLGNKKWESDYKLSFGKDEDCVRLCDRKTYAEGKKQAHELIKQDYVVQWLTDK
                     ELPGATTYLSTIDQKKYYSSGFPLGHYDQETGETYINNHVMLVIRYHTNDQGKHTIVG
                     FEVYPKSVSDYHCPGASKNYQPYKIDPTNEEIEYIPFTYSVYWREDLKVDWKHRWNFF
                     INAGELKESTSNQFHWITLANGLVVTSFLLLIVITILKKQETDGSIITQLAGEWLKSR
                     VPLNFQLNLLVSMGIHFLFTTLGTLIISCSLNQSHSIGNSVITCALFFFISGSFTSSF
                     VGVLLEGQASSQRLLYHSVFFGSTLPCVTLFIVLILNNILKANDAVNTIPQNVILLSF
                     AVYFALCIPISIIGGKCAARLFKMKTTNNFLKKFQLTEMSNRDVRPVYVDSKNSTPFL
                     LSNPIAITFIFGLIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLGNILIVCTCICLQ
                     SIIGCYVHLHYGNDSLSFKWNNIFGKILEACHSWRWKAFHMGGAVAWYLEIYSIFYLI
                     FVAKYRDFISSFLFVCYSTFFNILCWTAFGSLSYLCSLWFIGKMNEFNKEK"
     gene            <826832..>829219
                     /gene="CDC27"
                     /locus_tag="KLMA_80384"
                     /db_xref="GeneID:34718572"
     mRNA            <826832..>829219
                     /gene="CDC27"
                     /locus_tag="KLMA_80384"
                     /product="anaphase-promoting complex subunit CDC27"
                     /transcript_id="XM_022822137.1"
                     /db_xref="GeneID:34718572"
     CDS             826832..829219
                     /gene="CDC27"
                     /locus_tag="KLMA_80384"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit CDC27"
                     /protein_id="XP_022678429.1"
                     /db_xref="GeneID:34718572"
                     /translation="MLFHSSVRHGGGTGTARSSEFALGNQDSPHLADKDFFGGLPSAS
                     AATSAATGMVGSGLGSLENAASAASATAAVSAVNVNINANGSSTSNGTGISVERVRKL
                     ESLISSHLSQLNIESALFIAELFYAECSSLEDESREKTLASYYYALSLFMDGDYHTSM
                     FISSPLRHQSVANAYIYARCCLKLRKNYSNALDTLLSLQYHWDSSLPHFGYPKKSTIC
                     LLVGKLFRLLDHDSKSEAFFKSSLDEDPYLWEASEELCKLRSPLALTAFELSTSVPSV
                     PIGAGNQQSQGHGQGQGQGQSKMQNQGQNQNQGQNQNHSQSHNHSRVQGYSTNSLDPK
                     SKNKPHTPFKVPTRNKQNVSFSQNNSLLSSSNIGASVSPHFFKKTRFTTTPTTSATTT
                     NAIPNNMNDIPLENKNIGVTTPSKLYGTDSHTKLLRSPMERKIMTGSSFNSNNNNNNN
                     GISDNANANSIRGMVFDHGLEELFSNFIRIEYCKCKYDSFKAIRIMQSKIPLQLAVSM
                     PWCLSSLGKLHFELGNYEMAKSYFIKLRSLQPTRFKDMDIFSTILWHLQDKITLSSLC
                     AELLTLDKYHPVAWCTLGNLHSLNKDHDEAISAFGKAIQLDPFFAYAYTLQGHEYSNN
                     DSFDKAKSCFRKALTIDKTHYNALYGLGMCCVKLGKFEEALLYFEKARVLNPVNVILN
                     CCCGVALERLQQPEKALNFYELANELQPNSSLALFKKSQLLLNMGQYSSALHNFERLV
                     TLTPDEAHVHFLLGNLYQIVGKKQDAMNQYTIAMNLDPKGSQLIKEAMEKCHEQG"
     gene            complement(<829483..>832617)
                     /gene="BOI1"
                     /locus_tag="KLMA_80385"
                     /db_xref="GeneID:34718573"
     mRNA            complement(<829483..>832617)
                     /gene="BOI1"
                     /locus_tag="KLMA_80385"
                     /product="protein BOI2"
                     /transcript_id="XM_022822138.1"
                     /db_xref="GeneID:34718573"
     CDS             complement(829483..832617)
                     /gene="BOI1"
                     /locus_tag="KLMA_80385"
                     /codon_start=1
                     /product="protein BOI2"
                     /protein_id="XP_022678430.1"
                     /db_xref="GeneID:34718573"
                     /translation="MASNKLPMLSPLDTGSMRSVSGGEASVGETPLGLGFQSERTFPL
                     YICITEYTKRMDDELDMRPGDKIQVITDDGSYNDGWYFGKNLRTQEEGLYPKVFTQVI
                     AMERKPELMRAKSSKRIASPLATGSTTNLSYRSKDGSTSELPTPQPLETAQPAMYRRF
                     DAFKGPQSINDMNEKINGNSDVRDSSREAKAPPVDRNISMKSTMSDIDKALEELRGDS
                     FPSSNNSSDELQQQQSQKQKKPYLSRVASGSSLDYVPSNKVNEAKELRPEDVKSWTPE
                     QVTAYLISTGFDVESASRFQKHKISGTILLELELAHLKELEIHSFGTRFEIFKEIEAL
                     KEISTRSNASSTTYGNKRGSLMPAASFDQNVEINVTSPPKHETPTYRGHLRKTSQSME
                     ELGSNSTPTPKSYTTPSSTVLTKSSQKPRPASLLFTNETTKAPDITEEVFASPRRAPK
                     PPSYPSPVQPPKSPMVDSAGSGSSSSGRFLSPQPVVTNQGSKYAHPTIYEQVTDGKSK
                     IRADQEVQDLTTQGFEFPPKKKQGPSSSMPSLPNPYNKESDPMASNSSTNAAENRNSV
                     IYTRHTKTKSGGSFVELFNRISMLSETTEGKNADRDHDIGSEANVNKERPTSSVYGHS
                     RSASYTASHNRKASQASNSEKKHRRNSSLLSFFKEKDERSESENTGNKGSRHGSVSHS
                     RKNSFVSPYKTINNGTPSQRHSMLLSTSPIKDLPPPHTRKESKRRSVSAKDPSTEIFY
                     DAKDSLHDIEVNQNRSISESSKPKTTRGTSTKSMGKQKTTAFTEGIRSISVSEAMREA
                     DCSGWMSKKGTGAMGVWKNRFFTLHGTRLSYFANTTDKRERGLIDITAHRVLPAKEDD
                     KFVSLYAASTGKGRYCFKLVPPQPGSKKGLTFTQPRVHYFAVDTKEEMRAWIAALIKA
                     TIDIDTSVPIISSCATPTVSLSKAQEMLTQAREETRIREQQKPLNEHDEEWDQLRTDQ
                     TQSSEDFGNLSSPSITHNTTITSGLTSPYLMADNLGPNSTAATGYSANGLKSPNPQGG
                     EYFGLDPKFQINRI"
     gene            complement(<833231..>834385)
                     /locus_tag="KLMA_80386"
                     /db_xref="GeneID:34718574"
     mRNA            complement(<833231..>834385)
                     /locus_tag="KLMA_80386"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822141.1"
                     /db_xref="GeneID:34718574"
     CDS             complement(833231..834385)
                     /locus_tag="KLMA_80386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678431.1"
                     /db_xref="GeneID:34718574"
                     /translation="MSESFLSLYSDSSNVSASGKSQRKLIEIGSPTLDSLRGLSVEPS
                     SQTDPLESFDFDRYIAPYDFSEQVAEYTEQSKQSVAQRCIGNLQRIVESMESETPVLV
                     SLGLSISKETWNVKNYTIEDEFPVENVPLKVNVIKTLNNTLDDYLRNTNPQRVEVVAR
                     TLQYLNKLVQASLQKPLNEHAPKSSGSTFNPSSGTSMAQSIEPLSRRQTQIDRKSLYV
                     SKRIPSGGAGGGDTSSISSSKTTSSKSKRNIFQKMKVMSRWSVHHSTVEYPETSHVSH
                     ESTVQSVTTSVLSVSTPQSFRPEESSFDASSIRTTTHTGSNKTSFKKQDINDTPEYIL
                     WIQKLTTQVQRLPQTAQNDIIFSFINKCIIPFIINDGHLLQVGLVSRYIF"
     gene            <834999..>836393
                     /locus_tag="KLMA_80387"
                     /db_xref="GeneID:34718575"
     mRNA            <834999..>836393
                     /locus_tag="KLMA_80387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822142.1"
                     /db_xref="GeneID:34718575"
     CDS             834999..836393
                     /locus_tag="KLMA_80387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678432.1"
                     /db_xref="GeneID:34718575"
                     /translation="MINISQKSKSRRPKFLLRFSINQLTNIPQSAGYCYCKWHLKDGT
                     GTSTSKIEQEGQQIDTNHQSKGVTERIFVKNHRAVWNYKVDPPIKVKLHVDKYKSLSK
                     KILIVEVYFEFLEDVTKNEQSNGKLNHHSHTYTQKVTGKILLGNVTIDVTHFIDQNGT
                     EFHDRFLLQKSKVNSILSMSIKMQLIRGKFEDFRLTNGEQLLQKNKLELSNYMENYSD
                     TSSNPTTPISSLHPPESSDSKLSGGVRKTSHLSHPKTIHMHGETLASLTISNQLVEKL
                     YQKTFKFPWDPRPGEYTPQECVEDILEGGNGWAKNEKGINLIDLEALQITDLGNDDYL
                     LASLLDQQGIHYTPNNSNLNWDILASKWGKSGYTKSRGEYLKANIQNHYYTGKKQNID
                     DLAAEKLKDSKSWKVSYNPSKDASLNNSKLQLLHSQHHNFHFDHFFEHEGESHSSNAH
                     SLENIIGHRKSESQ"
     gene            <836889..>838583
                     /gene="HXT14"
                     /locus_tag="KLMA_80389"
                     /db_xref="GeneID:34718576"
     mRNA            <836889..>838583
                     /gene="HXT14"
                     /locus_tag="KLMA_80389"
                     /product="hexose transporter HXT14"
                     /transcript_id="XM_022822143.1"
                     /db_xref="GeneID:34718576"
     CDS             836889..838583
                     /gene="HXT14"
                     /locus_tag="KLMA_80389"
                     /codon_start=1
                     /product="hexose transporter HXT14"
                     /protein_id="XP_022678433.1"
                     /db_xref="GeneID:34718576"
                     /translation="MGIKCYCHQNNFIIYRKHQPVKCLCIALRQPRTLDMSEDTTSSF
                     ETTEKAIDVLMKENASATNSSEFDNNIVSQTAFSSEKDTTTAKNKLPLQPILLCLATS
                     FAGFIFGWDVGTIGGITNMASFQNHFGTKYNAATNMYYFPKMLVGLIVSIFNISCALG
                     GLFLVKIADINGRKPGIYAALTIYSLGTLIGWTCGASWWYFFFARFISGLGVGATAVM
                     IPMFIGESAPINIRGAMVVLYQLMITLGILAGNIVNYSCKNTLNARDNITWKIPVGLG
                     NLWAAIVVLGVHLMPESPLFLTKRFGDVLQAKKSFARMNSLNTDDPLVENHIQNLMKE
                     AEADDKLDEGTKHGKFEFIFGEPRLGFRLFIGIMVMAFQQLSGANYFFYYGTTLFNSV
                     GIEDPYLTSILLSSVNFASTFLGIYLVERLGRKACLILGSVGMFTCMSIYASVGSFAL
                     TKTPQASGAVMITFTCIYIMFFACTSGPVSFVVISELFPARTKAISMAICTSMNWLCN
