GenomeNet

Database: RefSeq
Entry: NC_040193
LinkDB: NC_040193
Original site: NC_040193 
LOCUS       NC_040193            1421705 bp    DNA     linear   CON 11-JAN-2019
DEFINITION  Malassezia restricta chromosome I, complete sequence.
ACCESSION   NC_040193
VERSION     NC_040193.1
DBLINK      BioProject: PRJNA495494
            BioSample: SAMN09478194
            Assembly: GCF_003290485.1
KEYWORDS    RefSeq.
SOURCE      Malassezia restricta
  ORGANISM  Malassezia restricta
            Eukaryota; Fungi; Dikarya; Basidiomycota; Ustilaginomycotina;
            Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
REFERENCE   1  (bases 1 to 1421705)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Complete Genome Sequence of Malassezia restricta KCTC 27527
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1421705)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JAN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1421705)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2018) Division of Polar Life Science, Korea Polar
            Research Institute, 26, Songdomirae-ro, Yeonsu-gu, Incheon 21990,
            Korea, Republic of
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP030251.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 2018
            Assembly Method        :: canu v. 1.7
            Assembly Name          :: MRES_180501
            Expected Final Version :: yes
            Genome Coverage        :: 38.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1421705
                     /organism="Malassezia restricta"
                     /mol_type="genomic DNA"
                     /strain="KCTC 27527"
                     /isolation_source="skin environment"
                     /host="Homo sapiens"
                     /db_xref="taxon:76775"
                     /chromosome="I"
                     /country="South Korea: Konkuk University Hospital, Seoul"
                     /lat_lon="37.57 N 126.98 E"
                     /collection_date="2010-05-01"
     gene            complement(<306..>1019)
                     /locus_tag="MRET_0001"
                     /db_xref="GeneID:38736767"
     mRNA            complement(<306..>1019)
                     /locus_tag="MRET_0001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626628.1"
                     /db_xref="GeneID:38736767"
     CDS             complement(306..1019)
                     /locus_tag="MRET_0001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482835.1"
                     /db_xref="GeneID:38736767"
                     /translation="MIQHHPKQHSTAHNRTGKMKTTIVGIALAAAAVTSVNALKCEKR
                     ETGPLVSWEAHLAEGDGHKQNYAMKYGSLVRSKERGEEYDFYECEAPEGFAKSDDEKM
                     YGVIKTKDGKKCLTNSYIWRWDGKAKHHRREPKKGEKEVRLEECAEGGEELRKQWFRM
                     IIPRKEGCSRVLLQQAREEDLALTLTYGEEGVAFHRRFMMILDRGCRRKDTGRRKVSW
                     RQERWEKSACSARPRKKRA"
     gene            complement(<2502..>4181)
                     /locus_tag="MRET_0002"
                     /note="MRES_03255"
                     /db_xref="GeneID:38736768"
     mRNA            complement(<2502..>4181)
                     /locus_tag="MRET_0002"
                     /product="iron transport multicopper oxidase"
                     /transcript_id="XM_027626629.1"
                     /db_xref="GeneID:38736768"
     CDS             complement(2502..4181)
                     /locus_tag="MRET_0002"
                     /codon_start=1
                     /product="iron transport multicopper oxidase"
                     /protein_id="XP_027482837.1"
                     /db_xref="GeneID:38736768"
                     /translation="MKFHLAISAAFAAGAYAADVGKHWKIGWIDNVNPDGKFPRRAIG
                     INGKFPHDPVSINSNDFLHINVSNAFGDGRPTTLHAHGLYYQNVNYFDGAANVAQCPI
                     PDGQSFNYEILNSPRAGKTESQWGTYWLHGHYKGQYTDGLRTPFIIHNANGEVYDYDD
                     DYTVALTDWYHEEHGYLKHHKFLKPDPIYPTPKEGLMYFAHTKANQTAKNLPGYNENA
                     TLPFEPGKTYRLRLINMSAASRFDFWIEGHDMDIIEADGTDVKRFATDVVQVGIGQRY
                     SVLVKARNSAENDWRIHADMEKDMYGGGFKHQDGDHLRLNLTSKVSYGKKNAKLGKGR
                     KTISTFKLFDDLLLEPVHKESAETKPDMAVTLMVGMNSTEDGIPIGTFNGTQFKAPLT
                     PPILTMKTENDTAIMDPKIYGPNSNAVVAPYNSTVELKLVSAGGAHPFHLHGTKFQLV
                     ERMKNTSLPCTKQCSRENPLRRDTVILPAGGSVTMRFRADNPGAWMMHCHMDWHLAAG
                     LAMMVIQAPREAKKMLDVPSYFPQQCRMQGLPVHGNAGGVRGSTTDFGRLN"
     gene            <5112..>6620
                     /locus_tag="MRET_0003"
                     /db_xref="GeneID:38736769"
     mRNA            <5112..>6620
                     /locus_tag="MRET_0003"
                     /product="carboxypeptidase D"
                     /transcript_id="XM_027626630.1"
                     /db_xref="GeneID:38736769"
     CDS             5112..6620
                     /locus_tag="MRET_0003"
                     /codon_start=1
                     /product="carboxypeptidase D"
                     /protein_id="XP_027482836.1"
                     /db_xref="GeneID:38736769"
                     /translation="MRSYQLSCTTSARMSLCSLFYFFVATLVVGTYGTRNDPIYNVQA
                     LRARLGSEGTKKFEIPTRLPNVTFEVPPSWGGYQPVSPRHDETRQLYFWMFPATGKVG
                     HDDLVVWFNGGPGCSSLTGVLTEEGPVKFNNVTHKAEPNPYSWTNLTNMIWVDQPAGT
                     GFSRGQPKNQSMEQIAEEFNGFLLSLYQTFPKLQGKRLWLAGESYAGKFIPYMADWIY
                     KHEVENQKAGIHLHGINMIDGFFMDDIIGKELPSMQFAQQHYRSMNISEADMSALEAK
                     AQKIGIDDYVERYLHYPPKGPLPIPRNLNKPESVYSTFKNLAKKANPCFSPFYVIATA
                     PCPLNSMGQNVTSEKAFPQNYFNDMPSIKPIIHADNKTYLSCSRAKPFKIMKKLHTQF
                     PIHTVLPGVIEKSNRTIIQHGKLDYIMLVNGTSLAIQNMTWAGAQGFQSKPNKTLLVD
                     GETAGLYHSERKLSLVQVDRASHMIAAYKPKPAYKLLQFLLGQIEEEDLIKA"
     gene            <6861..>9254
                     /locus_tag="MRET_0004"
                     /note="MRES_03250"
                     /db_xref="GeneID:38736770"
     mRNA            <6861..>9254
                     /locus_tag="MRET_0004"
                     /product="Csr1-phosphatidylinositol transfer protein"
                     /transcript_id="XM_027626631.1"
                     /db_xref="GeneID:38736770"
     CDS             6861..9254
                     /locus_tag="MRET_0004"
                     /codon_start=1
                     /product="Csr1-phosphatidylinositol transfer protein"
                     /protein_id="XP_027482839.1"
                     /db_xref="GeneID:38736770"
                     /translation="MSLASPLIPIKRAPVNSRKYKSREHFANDKKNAAPRVDSRQSNS
                     DLSFSNSRKVLKQTGSHQKTTKDTQSNLGFQKNKLSSSKKLPLIPECSREGLGHETRS
                     CVTPDHRARVGNDSCNGVSKSQSSHSMIEQANDSDNEFYDAIEATEASLPVTTQITKK
                     ADANQSPSDVSPAPHPNFQGKFNKIHDLQLLASNAKDRSARISRLTYADVRQLPDNMY
                     QDILVTHRALHCFLNSRMMEAYEIVEPYSECRLYYTLGYALLSTIKAMMTFEHQDLGT
                     AISHCRDALHIAHLLRKKQSALSSFGRFVRGAGPSVAWFSSMTPVEKHAELISSECTL
                     LKAVLGIAHSGDILGSLSEIFHLRAAYGEYRSLLKFIEWEDAHAQEKTDEHFRSGVFL
                     GSGCISLILGLLPSKVLKIMEIFGYEGDVQVGLRLLCQASGWNPDPSKRVPLHTIETE
                     GIRGPLSDMAMLMYHLVISTFIPVPHVNIDFSEKVLNYHLQRYPQGVFFLYFQGRLYS
                     TQARSAKAIECFKEARDVQNEYVQLKHICYWDMALAYMSLNEWRKTSFCFTVLANENN
                     WSKALYHYARAASLYETGNATEREEAKEVMERVPSMTQRIAGKSIPLEKFAARKARKM
                     TQYGYLFHPAMEFAYLTHCYTSSSPSSLYQRSLPIIEKELARMETEANPVQDDLCLAH
                     FLHGVILRNLAYPENHVKKDSFEGYFNASEACTKAETSLLYVAKHGALCEYDHYMLYF
                     CHYELGRLYISMGRHADARSQLELVLSGKNLGDHGRKGKYSMQNMCVLRSNAALELM"
     gene            <9357..>11093
                     /locus_tag="MRET_0005"
                     /note="MRES_03245"
                     /db_xref="GeneID:38736771"
     mRNA            <9357..>11093
                     /locus_tag="MRET_0005"
                     /product="Bromodomain associated protein"
                     /transcript_id="XM_027626632.1"
                     /db_xref="GeneID:38736771"
     CDS             9357..11093
                     /locus_tag="MRET_0005"
                     /codon_start=1
                     /product="Bromodomain associated protein"
                     /protein_id="XP_027482838.1"
                     /db_xref="GeneID:38736771"
                     /translation="MVQEACLIKRARHAQPASDQAFFQLQLSAFAFLSSCGFQGSSAN
                     ACHVFAECIQRYITLLGRTATGMAMGAGRHTANIWDVIMSLEEIMGQGTLDELMEWAN
                     DEGIWRRTTTDFWSPTLRKEQAKLARLANHELCSQRTSFSFEEIQDEALYVELTIREA
                     LDQCLEDDLVWGTSAYVTGTKRPYIEERLQDDENSYIPSFLPRFPTKDAWKERTPTDN
                     VVRARAPKPKTEAKARPIPRAATIQGVPPSDELGEDGVRKVWRRRAMAYAGVLAESSG
                     TRSELPSLDVCAKRRGPEAKLVPHGSTTSSIDAFMQVMDALGDDPTTQTPMLLTSLSR
                     SHHTNPTSTSLMAAAFKRRRLAHAMADPLRYVPNDSMHGCVHVHPTSPSAAPGPSLLI
                     TIPPAKDGVDEDTHAATAAPLFTPVHPHGRTVAMVPPSGAQFPTMSYRHASHLYHAAR
                     MLLYPDMQRVFSRLSDPPAILDDHRTEQVYHGTAASRTQLSGTIMSVRHRDTLGVMVS
                     RYRGANSILHASLERLRFHLAAEQEAQRRAALEDGRENEVEEPIRGERIKMPVKGTLV
                     HSWDWQKADPYA"
     gene            complement(<11096..>13417)
                     /locus_tag="MRET_0006"
                     /note="MRES_03240"
                     /db_xref="GeneID:38736772"
     mRNA            complement(<11096..>13417)
                     /locus_tag="MRET_0006"
                     /product="ATP-dependent RNA helicase SUPV3L1/SUV3"
                     /transcript_id="XM_027626633.1"
                     /db_xref="GeneID:38736772"
     CDS             complement(11096..13417)
                     /locus_tag="MRET_0006"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase SUPV3L1/SUV3"
                     /protein_id="XP_027482841.1"
                     /db_xref="GeneID:38736772"
                     /translation="MRGIIYSSWQYARCKLWMRTGTLPARWISDKSRSRSWHGAKRPF
                     KGPKPRPVAPLELTRPPIVVTEPMMDDILQDAVLSYAKSNETIQHFTRFGIPMAALNA
                     IQEHFSSTPMRSIRNAWGSILNLWAQECQKGFWDAFASRKELASAYTRQGHEALQRAC
                     AQSFLQWLLYHLNQLRQQKRISSKRLIEVQEAFMQLELIRSITDLRVPALAFANARSL
                     TRQIHLHVGPTNSGKTHGALVTLSRARTGMYAGPLRLLAHEVWERMNQGTISPGIPPR
                     ACNLRTGEEVRTVDEYAGLVSCTVEMADVTRPYDVAVIDEIQMIADPQRGFAWTHAVL
                     GLPAKELHLCGEASTVPLIQHLAKLCGDDLHVHNYERLTPLHVAPHSLYGDLGKVQRG
                     DCIVAFKRSTIFRLKEQIEARTGLQCALAYGALPPETKSEQAKLFNAGKLDVMVASDA
                     IGMGLNLRIKRVIFDTLSKWNGTETVPLSLSQIKQIAGRAGRYGTSRDASPHGLVLTR
                     HEDEMDILRAALAAPVRSVTHALIQPSKQKLESLSFLLPRSRPKEAVRNVLQENSMSS
                     LLEEFHAMADLDAGIFAISDFVSQQAISALIEHRGCGLLTHAEKETWSNTPVNVRDER
                     AMAWVGNAIEKYARGELVEFEACAKDLGTLEVEEAVTQIAADAEARRKAAKSTQPLAM
                     WVQQDEAILHVDTLMLLESLHRSLTIYLWLGFRFPLSFCFRHHVAERKRRTEASIEFC
                     LEVIRIRRAQRLTYLGRDEEAKKLLQKHIEKRR"
     gene            <13524..>15527
                     /locus_tag="MRET_0007"
                     /note="MRES_03235"
                     /db_xref="GeneID:38736773"
     mRNA            <13524..>15527
                     /locus_tag="MRET_0007"
                     /product="diphthine-ammonia ligase"
                     /transcript_id="XM_027626634.1"
                     /db_xref="GeneID:38736773"
     CDS             13524..15527
                     /locus_tag="MRET_0007"
                     /codon_start=1
                     /product="diphthine-ammonia ligase"
                     /protein_id="XP_027482596.1"
                     /db_xref="GeneID:38736773"
                     /translation="MKIVGLLSGGKDSCFNLCHCVLNGHEIVALATLAPPQGKDEIDS
                     YMYQTVGHDAVHAIATALDVPLYRAEIRGTALNQGAVYGERDPTKECVSSLEDETEDL
                     YRLLLRVKEKHPDIEGVSVGAILSNYQRVRVEHVCCRPDLRLASLAYLWKRDQSELLH
                     EMNQAGMEVLMIKAAGIGLTQHDLGRPLTVLTPKLEELHRLYGAHVCGEGGEYETLCV
                     DSPLFKRKISVDEKETVIHSDAAFASVSYLRILRTSFSDKENYGPAVVSERLKTPPLL
                     DDTGEVFLETLRTHPCQRKQAFPLETYTTWKPTMSVSQKGPWITATEISAEDLCQADF
                     EEEARCAFRRLHNALQEYGFNRTDITHVNVYLASQAYFAPLNQVYQHEFGAAPPSRVC
                     VALPNASSSVRIKLDAVACRSSSTQERRSMHVQSCSYWAPACIGPYSQAVCDHGRMFM
                     AGQIGMVPSTLEVPQDVSTQLALSLQNQHRVSAIRSEWSRYGWSEGGLCWLSPPNNMD
                     LASCMNALWQYPSPMLFVHLPPESLPKKALCEWQLTERTCDDETEPCTKTASFVSHGV
                     SCTFRVCASESLSSGAAIITPTRRDHENSELASDLAHLLCGAIHLKLIHDAQHQPDAA
                     LALLQKVTTQRLPPITLIPALHWHMPGIQSSHDPSSSCALVWL"
     gene            complement(<15539..>16987)
                     /locus_tag="MRET_0008"
                     /note="MRES_03230"
                     /db_xref="GeneID:38736774"
     mRNA            complement(<15539..>16987)
                     /locus_tag="MRET_0008"
                     /product="oligosaccharyltransferase complex subunit beta"
                     /transcript_id="XM_027626635.1"
                     /db_xref="GeneID:38736774"
     CDS             complement(15539..16987)
                     /locus_tag="MRET_0008"
                     /codon_start=1
                     /product="oligosaccharyltransferase complex subunit beta"
                     /protein_id="XP_027482843.1"
                     /db_xref="GeneID:38736774"
                     /translation="MRLIACVLVLLSFVAHSLAVSATGQRVLALVEDGPHEYSSYFDS
                     LKGRGYEVTTTTPDSVDSDTLFKFGERMFDHVIMFSPKMKHFPESMKPTVLVEFLRNG
                     GNLLVGLSPRLSESWRNFAREFGLEFGERDTMLVDHFRYDPASDRGDHAAVLVGSTGD
                     APLSGGGLVSNQAVFSRETLSLLDPFVFRGIAHWVGPSPLAFPLVLPPSTAYQTDVPK
                     ITFESTSQWEASGIQKLEPLHRMENLLTGADAYSHDTKASLVSAVQLRDNSARVVFVG
                     STESFQNGLYDNSERPKQRAVVDDLTAWSFQERGVLRVVRSAHERLRASPDDVRPDYE
                     EKPGMSRMYRIKDTVNYLLEVQEFQDGSWGPVTETLSPQLSAVMLDPYVTVPLVPENQ
                     NDSTLYRANLRLPDKHGVFTLRVNWKRHGYTYIVKNDVTPVRPFNHDEYPRMLSSSWP
                     YVAGALSTMIGFSVFVTLWLSMPAQKPTSKTL"
     gene            <17144..>20182
                     /locus_tag="MRET_0009"
                     /note="MRES_03225"
                     /db_xref="GeneID:38736775"
     mRNA            <17144..>20182
                     /locus_tag="MRET_0009"
                     /product="pheromone-dependent cell cycle arrest protein
                     Far11"
                     /transcript_id="XM_027626636.1"
                     /db_xref="GeneID:38736775"
     CDS             17144..20182
                     /locus_tag="MRET_0009"
                     /codon_start=1
                     /product="pheromone-dependent cell cycle arrest protein
                     Far11"
                     /protein_id="XP_027482842.1"
                     /db_xref="GeneID:38736775"
                     /translation="MVGASHLESAMGPTSHEMAREHDDITLLRNGGRTDIPFSFQEDA
                     DCIENELEEFYSYIEAPLLLENKASWMVWARKKWNSCCMPADVPIGAWKALDTHQRRR
                     ILHLLLDALDLHDTEARTTASHALLYHLQGSFGETDSEQEQLALIRENARMVFDLGGI
                     EDIFVACKRACWRHHMLNNLSDQQVPSENSQVLTPQEKAECLESINVEISTHFSQLYT
                     VIESLRGEFALGEILMTTSPPLPVYFLGLIANLREKSIGGFPVKKLVLLTWKSVLASL
                     GGYEALQRCKEGVRSREGLAPKSAIAESVPVSPQDMRQFHAEVTAKYPTLVDEQQAGL
                     LAGITLSDVTSALPTRLKGNGQGDETHLVMDEERLAVAKSAAAPPPLKPGRQKFQTDQ
                     SRPFILPFASEKFRDQVPLGIQEAFSLYQDHLYVKTSTWQTWLVRQELLNELRGARDP
                     RMLQAQRALSTLHLENPMHPSLNTEDEQRLEWVEQIYRQSLPSLQSAVIVLLKVVLAT
                     STPGNTNSAFGRAVAENVPPEHAPPPTLEDVDVIRHREILNKGVTFLLLLCLRWFKVN
                     HALQFEYLAQILLDSNIILLILKLFGLQETNHAVHSRCEASSFGLFRYCRLVGHDQST
                     HTSQSLFDQLTLFVGNVWDCYPDDPLRLRHTDSLASSSQPYSWRNFATASNMIQILYQ
                     VCKSKLHRILLLVQYKSSAILKRMLNVPNKQLELYVLKLLKFQIPYCGRKWRQSNMRI
                     ITQIYLRCHSKLREDWPGGSDLEAEVEASLPEEQTLRTLIQFFNRSRYQFRAPIAGMD
                     ISHATVKGALGPEWVEADRDAFEREAFPPRPVSSGTSTPGRYISGVSVEGYLDAYEDL
                     MQEMNDTLPLSTIEVPEPESTSTANSTQSNGQNLWEHLSPHEMDILSRSPRTNSGTLR
                     SPHSLSTSSSPRSLHSRRLSLSNPQVIRESVHRVNSSPGTCRPLMHWNMEELVEDAIS
                     TEEDPPEIPVERLEQANIPERPLASPKPGGIDEVEHIFGA"
     gene            <20279..>21661
                     /locus_tag="MRET_0010"
                     /db_xref="GeneID:38736776"
     mRNA            <20279..>21661
                     /locus_tag="MRET_0010"
                     /product="mitochondrial distribution and morphology
                     protein 10"
                     /transcript_id="XM_027626637.1"
                     /db_xref="GeneID:38736776"
     CDS             20279..21661
                     /locus_tag="MRET_0010"
                     /codon_start=1
                     /product="mitochondrial distribution and morphology
                     protein 10"
                     /protein_id="XP_027482909.1"
                     /db_xref="GeneID:38736776"
                     /translation="MYDAVTVLLREYWRTTGWNDQSSYLNLSKASDVLLDFAVPHGVS
                     LSSLSISPEAAFTAHTRILTVPLSGTIAYSNARTNSPFNFKCVCDPLQRMTRAALFIE
                     PDAGVPHSVFDPNKSREMLVYGGVHIPSACVEALCALRLSDDWQLLITAFSRAPRFPM
                     VPLGRLLGLIPPKRSGQVYPPPDMSVGPPGATNLLFTLQHQTPKTTSEYLYSLDDALW
                     GARVLRQVHEFSRGGSLYSGAEIFFSAAEKSGGVSSGLRCTMPHGASFMFGGPKSGPA
                     VWTMVLNPMMGYLRSDYIARVDDDLMIGTRFDLNAYSYQSDWTLGAEYILRRSPEEDT
                     NEGPSSMRERVGVWVNPNSTSNVSLRDHELPPALPTKPHQVSPQQSETPVEPESDAKA
                     LSSSEPSASTSMFLGLLKARLSMSGILSLLWEGHWRRCLVSVGLQSHLQSHAVSHLGV
                     EIKYLSDTQG"
     gene            complement(<21667..>28782)
                     /locus_tag="MRET_0011"
                     /note="MRES_03220"
                     /db_xref="GeneID:38736777"
     mRNA            complement(<21667..>28782)
                     /locus_tag="MRET_0011"
                     /product="pre-mRNA-processing factor 8"
                     /transcript_id="XM_027626638.1"
                     /db_xref="GeneID:38736777"
     CDS             complement(21667..28782)
                     /locus_tag="MRET_0011"
                     /codon_start=1
                     /product="pre-mRNA-processing factor 8"
                     /protein_id="XP_027482910.1"
                     /db_xref="GeneID:38736777"
                     /translation="MAAKPPPGFMGIPGPTSTGATPVAEPRPMSPAELAVKARKWKQT
                     QSRKYGERRGKTAFVDTGKQELPPEHVRKIVKDHGDMSNRKYRAEKRVHLGALKYVPH
                     AMLKLLENIPMPWEQVREVPVLYHITGAITFVNEVPRVIEPIYHAQWATMWLAMRREK
                     RDRRHFKRMRFPPFDDEEPPIDYSDNILDVEPLEAIQLELDEEEDAAIIDWFYDHKPL
                     VKDANHVNGPSYRFWTLDLPKMAALYRLGRTLQSDFTMGDKNYFYLFDLKSFYTAKSL
                     NVAIPGGPKFEPLYKDMDDYDDDWNEFNDISKVIIRQPIRTEYKVAFPHLYNSRPRSV
                     YLGTYHEPKNVYVQTDDPDLPAFYFDPAINPIPSRVLVNLDLFRSHYNNGEPVLSHED
                     TVFGEGIQGDDELPDEMAFTLPNEIEPFFNDLPLENELTSDAISLWWAGPPYNRRSGM
                     TRRTVDVPLIKAWYLEHCPPGQPVKVRVSYQKLLKKYVHNTLHARPYKAQSKKYLFRQ
                     LKSTKFFQTTRLDWLEAGLQVVRQSFNMLNLLIHRKALTYLHLDYNMNLKPVKTLTTK
                     ERKKSRFGNAFHLVREMARMTKLIVDAHVQYRLGNCDAYQLADGLQYLLNHVGQLTGI
                     YRYKYKVMHQIRACKDLKHVIYYRFNSGPVGKGPGVGFWGPSWRVWIFFMRGVTPLLE
                     RWLGNLLARQFEGRNGRTGGKSVTKQRVESHFDLELRAAVMHDLLDMMPEGIKQNKSK
                     TILQHLTEAWRCWKANVPWKVPGMPTAIENVILRYVKSKADWWTSVAHYNRERIRRGA
                     TVDKTVSRKNLGRLTRLYLKAEQERQNAYLKDGPYITSESAVAIYTSTVHWLESRRFQ
                     PIPFPSLNFKHDTKLLVLALEKLKEAYSVQGRLNQTQREELALIEQAFDNPHETLARI
                     KRLMLTQRAFKEVGLEFFDTFAKLVPTYDIEPIEKITDAYLDQYLAYEADKRALFPAW
                     IKPSDQEPPPLLVYKWSNGINNLQNVWDTSHGECNVLMETTLSKVFDKVDITLLNRLL
                     RLIMDHNLADYITAKNNVSIVWKDMAHVNSYGLIRGLQFSGFVFQYYGLILDLLILGL
                     RRASDLAGSPKMPNGFLQFENKNTETRHPVRMYMRYVDRVHILYRFTADQARDLIQRY
                     LSANPDPNNSNLIGYNNKKCWPRDCRMRLNKHDVNLGRAVFWTVKNSLPRSLTTIEWD
                     DTFVSVYSKDNPNLLFSMQGFEVRILPKIRQGDMSDQRDGVWSLVNAETGERSAQAYL
                     RVSDESIASFHNRVRQILMAAGSAPFAKIVNKWNTTLIGLMTYYREAVIHTNELLDLL
                     VKCENKVQTRVKIGLNSKMPSRFPPVVFYSPKELGGLGMLSMGHVLIPQSDLRWSKQT
                     ETGISHFRSGMSHDEDQLIPNLYRYIQSWESEFLDSSRVWSEYAHKRREANAQNRRLT
                     LEDLEDSWDRGIPRINTLFQKDRTILSYDKMWRLRNEFKQYQLLKYNPFWWTSQRHDG
                     KLWQLNQYRTDIIAALGGVEGCLEHTLFKGCNFPTWEGLFWEKASGFEDQMKHKKLTN
                     AQRSGLSQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQLFR
                     AHLWQKIHESIVMDLCQVFDQELEALQIETVQKETIHPRKSYRMNASCADIVLFASYK
                     WPMSNPSLLTDSREVVGGASGSKWWIDVQLRWGDFDSHDIERYCRAKYLDYTTDNTSI
                     YPSPSGVLIGIDLAYNMHSAYGSYIPGSKPLLQQAMAKIMKANPALYVLRERIRKGLQ
                     LYSSEPTEPYLNSGNYAELFSNQVIWMIDDTNVYRVTIHRTFEGNLVTKPINGAIFIL
                     NPRTGQLFLKVIHTSVWAGQKRLGQLAKWKTAEEVAALVRSLPVEEQPKQVIVTRKGM
                     LDPLEVHLLDFPNIVIKGSQLQLPFQACMKLEKIGDLILRATQPQMVLYSLYDDWLKS
                     ISPYTAFSRCILLLRALHVNSEKTKIILRPNINTVTQPHHIWPTFSDEEWIKVEIALR
                     DLILQDYGRRNQVAVASLTSSEIRDIILGMEISSPSQQRQQMAEIDQNQPQQQVTATQ
                     TRTVNVHGDELQTITTSQYENQVFSSKSDWRVRALSATNLPLRCQHLYVSNDDVREDA
                     GALTYVIPKNILKTFIITADLRSQVAGYLYGASPPDMPGVKEIRLIVWVPQRGSNTGV
                     ELPEQLPTHEHMLKDLEPLGWIKTQAQDLPHLAPTDVATHAHMMAAHPEWGANSVCIT
                     CAFTPGSVSLSAHTLSVAGFEWGRKASAADALGPATGFNTSMVDRAQLLLTDRILGTT
                     LAPTDGAWNYGLSLSAQWTPHFHYTLQLARPAAFWDEIHRPQSFLSFAGALADDENTA
                     DWQDALH"
     gene            complement(<28952..>30226)
                     /locus_tag="MRET_0012"
                     /note="MRES_03215"
                     /db_xref="GeneID:38736778"
     mRNA            complement(join(<28952..29215,29247..29574,29609..29810,
                     29839..>30226))
                     /locus_tag="MRET_0012"
                     /product="DUF410 domain protein"
                     /transcript_id="XM_027626639.1"
                     /db_xref="GeneID:38736778"
     CDS             complement(join(28952..29215,29247..29574,29609..29810,
                     29839..30226))
                     /locus_tag="MRET_0012"
                     /codon_start=1
                     /product="DUF410 domain protein"
                     /protein_id="XP_027482937.1"
                     /db_xref="GeneID:38736778"
                     /translation="MNSAEELPGGNGAYELQMKLRTTTVRLLRKKMFDKAIHVLEDGA
                     QRLLDMKEEGSACDITEYLLDVYTQADVKMDDENRKRIISILSRTTSPTWRRKSIAAA
                     SKWAVKATGNSLGDPQLNALLSKLLTQDNQWFEAEKHLIGAAGYDEEYASDLANMLLD
                     WNAAYSKALAESNDNEPPTDSVERVLSGTFALRGWIPLMLVEKPQSALAFIQAYVKSA
                     TERHPSLLLPVKPNPREYKSPSSVSNFTTAIYMTASPPLNFSQNAVALVCDIQSTKAP
                     VSNEMKAAWQSLLRQFVQDGGLTGMESLVDLLSEVSSKYIDLHPARKQTDMLSSMVSK
                     MMGVQSEPQGASANAQIKIKQLPRPAAPKLKAASDKQSTTSSTAPAVSEADQLVDEEM
                     D"
     gene            complement(<30313..>30956)
                     /locus_tag="MRET_0013"
                     /db_xref="GeneID:38736779"
     mRNA            complement(join(<30313..30421,30453..30628,30668..30763,
                     30805..30864,30897..>30956))
                     /locus_tag="MRET_0013"
                     /product="acetyltransferase (GNAT) family"
                     /transcript_id="XM_027626640.1"
                     /db_xref="GeneID:38736779"
     CDS             complement(join(30313..30421,30453..30628,30668..30763,
                     30805..30864,30897..30956))
                     /locus_tag="MRET_0013"
                     /codon_start=1
                     /product="acetyltransferase (GNAT) family"
                     /protein_id="XP_027482908.1"
                     /db_xref="GeneID:38736779"
                     /translation="MAVPHIRNATREDVPTILEFIKQLAIYEKALDQVQATEESLTNT
                     LFENPYAYVVIAEVEKDDHCKKPIGFSLYYYAYSTWTSRPTLYLEDLYVMPEYRNKGV
                     GKHLFKRLGEIAKEKECLRVEWSVLTWNSPSIGFYKNTLGAIMMDEWRTMRLDRAGIE
                     RLACLV"
     gene            complement(<31190..>31489)
                     /locus_tag="MRET_0014"
                     /db_xref="GeneID:38736780"
     mRNA            complement(join(<31190..31249,31289..>31489))
                     /locus_tag="MRET_0014"
                     /product="small nuclear ribonucleoprotein G"
                     /transcript_id="XM_027626641.1"
                     /db_xref="GeneID:38736780"
     CDS             complement(join(31190..31249,31289..31489))
                     /locus_tag="MRET_0014"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein G"
                     /protein_id="XP_027482913.1"
                     /db_xref="GeneID:38736780"
                     /translation="MSKVSQPELKRFLDKNVLINIQGGRKIKGNLRGYDLFLNIVVDE
                     AVEQVQAENNQHLWVDGARCGTVVIRGNSVNSLEGLESINTR"
     gene            <31973..>33325
                     /locus_tag="MRET_0015"
                     /db_xref="GeneID:38736781"
     mRNA            join(<31973..32359,32387..>33325)
                     /locus_tag="MRET_0015"
                     /product="metal homeostatis protein BSD2"
                     /transcript_id="XM_027626642.1"
                     /db_xref="GeneID:38736781"
     CDS             join(31973..32359,32387..33325)
                     /locus_tag="MRET_0015"
                     /codon_start=1
                     /product="metal homeostatis protein BSD2"
                     /protein_id="XP_027482914.1"
                     /db_xref="GeneID:38736781"
                     /translation="MSDSSNSQTLSPIQIQADTNSNQNTSHVVFDHDDLEGGYDHNDR
                     VPYRGAASVLDRVRYILGRFGKLTGMRIPGTAYASLSSGGREASSGSRRMGGGIHQDG
                     VFSNLNAKPETMRSSVDPHDRGDDDDIADDTLPPTYEVAAADTAPSYWESNVFGGSAL
                     VDSEGIWSENSTHVGEIPDMIQDGMMVGTIFAFCWNLFVSASFQFIGFILTFLLHSTH
                     AAKFGSRVGLGASFVQYGLDMRLTLDASLSRASQDDEDDEIVSMPSAGAVQRSRIGCD
                     LLIAFGVFICVEACIKYMLLYRKSARIVAEARRQEQQTLTIPDPENSSPSEVRGSYAT
                     RFVNWIRTGPVTMVSNTLQNIQNAVSHDLSIFMGEPMAHTAEDYIIRPGYGFAQDPVI
                     FSIHHGNTHSNMDDETVAHSLGLTNPFSGRVHDFDEEEIGHELRAVRFM"
     gene            <33986..>34506
                     /locus_tag="MRET_0016"
                     /db_xref="GeneID:38736782"
     mRNA            join(<33986..34385,34412..>34506)
                     /locus_tag="MRET_0016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626643.1"
                     /db_xref="GeneID:38736782"
     CDS             join(33986..34385,34412..34506)
                     /locus_tag="MRET_0016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482911.1"
                     /db_xref="GeneID:38736782"
                     /translation="MSHTPGSSKRLIQTLPSLPQRPSLPLPPEDKHAKHFTWEYMKDV
                     FEAFSKRERAMEMRIDALCFEAEKSLNELEHNENLSKSSMNGTNPLLGIRLLQQVDLL
                     DKENQDLTKRINELMLASSDQHIQELKREIEDSHKLILALDTALTDTENHSKSLEVRK
                     SSPM"
     gene            <34638..>35981
                     /locus_tag="MRET_0017"
                     /db_xref="GeneID:38736783"
     mRNA            <34638..>35981
                     /locus_tag="MRET_0017"
                     /product="DnaJ domain protein"
                     /transcript_id="XM_027626644.1"
                     /db_xref="GeneID:38736783"
     CDS             34638..35981
                     /locus_tag="MRET_0017"
                     /codon_start=1
                     /product="DnaJ domain protein"
                     /protein_id="XP_027482912.1"
                     /db_xref="GeneID:38736783"
                     /translation="MATIISFTPLVWQLPKMLCSRTYGCACNAINTLKIRGIVCNALQ
                     YSSVRQHSVRSIHTSMRLSSCDSPAPDDDPDVHFFYPDVAGAIKQLESNQVDEEEHHH
                     DYDLTMDSNAQVWMLSQSMVEGEGKPFKCILSSSLSQEKNNTHESVLHQSAMLDRNAS
                     TLAAGNARNRSILGTGFSKRSIGTLRHFSSTSSTCFHKTLYHYATLESSPYDVLHIPK
                     KATRSEIKSSYYALVKELHPDTASPNLSDKEKNARLEKFRTAVQAYELLMDNKKRSLY
                     DQFGVGWADHGRSRSATFRPRSDDDFEHWQMWTEILRRAKHRHGASWQRMAQNPYYQY
                     HFYGYTRMTPEDMKKQREATPLNQKIFVTLFVFTSILTVIQIGGLRAYGTRDSNIAIR
                     HNAEIAQNLENARQVARSEEGLQRQRQMLERAREHKRAREEYMLDALPTSSQISP"
     gene            complement(<35986..>38349)
                     /locus_tag="MRET_0018"
                     /note="MRES_03210"
                     /db_xref="GeneID:38736784"
     mRNA            complement(<35986..>38349)
                     /locus_tag="MRET_0018"
                     /product="6-phosphofructokinase 1"
                     /transcript_id="XM_027626645.1"
                     /db_xref="GeneID:38736784"
     CDS             complement(35986..38349)
                     /locus_tag="MRET_0018"
                     /codon_start=1
                     /product="6-phosphofructokinase 1"
                     /protein_id="XP_027482915.1"
                     /db_xref="GeneID:38736784"
                     /translation="MNEIQGRRLAILTSGGDCSGMNSAICAVIKMALYKGLEAFVIRE
                     GFAGLLKGNRNQDILAAEEANLGQNALSYGCGDFFRLGDLGGGDSKFHDQYIIRVGWD
                     DVRGWENQGGTLIGSARCKEFMSQEGRLQGAFNLISNGIDSLVVCGGDGSLTGADIFR
                     NEWPSLVESLLKQDRITNEQATKFQYLHIAGLVASIDNDLTCTDLTIGSSTALLRISE
                     SLDSISSTASSHSRAFVIEVMGRHCGWLALMAATACGADYVYVPERPPPEDWRQHLRD
                     SLLAIREKGKRKSIVIIAEGAIDVHLQPIKPSMVAEVLSQDLHLDTRVTTLGHTQRGG
                     RPDANDRILATLQGIDALRALLEDEPGKPSYIIGIRKGRIKRLLLRESIQSNGLLAKA
                     ISDQRFEEALSHRGSDFRAGLDTFTYNAAAVPSMHEPSNTFRMGIMHVGAPAGGMNTA
                     TRTAVRFCLRRGHTPLLINNGFVGLLKDLVFKATWLRVDSWASSGGSELGVNRVLPNV
                     DLHGVAKQLQKHNIQGLLIIGGFEAFTSIKILSEARPEFPALRIPLIGLPATLSNNVP
                     MNEYSLGTYTSLDVLAHTCDMIIQSASASRNRVFVVEVQGGQCGFVAVMGALATSASI
                     VYTPEEGVNLQQLNEDIQFLHRRFSQDPEFANDGRLVICNEKASSVYTAQMIAQIYGE
                     EGRDDFDSRYESLSHVLQGGIPSPLDRVQASRLAVRCCEFLEQHAGSSCAWDPPSAMI
                     AVRQAETIITPVAQMVDHADFANRRGTDFWWNQCKEYVEIISGRKFL"
     gene            <40267..>41181
                     /locus_tag="MRET_0019"
                     /note="MRES_03205"
                     /db_xref="GeneID:38736785"
     mRNA            <40267..>41181
                     /locus_tag="MRET_0019"
                     /product="lipase"
                     /transcript_id="XM_027626646.1"
                     /db_xref="GeneID:38736785"
     CDS             40267..41181
                     /locus_tag="MRET_0019"
                     /codon_start=1
                     /product="lipase"
                     /protein_id="XP_027482916.1"
                     /db_xref="GeneID:38736785"
                     /translation="MLFNRIALFAASCAALVSAGPLNFHAGSSKDQPVSNNWNTKEIS
                     QAAGLVQQTYCDRSTTKPGLKIGDSTLLFTAGNGDHRQRFNLYHSESLGIAVAIEGTN
                     LTSITSDLHDVKGLPVLPHPRYRSHYPEGTRVMHGFQEAYVSIMDDMVRAIEKYKKEK
                     NEKRVTIIGHSLGAAMGLLAAMDVELRLDDGICKTYLFGLPRVGNPTFAGFVDEKIGH
                     KFYSIINGQDWVPAVPPRALGYQHPSNYLWIYPGNSTNAKIYPGQENVHGILTVPRAP
                     NFYDHQGVYFHTQIGASFGQCPAKVGNM"
     gene            <41675..>43853
                     /locus_tag="MRET_0020"
                     /note="MRES_03200"
                     /db_xref="GeneID:38736786"
     mRNA            join(<41675..41726,41767..>43853)
                     /locus_tag="MRET_0020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626647.1"
                     /db_xref="GeneID:38736786"
     CDS             join(41675..41726,41767..43853)
                     /locus_tag="MRET_0020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482466.1"
                     /db_xref="GeneID:38736786"
                     /translation="MTEDLPTKDVSPAPGHHGNLNADQKSKLSFMWDLVFTVLNHPDK
                     AVKGEFSEEDELGHHDAHLSKQDQQKQAKSLKEEQEALRELFATHGVEEFHDQLWFLF
                     GPDIPDMIMLKFLRARKWNVHRAFAMLCKCVKWRIESDVMGIVAKGDLGLSREDPAYA
                     SQGPAEKVYSLGYSDKNVMPVIMIHVKNHIAATQPAETMTKFVISAAETFRTLVVYPN
                     DKVIVVFDMSGFGMRNMDWHSLMTVLKILEGYYPETLAKLYIYRAPWIFQGIWKAINP
                     LLDPEIRNKINFCNKSDELDVVPQHICEDTIGGDQVDVVKWVEPQPGEKEGLDRNDPK
                     RQEMWKSYRDISRDYEEVTKKWIISDGQDDRLNAERDQQSKRLRLKYIELEPFLRARS
                     MYQRAGIINEDLLLQFTYKQKDGRVLRQVTGADYARPALAKAVDAYTKRSEESRWSTV
                     SGNDIASKEKSGMKAGVTVATGSENFAARPPQSKNDAANQHVQTSNVMTGQHQHVSAE
                     NPYDRAQKSRSSLSVEARENRLPESNMVGSADTTSACANVSDNATKQSIDQSQTSEMF
                     NANRQYRPRGGSNAPSIVSSMSDDVFVDADDFEEHDSSVTNGLREIGAGESGDPHTVG
                     DSWHNQIKRSSGVPDRSKGIPAHSNGRGSQHMDAENDQLAGFPNLAHSEKLEEIADNN
                     EKMREPFDPTAGRKKPSLLSRLMCCGGTTE"
     gene            <44142..>46199
                     /locus_tag="MRET_0021"