                     FFISLFTPYVTEKIGFKLGFVFAVCLFVSVWFFTFFLKETKNKTSEEVDKLYALTE"
     gene            <839045..>842998
                     /gene="RTC1"
                     /locus_tag="KLMA_80390"
                     /db_xref="GeneID:34718577"
     mRNA            <839045..>842998
                     /gene="RTC1"
                     /locus_tag="KLMA_80390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822144.1"
                     /db_xref="GeneID:34718577"
     CDS             839045..842998
                     /gene="RTC1"
                     /locus_tag="KLMA_80390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678434.1"
                     /db_xref="GeneID:34718577"
                     /translation="MYKRNGGSRRVSTSQNQLSETPASVKYSSSNSRYTLHRQYSTGF
                     PSSSYGLSPKSKADVRNTYNTANTNNVGRESSSNEDDQNIRWKSTKNSGEQTRRFHGA
                     RYTLQTNKEISSIDKINDPRSRSLVIAGKSHLGLYSFDEESHTIVNTHDFVQSTKNNT
                     GLTKTSSSPSLRRSNNKISTISDVKAGFHNHKNYIAICGTSTTVSIYDINKTASIDNP
                     LITTLSEHTRSINSVDFNMVQTNLIISGGQDGCIKVWDLRSPKMYTNRSDVSINTGSD
                     SIRDVKWMPSYDFANDSNGISNKYLKFASVHDSGLLLKFDLRQPAQAERKINAHSGPG
                     LCLNWHPHQDYIISGGRDGKCCLWYLGDKSNVAGNNSNTTINLTNTPHTFSTTYPIGL
                     GTTSLAFPELTINTARPMNKLKFCPKYDSNVFNSLIGTSSMGEDSDISVYSLARKYIP
                     KTVVTSGAPSVGFVWWDENIVFNIDKQNVVTGWDTSQTPQLLDNLPKNAVKWRDLDGD
                     GILFLDQKPGGYRSQEELILTPGSGDNRRISLPHRMSSATTNSFMANNNLHMINNNNS
                     SAASFSKNAPFGLSHPHPNSLYGEKPSLPKHTPSFSSKISPSVNGSSWPNPYNSSHHN
                     SIASGSESALQVANESFVQSPYLIGLDFPHVLNTIRNTRLADMNRRVESQDVLELKSS
                     PTEVFKFLARELKFSYKQSYIDFKDNTRELETSSTRGSIESKNNLMEKLGLTENNTWT
                     HLIKYTKSHESDEVTSKGTEARSPLSENDNSLERSDTIHNTEIDKPDNLGDDINNNQL
                     DTKDLVELITVCDKNAETYLMIEDFANYKVWLMMRDALLWDLKILTESMATEENTMGL
                     GKKDLYTEQPWAKNDSFSSLKDIRNSAATSDYTSYSATDLSSSVNTHPRNSFNQPTHL
                     TQPPTVSKLKEQLESSKETSTMSRADSIQNSLQEDIMRIRQLHKNNSDKTDIAIEDYE
                     RNENEDENNENEGQFIKIPNSENRKSSFATSPTHVTGSIDNSETGDEHIQPRRPRTSF
                     IDSFISQLRSPASPKVEGDKESVSSKISPLPNLNTSAASFMNSKKNVIGQHKLQTAPE
                     VASIPESSIGQHHFRGASVSTTKAENQVSGITTLINETKKGYNTITPPWSTRKVIQQI
                     YEQSVSSGNILLTMAIVLLFQDRFQLVNEETVKNAITEFTTLLHRYELFEIAAELMKN
                     CPYSDISNNSAGLSSIQLYCDSCGKALINEVSKEKFTKEKHDTNIDAMARYGYWYCDS
                     CSKRNTLCCYCNRPMKSLAICMLNCGHEGHFGCLKKWYLEENMDTCPLGCLGILL"
     gene            complement(<843022..>843882)
                     /locus_tag="KLMA_80391"
                     /db_xref="GeneID:34718578"
     mRNA            complement(<843022..>843882)
                     /locus_tag="KLMA_80391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822145.1"
                     /db_xref="GeneID:34718578"
     CDS             complement(843022..843882)
                     /locus_tag="KLMA_80391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678435.1"
                     /db_xref="GeneID:34718578"
                     /translation="MMLMRITKMVFTGAAILVSASLSALYLYQNRLVYPSWAQGARDH
                     VDTPDQYGLPYEDVTLKTPDGVFIKAFDIRNDNSTATMLILSPNAGNIGYFLPMARFL
                     YHELNVSIFIYSYRGYGLSTGSPSEAGLKIDADTVMHHLANSDFHKSRKLILHGRSLG
                     GANAIYIARKFTSLCDAVILENTFLSIRKVIPYVFPLLKHVSFMCHEVWDSEHEIAKI
                     QDEQLPFLFLSGLKDEIVPPLHMKLLYKLCPSSLKQFVELPQGTHNDTIIQDGYWVVV
                     KEFLQKHDLI"
     gene            <845282..>845914
                     /gene="TIF45"
                     /locus_tag="KLMA_80392"
                     /db_xref="GeneID:34718579"
     mRNA            <845282..>845914
                     /gene="TIF45"
                     /locus_tag="KLMA_80392"
                     /product="eukaryotic translation initiation factor 4E"
                     /transcript_id="XM_022822146.1"
                     /db_xref="GeneID:34718579"
     CDS             845282..845914
                     /gene="TIF45"
                     /locus_tag="KLMA_80392"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 4E"
                     /protein_id="XP_022678436.1"
                     /db_xref="GeneID:34718579"
                     /translation="MSVEEVTQKTQDLKVEDSKPATVLSDSKDFELKHPLNSKWTLWY
                     TKPAVDKSESWSDLLRPVTSLETVEEFWAIQNGIPKPYDLPIKSDYHLFRNDIRPEWE
                     DEANAEGGKWSYQFKNKRHNIDELWLRTLLAVIGETIDEEDSEINGCVLNVRKAVFKI
                     AIWTRTTNMKSLTNIGTKFKQVLQLGEDEKLEFYNHRTSNSGHAPPTAVL"
     gene            complement(<846321..>849359)
                     /gene="VNX1"
                     /locus_tag="KLMA_80393"
                     /db_xref="GeneID:34718580"
     mRNA            complement(<846321..>849359)
                     /gene="VNX1"
                     /locus_tag="KLMA_80393"
                     /product="low affinity vacuolar monovalent cation/H(+)
                     antiporter"
                     /transcript_id="XM_022822147.1"
                     /db_xref="GeneID:34718580"
     CDS             complement(846321..849359)
                     /gene="VNX1"
                     /locus_tag="KLMA_80393"
                     /codon_start=1
                     /product="low affinity vacuolar monovalent cation/H(+)
                     antiporter"
                     /protein_id="XP_022678437.1"
                     /db_xref="GeneID:34718580"
                     /translation="MPKKSLKPQKSNSSEGTTRVFSVDDDAEELERDYHYLEGVKDGL
                     KLKRAAASSPRREPTLHRMGSRFSISEENDRIVVHDGSRHLVLQEELKKDRLGPGCLL
                     EADELDEGIPTKSGSPVPAGVDAEHVRLNNGTGRFQDDDDDENPLDTLIVDEDDEDAD
                     NANEDPGARLDQRLNDDAERGSISSVESYTLRERQDAINKTHPFGIRIWKPALYKKKR
                     SVQQAADEDIHETKFRNITLGVQITNLLWSLTAGLLLFVLFSFASVMVLVFGGFTTSA
                     FDYSVVFYKLGRYLLSPFGKIVFMKSDVQYLEEDQDEGISAQLFYKWITTYSNRLFFH
                     ESQTINDSNSNNNSNNNNNNSNNNDSTKNPDDINNNNNTRLFNASMTSNGNASIEPAT
                     TNAGSSLNHFRQNSYGSILHRNSPPENSSDEENAHLHRRLFGRGEWSIGRIIFYFMFY
                     TFIQPIVMLLSLLAWLCVFTIPMSNILWNLMYHCRKHPLALGIIDVKSATSVVATTPI
                     EEIKGQNVLLCTFRCAGLHYYKFTVDGTNVIVMNLIALVMFTIFDFYAIKNFWHIDSW
                     FTNESTIFMLCLLSIIPLAFYIGQAVASISAQSSMGVAAVINAFFSTIVEIFLYCVAI
                     QQRKGLLVEGSLIGSILAAVLLLPGMSMCGGAINRKTQRYNPASAGVSSAMLIFSMMV
                     MFIPTVLYEIYGEWEMRCDKSGNKCHFSQPQLKFDKMYQNVLAPIALFCAIVLFLQYI
                     VGMWFTLRTHAKLIWELPITETKENTGNSSANATAATTATANNTANLSMSQSSFGPIN
                     QTSSNNNRDASVPAGANIAGKANDNCGHSNGHDAPNWSKSKSACILLGATFLYAVIAE
                     ILVDCVDHVLEQYPINPKFLGLTIFALIPNTTEFLNAISFAMNGNVALSMEIGSAYAL
                     QVCLLQIPALVIFSMLYVWNKDLTKINIRESMFALIFPRWDLIASVASVFLFTYLYAE
                     GKSNYFKGSILILLYLVVMFGFYFQGVIDNGFWDEMLQIF"
     gene            <850156..>851040
                     /locus_tag="KLMA_80394"
                     /db_xref="GeneID:34718581"
     mRNA            <850156..>851040
                     /locus_tag="KLMA_80394"
                     /product="protein KRE1"
                     /transcript_id="XM_022822148.1"
                     /db_xref="GeneID:34718581"
     CDS             850156..851040
                     /locus_tag="KLMA_80394"
                     /codon_start=1
                     /product="protein KRE1"
                     /protein_id="XP_022678438.1"
                     /db_xref="GeneID:34718581"
                     /translation="MRNNVLVSLVALLAACAWVQAVPVTTTFFSVNPNGATITLVSVF
                     DPATLPGAALANTATTATTATTPATPGKPATTPTTTATTATPATPATTPTTTTTPGVA
                     AAGVTTDTTTDTDVTPKTPAAGAATDTNTDTDAAATTTPPAAAAAVTPTTDTDEAQAT
                     AKPATGTRPDPSTSRTPLNPDVTSAEPIDTYVTLTYGTTKTVTSKRQPTSGMWVTITK
                     NGRTTAVQTTWIQKFSSQYSKLAEPSSGSVGMGTLSGSVGIVKPKIESTISSAEAFVF
                     RPATSFTSALITFLMLFI"
     gene            complement(<851231..>852502)
                     /gene="ARG8"
                     /locus_tag="KLMA_80395"
                     /db_xref="GeneID:34718582"
     mRNA            complement(<851231..>852502)
                     /gene="ARG8"
                     /locus_tag="KLMA_80395"
                     /product="acetylornithine aminotransferase"
                     /transcript_id="XM_022822149.1"
                     /db_xref="GeneID:34718582"
     CDS             complement(851231..852502)
                     /gene="ARG8"
                     /locus_tag="KLMA_80395"
                     /codon_start=1
                     /product="acetylornithine aminotransferase"
                     /protein_id="XP_022678439.1"
                     /db_xref="GeneID:34718582"
                     /translation="MRGVRQFHSSKRALQSLIDKQKFQVTTYSRPNDLILSRGKNAIL
                     YDDINHKEYIDFTAGIAVTALGHANPEVAKVIYEQSKKLIHSSNLYYNDKCLKLSETL
                     VEATRKFGGQHDASKVFLCNSGTEANEAALKFAKKHGILKNPSKQGIIAFENSFHGRT
                     MGALSVTSNPKYREPFGSLIPGVEFLNVNDELNKLEQQISALKDKVAGLIVEPIQGEG
                     GVFPIPVDTLVGLRKICNDNDVVVIYDEIQCGLGRSGKLWAHAYLPKEAHPDIFTSAK
                     ALGNGFPIAATVVNEKINNILKVGDHGTTYGGNPLGSAIGNYVVGTIAQENFLEQVLQ
                     KGELLVNRLKKLQERFPNQIKDIRGKGLMIGCDFVEPPAKIVEAARDDGLLIITAGKT
                     TVRFVPALTIEDDLLQKGLDIFEKAVEKVYL"
     gene            complement(<853037..>853804)
                     /gene="KEI1"
                     /locus_tag="KLMA_80396"
                     /db_xref="GeneID:34718583"
     mRNA            complement(join(<853037..853678,853769..>853804))
                     /gene="KEI1"
                     /locus_tag="KLMA_80396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822150.1"
                     /db_xref="GeneID:34718583"
     CDS             complement(join(853037..853678,853769..853804))
                     /gene="KEI1"
                     /locus_tag="KLMA_80396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678440.1"
                     /db_xref="GeneID:34718583"
                     /translation="MQSSTAMVHLPQTFLSYPLYIGVEIALGVVVLNKFSGMYGILAL
                     FTGHPLDLMQWIFYIWSVFCLVVFIAGLKQVYKPTLLTMSTVTFIFTVDTFIGCLYCL
                     WFTAIWFSQEEPVKPLKSAGSPLGPAHENKLATQKGTSLNNNASQSASAGYEFLFIML
                     LTLIPQAIRFYFNFIIIAFEQQLLHSGKFTFDQNDIEVNLHNRNVLFRWKYNFEKWCY
                     YLCRRYL"
     gene            <854173..>855801
                     /gene="RIO1"
                     /locus_tag="KLMA_80397"
                     /db_xref="GeneID:34718584"
     mRNA            <854173..>855801
                     /gene="RIO1"
                     /locus_tag="KLMA_80397"
                     /product="serine/threonine-protein kinase RIO1"
                     /transcript_id="XM_022822152.1"
                     /db_xref="GeneID:34718584"
     CDS             854173..855801
                     /gene="RIO1"
                     /locus_tag="KLMA_80397"
                     /codon_start=1
                     /product="serine/threonine-protein kinase RIO1"
                     /protein_id="XP_022678441.1"
                     /db_xref="GeneID:34718584"
                     /translation="MNIEEKFERLNLANRDEHVNTQILEKYANSIKTDELSITRGKTN
                     KDKANRATVENVLDPRTMRFLKSMVNRGIISDFNGCLSTGKEANVYHAFAGNHEERHL
                     PVVGQDPETIEDADNTEINTPETSQPLQTAQTAQTTETKNRKEYAIKIYKTSILVFKD
                     RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEIKANVLV
                     MEFLNRGDGFASPRLKDYPYKDREEIKHYYHLMVAYMRLLYQVCRLVHADLSEYNSII
                     HQDKLYIIDVSQSVQPEHPMSLDFLRMDIKNVNSYFEKMGIDIFPERIIFQFIISEQL
                     DKYRGDYRSSTDLEKYVAENLPLKKTSEDEAADEVFRSLHLIRNLGGLEERDFDRFTD
                     GKFDLLKSLIANENKKYSGNITASEQYELSSSEDEDDDDENDNENEEGIKEKPRSTHN
                     LTSKEAESFDGEENNNGEVHISDSDSSESDNDDSEDEWYSDKETPLKGKKYEDKDLKK
                     QRKQEAKEAKREKRKTKVKKHIKKKLVNKTKSRK"
     gene            complement(<855853..>857568)
                     /gene="RTC5"
                     /locus_tag="KLMA_80398"
                     /db_xref="GeneID:34718585"
     mRNA            complement(<855853..>857568)
                     /gene="RTC5"
                     /locus_tag="KLMA_80398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822153.1"
                     /db_xref="GeneID:34718585"
     CDS             complement(855853..857568)
                     /gene="RTC5"
                     /locus_tag="KLMA_80398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678442.1"
                     /db_xref="GeneID:34718585"
                     /translation="MGQSTSVQQEQRSDEYGIDHGSLVSYFNEKCIKQFTKAELLSFT
                     NNIPEGRGLDDVVESSDISTLFHIPRDNTVLLSVFMNMFRTLANFPLIQESYDKVSFK
                     TLLKSTLLLSKGRAAKYTEWKNFDELKMLFIALALEKSIKSESLPGSSSSSELRSSKA
                     VIRSYNGVNVEELTINSNDLVHFFSFLLALSRKSIMNNCKIDDNALSKSFESFKQVAM
                     IFVRTMDPTIISASDSLKSYITYEQFYDLIHNIAPNLISPLNMLLEHTLYMTRDLVDA
                     DVLKPLENPSKIVTEPLLAQLATLFPKEIVFSRFQRLYVGRESGFSMRSFQSKVFKWM
                     APTILFIQGMRIRDEDSEMEENYVAKNPRYRGFLEEFGKLKNEDQHLDELIIKKRKVL
                     YAVYIRDPWKVSNKELFGDSNTKIIQLQPTQEIYDAKPTSVGNVYFNTVGGGIGVGNQ
                     QPLIKPSSKKYLPGNISLTIDSSLEFGIFRHVGDGGLFSPGRLSKVRGEDRKSFEYRF
                     LIQDVEVWGCGGEKELEEQVKLWQWEEMEAKRRQQINLQSMGEDRALLEMAGLVGQHQ
                     SGGSV"
     gene            <858070..>859986
                     /gene="ESF1"
                     /locus_tag="KLMA_80399"
                     /db_xref="GeneID:34718586"
     mRNA            <858070..>859986
                     /gene="ESF1"
                     /locus_tag="KLMA_80399"
                     /product="pre-rRNA-processing protein ESF1"
                     /transcript_id="XM_022822154.1"
                     /db_xref="GeneID:34718586"
     CDS             858070..859986
                     /gene="ESF1"
                     /locus_tag="KLMA_80399"
                     /codon_start=1
                     /product="pre-rRNA-processing protein ESF1"
                     /protein_id="XP_022678443.1"
                     /db_xref="GeneID:34718586"
                     /translation="MGSNDNPKGKEKITTDPRFAGIHNDPKFKPTKSKNFKIKLDDRF
                     SKKDLEVRRKAKVDKYGRKLPAEDKEAIDFDRYFEKEKDDEKTKSASDSDEEDDIQSP
                     ETKEETDAEKKLIDRARGETPVDYVSSSDEESSSESEEDSEDSDYESEEIELESSKPD
                     SGDATKTLAVVNLDWDHVKSTDLFVTFQSFVPKGGAIERIAIYPSEFGKERMQREEIE
                     GPPKELFQSKKSKSSDKEDKYDIKSIYEEGDAEKDFDSKSLRRYQLERLRYYYAVVYC
                     SDVSTAESIYQNCDGTEFESTANVFDLRYVPEGMEMTDEPRDECTSVPKHYKPIQFST
                     DALQHSKVKLTWDETPADRVEISKRAFTQKEIEEMDFKAYLASDSDESEVEHDDQAKN
                     KLKALVMDSVKLGDKSIFDGKDDKEDDEVDMEITFTPGLDEQNHQTSDNDLEKEESTI
                     DKIKRKEKERRKKRKQRVKELKKESEVKLKETLKKKNDDLDSADNDKKKAELELLMLD
                     ENEAESNINTKAHFNMKEILKSEKEKAKKSKYQNKDKIVEDEFTPDINDPRFKEVFED
                     HEFAIDPSQPEFKKTPAMEKILKERSKRSNKKTKNNKRKSDAIVDSGSSDKTKINSLV
                     SKLKSKSKKQKQNR"
     gene            <860235..>861524
                     /gene="CDC40"
                     /locus_tag="KLMA_80400"
                     /db_xref="GeneID:34718587"
     mRNA            <860235..>861524
                     /gene="CDC40"
                     /locus_tag="KLMA_80400"
                     /product="pre-mRNA-processing factor 17"
                     /transcript_id="XM_022822155.1"
                     /db_xref="GeneID:34718587"
     CDS             860235..861524
                     /gene="CDC40"
                     /locus_tag="KLMA_80400"
                     /codon_start=1
                     /product="pre-mRNA-processing factor 17"
                     /protein_id="XP_022678444.1"
                     /db_xref="GeneID:34718587"
                     /translation="MSLVQGYDTDSSDEDTQDFNKKHKLQTPKLKSKRPKRNGKGPWA
                     SWESSSEAEQDEEVQTTNIPNAGNSDMGDDIDSSVSFNQEKSTFVGKREKDYQGRSFM
                     HPPIDVEVDLKKEPLSFKCFLPKRKVAEYTGHKNGTTSLRFLPHSGHLFLSGGNDKTI
                     KIWDFYHNRELLRTYEGHSMTIKDLNFTHDGETFASASFDKSVKVWNTERGSISKRLR
                     FNAVPNCIMFHPEDKNQLVIGLSNSEILHYDFRVDEKDGKIQKYDHHQGSILALKYFP
                     NGKKLISSSDDKTVRIWENQINVPIKQISGTTQHSMPWIDINPQEQYFCTQSMDNTIY
                     TYSMMPKYKRHPSKMFKGHSTAGYGIHFAFSPDGQYIASGDSKGQTFIWDWKTTKVLK
                     KFKPLSNNLPITCLAWNPQETSKLCCAGNDGRIVVLD"
     gene            complement(<861619..>862917)
                     /gene="RPT5"
                     /locus_tag="KLMA_80401"
                     /db_xref="GeneID:34718588"
     mRNA            complement(<861619..>862917)
                     /gene="RPT5"
                     /locus_tag="KLMA_80401"
                     /product="26S protease regulatory subunit 6A"
                     /transcript_id="XM_022822156.1"
                     /db_xref="GeneID:34718588"
     CDS             complement(861619..862917)
                     /gene="RPT5"
                     /locus_tag="KLMA_80401"
                     /codon_start=1
                     /product="26S protease regulatory subunit 6A"
                     /protein_id="XP_022678445.1"
                     /db_xref="GeneID:34718588"