                     /db_xref="GeneID:38736787"
     mRNA            join(<44142..45859,45890..>46199)
                     /locus_tag="MRET_0021"
                     /product="cytoplasmic GTPase-activating protein"
                     /transcript_id="XM_027626648.1"
                     /db_xref="GeneID:38736787"
     CDS             join(44142..45859,45890..46199)
                     /locus_tag="MRET_0021"
                     /codon_start=1
                     /product="cytoplasmic GTPase-activating protein"
                     /protein_id="XP_027482465.1"
                     /db_xref="GeneID:38736787"
                     /translation="MKSPEKDNEDEASFVNINLDDRQTPRPTMDTLATPISNLRMGWM
                     SQMSLQSHSNSPSHESLKRIQNKTIASSSTPNLALPKRNQEDVFREHTPFSHTDGEKI
                     SPLKRGVEGKYRSRTEAPGSSSRLRPLLLAGKGPSPPRGVVYDSNMVPGVSMTVQDLN
                     GELVSVRSPTKFDSSEYFPSRFSYKAAESPVPKKGSSSWKDADNKTNAANSDTSFEMD
                     SVSPKNSSQNVHTGLSTVPSEKPTGSSAKMSSNQIIPPLHVPKGGSSNLTRMPHLPPK
                     PRKEEAKHLADFERMMQESKQAEKRRVVSRRSELRKRQEDEEHARLVWEREIMPCWTR
                     AREDERLWNLWWGGIPQVLRARLWPRACGNDLMLSHKIFPRALESAQRAIASGAFPDN
                     LLEAIKNDITQTLPSLRLFDEQTGPLYQDLIDVLLAFVFVRADEASQREQLGFTDVAF
                     VHSKYTLYVPGVANLAAILIMNLTPTQSLILLLNLIAKKSWLKAIYGLQTKSGTEDLS
                     SKALPVELQGYERVFNALLAERMPNIYANLHKAGVLPAEYVREWVRTLFVPWVEIDTA
                     ARLWDIILLDDGDSVLFRVSLAFLELLEPRLFVRDRDELVSVLQGSNKGAIHVWRREL
                     DGNLEDTTPPKDRIYAQYQMNESSIFERLFSQNVWWKDMTLQRLLDRELNR"
     gene            complement(<46208..>48055)
                     /locus_tag="MRET_0022"
                     /note="MRES_03195"
                     /db_xref="GeneID:38736788"
     mRNA            complement(<46208..>48055)
                     /locus_tag="MRET_0022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626649.1"
                     /db_xref="GeneID:38736788"
     CDS             complement(46208..48055)
                     /locus_tag="MRET_0022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482464.1"
                     /db_xref="GeneID:38736788"
                     /translation="MFEIVPRSDASSFQVGYLGAEGLDAWLIGDVLTKLDLPMSEVVC
                     FERCTVYWSAIESVQNKGDLVLYHDECVVWNRNHDSHTLIPSVIPFQFELTSDLPQCS
                     HMPESRISYKIVARLHHRLGHDIFTCAPFHPRRYIKAGWSTLETYANIGKQKGVIFNG
                     DAEYSFDPIQWVCSDTMQAFFWLERNIIRHVDPIRVQVHIPPPSGSLVVEKGLQLQSV
                     EATLNRIIQSHAWGRLYSDVELLHHLSEQDKLGSVPVTSKPHRDSQSSLPRLYQHLVV
                     FTGKSCRFHSQRPIHICLSLHPGSILGSVSAEGDAFDMHSTSHGLGDNTICESITQDT
                     VLQKVRFVLTIRIVIRNEMGEHKDIVTRKLVKVLPSPAGPLTMQMEKVAQSESHEKSY
                     VQIRDNMIPQQDADVFDTPQEYDGYDDLVPESSSMRAITLTNPGMISQLELATLPIEY
                     CETALEEPPPNIHEHVNDTHVPDYIHLTPTPSSHQHEVGMDATMDPCDEELPNFDEAS
                     FQPQSPLTMAVQEWNTREDYTAPPSLPEEGPPFTLATNLVSNRRHEDDSQSLPPSYTD
                     STNLSSTQRRDRSSSPVDVSELLPPAYVAQTPVTDRHQQDNVFPPLYEA"
     gene            <48304..>48729
                     /locus_tag="MRET_0023"
                     /note="MRES_03190"
                     /db_xref="GeneID:38736789"
     mRNA            join(<48304..48666,48709..>48729)
                     /locus_tag="MRET_0023"
                     /product="U4/U6 small nuclear ribonucleoprotein SNU13"
                     /transcript_id="XM_027626650.1"
                     /db_xref="GeneID:38736789"
     CDS             join(48304..48666,48709..48729)
                     /locus_tag="MRET_0023"
                     /codon_start=1
                     /product="U4/U6 small nuclear ribonucleoprotein SNU13"
                     /protein_id="XP_027482463.1"
                     /db_xref="GeneID:38736789"
                     /translation="MSGEVNSKAFPLADAALTNQILDLVQQASHYKQLKKGANEATKT
                     LNRGICEFIIMAADIEPIEIVLHLPLLCEDKNVPYVFVPSKIALGRACGVSRAVVAAS
                     VTTNEARELQSQIQTIKLAIERLLI"
     gene            complement(<48883..>50031)
                     /locus_tag="MRET_0024"
                     /db_xref="GeneID:38736790"
     mRNA            complement(<48883..>50031)
                     /locus_tag="MRET_0024"
                     /product="DnaJ subfamily B member 4"
                     /transcript_id="XM_027626651.1"
                     /db_xref="GeneID:38736790"
     CDS             complement(48883..50031)
                     /locus_tag="MRET_0024"
                     /codon_start=1
                     /product="DnaJ subfamily B member 4"
                     /protein_id="XP_027482462.1"
                     /db_xref="GeneID:38736790"
                     /translation="MGKDYYKILGVSKSANDDEIKKAYKKAALKWHPDRNKDNETTAK
                     KKFQDVGEAFEVLSDKNKRTIYDQYGEDGLKGGIPTADAEGGAFPGMGGFSAGGPGGG
                     TRTFRFSTSGGNPFGGAGGFHPSDPNDIFAQIFGGASPFGMGGMGSMGGMGGMGGMGG
                     MADDIPGSMPSFTSFGGGGSRGADMNADTGSKPQPKDFETPLMLTLEELYKGTTKKLK
                     IGRTTAGGRTEEKVVTIDIKPGWKKGTKIRFAGAGNETSPGVAQDLVFIVDERPHSRF
                     TRNGDDLRLIQPLKLVDALDPPKPGSPNSRRKITTLDGRTIEVPIPSAGLGKTTISPG
                     RTTRLAGEGMPISKVKGARKGDLVVEWNVEFPDRLNDSQRSAIRAALS"
     gene            complement(<50203..>54186)
                     /locus_tag="MRET_0025"
                     /note="MRES_03185"
                     /db_xref="GeneID:38736791"
     mRNA            complement(<50203..>54186)
                     /locus_tag="MRET_0025"
                     /product="AAA family ATPase"
                     /transcript_id="XM_027626652.1"
                     /db_xref="GeneID:38736791"
     CDS             complement(50203..54186)
                     /locus_tag="MRET_0025"
                     /codon_start=1
                     /product="AAA family ATPase"
                     /protein_id="XP_027482459.1"
                     /db_xref="GeneID:38736791"
                     /translation="MVTPVRHSSRLEHLSTSPPRDRSKRKAAQGAFYTQYFAEGELSE
                     DEDVYQATQPDDEEEEEEEEVQRPVRVTRSGRRTRSYAEQDWNNEEDEEETNEEPRIR
                     PRRSTRVSKSLRDFVATDDEEEEDDNADYEETVRLRHANERAERARQRQNLMQLAAMR
                     SQGREEDDYEDIHVKRRERRMHARSSSTPSNGESDDHGDALPEHRSYSFRARKKVNYS
                     LLPPPPEPLRDGFGRRIRRGSRGRASSRDQDVQDHTPDNSIFPPRLPTFPYTSLPRSM
                     QTKWNPTSMPTISGAELVNAMDEAMDSSDDDLPRTNLGETAGSRIGTSPPESVLENSM
                     ASTMGAVSSSTDAFGRLRRDKDALADVDPLGVNMDIDFNQVGGLEDHVQRLKEMVSLP
                     LLYPEVFQRFGVTPPRGVLFHGPPGTGKTLVARALAASCSSEGQRISFFMRKGADCLS
                     KWVGEAERQLRLLFEEAKRAQPSIIFFDEIDGLAPVRSSKQDQIHSSIVSTLLALMDG
                     MDGRGQVVVIGATNRPDSIDPALRRPGRFDREFYFPLPSRAARRAILDIHTRHWDPPL
                     DEQLKKVLSEATNGFGGADLRALCTEATLNAIQRRYPQIYHTNTRLVLSPETIQVDGR
                     DFMLALENMVPSSARASTSSFTPLPAHLESLLGDALSNCQKVFSRLLPKRAKRSALEE
                     AMYEIDMSEVSDSSAHLLEKELLQQSFVQAQVHRPRLLLHGSQGMGQRTLADALLYSM
                     EGYHVRTLSAALLLGDSSQTPESILVHQFQEAKRLVPSVLYVPDLDRWPLILPESVRG
                     MLSALLNDLSPSDTIMLFATSDVPFKSLPKDLQAWFGFLPRNKFELTFPDIEQRREYL
                     RDILVQASRPPTQFADAMPRRLRVLEELPAAPPRPPRMPTQIELEQQAENDARLLEHL
                     KFRLGSILAELRKKFKKFTRDVWDEYNLRELMEQFEWHRSKGQITIKLRYDRNPPHFE
                     LDSPDVHAQDAEIQSPEPLSVAGSVRDPISTEANEENSMQVNEEESRIQAPETVAVDD
                     ASTEQDGQEGSRVVHEQPEQEETEYIIRDFTIYTMTLDKMQKRLYHNQYLTSDAFMDD
                     LQKIVTNAEVASDVDADRMFRAHQMQNLAKIMMDPYVDATFRAECKQMERRVVAREEE
                     MRREAEKRKEQESHSRRLNGQRYSARVQGEEPEAHCLVDVSTIERAHKRARSQGQEER
                     ATGSAELDAVPMDAEDHGVKRVRLDDATNVPEGEMARASANEGMTPVNHDKYPSVLLN
                     EAAQASLLDTMTACTDGFTIEQLELTRSLCYERVLAHRSSWDRSALAQELKQVVQGIH
                     STVQDNK"
     gene            <54396..>56681
                     /locus_tag="MRET_0026"
                     /note="MRES_03180"
                     /db_xref="GeneID:38736792"
     mRNA            <54396..>56681
                     /locus_tag="MRET_0026"
                     /product="PHD finger domain protein"
                     /transcript_id="XM_027626653.1"
                     /db_xref="GeneID:38736792"
     CDS             54396..56681
                     /locus_tag="MRET_0026"
                     /codon_start=1
                     /product="PHD finger domain protein"
                     /protein_id="XP_027482457.1"
                     /db_xref="GeneID:38736792"
                     /translation="MSAPEKDVKLATKSATRLVPSFRRISSEEEERLSTASSLPSAWM
                     AQYGYHNGHEFSLPKHLVRYIEPTEGEFDQQVEYDMDEQDKYWLDELNAERKRDQLDV
                     ISYETFEIIFDRLEKEWFSLVKRIPSRFSIGEAMDEEEFPEESQCAICDDNECENLNA
                     IVFCDGCNLAVHQECYGVPFIPEGQWLCRKCTVSPDRPVSCIFCPQEGGAFKQTSDGK
                     WAHLLCAMWIPETGVSNSVYMEPIDGVQDIPKARWRLRCYLCNSRHGACIQCEHRSCF
                     TAFHVMCARRVGLLGRTQDISDEARDTKPDAAAAYCHRHLPLDRKVALHTRIRGTDDD
                     DNDTSSVSDVSTSELATVPKRPATSGYDSIVSKSARAYNKLYSSGPLPVPNYMVRRVL
                     DYISRISIRRKSQAVALIVRYWSLKRQQMRGAPLLKRLHIEPWTVGHFVDERTHALKL
                     TKLQYLFFLREDLEKVRLLAELVRKREKTKLKQLQLFRTYMLDQGLLYKQAQLHQALE
                     CVMALDKAQWFMYPVSKEAPGYYDIIKEPMDWNTIRSRIDTMSYRTWEAWEADVRLVC
                     TNATTYNQPQSLISKTAQKILKSLPDIVKDTRDTSVWEDGTASGLEPPDALLQMLQAP
                     YMVPDGISIGAPPQDATVMDAFLEQWYTVPNPEEPRAMRPPPKKPKRTAKLGPVRRSA
                     RHAPEPSEPAIITEPCVVDEINAKDSFKYFNVGWLLPPGARRGNRPRPEPRAQIKRPK
                     VARRTRRHEDGSSSLSELSDA"
     gene            complement(<56693..>59248)
                     /locus_tag="MRET_0027"
                     /note="MRES_03175"
                     /db_xref="GeneID:38736793"
     mRNA            complement(<56693..>59248)
                     /locus_tag="MRET_0027"
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase DHX16"
                     /transcript_id="XM_027626654.1"
                     /db_xref="GeneID:38736793"
     CDS             complement(56693..59248)
                     /locus_tag="MRET_0027"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase DHX16"
                     /protein_id="XP_027482633.1"
                     /db_xref="GeneID:38736793"
                     /translation="MSDDRPAAEYHALRDRSRQEYLTKRSRQQVELLRQEIKDEETLF
                     RGVRMSKREQRELEHKRELLRIAEEFEGLDDGTDTYALPEDYLTEQGRLDRKRKESAL
                     HDRRYDQGSRSQRKRPASEGDVFEHEQIARSKLLDQPKESAEADAYDFVFDETQAIQF
                     LLEKQAESPFNTLSDKELAMQQQLQEAQERADSIDATRRSLPVYGLRQELLDAINDNQ
                     ILIVVGETGSGKTTQLPQFLHEAGYTKGGQMVACTQPRRVAAMSVAARVADEMGVRLG
                     QECGYSIRFEDCTSDKTVVKYMTDGMLLREFLTNPDLGSYSAIMIDEAHERTLSTDIL
                     FGLLKDIARFRSDLKLIISSATLDADKFSEFFDDAPIFFVPGRRFPVDILYTSQPEAN
                     YLHAVITTVFQIHTTQPKGDILVFLTGQDEIDAATENIEQTSRALGDKVAELIVCPIY
                     ANLPNDMQAKIFEPTPPGARKVVLATNIAETSITIDGISFVIDPGFVKQNSYNPRTGM
                     AALTVVPCSRASSNQRAGRAGRVGPGKCFRLYTKWAFQNEMDENTLPEIQRTNLANVV
                     LLLKSVGIHDLLNFDFLDPPPTDTLIRSLELLYALGALNDRGELTKLGRRMAEFPVDP
                     MMSKAILASEEYHCTEEVLSIVAMLSESASLFFRPKDKKLHADRAKQLFIRPQGDHFT
                     LLNIWEQWVESGYSQIFCLDHFLQPKTMGRVRDVRDQLVQLCARVELVPESLTNPADV
                     TPIQKAITAGYFMNTARIQKGGETYRSIKQNTTVYVHPSSCLYKHVPPPRFLCYYELI
                     ETSKNFLRQVMEIQPAWLMEVARHFFSRDDLHDDSKQKHMLRGTGAAPLGAKS"
     gene            <59345..>59770
                     /locus_tag="MRET_0028"
                     /db_xref="GeneID:38736794"
     mRNA            join(<59345..59419,59444..59488,59515..59619,59646..59731,
                     59758..>59770)
                     /locus_tag="MRET_0028"
                     /product="RING-H2 domain core subunit of multiple
                     ubiquitin ligase complexes"
                     /transcript_id="XM_027626655.1"
                     /db_xref="GeneID:38736794"
     CDS             join(59345..59419,59444..59488,59515..59619,59646..59731,
                     59758..59770)
                     /locus_tag="MRET_0028"
                     /codon_start=1
                     /product="RING-H2 domain core subunit of multiple
                     ubiquitin ligase complexes"
                     /protein_id="XP_027482668.1"
                     /db_xref="GeneID:38736794"
                     /translation="MATPLGPSVHEDQDARVEPRFQVKKWNCVCLWSWDIQVDNCAIC
                     RNQIMDLCIECQANQGSSTIDECTVAWGACNHAFHFHCISRWLKTRPVCPLDNREWVL
                     QKYGR"
     gene            complement(<59767..>63045)
                     /locus_tag="MRET_0029"
                     /note="MRES_03170"
                     /db_xref="GeneID:38736795"
     mRNA            complement(<59767..>63045)
                     /locus_tag="MRET_0029"
                     /product="elongator complex protein 2"
                     /transcript_id="XM_027626656.1"
                     /db_xref="GeneID:38736795"
     CDS             complement(59767..63045)
                     /locus_tag="MRET_0029"
                     /codon_start=1
                     /product="elongator complex protein 2"
                     /protein_id="XP_027482489.1"
                     /db_xref="GeneID:38736795"
                     /translation="MPSSITYEYLSCAVQRTAHVADWVQWGEGRDALVLGVHKAVAVW
                     LDPSEPAARAPAVHMWPLPCQETVHVLKAWPDHVTRIVVGTYEGGLELWRVHGDELCC
                     DASVPGAHAAAITAVGVPRDAYTREYGPREFVTGGSDSKLRVWSCDPLRVVQTIDLEG
                     AFPLDVALVKLPQTDAMVMAVAATDRRISLYVRSGGAGTYVRQLRLAGHEDWVRALDF
                     TVALPDVWLASASQDQHVRLWRWRPETRQPQAPTDAFEAMARELLPDEGIRTKIDWLS
                     LPGSATRWGVSLDALLLGHDAWVTGVRWCPSVHTEPLAALLTSSVDHSVIVWTPDAAT
                     SSWPTLQDAGAAVGSLWLPAHRLGDVGSSSGGFLGAHWRPHRDLCVVAHDRQGAMHMW
                     RRTATHKWEPQATISGHAGPARDAAWERYGDCFLTVGQDRTTRLHGTVHTARAGRTWH
                     ELARPQTHGYEMQSVAWLGRTSFVSAADEKILRVFAAPKAFVHSATAWHMWQTPTPQP
                     RHVLVLSQAAASAGDMIESVMCETHYTNLAVVAWLGDMSMRGAEHVLQRVYACAWDAA
                     VQADCLGADVTVYLLPDTPDTERGVSHLRAWAAHHAPLASLYADDGVPRTALDAIPLE
                     PKVMPLRAAAAEAVEPASVQGDSVVLGGTFDHLHIGHKLLLTMGVLSARSAMWVGVTS
                     TALLAKKEHREYIEPIDVRMARVRQFLRDVSQALGKSLALHVVPISDPCGPAGTLPDL
                     DVLLVTEETVRGIEPIAAERAKHGVRPLHVYTVSLVHSAAAAKTGSTDIRAWLARRQQ
                     TPGTDWSPTVHEPATDGLASAHVPPLGLSNRAVEGASEVAAFTKPPNPEQLQSLTLWP
                     EMEKLYGHGYELLSVAMDTNTHMIASTCKASTPAHAVVRLFDAQHRFEPAKDALEGHT
                     LSITRVAFSPCGTYLLTVSRDRSWRMFRRTPSGYVAWIGERAHARIVWDGAWAPHSRM
                     FATASRDKSVKIWTLVDDAQRPYRLVTTLNASDAVVSVTWASDGALAMGLENGDVWLY
                     TCARDGTWQLHTTLARHHTGPVHRVACRPQGRWMDAYDRVPYQLLSVGDDGCTRLVSW
                     YIDP"
     gene            complement(<63091..>64962)
                     /locus_tag="MRET_0030"
                     /note="MRES_03165"
                     /db_xref="GeneID:38736796"
     mRNA            complement(<63091..>64962)
                     /locus_tag="MRET_0030"
                     /product="leucine-rich repeat protein"
                     /transcript_id="XM_027626657.1"
                     /db_xref="GeneID:38736796"
     CDS             complement(63091..64962)
                     /locus_tag="MRET_0030"
                     /codon_start=1
                     /product="leucine-rich repeat protein"
                     /protein_id="XP_027483057.1"
                     /db_xref="GeneID:38736796"
                     /translation="MARLTSSHDPRGGRGRWHGVSRRRAVRASQPQSKRHENILSNET
                     LETQVQNDMSPFPAVFREHVSWRRGPCTQASGMATLRSICMWVAVQHFSSHILPTPQA
                     LEALSGVRYTEALWWSDVNKDLLKHMPATMMEELFDLLCLHAPWSLTKEILTMYFLPA
                     VGTSSQPPRTRSRLFLPGSLPLFSQDAKCASLILATLAGNFALASDAHVVTRCITALD
                     LHGLTRLPGAAVTRLLRAPSQASHAWRLRRVSLPGCLSVNDAAVATIVQVTGDTLEHL
                     DVTLTSVTASSIAAMGAACPRLQVLKLAWCEHLSDASVSQAVSDAISQGAMSRPPMIP
                     FRALHTLDMSHTLVGDIGVSGLLRLCGTQLVSLDVSYTSVAESGTLDVLAMGLGSGTE
                     RVSRLEHLGIAGLCVHAVSLLDFVHKWLAYPGEVRQEAPSLRSLCLDNMVEYVRRQPS
                     SLQGRQGLSGDTMLMVAAMMHHTCHQHHVVMDCLSMNGDKRRAYVPSHWALPPDRMTR
                     AWEASGVSMVRMLATCTRRLSLQGLDLSLADAVGHAPSSSVLTELCLQHTSLSDASLQ
                     CLIPSTGALTSVFLDNTQVTPTSVDALVAANPQLSILGLSQCRGIPVRDRRAYWDRR"
     gene            <66389..>70213
                     /locus_tag="MRET_0031"
                     /note="MRES_03160"
                     /db_xref="GeneID:38736797"
     mRNA            <66389..>70213
                     /locus_tag="MRET_0031"
                     /product="helicase associated domain (HA2) containing
                     protein"
                     /transcript_id="XM_027626658.1"
                     /db_xref="GeneID:38736797"
     CDS             66389..70213
                     /locus_tag="MRET_0031"
                     /codon_start=1
                     /product="helicase associated domain (HA2) containing
                     protein"
                     /protein_id="XP_027483058.1"
                     /db_xref="GeneID:38736797"
                     /translation="MPHFFSIHLVQYISFLRRHNALPELLFHCNTPFRNIIARSASPA
                     MSCDPAFNAFDSKGPQYNRSRSRGFERASHGRGRHSCFSKRRLSTGRASELHIHPYPI
                     QTLDEIKARYSDLLSTAKLQWLDNPKNVIFSYKHSRFGSYPESVTLEGRYPGGNKPVF
                     RSTIAIDDDLGIVATGDGTSRKEAEKAAALHGMILLLEKDYILHPPPRASNSITKVNA
                     KVPVAALSDGTEVTLEQAREFIDYFCHEGRFGSPDVKVDAVYNTKSYRAQLYGWKAVI
                     SISGTPVGESIESSKKAAQNTACLNTATILANEYRDVWDQYLQVPKSKLAGKAPPVKF
                     RVSSALEEKIRHLYDAMRDSELYSNRPRITAAFSLRSSVAAPKRNSIQAQRTMSEEQH
                     EEKSNQMLENLNAYQLDERVEPMRLFRQALPVSQHAGDILVKIERNPVTICMASTGSG
                     KTTQVPQLLLDDFILRKQGSRCNIICTQPRRIAAISVAERIAKERGEALGDTVGYQVR
                     FQSHLPKPHGSILFCTTGVLLMRLQTALKDISGNSFLDNVSHILMDEVHERDIETDLF
                     LAVIRRVLQERKKRGCPEIKLVLMSATVDPKLFKDYFEESSLTTRPVPVVNIPGRSFP
                     VRKFYLEDIVSRLRRIPERQGGWIWREHSVQQYVHREIVEKGGTMGGSDNDAVDNIDM
                     PYPLVALVIADVISRSTDGHVLVFLPGWEEIKAVHQLLLSSKQMPMKGLDFDDQSKFE
                     IHLLHSSVPVSDQQAVFEPLRDPMIRRIILSTNIAETSVTIPDVVYVVDTGRVKEKRF
                     DPEHHLSSLVMTWVGRSNLNQRAGRAGRHRPGEYYGLLSETHHDRLGMHQTVEMKRMD
                     LSNVVMHIKALHLPGMEVEDVLASTIEPPAPERVKPALENLERIGALDYHSNLTALGQ
                     VLLQLPVDVYIGKMCLFGALFRCLDPALSLAAILTNRDPFVSPVYQRQEARVIKNSWC
                     STSFRSDPLCILNAYEEWSKLQRIDPNRANRFTYKNMLSRTTLFQIQQVKENLFTSLV
                     KANVIQVIKNSRTFMPRYRKRVRETDPEFNVNAHSTSLLSALIAVSSPHFAVRISQNV
                     YRTAQDKSCFIHASSVCSAKFQPDKSKLPFVDRDIYAFSEKVHSAGQSTTLGGATTFM
                     RTCTHIDPLSYMLFGASEVQASSNGLECDAWLPLTGDYDALDGVERIKAVMDACLLRV
                     LEGIRCSHARAPSSKLYESHALSDHDDDPDSATHPIRPLSVNEERELETFTAGIVDML
                     DHYKMECYGSPM"
     gene            <70452..>71966
                     /locus_tag="MRET_0032"
                     /note="MRES_03155"
                     /db_xref="GeneID:38736798"
     mRNA            <70452..>71966
                     /locus_tag="MRET_0032"
                     /product="kinetochore protein Mis13/DSN1"
                     /transcript_id="XM_027626659.1"
                     /db_xref="GeneID:38736798"
     CDS             70452..71966
                     /locus_tag="MRET_0032"
                     /codon_start=1
                     /product="kinetochore protein Mis13/DSN1"
                     /protein_id="XP_027483059.1"
                     /db_xref="GeneID:38736798"
                     /translation="MSGARGSPRKGPDTAERVPERRFSDILEEDAGNHAPNKRPRRPR
                     KTLREEVADDLVFIRMTPQAQATGSPPNNGMAVNAAVRPEPRAPLPRPPRRNSMNVKG
                     MRRVSSLRDGAPAYPHDDIPDDVLYKHCSDQVPPVVRMKHLLSWTLHRSIPQALAEAS
                     LPRLGKRRHGKSRWDQDAELALLAPIPPDVSRELNDLERQHIAEVSPILHRVVQETLR
                     DLNDGLIGISWLRHVQKAASRTLHPHPRNESNRHAEKQLLGMLEQLQNELASWKEHEA
                     DIDRIHDEVDALEAMTANIRDQASSKRKGRAQADGEAEVDEEQALADEVEASRSGAPQ
                     ASAWTWDDADADARRQLDLVQTVLTSTDKLNHAVAAQQSLDTSHDIDLQGTEVDARLG
                     SLELSIDKIYQRLHTIEQLDNLSEQYIRRVSNRAAQTLLERTSAGLATFSGIKSDSDT
                     NDLASSAAAQQRLDTLLAGIRDPNDTAHDPAQSSSVMPTDAHQLLRALARGSPP"
     gene            <72064..>73223
                     /locus_tag="MRET_0033"
                     /note="MRES_03150"
                     /db_xref="GeneID:38736799"
     mRNA            join(<72064..72996,73026..>73223)
                     /locus_tag="MRET_0033"
                     /product="THO complex subunit 3"
                     /transcript_id="XM_027626660.1"
                     /db_xref="GeneID:38736799"
     CDS             join(72064..72996,73026..73223)
                     /locus_tag="MRET_0033"
                     /codon_start=1
                     /product="THO complex subunit 3"
                     /protein_id="XP_027483060.1"
                     /db_xref="GeneID:38736799"
                     /translation="MSARLAGREAYRGVGQLEDPPTDASFFTRRHINYPPFTSARPPK
                     ELRGGHSAGVRALAWNATGDVLMSCGSDQLVRAWHPEKSTEVRSTTEFAGHLGQISAI
                     ACHPTNPHLFATGGIDKSVRLWDLRVSTATKVVSTPGSNINLAYHPEGRYLAVGDKSE
                     TVSLVNADQGTFLHKIKDGSLNREEINELAWSPDGTMLLLPMGSGTIGFLGAPHTPDA
                     HAEAATGPHGLHPSWHCIMHHQAHPAAIFCIKWDPTKRVVATAAADSTVAIWDASIWD
                     CHHIFSDFKFPARSIDFSCDGEWLAVGGEDSHLSLLSLASGRLSHSIPVSATINTLSW
                     HPSRPVFAYSGTDTSHSAHAGPGTAAARSAASSSTIWLYSVP"
     gene            <73317..>74283
                     /locus_tag="MRET_0034"
                     /db_xref="GeneID:38736800"
     mRNA            join(<73317..73437,73465..74213,74245..>74283)
                     /locus_tag="MRET_0034"
                     /product="microtubule-associated protein, RP/EB family"
                     /transcript_id="XM_027626661.1"
                     /db_xref="GeneID:38736800"
     CDS             join(73317..73437,73465..74213,74245..74283)
                     /locus_tag="MRET_0034"
                     /codon_start=1
                     /product="microtubule-associated protein, RP/EB family"
                     /protein_id="XP_027483061.1"
                     /db_xref="GeneID:38736800"
                     /translation="MSASRTELIAWVNELLALNYTKVEQCGNGAAYAQIIDSIYGNVP
                     MSRINFGARHEYESLTNYKVLQNVFNKNRISKPIPVDRLVRCKMQDNLEFLQWIKRFW
                     DLNYTGEGLYDPEARRAGQPGNPADTPMRRPASGNGGARPRPSSAAPRPSTAGPRPSA
                     VRPRPSTASQPVRSAPVSSAGPRRMSVAPRGVRGPSAAAISNETIQQLSAEIDEMKLS
                     VDSLERERDFYFGKLRDVEVLIQERLGELVQLTDEGEEINDPNGASEVETLKQIQGVL
                     YKTEEGFELPDAAEAEPEPLDDTETF"
     gene            <74511..>76225
                     /locus_tag="MRET_0035"
                     /note="MRES_03145"
                     /db_xref="GeneID:38736801"
     mRNA            join(<74511..75560,75806..>76225)
                     /locus_tag="MRET_0035"
                     /product="cysteine desulfurase"
                     /transcript_id="XM_027626662.1"
                     /db_xref="GeneID:38736801"
     CDS             join(74511..75560,75806..76225)
                     /locus_tag="MRET_0035"
                     /codon_start=1
                     /product="cysteine desulfurase"
                     /protein_id="XP_027483062.1"
                     /db_xref="GeneID:38736801"
                     /translation="MIAFAIRKGVSLRAIAPCRMSMLQAVHGVRRGYVTPSRPSPADH
                     LATVSGVERDGPLSNDQLLERVFDKKEVTRSANRPIYMDAQSTTPVDPRVLDAMMPYY
                     VEQYGNPHSRTHAYGWETESATSEARNHVAELIGADSKEIIFTSGATESNNMILKGVA
                     NFYRAKKNHIITTQTEHKCVLDSCRSLQEQGFEVTYLPVQSNGQIDLDTLRKELRPTT
                     SIVSIMTVNNETGVIQPIKEIGDILKTEGHELCKQLGKGVPKPFFHTDAAQAVGKIPI
                     DVNEAGIDLMSLSAHKIYGPMGIGAAFVRRRPRVRLEPLMSGGGQERGLRSGTLATPL
                     VVGFGEAARIAKKEMAFDHAHVLALSKRLRENILSRVEMVLLNGDPDGYPGCTNLTFQ
                     YIEGESLLMALKDICLSSGSACTSASLEPSYVLRALGLDDANAHSSLRFGIGRFTTEQ
                     EIDFVCDKIVAVVQRLRDLSPLWEMVQEGIDLNSIQWSG"
     gene            <76380..>77141
                     /locus_tag="MRET_0036"
                     /note="MRES_03140"
                     /db_xref="GeneID:38736802"
     mRNA            <76380..>77141
                     /locus_tag="MRET_0036"
                     /product="optic atrophy 3 protein (OPA3)"
                     /transcript_id="XM_027626663.1"
                     /db_xref="GeneID:38736802"
     CDS             76380..77141
                     /locus_tag="MRET_0036"
                     /codon_start=1
                     /product="optic atrophy 3 protein (OPA3)"
                     /protein_id="XP_027483063.1"
                     /db_xref="GeneID:38736802"
                     /translation="MASAKIVSLTIRTLAKPIATQIKNQAAHHESFRKVCISLAQSMH
                     RTESRLRQNLLPGSEKYKIRPLNDAKAISNGANAISEGFLFAVAALIIIGETYRGSRS
                     RANERDNLRDEISQLSEQLDVLNKKLQGDGVTDGNSLTASQSPSLPESTVLNSTPYPQ
                     LVHSVQILWALADKNGWLRDVEKLPGELKWLLESKESAASDTDSQEKLSVAAQSPSDY
                     ATSRVKVFSDDVKNTISPKGSRQDNEVSEISTVPT"
     gene            complement(<77321..>77956)
                     /locus_tag="MRET_0037"
                     /note="MRES_03135"
                     /db_xref="GeneID:38736803"
     mRNA            complement(<77321..>77956)
                     /locus_tag="MRET_0037"
                     /product="polyadenylate-binding protein 2"
                     /transcript_id="XM_027626664.1"
                     /db_xref="GeneID:38736803"
     CDS             complement(77321..77956)
                     /locus_tag="MRET_0037"
                     /codon_start=1
                     /product="polyadenylate-binding protein 2"
                     /protein_id="XP_027483064.1"
                     /db_xref="GeneID:38736803"
                     /translation="MQAGEAVGAISAEQAQREADFAQYSAEHEDSREGREADTEDADL
                     EAMKQRVAEMEAEAAKLREMNETAEQDIQGSASVAAHPTDEEKMEVDSRSIYVGNVDY
                     GATPEEIQQHFQSCGTINRVTILCDKFTGHPKGFAYVEFADANFVENAAVLNESLFRG
                     RLLKVTPKRTNVPGVGFRGRGRGRGRGGWYRGGFRGGYRGRGSWRGRGRFW"
     gene            complement(<78263..>78753)
                     /locus_tag="MRET_0038"
                     /db_xref="GeneID:38736804"
     mRNA            complement(join(<78263..78308,78402..78573,78618..>78753))
                     /locus_tag="MRET_0038"
                     /product="26 proteasome complex subunit DSS1"
                     /transcript_id="XM_027626665.1"
                     /db_xref="GeneID:38736804"
     CDS             complement(join(78263..78308,78402..78573,78618..78753))
                     /locus_tag="MRET_0038"
                     /codon_start=1
                     /product="26 proteasome complex subunit DSS1"
                     /protein_id="XP_027483054.1"
                     /db_xref="GeneID:38736804"
                     /translation="MSATKPTKPSNKESAGSQEANEKKHQVPTLGALDEDDEFEEFEA
                     DDWPDQDTIVGKDNTSDQPSGAATVSLDMSGSARSGGDHLWEDNWDDDDIEDEFSVAL
                     RAELAKTDTVQPMST"
     gene            <78917..>80383
                     /locus_tag="MRET_0039"
                     /note="MRES_03130"
                     /db_xref="GeneID:38736805"
     mRNA            <78917..>80383
                     /locus_tag="MRET_0039"
                     /product="oligosaccharyltransferase complex subunit alpha
                     (ribophorin I)"
                     /transcript_id="XM_027626666.1"
                     /db_xref="GeneID:38736805"
     CDS             78917..80383
                     /locus_tag="MRET_0039"
                     /codon_start=1
                     /product="oligosaccharyltransferase complex subunit alpha
                     (ribophorin I)"
                     /protein_id="XP_027483055.1"
                     /db_xref="GeneID:38736805"
                     /translation="MQKTGIRLSVFTLLVYMAVCLLGHMSACAAAETEWTQESYSKKL
                     DLGGAVSVVELDIKATPAEIGPEGSATYLFYLSRQEHDGLSMLTASLEQNSTHSQLEV
                     MPLGPLGDQQDTYQYAMNIPMKEKSDVSLSIKGVFLHQASPLPKELKQGDLQLLTWDG
                     DAQPRTPYVTASATVFINSPDPILTFKAPVTSSQLGNAVQFGPFTDLQPYTADSEPVP
                     QGHVHFAYSKPLVSYKKYQRHVEISHWGDNMATHDYIWLQNVGPRLKGCFSRSQNMIN
                     MHMNPLLEKTSQIQSIPLSLPGSAEGVYYVDATGNVSTSNLKASPKVAGTPRRLDIRP
                     RYPVLGGWNYTFTVGWNERMSKSGIARFNPAKPWRTRIAVPFLISPKTASIENATLTI
                     SLPEGAQDIKVSLPFKVDNVHTSRYPSYLDTVGRPTISITRAKCSFMNAMPVFVEYTL
                     PITTYLRKPFCVTLAVLLVFAASAFVSRQINAIPQSAK"
     gene            complement(<80430..>81144)
                     /locus_tag="MRET_0040"
                     /note="MRES_03125"
                     /db_xref="GeneID:38736806"
     mRNA            complement(join(<80430..80523,80551..80696,80728..>81144))
                     /locus_tag="MRET_0040"
                     /product="Tic20-like protein"
                     /transcript_id="XM_027626667.1"
                     /db_xref="GeneID:38736806"
     CDS             complement(join(80430..80523,80551..80696,80728..81144))
                     /locus_tag="MRET_0040"
                     /codon_start=1
                     /product="Tic20-like protein"
                     /protein_id="XP_027483128.1"
                     /db_xref="GeneID:38736806"
                     /translation="MSVKSGASQLYDADAPFLVESYQNVSDEAGGKDLLPSYSYNTTP
                     HTPGQPRSWDEAARAPTNPIRPTIPGAPGHVYADVNEDNPYLGVGGAPSIAPAPLNAT
                     ITGYATGLGWELSKLCAMAYAIPPFSSVLLLLWETQNDLARFHAYQAGFGGAIVLVGA
                     WVLRNIFGLRWFVWLLTRLCLFGSWYCAYIAHRSATSLEREPFLPVLGNYAVRCVGDE
                     "
     gene            complement(<81348..>81707)
                     /locus_tag="MRET_0041"
                     /db_xref="GeneID:38736807"
     mRNA            complement(join(<81348..81413,81474..>81707))
                     /locus_tag="MRET_0041"
                     /product="rRNA-processing protein CGR1"
                     /transcript_id="XM_027626668.1"
                     /db_xref="GeneID:38736807"
     CDS             complement(join(81348..81413,81474..81707))
                     /locus_tag="MRET_0041"
                     /codon_start=1
                     /product="rRNA-processing protein CGR1"
                     /protein_id="XP_027483127.1"
                     /db_xref="GeneID:38736807"
                     /translation="MSEKQDMKMSTLDIPREKTTSKKWNERMQHRQKMHSIKTREREM
                     KQAKEEESERRSQVRKERAFKAAEKERLEAMAARMSAKKALRHARRMGRTKKVAH"
     gene            <81911..>82565
                     /locus_tag="MRET_0042"
                     /db_xref="GeneID:38736808"
     mRNA            join(<81911..82337,82376..82416,82458..82489,
                     82529..>82565)
                     /locus_tag="MRET_0042"
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 6"
                     /transcript_id="XM_027626669.1"
                     /db_xref="GeneID:38736808"
     CDS             join(81911..82337,82376..82416,82458..82489,82529..82565)
                     /locus_tag="MRET_0042"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 6"
                     /protein_id="XP_027483130.1"
                     /db_xref="GeneID:38736808"
                     /translation="MLGRVLVAPTRALRAQTFAFRSFSSCAARFESLPTKEQVATPYK
                     ARGEFVRPKVEGSAIVSNVETPVAKPSNPQSLEEYGTDQAPNRAGVWSESQRPKSDAM
                     KGPRFEQMDPRFQPQTLSAMELVSNQPIHFTNKRVVSCDGGDGPLGHPRVYINLDQPG
                     PKACPYCSTRYQKVEEHE"
     gene            complement(<82806..>86438)
                     /locus_tag="MRET_0043"
                     /note="MRES_03120"
                     /db_xref="GeneID:38736809"
     mRNA            complement(<82806..>86438)
                     /locus_tag="MRET_0043"
                     /product="pheromone-regulated membrane protein"
                     /transcript_id="XM_027626670.1"
                     /db_xref="GeneID:38736809"
     CDS             complement(82806..86438)
                     /locus_tag="MRET_0043"
                     /codon_start=1
                     /product="pheromone-regulated membrane protein"
                     /protein_id="XP_027483129.1"
                     /db_xref="GeneID:38736809"
                     /translation="MPSPPPHLDDKNHVYHQVADQSYVTDMSQGSLDDSHPSISNGDR
                     IRTQESNSNQQQPAPPITSSLGVPATSATYSSPLRSDTIFTGQRDGSVTGISDNGLNR
                     NASKSARIHINTGSQGPTITVSQPPVSPVDSTVANSPITTEPRQRTGIQRANHPGQIS
                     LEGLRPQMPDMYEGNAQGRTGVVNVEGNDHTRLAALAEELEDEDSEAFSDAPPPGHVI
                     IRDEAFLGGQPTNPQELRERDPQPAYDYGGTTTPGATSSGSYDPMDDLDHVDIIEGET
                     DGMPSKPPRSARKKVYDQGKKGWGSLRQIFGINSNENKEDLSEKGLFTSDATNMKSVP
                     VQTSSGLRGTKRRHRPSAIEREAAKLVSAHKMLHGRGADSSDEDEMHLPGFNRSHLPD
                     SEASTPDALETAQQMDSRPVESGGVLGQLLKLYDQQQTDGTSQVSDSQAPESEAATEP
                     DATVLGGGLNLIGNEVVDAYGNHAAIQDVDPEVLKQAAESKPSTDSWRDSSRYSLQRS
                     GAGLINLANQNIVNVSNAGQSVVKNVASDVGLDIMDERPKAARSAAGTIGGLIATSGN
                     LIGAVSPLHAQLGPNPSRPGFTLDRYLLPDMNEKTLRRTAKIVAEASPVPKKMRTGPT
                     GTVPLTPNTFAAYVQQDSGVNPYFSAAESKSIAGSATASSMKRRGQAIGNAGKNLMHR
                     KWPHGSMSDDEQNHLMNTNPEELARREWKKKLRRRKARSKKQEIFITMHVAAILKRQE
                     FLLKLSRCLMMFGAPTHRIEQQIQATANVLEVNCRCVYFPSVMLLSFGDENTHTSETK
                     IIKQGSTVDLTKLTDMHTIYWNVIHDKIGVEQGSKQLDNLMRRKPMLRKWQFVLVSGL
                     ASAFITVGEWAFNGSLLDAIASFCLGSFMSFCQLSITSELYSNVFEIVFATLNSFIAM
                     GLHQISRYHTPTGEIHYGRYFCYEAVMAGSIVMILPGFIVLTAALELQSKSLVSGSVR
                     LVYAIIYSTLLGLGIMIGALPLLGSEGANLTKCNARKLDFPHWYNTPPGQNASPSFAW
                     AFLTVPGYALLLSLRNQAKVTRKEFPAMVLIAVCGWLVANFATIANKVNSSCNGTKDE
                     HCPVPEVLQNHSYLYSALGSFTVGILANIYGRFFDGRSFVVAVPGILFQLPSGMTGST
                     TLWNFATLQDDGSGSGNTEVTSGLQIGAQLLNISLGIAIGLFASSLLMFFLGGHRVRG
                     GGMFSF"
     gene            complement(<86743..>88259)
                     /locus_tag="MRET_0044"
                     /db_xref="GeneID:38736810"
     mRNA            complement(join(<86743..86959,86986..>88259))
                     /locus_tag="MRET_0044"
                     /product="transcription initiation factor TFIIH subunit 2"
                     /transcript_id="XM_027626671.1"
                     /db_xref="GeneID:38736810"
     CDS             complement(join(86743..86959,86986..88259))
                     /locus_tag="MRET_0044"
                     /codon_start=1
                     /product="transcription initiation factor TFIIH subunit 2"
                     /protein_id="XP_027483124.1"
                     /db_xref="GeneID:38736810"
                     /translation="MRGRDDDYVDSTKLEDDSDEMMEEQSDDSDEFHALPSLPNASLR
                     TALAERSSAKRKNDEGHGDEFKRTNKSAASRRDRQIQKGNAYSWEATYQRSWDHVQED
                     ESGNLESAVRQIIDINKRKRSLRDSIPVQRGIIRHFVLILDLSEDMNDRDLRPTRFDL
                     TLQLARQFVTEYFDQNPIGQLAIICARDGLAERLSLMGGNTFDHGAVLASRRKLEPRG
                     EPSIQNSLEMARSSLSHLPSSNTREILYISASLTTVDPGNIYQTIDKLVEEHIQVSVI
                     SLAAELRVFKELCTRTGGDFNVVLNEDHYKELLMKHVPPRVVTETPSTSTEEKKNDLL
                     VMGFPRRIPFHAPPSFCACHGRPMTGTKGLSFSDRGSAPVGYTCPRCSSRVCQVPTDC
                     PTCGITVIMSTHLARSYHHLFPVQNYEPVAWEAVTESSPLSCFACAFPFPPRPSDINE
                     ASVARTTMDVTLAPSSRYMCPKCHQHFCLECDAFVQEHLHTCPGCT"
     gene            <88486..>92400
                     /locus_tag="MRET_0045"
                     /note="MRES_03115"
                     /db_xref="GeneID:38736811"
     mRNA            <88486..>92400
                     /locus_tag="MRET_0045"
                     /product="protein transport protein SEC31"
                     /transcript_id="XM_027626672.1"
                     /db_xref="GeneID:38736811"
     CDS             88486..92400
                     /locus_tag="MRET_0045"
                     /codon_start=1
                     /product="protein transport protein SEC31"
                     /protein_id="XP_027483123.1"
                     /db_xref="GeneID:38736811"
                     /translation="MKAYLPRTAAFSWAPSSAEVDGLVMATGTVAGALDESFNNDSVL
                     ELWKLDATPDDTMNLSPSVLGSVNASARFNRLGWGFAHRDKPHGLLAAGLENGEVGVW
                     DVGMLMDPSTASHSQILRNTVHKGSVRGLSFNQPQPNLIATGSVNAEIFVWDLKSPTK
                     PYTPGSRSQHLDEISSLAWNGQVPYVLATASTNGSTTVWDLRHKREIAVLRNSAAGAS
                     MSSARSISSLAWHPLSPTRIATATEDDMNPGIVLWDLRNSRAPEAILSGHEQGVLGLS
                     WCRQDENLMLSCGKDSRTLCWNPQSHEIVAEMPPHSNWAFDVQWNPRNPNMLASASFD
                     GHVVVQSLQNIPVESEQDAAAVSTASMNPDDLFTALGNAPPPSTGGMPLVTAPKWLSR
                     PTSVAFGFGGQLVTISKPVPGAQGFPLRVHEIHTEPYIADRARVLSQALDENTLADFC
                     AMQCQNPNTRASDMAGWKTLQTLFHVDSRDELVELLGFSKDDITNQVQQAVGALGLPP
                     LEDENAQGEDPAPQVPSVTDEDPTAFFDQVPDMPLEPPQPAAEPFRLHPNGNQDPDRL
                     ITKSLILGDFENAVSLLVSQDRFADALVLATRAGDELLVKTQRAYFKRHAMNKPYLRL
                     LQSIVTEDLSDVVYHADLSEWQEIFAVLCTYAKQEDFSVLAERLGQRLEDRYLHSAQL
                     GTPALVDRKNAVLCYLAAGCLEKVMSMWIEEMQEEEYAIKSGSTQRDNSPYSAHAEAL
                     QTLMEKVVVFQHAVHYTDEDLQPPVPNDDGTVPVREFKLAPLYNYILEYVNVLAEQGL
                     VDIALKFVALTPPDYTPNQQSTVADAEWTHDRLLRASEMTQYAPTNPYAQGAYAQGAY
                     DQSAYGGYNVPAAPSVPAVPAPQPLAPPPMASQMAPPPPPLAAPSMPTIPSVPAVPTA
                     LSQPDPTPSPYAPPVHPVTAPPSVAQTTAYATQPVPQAMQAPPPPVIGAPPPASMTPG
                     LIPEPAVGTIASSPLPPPPQFKREKGGWNDVPAPSLPPPPPKRAPSAATGAAITSPFP
                     NQPPSMAASAAMPPPPPRGPPTGPPRPSSAASSAYMPPPMASPRTGLGIGQPSQDYGR
                     RMPQGHMNTPGVQRPQTPTVPGRPPMARTPNLRPQVTGPPSQFAGQQAATTPRAFSQS
                     AAVGTVPAPPRGQAGMVPPRSMTPAGGGYGAPPPASTPGGASKPGFQYPRGDRSHIPP
                     NLRPVSDTLAREVARLRSVDAQPKRILDDADKRVQLLLDVMNNGLVDARLVPVLQQLA
                     QAIQARNQQGALQLHVQLVTMATGDVATALVGVKFLIAKLYS"
     gene            <92505..>95633
                     /locus_tag="MRET_0046"
                     /db_xref="GeneID:38736812"
     mRNA            <92505..>95633
                     /locus_tag="MRET_0046"
                     /product="vacuolar protein sorting-associated protein 18"
                     /transcript_id="XM_027626673.1"
                     /db_xref="GeneID:38736812"
     CDS             92505..95633
                     /locus_tag="MRET_0046"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 18"
                     /protein_id="XP_027483126.1"
                     /db_xref="GeneID:38736812"
                     /translation="MASSVNVQGSDAPLFDVGRVQYTLPAPLIHVAAAANKLVLCLSP
                     FDGMPMRIVYLDLEEPAFTQEAFISSPTQARGSRWRDLHESTRVFVDASAVHVLLCAG
                     TYTYYWTPGWTRARRIMQLDGVPVTAAVFGEPRATPPVALPPLTGGRRWIWTPPILLG
                     TARGDLVETVLTAQLGGSDDRMDIFDRWARMSAGSAEYPLERGVYRLYSLASDANAIT
                     GLALETQGQNVVIVVATSSRLYEFVGLSSEVPGPVFQRVFDQYQQSSQSQWKTDLPRG
                     KGTLVTATLPVSWPYGSHRAMSWMNGAGVYAAQLLPDKGVCHADLFALPQRDDTPISL
                     GRTSLHHVLVYSDMAVCMNALDADVQYKVTLPLVAEERVLGIAMDSSSDTCWIYTSLG
                     GLYELLVKDEARDMWHLLLKRCDFEKALAFCHDETCRKQVLEKKGDALLHAGQLMEAV
                     ECYAQAQTPAFEQVVLSLMDVCADKALRRYVRLRLDKMPKQARVPRLMLATWLIELYV
                     AAIQAQEPTSEYYQTLLLEAQEILERHHDALDARTTYALLARQQCTELWLAYACILQD
                     TDKLVQHWIDQKQWNQALHTLSAQSALDAYYASSIALMQHAPEATIQCWQKCDQLDVE
                     RLIPALLQYTPAPNESDVVLMYLQHVIDVQGSKSPAAHALRLSRLCERASNQSALLKF
                     VESASPGALDLSYALRVCSEAGCREACVRIYARLQQYENAVHLALEANDIDLACSCAD
                     LAAHGPSGLQRELWLQCAKHVVQSQASMEDAMAFLHRTDLLTVEDILPFFPDFSVIDG
                     FKTEICDTLEGYVTRIDALKENMERTSATAANIQQDIDRLSKRTIEIDTEHRCMQCAT
                     ALLQRQFYLFPCRHGFHADCLTQLVTQHLSSRRLRRLLQLQNELAAADGTSEPRPTSP
                     TKSKVSSSSFPLSTSLERLREHVRPQAIVDAITAGLSVGVTSGRRALAPLDPSMSIRP
                     ASKGKSSTQAESANASVTSASWTAQLDKLRAELNTIVAGTCPICTLSVRNITAPFPDE
                     KDHEGDDADWIV"
     gene            complement(<95680..>97545)
                     /locus_tag="MRET_0047"
                     /note="MRES_03110"
                     /db_xref="GeneID:38736813"
     mRNA            complement(<95680..>97545)
                     /locus_tag="MRET_0047"
                     /product="triose/dihydroxyacetone kinase/FAD-AMP lyase
                     (cyclizing)"
                     /transcript_id="XM_027626674.1"
                     /db_xref="GeneID:38736813"
     CDS             complement(95680..97545)
                     /locus_tag="MRET_0047"
                     /codon_start=1
                     /product="triose/dihydroxyacetone kinase/FAD-AMP lyase
                     (cyclizing)"
                     /protein_id="XP_027483125.1"
                     /db_xref="GeneID:38736813"
                     /translation="MSTKHVFDDATGLVEKACLGVASTNPDLRFFAHHKVLYNAAHPR
                     DKVAILAGGGAGHEPAFSGLVGSGLVTVAVSGDVFASPSSKQICSGVDLAPTDKGIVT
                     IVLNYTGDCLNFGLASEKARSAFHSEGKGRDIEMVNVGDDVSVGRSKGGLVGRRGLTG
                     AAFTAKVLGAASEKGDDVQKIAHLGRTMVKNFVTVGSSLDHCHVPGRSTDPKERGALS
                     QSAVEIGMGIHNEPGAKHIENKPSGEDLIKEMLELLLREDDPERSFVKFNKDDDPVLI
                     INNLGGMSSIELGAIAAEARTQIERDWNLRLSRVYCGTYVTSLNAPGFNISLLNHKRV
                     SEEYGSDVLELIDAPTGATGWAGAQTGWTSKNPLPTLKQMEDEPAKLLEEKANSGHAV
                     SGKPTENQAAKSGPTNSDGELTKKIIESLCKAIIDVEPTLTKYDTVVGDGDAGETLRH
                     CAEAVLQYLKENKIPLDRATSTVLGITEAQESSMGGTSGALYAIYLTGLVQGLLKSTQ
                     NNGEAATVKHWASAANHAFQSLGKYTPARPGDRTLVDALEPFCRTLASEAESGKSAKE
                     ALKAAVDASKEGAEKTRDMTARLGRATYIGETSEKVPDPGAWGIWALVEGIYKVL"
     gene            complement(<97722..>98692)
                     /locus_tag="MRET_0048"
                     /note="MRES_03105"
                     /db_xref="GeneID:38736814"
     mRNA            complement(join(<97722..97778,97816..97962,98003..>98692))
                     /locus_tag="MRET_0048"
                     /product="mitochondrial DNA replication protein"
                     /transcript_id="XM_027626675.1"
                     /db_xref="GeneID:38736814"
     CDS             complement(join(97722..97778,97816..97962,98003..98692))
                     /locus_tag="MRET_0048"
                     /codon_start=1
                     /product="mitochondrial DNA replication protein"
                     /protein_id="XP_027483122.1"
                     /db_xref="GeneID:38736814"
                     /translation="MAPAQGRFSWSNIAVGAVMNMFEVTTLGQPFEVIKTQMASNRTQ
                     TMYQALKTVWNRGGVLGFYQGLIPWAWIEASTKGAVLLFTSTEVQKVAKSLGMGPGAA
                     GLLGGMTGGIVQSYATMGFCTCMKTVEITRQKQVTAGVPPPSTWKVFADIYNKEGIRG
                     INKGVNAVALRQMTNWGSRMGFARLAESPVRRFTGKTEGEKLNNMERILCSTIGGALA
                     TWNQPIEVIRVEMQSQTKSAAAHRSAKPSILGTAAYIYKENGLRGLYRGVSPRICLGI
                     WQTVCMVSFADSVREWLGTSK"
     gene            complement(<98899..>99825)
                     /locus_tag="MRET_0049"
                     /db_xref="GeneID:38736815"
     mRNA            complement(<98899..>99825)
                     /locus_tag="MRET_0049"
                     /product="ESCRT-II complex subunit VPS22"
                     /transcript_id="XM_027626676.1"
                     /db_xref="GeneID:38736815"
     CDS             complement(98899..99825)
                     /locus_tag="MRET_0049"
                     /codon_start=1
                     /product="ESCRT-II complex subunit VPS22"
                     /protein_id="XP_027483121.1"
                     /db_xref="GeneID:38736815"
                     /translation="MRRGPGIVALDRKNASTGQYTCISQQWNESKLLELNERIDDFSR
                     ALKSFAVRHQRDIRRNPQFRHAFQRMCANMMVDPLAGRPPSVDAGGRLGQVANLWSQF
                     LGLDDWQYELGVQIVDVCISTRPQNGGIISMNALIDGVMRLRHCDSMYSQASSKNVEW
                     KISEEDIERSIQALHPLGCGYEVFDLLGAKMIRTMARELSSDALHILNILSSQYMAPR
                     DCLSNTYVTAEVLASCSKNNDVPGENPTWLPERAKQSLDDMLLNDGTLWLDIIPTDVN
                     NEPEQNRRRYYAFSLFSGEFSSGSFTGNGVSS"
     gene            <100274..>101152
                     /locus_tag="MRET_0050"
                     /db_xref="GeneID:38736816"
     mRNA            <100274..>101152
                     /locus_tag="MRET_0050"
                     /product="homeobox domain protein"
                     /transcript_id="XM_027626677.1"
                     /db_xref="GeneID:38736816"
     CDS             100274..101152
                     /locus_tag="MRET_0050"
                     /codon_start=1
                     /product="homeobox domain protein"
                     /protein_id="XP_027482824.1"
                     /db_xref="GeneID:38736816"
                     /translation="MGFVPGSMKSDIPANSYPYDDLQNKESPNYAGSVSSEASSDNAS
                     VDHGAEESYSSTPQNNQSKGNGKRARKLLTEEQSRVLHDLLRRTSFPSTQVRQEVAAQ
                     LGLSPRKVQVFFQNKRQKQRKKSTLSMPTQVKMTESQRMLQARSAEASPVQQNDTYPR
                     NLSPLSQTQLHGDIRDVTPSISLNTNTSPPSIQHYHPPHSLPFKWPHSYSEPRRAFER
                     PYWHESRYDRKDFNASGFFKASPDLTTSRSTPPYTRELYMNQNASRILPPIVSNIRTS
                     NTKLPSIDEVVSRAPY"
     gene            <102163..>102939
                     /locus_tag="MRET_0051"
                     /note="MRES_03100"
                     /db_xref="GeneID:38736817"
     mRNA            join(<102163..102662,102693..>102939)
                     /locus_tag="MRET_0051"
                     /product="ubiquinone biosynthesis monooxygenase Coq7"
                     /transcript_id="XM_027626678.1"
                     /db_xref="GeneID:38736817"
     CDS             join(102163..102662,102693..102939)
                     /locus_tag="MRET_0051"
                     /codon_start=1
                     /product="ubiquinone biosynthesis monooxygenase Coq7"
                     /protein_id="XP_027482825.1"
                     /db_xref="GeneID:38736817"
                     /translation="MLRLVWRMPRSGWRSIPSSMRHFQTENLASDAFTKTSANHAERL
                     AKSKRFIAALSPADRRVVASMLRVDHAGEIAANTIYEAQADVFGFLGKQATKKLMLEM
                     WDNERKHLASACAMLDEYNTRPSALTPAWALAGRILGGATALMGEKSAMACTEAVETV
                     IGEHYDDQLLHLEHIGETLSREYQGKQAEELKEILTLLRNVLMEFRDDELEHLDTAVE
                     HDSQQAPAHALLAAVVEYGCKGAIEIAKRI"
     gene            complement(<102936..>103815)
                     /locus_tag="MRET_0052"
                     /note="MRES_03095"
                     /db_xref="GeneID:38736818"
     mRNA            complement(join(<102936..103571,103597..>103815))
                     /locus_tag="MRET_0052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626679.1"
                     /db_xref="GeneID:38736818"
     CDS             complement(join(102936..103571,103597..103815))
                     /locus_tag="MRET_0052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482702.1"
                     /db_xref="GeneID:38736818"
                     /translation="MSSLTSILAFAHGGGSLLPPKDAHIHVSDTLDAHGVFVLLQYAI
                     KALQDARPVVWVSVRADGPTHLAHIARKAGISLDTPHFVYIDATSFLDDSLVPLHEII
                     QQALPPPASHPDTQAGALVIIDSLSMLQWCLSGTPEHIYHTFVNWLRLLRQTCESLDT
                     ALLTLMQADACAAVSHRGTLDQSDERLFRYLLRTADVWVSVSELPSGRAAACDGECGM
                     YALVRPMMARTSRPSDPIYPFLMERYIPAPTKFLYRILPDGTGPKQDDGTRAIVRVWS
                     RGSGADVI"
     gene            <103869..>105401
                     /locus_tag="MRET_0053"
                     /note="MRES_03090"
                     /db_xref="GeneID:38736819"
     mRNA            <103869..>105401
                     /locus_tag="MRET_0053"
                     /product="2-(3-amino-3-carboxypropyl)histidine synthase"
                     /transcript_id="XM_027626680.1"
                     /db_xref="GeneID:38736819"
     CDS             103869..105401
                     /locus_tag="MRET_0053"
                     /codon_start=1
                     /product="2-(3-amino-3-carboxypropyl)histidine synthase"
                     /protein_id="XP_027482705.1"
                     /db_xref="GeneID:38736819"
                     /translation="MSDASHPKRRYTRPATGDAGPVFGGIPASVLEDPLLNGAIDSLL
                     PRHYNFEIHKTVHQIRQYQVTCVALQMPEGLTMWATAIADIIERFTGAQSVIMGDVTY
                     GACCVDDYTAMALGCDMLVHYGHSCLVPVDQTMIRTLYVFVEIHVDTTHLYHTIRANF
                     PSECARFRDRVLTTPQEQATRPAVAVDVPAPSRPTHLAVVGTIQFIGAIQAIRDALTS
                     ENDAAPAAIGAGDDTEEPVKQGPYRISVPQIKPLSPGEILGCTSPKLDASDVDGVLYV
                     GDGRFHLESIMIANPRIPAFRYDPYTKRLQRELYDHTEMRRLRKQAIRDAQATLDHPA
                     PATQGAWGLVLGTLGRQGSHKVLDYLRTSLQDRHAHIPHVPILLSELSPQKVELFGEH
                     LSVLVQTSCPRLSIDWGSAFPRPLLSPYEAAVALGRTPPWDDAPRDLGLARYPASQAA
                     PDDAAKHDYPMDFYANASLGPWTPRHGLGSIRKAGRNHRALLQALGLGPPRPPAAQTA
                     PR"
     gene            <105471..>106391
                     /locus_tag="MRET_0054"
                     /note="MRES_03085"
                     /db_xref="GeneID:38736820"
     mRNA            <105471..>106391
                     /locus_tag="MRET_0054"
                     /product="pyruvate dehydrogenase protein X component,
                     mitochondrial precursor"
                     /transcript_id="XM_027626681.1"
                     /db_xref="GeneID:38736820"
     CDS             105471..106391
                     /locus_tag="MRET_0054"
                     /codon_start=1
                     /product="pyruvate dehydrogenase protein X component,
                     mitochondrial precursor"
                     /protein_id="XP_027482693.1"
                     /db_xref="GeneID:38736820"
                     /translation="MSLLAPVSRILRMGRSAVQVARMSTSLPRAAFKEFTMPAMSPTM
                     EHGNLGQWKVSEGDTFSAGDIILEVETDKAMMDVEAQDDGVMARIVVPSGTKDVPVND
                     LIAWLAEEGDDLSQVPETKGASQPPRDAPKGAAEDAPKQAPTPASSERKNEVPHGTDT
                     VHVTKPTFPSVLRLAHERGISEPEKVIQGTGRHGMITKGDVLAYLGDIKSAYGTAQVH
                     HTTMSELSGAKRDGAHAQASQPAYTPLSASEHRRLVVAGLASLGTAPRTPAPPATYAA
                     VLEGYGAPKAPAPPRPSTAASALAAFYEKL"
     gene            complement(<106395..>108215)
                     /locus_tag="MRET_0055"
                     /note="MRES_03080"
                     /db_xref="GeneID:38736821"
     mRNA            complement(<106395..>108215)
                     /locus_tag="MRET_0055"
                     /product="palmitoyltransferase ZDHHC13/17"
                     /transcript_id="XM_027626682.1"
                     /db_xref="GeneID:38736821"
     CDS             complement(106395..108215)
                     /locus_tag="MRET_0055"
                     /codon_start=1
                     /product="palmitoyltransferase ZDHHC13/17"
                     /protein_id="XP_027482821.1"
                     /db_xref="GeneID:38736821"
                     /translation="MSGESLHASAQHGHVDRVRAHLDAGADVNERDEEGVTALHWAAI
                     NGHDDCCRLLLARGADVHATGGALHATPLHWCTRQGHVQIMALLLDHGADPLLLDSQG
                     FHALHLATHSSLVMALVYLLQRDEFQPQAALDRKDRQGHTSLMWAAFQGDALSVDVLL
                     QHGASVHLADMDGLTALHWSVVHGNRACIERLVEAGSDTSAREHKGQTPAGLAQELGS
                     WPAYQAAVASVRARSRRPVRTLVAFVAPTVLYGAMFQAAARVPWVLAPLVLVLGIVGT
                     HLLTTGFLWRVAHAKALQTSPYFASLLCMIVAHGIVYYASYLSRASALCDAVMLVCVP
                     ALLSFWVVCATRAPGACAKARDVRRTVHELAREGKLTGQHFCASCMSRRPLRAKHCVL
                     CRTCVARHDHHCPWIMNCVGLENHVPFLLLLVSAVLAMAAFERAAWSYMLRTMPPSCA
                     GPWACHAALFYVTVMILIAAVWCLLLLSGQVYHVSTQVTSFELINLRRHGFMGGRPDA
                     HMLGQGQAGYIQTQREQLLAQGLSPKEAQRALWGRGSPPRSTHWLSSVCPGMLGAPWL
                     ARQGTAASNPFDRGCLGNWLSFVSRGRYDRIDYTCLYDVA"
     gene            complement(<108255..>109163)
                     /locus_tag="MRET_0056"
                     /note="MRES_03075"
                     /db_xref="GeneID:38736822"
     mRNA            complement(<108255..>109163)
                     /locus_tag="MRET_0056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626683.1"
                     /db_xref="GeneID:38736822"
     CDS             complement(108255..109163)
                     /locus_tag="MRET_0056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482691.1"
                     /db_xref="GeneID:38736822"
                     /translation="MPLSQALKALVHAPRYAARASKYQPGVTIPAGVSGSPKAAPQVS
                     ILQDLFRRLERDAASHGVRWGEWLTLSTATLFAINAPSTLRVLHTYVMQHGGTLRPLA
                     DRVDRACLMREVGLKTLGLIGTPRAINNLAALRASVDADAELAAHMPTESRRALSPEQ
                     LQQSFRAGSDLFDDIYAKQSPKLRGVLAHHHPDLGEYIVHYEYGPLFAPASQYHHAPE
                     PAWEVNRVRMSLLAIASLHAQGGVAPQVVSHVYGLLRARPHIRDEAGLAFLTSEAGAM
                     WALETINDMCRVVDGAEDAERQVAHL"
     gene            <109292..>109684
                     /locus_tag="MRET_0057"
                     /note="MRES_03070"
                     /db_xref="GeneID:38736823"
     mRNA            <109292..>109684
                     /locus_tag="MRET_0057"
                     /product="large subunit ribosomal protein L34"
                     /transcript_id="XM_027626684.1"
                     /db_xref="GeneID:38736823"
     CDS             109292..109684
                     /locus_tag="MRET_0057"
                     /codon_start=1
                     /product="large subunit ribosomal protein L34"
                     /protein_id="XP_027482692.1"
                     /db_xref="GeneID:38736823"
                     /translation="MTLPRFAGVRAFRHLRSTGTRMIPACENIPARSATSTVYTRTPM
                     TTAWRAPIPSSPILSMTRPMLWNKNAGASPSQIPLGGVRFTTYGSEYQPSQRKRKRKH
                     GFLARLRSRTGKKILIRRRAKGKTAISH"
     gene            <109772..>111199
                     /locus_tag="MRET_0058"
                     /note="MRES_03065"
                     /db_xref="GeneID:38736824"
     mRNA            <109772..>111199
                     /locus_tag="MRET_0058"
                     /product="DNA-binding protein HGH1"
                     /transcript_id="XM_027626685.1"
                     /db_xref="GeneID:38736824"
     CDS             109772..111199
                     /locus_tag="MRET_0058"
                     /codon_start=1
                     /product="DNA-binding protein HGH1"
                     /protein_id="XP_027483188.1"
                     /db_xref="GeneID:38736824"
                     /translation="MSLPATHEILLFLADANPQVRQLAMANVVSFSVKSHPLRRLLTD
                     PLTYDDGRPVCKANGEPLDVLAQLKALCQDQPLTIHDAFSALINLCDSPSIAARIGDD
                     DFLAFLVTYIGDSVSLLADLACMLLSNLTKFESIASRLLALQVEDRPFYSFLSPLDLQ
                     VALSGLDADASQPDYEEKKKAVEAASKRLADSMHANATEKLPALIKLLRAFEEGATVE
                     TSRASDADMRKRIEAARKEQDQPVEMGADGRPQIRRKSTCNFLASVFANVTVLPRGRE
                     FFVMPMQGADPQQADAYPVGRMVVFTEHADLIRRGGVISALKNILFLKHAHRLLLAPS
                     AEQPDRPSLDILPYILMPLIDGKELAKVDLEDQESLPEACQLVDENKPREKDSALRLM
                     LVECLLLLCTSHYGRQSLRERGAYIVVREAHLAEPKEQITEAIVRLVNLLKRDESDAS
                     MKDDQDVHVSVEGEDADDDLVIEEL"
     gene            <111251..>112026
                     /locus_tag="MRET_0059"
                     /note="MRES_03060"
                     /db_xref="GeneID:38736825"
     mRNA            join(<111251..111524,111695..>112026)
                     /locus_tag="MRET_0059"
                     /product="NTF2-related export protein 1/2"
                     /transcript_id="XM_027626686.1"
                     /db_xref="GeneID:38736825"
     CDS             join(111251..111524,111695..112026)
                     /locus_tag="MRET_0059"
                     /codon_start=1
                     /product="NTF2-related export protein 1/2"
                     /protein_id="XP_027483189.1"
                     /db_xref="GeneID:38736825"
                     /translation="MTTDRISAPAWLAEFTANAAETFVTAYYGASDAPQRIKLVPSLY
                     LPNSSISWNGNPISGSTQYAQWLDAQPGSQHEIQSFDCHALGPFDAYDQNEAPSLLLT
                     VSGTVAHYTPESLATPTSNAPKSATSTGTSSRRKFDADAPIETYPRVFSQSFVLINGA
                     GTNAEGGVPFVWMPQNKGPKKSETRTVAKYFIQADCFRFVG"
     gene            complement(<112041..>113087)
                     /locus_tag="MRET_0060"
                     /note="MRES_03055"
                     /db_xref="GeneID:38736826"
     mRNA            complement(<112041..>113087)
                     /locus_tag="MRET_0060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626687.1"
                     /db_xref="GeneID:38736826"
     CDS             complement(112041..113087)
                     /locus_tag="MRET_0060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483234.1"
                     /db_xref="GeneID:38736826"
                     /translation="MNQVAVRQRADERRIDVHGNEEENQHVPLTPRQRASLRFLQINT
                     PMSLLCCIATGLISTLIVPSMHYVFRSQPTYFTMAPRMFLAYSIVMLFFEFGFCLLSL
                     ITPNPHTQRCIVQGAGSRLALSNYILSMWLLCRIIDTNMTMILGSIVLVGILLLTATN
                     GLVLRTKYRPRWVHPFELLLVHVPNKLVLLLVGQVLLWDQLMLTWGWDRSMGRHALGE
                     GLWFAALVQSLIGIALVVWISLTSDVSVYLASVFLDIAVLKFHKMPVIGPNSRPFVLS
                     IILSVSMGLRTIALILPMMLDNGFLVICHTHRRHLPEERYDEAVVAPASLPPAEQNER
                     TRLLASRDMAYGTT"
     gene            <113223..>115106
                     /locus_tag="MRET_0061"
                     /note="MRES_03050"
                     /db_xref="GeneID:38736827"
     mRNA            <113223..>115106
                     /locus_tag="MRET_0061"
                     /product="solute carrier family 36 (proton-coupled amino
                     acid transporter)"
                     /transcript_id="XM_027626688.1"
                     /db_xref="GeneID:38736827"
     CDS             113223..115106
                     /locus_tag="MRET_0061"
                     /codon_start=1
                     /product="solute carrier family 36 (proton-coupled amino
                     acid transporter)"
                     /protein_id="XP_027483233.1"
                     /db_xref="GeneID:38736827"
                     /translation="MSGEPSPSRSTRATAQERLSPYAELESYPLPDEDKAVHVQRYLV
                     KPDDSTPDDSGHADDVQPSASAFSVTSSRISMNEDEYQAPHHMPGGAITEDLYRWAHQ
                     NRPRTRRTESVHLPRTRDLDSVIDSDILKQPGGFRRSYVMAQAAEQGKPPPRALKSFV
                     EFLMLYGHFAGEELNDFEIDEAEEEEDEETGPTESSSLLRRRHVHGHIPSLRGHRRHE
                     HKGEASVLDAVLMLLKSFVGTGILFLGKAFFNGGLLFSVIVMCLIAGVSLYSFLLLVQ
                     ANQKLHVGFGDMGGILYGPSMRHAILASIVISQLGFVAAYTVFVAENMQALIMSMTQC
                     RTLVSHGTLILAQALVFLPLSLVRKIAKLSSTALIADVFILTGVVYLLYYEIGSLAAH
                     GLADVVMFNTNNFPLFIGTAVFTFEGVGLVIPITESMKEPQKFPKTLSWVMLGVAALF
                     AAAGALSYATFGSETQTVVITNLPGNSGFVQAIQALYSVAILLSMPLQLFPALSILEL
                     GLFRRSGKYSLRTKMLKNLFRFLVVILAMFTAWLGANDLDKFVSLIGSVACVPLCFIY
                     PPLLHLRACATTRRAKMIDMALFTFGIFCVVFAGTQTVQSMLSGSSPPKPPVCVPSPP
                     RPL"
     gene            <115532..>116491
                     /locus_tag="MRET_0062"
                     /note="MRES_03045"
                     /db_xref="GeneID:38736828"
     mRNA            <115532..>116491
                     /locus_tag="MRET_0062"
                     /product="C-4 methylsterol oxidase"
                     /transcript_id="XM_027626689.1"
                     /db_xref="GeneID:38736828"
     CDS             115532..116491
                     /locus_tag="MRET_0062"
                     /codon_start=1
                     /product="C-4 methylsterol oxidase"
                     /protein_id="XP_027483232.1"
                     /db_xref="GeneID:38736828"
                     /translation="MEALSQSFNQTLESLTGHPTPAHILYANLDTSKLTYAEQLWVQW
                     YQYWGNPVIATGVMSFLLHEIVYFGRSIPWMIIDAMPSMRKYKLQPNYVPTLADQWRC
                     TRLVLLSHFTVELPQIWSFHPICEYFGMTTHEVPFPSWTKMVWQIALFFVFEDAFHYW
                     AHRTMHFGPLYKHIHKLHHEYVAPFGLSAEYAHPLEVLVLGMGTIGGPFLLCAFTKDL
                     HILTVYIWVILRLFQAVDAHSGYDFPISLHNWIPFWAGADHHDYHHMAFLGCYSTSFR
                     WWDHFLGTDRGYQRVRAKQKAQKLRAEADELDKYAASLKIQRE"
     gene            <116590..>118776
                     /locus_tag="MRET_0063"
                     /note="MRES_03040"
                     /db_xref="GeneID:38736829"
     mRNA            join(<116590..118651,118679..>118776)
                     /locus_tag="MRET_0063"
                     /product="TBC1 domain family member 8/9"
                     /transcript_id="XM_027626690.1"
                     /db_xref="GeneID:38736829"
     CDS             join(116590..118651,118679..118776)
                     /locus_tag="MRET_0063"
                     /codon_start=1
                     /product="TBC1 domain family member 8/9"
                     /protein_id="XP_027483231.1"
                     /db_xref="GeneID:38736829"
                     /translation="MSTIVHSLRDYRPPTRAQQFAFAFGLPPNEGPYVDEAGNRAEIL
                     SAILSLSNPDAPGVREDLVYAGRLTLTPSFLCYVSQGDYGRGCRVAIPLATIRRVERL
                     NTRDAVFALSVSVWHGMQLVFQLNALRPSCEGFCNALRDLLRAHLGDMKQLRPFLDTC
                     YSESLLRLGDEDAKGKHREDAVPYEMGLGETFGFPGDPKKLKDKSKMRLWKEYLATHG
                     RNITLLRYPQFTRLVQVGLPNMLRGELWEVASGSIFQRLAHRGEYAAILKEHEGQTNA
                     SMEEIEKDLNRSLPEYAAYQTDEGIATLRRVLVAYSWKNRELGYCQAMNIVVAALLIY
                     MSEEQCFWMLDTLCERLLPGYYTQSMSGTLLDQKVFEHLVWQTMPILHEHFMRHDMQL
                     SIVTLPWLLSLYINSMPMVFAFRIIDCFMAFGSQVLFQIGLAILKINGEAILRITDDG
                     TMIGLLRTYFRTLGDSAYPESPDERRRQITRFQQLLVIAFREFGVITNELVEQQRKQF
                     RQQIVQEIEGFARRSAIRNLQDYGHFTKAQVSLIYDHIVESIYRARNAPVSLTGGEKP
                     LSIQDPKQDMKEMRINFTTFRLFLSEMATWARDEYIVTNGLQERIERRVPDEKFARRI
                     FTYWDRDHSNSLSLQNIVTGLDEIMFLDGDLAGTTEWFFRLHANGKDKLSKNDVLALS
                     ESLLFLFRNEPGDEHLSSISTMISQAFELSADPTRPT"
     gene            complement(<118769..>119374)
                     /locus_tag="MRET_0064"
                     /note="MRES_03035"
                     /db_xref="GeneID:38736830"
     mRNA            complement(<118769..>119374)
                     /locus_tag="MRET_0064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626691.1"
                     /db_xref="GeneID:38736830"
     CDS             complement(118769..119374)
                     /locus_tag="MRET_0064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483238.1"
                     /db_xref="GeneID:38736830"
                     /translation="MPEAESAVSSGANVWVAVADGDMERVKYLLEHEGVTSTSKDESG
                     YTPLHAAASYNQHELLQYLLEQADDAQEAINVTDNDGDTPLFFCDVLETAKLVVEKHG
                     ADAQHRNHEGRSAAQNALENDSDDIAAYLASKTGETLAYEEQAPMGEEEEDPRVDEVM
                     QRIEDIMQRAEDTQTDPTEELQQVVGASIVRQIMEGYGRAT"
     gene            <119455..>119771
                     /locus_tag="MRET_0065"
                     /db_xref="GeneID:38736831"
     mRNA            join(<119455..119518,119548..119602,119630..>119771)
                     /locus_tag="MRET_0065"
                     /product="transcription elongation factor"
                     /transcript_id="XM_027626692.1"
                     /db_xref="GeneID:38736831"
     CDS             join(119455..119518,119548..119602,119630..119771)
                     /locus_tag="MRET_0065"
                     /codon_start=1
                     /product="transcription elongation factor"
                     /protein_id="XP_027483237.1"
                     /db_xref="GeneID:38736831"
                     /translation="MGKRKKSTRTPGAGRKKMPPLDTVFTCLFCHHERAVSCKIDDKA
                     RIGYLSCKICGQNFSADTDTLSQPIDVYSQWIDACEDVADNY"
     gene            complement(<119774..>121959)
                     /locus_tag="MRET_0066"
                     /note="MRES_03030"
                     /db_xref="GeneID:38736832"
     mRNA            complement(join(<119774..121811,121843..121893,
                     121922..>121959))
                     /locus_tag="MRET_0066"
                     /product="SCY1-like protein 2"
                     /transcript_id="XM_027626693.1"
                     /db_xref="GeneID:38736832"
     CDS             complement(join(119774..121811,121843..121893,
                     121922..121959))
                     /locus_tag="MRET_0066"
                     /codon_start=1
                     /product="SCY1-like protein 2"
                     /protein_id="XP_027483070.1"
                     /db_xref="GeneID:38736832"
                     /translation="MASSFWSHASSLIGRTNISIHYHVDETRSPLYVGPWRVYTATRK
                     AAASSNTMEQALTRNTVSVWMYTPISRGVMRTKEIEHLKRDVTTLSRLRHPCILEVVE
                     PLEECRSSYLFATEHVVASSHELLQDSVDPAHQLDEVELQKGFLQLARALDFLHDAKL
                     VHTNLTSMSVVMNAKGDWKLCGCAYLTSLAGVQSDSGRWAYEEEEHALPEVMRRDMDF
                     ADPVYVIDRRVGPYNDMYSLGILFYMATHHSAKPYQTYGSASALSAYMEDWPERMYSS
                     TWSLLERDVQTILTRLLSRTETPRYTAKAFLDLPYLNSMLVRVLKFLERESFAAHSRT
                     EKVQFLRGMYKMLPQFSVPLMRRKLLPNLLEATSDRMLLPYILPNVFYIAKNLSQIEF
                     TTTVLVRLEPHFCVHEPAQSQMLLLNQTDLLLSKTTQKDFQTRVMPLLYSAFDNEHVA
                     VQENALQRIPKLCGTLDYTHVKDILLPKLTSLFSKTKTLSVKVTSLICFHAMIPMLDK
                     TSITDVLLPTLNRIKTREPSVMVGSLAVFEALCDKVDLETKATVFLPRLWIMAMCPLL
                     NEMQFGRFMRAIKDIGQGVEQQQLERLREAKHLQLHTEEQASKTIAPVPLNAAIASTG
                     DIDLEALVGHARYETSVHAMDDLFAPDSAQPRSKSPVVPPPPPSGTLAPPPGWSGGLL
                     VPDSGPRSKTPRAASKAQWHDFDPLL"
     gene            <122055..>123064
                     /locus_tag="MRET_0067"
                     /db_xref="GeneID:38736833"
     mRNA            join(<122055..122669,122699..122810,122839..122900,
                     122936..>123064)
                     /locus_tag="MRET_0067"
                     /product="protein YIH1"
                     /transcript_id="XM_027626694.1"