                     /translation="MSTLEDLNNESQLAEDDIDQEFYNLSAADLTTRSKLLDNEIRIF
                     RSELQRLSHENSQMLEKIKDNQEKIKNNKQLPYLVANVVEIMDMDELQDSNEIDTQGG
                     NVNLDNAAKGKAAVIKTSSRQTVFLPMVGLVDPVKLKPNDLVGVNKDSYLILDTLPSE
                     FDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKQGEKFKDMGIKAPKGALM
                     YGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMFIGEGAKLVRDAFALAKEKAPTII
                     FIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFGSDDRVKVLAATNRVDVLDPA
                     LLRSGRLDRKIEFPLPTEDARAQILQIHSRKMTTDDSINWQELARSTDEFNGAQLKAV
                     SVEAGMIALRNGQSQVKHEDFVEAIGEVQARKSKSVSFYA"
     gene            complement(<863284..>863655)
                     /locus_tag="KLMA_80402"
                     /db_xref="GeneID:34718589"
     mRNA            complement(join(<863284..863511,863629..>863655))
                     /locus_tag="KLMA_80402"
                     /product="probable 26S proteasome complex subunit SEM1"
                     /transcript_id="XM_022822157.1"
                     /db_xref="GeneID:34718589"
     CDS             complement(join(863284..863511,863629..863655))
                     /locus_tag="KLMA_80402"
                     /codon_start=1
                     /product="probable 26S proteasome complex subunit SEM1"
                     /protein_id="XP_022678446.1"
                     /db_xref="GeneID:34718589"
                     /translation="MSGKLYEKAHSNYKINTTNMSTKEPVRSSLEDDDEFEDFPADSW
                     PSQPVSQDLTRDSNLWAEDWDDIEVEDDFTKELKEELEKQ"
     gene            <864008..>868381
                     /gene="RPO31"
                     /locus_tag="KLMA_80403"
                     /db_xref="GeneID:34718590"
     mRNA            <864008..>868381
                     /gene="RPO31"
                     /locus_tag="KLMA_80403"
                     /product="DNA-directed RNA polymerase III subunit RPC1"
                     /transcript_id="XM_022822158.1"
                     /db_xref="GeneID:34718590"
     CDS             864008..868381
                     /gene="RPO31"
                     /locus_tag="KLMA_80403"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC1"
                     /protein_id="XP_022678447.1"
                     /db_xref="GeneID:34718590"
                     /translation="MKDTVVDIAPKKIKGISFSALSAADIVAQSEVEISTRDLFDLDN
                     GRSAKEGGALDAKMGVSSSQAECNTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQI
                     LQSVCKGCGALLLSEEDKRKHLSELRRPGMDNLRRMNILKKILDQCKKQRRCFRCGDL
                     NGVVKKAAAGSGSAALKIIHDTFRWVGKKSAPEKDRWVGEWKQVIENNPELERYVKRC
                     MDDLNPLKVLNLFKQITPDDCELLGIDSTTKSGRPETYIWRYLPAPPVCIRPSVMMQD
                     SPASNEDDLTVKLTEIVWTSSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP
                     SMLPGSSGTKSKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSVEEVAV
                     PDRVAKILTYPEKVTRYNKHKLQQLVINGPQLHPGANYLLKKNEDARRNLRYGDRVKL
                     AKQLQYGDVVERHIEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNA
                     DFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKD
                     SFFDRSQLTQLLSMMSDGKLQFDIPPPSIMKPHYLWTGKQVFSLLIKPNKNSPVVINL
                     DAKNKVYIPPPKKSYPNEMSQNDGYVLIRGSKILSGVMDKSVLGDGKKHSVFYTILRD
                     YGPDEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGADLKNKKEQMVEYAYKKCDELI
                     DLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPLIMATCGSK
                     GSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSP
                     PEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY
                     GGDGLDPFDMEGNAQPVNFIRSWTHANNITFSEDTVGLLPYQIIEETNKILKPLEAKL
                     KRYDNVGNELKNEDANRDEYIDQFDAERSFYQSLRQFMTEKAEFLAKLRKERGMKELL
                     DEPGEELKDINWDEGVSSSVLISLNQLCKISKSLVESFLTIAISKYHKAKVEPGTAVG
                     AIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND
                     NDERAARVVKGRVEKTLLSDVAYYVQDIYKDNMAFLQIKIDLETIEKLQLELTLEDIV
                     VAIAKAPKLKISTNDISIIGKNRINIAVSYDAKSLKSISTSMKEPEPNEVFYRMQQLR
                     RALPHIVVKGFADIARAVINIRDDGKRELLVEGYGLRDVMTTDGVVGSKTKTNHILEV
                     NEVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR
                     DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVIKNTVLGE
                     KDLEPKPTLFESLCDTLVRAN"
     gene            complement(<868490..>869668)
                     /gene="ESC2"
                     /locus_tag="KLMA_80404"
                     /db_xref="GeneID:34718591"
     mRNA            complement(<868490..>869668)
                     /gene="ESC2"
                     /locus_tag="KLMA_80404"
                     /product="protein ESC2"
                     /transcript_id="XM_022822159.1"
                     /db_xref="GeneID:34718591"
     CDS             complement(868490..869668)
                     /gene="ESC2"
                     /locus_tag="KLMA_80404"
                     /codon_start=1
                     /product="protein ESC2"
                     /protein_id="XP_022678448.1"
                     /db_xref="GeneID:34718591"
                     /translation="MSDSDSDDFFYNQDLSEEEDELEIADDTNVVNTSTLKLSTPLIA
                     NKKRAYNDENLKNSSVKTQKTEAETENAIDKIDSQDDSDSIVLLSDESPSSDSYVSEQ
                     EILPAKSTREKKPITINTHDETFDFLNEITKDAKRFDALRKNDPRTRRIYNINFVSTL
                     EGTQNKRVNVKVTGNKSFESILPITIKSFIKSYKVPRSLQMFYKPADLVLFRAGIEVL
                     PFSNCDSLQIPSNSIREEAEVDLIIVHASEAQNYKNEYKRIRDSRLHSFDDENESKDE
                     NPDSKNDDKFKLFEKELENAPKLEMSPDEVIEIAEMDSEEENIIRLVLIDKKNKRTSI
                     PVHPSMTFRDIAEKYKQISKLSSDTVVKLTFENTDMEPSETVESQDLEEDDILEIKII
                     "
     gene            complement(<869969..>871495)
                     /gene="APE4"
                     /locus_tag="KLMA_80405"
                     /db_xref="GeneID:34718592"
     mRNA            complement(<869969..>871495)
                     /gene="APE4"
                     /locus_tag="KLMA_80405"
                     /product="putative aspartyl aminopeptidase"
                     /transcript_id="XM_022822160.1"
                     /db_xref="GeneID:34718592"
     CDS             complement(869969..871495)
                     /gene="APE4"
                     /locus_tag="KLMA_80405"
                     /codon_start=1
                     /product="putative aspartyl aminopeptidase"
                     /protein_id="XP_022678449.1"
                     /db_xref="GeneID:34718592"
                     /translation="MLRIHLRTKSTMSGAKAFNYPQEFINFLNSSPTPYHAVHNIKSH
                     FLSKGFKELKETDSWDKSLERGSKYFVTRNNSSIVAFVVGKEWAPGNPVAIVGTHTDS
                     PVLRIKPISKRASEGFAQIGVECYGGGIWHSWFDSDLSIAGRVMVHDKDTKKTVAKLV
                     DLKKPLLKIPTLAIHLDRDVNAKFEFNKETQLLPISGLSLNDKKQEEAKKIDGCCGDS
                     QPLSEAQFSSLKSIIERHHEDLLKLISKDLELESVNDIIDFELILYDHKPSTLGGIND
                     EFVFSGRLDNLTSCFTAMHGLTEVENLDPNMEKGINLAAMFDHEEIGSSSAQGADSNF
                     LPNVLERILTSRALSTSTAEENPNSWEAPSSTLLQTAAKSFFLSSDVAHAAHPNYASK
                     HESQHKPQFGSGPVVKVNANQRYMTNSPGLVLIKQIADEAKVPLQLFVGANNVPCGST
                     IGPILASKTGIRTLDIGNPILSMHSIRETGSAKDIELQIKLFKHYYERYCSIQETIDV
                     "
     gene            <872387..>873535
                     /locus_tag="KLMA_80406"
                     /db_xref="GeneID:34718593"
     mRNA            <872387..>873535
                     /locus_tag="KLMA_80406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822161.1"
                     /db_xref="GeneID:34718593"
     CDS             872387..873535
                     /locus_tag="KLMA_80406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678450.1"
                     /db_xref="GeneID:34718593"
                     /translation="MVSLPTELVHADDKDNRVTDIVSPINVATTFRYDNDDLIPWSER
                     EDYSFMEKKPIYSRLAHPNSTRVESILSKILDGEAVVYSSGLAAYFAMLTHYNPKRLF
                     IGQSYHGCHSIANIYTRNWKLEQHRLDVNEILQHADKGDIVHIESPVNPYGTSFDIQA
                     FADAAHTKGALLVIDSTFAPPPLQYAWDFGADVIVHSATKYLGGHSDLLAGALVVKDK
                     EVAAQLRTDRIYLGTNIANLEAFLLLRSLRTFEMRIKTQSENATKLVSYLSEHKAEFP
                     DVIDKIFHSSLQTESFVKRQLKGGYGPVFSITLKTKEQCKKFPQLLEYFQHATSLGGV
                     ESLVEWRALTDPNIEQTLIRVSVGVESAEDLINDFTSGLKKLQDEHKN"
     gene            <873883..>883266
                     /gene="VPS13"
                     /locus_tag="KLMA_80407"
                     /db_xref="GeneID:34718594"
     mRNA            <873883..>883266
                     /gene="VPS13"
                     /locus_tag="KLMA_80407"