                     /db_xref="GeneID:38736833"
     CDS             join(122055..122669,122699..122810,122839..122900,
                     122936..123064)
                     /locus_tag="MRET_0067"
                     /codon_start=1
                     /product="protein YIH1"
                     /protein_id="XP_027483235.1"
                     /db_xref="GeneID:38736833"
                     /translation="MNALVVRLQDRTSFASDDQADYAEELAQELIALQSIYGSEQVEL
                     KSGPNLGEPITFQVQLPCEDMGHDICIKFQIQLPKGYPNCHEAPQIELVNRFLPPFHT
                     DESVRHAVQDTFSPHGAAPWTQGEPVLFQGIDTAYELVLDWWKTKRRTIPPQQSPLPH
                     APKPTVTKSPPQRQINLDTLVRSDLISERKSEFLGHAAHITHPDDVPIFLAHILESDK
                     RIQRATHPAIHAWVCRTPDGVFHHDCDDDGEAAAGGRLAHLLTLLGAENVLVVVTRWF
                     GGVLLGPERFKHINRAARDALSKGDFIRT"
     gene            <123397..>125580
                     /locus_tag="MRET_0068"
                     /note="MRES_03025"
                     /db_xref="GeneID:38736834"
     mRNA            <123397..>125580
                     /locus_tag="MRET_0068"
                     /product="dehydrogenase"
                     /transcript_id="XM_027626695.1"
                     /db_xref="GeneID:38736834"
     CDS             123397..125580
                     /locus_tag="MRET_0068"
                     /codon_start=1
                     /product="dehydrogenase"
                     /protein_id="XP_027482737.1"
                     /db_xref="GeneID:38736834"
                     /translation="MLFEKPFLLLLVALLGSAVISSEASDHRGLVREIRKRDAASTNP
                     SDLDGKTFDYVIVGGGLAGLTVASRLSENENVTVAVIEAGPAGTSKDLASRIDPPAGN
                     LYNHMLETNMNWKFKTVPQANLGGAVKDFPRGKVLGGSSAVNGLYYVRHSTSEQDAWG
                     EIIGDKNLWGWNNMYRAMKKSENFTDASDEIKKVEHISSEPGSHGTKGPIQVSWPGEI
                     YDSIGAFIKAASKTGAPYVKDPYSGHNIGAYVALETLNPSNWTRSFSRSGYYDPYVYR
                     KNLKVLTGHLVTKVEMEKGQKLAKATGVTYQAKPDGQTYHVKAGREVIMSGGAVNTPQ
                     ILQLSGIGEKNFLNSKKIDVVVDSPGVGHNLQDHVSGGVQWAPGQNTKIPPTNTNQSP
                     IVNSYTNTAVCYVNGTQGLKDQWTNYLNQVKGNKTKAVNALQAPDVVKKGYELTYSTV
                     LGLIENGVAPLEMLYSLTFGQVMVQTAMQHSFSRGSIMINSTDPFEHPIIDPRYFEQD
                     SDRFMLRSGFKLARNIGQTAPLKSFLGEESVPGNSVQSDEQWDKFIEGRVGTEYHPSG
                     TAAMLPKNKGGVVDKTMKVYGTSNLRVIDASVVPYVVSSHFMSLVYGLAEIGSEIVLD
                     AYNHDMQNKKSSNGGATGGNSQGNSNKGGAADGSSQNSSGKGGAAKGDNQNNSGKGGA
                     TKGDNQNNSSKGDGSSARAGATPISILSTLTITSFVTFAYLYSAI"
     gene            <125997..>127865
                     /locus_tag="MRET_0069"
                     /db_xref="GeneID:38736835"
     mRNA            <125997..>127865
                     /locus_tag="MRET_0069"
                     /product="dehydrogenase"
                     /transcript_id="XM_027626696.1"
                     /db_xref="GeneID:38736835"
     CDS             125997..127865
                     /locus_tag="MRET_0069"
                     /codon_start=1
                     /product="dehydrogenase"
                     /protein_id="XP_027483239.1"
                     /db_xref="GeneID:38736835"
                     /translation="MTRFISWAVVSVAVLCVSQVSGFYNETRVFDRRQTTGNGWDLDN
                     KSYDYVIVGGGTAGLVLANRLSADGSNSVAVIEAGNSGYDDNNKFIVPSAMLYDSGTN
                     TQYDWQFKTTAQKHMNGRKAAWPRGKVLGGSSAINGLYYVRPSDAEMNAWADLAGGNA
                     YDHWGWDSFFGFFKRSEKFQTPLKSVQDQAHIHYDDGSHGHHGPIHTTWPAITYGPVG
                     AFIESANKAGVKMNKNGYDGKNQGVYLALSSLNKDNWQRSFSRNEYLDPIGDRKNLHV
                     LTGHTVTQILFDRSDKNNVQATGVHYKAAANEYEHTLHANKEVILSAGSINSPQLLQL
                     SGVGPSGLLQSLGIDVVVDLPGVGENLQDHVMAGMSFSVKNDKDVPPQKVTGNKKTDS
                     YVNSAVSYVAFHNIFNDADAFRGKIQARVKAIPDELNVDDSVREGYRAVYDKIANDLF
                     YSNVSPVEVLGNVMFGSISLQAALQHPLSRGNIRITSKNPFDYPRINPNYFREDIDLK
                     ILREAFKLIREITQQPPLKDHIASENWPGNGVQSNEQWEDWIRNAAGTEYHPSSTCAM
                     LPRNKGGVVNPDLKVYGTRNLRVVDASVPPLALSCHLESVVYALAEAAAEIILNHN"
     gene            <128120..>129079
                     /locus_tag="MRET_0070"
                     /note="MRES_03020"
                     /db_xref="GeneID:38736836"
     mRNA            join(<128120..128159,128191..128254,128288..128472,
                     128499..>129079)
                     /locus_tag="MRET_0070"
                     /product="golgi reassembly stacking protein"
                     /transcript_id="XM_027626697.1"
                     /db_xref="GeneID:38736836"
     CDS             join(128120..128159,128191..128254,128288..128472,
                     128499..129079)
                     /locus_tag="MRET_0070"
                     /codon_start=1
                     /product="golgi reassembly stacking protein"
                     /protein_id="XP_027482471.1"
                     /db_xref="GeneID:38736836"
                     /translation="MGANESRLNSDDLGPKQGYHVIRVAQKSPAQYAGFEPFFDFCVG
                     INGQPLAGLGVNILNENISNAQPTKASWSMVEESEGRTIIINTWNSKHQEYRDVSIVP
                     SRKWSENNSQSNAQPSLLGLTLRLCNPLETISHVWHVLEVIEGSPADSAGLVPYGDYI
                     IGWTQGPLRSEHDFFQLIEQYINRNLSLYVYNSDYDHTREVVIVPNRDWGGEGILGCG
                     MGYGLLHRIPQPRKLWDDVVPEDQNQAYLSKETPSLSHSDVSTAPVSSNVTQEPISND
                     YGVTLNMHEEEEE"
     gene            complement(<129153..>130727)
                     /locus_tag="MRET_0071"
                     /db_xref="GeneID:38736837"
     mRNA            complement(join(<129153..130688,130719..>130727))
                     /locus_tag="MRET_0071"
                     /product="glycoside hydrolase family 5 protein"
                     /transcript_id="XM_027626698.1"
                     /db_xref="GeneID:38736837"
     CDS             complement(join(129153..130688,130719..130727))
                     /locus_tag="MRET_0071"
                     /codon_start=1
                     /product="glycoside hydrolase family 5 protein"
                     /protein_id="XP_027482472.1"
                     /db_xref="GeneID:38736837"
                     /translation="MAKIFRKFNEMLHQGGYDQAHVKVVPWDHPVGNRVKYLFRKQRG
                     VNLGSWFALESWLTGSLFKNAKEPSSCDIDLVKGMKPDDAKALLEDHWDNFINDGDWS
                     WMKAHGINSVRIPILYPHFLAGNPKHKKLLKGTEYGPYDFVYEGAWKRIVKAIEKARS
                     LNIGVLIDVHGVPGGQNGDSHCGKSDGNAGFWHGSHASSNRKVTIKILVALAEAISCF
                     ENVIGLELMNEPQNHNALESFYAEAIKSIRCSSKPDAASMPLYVGDAWDTNHYTHYVG
                     KHTSCDNPLVVDHHLYRCFTPNDHKTTAAAHANHLDVEHHGKTAVWLEHMANNAKNSI
                     IIGEWSGALNPGSFQGCNGKLEARKQWSLAQWRAFEKLTAGYYYWTLKKEGGPDPGWC
                     LYTAIEKGSMPPSLNPLDDTHVDLNLLKIEGEKCREQGYMKHVKYWDNKGGHFDHEQY
                     NAGFKVGWFDALDFLADGAEIGLPFQLVQYRIKSYRKDHDHKFIWEFEHGYTQALNAF
                     RRVLYA"
     gene            <130848..>131921
                     /locus_tag="MRET_0072"
                     /db_xref="GeneID:38736838"
     mRNA            join(<130848..131150,131176..131236,131261..131661,
                     131689..131702,131732..131772,131800..>131921)
                     /locus_tag="MRET_0072"
                     /product="protein of unknown function (DUF1769)"
                     /transcript_id="XM_027626699.1"
                     /db_xref="GeneID:38736838"
     CDS             join(130848..131150,131176..131236,131261..131661,
                     131689..131702,131732..131772,131800..131921)
                     /locus_tag="MRET_0072"
                     /codon_start=1
                     /product="protein of unknown function (DUF1769)"
                     /protein_id="XP_027482473.1"
                     /db_xref="GeneID:38736838"
                     /translation="MAPKLRISAGPSKENLSLVAVNHDEQPIVIDSEDFQGRIAVRVK
                     DFHGELPDGVESLKQSAYFSEPYGSKFSYSIQIQGRFLDELTADDILFGNDFDAPIRD
                     SLPPGMSLFLRFLTYIDPNMTHDLYADQPWAFSNFLATMHKVKVIRAMPDTFSACKSA
                     EECFRADTWPDFPFLSEEEKFCSEDITPLFFQNDVQHSTPTLSSEFENNEDTIRRLCN
                     DPGASKNRVSWLSSKDNRKKLKITPSDVITADFANGLIDFNTLEAILPFGGFRLSLQR
                     YWNGQPVRYTCKHARTNKVFFVVQYVYTQCIEIYIQI"
     gene            complement(<131950..>132687)
                     /locus_tag="MRET_0073"
                     /db_xref="GeneID:38736839"
     mRNA            complement(<131950..>132687)
                     /locus_tag="MRET_0073"
                     /product="Bsp1 protein"
                     /transcript_id="XM_027626700.1"
                     /db_xref="GeneID:38736839"
     CDS             complement(131950..132687)
                     /locus_tag="MRET_0073"
                     /codon_start=1
                     /product="Bsp1 protein"
                     /protein_id="XP_027482474.1"
                     /db_xref="GeneID:38736839"
                     /translation="MLVRKVCWQSIPYTKHRVCSLGFFHSSFIIRSRIQSGMPIPDFK
                     SWKVLQLKQECKRLGLVTSRTKQGLIELLREYYEKESINENKAAKIDPNVIVISDSEI
                     DEHSTSFEVVESKSTSPPVEKGRLSNAFKSLSLSDNDTVSTSRSRSASSCSNISESEL
                     PTNDHASTYGPQPNFMDQPMCDAIFADEQLFKRILMLEPISLDEMLGVAHRSKVLTSA
                     SATRNRAELRTWLDCQGICFYEAELST"
     gene            <133188..>133538
                     /locus_tag="MRET_0074"
                     /db_xref="GeneID:38736840"
     mRNA            join(<133188..133278,133307..133389,133416..>133538)
                     /locus_tag="MRET_0074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626701.1"
                     /db_xref="GeneID:38736840"
     CDS             join(133188..133278,133307..133389,133416..133538)
                     /locus_tag="MRET_0074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482467.1"
                     /db_xref="GeneID:38736840"
                     /translation="MRLHDGPSLKAFIHRAKVLALYRNFLRSTRSTPTLEARHETIAW
                     FRYEIERARLETDAGRIQAYMMNGRMVLNQLEGMSMLNASDSSFPQLRGKRNLL"
     gene            complement(<133542..>136769)
                     /locus_tag="MRET_0075"
                     /db_xref="GeneID:38736841"
     mRNA            complement(<133542..>136769)
                     /locus_tag="MRET_0075"
                     /product="protein of unknown function (DUF2422)"
                     /transcript_id="XM_027626702.1"
                     /db_xref="GeneID:38736841"
     CDS             complement(133542..136769)
                     /locus_tag="MRET_0075"
                     /codon_start=1
                     /product="protein of unknown function (DUF2422)"
                     /protein_id="XP_027482468.1"
                     /db_xref="GeneID:38736841"
                     /translation="MTSSHTSGAGWIPRALQRSWTRIKKWNIPAHTIRLIPPIALSIA
                     LLPFVFARPVQQWIGSHSFFCYVLRQLAFYPGENTFVAHIEITVISLFLSSLWLGVGF
                     VITCAQVWIDSPNPIYTSLKTRGLGAAYIFTSFFIAGAIWSRIPRLRIPLRAVMFTQV
                     WVMTGSKSEITSRNFTDIFYPFFVCALLGIAANSLVPRTSNGKYFISLVSTLKTLSVL
                     VETAMKDYEKQLQKWYHYQDLNSDDPDNAPSFEQSPEAINLIKTLKGQVQVTNNAFTA
                     SQHEVIWCLLPASSTKHFMTFVTDASIWLSSGWGMSMPSMDLTDPIFEEARAAEGGEA
                     ASVSEVSVRPLRMSYTNPATTTIIQRISMDHLTSSLTELRNSVLDIIALIQVLSEYSM
                     HPVPSTYTHKVSATFCQAIHHYRLGDGEKFENPYTILTNAESKVEKAMNSCFVQLQLL
                     LRERGFKESKNAQVCSPVASMHSSQDGTAQTRPKDTGTDISELFRKPSLFCPDMYIMS
                     HFYQSLYHLANQAKQTIHVSIPMLDHILKHRHKRIFMPSLNIWRWFQTSSGIGSFGST
                     TLSETLTTFIQPKPTKPDISKEPGQFDPYSIVFDEDDQHTQYYNYARNMAKASRHTHR
                     RKKTGGSFFERINDALTSFTHSPSAINLRVHVSSFLRSVKQSHHIRFGLKLAAGVTLF
                     CIIPFLQNSPNDFWKREKGQWMLISYIWVLETSTGNTIRVLVYRIVGTVFGAVLGLII
                     YEISRGNVWALCVMIPVFDIPSAFIRLNVNSTLGGVIGFTTPLVVMVTFLNPGSSAVH
                     VAVVRGYMILLGVAAALLVNLIFWPYHARIQLMHKLSKTCTLLQNMYLSLARQRFYAG
                     FKTSPELKSGFRNFEKSVRLQLAQCDTLLNIMTSEFSLVPKPVLIVRRIYEHLEMIFV
                     LFVTLRSFREQEFLGDRQDALFGDLPLRQEFISSVILDLWLAGQVMVTRSKLPQSLPS
                     TRRALEDLVTATALEYHELLCHDAKDNAKHKSFYDGPMIEPFAQAELLDSTDDVNDLG
                     QAPAKTMGGLMYLLTEHSVLSQLVFSLESLLQLMRLIMGELHLVF"
     gene            <136902..>138089
                     /locus_tag="MRET_0076"
                     /db_xref="GeneID:38736842"
     mRNA            join(<136902..136946,136971..>138089)
                     /locus_tag="MRET_0076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626703.1"
                     /db_xref="GeneID:38736842"
     CDS             join(136902..136946,136971..138089)
                     /locus_tag="MRET_0076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482469.1"
                     /db_xref="GeneID:38736842"
                     /translation="MAGRMPANLDSLPFELLWRVLLYSRSASLAHVCKTLWHACALAP
                     RSVKAEYLFCCWLDSYNLRFQLKASSSMYAPAMQRKFIPTTYPSFGASNALRRTATCD
                     ILTFVSRFGICTSEIFALVERIVIHATLCGNICQLHGIFTHCPDGTQQMKPIRIACHF
                     VPERLFRKMVIAKMPLYLHDAHVSEQRIVRSIVRHICDLTPVYIQENDIRLPPWKHLE
                     MISRMILLHQASPNSSQGYPLAMAVHLGSTPLVCLLLATGADPSLKKGIAMHIACKKR
                     SLSMLRLLVEQDDTSELQWRTRLRAIVDDLIALTLLRTTGKIPPQCKRALPMKGATPS
                     KRSRLSDRCQVDTCMLSTAVQVGAWDIVSYLMQSKGVIPDVNTLRKIDEVGIA"
     gene            complement(<138116..>139867)
                     /locus_tag="MRET_0077"
                     /note="MRES_03015"
                     /db_xref="GeneID:38736843"
     mRNA            complement(<138116..>139867)
                     /locus_tag="MRET_0077"
                     /product="4-coumarate-coA ligase"
                     /transcript_id="XM_027626704.1"
                     /db_xref="GeneID:38736843"
     CDS             complement(138116..139867)
                     /locus_tag="MRET_0077"
                     /codon_start=1
                     /product="4-coumarate-coA ligase"
                     /protein_id="XP_027482470.1"
                     /db_xref="GeneID:38736843"
                     /translation="MTMIFKSVYRPLELPLHETVPSFVLRFTSDENDNKKILIPSVNT
                     NRRRASALSLAQVRESAYGFGTALMSKDVVNRPWKKGEVMAFYSENQHDYLVAALGVM
                     LAGGVPSLLSPMYKPEELNHAFELTHPRAILASVHTYEGAKNAAAKFSQTGAGNVDVY
                     VFDEEHERSMYTHLIDPGKKLRASGDMSLETVRINPTTDEAFYCFSSGTSGLPKAVRL
                     SHSNMVTNTIQMTVTLGGRVNKPVYDPSEWYNQPDAPVHDGENEVHYSLLPQFHCYGM
                     ITALINLHTITPGVIEAKFTPESFFRAVQDFKVTFTFVVPPILIALVRSPLADKYDLS
                     TIKSFASGAAYLSKELCQMVNKRYGISITDGYGMTETSPIVSLQTQNDLSLNKLNVGR
                     LVSNTEAQIIDMNTNKLLGPNEIGEIWIRGPQVMLGYLKNDEANAKTFIPHANDKDRF
                     LRSGDIASIDENGYITLHDRVKDIIKYNGYQVAASEIEKVINTLPFVLESAVVAKVIK
                     DDVSNNELPWACIVARPDSSHTAGNARDSEVLDYVNERVSGYKKLRGVCWMESLPRTA
                     SGKVLKRELRKFVAGEQ"
     gene            <139959..>140684
                     /locus_tag="MRET_0078"
                     /db_xref="GeneID:38736844"
     mRNA            join(<139959..140016,140041..140264,140293..140534,
                     140564..>140684)
                     /locus_tag="MRET_0078"
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /transcript_id="XM_027626705.1"
                     /db_xref="GeneID:38736844"
     CDS             join(139959..140016,140041..140264,140293..140534,
                     140564..140684)
                     /locus_tag="MRET_0078"
                     /codon_start=1
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="XP_027482475.1"
                     /db_xref="GeneID:38736844"
                     /translation="MWKSRLKNALATHANDWSIGMYAFATMHKHKMQSELEPRVRYVI
                     HRGFVNETNDPESECLIFTTDVRSGKASDIAMRPSAPVEIAWYISQERIQFRIRGSAH
                     VLSAPTHEWRLGFPAAQLEQRGTRLDWDQERERIWRTLSPKMRGSFFGPTPGKPLTSS
                     EIQPPVESVENIPESFALVIIEPHHVDMLDLKSAQRTLYERHTSGVWESQLVAP"
     gene            complement(<140689..>141063)
                     /locus_tag="MRET_0079"
                     /db_xref="GeneID:38736845"
     mRNA            complement(join(<140689..140768,140797..140865,
                     140910..>141063))
                     /locus_tag="MRET_0079"
                     /product="enhancer of yellow 2 transcription factor"
                     /transcript_id="XM_027626706.1"
                     /db_xref="GeneID:38736845"
     CDS             complement(join(140689..140768,140797..140865,
                     140910..141063))
                     /locus_tag="MRET_0079"
                     /codon_start=1
                     /product="enhancer of yellow 2 transcription factor"
                     /protein_id="XP_027482476.1"
                     /db_xref="GeneID:38736845"
                     /translation="MSDEGGESCEELLNLLHQRMISTGEWSSTLSQMLRMLEESGWET
                     QLREQAEKEARAQNSIQVGALVDKLGGYAHDTFPRTVRATISAKIRDYLDRNLEDA"
     gene            complement(<141172..>144576)
                     /locus_tag="MRET_0080"
                     /db_xref="GeneID:38736846"
     mRNA            complement(<141172..>144576)
                     /locus_tag="MRET_0080"
                     /product="LCCL domain protein"
                     /transcript_id="XM_027626707.1"
                     /db_xref="GeneID:38736846"
     CDS             complement(141172..144576)
                     /locus_tag="MRET_0080"
                     /codon_start=1
                     /product="LCCL domain protein"
                     /protein_id="XP_027483253.1"
                     /db_xref="GeneID:38736846"
                     /translation="MDGGSVAAQRLCDVLASIDEVGEAYVSWNAASPSWCSGPELTWL
                     NDSFVPVEAAINRTRIPVLYESHTVYKAPPLCGLASFRHTVNSELNFLRCSPDSSTNA
                     PYLETFWNEVLYALAHTGPVAALQTAKKRSVKDAAAMVHIAARNGRHWIRIMPLRSDA
                     LLREFREYDSTVSMTSPPREDEAILQNSIVYTAHELRMAARNGETIEIVLTRLNSGDT
                     SATIDMDSYWSGSELARMKWRLYKISEYVQSLGLQVTFGAHERMRLDAKIPRPPPAWQ
                     APPTLFLNLDVSAMVALCSDLTHESHLHVHDHGNRALVMQQNHERQSPLSGLLMKTFH
                     QPVQLVATRKAIEKFLSIVEQTASESEYARASWLLGSRHALRMGDPWDWLFPNAVRVL
                     DENCKVHSGWEDVPYVHQLLDALAECHGYSRPKSLGSSPHTLDSIQEGLSKRITTLLA
                     HSHGVHELLEKAGPMSGTPLNHSALWLIQPRSFVSKTPESLPILHTSRFSDLMRTTSL
                     RRAHQRWLRVWNWLQGPRVPVQHTIRHYPWWPWKRLENAWMQWTKPLAWKVPPQWEVN
                     SVPSNMEDIEMEPVSPLPGQSTIGERWWYKIEHDLRCNWLHWLVLCSVCVAWLFAFAS
                     LVHNTWFSSTVLTENGWETPESLACTSTKWGRNALCGLNGNDCKPFSNTSLVFRCPSG
                     CETTTLLNPRTIGSDSYNYVPLVVGGGNSTPYRADSFICASALHAGVIGPKGGCGIAR
                     MMGAYTNFEGQQQNNIASFPFHGVFPSSFKFEKPMNTSHCTDDRWRMYTLNVVFLAFI
                     TFVLRPMPIFLFWVFSCVGFWHVNLVSELRDVPPPIGDAVGDFGPHLFVCFVIWHVVL
                     QHVWYAFEHVPLEFGIAWLGLWWIGVLLDVVFANVPLQRLTYHDISQQPGAVTSIVII
                     VIVVVVLAINQVRVVRSVGLLPKYLALYVVFGIVLALCAAVPGEGLRLHHYVIALILL
                     PGCAFPTRISLLCCAILFGMYINGVARWGFDGILQDNGVIQGDATGNSLLPSFSSSMT
                     TDGVIKWNPIPADQRNIWSAFNLLVDDVLRYEGPDTSYNLSSLFAEFRSQPSNLLSQQ
                     QIYETLQKSTHYLRLAYSSATETGDFTRAALASLNGSFIPPKTGRT"
     gene            complement(<144658..>148269)
                     /locus_tag="MRET_0081"
                     /note="MRES_03010"
                     /db_xref="GeneID:38736847"
     mRNA            complement(<144658..>148269)
                     /locus_tag="MRET_0081"
                     /product="syntaxin-binding protein 5"
                     /transcript_id="XM_027626708.1"
                     /db_xref="GeneID:38736847"
     CDS             complement(144658..148269)
                     /locus_tag="MRET_0081"
                     /codon_start=1
                     /product="syntaxin-binding protein 5"
                     /protein_id="XP_027483252.1"
                     /db_xref="GeneID:38736847"
                     /translation="MSWLKSAVGRSKAAGHDRLPPLNSRLGDWTGDFRDVNKYAEGFL
                     DQLTLPGEISAMAYEPGMGYLAVGTSAGTVHLFGSPCVRMALTLRPALRVKHILFKSD
                     TYLMICIDEKDNLNVYDLSRRDPHAAAMHGARRAAPGQTQMTNSDAPMRIGIHSARNV
                     VLCAEVTSIHSMLFLGLTDGSVEAYDLERFCGTQYRIPNLWWNEEEILRRSQVPNAPS
                     RLHTPLIIDIQTHPRDPGILLLCYEGGAVIYSIRQSTAIHVFQLRLLPGAPGPVPSAP
                     LEEVWSERLCPATAISWSPCGTMFVMGHENGALSFWHIAEEDKPLMVRTLDDIDIDRP
                     VLPEQLPKTSAGPREPIFKLTWSSFPEQGWYEYGAQAAGSWAGSGTAQANTSANHGSA
                     QNGTVLTVMGGTPVDQPATSLHTFHFPPTPAASFFSASASDASARARTALRDSLQPTY
                     VGAYRTASIVEDFCLLPRLSPHFGGTHDPYAILVLVGQDASLPSLAVQSTRRGMDVFS
                     FPPLQGPHSYERLSLPLPLAFSGRGTILGCHMATVPVMQYRRLVQQAPNHPLGTIKYD
                     QPMGGVAKPQVQNAKLMHAQALAQKGQPRILITWHLDGRVRLHDVSPHLLLLGEEDSR
                     RGVVLVDPFPTQLSHLTLHVRDHVLHPSMFGMPALDTLQRFPMQIQIDHVQVAWDSLE
                     CVVSLTTGHALHYALGSGTVINTTTSPLVDAMHQMRMDDSPADHVTEFTSLEPLANHE
                     SSGFQPNTLMSLLPGSPTCSALSDVGLYACAYGGMLVVADCRSHDIVVRAGSGNADFF
                     SRQLGSREAKIIEHESSSEIVWQRFSVCRTVSDSILALRLLVGRANGFVTVWSFERGS
                     LESWMGFRSDAMSLGMSGRPVYVDVVGSSGAVASATEHNMQRAELDQAREGVTNNTHD
                     FYLLLAVYPHEARLYDQVTGQRFAQADWPDPALSACIIERQNARMLAVIASNSVFILS
                     LPRLDTVHRVQRHVPPDQEVVAATPRISLERQGDFIEITSGQQLRLWTVFGSLPHGEM
                     PSMFLYTPRSLPLPPGAGASGYIASVASWLGSSAGQSLSAGAQIDTIICGKRRAKLPP
                     LPPRMTLSKDNENTPIASSITEQGAGAKDAPTNSTQTSASGSWLGSYQRQFLNFASSS
                     ARAQAQLNMQLLHKRDEILSDLDESMTNLERGAKDFFKQTRNSALKAAAKDKIKTYL"
     gene            complement(<148416..>152147)
                     /locus_tag="MRET_0082"
                     /note="MRES_03005"
                     /db_xref="GeneID:38736848"
     mRNA            complement(<148416..>152147)
                     /locus_tag="MRET_0082"
                     /product="C2 domain protein"
                     /transcript_id="XM_027626709.1"
                     /db_xref="GeneID:38736848"
     CDS             complement(148416..152147)
                     /locus_tag="MRET_0082"
                     /codon_start=1
                     /product="C2 domain protein"
                     /protein_id="XP_027483255.1"
                     /db_xref="GeneID:38736848"
                     /translation="MTTHHIGEGWSERNKVPTVQEFIEKERLRNSEYFDTPEASEKSS
                     SAANADTGESLNPPVGDGRPSSDLSYLKSTSNKKINSNERSPMIQRPTEENPSHGASG
                     SGDSQGQMHESGPQDPYRQEESSYEDCSSASNAHAQDEQESIKSGSKDKRRFHRSLSL
                     LSRKSSQKSRSQESPARDIEHEHPKESEKSRKHQKVVDSGGGEAEKNRIKEAAKASRE
                     PKKNDFVAKGQRVVEDPVTKDDVIIQDGRDPKINPMELDSRYKGGFSSKRPLNSDVYH
                     SKYINPDPARPTSLLLQRFPEPLDPGKIRELDDLFNMMYIGYGAVVVMVWGVATVGHG
                     WGIFAVRSFWLALAALAGFSGMGLIRNKIVNQMERIRVAMHRQRGEECTPPYPESVEW
                     MNAIIACVWRQLNPEMFIAMLDQVEDIMQASLPSMISSVKISDLGLGENPFRVIAMRG
                     LADLMTDSVHPTHTWIEKADGKKEQVNLDEQDLENLEHSDPEMREQALEDLAGDFLNM
                     EVSFCYAAMPGQSSKDRSKNIHLLIEFFIGAFDWLEIPLPVWVQIERIIGTARIRAQI
                     MSEPPFIRNVTFSLMGVPNVSISAIPILRVLPNVLDLPIISNFVQMSIAAATDMYVAP
                     KSMTLNVHRILAGDGVKKDTDAIGVIVVNIHYGQNLSSQDMNGRSDPYCVLSLAKFGR
                     PMYSTRIIFEDLNPVWEETAFLLISKDDIRSDEGLSLQLWDSDKRSADDIVGRVNIPL
                     RDLVRRPNEMQSHMSDLMGFEDADQMQGQLCWSVGFYEKAHLNKDLRVQPNRDAADDK
                     VDSVVKREPSPIDSEQEALTLDTPPDPEYPSGILSVIVKFVAGLERRDVEKGVNDKDR
                     EGAAGQDVDASSSKLPCGYCELILNDNLFYKTRVKQYTNMPYFQAGTEVFVRNWTTSE
                     LRMIVRDSRVREHDPIMGIVALPLKNLFESSSQVEQMFALQDGVGYGKLSCSIVFRAI
                     KLQIPRELRGFTTVSVDLLSSIDIQGNTPEWTKKLDNVKITLVANKYEHKLGTRYKHL
                     TGEDEPLASVPVFDRYSTNLVFCFGRTPVTSTLPIPDFFRAVGLAILPLRELEDGQMT
                     DVELPILAGPALHALERNFINKQTKATHKFEEVGVLSVRVRVNPGLDDVHKHILAGAR
                     DRHEFEVYERLVGLPNRAEVNSHANDDGVITRSERREMNRLFTRELHMRHRGIMGYTP
                     VRTAVWAKDGLKSHVSSLGRSMFGSKDQRDQYIMSEVGD"
     gene            <153711..>155689
                     /locus_tag="MRET_0083"
                     /db_xref="GeneID:38736849"
     mRNA            join(<153711..153939,153969..>155689)
                     /locus_tag="MRET_0083"
                     /product="fungal Zn(2)-Cys(6) binuclear cluster domain
                     protein"
                     /transcript_id="XM_027626710.1"
                     /db_xref="GeneID:38736849"
     CDS             join(153711..153939,153969..155689)
                     /locus_tag="MRET_0083"
                     /codon_start=1
                     /product="fungal Zn(2)-Cys(6) binuclear cluster domain
                     protein"
                     /protein_id="XP_027483254.1"
                     /db_xref="GeneID:38736849"
                     /translation="MPDYSNQGPECMPNIKDHFFVSINGKYLSLHDARRLGHNLRDAC
                     ETCRKRKLRCSGITQDGSPCHRCTIDQTMCIFATKSKIGRPRKRLHSPGADVPAALLR
                     KKRMEKPYSSTDAFSENSSPTMESSISMLPRSSGFPNDNTPAVLDASTSTLSPASVYP
                     NNGVLSSTLSDLSLAAFVESLYTLEIAPSDGLTSSMLGASEKSAGALYPEQGMVPDPT
                     TNTYFLNEDKSSEQGNWQNQMEFAKSAFLDEHLAFSVPSDMRWWNTAWSLPHSYELLL
                     SSLPDSNKDMNSKLDFMTPPEIPHVSSPTTPQAATFPVSEKLSPRKQAIETSLGPVPE
                     NIGAIPDRKFDLLLPSDSCLHGQCNHTDGMSPSPLTRMSSTRELHATEDEKHCPDKVH
                     CVPSPDGTHCSCTSSSGLSFLSLERSIRSRIQATDHEADKSPEKKALSSLVFTLTMSQ
                     SVSKQCTCSTDCPTCKSSPSYKSSGAILISTALQIYARALQLFHEMLASDGTHTCSCS
                     GPRGTCDAACGCCARATRPDAVQSSMEVRIGDYTPSAQNSRKIALYALKLELLDLERA
                     MARVQRVSMQPLQQRPGTLSAPDTNNASQCCGLAKTQESSEHAASALHLNPFDQLVIR
                     KLHSQLNEALHAVEQMEVQDDHNHS"
     gene            complement(<155711..>157194)
                     /locus_tag="MRET_0084"
                     /db_xref="GeneID:38736850"
     mRNA            complement(join(<155711..156625,156654..156726,
                     156752..157121,157149..>157194))
                     /locus_tag="MRET_0084"
                     /product="ataxin-3"
                     /transcript_id="XM_027626711.1"
                     /db_xref="GeneID:38736850"
     CDS             complement(join(155711..156625,156654..156726,
                     156752..157121,157149..157194))
                     /locus_tag="MRET_0084"
                     /codon_start=1
                     /product="ataxin-3"
                     /protein_id="XP_027483257.1"
                     /db_xref="GeneID:38736850"
                     /translation="MSEVGYEVLLKYIYHEKQEEGSMMCAQHALNAILQGQFFDPSQL
                     AQIADEISEYERNELGICTQDAKNMLSRHMDETGYFSLEVIDRALRAWDMNLVRWRSC
                     KELRERYAYPEREFAFLLNLGHHWIALRGFGHVSRTWFNLNSFYLEPQWLSNIYLSSL
                     LQQAELEQYTVFTVELQAGMDPPATITDDVADAHASRFSEDHSLMMDEDEDFQKALSA
                     SLEEDQANAAQPSTPTGRRRAGQERLDAEEEMHDPLRSRMRHSTGVSTPGSGYRSMRR
                     FGPHDERENTSKTYQRASLSRRNRPKSSHDIEEEGDLASYPSRKSPFLHPIAASLLDE
                     DVEDLAEEEENAHLEFLDDDEAQLQAAIASSLGQPYQVPERILDQTYRTCEMAKESQK
                     IPEDVQRITKLREDALMNTSQRLTSADDLSRAPTISSKTSICRSHNAEPADAGAETST
                     ISTEEMRRRRLARFEGL"
     gene            complement(<157294..>158738)
                     /locus_tag="MRET_0085"
                     /note="MRES_03000"
                     /db_xref="GeneID:38736851"
     mRNA            complement(join(<157294..157376,157411..158686,
                     158727..>158738))
                     /locus_tag="MRET_0085"
                     /product="RuvB-like protein 2"
                     /transcript_id="XM_027626712.1"
                     /db_xref="GeneID:38736851"
     CDS             complement(join(157294..157376,157411..158686,
                     158727..158738))
                     /locus_tag="MRET_0085"
                     /codon_start=1
                     /product="RuvB-like protein 2"
                     /protein_id="XP_027483256.1"
                     /db_xref="GeneID:38736851"
                     /translation="MASMASISTAPVQTTIQTLERIGAHSHVRGLGLDERLEPQDSAQ
                     GMVGQRAARKAAGMIVKIVQNAKIAGRAMLMAGPPGTGKTAIAMGMAQTLGPDVPFIM
                     LSASEVFSLEMSKTEALMQAFRKAIGVRIKEEAETIEGEVVEIQIDRSLTGATKTGKI
                     IIKTTDMETVYELGNKMIDALQKEKVIAGDVITIEKSSGRISKLGRSFACSRDYDAIG
                     SDTKFVQCPEGELQRRREVVHTVSLHEIDVINSRTQGFLALFAGDTGEIKPELRDQIN
                     AKVGEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALETELAPLVVMASNRGQTRI
                     RGTRFTSPHGLPIDLLDRILIISTKPYSEDEIKRILSIRAQEEDVNLKQEALEVLARM
                     AMETSLRYTINLITTAHLAARRRKADEVDVADVRRVYNLFVDEKRSVQYLQEHAAEFM
                     SEEVVS"
     gene            <158878..>159600
                     /locus_tag="MRET_0086"
                     /note="MRES_02995"
                     /db_xref="GeneID:38736852"
     mRNA            <158878..>159600
                     /locus_tag="MRET_0086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626713.1"
                     /db_xref="GeneID:38736852"
     CDS             158878..159600
                     /locus_tag="MRET_0086"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483259.1"
                     /db_xref="GeneID:38736852"
                     /translation="MVESKPSAKPLGFYTKENAAFNVLQNTAITGALGGVTGTVVSVL
                     RASPIQPAIAAYRMVKGWSAFSFGFFAIREYIMQPLTAPVWPMCQQLGHAENIAPSFF
                     SGAVMGMFSALWLRRPVVPGIFTMSGICTAIQLVFNEFKLGLLRFMDESGTIEDESAK
                     QPSSSLPARQPLMPEHSEPTTSKPTLYEQAQLAMKKYSPIQSISDDEYRARLLERQRE
                     IDAQLRLLEEELYERRRAMSIA"
     gene            complement(<159601..>161166)
                     /locus_tag="MRET_0087"
                     /note="MRES_02990"
                     /db_xref="GeneID:38736853"
     mRNA            complement(<159601..>161166)
                     /locus_tag="MRET_0087"
                     /product="glutathione synthase"
                     /transcript_id="XM_027626714.1"
                     /db_xref="GeneID:38736853"
     CDS             complement(159601..161166)
                     /locus_tag="MRET_0087"
                     /codon_start=1
                     /product="glutathione synthase"
                     /protein_id="XP_027483258.1"
                     /db_xref="GeneID:38736853"
                     /translation="MTLASDLPVWPPSELKDSIRNKLISQDARDFALSHGLVYRALPS
                     KPNGEPLQDTTIHAPTTIVPTPFPRDLFEKAQSLQPLFNKLYARVAMDANFLRTVMKD
                     SVIKVDDFQRRLFDIWHTVQEEGASQPVHLGLFRSDYLMHADNRNELELRQVEFNTIA
                     ASFGGLCTFASNMHRHLLRNHAYSNAAPCLHMDNLPKNEAIDTLVSGLVDAHKYYVSE
                     CTNDSRTTAPVILFVVQPKERNAFDQRALEYEIEDKHDINVMRMSLDDLQTKATVHGT
                     NRKLFVQAPLHSTPVEVSVVYFRSGYGPDDYTSNAAWDTRLLLERSHAIKCPNVALQL
                     AGSKKVQQVLSESNILEKYIGSDAHEIRSTFSQLWPLDDSKIGREALAIARSTPEKFV
                     MKPQREGGSHNIYKHDIVPALDAMKKRDEERQARGEDVSVKEHEGYILMSLIDTPKDR
                     GAMMLRAGCGEEAQLMPQTVSELGIYGTILFGTKELEEQRSGGYLLRTKSSESNEGGV
                     AVGFSVIDTPLLV"
     gene            complement(<161351..>162526)
                     /locus_tag="MRET_0088"
                     /db_xref="GeneID:38736854"
     mRNA            complement(<161351..>162526)
                     /locus_tag="MRET_0088"
                     /product="sphingolipid 4-desaturase/C4-monooxygenase"
                     /transcript_id="XM_027626715.1"
                     /db_xref="GeneID:38736854"
     CDS             complement(161351..162526)
                     /locus_tag="MRET_0088"
                     /codon_start=1
                     /product="sphingolipid 4-desaturase/C4-monooxygenase"
                     /protein_id="XP_027483251.1"
                     /db_xref="GeneID:38736854"
                     /translation="MLGFFRRDLHWNKAVPSINIDWSLYGGEERMKAGSDRAATGRPW
                     MPHVSDKPLASDDFLWSLNEEPHRTRRLAIMKAHPEVRKLMGHEPLTKYVAAGVVFLQ
                     LMVALTLTFLGVHPLDWRFILTAYLLGGIANQNLFLAIHEITHNLAFKSIAANRLLAI
                     LVNLPVGVPFAMTFKPYHIEHHKHLGEDGIDTDMPTRLELMVLNNVLGKAFFATFQLF
                     FYAIRPGFVRVQKLTAWHMLNICIQLLFDFMICYLCGSPVPLYYFLMSSFFAGSLHPI
                     AGHFIAEHYMFSNIEQETWSYYGPLNIFTYNVGYHNEHHDFPSVPWTRLPALRKLAPE
                     FYDVLPSHSSWTMVILAFIFSNHSGMNMRVKRQPRFKKLQEPSIEDAPNYTGWEVRT"
     gene            <162646..>163006
                     /locus_tag="MRET_0089"
                     /db_xref="GeneID:38736855"
     mRNA            join(<162646..162887,162916..>163006)
                     /locus_tag="MRET_0089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626716.1"
                     /db_xref="GeneID:38736855"
     CDS             join(162646..162887,162916..163006)
                     /locus_tag="MRET_0089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483250.1"
                     /db_xref="GeneID:38736855"
                     /translation="MVGDSRAEPSRIMPGSFESWLEKVLDSIFQEGVNSATLNFMNYT
                     FYALFAVLTTLFLGSGLNLHVLALLLLAIALCLATNWFVSELYRESLRQKEKSSSKPL