                     /product="vacuolar protein sorting-associated protein 13"
                     /transcript_id="XM_022822163.1"
                     /db_xref="GeneID:34718594"
     CDS             873883..883266
                     /gene="VPS13"
                     /locus_tag="KLMA_80407"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 13"
                     /protein_id="XP_022678451.1"
                     /db_xref="GeneID:34718594"
                     /translation="MLESLVSALLNRFLGAYVENFDPKQLNVGIWNGDVKLRNLRLRK
                     DSLDALDLPVDVKFGHLGELTLLIPWSSLKNKPVKIIIEDVYMLCTPRTAESYCLQDQ
                     VERELKVKLQRLAELELSNSSKPDMNPESNRNESFTQSLLTKIIDNLQVTVRNIHLRY
                     EDVNSIFSEKPCAFGISLSELSAVSTDESWNPSFIAIKQQITHKLATLDSISFYLNTS
                     TESIDIDDKEELLVRLRESIADKHGTPEYQYLLKPVKGSARLKMNNAGATQDTPHIDV
                     QLMFDQFALVLDDCQYKEVLHNMSKYHWFHKTLKFRRFRPTCEPKEDPIQWFRYAANC
                     VLSEIHEKNYRSSWEYIKKRRQTRDEYVALFKKKLTLPNITDPLPNPDDETRLIELDR
                     DLEFDDIKFFRAFARRQFSQESKVTRMTETVSTNSNPQGWFSSWWGSGSNKSDDTLTM
                     TDEQRKELYEAIEYDDSKDALKSIDIPRDRTTVRVTNLLQKGSLTIIDKTKGHRMCDF
                     IFEESATEFLKRPDSFLLKFELNSFLVEDGSPHTSYRHIISPRANQESSEPLLHLCFD
                     SCPMDDSADSFLDVKFGSVFVYYHIHFINELLRFFNPPKKHWETISAIMNAAEATVEG
                     WTTQTRMGLEALLDEHKTIDVNLNAASPTIIIPLDAHSWESPCAIIDAGSIKMRSDLV
                     PKEEIKKIKELSVDEYAKIDSAELKRLMFDRFKIKLTNTQFLIGPDMKSAITSINVKQ
                     TDNNFTILEKMELDFIFDVLIFPKAMNLPKARASVTLPNLNLFLNDAQYKIIMQLIER
                     CTPYVDEDDDDDNNGDSSSSDSFSQLIPIDNASDRNQALQNLKQALLLKQTKKMLDKL
                     SKTELEQVSFELTLDVSRIEISLSKCLEGSTMRSTKLVKLVGEHLSLGLEKRFVQLGF
                     NISLTELRLEDHISNFGSTNREEYILFSNNSTKQPNLFDINGSRTQQIIEYESKLYEV
                     FDINVDLKMSELTLSLIPKSILTLLNFILNTFTDPETPAVPANVIRQSNQTETDSKPG
                     STNVNLLLDGINIILNDESSRLATLGIHNSELSINMLPQSMKVKAKLGDMKLLDETSV
                     DLPKNSIFRELISREDDDLAELVYETFDPETNKNNYDSYLFYRTGAMRINFVEHSINK
                     IINFFAKFQKMKVFFDTAHNNAYSKAPDIDTVNNIKFDILIKTPTISFPKLIDPRNNS
                     YDELIWKMGDVYLSNYFTGDDNKLVNNASVGIKNTHISSIFNFEGNMVQQLSAVSNLD
                     LRFDILYDQYYKESEALLNITGFFAPFYVNLTDLQIQYILGLVQKISSSFIVDQVNDD
                     MEDIEMTALNTNSIIDPQKELHLSQNIFSPEKKASELNIKSTRVEFEFNAPEVSLSLY
                     NHTKGALSIDELGVARFNLEDFGISGSALNSSSFESEMHITSFTVEDIRYSKTSKHTQ
                     VIPKIEGEHHQFMASFNYSEGKESSNLTFEVTIDSPKIVLATEFILSLQDFLTSSFTS
                     QQPANLQGLAQHNNGIEPDQNDETSELKNEKSKMSVSYSINVVDSAVILLADPADSHS
                     EAIVFTIGQFLIANQNVLSISANNVGLFLSRMGTLKTNRIRVLDDFSSTILIDGRDST
                     PEMLKTQIHSSVGPLMLRLSLRDIRLAMRIFDSALSMAKDKGLISKTDSEKKEDDINT
                     KYGRFSKEFKNKIKKYAPSMVSSFSELSNAIQRNSVHKSTKIIAKAEKLHLDFAGMRI
                     VLIGDIHELPIADFNVNSFSVDAKDWSTNIDAISTIEMYASAFNYSRSSWEPLIEVFP
                     LTFHLSKDDETGNAFMFDIIARKNVEITLSSRTIALLSQIPASLTKVHDLKPRGAERP
                     YRIHNDTGHPLNIWIKNTEDGSPGKKTNLTKLEQGAIIDWEFEDWRVVRETLNTDKNI
                     LQVSFDSEVYTNVIEVDATKEGETVHMLSPPVNGVHNRLLVGSKLLKNNVKQISFGST
                     LLFFNSTSTEIEVGLFDKAQTTLIKTIEPRETKAIPIDLAYNSSFQLRPKISGAKYQW
                     SKTPLFWKLLREAPNSLTCASESNAPPFYFEAEGLVEKDDPLSKIYPRMTVSVSAPLV
                     LENLLPENISFCLMGKEDKHRQEMYLEAGSSIPLHNVSLESYLFLSVKPDDDIFQWSN
                     ETLVNSPDISELQEEYRTLIKTVDGQKLYLNLKYHSDGRRAKTISIYAPYVILNKTTH
                     DLSVFSDRQWGVLKSNVFLENDKKVAKPKMFSFQYEDYNRNRAKIKFTETNPSVPVSF
                     DAIGQSVDVSLELLNHDQECNLGISVKEGEGKYRFTKIVELCPRYIFRNSMQESLEIM
                     EYGTSSPTLLGPNEVIPLYFLKRTLSKKFVARFAKIPSTWSNPFRLKDVGETFVKMNI
                     TDAAQRLVKMEISLEGATLFINATDSDDNWPYSIRNFSDNEFLFWQRNPRFVDEESDE
                     LDYYYQEDEDEVDFEPIYYRIPPRSVMPYSWDYPSAKQKKLYIHTKNRRREIDLNEIG
                     NLRPIRIPPDNPKNPPTIVDINILMDNGVQVLVLSNYNQEQSLYKLRSQRRLESESSL
                     ASSVTSKSDRFEVDEDMDSKLNARVVLSFSGIGVSFINQRLQELCYLNILGLEFRFND
                     SEMYQNLSFKIKWLQIDNQLFGGIYETVLYPTKIPKESKEIDIHPSLSGSISKVKDES
                     SSLMNFKMATILLQEMTIQIDEDFLFALIDFVHVPGAAWNENTDYDDNNNEAFILNKC
                     SIPDFPTTIKSNKVYFEMLHLQPTLLHLSFVRTDRVNVEEEKTSGNSPINYFINVLTM
                     ALGNIEGAQIKLNSLLLEHVRVSPPTLIAAIESHYAQQFFYQLHKILGSADFLGNPVG
                     FFNNISSGVMDIFYEPYQGYIMNDRPQELGIGIAKGGLSFLKKSVFGFSDSFSKMTGS
                     MAKGLSVAIQDTSFQERRRLQQRQRGKFGSVGVGASSFFNNVTSGITGVALDPYSGGA
                     KEGPLGFIKGVGKGLIGLPAKTAIGVLDLASNVSEGIRNSTTLMDGGQIERVRLPRYV
                     GSDNLIKPYNLRDSQGQYWLKSCNGGQFAKDIYVGHVICETPAGFQIVIVSLQRILRM
                     QLSNLTVMEHIPFNTIRNVKVSKTGITIYTAEREYFFSVPKDEERRYLYKLVHAAVVE
                     FNSKWQVQL"
     gene            <884645..>885409
                     /gene="SDH2"
                     /locus_tag="KLMA_80408"
                     /db_xref="GeneID:34718595"
     mRNA            <884645..>885409
                     /gene="SDH2"
                     /locus_tag="KLMA_80408"
                     /product="succinate dehydrogenase [ubiquinone] iron-sulfur
                     subunit"
                     /transcript_id="XM_022822164.1"
                     /db_xref="GeneID:34718595"
     CDS             884645..885409
                     /gene="SDH2"
                     /locus_tag="KLMA_80408"
                     /codon_start=1
                     /product="succinate dehydrogenase [ubiquinone] iron-sulfur
                     subunit"
                     /protein_id="XP_022678452.1"
                     /db_xref="GeneID:34718595"
                     /translation="MFNVIFKRGLATEVKAAAPRLKTFKIYRWSPDTPAEKPRLQEYK
                     VDLNQCGPMVLDALIKIKNEQDPTLTFRRSCREGICGSCAMNIGGRNTLACLCRIDQN
                     ENKQTKIYPLPHMYIVRDLVPDLTHFYKQYKSIQPYLQREKVPEDGKENLQSIADRKK
                     LDGLYECILCACCSTSCPSYWWNQEQYLGPAVLMQAYRWLIDSRDEASGIRKQMLQNS
                     MSLYRCHTIMNCTRTCPKGLNPGRAIAEIKKALAMD"
     gene            <886134..>886577
                     /gene="ATG10"
                     /locus_tag="KLMA_80409"
                     /db_xref="GeneID:34718596"
     mRNA            <886134..>886577
                     /gene="ATG10"
                     /locus_tag="KLMA_80409"
                     /product="autophagy-related protein 10"
                     /transcript_id="XM_022822165.1"
                     /db_xref="GeneID:34718596"
     CDS             886134..886577
                     /gene="ATG10"
                     /locus_tag="KLMA_80409"
                     /codon_start=1
                     /product="autophagy-related protein 10"
                     /protein_id="XP_022678453.1"
                     /db_xref="GeneID:34718596"
                     /translation="MLTLPEYNEQIPNVRSLLTKWAKVERIQDVQDGLQLDVRLKTDT
                     LLELHIYYDHVYHVPSIKFRLWSLDTEEDISSLRLLTLSDSELRSILNLGTFSVTLST
                     DMEMKSVYYYINNCDTDANVGSDVEHYLTRWISLYIRIFDLNFVP"
     gene            <886918..>887565
                     /gene="GOS1"
                     /locus_tag="KLMA_80410"
                     /db_xref="GeneID:34718597"
     mRNA            <886918..>887565
                     /gene="GOS1"
                     /locus_tag="KLMA_80410"
                     /product="protein transport protein GOS1"
                     /transcript_id="XM_022822166.1"
                     /db_xref="GeneID:34718597"
     CDS             886918..887565
                     /gene="GOS1"
                     /locus_tag="KLMA_80410"
                     /codon_start=1
                     /product="protein transport protein GOS1"
                     /protein_id="XP_022678454.1"
                     /db_xref="GeneID:34718597"
                     /translation="MSNSFVTVRSQAISLESQTDSLLTRYSSFAQTTSSEPLAQETQL
                     QEKLETILNKRQDIVETLQKIADNDSDISTTKLSQLQRHRETLQENWQTFRNIRSSIQ
                     QERNRLNLLFSVKKDLQQDTIENRDEYIQDEYRRVENSHSVVDSLIDQAYETRDQFMS
                     QRRVLHKSGDRILQTLQHIPLINNVIAKINTRRKKNAVILASLISICILVLFFTA"
     gene            complement(<887649..>889367)
                     /gene="FPS1"
                     /locus_tag="KLMA_80411"
                     /db_xref="GeneID:34718598"
     mRNA            complement(<887649..>889367)
                     /gene="FPS1"
                     /locus_tag="KLMA_80411"
                     /product="glycerol uptake/efflux facilitator protein"
                     /transcript_id="XM_022822167.1"
                     /db_xref="GeneID:34718598"
     CDS             complement(887649..889367)
                     /gene="FPS1"
                     /locus_tag="KLMA_80411"
                     /codon_start=1
                     /product="glycerol uptake/efflux facilitator protein"
                     /protein_id="XP_022678455.1"
                     /db_xref="GeneID:34718598"
                     /translation="MSENTQYDNTRDSGGQSPVNNNNAWQESGFAHTRPRRYTTRSSV
                     SERQSGLSGLEEEDSDIDDQTTVPVTAYVQQYLDEGSYFPVQEVVPNTSLNMNMYRRK
                     RGNTVTSNVIASRPMEANYTGSVSSPDPALQNQNNEGGVPANDPNDPNNVNNAITMMV
                     KPKTLYQNPQTPTVLPSTYYPINKWSSFKYQHMKEFFGEFLGTMIMMMFGTAVVCQSK
                     LSEQDKINQFNQILAMNHKSNDDISMLQYIATPNVAGNFVSIAFGWAGAVVMGYFAAG
                     GSAISGAHLNPAITVSNFIYRGFPFRKLGFYFMGQYVGSYLGSLLMIWYYHKVIAHVY
                     PNWPQEESVVAMFSVVPLDYLSTPRQIIAEFVIGAMLQCGIFSLTDPYTCLSTDLFPV
                     MLFILIFSLNASGAYQTGAVLNPARDMGPRLALWTIGMDKDVIFNSHHHFFWVPMVVP
                     FLGSFAGGLVYDFCIYQGHESPLNLPLSAYTDWFRRQWDTIKLKTSSGLKGTDLETID
                     SGHTLSHIESHRSQLSENKQVHFKSVLRNSKLRNPSTGVPTIFESEETTYSRPNFEQK
                     TSNGSI"
     gene            <890833..>892839
                     /gene="GUT1"
                     /locus_tag="KLMA_80412"
                     /db_xref="GeneID:34718599"
     mRNA            <890833..>892839
                     /gene="GUT1"
                     /locus_tag="KLMA_80412"
                     /product="glycerol kinase"
                     /transcript_id="XM_022822168.1"
                     /db_xref="GeneID:34718599"
     CDS             890833..892839
                     /gene="GUT1"
                     /locus_tag="KLMA_80412"
                     /codon_start=1
                     /product="glycerol kinase"
                     /protein_id="XP_022678456.1"
                     /db_xref="GeneID:34718599"
                     /translation="MTGNAETTVQSGAEGAVVPLVAAIDVGTTSSRVILFNRLGQEVS
                     KHQIEYSTSASHQAYSASGERRLEVENGGSGKGKSPGDGVEQTIFSAEGIAIEATEYL
                     EIEDLEKDVEPTLRFPKPGWVECKPMNILINVVQCFAANLITMDRVNGDRVSNGLPPY
                     RIKCIGIANMRETTLVWSKSTGKPLVDYGIVWNDTRTTAIVQKKKDQTPEDYQEYLRE
                     MTGLPLFSTYFSCSKLRWLLDNSPEVKKAYDEKDLVFGTVDTWLISNLTHNNVLVTDV
                     TNACRTGFMNLNTRDYDDELLNYWDIDKSKIHLPKIVSSAEYYGNFVVPECTKKSLTS
                     TAWDLLKAFSERVPPVPIQGCLGDQSASLVGQLAFKPGSAKCTYGTGCFLLYNTGTTK
                     LISKHGALTTFAYWFPQLHSEENDYGKPHFALEGSVAVAGAVVQWLRDNLRLIPRAED
                     VGPLASAVPDSGGVVFVPAFSGLFAPYWDPDARASIMGMSQYTTASHIARAAVEGVCY
                     QARSILKAMSSDAFGSDDKDFLEEIVDETYEKTALSSLAVDGGMSRSDEVMQIQANIL
                     GPCVKVRRSPTSECTALGAAIAAAMAFKTEEERIIWKNLKDVKKWVFYGGLEKGDVAP
                     TNSSSQSQLKVFTSKSSDIERRKGWKMWETAIEKSKGWMREVQI"
     gene            <893370..>894137
                     /gene="RPL8B"
                     /locus_tag="KLMA_80413"
                     /db_xref="GeneID:34718600"
     mRNA            <893370..>894137
                     /gene="RPL8B"
                     /locus_tag="KLMA_80413"
                     /product="60S ribosomal protein L8-B"
                     /transcript_id="XM_022822169.1"
                     /db_xref="GeneID:34718600"
     CDS             893370..894137
                     /gene="RPL8B"
                     /locus_tag="KLMA_80413"
                     /codon_start=1
                     /product="60S ribosomal protein L8-B"
                     /protein_id="XP_022678457.1"
                     /db_xref="GeneID:34718600"
                     /translation="MAPSKKVAPAPLASKATSAKKSNPLTKSTPRNFGIGQAVQPKRN
                     LSRYVKWPEYVRLQRQKKILSIRLKVPPSIAQFQNTLDRNTAAETFKLLKKYQPETAA
                     EKKERLTKEAAAIAEGKTRQEASPKPYVVKYGLNHVVSLIENKKAKLVLIANDVDPIE
                     LVIFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVREEDEAALAKLVSTIN
                     ANYLEKYEESKKHWGGGIMGAKAQKKIEKRAKAAESA"
     gene            <895776..>896504
                     /gene="SBP1"
                     /locus_tag="KLMA_80414"
                     /db_xref="GeneID:34718601"
     mRNA            <895776..>896504
                     /gene="SBP1"
                     /locus_tag="KLMA_80414"
                     /product="single-stranded nucleic acid-binding protein"
                     /transcript_id="XM_022822170.1"
                     /db_xref="GeneID:34718601"
     CDS             895776..896504
                     /gene="SBP1"
                     /locus_tag="KLMA_80414"
                     /codon_start=1
                     /product="single-stranded nucleic acid-binding protein"
                     /protein_id="XP_022678458.1"
                     /db_xref="GeneID:34718601"
                     /translation="MSETIEQTNTKIVVDPESSVFVGNLSPETTAEDLKQVFGESVKV
                     EIPTFQSDRTYPRIFAFVTFEDKVDVEELKEKFDKTVIKDKSIYVTKVLTPEEQQLKK
                     QKRRANQRGKAVPAPPKKNKETKVPLEQMERSKDTLYVNNIPYHTTKNEIASFFGTSE
                     ESVVLPMRRMKDTATKRVFFSKKYNRGIAFVSFPEGTDIEAKAAEFNGKTFEDRELTV
                     DVAANKPAHTETEPQTETANATSE"
     gene            <899088..>903089
                     /gene="YBT1"
                     /locus_tag="KLMA_80415"
                     /db_xref="GeneID:34718602"
     mRNA            <899088..>903089
                     /gene="YBT1"
                     /locus_tag="KLMA_80415"
                     /product="ATP-dependent bile acid permease"
                     /transcript_id="XM_022822171.1"
                     /db_xref="GeneID:34718602"
     CDS             899088..903089
                     /gene="YBT1"
                     /locus_tag="KLMA_80415"
                     /codon_start=1
                     /product="ATP-dependent bile acid permease"
                     /protein_id="XP_022678459.1"
                     /db_xref="GeneID:34718602"
                     /translation="MKDVWGLIAEDYSVLVVKRFNHFVQNKKKRRNFSFNLIHFFMKY
                     LLLQAIWATLSSIISFIPTMLLKRILEFVEDQSTAPLNLAWCYIFAMFLSRILTATFA
                     AQALFLGRRVCIRMKAIIIAEIYSKALRRKVSPNSAKDPTDVVDPQQLNDEHNIDGDE
                     ESSTTANLGAIINLMAVDAFKVSEICAYLHSFVEAVIMTIIALTLLYRLLGWSALVGA
                     LMIICLLPLNFKLATLLGTMQKKALAITDKRIQKLNEAFQAIRIIKFFSWEENFENDI
                     QKTRDEELNMLLRRSMVWACSSLVWFITPSIVTSASFATYIYVQGKTLTTPVAFTALS
                     LFALLRNPLDMLSDMLSFVIQSKVSLDRVQEFLDEEDTKKYDQVTISRNKLGFQNATF
                     TWDRNNQEFKLKDLSIDFKIGKLNVIIGPTGSGKTSLLMGLLGEMELLSGKVIVPSLD
                     PREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFNSPYNESRYNAVTSACGLTRDF
                     EILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHVLLDDCLSAVDSHTALWIYE
                     NCITGPLMQGRTCVLVSHNVALTLKSADWVVILENGRIKEQGEPIELLHKGSLGEDSV
                     VKSSILSRTASSVNLTESNRIVDKSGSSSADAKATETKKGNEAKQKTDGKLISEETKS
                     NGVVSLDVYKWYSVFFGGFKMIFCLCCLFLFAQLIEISQAWWLRAWASNNSINVVTQA
                     TSFRITGFLQPMKKATPMLFGSTSSEIETQSMTKSGHSTAYYLLIYLGIGLFQALCSS
                     TKIIISFLAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTP
                     YMEGAFASLIQCVSTIVVIAYITPQFLAVAALVMLLYYFVAYFYMAGSRELKRLESIS
                     RSPIHQHFSETLVGITTIRAFCDERRFMVENLKKIDNNNRPFFYLWVCNRWLSFRIEL
                     IGALIVLAAGSFILLNIKSIDSGLAGISLGFAISFTDGALWVVRLYSNVEMNMNSVER
                     LKEYTDIEQEPSNVGAYVPPQEWPQKGKIEVHDLSLRYDPKLPRVIKNVSFSVDPKCK
                     VGIVGRTGAGKSTIITALFRFLDPETGYIKIDDVDITSIGLKRLRQSITIIPQDPTLF
                     TGTLKTNLDPYDEYSDSQIFEALKRVNLVSEEELNPNNTSDASSSKSENANKFLDLDN
                     EVTEGGANLSQGQRQLVCLARSLLRSPKVILLDEATASIDYSSDAKIQATIREEFSNS
                     TILTIAHRLRSIIDYDKILVMDAGEVKEYDHPYSLLLNHESIFYSMCEDSGELEALIQ
                     LAKESFVRKLNSN"
     gene            complement(<903220..>904827)
                     /gene="MUP3"
                     /locus_tag="KLMA_80416"
                     /db_xref="GeneID:34718603"
     mRNA            complement(<903220..>904827)
                     /gene="MUP3"
                     /locus_tag="KLMA_80416"
                     /product="low-affinity methionine permease"
                     /transcript_id="XM_022822172.1"
                     /db_xref="GeneID:34718603"
     CDS             complement(903220..904827)
                     /gene="MUP3"
                     /locus_tag="KLMA_80416"
                     /codon_start=1
                     /product="low-affinity methionine permease"
                     /protein_id="XP_022678460.1"
                     /db_xref="GeneID:34718603"
                     /translation="MEETNLGEGTKKTHYVTEIASESLEDLEENVTSVVLNNEVPQGR