                     PKPDPKSE"
     gene            complement(<163117..>164646)
                     /locus_tag="MRET_0090"
                     /note="MRES_02985"
                     /db_xref="GeneID:38736856"
     mRNA            complement(<163117..>164646)
                     /locus_tag="MRET_0090"
                     /product="NADH dehydrogenase (ubiquinone) flavoprotein 1"
                     /transcript_id="XM_027626717.1"
                     /db_xref="GeneID:38736856"
     CDS             complement(163117..164646)
                     /locus_tag="MRET_0090"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) flavoprotein 1"
                     /protein_id="XP_027482492.1"
                     /db_xref="GeneID:38736856"
                     /translation="MQGMLASRSAGLVCKRRLASVPNGIIRGMATVADAPKRSHGGLG
                     DQDRIFQNLYGHHDFRLKGAMARGDWHRTRDIIDKGHDFIINQMKASGIRGRGGAGFP
                     SGMKWSFMLKPGWEKDPRPRYLVINADEGEPGTCKDREIMRHDPHKLIEGCLVAGRAM
                     GANAAYIYVRGEFFLEAYNTQVAINEAYKAGLIGKNACGTGYDFDVYVHRGAGAYICG
                     EETALIESLEGKQGKPRMKPPFPADTGVFGCPTTVANVETVSVAPTIIRRGPSWFASF
                     GRERNHGTKLFAISGHVNRPCVVEEEMSIPLKELIERHCGGVRGGWDNLLAIIPGGSS
                     TPMIPQEVCEKALMDFDSLRDNQTALGTGAVIVMDKSTDLIKAVSRLTKFYQHESCGQ
                     CTPCREGTSWLASMMTRFESGRASLREIDMMWELTRQMEGHTICGLADASAWPIQGLL
                     RHFRPRVEERVKEFVAQNGTVLYGGRLASERRPDLAIPGNMSFPDRTTKDNYQPGLHS
                     A"
     gene            <164880..>166013
                     /locus_tag="MRET_0091"
                     /note="MRES_02980"
                     /db_xref="GeneID:38736857"
     mRNA            <164880..>166013
                     /locus_tag="MRET_0091"
                     /product="SURF1-like protein"
                     /transcript_id="XM_027626718.1"
                     /db_xref="GeneID:38736857"
     CDS             164880..166013
                     /locus_tag="MRET_0091"
                     /codon_start=1
                     /product="SURF1-like protein"
                     /protein_id="XP_027482493.1"
                     /db_xref="GeneID:38736857"
                     /translation="MVLSLWRRPMWRLMRHVHLRGAAPIGLRCAPQPARAFSVLLPNA
                     FPQPTPRTPPHNLPVAVPEGEQSGEPLIYNRPQRKKQRPWYKSPALYALAFLQCLAMY
                     LGFWQLRRLDWKLALIDELEEKLRCDPLRLPRNVNMNVLHEFEYRLFEVRGHFDTSRA
                     LFVGPRTYENERGYHIVMPFKRASGGPDILVNRGFVSNDNIVGTGMEKRLRHPLKEDA
                     NERSIVVLYPRVYPPGRFGLPNEPEKNVWLQLNPGQMAHWLNEQAGVQDVIATENTPK
                     ESHFYGMLRRLTAPPTQESVTPQEAFQRKQSQPVIPIYMEEIFGGTYGEAAVLLNEGI
                     PVGRPARIELRNQHAEYAMTWFSLSAITTFMFIFMLRKGRGTS"
     gene            complement(<166021..>168609)
                     /locus_tag="MRET_0092"
                     /note="MRES_02975"
                     /db_xref="GeneID:38736858"
     mRNA            complement(<166021..>168609)
                     /locus_tag="MRET_0092"
                     /product="exocyst complex component 2"
                     /transcript_id="XM_027626719.1"
                     /db_xref="GeneID:38736858"
     CDS             complement(166021..168609)
                     /locus_tag="MRET_0092"
                     /codon_start=1
                     /product="exocyst complex component 2"
                     /protein_id="XP_027482490.1"
                     /db_xref="GeneID:38736858"
                     /translation="MSLSVNENELLQAYELNSINPTKWEDVKRQNLGHTGDLAYSHGE
                     DWSDPLGLRSTLPTARSDEADILSKINISSKMFDAKSFLNTVHPNATYPELSQGAAHL
                     KKTMVQRSEALRVLVDQNFDRFVTVKATNDNVFREMSESVGSPFGAGPDEGVKALRAS
                     LAGASAQANDVFRPILENYAKSSKLRNTLGVFQRSHFFFNLPGSLHESVEAGNYEVAL
                     RDYLKGKYLLENRPGQILPIQNESNEPPTESQLAQQRRIFARVWDAVDDIMYDMQGKL
                     VDILREPHRSVEEQEKCFEVLLCLDPSTDPVAIFLESQHAHILTLLRSTIEHQTRAIQ
                     PHITSSPTEYSDLERAKDLHECLVLVRTSYGSRPSFEKELGAPHWQSIENMVSELCRV
                     TLQSMPVFWRIAQGHASGKYTKEAAILSSSIHTQSKAWAVECVALFVQSLRRFFSLES
                     FRLRASKPLMAQLPSWVPHPCSSLCTTHYMNSILNTIADAVKELKALSIPGTSAQLQE
                     LLLDVRFQFTEVHCFQWLQDACVCHYLENWVPNSQQPSITSYLFSFSVFNRWNAREGF
                     YLGDVRSKQGTTKDDVDNLFVSRLKDTFVQVLHTFLEGLVRAAQSEHDVPELRTLMRK
                     YHEAYTTQPRDRDTRILLSISNLSHLRSHVIGAWIKQFEDAYHVKLTTEQTRLLDTCT
                     RIDNELLSDSVRRKGQCVQEIVRQGILESGMKWDQCPHPSNVSPFVYQALLQLVQVHA
                     QIRATVPSLVSRVIAALVEIMADAILDAYCRIPAFNTGGMLQATLEIEFVHQTMSFHV
                     SPKAESTLKHVYDTISQRYSASAQGQKPADMKKDLESVKHTLIASRKATALAFLCFRR
                     PKTTGT"
     gene            complement(<168710..>170302)
                     /locus_tag="MRET_0093"
                     /note="MRES_02970"
                     /db_xref="GeneID:38736859"
     mRNA            complement(<168710..>170302)
                     /locus_tag="MRET_0093"
                     /product="26S proteasome regulatory subunit N5"
                     /transcript_id="XM_027626720.1"
                     /db_xref="GeneID:38736859"
     CDS             complement(168710..170302)
                     /locus_tag="MRET_0093"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit N5"
                     /protein_id="XP_027482491.1"
                     /db_xref="GeneID:38736859"
                     /translation="MSQEKQEADYTAEVDTLLPQLEKLTSSGLLQEALDLVIPLEKKA
                     RGASDVLSTARLLLTSVLMIRTTPDVAHTDVEKLCETIHSFSKKHGQSKFAIVRMIQL
                     TMLFLQASDTSDMRAPTSLYAIIGKDSLQTQDVAMESTEATENMAVDEESKKADSKPS
                     NDDELDREGKEDDRITALMRHARAIGDTSLNDAAKMKIMQTLRDITAGKVFLEVERAR
                     VSRCMSDMLYAKGEVDKAADTLQDLAVETFGSLSRREKVEFILEQMRLNVERTDMARA
                     NMLSRKVNTKFFEDEEQQSLKLLYYELMIQIGVHDGRYLDVCKYYREVLNTPSIRSDE
                     EKSKDVLRHVIIFLILSPFDNEQSDLVSRVESTESLDMVPEYKSLLKCFTTPELMRWP
                     GIEALYGPMLRQLAVFSGSPEAEERWKQLHARVVEYNIQVVAKYYTQIHLERLAQLLD
                     LPLDKAEEALADLVVKKTTHARIDRPAQIVNFQSPMTDAEVLNHWSNDMSKLLQTIEK
                     VSHLVEKEWAIQRAGLVVKANE"
     gene            <170464..>171498
                     /locus_tag="MRET_0094"
                     /note="MRES_02965"
                     /db_xref="GeneID:38736860"
     mRNA            <170464..>171498
                     /locus_tag="MRET_0094"
                     /product="adenosine kinase"
                     /transcript_id="XM_027626721.1"
                     /db_xref="GeneID:38736860"
     CDS             170464..171498
                     /locus_tag="MRET_0094"
                     /codon_start=1
                     /product="adenosine kinase"
                     /protein_id="XP_027482496.1"
                     /db_xref="GeneID:38736860"
                     /translation="MVLTENLKLVALGNPLLDMQVRDGQEVLQKYGLKSNDAVLASPE
                     QLSIYGHLVENYQVTYVAGGAAQNTARCAQYVLPQDSTAYLGCVGNDDLAQQLRAANE
                     REGVQSVYQVVNDTPTGSCAVVITGHDRSLCTNLGAAEKFAQSHLESADAKAVIEAAK
                     FFYLGGFFLTHGVESALALAKHAKDTGKTFSMNLSAPFIPQFFKSQVDQVIPYAGLVI
                     GNESEAEAWAKASGLDTTDLNVIAQKIADSPSELSKPRTVLITHGAESTIRAVQGASS
                     THTHPTPKVDAANIVDTNGAGDAFAGGVIAALILGKSMEEAVDVGHRLGGMCIGQVGP
                     VLKFPKENVL"
     gene            complement(<171728..>176506)
                     /locus_tag="MRET_0095"
                     /note="MRES_02960"
                     /db_xref="GeneID:38736861"
     mRNA            complement(<171728..>176506)
                     /locus_tag="MRET_0095"
                     /product="transporter"
                     /transcript_id="XM_027626722.1"
                     /db_xref="GeneID:38736861"
     CDS             complement(171728..176506)
                     /locus_tag="MRET_0095"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_027482497.1"
                     /db_xref="GeneID:38736861"
                     /translation="MSHPQEPIDEKYDGNLSSPPDSGKIPEKYQPFSDEDEFLMDNQH
                     PKSRTGDTGVKREDRQGNQKFGVRVREHWWQLWRFKNAPPPPPESLDDAKELPLGRAN
                     IFSDYTYHWIGSMLLLGYRRPLEATDLWAMDGPRQAEHLSNKLVQCWEARVAKADKQN
                     EKFRNGQAKPSASMYRKWKSQAKKEYEEKVGGEASVEERLAAKEAIWSMPDFSVLKQI
                     EITSEMRRKKELAGSVKSGQKRANLFMSCFDIFWPHILEAFLSKLLADVAQMCSALVI
                     EQLMGAIRQEKTGLACGYSVVMFVMLVIGNILSNRFFYKSLYVGVFCRAALVSGIFRR
                     ALNMQGRDRSTGKLVNHISTDVSRIDFGAQWWLLAFTAPVEIIVCLIILLTRFGVSCL
                     SGFALIVVVMPFQMFYMLFLFTLRAKSMQWTDRRARRTQEVVSGMRIVKLFSYESNFF
                     KLISDLRKHELKYIFYLAVARSGLMASAISLPLLSSVLAVITYYFKKNRLDLEDLEKV
                     FPAITLFQLLRLPLMFLPFGLSVIADGWNSFMRLRDVFYAEQHDTTLHSDESSPYGLF
                     INDATFLWESVEEDETLKPVKKLNEKSSKRQAKHKRLWARLLRNRKSKPAKSGKKFKF
                     LRRKDKVSAAEVAADEGVPVTSVPDKMPDEVIETPFQMENVNLKVRRGELCAVIGPVG
                     SGKSSLILGAIGEMSRSAGDVIWSSQRVAYCAQSAWIQNATIRENIVFGQPWNAKHYW
                     DCVKRAELFADFAILQGGDMTEIGERGVTLSGGQKQRINIARALYFDADIICLDDPLS
                     AVDAHVGKALFNNAILPLRDQGKTVILVTHAIQHLPRCDRIVLMDDGRIDETGTYEEL
                     MSLRGSFFNTMYNFGMLKDQEEDADELAAEEEDSKAPAKKYTLADLSKPGFGKTTESE
                     ERNTGSVDGHVWLSYIRAGKGWLVVPIVLVAGACMQASTNLSSYWVIWWQEWEGEKAD
                     QKARDVPVTTNKSIGLEAGVYAALGIIQLLFNFVMDVALGVMTFLASRRLHDNGMRRV
                     IYAPMAWFDTTPLGRIMNRFGKDIDVLDNQLSNLVRQCASTVLSILGASIMVIVFTYY
                     FAIVVVAVFVFAYFFSTFYRSSAREFKRVDALLRSTLYSHFAESLSGLTTIRAYRESD
                     RFLHDNYKYMDLQNRAYFLTIVNQRWLGLRLDVLGSVCVLITGLLCSNRVGTINSGTS
                     GVSLSQVVTVAQTLGFLTRQLTELENEMNSAERVVYYAESLDQEPAQQIPENKPDAAW
                     PSHGKVELNNVWLRYRPNLPPVLKGVNFTVNGGEKVGIVGRTGAGKSSILTVLLRLAE
                     ATEGTVRVDDVDVSKIGLEDLRRSIAILPQEPLLFSGTLRSNLDPFERFDDARLWDAM
                     HRAYLTSASNASEPGTGTVTPNPDATTPNNPQATQEQEPKSLTRLTLDSIIDEEGANL
                     SVGQRSLVSLARALVKNSKIILLDEATASVDLETDTKIQRTIRTEFADRTMLCIAHRL
                     STIIGYDKIIVMDDGKVAEFDTPLNLFDTPDSIFRGMCERSGIIRNDIVSARSLVTSA
                     AANQASAQDHSMTEHVHTTVLNQQPVMYPPPPQQPDNSKE"
     gene            complement(<176878..>177975)
                     /locus_tag="MRET_0096"
                     /db_xref="GeneID:38736862"
     mRNA            complement(<176878..>177975)
                     /locus_tag="MRET_0096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626723.1"
                     /db_xref="GeneID:38736862"
     CDS             complement(176878..177975)
                     /locus_tag="MRET_0096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482494.1"
                     /db_xref="GeneID:38736862"
                     /translation="MSFTLPPPLKQQLSLYRDSLNGQIDAWAAEYHVNPAAIRRFLGF
                     SREFGRQPNSWNLYQRYLAEQKRKSANGDPTALDLTGAQGIRSDSSATQAQRIRDELA
                     PLYQKMKEDPEFMLRTQQDINAWEQDNRIEKSGTITRAEYKRAVRRFEQFSQQCSQNL
                     GAESFTIIAHPNIGSNHVQIAASTAGLHAFQTALGPGKPLETFQNRFAACICLTIAPT
                     DDPTVLERDARLDVQVPLQPQEPIILPEDPTLLTSIQKRKLATPLFQRLVESGLDPVE
                     LANFRKKSQSRFPWKGLMTWLHENGYRFNYWPNDSTLYGIRHTTGEAALLPAHLRCEG
                     LNTPNCWKSDAMNAILRACVDPTDPLRVVRL"
     gene            <178149..>179094
                     /locus_tag="MRET_0097"
                     /note="MRES_02955"
                     /db_xref="GeneID:38736863"
     mRNA            join(<178149..178169,178197..178844,178876..>179094)
                     /locus_tag="MRET_0097"
                     /product="transcriptional regulation protein GF11"
                     /transcript_id="XM_027626724.1"
                     /db_xref="GeneID:38736863"
     CDS             join(178149..178169,178197..178844,178876..179094)
                     /locus_tag="MRET_0097"
                     /codon_start=1
                     /product="transcriptional regulation protein GF11"
                     /protein_id="XP_027482495.1"
                     /db_xref="GeneID:38736863"
                     /translation="MDPKRIFESRLLDSLINEVVVSVALEVHSRAKRAKMDCPKCDKP
                     EPAHDVSDPASLVHGTKTDYYSNNPLFECLVCSRQVSSNRYATHLEKCMGIGSKSLRK
                     GSARNAKTASTAVTQRLLNTNSRSASPASSTTSTQRKQGASPAPAASKDKAKKTESPG
                     PLAKQIGNTSGAQAPKSEVAKRVDTLIPPKPSVSTPQTDSGSAPGQHDDDMLDEADFP
                     SFSLSSDTEDSGGASDAEEVTAAQAALDDNVEDIEFDLDEEDGSDNNDVEVDVIGVIE
                     SDAGVDDDDDDDDDDDIGV"
     gene            complement(<179095..>181227)
                     /locus_tag="MRET_0098"
                     /note="MRES_02950"
                     /db_xref="GeneID:38736864"
     mRNA            complement(<179095..>181227)
                     /locus_tag="MRET_0098"
                     /product="aarF domain kinase"
                     /transcript_id="XM_027626725.1"
                     /db_xref="GeneID:38736864"
     CDS             complement(179095..181227)
                     /locus_tag="MRET_0098"
                     /codon_start=1
                     /product="aarF domain kinase"
                     /protein_id="XP_027482487.1"
                     /db_xref="GeneID:38736864"
                     /translation="MRVQFGSALARRPSLLGDVWRQRIPRINACVAHAGMRTATQSRP
                     TRVIRLGALGVVGGMGILTYSFLQWRFLQAPPKDPHEKEQEISSIPAPSPSPKPIVLR
                     VWHAVSLYVIEPLLVCKRFILLALIFAPVVLATPLLFVGTVSTYKDQDGHLVESDRWG
                     ALLWYRLLVSQMEMAGPTFVKLGQWAGSRRDLFPDELCNRLSKLHSNNKPHSVAYTRR
                     VLERVFQRPFDEVFATFDEKPVGIGAVGQVYKAVLHQHLLPLDYVEDTNDQNRLHVAA
                     ENIGRELALTFEHDQSTHQHGAAVAIKILHPNVHRIIRHDIKIMQFFAGLLNALPGMR
                     WISLPEEVEQFAQLMVSQLDLRQEASHLSRFERNFAGRGGTVVFPRPLHAFCSQDVLV
                     EELIEAVPLKHFMHMGSGAYDSRIAEMGLDAFLSMLLIDNFTHADLHPGNIMVKFYRP
                     SMRSLLQNILSRILYRFDPDYVLGHRNRTGIIPDDQVAQKLVSCSQHPDDWHAMIHNI
                     QEDGFLPELVILDAGLISELSPKNLQNFMDLFAAIATLNGRQAGALMVERCRTPELVT
                     DKEGFVNAMEGIISNVASGGFSLAALDIGHVLNKALKAVRKYHVKMEPDFVNTVLSIM
                     ILEGIGRRLDPNLDLFRNAIPILRSLGHKMSSDEAQLATLRDRMSVSTLFPMLKLWFF
                     MECRSLFLAPQNAPQIVDAFIRYGWLSE"
     gene            <181386..>181844
                     /locus_tag="MRET_0099"
                     /note="MRES_02945"
                     /db_xref="GeneID:38736865"
     mRNA            <181386..>181844
                     /locus_tag="MRET_0099"
                     /product="nucleoside-diphosphate kinase"
                     /transcript_id="XM_027626726.1"
                     /db_xref="GeneID:38736865"
     CDS             181386..181844
                     /locus_tag="MRET_0099"
                     /codon_start=1
                     /product="nucleoside-diphosphate kinase"
                     /protein_id="XP_027482488.1"
                     /db_xref="GeneID:38736865"
                     /translation="MSNEQTYIMIKPDGVQRGLVGKIIQRFEDRGYQLVAMKLVQAGE
                     DHLEKHYKDLKGKPFFPGLIKYMASGPVVAMVWQGKDVVKQGRALLGATNPLASAPGT
                     IRGDFCIDVGRNICHGSDSVESAKAEIALWFGEQDATISYPRAVDQWIYE"
     gene            complement(<183047..>183972)
                     /locus_tag="MRET_0100"
                     /note="MRES_02940"
                     /db_xref="GeneID:38736866"
     mRNA            complement(join(<183047..183134,183158..>183972))
                     /locus_tag="MRET_0100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626727.1"
                     /db_xref="GeneID:38736866"
     CDS             complement(join(183047..183134,183158..183972))
                     /locus_tag="MRET_0100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482780.1"
                     /db_xref="GeneID:38736866"
                     /translation="MEASRVWEEVVLLRSTLLPDEFQWRGTADENQTWEDTLTAYQNG
                     EPPAFLPAQVHLSLCVSKLLGVWIHAKLDEHQIRPHISVFVQRTDAISQATLADMVRE
                     RLDECEAQDLLHPTFDVLSLLQETMPEQVPTLEQASCSDERQANASSLTMKRVIFWSH
                     HLVAPSKRRQFGAWCPELGVWGLLKLGYPGFLCFEGACCDVDDMVWRVKRMQWAAISM
                     RTEVSWTFTRPETTHDTTLDAALRSCALAKGRCMQDKLRTDAMELDSMSDFVARLRSM
                     ELSENEISDACHLRTAQEGGGKNS"
     gene            <184005..>184349
                     /locus_tag="MRET_0101"
                     /note="MRES_02935"
                     /db_xref="GeneID:38736867"
     mRNA            join(<184005..184051,184082..184191,184225..>184349)
                     /locus_tag="MRET_0101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626728.1"
                     /db_xref="GeneID:38736867"
     CDS             join(184005..184051,184082..184191,184225..184349)
                     /locus_tag="MRET_0101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482781.1"
                     /db_xref="GeneID:38736867"
                     /translation="MTKKYYEGSPKRMALTWGVMLAAAFTGFFYVKSANRMRKKEYIA
                     VQAQTDEGERKHISKEFLGSLESNPRDKTPIQMLMMSLERQWNKSVSGK"
     gene            complement(<184360..>184918)
                     /locus_tag="MRET_0102"
                     /db_xref="GeneID:38736868"
     mRNA            complement(join(<184360..184452,184481..184497,
                     184524..184641,184667..>184918))
                     /locus_tag="MRET_0102"
                     /product="glutathione peroxidase"
                     /transcript_id="XM_027626729.1"
                     /db_xref="GeneID:38736868"
     CDS             complement(join(184360..184452,184481..184497,
                     184524..184641,184667..184918))
                     /locus_tag="MRET_0102"
                     /codon_start=1
                     /product="glutathione peroxidase"
                     /protein_id="XP_027482782.1"
                     /db_xref="GeneID:38736868"
                     /translation="MVTFYDLKAAMPQGKSFDFAQLKDKVVLIVNTASKCGFTPQFEG
                     LEKLHKTYSPRGFTVLGFPCNQFMSQDPGNDESIGSFCLLNYGVSFPIMAKSDVNGDN
                     ANEVFKFLKHAKPGLLGSEMIKWNFTKFLVDRQGNVVERYAPTTDPKDIAKDIEKFL"
     gene            complement(<185006..>186158)
                     /locus_tag="MRET_0103"
                     /note="MRES_02930"
                     /db_xref="GeneID:38736869"
     mRNA            complement(join(<185006..185033,185061..185134,
                     185160..185313,185338..>186158))
                     /locus_tag="MRET_0103"
                     /product="ornithine carbamoyltransferase"
                     /transcript_id="XM_027626730.1"
                     /db_xref="GeneID:38736869"
     CDS             complement(join(185006..185033,185061..185134,
                     185160..185313,185338..186158))
                     /locus_tag="MRET_0103"
                     /codon_start=1
                     /product="ornithine carbamoyltransferase"
                     /protein_id="XP_027482783.1"
                     /db_xref="GeneID:38736869"
                     /translation="MFLSLASPIRCGASRLTSTCAKAYVSTNAHGVPSLMTLADVRTE
                     QIDRILQHSAALKHKARHTALGLSGIESSLTKKTIALVFSKRSTRTRVASESSVAALG
                     GHAMFLSPSDIQLGVNESLYDTAHVVSSMVDGIMARVGSHDEIEMLAGNSRVPVINAL
                     SSRFHPTQILADLLTMLEADGQKSCKALAGKKVAWVGDSNNILNDMLVTYPRLGMHLS
                     VAAPQGPAYACDPIVWDLMQKGLEELPSDQPRGHVEWCHDPLRAVRDADYIVTDTWIS
                     MGDEAQKEQRLRDFAGFQVTNDLARQGKAKLDWKFMHCLPRKAEEVSDDVFYGPHSMV
                     FPEAENRKWTIMACFDWLFGRRAL"
     gene            <186245..>186479
                     /locus_tag="MRET_0104"
                     /note="MRES_02925"
                     /db_xref="GeneID:38736870"
     mRNA            join(<186245..186251,186279..186418,186444..>186479)
                     /locus_tag="MRET_0104"
                     /product="small EDRK-rich factor"
                     /transcript_id="XM_027626731.1"
                     /db_xref="GeneID:38736870"
     CDS             join(186245..186251,186279..186418,186444..186479)
                     /locus_tag="MRET_0104"
                     /codon_start=1
                     /product="small EDRK-rich factor"
                     /protein_id="XP_027482784.1"
                     /db_xref="GeneID:38736870"
                     /translation="MARGNAREIARAKNQKKQADMNKGKSNDSGLTLAQRRERDAAAL
                     RAKQEAAAAKKGAQKS"
     gene            complement(<186485..>187261)
                     /locus_tag="MRET_0105"
                     /note="MRES_02920"
                     /db_xref="GeneID:38736871"
     mRNA            complement(<186485..>187261)
                     /locus_tag="MRET_0105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626732.1"
                     /db_xref="GeneID:38736871"
     CDS             complement(186485..187261)
                     /locus_tag="MRET_0105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482785.1"
                     /db_xref="GeneID:38736871"
                     /translation="MPPPRARAIQRALGVPLTAAARLAVDLVLVMTQSRTAVLIDTCA
                     LSIARVQALAEVCRGEDILLVVLAQQVFVVHRRAFGAKWERDDTCVYVDPRHPQQKAA
                     RSPGTHAILACIYDACTQDTRSCMIVGRDVRAHSIAACGWLLDYPVVYTCATGATDVR
                     CVPLTEAHWTDGWDTEALTVTDLSLLLVEVQLHSTSLPQPHPVLAYTVPTQMPDAHAI
                     VAAANHRMLAHGAARRWLEGLGLVEFRIHSSHVHMDRIAL"
     gene            <187309..>188229
                     /locus_tag="MRET_0106"
                     /note="MRES_02915"
                     /db_xref="GeneID:38736872"
     mRNA            <187309..>188229
                     /locus_tag="MRET_0106"
                     /product="protein FRG1"
                     /transcript_id="XM_027626733.1"
                     /db_xref="GeneID:38736872"
     CDS             187309..188229
                     /locus_tag="MRET_0106"
                     /codon_start=1
                     /product="protein FRG1"
                     /protein_id="XP_027482786.1"
                     /db_xref="GeneID:38736872"
                     /translation="MPPGGSSLRLTFKGDKPKRKRKTQDGASRKRAAAVDDESDAEMY
                     GGDEQAWVTPDVRDEVTGPCFVHQRREDGSAIVLSFNAPLSQVETSKVEVPSISIDGE
                     GDGPTIAGVEVTPQTVHQVWVATSLPESDKWTMRSAQGTFLAADKYGDVTATNEARGP
                     HEEWTLWRVDPVPCDDAYTIPGPRAGYAFQSKHGGWLATDDTSEQRKRLVRADATDVS
                     GACVWDIRVQWRFRHACRKAKRGVSTSGSTSLVDEAQLARSRQGWTAGAAHHVPPASR
                     RELLRAQREGRLAEAMLDRRSQLKSDKYTK"
     gene            complement(<188230..>189699)
                     /locus_tag="MRET_0107"
                     /note="MRES_02910"
                     /db_xref="GeneID:38736873"
     mRNA            complement(<188230..>189699)
                     /locus_tag="MRET_0107"
                     /product="6-phosphofructo-2-kinase/fructose-2,
                     6-biphosphatase 4"
                     /transcript_id="XM_027626734.1"
                     /db_xref="GeneID:38736873"
     CDS             complement(188230..189699)
                     /locus_tag="MRET_0107"
                     /codon_start=1
                     /product="6-phosphofructo-2-kinase/fructose-2,
                     6-biphosphatase 4"
                     /protein_id="XP_027482787.1"
                     /db_xref="GeneID:38736873"
                     /translation="MAPPLYTTQTGRLWHAGQILVVTVGVPGRGKTHLAHAIQRYLRW
                     MGVKCSVYNLANVRRSMLGPLAELPEDYFSYTKDNAEVVKLRDQAREMHENAIAKFFE
                     QGGQVAVYDANNSNKERRNMIRGRFSAMGVQIMFIECVCDDEEMIERSIRSMHSFNPD
                     YEGWKLRDIKASFRKRIEQHEKVYEPITNNALPHVQLLNFGQRIVVNNVQGYLQNRIV
                     FFLMNIHNQERTIYFARTGESLVEHIYKADAELSSLGYQYANRLCDFIRTLRSKDRRS
                     RIDDSTTPSQQHTLSFITSSGSTELKNTFDAGGDETRELQVWCSTRKRSQNTADVFRQ
                     HHIRVLEMAQLCELKPGVVDGMSEEEILARFPHYREEQANDPYSFRFPRAESYHDLAI
                     RLEPVILELERARKDVLIIGQPSVLRCLIAYLQGNKPQEIPFIQVREGDLVEIRPQAF
                     GLATRLFSFWDPEKERKERDIRFAVRAAMVVSQKDEQDK"
     gene            <189799..>190787
                     /locus_tag="MRET_0108"
                     /note="MRES_02905"
                     /db_xref="GeneID:38736874"
     mRNA            join(<189799..190597,190625..190641,190671..>190787)
                     /locus_tag="MRET_0108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626735.1"
                     /db_xref="GeneID:38736874"
     CDS             join(189799..190597,190625..190641,190671..190787)
                     /locus_tag="MRET_0108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482778.1"
                     /db_xref="GeneID:38736874"
                     /translation="MSMSNVARVLAGAAGVTLATLAGLLYIYQTALIYPASLPEGSRA
                     IVDSPALYKLPFTEHRLVTPDRIKLHVYAMTHDDESEKRPTILMLHANAGNMGHRLPI
                     AQQFFYRLGCHVVMLSYRGYGLSTGEPTEPGLRIDAQTTLDWIREHPKLAGTPVIAYG
                     QSIGGAVAIDLAARNPQTVRVLMVENTFLSIPKLIPSVLPILRYFTFLCREVWPSFQS
                     ITKIPSSTAVLFLAAKKDEIVPHEHMIELHRLCSSPQKEFHVFEHGTHNDTWLDEKYT
                     DTIALFLNKHKTMWDPPQAVWQDTHDDDERKSFL"
     gene            complement(<190807..>191018)
                     /locus_tag="MRET_0109"
                     /db_xref="GeneID:38736875"
     mRNA            complement(join(<190807..190850,190878..190976,
                     191009..>191018))
                     /locus_tag="MRET_0109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626736.1"
                     /db_xref="GeneID:38736875"
     CDS             complement(join(190807..190850,190878..190976,
                     191009..191018))
                     /locus_tag="MRET_0109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482779.1"
                     /db_xref="GeneID:38736875"
                     /translation="MFAGAPTPSPLELAISRVQARKTLRSFAMIVGVLHFAPYLFHFV
                     GNLCRK"
     gene            <191161..>194455
                     /locus_tag="MRET_0110"
                     /note="MRES_02900"
                     /db_xref="GeneID:38736876"
     mRNA            join(<191161..194274,194302..194381,194410..>194455)
                     /locus_tag="MRET_0110"
                     /product="DNA repair protein"
                     /transcript_id="XM_027626737.1"
                     /db_xref="GeneID:38736876"
     CDS             join(191161..194274,194302..194381,194410..194455)
                     /locus_tag="MRET_0110"
                     /codon_start=1
                     /product="DNA repair protein"
                     /protein_id="XP_027482688.1"
                     /db_xref="GeneID:38736876"
                     /translation="MRGTVRRRDEEEDTMVRDLELFSKRARLNTPASATDIDEERAPS
                     PDTHSMPPEASTMGVIERVDMINFMCHRNLSITLGPRINFIIGHNGSGKSAILTAITV
                     TLGGKAQTTSRGSSLKDFILEGAQAAEVRVRLRNGGSDAYRPDLYGDAINIERRIHSD
                     GSGSWKIKNADGKTISTKREELDAICDHANIQVDNPMNILSQDAARQFLGSSQPEDKY
                     SFFLRGTQLTQLAQEYELIQTNIQRMKRAIALTEDILPELERDAREANAKWRLIEQAR
                     AEQEKLDALKEELVWSQVIAKEKVRASLEEKLEHARMKQSAIQQRRDEDALRAKGLDD
                     TVSEYEARSRESNEREIHLKEQRAQVTHTVKEYRASLLALKTRERELNEQADRVKLSI
                     RQIQSQMDAEARRQVQDRRALRDAQAAERDERIRERLHVERQQLELSQADESLHAKFM
                     GLRAERARLTTELHTYDDKISNLQRFVVRCNAAASNRVTAFGGPEITQVLSAINHETR
                     WKERPYGPLGMHIRLRDRRWAPVIESVLADPLNAFVVTNHHDRALLSRILKTYHASNQ
                     IITAARDLFDYSHGEPEASVLTILRVLETDEHILRVLIDGHRIEKSALVPERVLGDQL
                     MRRRLPNVLQCYSADLFKITGGATSSVTQTVTRYTGVPRFAVDHTSELEEAHRAIAQH
                     DASRSQVQQSLSELAEQETQLKSEQMRNQQQVEATRQEHRKLRQRIAQLEETMRDDEP
                     ANVVALEEARAEADVEMARIVERFKQTEGEKETAEAALAPHAAKLDHLTEQIHLLEEH
                     RMQYETELQKTYTERVRLQKTQEHWSRQLDAQEALIGETQRELASLNELIGSWTQMAT
                     DYCARVETQRTPASLEEQIRAIETQMQQDEACSGQSVEDVIRELRAKNKAYQEARQKL
                     EQTHTTIRLLESAIQLRLEKWHYFRRFVAIRARANFSMHLQNRGFSGSLHFDHNAQTL
                     KLRVQTGDTDTSHDKDPKVLSGGEKSFATICLLLSLWEAIGCPIRCLDEFDVFMDAVN
                     RQVSMKMIIDAARASLGVQYLLITPQNMSQVSLGPEVQVHRMQDPERRS"
     gene            complement(<194458..>195747)
                     /locus_tag="MRET_0111"
                     /note="MRES_02895"
                     /db_xref="GeneID:38736877"
     mRNA            complement(<194458..>195747)
                     /locus_tag="MRET_0111"
                     /product="2-dehydropantoate 2-reductase"
                     /transcript_id="XM_027626738.1"
                     /db_xref="GeneID:38736877"
     CDS             complement(194458..195747)
                     /locus_tag="MRET_0111"
                     /codon_start=1
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="XP_027482687.1"
                     /db_xref="GeneID:38736877"
                     /translation="MHVHILGVGAVGTLIATHLRAAVRQGLMMRAFPPRSPVRSAVAA
                     HLPDAAKTTITLHMREKAFARSSPVFRELRVNHDGACMSERGYAVELVSPIDPAQPQV
                     LLPDKDGMAREWPGAEPYPLDSLIIMTKADATYAAIRSLVPRIAPSTTIVLLQNGMGV
                     LDMLLERLWPQPHSRPHFVLASTTHGCYLKKPLHAVHAGFGSIHLGIVPSLRLRGLES
                     RSGELDWHALPEDSLRQTLALLLSLPLDVHWEPIRSYQLRVLRKLAINACINPTTALV
                     DCKNGDLFGTPAALELFRVLCTEMSQVLEAYARDAKAAESSNETEAAHLSSLPLADLL
                     TQTDSEGLPLLDASLKPASLLHEVENVVRATASNWSSMHQDIKTRRGKTEIDFINGYI
                     TELGRAYGIPTPANDMMTNLIKLKAQRVTGSWNANAM"
     gene            <195838..>197844
                     /locus_tag="MRET_0112"
                     /note="MRES_02890"
                     /db_xref="GeneID:38736878"
     mRNA            <195838..>197844
                     /locus_tag="MRET_0112"
                     /product="subunit of the DSC ubiquitin ligase complex"
                     /transcript_id="XM_027626739.1"
                     /db_xref="GeneID:38736878"
     CDS             195838..197844
                     /locus_tag="MRET_0112"
                     /codon_start=1
                     /product="subunit of the DSC ubiquitin ligase complex"
                     /protein_id="XP_027482686.1"
                     /db_xref="GeneID:38736878"
                     /translation="MMRRTVRPWLCCLSWLVCLAVVHFADASSLSERLDALQARRMRL
                     IHERAELEGYLQGNVTQQGAFRPVREQDPRLDRALHDMELEAHPFYPNVSGFYHGHLS
                     AWNTSRLSWDQVQERGLAEWNNTVIQPYFRAYGVTDQASHIRGGFSLPVPWINGSLDD
                     TDIQLVGVHDIRHGMLYLVGMPVTAKAVLDIRNVLAMIPETQAAFRNDAGKACLNDIN
                     MRIQRIDEAMTSPYTISIPDPDPSASSNCTMQLYAKLSPEDLDQRELNTIEHELREPS
                     GIVTRPAPRLHMKVLGISTRCGMYLETDSMVGISRAQYWSDVRYYIAGMICVLLMQLV
                     LMTREMERTQTHTAISRISGLSMFIHSLFDACMSLAHFILGLALPGSYAPGFFSIAFM
                     QAVLFFVLEFRLYAIVTKQRMESHRGTMQRVDSLSDDDDNSFDSLLDEPTLRHYVDNG
                     YRRLRRALHRVPRMFFLVSWLMAVIFFANVAPILYTLVAVSFLMSFWVPQILHNIRQR
                     STGFHTSTIIGMSMARCYVPLYLYQDFFNPLPLESTPWFWLLMGWCAAQTLFLVGQNM
                     GGPLFFLPYSWRHSEKDWNWHPSKEALAAMLSHTHDEEEAAVDPLSIPLGDCPICLMP
                     TSWDDESVMVAPCHHVFHKECLLPWLDIKQICPSCRLPLPVYNK"
     gene            complement(<197859..>200924)
                     /locus_tag="MRET_0113"
                     /note="MRES_02885"
                     /db_xref="GeneID:38736879"
     mRNA            complement(<197859..>200924)
                     /locus_tag="MRET_0113"
                     /product="transcription initiation factor TFIID subunit 1"
                     /transcript_id="XM_027626740.1"
                     /db_xref="GeneID:38736879"
     CDS             complement(197859..200924)
                     /locus_tag="MRET_0113"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 1"
                     /protein_id="XP_027482685.1"
                     /db_xref="GeneID:38736879"
                     /translation="MDSEHDDAVSQLGGLALGQVLQDMGIVSADSDLSRIGLGSKRSA
                     NAQALHRDEIYRNDFDDGKEEEGKDDEEDEEDDLAEDEAAAKAENTRSLRREKVKVRG
                     EDDDFADEEENDKDGSEEPQKQQATHAALLMSPRTEARHMFPDFQQGTLLDFTELFAT
                     RSLKRRKLVGKLPQYDKNHHELSASETGYDEFMASDGVKGESEPHLLPRLVQPYVAKQ
                     ASDPTRSRCQVICDGNSSTSHLLTNVEVDDWERHITPHSSEEPSHVLTMAEVSRPRND
                     ELAKGIWFENIIWNSQHPFRRFDRLIMDMNDAEMILENENTQSEKQASLLRADAPPNL
                     LKSSKFTSELDPFNLSNDRMYELSKVHRHRVRQTLGQLVVRHAWPAIKLQLPFYKTRL
                     TKHETRSWHRPRIQFPSNMPISFSRVRSSRKKDGERKSKDPSEVLHSTRDLTLKDASN
                     YVLCEYSEEYPPLLSNLGMGSLLVNYYRKKDAKDDYIPRSDMGEAFVLDVTDESPFMK
                     FGSVEPGQTQLVLYNNMTRAPLFRHKPTQNDFLFIRSTTKDDVRYYLRDVPNLYVVGQ
                     TYPTTPIPGPHARLVTNNIKYRLQMITYKLVEKSHAHRIKIHRVMKYFPDQNELQMRQ
                     RLKEFMVYNRKSGDMHQGFWRLKPDVPIPDEAELQKLLTPEHICLVEGMQVGQRHLLD
                     AGFTKTAEGADDDADEGKMEIEQLLAPWITSKNFLHATQGKAMLKLHGEGDPSGRGEA
                     FSFVRVSMKEIFLRAGEDVDERLAAEAETRAKSGHRYNVAEQQAIYRSEIARIWKAQL
                     AALSNPEPPRITAKEEQMWREEQRRERKQLEHKATKPLLVKRLFNGVWYKHIVRDPSV
                     INAYVKQRQEIEEQSIVTESLMPTGDAALDAMRKKRLEEEIAARVKNQDRRLQRKNAK
                     AAAEGIIGGYKKMPNKTNTKRRCGRCGMVGHMSTNNACPQYQASNAGGRGGSGAGGSA
                     ANSVRPPSVMPMPNSTYYTSATNQQQGVPMPSAFPPLGMNDPMGPQSPV"
     gene            complement(<201010..>201990)
                     /locus_tag="MRET_0114"
                     /note="MRES_02880"
                     /db_xref="GeneID:38736880"
     mRNA            complement(<201010..>201990)
                     /locus_tag="MRET_0114"
                     /product="TatD DNase family protein"
                     /transcript_id="XM_027626741.1"
                     /db_xref="GeneID:38736880"
     CDS             complement(201010..201990)
                     /locus_tag="MRET_0114"
                     /codon_start=1
                     /product="TatD DNase family protein"
                     /protein_id="XP_027482684.1"
                     /db_xref="GeneID:38736880"
                     /translation="MSTILPRYVEIAVNLGDPMFRGVYHEKKKHTDDLDQVLTRASNA
                     GVDAQIITAGSLAEVHDVLRLADTKRGLFATAGCHPTRSTELESYGAPAYMNALKDVI
                     LANPCIVAVGECGLDYDRLHFSPADAQQRCFKLQLQLAEQVRLPLFLHSRGAHTDFVR
                     ILRPHLSSLRLDHTEPTPESKGSVGVVHSFTGTLDEMQELVQMGLYIGVNGCSLKTQE
                     NLDVVKHIPLHRIMLETDAPWCDIRPTHASHAHLEAFAKSSPQLCALYSPVRVKPEKW
                     TENAAVKGRCEPCHIGQVAAVVAQLKGIRLEELASQAFQNSVDLFRLPLL"
     gene            complement(<202169..>204259)
                     /locus_tag="MRET_0115"
                     /note="MRES_02875"
                     /db_xref="GeneID:38736881"
     mRNA            complement(<202169..>204259)
                     /locus_tag="MRET_0115"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626742.1"
                     /db_xref="GeneID:38736881"
     CDS             complement(202169..204259)
                     /locus_tag="MRET_0115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482683.1"
                     /db_xref="GeneID:38736881"
                     /translation="MQYFLLPAALVTASGMLANAAPLNGVNKDAADLQPLAAPATNAG
                     EPLVVQWKPAAKNSAWKHMDVSLVALLANGKQHETSLAHGIDGTDPTNNTLHAKAPKH
                     VHGDSTQYLIKFSDGQDEKKSPKFVIRENKDSKLHSRRNSGSGISKEQIDSIIQEMLG
                     SGERDSDDSGSSTGHGSPTAAINRIPSAASSSLVSKASSKHKPITISGVTYYPKIDST
                     SKSKSKSKSKSKSKSGKKSSKSTSATSTPDSRDAWSDMAQQMEANEKHSNKSSSSTNS
                     SEHGRNAAAAKIPTASPSSSTSSSKKHGHSKSSSSSHKKHNGHHSHGHHGGQHGHSGK
                     SHSSETKKHQHSSKSQSAETSSSPSSSADASQGRSAVQQQGGGKTGGELQVDTPAFAS
                     QCRPLRITWHGGKAPYTPYITAEGDVGNVLDSLEQTQDTTASWKVTVPEGQKFTINMC
                     DADGVCRPSGPVGPVSKGPDSCINGGGAPPKKRFAKREESWTSRSSGTASESPKSSSS
                     KAVRHRAHKSSHKPSSAQTSPSRKDQALLRSLLHHSSSMGGSASDAEGASSLFLGMDP
                     MAGLSSLFQHSSSDASQTPSRSSSGSMTRSRATPTSLPVHHGKQSASQGGSESARGQA
                     TRSLNNESSGESDSDIMNMLAQGMMGDSGLSPKQISRYFHSEGVRTSDHQRHGQESVS
                     LDYNRGTQSVSMSS"
     gene            complement(<204652..>206234)
                     /locus_tag="MRET_0116"
                     /db_xref="GeneID:38736882"
     mRNA            complement(join(<204652..204677,204717..204924,
                     204953..205178,205206..205790,205816..205941,
                     205967..206045,206070..206187,206220..>206234))
                     /locus_tag="MRET_0116"
                     /product="COP9 signalosome complex subunit 2"
                     /transcript_id="XM_027626743.1"
                     /db_xref="GeneID:38736882"
     CDS             complement(join(204652..204677,204717..204924,
                     204953..205178,205206..205790,205816..205941,
                     205967..206045,206070..206187,206220..206234))
                     /locus_tag="MRET_0116"
                     /codon_start=1
                     /product="COP9 signalosome complex subunit 2"
                     /protein_id="XP_027482682.1"
                     /db_xref="GeneID:38736882"
                     /translation="MSDDEFMMDDALDDDEQDYEFEFEDDEDMDDQNADVENKYYNAK
                     VIKADNPRDALREFRDIVHQDQIQSEWGFKALKQQIKLLLSLGQYDDALNEYAHLVRC
                     TEKSFLSFNYVEKSINTILDCASTVLEMPCDKIEAWYEVTKRTALARNTERLYTKVCI
                     KHAYLWLSRHEWHRLSLVLGDLRANVLSDKQSDTQIHGTNVLELYSLEIQMYQQLHNA
                     SMVKKVFLEATNVTNAIPHPRTMGVIREFGGKMYMEEKDWEAAQVNFFQAFRNYDEAG
                     SSQRIQVLKYLVLANMLMGSSINLFDSQETKPYKDDPDIVAMTALMDAYERRDVKDAE
                     RIISDHHYTFLQDTFVQQFIPDVIKELRVQYILNYIRPYRSVRLDRLASMLDIRIDEV
                     EALLVMLILDGRIDGALDGMHHVLQIKHASTPNHSQDMQHALHHWSKQVHALALAISH
                     KQAKRLVRTK"
     gene            <206394..>207108
                     /locus_tag="MRET_0117"
                     /note="MRES_02870"
                     /db_xref="GeneID:38736883"
     mRNA            join(<206394..206405,206436..206613,206651..>207108)
                     /locus_tag="MRET_0117"
                     /product="mitochondrial organizing structure protein 2"
                     /transcript_id="XM_027626744.1"
                     /db_xref="GeneID:38736883"
     CDS             join(206394..206405,206436..206613,206651..207108)
                     /locus_tag="MRET_0117"
                     /codon_start=1
                     /product="mitochondrial organizing structure protein 2"
                     /protein_id="XP_027482681.1"
                     /db_xref="GeneID:38736883"
                     /translation="MAQTDKLSVYPEADKELTVVETHTELERQVSRARQAVQSFSAKF
                     LGSVRSGVNSVIKTEDKVEDRVSSLLAKNENLTPNGLYVGVLTLASMVFTRHRAFPIR
                     WTVPPVVLVASMRYFLPGTSDNIAEYYEKKEEALSKPFSEARRAQWTRAKQFWYTGID
                     HLQMTREKLAGTWTSSVRGLEDSTGLQVSSILSGSDATPSATPNSAEPKQTRKLV"
     gene            complement(<207139..>208108)
                     /locus_tag="MRET_0118"
                     /db_xref="GeneID:38736884"
     mRNA            complement(join(<207139..207699,207724..207871,
                     207899..207923,207950..208051,208093..>208108))
                     /locus_tag="MRET_0118"
                     /product="coiled-coil domain protein 130"
                     /transcript_id="XM_027626745.1"
                     /db_xref="GeneID:38736884"
     CDS             complement(join(207139..207699,207724..207871,
                     207899..207923,207950..208051,208093..208108))
                     /locus_tag="MRET_0118"
                     /codon_start=1
                     /product="coiled-coil domain protein 130"
                     /protein_id="XP_027482690.1"
                     /db_xref="GeneID:38736884"
                     /translation="MQGFGMGRYRPRDEEAERRELEKSFHPLKSNGPRTTKVRFELPF
                     SIWCDSCQNHLAQGVRFNAEKVPAGSYYSTPVWLFRCKCTMCKAPFEIRTDPKNTEYV
                     VVSGARKQVREWEPSEDDVVIGRSEQSTSSMDGAFADIERQNLVKGSVSSYQDRIAEL
                     EQVSAEQWSDPYTMNARLRKAFRTEKHARIESELRDATLRERIGWSQDRILEPASSTE
                     HGYTTPDIRRAWSESQQARKDSQRTPRQDHSLRSAQHLTPAAQKLARRLIANSHSKQA
                     ARRRQGL"
     gene            complement(<208156..>209400)
                     /locus_tag="MRET_0119"
                     /note="MRES_02865"
                     /db_xref="GeneID:38736885"
     mRNA            complement(join(<208156..208230,208257..208467,
                     208492..208554,208585..208938,208966..209215,
                     209247..>209400))
                     /locus_tag="MRET_0119"
                     /product="protein
                     farnesyltransferase/geranylgeranyltransferase type-1
                     subunit alpha"
                     /transcript_id="XM_027626746.1"
                     /db_xref="GeneID:38736885"
     CDS             complement(join(208156..208230,208257..208467,
                     208492..208554,208585..208938,208966..209215,
                     209247..209400))
                     /locus_tag="MRET_0119"
                     /codon_start=1
                     /product="protein
                     farnesyltransferase/geranylgeranyltransferase type-1
                     subunit alpha"
                     /protein_id="XP_027482689.1"
                     /db_xref="GeneID:38736885"
                     /translation="MVILSELTDQEKDLDEEMSAFDLHAPIWKDIVPVPQNDGPEPLC
                     PILYDPQYVRAMSLFRALREKNEGQMEVSERALALTDMLVHMNPANYTVWQCRAHVLI
                     QMALSGQENDRLYKELDFLDTFALVNMKNYQVWQHRKLIVSILGDPSRELEFVSSVLN
                     HDGKNYHTWAYRQWILAHFGGLGLRDESVSAVGAGQYPHFWASDIAYADKMIQNDVRN
                     NSAYNHRWYCIFGRAMHGRSELPAEMEEVRDAEINYALEKIAMAPHNASAWNYLRGLH
                     LALQPKRALSSLNERIREYIVDQDQGDAAQLPEQDRPCKTPPYALEWLFDSCVETTEQ
                     DAMSKATRLDLLARLRRADPTREKYWLYREQTLP"
     gene            complement(<209511..>210320)
                     /locus_tag="MRET_0120"
                     /db_xref="GeneID:38736886"
     mRNA            complement(<209511..>210320)
                     /locus_tag="MRET_0120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626747.1"
                     /db_xref="GeneID:38736886"
     CDS             complement(209511..210320)
                     /locus_tag="MRET_0120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483132.1"
                     /db_xref="GeneID:38736886"
                     /translation="MTWALFPHGPRMHLSMSYGAGLQSARSYCSGSANTHLFENMITN
                     AAHIWHEPGNDFLDHGQAHEKRLSHTLTDDVVARQMALSSTLAEDSLGLASLCMKKTF
                     DVLELESPFNLSKDLELFFPLCTSTSCLGPHQNVVTILSLALDPPLNLLVEKEPMKSD
                     KALMASERLLSDAVRSTLCTIQNYYMQHFRHVSLIEATLRLHNMWPKRLDVSRLEYSV
                     GSSTSSADLKVHLPGWRKYDVELALADISLGFRYTRTGAPFVFWHLTEVPL"
     gene            complement(<210402..>210854)
                     /locus_tag="MRET_0121"
                     /db_xref="GeneID:38736887"
     mRNA            complement(<210402..>210854)
                     /locus_tag="MRET_0121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626748.1"
                     /db_xref="GeneID:38736887"
     CDS             complement(210402..210854)
                     /locus_tag="MRET_0121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483133.1"
                     /db_xref="GeneID:38736887"
                     /translation="MLDEHYVKCIYERMHFNNACQRQTCDDQAQRLPAATLVFFTYAG
                     ILLHGLRLHKTTISTMQARNFATNACQTNSCLGSWVKYVQWSHAHVSLPVAALVRVPV
                     HSSVKLSSPVNPSKHHPNSCSRRIFYEIIACHFLVSSQACCVFLPHRL"
     gene            complement(<210887..>211554)
                     /locus_tag="MRET_0122"
                     /note="MRES_02860"
                     /db_xref="GeneID:38736888"
     mRNA            complement(join(<210887..211442,211475..>211554))
                     /locus_tag="MRET_0122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626749.1"
                     /db_xref="GeneID:38736888"
     CDS             complement(join(210887..211442,211475..211554))
                     /locus_tag="MRET_0122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482636.1"
                     /db_xref="GeneID:38736888"
                     /translation="MHCFLTLRVLLAFLVTLGAAQVLYELDDSAQLLGGYAKQNVAHP
                     AISHTSLSMNEPLPTPASTPSLEKRNATTSNHIENAGSVAPGATASITADTSKGTCQM
                     SNDLDDNQQASWTETVVSTCCTSEAYSECWFRIQAKTDTKYACVIPRCDALLSNEPDK
                     MAGFRPLSGSIGEGKYQNMFPILILSAAVRPAIPFLLFLVAPLCISFILLL"
     gene            complement(<211733..>213031)
                     /locus_tag="MRET_0123"
                     /note="MRES_02855"
                     /db_xref="GeneID:38736889"
     mRNA            complement(<211733..>213031)
                     /locus_tag="MRET_0123"
                     /product="cystathionine"
                     /transcript_id="XM_027626750.1"
                     /db_xref="GeneID:38736889"
     CDS             complement(211733..213031)
                     /locus_tag="MRET_0123"
                     /codon_start=1
                     /product="cystathionine"
                     /protein_id="XP_027482637.1"
                     /db_xref="GeneID:38736889"
                     /translation="MSGPATPPQLDTLAIHADQPDHIKEPAYPVAPSISVSTTFHQPH
                     PDSDLAHTGHGEPHPEDAFHIYSRYSQDTRVRSERVISGMMKGHALLYSSGLSAADAI
                     ADLLLPTTIAIRRGYFGVHGVFQKYAQGRNVKFIDLDDEYPTQEGTPSQDSDVRRGAT
                     LVWLETPLNPTGEARNIEHYAQRAHAAHAYLAVDATLAPPPLQHPFQHGADFVMHSGT
                     KYFGGHSDLLVGIVATQNYQQFVALWKERSISGRVPGSLETFLLLRSLRTMPLRVRHQ
                     SATATNLVQFLYSLTEGQLPAEHVPDDIAHGRFVKQVWHSSLQPRPAYPEEVADTQKE
                     NHAFDPKTQLPMGGSPTFGLLTAHADYAKYLPHFLSYFVPATSLGGVESLIEQRVIAS
                     PDTDPRLIRISVGLEDSKDLRSDLLQAMLATLQHVRSQSQ"
     gene            <213171..>213809
                     /locus_tag="MRET_0124"
                     /db_xref="GeneID:38736890"
     mRNA            join(<213171..213603,213630..213690,213719..>213809)
                     /locus_tag="MRET_0124"
                     /product="membrane-associated progesterone receptor
                     component"
                     /transcript_id="XM_027626751.1"
                     /db_xref="GeneID:38736890"
     CDS             join(213171..213603,213630..213690,213719..213809)
                     /locus_tag="MRET_0124"
                     /codon_start=1
                     /product="membrane-associated progesterone receptor
                     component"
                     /protein_id="XP_027482642.1"
                     /db_xref="GeneID:38736890"
                     /translation="MGQLVSTFLPPWARPYWNSIIENPLNLALFGVCVPLGVFLLWPP
                     ESSSPLSMPSVKEARSLMPTAQYSTLPAEHAKSIEWIRYTPRTLALHDGTQGEHSQIL
                     LAIDGHVFDVSSGRNFYGPNGPYGNFAGRDASRGMAKQSFALDVLTPIDQPLDTLSDL
                     TPAERRNMEEWISHFRGKYPIVGQLVNEGDVETC"
     gene            <213844..>215166
                     /locus_tag="MRET_0125"
                     /note="MRES_02850"
                     /db_xref="GeneID:38736891"
     mRNA            <213844..>215166
                     /locus_tag="MRET_0125"
                     /product="DUF1992 domain protein"
                     /transcript_id="XM_027626752.1"
                     /db_xref="GeneID:38736891"
     CDS             213844..215166
                     /locus_tag="MRET_0125"
                     /codon_start=1
                     /product="DUF1992 domain protein"
                     /protein_id="XP_027482643.1"
                     /db_xref="GeneID:38736891"
                     /translation="MRPTPLWTFVSAGVRYSQRASDKLFADAAREEAQQGARRPRLSM
                     DPQDPVWTGDERLEDTVLRMLMDKYKPLRQQVSMRAAESSRLRQSQKPTLRPTESRRE
                     TAPKTPYTPPGQPWNAVFVRPSHAAAEEPRVYRGKYMDVSPPKSDMAQHLARKGIAPS
                     QLALDDRKAMSELRHALRRSMHRDKIEVARDIKLGRHAPMPSEESAPQIGMLGATKGL
                     AGIAEQRIVEAQAKGLFRSNPLHGKPMPRDYNETNPFLHREEFVLNRMIQRQGNVPPW
                     VQRNQDLQTEMRSLQQRIQHAWICRMLYRLDASEEWGSLAPVHVHWHDHLGPDDLRSY
                     RIEARSEAEQRTLEWVRTFRDAAWIAAESAYHTAAVDQLNQVIRSYNHTAPPSARKVL
                     VTKDAFLASSIQRAFPLMVDAASARIRARREMPRKARTDTPRWPRWLW"
     gene            complement(<215170..>216168)
                     /locus_tag="MRET_0126"
                     /note="MRES_02845"
                     /db_xref="GeneID:38736892"
     mRNA            complement(<215170..>216168)
                     /locus_tag="MRET_0126"
                     /product="SMR domain protein"
                     /transcript_id="XM_027626753.1"
                     /db_xref="GeneID:38736892"
     CDS             complement(215170..216168)
                     /locus_tag="MRET_0126"
                     /codon_start=1
                     /product="SMR domain protein"
                     /protein_id="XP_027482640.1"
                     /db_xref="GeneID:38736892"
                     /translation="MDGEGVCAVVETVFIWRAVNYFIDMLCCGGGGNCGRGCGGCGGC
                     GGCGRHHGSAQAPASMPPYGPPSGGYAPYGQPPYGQPPYGQPPYGQPPYGYPPHGQPP
                     YGYPPYGPPPQGQAPYPPPGQNAPGGPAKDSEKILGSANVHEFDDNNKNAQNPHYKEL
                     RRRAQSEGSKMAHAFDASKKAYASGQGARAKELSEEGHRHQTEMERLNTEARQWIFAA
                     NNADSPPDTLDLHGLYVKEALSKVEEAVQKAQQQNYPQLKLIVGKGIHSRDHVSHVKP
                     AVQRLLSHYHLDAHVDQDNTGIVVVNLRGPPGGGSTDFTHAMARGASGNEHECLIM"
     gene            complement(<216210..>218063)
                     /locus_tag="MRET_0127"
                     /note="MRES_02840"
                     /db_xref="GeneID:38736893"
     mRNA            complement(<216210..>218063)
                     /locus_tag="MRET_0127"
                     /product="ATP-dependent helicase IRC3"
                     /transcript_id="XM_027626754.1"
                     /db_xref="GeneID:38736893"
     CDS             complement(216210..218063)
                     /locus_tag="MRET_0127"
                     /codon_start=1
                     /product="ATP-dependent helicase IRC3"
                     /protein_id="XP_027482641.1"
                     /db_xref="GeneID:38736893"
                     /translation="MWLWRHWRRWARTYATSLRPYQHECVNACLQALEERGLTRIGVS
                     APTGSGKTTMFLELVSRLGGHGVRHALILVNGITLAQQAAERARYMFPHMSVEMDQGA
                     RHVASGQADITVGTVQSLRQRLAKYDPSAFKCVIVDEAHHSTSPSYQAILSHFHCDLS
                     PEPVTQVRTPIIGFSATFTRHDGVALGRVYEEIVYHKDFLDLMSEKWLCPIRFTLIRA
                     GFDLSRVSSASGDYVPSSLARVVNQAPMNEVVVRSWIDLAWQKRRMTLVFAVDVAHVH
                     ALVDEFRARGIDARGIHGGMSLGERDALLQAFREHAFPVLVNCAILTEGADIPAIDCV
                     WLVRPTKSRNLFSQMIGRGMRQSVGKQDCLIVDVAGNVENDLACTPTLCGLDVQPMAN
                     GEVALVPKRSSASRAPASFMDPPQDVAYIDFDDPEALRRAMSAKPHASLASMSPNAWV
                     DCGADTYVLGSFDGAYVKVRRVNDEWQAHYYTRNAAFWRDYAAGLAASSPYLKRKILT
                     SHELGHAIRGSDTFMKQVCEAAARSPLWLRHSAYWRRMPATAKSRAFLAQTLAGKGSR
                     DVSIPDTMSQGALQRTLIRLRHGSKALWRHAMKRHNRRQPIPRDQVQVGPL"
     gene            <218117..>219157
                     /locus_tag="MRET_0128"
                     /note="MRES_02835"
                     /db_xref="GeneID:38736894"
     mRNA            join(<218117..218165,218190..>219157)
                     /locus_tag="MRET_0128"
                     /product="MEMO1 family protein"
                     /transcript_id="XM_027626755.1"
                     /db_xref="GeneID:38736894"
     CDS             join(218117..218165,218190..219157)
                     /locus_tag="MRET_0128"
                     /codon_start=1
                     /product="MEMO1 family protein"
                     /protein_id="XP_027482646.1"
                     /db_xref="GeneID:38736894"
                     /translation="MSTRCASHAGSWYPLSHEALDTCLNECMKAARAAQASASLPVAQ
                     HPMVHGCRAIIAPHAGYRFSGRAAASAYGCIDPDTVDRVFVLGPSHRVYLEGCALSPF
                     SYLATPLGLLPVDTQAIEELHSSGLFTFMSTDVDQAEHSIEMHLPYIYKVWSGRPVQV
                     VPILVGQLSTDACREYALCLAEYFADPRTLFIISTDFCHWGDRFRYTRYQAPEDEPVV
                     LSCDTKHHIREYFPIHQSIAAIDAECMAAISFGREGAALARTQYLESLQRTHNTICGR
                     YPIVLLLTILELLEEAEYAFECRFTHYEQSSACESLDDSSVSYASAYVRSLSQSGLDA
                     SRLT"
     gene            complement(<219106..>220605)
                     /locus_tag="MRET_0129"
                     /note="MRES_02830"
                     /db_xref="GeneID:38736895"
     mRNA            complement(<219106..>220605)
                     /locus_tag="MRET_0129"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626756.1"
                     /db_xref="GeneID:38736895"
     CDS             complement(219106..220605)
                     /locus_tag="MRET_0129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482647.1"
                     /db_xref="GeneID:38736895"
                     /translation="MAFRAPWTAVARARSRCFSTSTCLHKSKVSALEFQLSTKDAVYR
                     ARLAALEQLLPSIKGRWGGVSFAVMQALGLGWLTDSEESLMRFVRARATYVPRWVIDA
                     ICHVPCRGEQGTAKASFITTNSTLPGNGWRPLDTLPLSPPPPRTSSSPPPSQAIITPH
                     DEPMTYTAFSPERHLHPDVDIPDGISVIPFNLSPMSLLALGPSADLSTSMINMISKDP
                     IWHTDKRFTILPGVEVQLATVNTNEPETDRAMLRMNLDKIDVDMLACYPVLLPIHLIE
                     FQYDAHGQQDLRATVALGAWDPYLITYALRTEDPDVWRSKLTPSFLDLDMVDFDPRVP
                     VAPSVLDPLAKDEADAADIRIIDFLTKQSHLKGAFEQHAKMCLEKADWSACEAWERQH
                     ADADSHEARSGVGRHIAWSSTHIRPYYEDMEVNRRYAALSSEAALWTHLYKGVENDRS
                     RGVDVSRVEMLQDGESVTGEEAIELIRKRLAEAQVKRLASKPDWLRERT"
     gene            <221052..>222314
                     /locus_tag="MRET_0130"
                     /note="MRES_02825"
                     /db_xref="GeneID:38736896"
     mRNA            <221052..>222314
                     /locus_tag="MRET_0130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626757.1"
                     /db_xref="GeneID:38736896"
     CDS             221052..222314
                     /locus_tag="MRET_0130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482602.1"
                     /db_xref="GeneID:38736896"
                     /translation="MLGVSWVASVALLLSAVWYGANAQGTMEQQVKVEQLALTDPVKA
                     AQEVLKFPGIFSPNLALWAVFNNISGHGDEQVPWGRGAFYRWDPWTIGGTDTGYFWLP
                     REFNMFKLNRTFVIARKDGKVAKSPFYVNKEYDPKKIERAVIFWPGKWRDSWRYANYV
                     GNAYHVAQKYPELDVKSDNVLIILPAFMNEKDESRHALHDDEISFRGTGWSVGGTVRQ
                     PREFKHLSSFDVVDKYIDMLMDKNQFPNLKKIVVGGHSMGAQASLRYAFLRDKPEQDH
                     AVKFWIGNPGAYVWLNDKRPFSTKKCRNYDSWPYGISDPKTIPTYARHRAGKNGSKLV
                     ENFLKHRVHFAISQDDNGQGVSNCAGSVQGPTRICRAAEWIVQHGNTTEYEWPDTHTV
                     NFLPGVSHQDYPTLAYYGTIKFLFSPCH"
     gene            complement(<223308..>224780)
                     /locus_tag="MRET_0131"
                     /note="MRES_02820"
                     /db_xref="GeneID:38736897"
     mRNA            complement(<223308..>224780)
                     /locus_tag="MRET_0131"
                     /product="FAS-associated factor 2"
                     /transcript_id="XM_027626758.1"
                     /db_xref="GeneID:38736897"
     CDS             complement(223308..224780)
                     /locus_tag="MRET_0131"
                     /codon_start=1
                     /product="FAS-associated factor 2"
                     /protein_id="XP_027482601.1"
                     /db_xref="GeneID:38736897"
                     /translation="MADASSVAQLREELAFHGLGGDSFPADDLLQVMLDVEGGDVRAA
                     ARSILDAQAAERRVERANPTASPALPAPTHSWVTWCARAVLWPFSFLGAALLWCFRLV
                     QRISPQRPGTDTRGLTRYAQDPKACALRWIHELELETNGSVLPDAASFQRVPLPPFVT
                     MSYSEALRQSKNDIRILMIVLTSRVHNEHDFFCKHVLTDPHLVRMLHSPDLLVWGGDI
                     SDREAYRVSALLEATTFPFVAFIALQSRRSRSRGRIVPHPTVLSRLEGSPQTILSASS
                     ICAHISDVLLPRTSAYLHELRSERRLREMDRELREEQNLAFEHACLRDQERVIRKRAE
                     NERKIENESQRALEEHKHALLEAQKAQWRAWARAYLVPREPDLSVTPVIRVNVKMPDG
                     RNLQRRFFPSDSLEQLYAYVDTLDVHNDDAPVSMPRDYAHSYDFYLVQTYPRRVLSPE
                     NMAILLQDVDGLGPSANLIVESSTAHNLDEDDEDDDDNDD"
     gene            complement(<224848..>227022)
                     /locus_tag="MRET_0132"
                     /note="MRES_02815"
                     /db_xref="GeneID:38736898"
     mRNA            complement(<224848..>227022)
                     /locus_tag="MRET_0132"
                     /product="cortical ER protein involved in ER-plasma
                     membrane tethering"
                     /transcript_id="XM_027626759.1"
                     /db_xref="GeneID:38736898"
     CDS             complement(224848..227022)
                     /locus_tag="MRET_0132"
                     /codon_start=1
                     /product="cortical ER protein involved in ER-plasma
                     membrane tethering"
                     /protein_id="XP_027482604.1"
                     /db_xref="GeneID:38736898"
                     /translation="MSLSSVDPVQADFVIKFEGFPKIFADGTKRAPPGFLDERAQELE
                     RLMARLRDVGLVSVSRAGPRARGQVLVFVHIEHAVLQEMRQIERSQDFLHGVVTAEEL
                     SMDEPFKPAERVRYTHKRITAPYRASSAEQGAGITARCAEFPHVMDMMPLHDSSFNQA
                     WIKTWSHVSLASIVYGIDQSEIDKLRDHFGVHIAMYFAFLNAYSKSLVPMAVTGFIFW
                     LSGLANHHMYACLVVLWAIAFVEYWHIRERMLAVRWGMTGVSSVSERNSHFTPRTKSL
                     SPITGMEEEVFENWRHDVRSLLCVPVTILFLVFLVSTMAAIFLFQVVVDEVYDGPAKS
                     LVALIPTILFSTCIPLIQSAWRMAAQIMTNFENHATVHRFQSSLTSKIFGMQSVVTYG
                     ILALTTYMYLPFGEYLINQLQVHGYLDRLFAFVTRDPNAFKGRIQPFHVSPTGLHDQL
                     FAMSVTQQLMNTFTEVILPILWRHAEKFINKIRGSSRRKELEAFAKTNRDQAFLERVQ
                     NEFDLDVYDEFTDYAEMATQLGVISLWSVLWPLAPVMSVVNNFFELRSDAFKLVVNMR
                     RPIPRRVESIGSWSSVLSYLAHLSFFTNFTMLFIFDTFKPDSASSYKPPSNELRKRIE
                     LWLQPFFAALLLNYAFSMVPSIVRYVLERTMWQNSAEDVSIRRRLHQNRVALISRFEK
                     YDTMKQTHTSVPTLDAASQPGSFWHPSSDTGVSYIASAAKAT"
     gene            complement(<227128..>228777)
                     /locus_tag="MRET_0133"
                     /note="MRES_02810"
                     /db_xref="GeneID:38736899"
     mRNA            complement(<227128..>228777)
                     /locus_tag="MRET_0133"
                     /product="Na+/H+ antiporter"
                     /transcript_id="XM_027626760.1"
                     /db_xref="GeneID:38736899"
     CDS             complement(227128..228777)
                     /locus_tag="MRET_0133"
                     /codon_start=1
                     /product="Na+/H+ antiporter"
                     /protein_id="XP_027482603.1"
                     /db_xref="GeneID:38736899"
                     /translation="MYDIIETELSQMSKGLSIMGGFVVIYGLISFFVKERMYLSEPLL
                     AVTVGIVIGPHVLNWVDPYSWADDTIINEITYEISRLVIAVQVLFTGIALPEKYLRSE
                     WRSLSMLLLVIMTIAWFITALLIWGLVKNVTFLEALCISSAVTPTDPVLANSITSGQY
                     AEEHVPENVRHIILAESGANDGLGFPFMFLAVVLLVRTGMDKGTSVGEEIWRWFYGVI
                     VYDIFLSIAYGIVVGYIARKSLRWAAEHKLIDMSNFFGYGFGLALFTVGTAGLFGTDD
                     ILACFVVGNVFTWDDWFRLRQEETDFQEIIDMLLNVAIFMYIGMIIPWQDYSNEDIGL
                     SGWRMVLLGITVILLRRPPWVIALQKFIPALKSWQQGFFAGWFGPIGVGAVYYIEVAI
                     RSVPHDHTRDHLRRITKPVVLFCVFSSVLMHGVTIPITYFGPRVMRHSYSIKFFPRNN
                     DPFRPRHLLSRLMTWEAPTQAEDQEQQDSPAKAESPVASPVMPLHHGHVPFSRQVDGQ
                     DPPDKIIAHGGHIAHMRSDHGNHDSSAVHSHISKPAPAIVM"
     gene            complement(<229085..>230036)
                     /locus_tag="MRET_0134"
                     /note="MRES_02805"
                     /db_xref="GeneID:38736900"
     mRNA            complement(join(<229085..229100,229126..>230036))
                     /locus_tag="MRET_0134"
                     /product="methyltransferase"
                     /transcript_id="XM_027626761.1"
                     /db_xref="GeneID:38736900"
     CDS             complement(join(229085..229100,229126..230036))
                     /locus_tag="MRET_0134"
                     /codon_start=1
                     /product="methyltransferase"
                     /protein_id="XP_027482606.1"
                     /db_xref="GeneID:38736900"
                     /translation="MSSVRQVHPSPDVAKGVEYWESVPATVDGVLGGYGNGTLPRVDA
                     LGSRTFLLRTLPYLSSIPPAAYNGTPMEWKESRVKHRGGKGATVTRALDSGAGVGRVT
                     EHVLLPLVDEVHLVEPVHKFLQEAKLRSSSWKPMQQTVESSPFNARKVVYFHQSTLQG
                     FPLANPMSSTDTSQNHLPPTYMNNEATEPPSSPVTYDIILCQWCLQHLSETDLIQFLQ
                     DAKKLLRPPQLADDARPGCDGGIIFVKENVCSELPDGSESCWYDQEDYSITRSRKLYE
                     RIYAEAGLTVVRTEVQLGFPPELFDVQMWALR"
     gene            complement(<230139..>231203)
                     /locus_tag="MRET_0135"
                     /note="MRES_02800"
                     /db_xref="GeneID:38736901"
     mRNA            complement(<230139..>231203)
                     /locus_tag="MRET_0135"
                     /product="alpha/beta-hydrolase"
                     /transcript_id="XM_027626762.1"
                     /db_xref="GeneID:38736901"
     CDS             complement(230139..231203)
                     /locus_tag="MRET_0135"
                     /codon_start=1
                     /product="alpha/beta-hydrolase"
                     /protein_id="XP_027482605.1"
                     /db_xref="GeneID:38736901"
                     /translation="MMPKIPPPPFGAVFKGATSQILEQFMDLSGPSYKPTVFNPSSQV
                     MKGPLRVAKDRVPPSKSGEEPGFDIYYEVHGKGSRRIALIMGLANSCFSWLEQVEEFG
                     HDPACSVLVLDNRGYGNSDTPVQRYTTGEMAKDVIEVMDHIGWTEKQSVNLVGVSMGG
                     MISLEIARQNPERLASLLLLSTTSGDGSSLPPPIGLVAMTRGFFSSLTGRTRAEARVN
                     RMTNVLFPLPWQNEKHPTDPRGRTNGEVMREILLWRSKFVLPPTTLGPLLQMSACLTH
                     HVSSKDLKRINDLVPKIAIITGDWDQIVNPSHSKHMHKMMPDALYEVWKDAGHAIHIQ
                     FPFTFNKFLRQWIGLPPVHD"
     gene            <231306..>233297
                     /locus_tag="MRET_0136"
                     /note="MRES_02795"
                     /db_xref="GeneID:38736902"
     mRNA            <231306..>233297
                     /locus_tag="MRET_0136"
                     /product="pseudouridylate synthase/pseudouridine kinase"
                     /transcript_id="XM_027626763.1"
                     /db_xref="GeneID:38736902"
     CDS             231306..233297
                     /locus_tag="MRET_0136"
                     /codon_start=1
                     /product="pseudouridylate synthase/pseudouridine kinase"
                     /protein_id="XP_027482800.1"
                     /db_xref="GeneID:38736902"
                     /translation="MWPGTLRFVLHDGVQAALHAGRAVVALESTIITHGLPRPLNYEM
                     AVAAEDQIRRVGAEPATIAILDGRVHIGLDKTQLARVADSDPSHTTKVGRGSLAHALS
                     QGMGWVGGTTVSGTMALAHRAGIRIFATGGIGGVHRGAESSMDISADLTELGRTRVAV
                     FCSGAKSILDIPRTLEYLETQGVPVFTFHASGEFPNFYTASSGCKVPVVSSVDHAARI
                     VAANEQLGLENGIVFGVPIPREFEANGQEIQLAVEQAVLESKELGIDRLGKQVTPWLL
                     QRVSSLAAHSVQNNVALVLNNARHAAECAMSLAGPRKSTVAQVHAPKKARIMVIGCAA
                     MDITALALEPSLSDPSTAPGSIDMTVGGVAHNIARAAHAMLEDKRAVVLVAPKADDIL
                     GRLMQDDMRVSRMRTDALIQSARTPTCNLVLDANGELVTGIADMRVLDEIMVPEVVAM
                     RLQQHQPNFIALDANLQPASLAAALAYATKERVPVLYEPTSTAKCHRILDAMQMLQRA
                     QKIQIVTPNQYELASMAERLRTTFPREPTNHVDAVIRATRLPPALIQDAFMMTHVAQI
                     QLIKLGGLGVLLVMQGQGAQHHFVHVPALPMDHGKPFVNSTGAGDSFTGAILARMSTM
                     STSFDQITLEDMVDLVNIGQSAAQRTLTCKEAVARSMGA"
     gene            <233357..>234190
                     /locus_tag="MRET_0137"
                     /db_xref="GeneID:38736903"
     mRNA            <233357..>234190
                     /locus_tag="MRET_0137"
                     /product="sulfhydryl oxidase"
                     /transcript_id="XM_027626764.1"
                     /db_xref="GeneID:38736903"
     CDS             233357..234190
                     /locus_tag="MRET_0137"
                     /codon_start=1
                     /product="sulfhydryl oxidase"
                     /protein_id="XP_027482799.1"
                     /db_xref="GeneID:38736903"
                     /translation="MLPLTRFLRFVIVATLLLLIPAFVYLSQSTSSPVRDPKTGEYIW
                     EALMQSMQGHGPDQDQVSHGKPYFPITDWRSFASHWMPTNPAAMYHNWHQPVPQTVPT
                     PAATLPTTHGTISPTLAVPMPTDSIKLDSKVDGAYAPSMSNETAKAELGRSTWRFLHT
                     MMARFPDKPTPQQSADLQNFMRLFSLLYPCGDCAAHFQQLLKEWPPQTASRHNAEIWL
                     CNVHNQVNRRLHKPQFDCSKLNETYDCGCGTKTMAKTNLYDIDTKEASGMAHILPIRT
                     V"
     gene            <234503..>235660
                     /locus_tag="MRET_0138"
                     /note="MRES_02790"
                     /db_xref="GeneID:38736904"
     mRNA            <234503..>235660
                     /locus_tag="MRET_0138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626765.1"
                     /db_xref="GeneID:38736904"
     CDS             234503..235660
                     /locus_tag="MRET_0138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482819.1"
                     /db_xref="GeneID:38736904"
                     /translation="MDLLNNLTNGKAGQVLEKFGGNSQGGQQQQQGYGNTSAGGYSGN
                     SNNFGGSSGGYNGNSSGSTAGYGGSSNGSYGGSSGSYGNSSSGGYGNSSNGSYGGSSG
                     GYGGSSNGGYGNSSGDYGNSSTGGYGNSSGGYGNSSGDYGNSSSGGYGNSSNGSYGGS
                     SGGYGGSSNGGYGGSSHGGYGNPSSGHGNSSSGGYGGSSNGGYGSSSNGGYGNSSSSG
                     YGGSSGGYGGSSNGGYGGSSHGGYGSSSNGGYGNSSNGSYGSSSSGYGSSSNGGYGGS
                     SNGGYGGSSDSFGSSGGLGASSGHHGGHNSSGGYGGSSAGYGGNSSGYGGNSSGYGGN
                     SGGYGGNSGGYGGNSGGYGGNSGGYGGNSGGYGGNSGGYGGSSGSYGGSSY"
     gene            complement(<235782..>236498)
                     /locus_tag="MRET_0139"
                     /db_xref="GeneID:38736905"
     mRNA            complement(join(<235782..235796,235836..>236498))
                     /locus_tag="MRET_0139"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626766.1"
                     /db_xref="GeneID:38736905"
     CDS             complement(join(235782..235796,235836..236498))