                     HLGLFSTVNLFVSRIIGGGIYAVPSSVFINCGGNIPLFLSVWIIAAIIAFIGMSIFLE
                     LGAALPRSGGRKNFLEVMFNRPWMMTTVMLCSFSILTCFAISPAIILGKYILYALGYD
                     AHFVNEESYASNYIAIISVIVIVLMHGLSLNHGILIQNFLGIIKFVIILIMCGTGTYV
                     ILFYENGNIGTGVSSVNTLNYFGFESTVSTASIATAFIQCFYCFAGWDTVHNVTSEIK
                     NPTRTLKLAGPLSLLIALICYLLLNIAYVKVLSYDEIQTAGPLIGSVLFTKLLGESIG
                     GKFIIISIILSAGSNLFVTIYGVSRMNQEVFREGLFPFSTALARNWPFTAPLPSLVVC
                     GFVSCFWLSIIPNTGPAFDYVVSFEGYGNQIILLFVAIGLLFRKKCLQSHDSTVVAPK
                     IGIVIFVIFSFYLSIAPFIGKQAENSLTSLPPYPISALLLFLLSFLYWLFTFKVFPFV
                     FGYTLKKKVVIQEDGLEVFQWSKKKYI"
     gene            <905782..>906716
                     /gene="COF1"
                     /locus_tag="KLMA_80417"
                     /db_xref="GeneID:34718604"
     mRNA            join(<905782..905806,906310..>906716)
                     /gene="COF1"
                     /locus_tag="KLMA_80417"
                     /product="actin-depolymerizing factor 1"
                     /transcript_id="XM_022822174.1"
                     /db_xref="GeneID:34718604"
     CDS             join(905782..905806,906310..906716)
                     /gene="COF1"
                     /locus_tag="KLMA_80417"
                     /codon_start=1
                     /product="actin-depolymerizing factor 1"
                     /protein_id="XP_022678461.1"
                     /db_xref="GeneID:34718604"
                     /translation="MYSPAFFGADESLNAFNDLKLGKKYKFILYGLNDNKTEIVVKET
                     SADQDYDAFLEKLPENDCLYAIYDFEYDLGNNEGKRSKIVFFTWSPDNAPVRSKMVYA
                     SSKDALRRALNGVSSDIQGTDFSEVAYESVLEKVSRGAGSH"
     gene            complement(<906968..>908632)
                     /gene="EFM1"
                     /locus_tag="KLMA_80418"
                     /db_xref="GeneID:34718605"
     mRNA            complement(<906968..>908632)
                     /gene="EFM1"
                     /locus_tag="KLMA_80418"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822175.1"
                     /db_xref="GeneID:34718605"
     CDS             complement(906968..908632)
                     /gene="EFM1"
                     /locus_tag="KLMA_80418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678462.1"
                     /db_xref="GeneID:34718605"
                     /translation="MVTKSSLGAFLEHARVNKCEVSDEIEFRLDPVIGIGAFCKKPVQ
                     KVDVPLIRVPIDFTIKKKEAEEYFAIDKFQSSNPNALTQLYLLALKRDRTSKWTPYLD
                     ILPTFNEIHSPLLWKDQELNLIRGTDLYTKTKRKLVLLLDEWFNLLKELNLCTESVTK
                     FYESQDRNNISVEESYSIDSFGAYVWASLIFSSRAFPSILYDTTAPLNEAFLLPVVDL
                     LNHKPNADVKWKEEAGFITFSSSESLKAEDELFNNYGDKSNEELLLSYGFSYEGNSHD
                     CTSISLKIDGISIEKARSCGIRLNHDNIVGDTIRFDIPRNDPLPRELVLFFGFISKLN
                     SEKDITVRAVLEGLGQLRAIFAQKVAIFKEKLKMLPNAIQNATIKKNTSIYLNSQRKL
                     YQSSEEEVNKRIKAIIKTYKPISFKSMYKSDTAFANSLLLSMGVSSFEELARKNVMHH
                     ALLLWIVKAHNSSFYKGEKPPEFVKAMFEEVKSSIKIDKEDVLEYMSFYKTFFPALSK
                     SIPEIYNVGSWSISDFVIAGVVIDRLVWLRETSNEYLIFKKTKFEM"
     gene            complement(<910212..>912602)
                     /gene="isp4"
                     /locus_tag="KLMA_80419"
                     /db_xref="GeneID:34718606"
     mRNA            complement(<910212..>912602)
                     /gene="isp4"
                     /locus_tag="KLMA_80419"
                     /product="sexual differentiation process protein isp4"
                     /transcript_id="XM_022822176.1"
                     /db_xref="GeneID:34718606"
     CDS             complement(910212..912602)
                     /gene="isp4"
                     /locus_tag="KLMA_80419"
                     /codon_start=1
                     /product="sexual differentiation process protein isp4"
                     /protein_id="XP_022678463.1"
                     /db_xref="GeneID:34718606"
                     /translation="MERIKAVLSSDAPVTEKKVMDVYPEDNISFIGSSEDHSQEDEKK
                     TAIKAVISPIRSDDFLTNQLSKEIVEDEYAGIVVEDDSPYPEVRASVPSTDDPTIPQN
                     TVRAWVIGMVMATIGSALNMLFSLHSPSIVLSSFVTTILAWPVGKAWERWIPNAPLFG
                     RFGGPPLNPGPFNLKEHTLIQIMANVSFGGGSAYATDIFLAMNNYFGKDFGWGFEIVA
                     ILATQCIGFSLAGLVRNVLVNPPSMIWPSNLVTSTFLTNLHVNENHIANGWRISRLKF
                     FLIVFIAGFCYYWLPGFLFQALSYFAWVTWIKPNNVVVNQVFGASTGLGLIPLTFDWN
                     QIAGYVGSPLVPPIGTIFSILLSMIFIFWVAVPAVHYSNVWYGKYLPISDSSSYDRFQ
                     QTYNVSRIVKPDLSFDKEAYKQYSPLYLSATFAISYGMSFASNAATIVHAALFHGKQI
                     KNAFKILDKEDEDVHNRLMKEYKEIPWWWYMAVFLVFFALAIVTVRAWDTQMPIWALV
                     FALIIAFVFLIPIGIIYAITNMSVGLNVITEFIIGYILPGRPIAMMFFKTFGYITNSQ
                     AVTYASDMKMGHYMKLAPRLVFSAQFIATLWSCIVQVCVLKWAQGNISNICTPHQKSH
                     FTCPGARVFFNAAIIWGVIGPQRMFSSGQMYNKVLYFFLIGALTPALTWLILKKWPNS
                     FVKYLNWPVFFSGTGLIPPATPYNYGAYCMVGITFGYFIKKKWFHWWTKYNYSLSAGL
                     DIGLAWSSLMIFFCLQLTNKSAPKWWGNDVINTVEYEGVAIQKILPEGESFGRKHW"
     gene            <918522..>920855
                     /locus_tag="KLMA_80421"
                     /db_xref="GeneID:34718607"
     mRNA            <918522..>920855
                     /locus_tag="KLMA_80421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822177.1"
                     /db_xref="GeneID:34718607"
     CDS             918522..920855
                     /locus_tag="KLMA_80421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678464.1"
                     /db_xref="GeneID:34718607"
                     /translation="MSFLGVKRASTDTTESGAKDGKVESDEFRIPEQDLEKDSIKKEV
                     IAEEYEDETDSTLSTSEAIEITLKDIDEVVDLHERDVDAPAGTIRMWVLAIGLSTVIS
                     GVDVFFAFRFPSISIGAIVAQLLAYPLGLLWHMIVPEWTIRIGKWSLPLNPGRFNTKE
                     HALIYLFTNTVASTGLLSNTQIEQVKFFKNDYGIGRFILFDIAGFLISWGLAGFSLPI
                     LVDREEVIWPGVLNSCALFKALHNYKEPSIRGWKITRFNFFICAFTASFIWYWFSDLI
                     IPFIASLGAFPSWSRPKNAVLGQVFGTTNGLGLLPLTFDWPTISNLGNPLLVPLWAAA
                     TIFASFVFWVWIVVPAMYYQNKWHTAHLPLLSNNLFDKKGTSYKINSVVTKKWQIDLE
                     KYKAYSPVFIPVGFLMSLALSLGGFSAVMISFFWKFKTDAWEPLFKKETHSTSHYIVA
                     SGKKFKTFYVCSILVGLALGFVFSEAWHEAAQLGAGGYLVSALIGILIFVPVALVESR
                     STFELNMNGFFNVVGAFWFKGKPIATLYFLNTGFSIFEHAMHYTQGAKLGFYMKTPPK
                     LTMFVLLAAGIWASLVTSSVAGFVLYHIDNVCTAAAKNHMICKKQQTAFNTQILWGLF
                     GHKIFGDGGRYNFIMYFFLVGAVVSCIVIVMQIWRPKSVFWAKANPALFMAGAENIPT
                     STGINYSAWFIVAMIFNYYIHKKHTAWWRKYNLILAAGLDCGVAIAAILVYFCVVYTG
                     GSANYSWWGTEVASSSCDSKGCPYLPAKKIDASGITW"
     gene            <921643..>922914
                     /gene="ARR3"
                     /locus_tag="KLMA_80422"
                     /db_xref="GeneID:34718608"
     mRNA            <921643..>922914
                     /gene="ARR3"
                     /locus_tag="KLMA_80422"
                     /product="arsenical-resistance protein ACR3"
                     /transcript_id="XM_022822178.1"
                     /db_xref="GeneID:34718608"
     CDS             921643..922914
                     /gene="ARR3"
                     /locus_tag="KLMA_80422"
                     /codon_start=1
                     /product="arsenical-resistance protein ACR3"
                     /protein_id="XP_022678465.1"
                     /db_xref="GeneID:34718608"
                     /translation="MSSSFTRRCDEPSMESRDQEPSQSNDWRLLDTAKKLSYKDLMLP
                     VTIILCMIISVLISVYVPSSRHVFDAKKDFNLVNVSIPLAIGMIVMMIPPICKVPWES
                     IHVFISKNSVWKHIAISLVLNWVIGPLLMTGLAWLVLFKHEEYREGIIMIGIARCIAM
                     VLIWNQIAGGDNDLCVVLVICNSLLQMFLYAPLQLLYCYVISAGNFQGSYNRVFEEVA
                     KSVGVFLGIPLLCGIATRMLFVCIIGKDKYERNVLKYVAPWSTIGLHYTICVLFISRG
                     YQLVHELGSAFLCFVPLILYFIIAWTLTFVLLRCLTKQSTEDNQECDCDQEKLLLPNS
                     WGKKTCTSNFPITMTHCFTTASNNFELSLAVAISLYGNDSKQAIAATFGPLLEVPILM
                     MLALLSKYLHAKFMWESEGISSGLRYSSNDS"
     gene            <924107..>925021
                     /locus_tag="KLMA_80423"
                     /db_xref="GeneID:34718609"
     mRNA            <924107..>925021
                     /locus_tag="KLMA_80423"
                     /product="flocculation protein FLO9"
                     /transcript_id="XM_022822179.1"
                     /db_xref="GeneID:34718609"
     CDS             924107..925021
                     /locus_tag="KLMA_80423"
                     /codon_start=1
                     /product="flocculation protein FLO9"
                     /protein_id="XP_022678466.1"
                     /db_xref="GeneID:34718609"
                     /translation="MWFALFQVLLLMGIPLVDCQSFNTDLNTVLGCDPKTNSLSKGFS
                     VSYYHYPLIPSGSAGCYVGDSQTFLTDEYLHGGYATYGDGLIGSSTGVTDLTFQFRFP
                     GGCLRPILGSLPSNYNNPPQFSMSNFSMLITGYFFAPKTGLYDFVITNGDDVIDINMG
                     DGKAFACCQLENTITKPAPFDISVVWRTTSGSGSFNLVGGYYYPLRIFYMNRYQDAAI
                     KMYFKDPDGVVHNNFDGYVFTIPDGEKCPAPVATTTLPWTFQSTATGTAIGTTTAVDG
                     EAITEDFIVVRLPHIETATAINTPWTGT"
     gene            <925341..>926624
                     /locus_tag="KLMA_80424"
                     /db_xref="GeneID:34718610"
     mRNA            <925341..>926624
                     /locus_tag="KLMA_80424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_022822180.1"
                     /db_xref="GeneID:34718610"
     CDS             925341..926624
                     /locus_tag="KLMA_80424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022678467.1"
                     /db_xref="GeneID:34718610"
                     /translation="MYYQNKWHTAHLPLLSNNLFDKKGTSYKINSVVTKKWQIDLEKY
                     KAYSPVFIPVGFLMSLALSLGGFSAVMISFFWKFKTDAWEPLFKKETHSTSHYIVASG
                     KKFKTFYVCSILVGLALGFVFSEAWHEAAQLGAGGYLVSALIGILIFVPVALVESRST
                     FELNMNGFFNVVGAFWFKGKPIATLYFLNTGFSIFEHAMHYTQGAKLGFYMKTPPKLT
                     MFVLLAAGIWASLVTSSVAGFVLYHIDNVCTAAAKNHMICKKQQTAFNTQILWGLFGH
                     KIFGDGGRYNFIMYFFLVGAVVSCIVIVMQIWRPKSVFWAKANPALFMAGAENIPTST
                     GINYSAWFIVAMIFNYYIHKKHTAWWRKYNLILAAGLDCGVAIAAILVYFCVVYTGGS
                     ANYSWWGTEVASSSCDSKGCPYLPAKKIDASGITW"
     gene            <927412..>928683
                     /gene="ARR3"
                     /locus_tag="KLMA_80425"
                     /db_xref="GeneID:34718611"
     mRNA            <927412..>928683
                     /gene="ARR3"
                     /locus_tag="KLMA_80425"
                     /product="arsenical-resistance protein ACR3"
                     /transcript_id="XM_022822181.1"
                     /db_xref="GeneID:34718611"
     CDS             927412..928683
                     /gene="ARR3"
                     /locus_tag="KLMA_80425"
                     /codon_start=1
                     /product="arsenical-resistance protein ACR3"
                     /protein_id="XP_022678468.1"
                     /db_xref="GeneID:34718611"
                     /translation="MSSSFTRRCDEPSMESRDQEPSQSNDWRLLDTAKKLSYKDLMLP
                     VTIILCMIISVLISVYVPSSRHVFDAKKDFNLVNVSIPLAIGMIVMMIPPICKVPWES
                     IHVFISKNSVWKHIAISLVLNWVIGPLLMTGLAWLVLFKHEEYREGIIMIGIARCIAM
                     VLIWNQIAGGDNDLCVVLVICNSLLQMFLYAPLQLLYCYVISAGNFQGSYNRVFEEVA
                     KSVGVFLGIPLLCGIATRMLFVCIIGKDKYERNVLKYVAPWSTIGLHYTICVLFISRG
                     YQLVHELGSAFLCFVPLILYFIIAWTLTFVLLRCLTKQSTEDNQECDCDQEKLLLPNS
                     WGKKTCTSNFPITMTHCFTTASNNFELSLAVAISLYGNDSKQAIAATFGPLLEVPILM
                     MLALLSKYLHAKFMWESEGISSGLRYSSNDS"
     gene            <929876..>932794
                     /locus_tag="KLMA_80426"
                     /db_xref="GeneID:34718612"
     mRNA            <929876..>932794
                     /locus_tag="KLMA_80426"
                     /product="flocculation protein FLO5"
                     /transcript_id="XM_022822182.1"
                     /db_xref="GeneID:34718612"
     CDS             929876..932794
                     /locus_tag="KLMA_80426"
                     /codon_start=1
                     /product="flocculation protein FLO5"
                     /protein_id="XP_022678469.1"
                     /db_xref="GeneID:34718612"
                     /translation="MWFALFQVLLLMGIPLVDCQSFNTDLNTVLGCAPKTNSLSKGFS
                     VSYYHYPLIPSGSSGCYVDDRKTFLTDEYLHGGYATYGGGLIGSSTGVTNLTFHFHFP
                     GGCLRPILGSLPSNYNNPPQFSMSNFSMLITGYFFAPKTGLYDFAITNGDDVMDINMG
                     DGKAFGCCQLESTISNPAPFDISVVWPSSTGSGSFNLVGGYYYPLRILYINRYYEAII
                     AMSFKDPDGVVHNDFDGYVFTIPDGEKCPAPVATTTLPWTFQSTTTGTAIGTTTGVDG
                     EAITEDFIVVRLPHIETAIAINTPWTGTYTTTVATATTTVTGSDRIPTIETIFSVETP
                     QVETATTINAGWTGTYTTTYSTDISTETGADGIPTVRTNFLVETPQVETATTINAGWT
                     GTYTTTYSTDISTETGADGVPTVKTNFLVETPQVETATTVNIPWTGTYTTTYSTTIAT
                     ETGTDGIPTVKTNFLVETPQVETATTVNTPWTGTYTTTYSTGISTETGADGIPIVRTN
                     FLVETPQVETATTINAAWTGTYTTTYSTTISTETGADGIPTVRTNFLVETPQVETATT
                     INAGWTGTYTTTYSTDFVTVTGIDGIITLQAVYHVQTPTLKPSKFDNLSSTSNDTQAY
                     STDIIATTGADGVPTVHPTFSVDASEIGSISTVISPWTGTYTTTYSTELVTATGTDGI
                     ITVQTVYHVKTPSTGTTNTKKSAWISNYLQTYSTGGIGSSSADGVSNVQTAIHVKTGE
                     AGNAMKINIPWTGTYTTTYSTGAFTSTGSNGIQTVQTAFYVKTPEMCSSSFGYSNTSS
                     TTSHGTDSNGNKNLQSETSKPLVKVSVTSGNVIGHSTAETNLPISQKTSSNRPTTSKN
                     DDGPVPERGSTANINTPLGTTMNAVGETSGAVSGIIDTETKGKQSKTMSISVGQPVTV
                     SSATSKATSPQPSLNPSIPTFTPSISGASQTATFETRLEDKANKILISPLVVMLLAFL
                     "
     gene            complement(<933287..>934846)
                     /gene="FCY2"
                     /locus_tag="KLMA_80427"
                     /db_xref="GeneID:34718613"
     mRNA            complement(<933287..>934846)
                     /gene="FCY2"
                     /locus_tag="KLMA_80427"
                     /product="purine-cytosine permease FCY2"
                     /transcript_id="XM_022822183.1"
                     /db_xref="GeneID:34718613"
     CDS             complement(933287..934846)
                     /gene="FCY2"
                     /locus_tag="KLMA_80427"
                     /codon_start=1
                     /product="purine-cytosine permease FCY2"
                     /protein_id="XP_022678470.1"
                     /db_xref="GeneID:34718613"
                     /translation="MSSPVYNEGYLSSDIEKQDPAESHVQELEKDHSVYTTTTEVSRL
                     SWVNRLAVRVNAETKGIDPVTENEKDDTDIMNAATMWFSSNMVISAFSLGCLGISACG
                     LNFGTSVLTIFFFTLLGVMPVAFFSVFGVELGLRQMVLSRFLVGNITARLFSFMNVIA
                     CVGWVSVNTMASASLLHMVNPGGHNCPPWAACLILIMCTIVVTFFGYRFIHLYEKWSW
                     VPNFAVFLVIIACLAKSGNFTNGPWGGGPNTAAGVLSFGSSIFGYAAGWATYAADYTV
                     YMPRQTNKKKVFFSVVLGLGLPLLFTMTLASAAMACTQTNKRWAELYDSHSVGGLCYA
                     ILVEDSLWGFGSFCCVLLAMSTVANNTPNMYSIALGTQAMWEPLAKIPRVFWTFVGNL
                     AALAISIGAYYKFESFLSKFMDSIGYYIGIYIAISLSEHYIYRRGFTGYTVSDWNRWD
                     KLPIGYAGCAALFIGAFGVAFGMSQSYWKGEIGRHIGSGGADIGFELGAGFAFIAYNI
                     CRPLELKYNGR"
     gene            complement(<936555..>937733)
                     /locus_tag="KLMA_80428"
                     /db_xref="GeneID:34718614"
     mRNA            complement(<936555..>937733)
                     /locus_tag="KLMA_80428"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822185.1"
                     /db_xref="GeneID:34718614"
     CDS             complement(936555..937733)
                     /locus_tag="KLMA_80428"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678471.1"
                     /db_xref="GeneID:34718614"
                     /translation="MTVAEPIPPISDLKPASSTTSPTTSPIANPSSKSQQYTFSYLNK
                     PKSRFTLPTVQSPWGYKVWLREFCKALRKQGLGYLLPLRDGTFSHVPEDDEKDYITRI
                     HSACVPPGKCPKWLKLSPEDDASIVDCFLQAVKKINAEEYPTNIVDEMAALSLLPEES
                     LQSFLKRAKDLQRRASNANFPGVDQILIDKTLVTLPETYHRATVTFYNQKDRSFKRFM
                     EILSETETKISDGKEIDTNTTKKEVLNLKVDKEERDVLKKEEIDVLKREEIDALKKEE
                     VDSLKNNEIDSLKKEEVDSLKKKEIQTFAKEVSRISMPDEEPIHDFLARMGDLYDRLA
                     RADLLQLESQMVANILRALPKKFELMVATFRLGFDQDFPSLVALFSDPEIATRLLGIE
                     "
     gene            complement(<938312..>938680)
                     /locus_tag="KLMA_80429"
                     /db_xref="GeneID:34718615"
     mRNA            complement(<938312..>938680)
                     /locus_tag="KLMA_80429"
                     /product="hypothetical protein"
                     /transcript_id="XM_022822186.1"
                     /db_xref="GeneID:34718615"
     CDS             complement(938312..938680)
                     /locus_tag="KLMA_80429"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_022678481.1"
                     /db_xref="GeneID:34718615"
                     /translation="MFGTRFFSQLPLWEISEYPPWSLFLSLICPLTYRAHSFHCYPHL
                     DFIALTNLAPLPIKLQPTSTSSIYFSLCYPDDICLYPSTGLITPPSIPPSLYLLHFCF
                     FYILLHHFSRNKHTFLLPAH"
CONTIG      join(AP012220.1:1..939718)
//
DBGET integrated database retrieval system