                     /locus_tag="MRET_0139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482814.1"
                     /db_xref="GeneID:38736905"
                     /translation="MESELSLPRSVHLQTTTAHIKDAPKVSAHIMPFSINYNGSAPVH
                     TYFVLHPAQDSGAHVTADPCKTFNDETCTAAISSFRGRHIHGVRQKLPFGYELGFFRM
                     SREVMKSPSNPSQRSNMTGLLSQRMPKVPKKFSLDDDDDDNFADDDCTGDHYQTLLPS
                     ESLFSENVDDEDSEPASIHSLNPVYHAGTSFWIWGPDGPLDQGGDPYMRTWNEWIQVV
                     SPAIHDI"
     gene            complement(<236557..>237344)
                     /locus_tag="MRET_0140"
                     /db_xref="GeneID:38736906"
     mRNA            complement(join(<236557..236598,236627..236693,
                     236724..237229,237255..>237344))
                     /locus_tag="MRET_0140"
                     /product="protein-L-isoaspartate(D-aspartate)
                     O-methyltransferase"
                     /transcript_id="XM_027626767.1"
                     /db_xref="GeneID:38736906"
     CDS             complement(join(236557..236598,236627..236693,
                     236724..237229,237255..237344))
                     /locus_tag="MRET_0140"
                     /codon_start=1
                     /product="protein-L-isoaspartate(D-aspartate)
                     O-methyltransferase"
                     /protein_id="XP_027482815.1"
                     /db_xref="GeneID:38736906"
                     /translation="MAWRCTGSSNEELLTNMKAVGIIRSSRVLEAMKLVDRANYVPSV
                     TRRHAYQDAPQSIGYNATISAPHMHAFAAEILLPYLSQGCSVMDVGSGSGYLLATLHH
                     LLPPSDRKTHIVGVEHIQELVSASIENLKRDGLERELGNGRIVAMQGDGRKGCPEFAP
                     YSAIHVGAAAPCIPETLVQQLASPGRLIVPVDRPTSNYQDLYQIDKSVDGKVEKKILF
                     GVMYVPLTNAEEQWSK"
     gene            complement(<237414..>238654)
                     /locus_tag="MRET_0141"
                     /db_xref="GeneID:38736907"
     mRNA            complement(join(<237414..237834,237859..237917,
                     237944..>238654))
                     /locus_tag="MRET_0141"
                     /product="protein OS-9"
                     /transcript_id="XM_027626768.1"
                     /db_xref="GeneID:38736907"
     CDS             complement(join(237414..237834,237859..237917,
                     237944..238654))
                     /locus_tag="MRET_0141"
                     /codon_start=1
                     /product="protein OS-9"
                     /protein_id="XP_027482816.1"
                     /db_xref="GeneID:38736907"
                     /translation="MSWLRNLLLFTACAVTCITAQSRVEIANILKRDEFSIHFSNETI
                     PITEALQLLDDKKAYSQDASLQVAHTNGKFQMYRITDTEAYVCHIPLVKSDEGADQNK
                     RVLPNKETDAILSRGLSLLAKLRGKELQNIQSYFSHVLRYGNHILQYPLMAMLDNDGV
                     PEVDNRDTLPEGYYLMGVWDSLEGIKNELVPLYNTPSADLDDDVAPLYEDNAFFIQQV
                     WNGGTVCDLNGLPRTTTVKYYCGSNNKILSLAEVLTCNYVMVVETNVLCDDVAFIPPK
                     TKESNKIQCHMITPDNLEESKAHVKHVEERHNHRYKDVHEHDDTGILAEKIQDVGAGT
                     GAQPTMQLDPKVLQLIDKYLQSREQMTETTSSTPSSHETSTVKATGTVAEQASELPFH
                     RQEL"
     gene            complement(<238705..>239526)
                     /locus_tag="MRET_0142"
                     /db_xref="GeneID:38736908"
     mRNA            complement(<238705..>239526)
                     /locus_tag="MRET_0142"
                     /product="DUF1183 domain protein"
                     /transcript_id="XM_027626769.1"
                     /db_xref="GeneID:38736908"
     CDS             complement(238705..239526)
                     /locus_tag="MRET_0142"
                     /codon_start=1
                     /product="DUF1183 domain protein"
                     /protein_id="XP_027482817.1"
                     /db_xref="GeneID:38736908"
                     /translation="MLGGPRSALVVLLCVVTFCMSVLGKKHQNSPYEKVRFSDIRTLT
                     LYRGRMTTARRLEPIPQLTCEGSLCHKFQPAVIQCQSTGDNQWKCESQLPLWAQLGAV
                     EVSCEGWNFSDDIFVLKGSCALRYELLPTSTRISGSWESILFSVLFWSLAVFIVLSLL
                     HTCLGTERYNAMDDHSNGAPPPYQKHVTSTFSSPVTRAMSALGLGAIAGYFFRTRQTD
                     PPSTHGDMYRPFPAYGTMPHHGVYYGDAAAQLHSDHIASSSSAHTSTGFGGSENR"
     gene            <240003..>240479
                     /locus_tag="MRET_0143"
                     /db_xref="GeneID:38736909"
     mRNA            <240003..>240479
                     /locus_tag="MRET_0143"
                     /product="peptide-methionine (R)-S-oxide reductase"
                     /transcript_id="XM_027626770.1"
                     /db_xref="GeneID:38736909"
     CDS             240003..240479
                     /locus_tag="MRET_0143"
                     /codon_start=1
                     /product="peptide-methionine (R)-S-oxide reductase"
                     /protein_id="XP_027482818.1"
                     /db_xref="GeneID:38736909"
                     /translation="MLRARTTSRAFRCTRLFPLLSQRFQSKMTQVPKTEREWRAILSP
                     EQFRVLRQKGTEWAGTGEYDEHFQPGVYHCAGCQAPLYTSTTKFQSGCGWPAFFDAIP
                     GAIARHDDFSHGMRRTEITCTNCGGHLGHVFYGEGFPTPTNERHCVNSISLSFHHD"
     gene            complement(<240526..>240949)
                     /locus_tag="MRET_0144"
                     /note="MRES_02785"
                     /db_xref="GeneID:38736910"
     mRNA            complement(join(<240526..240862,240891..>240949))
                     /locus_tag="MRET_0144"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626771.1"
                     /db_xref="GeneID:38736910"
     CDS             complement(join(240526..240862,240891..240949))
                     /locus_tag="MRET_0144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482801.1"
                     /db_xref="GeneID:38736910"
                     /translation="MSEIPTSSSSSLSPDTLVDEFMRQGHFDQLRKQMLRDFLQSERH
                     AAFREQLESYLHDYVSKDAERLAYRDARLRQSDIMHALDQHPLFDELVSDLSKQGKES
                     WLGEGGRLAEQVREQVTRMIQAHASSRQE"
     gene            <241441..>242880
                     /locus_tag="MRET_0145"
                     /note="MRES_02780"
                     /db_xref="GeneID:38736911"
     mRNA            <241441..>242880
                     /locus_tag="MRET_0145"
                     /product="adenylosuccinate lyase"
                     /transcript_id="XM_027626772.1"
                     /db_xref="GeneID:38736911"
     CDS             241441..242880
                     /locus_tag="MRET_0145"
                     /codon_start=1
                     /product="adenylosuccinate lyase"
                     /protein_id="XP_027482804.1"
                     /db_xref="GeneID:38736911"
                     /translation="MDNWQSPLSSRYASKEMSHLFSNAMRFGTWRQLWLNLAIAEKEL
                     GLPIPDEAIEQMRAHLTLDEEQMKLAAEEEKRRRHDVMAHVHVFGVMAPAAAPFIHLG
                     ATSCYVTDNADLIFLRKGLNLLLPKLAVVIQRLASFAEKHRDLPTLGFTHMQPAQLTT
                     VGKRATLWIQDLLWDLRNLSRARDDLGFRGVKGTTGTQASFLQLFDGDHDKVEALDER
                     VTELFEFPYAMPVTGQTYSRKIDIDVLSPLASFAASALKIATDIRLLCHLKEVEEPFE
                     KDQIGSSAMAYKRNPMRSERVCGLARWLGNILNSARETAGGQWMERTLDDSANRRLTI
                     PEAFLTADVILTLLQNISEGLVVYPAIIARHIAAELPFMATENIIMAMVRSGGDRQEC
                     HEKIRVLSHQAARVVKEEGGENDLIERVRNDAYFAPIADRLDVLLDPSSFTGRAPQQV
                     DKFLAQWVKPALEPYAASLAHTGRAELSV"
     gene            complement(<242881..>244260)
                     /locus_tag="MRET_0146"
                     /note="MRES_02775"
                     /db_xref="GeneID:38736912"
     mRNA            complement(<242881..>244260)
                     /locus_tag="MRET_0146"
                     /product="DNA cross-link repair 1A protein"
                     /transcript_id="XM_027626773.1"
                     /db_xref="GeneID:38736912"
     CDS             complement(242881..244260)
                     /locus_tag="MRET_0146"
                     /codon_start=1
                     /product="DNA cross-link repair 1A protein"
                     /protein_id="XP_027482680.1"
                     /db_xref="GeneID:38736912"
                     /translation="MTPPIKRPRLAWHPDVPRTAEEAEKQLEDALKSSLQRIACPVCG
                     ETWPESDIARHASACGVSSNKDTTVQQWAAIFPPTKKPQRIPPYKMLDSMPIAVDAFR
                     YGAIEGCSAYFLSHFHSDHYAGLSKRWAHGPIYCTRETAKLAHDILRVDPAWLRMLDL
                     DTRTPIPEVQDVHVTCLAANHCPGSCLFLFEGPRQDGKMARYLHCGDFRACPAQATHK
                     AIRNACPLDAIYLDTTYLNPQYCFPPQPQVIKACADLVTSKTSPLVVVGTYSIGKERL
                     FLALAEALDTYIYCVDKRKYHTYALLDDTTLQKRLTKDPLLARVHVMPLRALVPNALQ
                     TYADALQKQGLTIAQTLAFRPTGWTSRQTRQQAPPPKALTPQHIVPPPFTQRHLQPTR
                     HGSVQMYAVPYSEHSSFYELMAFLLHVPHHRMIPTVPTKFQRYADVWTAASLHQGHVQ
                     IEARSTDYW"
     gene            <244311..>245228
                     /locus_tag="MRET_0147"
                     /note="MRES_02770"
                     /db_xref="GeneID:38736913"
     mRNA            <244311..>245228
                     /locus_tag="MRET_0147"
                     /product="cyclin-C"
                     /transcript_id="XM_027626774.1"
                     /db_xref="GeneID:38736913"
     CDS             244311..245228
                     /locus_tag="MRET_0147"
                     /codon_start=1
                     /product="cyclin-C"
                     /protein_id="XP_027482813.1"
                     /db_xref="GeneID:38736913"
                     /translation="MAANFWRSTQCHRWTMDPASVARARHEDLQYVSAQDMAAITTWC
                     LDTISTLGIRLHAHQQVIATASVYFQRFYTKNSYAATDPIVVLVTCLYLATKSEEAPV
                     RLRVVGAEASRLLHERGYEDPPNYVPLIAGMEYYLLEELEYDLIVFHVYRSLPALCDA
                     CVKACACPQGGGPSASTLLQLAWYMANDMYRTSLPLSYPPYTLAIACMYLALGLAPAR
                     PTDWAPAATPLHDTESSSRKPCMVSFLAGFNVSLPVISCILQDMLSHYELWHALSHPP
                     SGLSLLEDHQALFHRLYRMREDRCRAMAA"
     gene            <245629..>245986
                     /locus_tag="MRET_0148"
                     /db_xref="GeneID:38736914"
     mRNA            join(<245629..245677,245703..>245986)
                     /locus_tag="MRET_0148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626775.1"
                     /db_xref="GeneID:38736914"
     CDS             join(245629..245677,245703..245986)
                     /locus_tag="MRET_0148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483039.1"
                     /db_xref="GeneID:38736914"
                     /translation="MEPVMASVGKHCQGPLANFQRCIYAHRENPSACNEAQQELARCA
                     SEASPTLQTIKKTCGKYIHDYDQCLFANQHASQEEVASQCTSKLRALAECTDAVMLNS
                     ESSQAEAR"
     gene            complement(<245951..>246352)
                     /locus_tag="MRET_0149"
                     /note="MRES_02765"
                     /db_xref="GeneID:38736915"
     mRNA            complement(<245951..>246352)
                     /locus_tag="MRET_0149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626776.1"
                     /db_xref="GeneID:38736915"
     CDS             complement(245951..246352)
                     /locus_tag="MRET_0149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483040.1"
                     /db_xref="GeneID:38736915"
                     /translation="MSSSSSVTSVGPRASPALLPDMRLEQFFLSTIRQHVLIDGVSPE
                     SYVNATHTPWDKVYHIEWRALLRLLWWEQLVSPLWQGVLWGMGGVALVCARQSLLYTQ
                     TAKVPPPPRPQGLIPFLTQILARLGLGGLAI"
     gene            <246470..>246814
                     /locus_tag="MRET_0150"
                     /note="MRES_02760"
                     /db_xref="GeneID:38736916"
     mRNA            <246470..>246814
                     /locus_tag="MRET_0150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626777.1"
                     /db_xref="GeneID:38736916"
     CDS             246470..246814
                     /locus_tag="MRET_0150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482503.1"
                     /db_xref="GeneID:38736916"
                     /translation="MEAPASRVGLVQSIEKLQQTHLPRVSHAMEGLFESVAHGLVTDA
                     DGAGVEAACQRAEDELALLARFLRDTGLAGLPLSDEQDVQRVTQAVFEQRARLSDATA
                     MVSSMLAKKPAT"
     gene            complement(<246815..>247525)
                     /locus_tag="MRET_0151"
                     /note="MRES_02755"
                     /db_xref="GeneID:38736917"
     mRNA            complement(<246815..>247525)
                     /locus_tag="MRET_0151"
                     /product="2,5-diamino-6-(ribosylamino)-4(3H)-pyrimidinone
                     5'-phosphate reductase"
                     /transcript_id="XM_027626778.1"
                     /db_xref="GeneID:38736917"
     CDS             complement(246815..247525)
                     /locus_tag="MRET_0151"
                     /codon_start=1
                     /product="2,5-diamino-6-(ribosylamino)-4(3H)-pyrimidinone
                     5'-phosphate reductase"
                     /protein_id="XP_027482502.1"
                     /db_xref="GeneID:38736917"
                     /translation="MEALLAAHQPRRDERRVWVTLTFAQSSDGKIAGPGKTPLRLSGA
                     DSMVMTHRLRALHEGILVGIGTVLVDNPRLDVRLDAYHGPSPRPIVLDRHLRMPVTCR
                     LLQRDPPARPLVLCAEPTASRDAWEARRRALEAAGAHVRAVDVDGPHLAWPSILSILA
                     QERIRSVMIEGGASVINSVLSSHAVVHKVVVTVSPSHVGEAGYGYAASALWNAPQLHQ
                     VATLRLGPDTIVVWDTTA"
     gene            <247560..>248354
                     /locus_tag="MRET_0152"
                     /note="MRES_02750"
                     /db_xref="GeneID:38736918"
     mRNA            <247560..>248354
                     /locus_tag="MRET_0152"
                     /product="transcription factor C subunit 7"
                     /transcript_id="XM_027626779.1"
                     /db_xref="GeneID:38736918"
     CDS             247560..248354
                     /locus_tag="MRET_0152"
                     /codon_start=1
                     /product="transcription factor C subunit 7"
                     /protein_id="XP_027482983.1"
                     /db_xref="GeneID:38736918"
                     /translation="MLTTLYVARHAHRMNRSLASADDAVPRDPPLTARGEEQIHDLAA
                     FFEGLPPDEKPQLVLSSPYTRCIRTALPTAERLSLELCIEPGLAEWFGPVWPPESGLH
                     PSPRAAEHVVSHFPRVSTRWTPLLYPDPRGESIPGVHARAQAVMQRIDARCQEWGVER
                     LLIVSHAATIIALGRMLQTQGSYEDVRDRDIRAGTASVSKYVRSSPHEVWRQVYNGNT
                     SFLPHGEERAWDFGFVPDNTTEPGMGPHWHDAYAPRHARLIHRPKL"
     gene            complement(<248332..>249618)
                     /locus_tag="MRET_0153"
                     /note="MRES_02745"
                     /db_xref="GeneID:38736919"
     mRNA            complement(<248332..>249618)
                     /locus_tag="MRET_0153"
                     /product="HAP4 transcription factor"
                     /transcript_id="XM_027626780.1"
                     /db_xref="GeneID:38736919"
     CDS             complement(248332..249618)
                     /locus_tag="MRET_0153"
                     /codon_start=1
                     /product="HAP4 transcription factor"
                     /protein_id="XP_027482982.1"
                     /db_xref="GeneID:38736919"
                     /translation="MSAAALSLTSLRPEPPTLGLPPPDGEDIIQPSKEWVLPARGKPG
                     RKPSATVPPTKRKAQNRASQRAFRERRHAYVTELEEKVAQFEAREMQANVQLQRLAQQ
                     YRKEADYLRQSQQELLTRCERLERDLSTCQRRMASMARTHASGCRPPPHEQRQGAEPL
                     ESMPPVPLKAVQLVPLRRKREPSPPMTSLSEVDERSLDVDCGFCTDDTVCVCRGQARL
                     DLDPVDAGASWPAPTPALRKTRLWHTTTAPPPAAPSATAPSVRLPSRPRPRQRLWPVT
                     NDVRALRCTGDQRTCQACQSDPALAQFCTAVSRRCRLPVSMQRDDKAVSRESVPHAFT
                     RLRRHPNFSAWRGGLDMLADVVARDPMLASCVASPPVPAARQRVEAHSIMVRSDAVSE
                     ALDMLNRPDRPRACPCPWAPSRMPWPRRSFTASVGE"
     gene            <249801..>250598
                     /locus_tag="MRET_0154"
                     /note="MRES_02740"
                     /db_xref="GeneID:38736920"
     mRNA            join(<249801..250451,250491..>250598)
                     /locus_tag="MRET_0154"
                     /product="nicotinamide N-methyltransferase"
                     /transcript_id="XM_027626781.1"
                     /db_xref="GeneID:38736920"
     CDS             join(249801..250451,250491..250598)
                     /locus_tag="MRET_0154"
                     /codon_start=1
                     /product="nicotinamide N-methyltransferase"
                     /protein_id="XP_027482507.1"
                     /db_xref="GeneID:38736920"
                     /translation="MAGRDTELDEEGWALFEEPKDFRPPTPPPTEVQHTCLDGDVITL
                     RLVGSHPLWGHYLWNAAPTLSTYLEEHASLVREKRVLELGAAAGLPSIVARKTGASSV
                     VATDYPDPDLLQNLAHNVERYGGHVVGFIWGADGAPLLTHAPEGFDLVLLSDLIFNHQ
                     AHPALIDTLDRCMRRDGQALVFFSHHRPHLAERDLAFFTLAEERGYVCTKLQEWVLSP
                     MFPDDPGDAQVRATVHGYTLRHRSRDAEAAPCPS"
     gene            complement(<250552..>252645)
                     /locus_tag="MRET_0155"
                     /note="MRES_02735"
                     /db_xref="GeneID:38736921"
     mRNA            complement(<250552..>252645)
                     /locus_tag="MRET_0155"
                     /product="poly(A) RNA-binding protein"
                     /transcript_id="XM_027626782.1"
                     /db_xref="GeneID:38736921"
     CDS             complement(250552..252645)
                     /locus_tag="MRET_0155"
                     /codon_start=1
                     /product="poly(A) RNA-binding protein"
                     /protein_id="XP_027482506.1"
                     /db_xref="GeneID:38736921"
                     /translation="MRFAQSLDVEAMTPGPLALVTSSDTPNEATAFPPLSSSSSSSRG
                     AADELPVAGDLDRRRPSSSTQVSDSVTLSNVSLNVFSSPDTDPASSAMLLLPSDGGGD
                     ATAMASSASLPRPLSAADKHLPVSSPLLSHFPRSGSVSPARSMSSFATQRTDDADATR
                     PTLHGAAAGAHAAGDQRTQLYVRNLPPHVRWQDLKDLFRRAGTVLRADVHASPFGLRH
                     IVSGTVLFATETDAHHAINTLHGYNWHGHVLEVGLDEHIAGRIDGSRRLSRPHAGGDA
                     RHGLGASHASAPPVPLPYPGRVLFVGNLPFHCQWQDLKDLFRAAGNILRADVALNEDG
                     RSRGFGTVLFASPEDAQTAVRLYHGYEYSGRILKVHFDRHTPCGPASFMVPTDPSQYT
                     SAFHTRRMAPSAPVLPPMPAPLLSPFPPQPHVMPDMAHMAPMQETASPWTHAAAPRPA
                     DAPRSSHPAPYPHPGRIALPPVSFPMMGAMTPGVPLTPGMPGFMMRPALETPPVYPYL
                     MSPGLAIHAPGVSSGFNPYLNTTPGAPVDMHHAMAMAQPASPLPPTPHWSQPVRQRTR
                     APSTSKPSALQDAPPVSPSAQVSPTSAAPTEGGEYPFPGTTATVEPAPSQALPKDDSP
                     VLSSTRELTSAIAKMSVRGTARAKRTSAHLDKSTPGDAASTEERATAEAALSRLRQDL
                     AMKDKGQPLHLATDA"
     gene            <252797..>253735
                     /locus_tag="MRET_0156"
                     /note="MRES_02730"
                     /db_xref="GeneID:38736922"
     mRNA            <252797..>253735
                     /locus_tag="MRET_0156"
                     /product="small subunit ribosomal protein S5"
                     /transcript_id="XM_027626783.1"
                     /db_xref="GeneID:38736922"
     CDS             252797..253735
                     /locus_tag="MRET_0156"
                     /codon_start=1
                     /product="small subunit ribosomal protein S5"
                     /protein_id="XP_027482505.1"
                     /db_xref="GeneID:38736922"
                     /translation="MWLLWRGGSALRRVPALARGTSSTAKDAVRQKPETPMQRALPIL
                     FHMEDLARFPDLLKKPVAVHDVPVYSAPSAYGSSVALFNEEPFFPTPPPSVLAIMTAG
                     SDQGEEVNSESYLSAVTPLSPKEIRQLHRYNITIKRVVNMTGKGRTPSWYSLVVAGNG
                     RGLVGYGEGKDTNISRANKKAFHAAVKNMDLVSVHRSKSGANTLESPVEGRWGATRVV
                     MRPRPAGFGLRVPDVLHPIARAAGFTDLGAAIYGSSNTMNVVKAALQVLWGGSAPIGM
                     GGGIRGPMRRGDRGQGALSRREMELSRGRRLEELDV"
     gene            complement(<253737..>257423)
                     /locus_tag="MRET_0157"
                     /note="MRES_02725"
                     /db_xref="GeneID:38736923"
     mRNA            complement(<253737..>257423)
                     /locus_tag="MRET_0157"
                     /product="exocyst complex component 4"
                     /transcript_id="XM_027626784.1"
                     /db_xref="GeneID:38736923"
     CDS             complement(253737..257423)
                     /locus_tag="MRET_0157"
                     /codon_start=1
                     /product="exocyst complex component 4"
                     /protein_id="XP_027482504.1"
                     /db_xref="GeneID:38736923"
                     /translation="MKRITGGKKQRPVIRHENPNLGAGAGVAYGTIVVPGHNSFPAPA
                     PDSTPDAPPIPDQPMQPDASSAQAPPLSRVRPPRLSRVMKMPDVDPYASMAGSVSTPP
                     STLDAAVPDSTPTPPVAPSPAAHVPNVAVSTVPPPSTLPPLVREAPLPSQPPPIQSRA
                     PERQEASSQPPVAESLRLGSLTQEREIAEARRKQKLRLLRSAERERHLSHAPRVMHPQ
                     PSRPVEAYVDARDAPHFQGLHAVLRKIKTEWGFLLDTDFNPVRLSMALLPHGPLRGSM
                     SDFSSLAGLIETSLQSTVGDHFHSFASAIHVNHGMISSLSASQDGVSAARQQLQSARD
                     ALGTRRADLVQMWQRLQSVKEAMRILALLEQLRDVPDELESLMTEKRFLEATHLLMRS
                     LRLIQREDLAELGATADLRAYLRAQEHSLLDILIDEVQSHLYLKSYWCDVRWQSYMPG
                     QDTLPDMVLGAHSSDARPWTTLPQFLDALHSRVAKDDAASPHAMRSRASEEDSFLYLE
                     MLLESLAQLGKMGYALDTIAQMLPTELHQLVDTTIDQVEARYAAQNTSTSVRLETVLF
                     APHATHSVLDEGRTHRTFSLRGLPDARTSANAEIAALQRDAEILRDLFWTLCSKLEAV
                     LAAHRAVQEVARALLVRTSHDDAGAADRANADMGIAALSGVWGAVEYEIRMLLLDYLA
                     EDSERSTVSQHVPSLDAVLRMTRFERERNVLFRLTPAHRMPSVAASADRVDEALDVYV
                     PGLMGKETGLPFVMEPRAHADEYLGAGHRRIVKPLSFTASVLLPPTLQLVVRAEQIWP
                     VDADHGADLGAFLRDFVRGRFLPLLGQQVRTLVQNASSAPDAFHAEPAARIGVARAVV
                     RSSVQLVALMDSLYSMQQAAPFDQAGFTNMIILAFLVYYEACNARFKRLVSEDGDSPD
                     GPYMLAAVWTQRPELYACLATAMDAPPSSTRAADAYRAEARTEMRLAEGQAPRRADLL
                     TSRKRHMSLGTLHHSLDWLGTHMAPFHAPDSGAEPLPVSPEAQKLWQDVPSMYAVLAK
                     CVLMTLRVELRLKTLYYLREAIRGTYICDALSMEPDVHVVELTTELSACHEVYRETML
                     PQHHAYVFGGLDVLMDTLMTEAVLHVRAINRFGVTKMLRNLLSVQQNLKNIVDEPRRI
                     HLDRSRRLWELLAHEPESWLPDAPATYSAAEYLAVVRLSLGWGVDHAPIPLAGTTQQG
                     VSDERFRACVHTLDAALKRAAAAT"
     gene            <257524..>258441
                     /locus_tag="MRET_0158"
                     /note="MRES_02720"
                     /db_xref="GeneID:38736924"
     mRNA            <257524..>258441
                     /locus_tag="MRET_0158"
                     /product="protein N-lysine methyltransferase METTL21D"
                     /transcript_id="XM_027626785.1"
                     /db_xref="GeneID:38736924"
     CDS             257524..258441
                     /locus_tag="MRET_0158"
                     /codon_start=1
                     /product="protein N-lysine methyltransferase METTL21D"
                     /protein_id="XP_027482993.1"
                     /db_xref="GeneID:38736924"
                     /translation="MGPNFPEALAIAPQAPSTGADDVAWAHDSADDIAQYGIAGRIWE
                     SAFLVESYVHAPSTWTWDPPRTIVGAPQARTILELGSGVGTAGLTTAMALDTRQTHDL
                     IVTDLPDVCPLLARNTRDFHREGVRVHVRPLAWGDQDAARRILHEFRPTHLLCSDLVY
                     FPDLLAPLLHTLLDVTDRVPDAQVVIAYKIRSLTKEQPFWTALGVWFDMAWTQCSTGP
                     DQPLAPFGSHASHFVHKPPCDAQGKPLDDFFVLVAHRKSHTLTWTRPSAPATLLSGMH
                     MVDGLAVPGEGTDTFEWMILSSASDAYLH"
     gene            complement(<258433..>259989)
                     /locus_tag="MRET_0159"
                     /note="MRES_02715"
                     /db_xref="GeneID:38736925"
     mRNA            complement(<258433..>259989)
                     /locus_tag="MRET_0159"
                     /product="protein MPE1"
                     /transcript_id="XM_027626786.1"
                     /db_xref="GeneID:38736925"
     CDS             complement(258433..259989)
                     /locus_tag="MRET_0159"
                     /codon_start=1
                     /product="protein MPE1"
                     /protein_id="XP_027482992.1"
                     /db_xref="GeneID:38736925"
                     /translation="MATSAVYYKFRSQREPQRLTFDGTGISVWELKREILLQNKMGKG
                     TDFDLCVYNADTDEEYKDDNFSIPRATHVTVRRLPASKPGRGTAQLYVTDTMAPTAAA
                     GLDVPAPPPTTAAPSMPYRGPMSKRFDGRDAPATSEPSAPIQSAVIDHQQDEASKIAA
                     MFQASTEQWEETQERMAHATYRERSGAPRRGPPTGRYAPPAVERPPPPPGFICYRCGQ
                     KGHWIQDCPTNDNPEYDNRRFKRTTGIPKSMLRTVEQSTAENMTGVMVTPDGSYVIAT
                     PDSGSWQRTRARARPLSKTDVYQSMPSDPTLACPLCTKLMRDAVKTSCCQTSFCEECV
                     QTHLFEHDFVCPECEKRIPDIEMLKIDDVLRKKIREYVEKAIARSEEAFEQGTGVDEE
                     AAQQAAVSEFAATGQQDKGSSDEPPAAEAATAAAPPPPPPENTAAAPAPSGPTFQPQL
                     VQQLVMMLQNPQLPMPMRMQLQMQLQFQQMLFFQSFAGMPPPPAPDTTKRRHADEDAT
                     DRHDKQTRLM"
     gene            <260849..>261796
                     /locus_tag="MRET_0160"
                     /db_xref="GeneID:38736926"
     mRNA            join(<260849..260945,260973..261067,261096..261223,
                     261253..>261796)
                     /locus_tag="MRET_0160"
                     /product="vacuolar protein sorting-associated protein
                     VTA1"
                     /transcript_id="XM_027626787.1"
                     /db_xref="GeneID:38736926"
     CDS             join(260849..260945,260973..261067,261096..261223,
                     261253..261796)
                     /locus_tag="MRET_0160"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein
                     VTA1"
                     /protein_id="XP_027482935.1"
                     /db_xref="GeneID:38736926"
                     /translation="MLPDVPAALQGVASMLARADQVAKADPVIAYWCKYYAAQIGIEE
                     AAGKADAQAFLMRLMDDLERLKAELSTQEAVHSETVAYAYVENFALRIFLGADNEDRQ
                     GHATKATAQAFVAASKFLEVLRAFGPLDDDVQTKIKYAKWRATQIHKALRSGQSPAPG
                     PSAPRTEEEEVVSQLTTPPPREPPALAPPPDHTEPSLPSVPTQHEGEALHTSVQGTHA
                     REEAAPTASPAPPQEAETADCLLSVRDIAHVQKLSRWASSALDYEDIETARKHLREAL
                     IMLDAAASQQP"
     gene            <261950..>262984
                     /locus_tag="MRET_0161"
                     /note="MRES_02710"
                     /db_xref="GeneID:38736927"
     mRNA            join(<261950..261998,262026..>262984)
                     /locus_tag="MRET_0161"
                     /product="succinyl-CoA synthetase alpha subunit"
                     /transcript_id="XM_027626788.1"
                     /db_xref="GeneID:38736927"
     CDS             join(261950..261998,262026..262984)
                     /locus_tag="MRET_0161"
                     /codon_start=1
                     /product="succinyl-CoA synthetase alpha subunit"
                     /protein_id="XP_027482936.1"
                     /db_xref="GeneID:38736927"
                     /translation="MIGKASVNMFRGVQRAAGARSFSSTVLRRSYDDTVKNIYVKKDS
                     PIICQGFTGKTATFHCEQTLAYGTNLVGGVSPKRAGQEHLGLPVFGTVKEAVDKTKPD
                     ASVIYVPPAGAADAIIEAVEAEVPLIVAITEGIPQKDEIRVANVLKQQSKSRLIGPNC
                     PGVINPEGCKIGIMPAHIHMPGKIGIVSRSGTLTYEAVNQTTNVGLGQSLCVGIGGDP
                     YPGSTTVDLVKMYLEDERTEGIVIIGEIGGSMEEDAAEYLEKYNLTRPNPKPVVAFIA
                     GRTAPPGRRMGHAGAIISGGKGGADSKVNSLQKAGAVVADSPAKIGELMLQAMKQAGR
                     A"
     gene            complement(<263084..>264136)
                     /locus_tag="MRET_0162"
                     /note="MRES_02705"
                     /db_xref="GeneID:38736928"
     mRNA            complement(<263084..>264136)
                     /locus_tag="MRET_0162"
                     /product="deoxyhypusine monooxygenase"
                     /transcript_id="XM_027626789.1"
                     /db_xref="GeneID:38736928"
     CDS             complement(263084..264136)
                     /locus_tag="MRET_0162"
                     /codon_start=1
                     /product="deoxyhypusine monooxygenase"
                     /protein_id="XP_027482933.1"
                     /db_xref="GeneID:38736928"
                     /translation="MLPDIDALEASLLNTSGTVKLDVRFRTLFTLKGIAALSEEKRLR
                     VIDIISRALNDDSALLKHELAYVLGQIKDTRALPRLEQVLSDEKEHAMVRHEAAEAMG
                     AISSPSVLPVLQKYLHDNDASIRETCHLAIHKIELDNSEAGRREQALKELREKEHGDA
                     LSAARAATAPIDPAPATVMVAGTKDTDQNVYTLENVPKFREALLDRSLSLFERYRAMF
                     ALRNTVQQGGEAAQGPAVQALIEALCDDSALFKHEICFVFGELCHPASIQAMARVLND
                     DREHEMVRHEAAEALGAILEEGCEPNESESDKVIQILRRFANDASAPRVVRESCIVAL
                     DEIAYNQDPTQFQRVE"
     gene            <264229..>265065
                     /locus_tag="MRET_0163"
                     /note="MRES_02700"
                     /db_xref="GeneID:38736929"
     mRNA            <264229..>265065
                     /locus_tag="MRET_0163"
                     /product="mRNA turnover protein 4"
                     /transcript_id="XM_027626790.1"
                     /db_xref="GeneID:38736929"
     CDS             264229..265065
                     /locus_tag="MRET_0163"
                     /codon_start=1
                     /product="mRNA turnover protein 4"
                     /protein_id="XP_027482934.1"
                     /db_xref="GeneID:38736929"
                     /translation="MARTKRAKVVSLTQTKAKTREHKENLIETIRESANQYAYVWIFA
                     VSNMRNTYLGEVRKLWTGSKIFFGKLRVIAKALGETPEEEIRPGLGQIAKRLRGNVGL
                     LFTDSPPAEVLDWCMDYRRLDYARMGNRATETIELPAGPVYCRTDPPETLPHNIEPQL
                     RALGMPTQLKRGVPTLLENFVVCRKGEKLTAERAQILKHLIVQMAHFRLIPLTYWSAV
                     GAPGDDSEGAVVDVPVSEEDRELIEDSRTGGRKDQEDEMPEDEMDAIEARDQAMMMPP
                     GL"
     gene            complement(<265093..>266265)
                     /locus_tag="MRET_0164"
                     /note="MRES_02695"
                     /db_xref="GeneID:38736930"
     mRNA            complement(<265093..>266265)
                     /locus_tag="MRET_0164"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM21"
                     /transcript_id="XM_027626791.1"
                     /db_xref="GeneID:38736930"
     CDS             complement(265093..266265)
                     /locus_tag="MRET_0164"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM21"
                     /protein_id="XP_027482931.1"
                     /db_xref="GeneID:38736930"
                     /translation="MIRIMWKYQMRVASRTGAYLSRNLNGQSLVRAPVLIRYFASQQQ
                     QRPSDGEQMSKEQAELLRLLRESESLDNKKAFSRVPEQSLGLAGVALSQGAASASTRR
                     IDKWTGFGKKWRDLSGGQKAARATVNTSRFFVVSFGALLTFVVGYSLTSELFARNSPT
                     VIYNEACKVIQKSDKVHDHLLEPYRFHTSLAHGDFSPLNLPSHPHNATNSVHSSRFID
                     PRSGRETMFLHFFIESRDKDKPLGYWQFVRSSIVSGAQWLKTQAIEGGNKAYVWWQEQ
                     TREPTDASSDQALAPEPKLPPQPWWITRKLRGAVHGVGEIIGKTSDAVGMSSLDFAAA
                     KPVPGTWTSGEVYIELVKDDKDTFQYKHFTIDIPNSRSPLRRRLHLDQRHDGVPIR"
     gene            <267481..>268122
                     /locus_tag="MRET_0165"
                     /note="MRES_02690"
                     /db_xref="GeneID:38736931"
     mRNA            <267481..>268122
                     /locus_tag="MRET_0165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626792.1"
                     /db_xref="GeneID:38736931"
     CDS             267481..268122
                     /locus_tag="MRET_0165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482932.1"
                     /db_xref="GeneID:38736931"
                     /translation="MSRFFKFAFSAIFALVAFVAVARAGEEFYDEDGNEFKVFDSGVG
                     DDDWREEHDKRSFDVRGKSSFGMSRRHQKYKSVLFTHGPEKFENIWSDNVKITWYASN
                     DLKQPACCETGWDPENHHHIGAVMKGWKNGPSCGDFVRLCNEKTNKCTKVRIVDECAG
                     CKENHVDLTKSAFKRLATTGTLDEGVTTGLKMFSSRMPNPWDLALFGPVKLKI"
     gene            <268696..>270483
                     /locus_tag="MRET_0166"
                     /note="MRES_02685"
                     /db_xref="GeneID:38736932"
     mRNA            <268696..>270483
                     /locus_tag="MRET_0166"
                     /product="ubiquitin carboxyl-terminal hydrolase 12/46"
                     /transcript_id="XM_027626793.1"
                     /db_xref="GeneID:38736932"
     CDS             268696..270483
                     /locus_tag="MRET_0166"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 12/46"
                     /protein_id="XP_027482929.1"
                     /db_xref="GeneID:38736932"
                     /translation="MDPTSNVSTTGTLASPAQTSPTTNSGVAHRRGIKPVITPLNVPD
                     VNPSSNVPTLRDMVSMYGWEPTEWDRWSTDLGKSLHTNQNRPVLLGMVNFGNSCYANS
                     VLQALYHCQPFRDAVMSIDKMPLHSPLPSSHLTSASCMKDALTSLFHSMALSSVRLST
                     QDKHIARRDPGPLIIAGSVDQDVLKAFLMTLHQNCNLFDSTMHHDAHEFLNFILNQVC
                     EDMIDKRQRRAYKAREQSFTPLTACFNSPTISQRTYIHHLFQGILTNETRCLSCETIT
                     NRDEEFFDLSINVEHNTSVASSLRLFSEREMLSGRNKFFCDTCSSLQEAEKRMKIKQP
                     PNILALHLKRFKWSESNNVYVKHASRVVFPLDLRLFNTTDQTSQPDQLYELSAIVVHI
                     GSGAHQGHYVSIVRIGTRWAIFDDEDVSFIRESDISKYFGDAPEIGSAYVLFYQAVDE
                     APLPKTIPQPSVTTNFSSPTVKVDSMPTSKPITPPNLPKVLSAQTSATAQPVPTIVID
                     PLQRPGNGQPPSSPQIANGAARPALSKPESLPSTPPSEPVPPSSSQGMSPNVNASHRH
                     ALTVDSSRERRESNRKSWLGFSKLGRMLS"
     gene            complement(<270552..>272270)
                     /locus_tag="MRET_0167"
                     /note="MRES_02680"
                     /db_xref="GeneID:38736933"
     mRNA            complement(<270552..>272270)
                     /locus_tag="MRET_0167"
                     /product="meiosis induction protein kinase IME2/SME1"
                     /transcript_id="XM_027626794.1"
                     /db_xref="GeneID:38736933"
     CDS             complement(270552..272270)
                     /locus_tag="MRET_0167"
                     /codon_start=1
                     /product="meiosis induction protein kinase IME2/SME1"
                     /protein_id="XP_027482930.1"
                     /db_xref="GeneID:38736933"
                     /translation="MRLGLLDDSRLEAERQFVPIKKSGTGSFGSVFVADWQSPLPPCT
                     LLPAMQHSYTRPEYMGKRIVAIKKMKRSYKTLQDCLSLNELHAFITIPPHENIILLYD
                     VFRKPLTHELFLVFECMEGNLYQLIKSRKGRAMASGLIASITKQAVSGMAHIHAHGFL
                     HRDMKPENLLITTTGLGDYPNPGANAGTLKQDVLVLVKIADFGLARKVEKDSTLTTYV
                     STRWYRAPEILLRSRHYTPSVDVWAMGAIIAEMVRLHPIFPGANAMDQLQYIAHVFGT
                     PPYDMNFNDTDEIWIKWLEQMKKLDHRAQARSFDVFKAFFANTTSYALLDMIFRMLHF
                     DPAARITASECQQHPYLAQEASLLAPQHCLVPEPRPASSIAALSYDFDSPGDTDSTSS
                     PACSNEIQNGSPSQNELIAAPDMFHRHGIAHEDHPNSFLPKLNLLHRTHGMPWQRSGS
                     SLFSSTYGRKKPVDAPRSSSHTNGTLPSGEWNKSSHSFGERDSGSLSPERDDARTHSS
                     SHFLQKVRRSSGEKDDAKQAERKRREDEKSLLRERSRAVMQHRASLLHEQSTSAGTKR
                     WSDYGI"
     gene            complement(<272553..>273791)
                     /locus_tag="MRET_0168"
                     /note="MRES_02675"
                     /db_xref="GeneID:38736934"
     mRNA            complement(join(<272553..272561,272632..272682,
                     272721..>273791))
                     /locus_tag="MRET_0168"
                     /product="centractin"
                     /transcript_id="XM_027626795.1"
                     /db_xref="GeneID:38736934"
     CDS             complement(join(272553..272561,272632..272682,
                     272721..273791))
                     /locus_tag="MRET_0168"
                     /codon_start=1
                     /product="centractin"
                     /protein_id="XP_027482927.1"
                     /db_xref="GeneID:38736934"
                     /translation="MATEFDDVLTNQPVVIDNGSGTVKAGFAGQDTPKCFFPTCVGRP
                     KHTRAMAGAVEGDRFIGRKAQELRGLLRMKYPMEHGIVEDWEDMELIWNHIYNDELKT
                     LSEEHPVLLTEAPLNPRANRETAAQIFFETFNVPAMYVSIQAILSLYSSGRTTGVVLD
                     SGDGVTHAVPVYEGFAMPHAIRRIDVAGRDVTEHLQYLLRRSGYYLHTSAEKEIVRAM
                     KEKCCQLALPGHQDSHQDMNRIMEFSLPDGNTVKLGYERYRAPESLFNPELIGREDVG
                     TQQVLLDAIGRADLDLRRHLYGNIVLSGGTTLLRGYGERLLYEMKRLAPPDMKIKISA
                     PPERKYSTWIGGSIFAGLSTFRKMWISADAYQEDPGIIHRTF"
     gene            <273928..>276498
                     /locus_tag="MRET_0169"
                     /note="MRES_02670"
                     /db_xref="GeneID:38736935"
     mRNA            <273928..>276498
                     /locus_tag="MRET_0169"
                     /product="alpha-1,3-glucosyltransferase"
                     /transcript_id="XM_027626796.1"
                     /db_xref="GeneID:38736935"
     CDS             273928..276498
                     /locus_tag="MRET_0169"
                     /codon_start=1
                     /product="alpha-1,3-glucosyltransferase"
                     /protein_id="XP_027482928.1"
                     /db_xref="GeneID:38736935"
                     /translation="MKKSTGIAATGGHLSGWRDADIDRSSDVPSGTAHMPARKLRPRL
                     SASSVGSHGASSTMPPPAQPASRLQSIHDDECLSAHSSRRTKSRVLDDRLSAKSGRTR
                     AGMDRSDAVSLHALSSHSRVLWSSTASARTESASDARSRDRIAHWREQHVQALEQDAR
                     AANKKSRKSMDHIPSQRYKQGREEPSISSETPLRCLLRYLAHEDLQDSIWWLGLLLAC
                     LLRALVGLGGWSGRGKPPMYGDFEAQRHWMELTWHLPTGQWYRHDLPYWGLDYPPLTA
                     WTSWLCAWVALWFVPLQEAFALLTSRGDESSAVVVFMRLSVLALDVLLYLPSLAWFLS
                     RRLETRSIRVRHIALLTAWFQPALILIDHGHFQYNNVMLGLAALSFTLLQSKLPNVHA
                     SITGPAVATAELQRLVLDTLSRHISLQYVLAAVFFSMSLCFKQMALYYAPAVFAIMLG
                     RCAGLMQCHWLRGLALFAGLGGATLGTFALLFLPWLPRRAELKQVGLRIFPLARGLFE
                     DKVANIWCALSVLPVGPRWKLQRMFGVETLAKMSLLTVLLAILPCCILLFMASVESVR
                     RELIMDDAQAEQVVAKVRRRAGSVASGVSHRMTPSVRGENYARSAHDSSRGSDRHSVA
                     SGSLFGGSTSTLMRDAGPHRTRPPTSIKSTSYRTSVTPSPAADLLPYTLVSTSMAFFL
                     FGFQTHEKSILLPLLPLTLIMTARGDRTGAGAVAADWEWAVLANNVGMFSMWPLLLRD
                     GQGLAWWVLLLLWNGMVGYRPWEALRSTRATFVAWLSAAVHAGMLLMMLAQASVAVLP
                     PHASGWLSALFQRYPDLFPVLNVLLCMPVFMLVWLWSLKKHVEITLASGVLVVTKSIK
                     "
     gene            complement(<276522..>277331)
                     /locus_tag="MRET_0170"
                     /note="MRES_02665"
                     /db_xref="GeneID:38736936"
     mRNA            complement(<276522..>277331)
                     /locus_tag="MRET_0170"
                     /product="translocation protein SEC62"
                     /transcript_id="XM_027626797.1"
                     /db_xref="GeneID:38736936"
     CDS             complement(276522..277331)
                     /locus_tag="MRET_0170"
                     /codon_start=1
                     /product="translocation protein SEC62"
                     /protein_id="XP_027482867.1"
                     /db_xref="GeneID:38736936"
                     /translation="MDRQKTAPPEVRNVVNFLRNKAQMKTRTGILGGQRVEYFKGNAA
                     IKAVLSPEYAKLKNVPPVSNEEEADRMLHSFLPYAFFLRVDRGEAPPAGKDGPAPRPL
                     QVVQMQMFEKDMHYVWLYEGMQLYQKLAGLGLVVALLSLVMFPLWPYFLRRGVYYLSL
                     GVLALFGLLMVIAVIRLILWLITIIVLPPGIWIFPNLFADVGVIESFIPLWAWDVPPE
                     KKKIKRAGKKKTKKTAAEPAAETETATATATDEPKEASQVAQDPQDYTDIN"
     gene            <277457..>281179
                     /locus_tag="MRET_0171"
                     /note="MRES_02660"
                     /db_xref="GeneID:38736937"
     mRNA            <277457..>281179
                     /locus_tag="MRET_0171"
                     /product="condensin complex subunit 1"
                     /transcript_id="XM_027626798.1"
                     /db_xref="GeneID:38736937"
     CDS             277457..281179
                     /locus_tag="MRET_0171"
                     /codon_start=1
                     /product="condensin complex subunit 1"
                     /protein_id="XP_027482866.1"
                     /db_xref="GeneID:38736937"
                     /translation="MDVEAAESAPSSSSFDLAEQLLRLQEDDLDLEYDVASFDSEAQQ
                     SHITRIVDAVALSATSVQDANIYQCILCSIKCVGSMHSDLSHRLLDTLLSGMNVILDE
                     IADMEPTTVASYTEPLERYAFLLKWMTEMMEKHRDQHGSSDKGLKRAAASTRKGDVSW
                     TWTSSLPSVLTLMSKTLRIVSERMWSSKAMRDTFVSRCILQPVMLCQENEAYLKVQVI
                     KQGMFKVLCLAVKLHGQAFHVQTSILQALQYYEHLAEPMAELLGVMRTDFDIERLGED
                     VLRDLAAKSFTSLDTKSPRSFGRFLVRMTELNPRTVLKQMSLLERQQESESYPIRNAM
                     IEVHGLLIKYLSMSEDDVDIAPNEDDEDDDRSAPQKQMDMLFERLFERFLDLTTFVRT
                     KVIQVCSKLCDIPAKLPAQRLRMTSLAIRSLEDKGSHVRRNAISLLIKLLLTHPYGVL
                     HGGELDARVWTERRDVVRAELARAEERLEFPVTDVEQEAPPDKTKPRRSDLDLDALAA
                     SQQSMTQAEQDHLVKLRLTVTYYDDALHFVHMVEQGVPILIQLLASTNKAEVLESMEF
                     FRVAHEYKVRGAADGVRAMVHLIWAKDNALIMEDGSQIKGVRSRLMEVYRSLYFSAYP
                     GLSRAEQVARVCRNMIERTFGATLAELTSLEQLFCLMHAEGLVERAVVDKLWEVYAST
                     RPISRAQRRGSIMVLSMLAKAERELVADKMDVLLRIGLGTLGARDLVLCKHTCIALQH
                     VSGSAKKIKGALSDENVRYPMHHTMFTRLSAVIEMTTDVIGRHPEWFSVAEAAIDAMY
                     LLGEQPDAMCTDIVRRMSYAAFTPTGRAADDAYRMAQLVFVVGHMGLKQMVYLELVER
                     EFKRRKSVRDASNDSSSKRTSELDQVAEQAEDDIGDTMAWVREHELLFGPQSLLACYG
                     TLVPFICSNTRQYPDAYLQRAAALTLCKFMCISSEYCEANLGLLLHILRTSKDAVVRA
                     NAVIGLGDVAVCFGTLVDENSERLFAGLGDADLGVKKNTLMVLTHLILNGMIKVKGQL
                     GELAKCLEDDEMRVSDLAKLFFSELAMKENAVYNHLPDIISHLSTGEHAVDETTFMNT
                     MRFIFTFIDKERQAENVIEKLCQRFRLTTEERSWRDIAYCLSLLPYRSERSIKKLVDA
                     LPFYQDKLYVPEVHQRFTEILTKMHQGKVSAAAKAGDTDLREFEDALHQAAAQGTQDQ
                     AMEEATHAQAAKLEKRQAPQTRHRTRRARQTRPAHP"
     gene            complement(<281130..>282974)
                     /locus_tag="MRET_0172"
                     /note="MRES_02655"
                     /db_xref="GeneID:38736938"
     mRNA            complement(<281130..>282974)
                     /locus_tag="MRET_0172"
                     /product="cwfJ domain protein"
                     /transcript_id="XM_027626799.1"
                     /db_xref="GeneID:38736938"
     CDS             complement(281130..282974)
                     /locus_tag="MRET_0172"
                     /codon_start=1
                     /product="cwfJ domain protein"
                     /protein_id="XP_027482869.1"
                     /db_xref="GeneID:38736938"
                     /translation="MTARKVLFLGPPQGRVRAMVEKTVAINEKYGPFAAAFIVGDVFS
                     PQKEPGEDERALLDGSLHMPMPTYFFHGTSMPSYLASHIHEKCPDHCGIACMAPNLYY
                     LGSAGVALIQGWRVAFCGGVWAADADPMQWRKPTGTDDTMPDTWSTWDALDSSAASEA
                     ALQSLLRHPFLALGEACAPEPPRDPESLQQVRAWQYAQGAFEFQQEQDVQALGKRRAI
                     DFLLTNAWPRGVDMLSGVPLDESIRATGLAPIARLAEACRPRYHIAHVQPSIATTDGV
                     FWEREPYENWPFVKMPPPTIPSITRFVSLAHAANSSKQRWFLALQVVPSDELLASSDT
                     HHYAPTHTTPAPLWQERPAKVIPPKRAPIEDFPAPRRKRRQKGREPIEPSSCWFCLSN
                     PAVEKHLIVTIGTECYLALPKGQLPVSSDASALVPGGGHVLIVPIAHTPSLHASEAAA
                     SSGALRAELAQWKRALAECYASFEAVPVTWEIVRRASRVAHAHVQVVPLARELQADYA
                     AYVREAAEREGWRWESEDVTAAWTSECTQDRSDYFYMTIGDIRLLLLLDGERFNMQFA
                     RETLASFLGMPERADWHACVQNPEIERAERDEFKDALAEFAAHVVSDA"
     gene            <283073..>283401
                     /locus_tag="MRET_0173"
                     /db_xref="GeneID:38736939"
     mRNA            join(<283073..283128,283154..283245,283274..>283401)
                     /locus_tag="MRET_0173"
                     /product="vacuolar ATPase assembly integral membrane
                     protein VMA21"
                     /transcript_id="XM_027626800.1"
                     /db_xref="GeneID:38736939"
     CDS             join(283073..283128,283154..283245,283274..283401)
                     /locus_tag="MRET_0173"
                     /codon_start=1
                     /product="vacuolar ATPase assembly integral membrane
                     protein VMA21"
                     /protein_id="XP_027482868.1"
                     /db_xref="GeneID:38736939"
                     /translation="MSIDVTPSRVGPPGPDPARGVYYKLAFFSTALFVLPIVAYYYAK
                     DRWLGGDAVYAGGLAALVANLVLAGYIVAACLEDDGTQSQRRAKKTQ"
     gene            complement(<283408..>284011)
                     /locus_tag="MRET_0174"
                     /note="MRES_02650"
                     /db_xref="GeneID:38736940"
     mRNA            complement(join(<283408..283511,283538..283693,
                     283723..>284011))
                     /locus_tag="MRET_0174"
                     /product="N-alpha-acetyltransferase 30"
                     /transcript_id="XM_027626801.1"
                     /db_xref="GeneID:38736940"
     CDS             complement(join(283408..283511,283538..283693,
                     283723..284011))
                     /locus_tag="MRET_0174"
                     /codon_start=1
                     /product="N-alpha-acetyltransferase 30"
                     /protein_id="XP_027482863.1"
                     /db_xref="GeneID:38736940"
                     /translation="MDAHVASHVRIDTYRKEEDLKDVMRLIEKELSEPYHIYTYRYFL
                     HDWPDLSFLAWWEEQAVGVIVCKLDRHMRGSRLMRGYIAMLSVDPRYRGQGIATKLVS
                     AAVQRMKERGAEEVVLETEVTNKSALRLYENRGFVREKRLYRFYLNGNDAFRLVLPIA
                     EPHIPKAPPLPPRHPLGLGPIM"
     gene            <284192..>285136
                     /locus_tag="MRET_0175"
                     /db_xref="GeneID:38736941"
     mRNA            <284192..>285136
                     /locus_tag="MRET_0175"
                     /product="alpha/beta-hydrolase"
                     /transcript_id="XM_027626802.1"
                     /db_xref="GeneID:38736941"
     CDS             284192..285136
                     /locus_tag="MRET_0175"
                     /codon_start=1
                     /product="alpha/beta-hydrolase"
                     /protein_id="XP_027482862.1"
                     /db_xref="GeneID:38736941"
                     /translation="MWPLKNLVIYALSYGLRILDWIQIALSRRCRVVASNDVKIELIR
                     FPSRDSGRYIRAYRYTPANATGKLPVYLHWHASGWILKRLGIDIHLCSRISKELNCVV
                     LECDYRKAPENKYPAAHNDTEDAVLYVLANEHAYDTTRISVGGSSAGGNMALSLSARL
                     GSERIKSCFALYPAAHLTHPERLDTVMGCVSDKFRSGVVIPHWCMKLFINAYTTPGTD
                     MNDPRLSPIFYDASKFPKYVAVACGDADTLYRMSFDLMKKISGSASGTNVDGSRKFIC
                     VLNEAHEFNTFGRTRASQEERDRVEGEAINMIRASWRQ"
     gene            <285242..>286357
                     /locus_tag="MRET_0176"
                     /note="MRES_02645"
                     /db_xref="GeneID:38736942"
     mRNA            <285242..>286357
                     /locus_tag="MRET_0176"
                     /product="alpha/beta-hydrolase"
                     /transcript_id="XM_027626803.1"
                     /db_xref="GeneID:38736942"
     CDS             285242..286357
                     /locus_tag="MRET_0176"
                     /codon_start=1
                     /product="alpha/beta-hydrolase"
                     /protein_id="XP_027482865.1"
                     /db_xref="GeneID:38736942"
                     /translation="MDLPTERSQRVHHEWSLRYVGLLFIIAFLRTMAYVEVFLTDKLR
                     PKVKDDVKVTKIWFPSREKGRYIKAFIYEPVSMPTGPRPVNINVHGSGFCSAAFFGNS
                     RWFNYCVASKLQCYVIDTDYRKAPEHPCPLPVRDIEDAVQWVLQHPEKFDVDRISMTG
                     FSAGGNLALSAASAFGPEKIKALVSYYAPLDGSAAGAPVGDANGHPPKSPFRSGVILD
                     SFVFSVFYAAYVPPQCDPGHPNLSVINIPLEKLPDHLFLITGDADSLATESIRFYDNI
                     MENGSRDQKYHSRLLIVPNEAHAFDEQPKHPESVHWRDKAYQQSVDVIRSAWYPDDGE
                     PSNPPVAKPAPKAIISFVTQQSAGAKDSSKPAPAIRA"
     gene            complement(<286359..>287688)
                     /locus_tag="MRET_0177"
                     /db_xref="GeneID:38736943"
     mRNA            complement(join(<286359..287579,287605..>287688))
                     /locus_tag="MRET_0177"
                     /product="alpha-1,2-glucosyltransferase"
                     /transcript_id="XM_027626804.1"
                     /db_xref="GeneID:38736943"
     CDS             complement(join(286359..287579,287605..287688))
                     /locus_tag="MRET_0177"
                     /codon_start=1
                     /product="alpha-1,2-glucosyltransferase"
                     /protein_id="XP_027482864.1"
                     /db_xref="GeneID:38736943"
                     /translation="MAFAFAWHVATTIGTSVLVNQHLKEPYMDEIFHTPQFIRYCQGQ
                     WNKWDPMLTTPPGPYLVTLALRPFMQVLGFFRACDDVMAIRSTNVLALLSLPLLCMGV
                     LRARGCSDPGFVPYICASLPPLWFFGFLYYTDVLSVIAIIASVGAMERKHHVQASLWG
                     SAALFFRQTNIVWVLFIMGVAALRECQRVAGVSPRITPPITTLLVQRSVWMRIIRTVS
                     PYVPIFPAFMLFIQWNDGAIVLGDKSHHQVALHLAQVGYFFGFALTFGWPLIFFLVPM
                     RWGKVHAMVSVVLLTMGVLAVRYGTIVHPFLLADNRHYTFYVWRRIINARLWTRYALV
                     PVYVFSAMSFVRILSKKQSGLWILGWLLATCLTLVPSPLIEPRYLILPYLMMRLYMPT
                     TTRKQEIIEWVFYMMVNALTMTLFIGYPFTWAHEPGTQRFMW"
     gene            <288959..>289339
                     /locus_tag="MRET_0178"
                     /db_xref="GeneID:38736944"
     mRNA            <288959..>289339
                     /locus_tag="MRET_0178"
                     /product="tyrosine-protein kinase srms"
                     /transcript_id="XM_027626805.1"
                     /db_xref="GeneID:38736944"
     CDS             288959..289339
                     /locus_tag="MRET_0178"
                     /codon_start=1
                     /product="tyrosine-protein kinase srms"
                     /protein_id="XP_027482861.1"
                     /db_xref="GeneID:38736944"
                     /translation="MEEGGLFDEQPHAYEAAKDAAALASLKAMQELSAAGILSIRDFA
                     FSEDDQRHRGFGSVLPSQAKEEQCMYIALYDFQAEADNELSVEAGMPVQILALLTDGW
                     VLARQVDHPEHTGLIPYTYLQPIG"
     gene            complement(<289369..>291363)
                     /locus_tag="MRET_0179"
                     /db_xref="GeneID:38736945"
     mRNA            complement(<289369..>291363)
                     /locus_tag="MRET_0179"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626806.1"
                     /db_xref="GeneID:38736945"
     CDS             complement(289369..291363)
                     /locus_tag="MRET_0179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482860.1"
                     /db_xref="GeneID:38736945"
                     /translation="MMRSRHIPFLRYVPRTASPRRLPSRAAQQRTWERRSWCMSRVPY
                     PPSLHASIHTTCIAYDKQSNMNMHACLDPLEMDQEATSQAVHTHTLISNMNALALVLQ
                     NIPTVSKDLWNQLVHFYLDAMQRMTPSAACEVFCTLAELTDKSQPIDESTRVRVCNEG
                     IRVLTYHIEKNQDTINKPTQDTWRAVQVLGRPRVQDMTWFFRKLVLQNKLSEATFFLS
                     DFIKQSWHHDTTPPSRALMHTLMIQMLLVKRVIQLKPAPMEGHFCASRSLYYQYADAL
                     VRLGELLEYNYLPLVPTHKEDITWLIKLLTTFTKLQHESACSNHFRKRIASVLEGFIN
                     HLPCGRAVSETSHQTGPKRSCRLDRMTHFTPVLTERAYNVLLYYTLYIIKKRTWCQMV
                     LDHMIQKRSPSVAPGLVTGNILLQKSTRLRDAKMGGISAEIGMSWREPSTQDDTEKMR
                     QERLLAHLDCAISDNNSYRAYALIQHIAHTRMKNRRWANGFRATSVVLRMYPELRNNR
                     PRERIPFMHHSQFYILAMCLAVRAGNMLLMLRVFHLCKLSCIFRGWQVPETVAMRFML
                     LLAQHVTYQRRHTHEHLETTKEIRAIALEEYTWIMRHSRRIGKLPPTSMYEPLLRFLY
                     QTAHAVPNSNPDVLRIKNDMNAMKLAKQPTSREGTHEKDA"
     gene            complement(<291823..>293112)
                     /locus_tag="MRET_0180"
                     /note="MRES_02640"
                     /db_xref="GeneID:38736946"
     mRNA            complement(<291823..>293112)
                     /locus_tag="MRET_0180"
                     /product="mannose-6-phosphate isomerase"
                     /transcript_id="XM_027626807.1"
                     /db_xref="GeneID:38736946"
     CDS             complement(291823..293112)
                     /locus_tag="MRET_0180"
                     /codon_start=1
                     /product="mannose-6-phosphate isomerase"
                     /protein_id="XP_027483176.1"
                     /db_xref="GeneID:38736946"
                     /translation="MWTLIPGVQSYEWGVPGGAPNSLVADFAESTPELHFQREANKPY
                     AELWMGTHPNVPSRVIQTDGSQVSLNDILRNDHSLLGSNIVKRFGADNSCGALPFLFK
                     VLSINKALSIQAHPDKALAEQLHQQKPTMYKDDNHKPEMAIAIQAFEGFCGFRPVKEV
                     RDFVTRVPELRTVLGADGVMDKRLQEAVDAQSRGDEKACVRDTIKLVFGALMRADPQV
                     YEPAVSSLAERYERGTDEVSEEVRALIVRLNQQYPKDVGVLCTFFLNVVHLERGQAMF
                     LGADEPHAYLSGHILECMAASDNVVRAGLTPKARDVEVLVDMLTYESKDAAAQRLDAP
                     VWDGDSRKGTVIYNPPIPEFAVLLTTLAPGACSDHRALDGPSIIIATEGSGTYTVNGK
                     KAEVHTGRVFFIEANQALQITAGASGLIVARAFVEVA"
     gene            complement(<293256..>296419)
                     /locus_tag="MRET_0181"
                     /note="MRES_02635"
                     /db_xref="GeneID:38736947"
     mRNA            complement(join(<293256..296387,296417..>296419))
                     /locus_tag="MRET_0181"
                     /product="5'-3' exoribonuclease 2"
                     /transcript_id="XM_027626808.1"
                     /db_xref="GeneID:38736947"
     CDS             complement(join(293256..296387,296417..296419))
                     /locus_tag="MRET_0181"
                     /codon_start=1
                     /product="5'-3' exoribonuclease 2"
                     /protein_id="XP_027483177.1"
                     /db_xref="GeneID:38736947"
                     /translation="MGVPALFRWLSKKYPKIVQSVEEEEPGHMPGPDGHMVDIPIDIS
                     RPNPNGEEYDCLYLDMNGIVHPCTHPEGKPPPETEEDMMIEVFKYTDRVINMIRPRKF
                     LMLAIDGVAPRAKMNQQRSRRFRSAQDAKILHEQREQELEERKKKGLAGEEEAIQKSW
                     DSNVITPGTPFMDLLASSLRYWIAHKLNTDPGWKNLCVVLSDASVPGEGEHKIMDYIR
                     RKRSDPNHDPNMRHVIYGLDADLIMLSLATHEPHFKVLREDVFAQDAKHRGCHRCGQK
                     GHIAAHCRGEARKEDAKPLQKKPFIFLDVPTLREYLNVELQTPGIPFAFDLERAIDDW
                     VFLIFFVGNDFLPHLPSLEIREGAIDTLLKIWKRELPNMSGYVTNNGKVELANAQFIL
                     DGLAQAEDDIFRKRKEVEDRQEANKRRHTSNYSEAQHGDTTYVGHAKVIPPRPVAPPT
                     IGPSKSVPGSRNKGPIMLDGDNADVVKNRAQIRMANISAAEQLKMELSQGQGIKRTSS
                     PVEKESKRIKADPEESAPVKEEDVLGDDSIKAEEDDDDEEVPPETKMLERKINADGTV
                     EYQDTVKLWEPGYRERYYRQKFGVELSDTKFRREVVQAYVEGLCWVLAYYYQGCPSWK
                     WYYPYHYAPFAADFTDMHTMQITFEKGEPFRPFEQLMGVLPAASKNNLPKPFQWLMTD
                     PESEILDFYPAEFLVDMNGKKMAWQGVALLPFIDEKRLLDALHKRYDQLTDEEVRRNS
                     FGRNVLFVSDDADLYPTLSQLYAKRSDKRAVHIDTARIPQMAGSLAADTTCVPGATYY
                     SPLHSLPDMQDIPHDRSISAHYEFPEQRVPHRSVLLQGVRMPSRRLTPADQDWIRRGG
                     RGQGGGRGRGRRDGWNDQGVLYGRDARPPSQSPYGAGPYGGGPYGGGPYGGGPYGAAY
                     GSGPYGAGPYGGGAYGAGPYGAGPYGGGPHGGGPYGTGPYGGGPYGGGPYGGGPYGGG
                     PYGGGPYGGGPYGGGPYGGGPYGAGPYGASAYGSSPYGAGPYAGSAYGSAYGQNQTGY
                     GALPYRGYGAPRGR"
     gene            <296583..>297346
                     /locus_tag="MRET_0182"
                     /db_xref="GeneID:38736948"
     mRNA            join(<296583..296792,296820..296903,296937..297134,
                     297167..>297346)
                     /locus_tag="MRET_0182"
                     /product="PITH domain protein"
                     /transcript_id="XM_027626809.1"
                     /db_xref="GeneID:38736948"
     CDS             join(296583..296792,296820..296903,296937..297134,
                     297167..297346)
                     /locus_tag="MRET_0182"
                     /codon_start=1
                     /product="PITH domain protein"
                     /protein_id="XP_027483178.1"
                     /db_xref="GeneID:38736948"
                     /translation="MQHGVRGEATPQDLATQQGINAGSNLYAYIDHERVWGVNIEPPE
                     SAKKACKPWDERQSLETWIESGVDDQMILHVPFTCPVCIESILLYPGRSDLSVRRCAA
                     FVNRPNGIDFDDALAVLDGRLGPASTGRAQADFALLPGATDVTAYPVSVSRFSHTSSV
                     SLLLLDSLAHTSSRMYYVGFIGKALDPRSDTLHRHDVPAETSATHKVDGVGSFLGAAS
                     TPSVR"
     gene            complement(<297385..>297713)
                     /locus_tag="MRET_0183"
                     /db_xref="GeneID:38736949"
     mRNA            complement(join(<297385..297457,297484..297513,
                     297540..297608,297637..>297713))
                     /locus_tag="MRET_0183"
                     /product="NADH dehydrogenase (ubiquinone) 1 beta
                     subcomplex subunit 7"
                     /transcript_id="XM_027626810.1"
                     /db_xref="GeneID:38736949"
     CDS             complement(join(297385..297457,297484..297513,
                     297540..297608,297637..297713))
                     /locus_tag="MRET_0183"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 beta
                     subcomplex subunit 7"
                     /protein_id="XP_027483179.1"
                     /db_xref="GeneID:38736949"
                     /translation="MTDHTASVAEANAARLPLGYRDSCSALLIPLNKCRRKTFYAPWE
                     CENERHTYERCQYQDFLQRQKKLQQLVAEKAAAAAAED"
     gene            <297880..>298330
                     /locus_tag="MRET_0184"
                     /db_xref="GeneID:38736950"
     mRNA            join(<297880..297958,298003..298268,298304..>298330)
                     /locus_tag="MRET_0184"
                     /product="small subunit ribosomal protein YMR-31"
                     /transcript_id="XM_027626811.1"
                     /db_xref="GeneID:38736950"
     CDS             join(297880..297958,298003..298268,298304..298330)
                     /locus_tag="MRET_0184"
                     /codon_start=1
                     /product="small subunit ribosomal protein YMR-31"
                     /protein_id="XP_027483180.1"
                     /db_xref="GeneID:38736950"
                     /translation="MLRPTLIRAAHVHKPLIRFPDRRAPKTPHDPQPHPSAPEEVAKN
                     FDNFRKILETGPHFDPAKLKPFSLESSQPKVGGSASSSAKADAVDTLFDLPPRFWNTP
                     SMRMSPAEMDAVQSGGASLFD"
     gene            <298497..>299498
                     /locus_tag="MRET_0185"
                     /note="MRES_02630"
                     /db_xref="GeneID:38736951"
     mRNA            <298497..>299498
                     /locus_tag="MRET_0185"
                     /product="syntaxin 16"
                     /transcript_id="XM_027626812.1"
                     /db_xref="GeneID:38736951"
     CDS             298497..299498
                     /locus_tag="MRET_0185"
                     /codon_start=1
                     /product="syntaxin 16"
                     /protein_id="XP_027483181.1"
                     /db_xref="GeneID:38736951"
                     /translation="MPSAGSSNSNYYTPSEQPSAIGVTRSRTLFFLSIRDSIVPSGHG
                     SGASAPLLGDNENHVYFDADKSTIPMPAELPPFWVDATEDADSLLSGMIPTLAELDRL
                     HAQHLLPSFADKTPLKRQIEALTSGITSEFRQASQLVAKLAAQTTDAMRSQKLSKYEM
                     TAARNAQTALATRVQQMSAMFRQKQSQYLRKLQGMEVKERGDTAMFDSVKSMQEDVAL
                     SEQLQGEQEMRLVDTDDSEAMFHERDREITQIARSIGELAQLFQDLSALVIEQGSMLD
                     RIDYHIDSMAMNMQHSSSELNRASTYQVGAGRRSMILLLLLCIALLVAILIIRPFFR"
     gene            complement(<299503..>301068)
                     /locus_tag="MRET_0186"
                     /note="MRES_02625"
                     /db_xref="GeneID:38736952"
     mRNA            complement(<299503..>301068)
                     /locus_tag="MRET_0186"
                     /product="protein NAR1"
                     /transcript_id="XM_027626813.1"
                     /db_xref="GeneID:38736952"
     CDS             complement(299503..301068)
                     /locus_tag="MRET_0186"
                     /codon_start=1
                     /product="protein NAR1"
                     /protein_id="XP_027483182.1"
                     /db_xref="GeneID:38736952"
                     /translation="MAFSGALTLTDLNDYLGPSQACIKPVEAPQSASGAPESTISMED
                     GVYVEAPVGAPRARTQLETAQISLNDCLACSGCVTSAETVLIGVQSLDEVRKELQRKD
                     DRIFVASISSQTMASLQARMALPMHAVWDRVTRSLRSIGFDVVQDMALARHMSLMETV
                     REFRTRYQARWHGTKDAPKLPMLASACPGWVCYAEKAHAELLPYVATTKSPQQLAGLL
                     AKRVWGPQCRGRDMSDENAQYVYHVAVMPCYDKKLEAARQEPGQASKEVDCVLTTGEL
                     YDLTIDVDVSAKAEQTSLTWPPEPGSSSGGYLFAVLLDAYVSWTQAHPDTQPLVELRT
                     IRSSDYTEYTLRAPDGTVIFKGATCYGFRNIQNLVRKVQRETGAKSSRGRGRMRSMVT
                     ADQQHPYDYVEVMACPGGCVNGGGQLRPPEDWAHAIETEAQNSTVQGWQGTDRRWVQH
                     VEDAYWNDENRKVSVESASALLEDAARGSLRSWLNTWDERASDMVRRFPHGDLHTTFH
                     AVASSTDGLSVQW"
     gene            <301161..>301709
                     /locus_tag="MRET_0187"
                     /note="MRES_02620"
                     /db_xref="GeneID:38736953"
     mRNA            <301161..>301709
                     /locus_tag="MRET_0187"
                     /product="U3 small nucleolar ribonucleoprotein IMP3"
                     /transcript_id="XM_027626814.1"
                     /db_xref="GeneID:38736953"
     CDS             301161..301709
                     /locus_tag="MRET_0187"
                     /codon_start=1
                     /product="U3 small nucleolar ribonucleoprotein IMP3"
                     /protein_id="XP_027483183.1"
                     /db_xref="GeneID:38736953"
                     /translation="MRQLKFHERKLLKKHDFLQWRNEHNIREIQVMRRYHIQDRDDYH
                     KYNVLVGKTRQLALRLSTLPATDSFRAQHESMLLNKLYDMGLLDTGAKMSDIMERLNV
                     SAFCRRRLPVVMVRLHMSESVSQAVKYVEQGHVRVGPDTINDPAFLVTRSMEDFVTWV
                     DTSKIRRAIANYNDELDDFDLL"
     gene            complement(<301715..>303271)
                     /locus_tag="MRET_0188"
                     /note="MRES_02615"
                     /db_xref="GeneID:38736954"
     mRNA            complement(<301715..>303271)
                     /locus_tag="MRET_0188"
                     /product="intermediate cleaving peptidase 55"
                     /transcript_id="XM_027626815.1"
                     /db_xref="GeneID:38736954"
     CDS             complement(301715..303271)
                     /locus_tag="MRET_0188"
                     /codon_start=1
                     /product="intermediate cleaving peptidase 55"
                     /protein_id="XP_027483184.1"
                     /db_xref="GeneID:38736954"
                     /translation="MMRTWRYALRRGVRTLSSASRPPACGQPLPHTHPHLFPIDFRMG
                     TNPVDGGGVAFDHLTPGIPATEYENRRRALMDRLPPNSVVVLMGGRIKYMSRNIFYKF
                     RQESNFWYLTGMQEPDAALVLEKTGHGERGYKMTMFVEPRQAHKEVWDGPSCGMDGAT
                     RIFGADEALPNDPAIMLQFFKTAVANADQLYVDLPAQVSTPRISQRTPRFSIHEFLAP
                     SSPSGYDLFVRKTDFDNVVKLFSDRRNTHSLQREMDVLRSRKSKNELQVMRHAGAISG
                     QAMSKVMRAVHPGMQEAEAQALFEYECARRGAERQAYVPVFASGRHGLMIHYVRNDGV
                     MGEHDVMSVDAGCEFRGYASDITRTMPTSSDGRFTSAQRDLYEALLRTLKGCTALATS
                     RQGYTLAGLHRRSVEMLSAELRDLGFHLSFGSLERILYPHYIGHWLGIDLHDTSTVER
                     ATRLEEGMVLTIEPGLYVPDDPMYPEAFRGLGMRVEDDVAVGYDDNIILSADAPKEVA
                     DIEAVCGNRI"
     gene            <303391..>305613
                     /locus_tag="MRET_0189"
                     /note="MRES_02610"
                     /db_xref="GeneID:38736955"
     mRNA            <303391..>305613
                     /locus_tag="MRET_0189"
                     /product="kinesin family member 20"
                     /transcript_id="XM_027626816.1"
                     /db_xref="GeneID:38736955"
     CDS             303391..305613
                     /locus_tag="MRET_0189"
                     /codon_start=1
                     /product="kinesin family member 20"
                     /protein_id="XP_027483185.1"
                     /db_xref="GeneID:38736955"
                     /translation="MAAVEPRAMQTPKKLRSPLKSSVHTQNSMAGTRTPSTSSLARST
                     EQGVSNEPIQTFLRIRPPLSEPDNESCIDVLSDTQVVMHVPSDTQLSKSRSRSTTAAP
                     IKYTFSRVFAPLPHGTQNHAQAQQDFFTATTLPLVEDVLAGKNSLVFTYGVTNSGKTY
                     TVQGPHRRGEAGILPRAIDVIFNSIAGRECTKAVRPVGLTGVHPGISDPSQSLLASRS
                     RTKLKTNHRTMMTPTSARDAEGAVDMDPTSVEVNPDYRYSVWVSYVEVYNEKLYDLLE
                     SPTQSLLTRPDRSDNESTTPAPTRRPLLLKSEAESGGKFVSGLKEIKVSSILEARELI
                     RCGMENRSVFGTMANRSSSRSHSVFTIKILREHTGVDVPLNDVAGLSRKYSVSRLSIV
                     DLAGSERISNTDISSGPRLKEAGSINKSLMCLGQCLETMRKNQTRAGISPSIPDRLSS
                     SSGLHDAQRKRRQSIVPFRHSKLTELFQSFFMGDGKVRMIVNLNPTGTGFEENANVMR
                     FSAMAKEVGIHVTSSAAPASDVSSSFVHDTSVVEMSHVSDDEDDDEEQDEFVNMLLAE
                     NQRLRLQCERAESACRIVEETVRSEMGQHLAATLQKMQRYYEHQLQAEIDASDAFMDR
                     KIDLFTRLTQAVHDEPVSANSNVTTEDNIMIPPNRILSESRNHINYTSEPSTDSTAQR
                     TSPRPKHAPTRTSISAEESQDAVYLSEPSSPSKRYRKLCQKTAIHTDEMDMIAQDLNA
                     "
     gene            <305724..>306980
                     /locus_tag="MRET_0190"
                     /note="MRES_02605"
                     /db_xref="GeneID:38736956"
     mRNA            <305724..>306980
                     /locus_tag="MRET_0190"
                     /product="RNA recognition motif domain protein"
                     /transcript_id="XM_027626817.1"
                     /db_xref="GeneID:38736956"
     CDS             305724..306980
                     /locus_tag="MRET_0190"
                     /codon_start=1
                     /product="RNA recognition motif domain protein"
                     /protein_id="XP_027483118.1"
                     /db_xref="GeneID:38736956"
                     /translation="MSESRDLTNKEQRMARKAQRQKEREENTNKSKKRSCLDEEEKGQ
                     DSVDSNQTDDSRVEHREHESDGEVEAISHKEQRKRRKMEKYMSQHSEGDVNTRPSKPQ
                     RSPYSVWIGNLAFSTSVEELTEWLQEQGIEGISRVHMISGVRREEHNRGFAYVDLPSQ
                     DQVERCIALSESELKGRNLLIKGGTDFRGRPGLDPKAAELGSDANHGRTGLSKTAQRI
                     LRSQKNPPAPTLFLGNLSFETKESDIYDLLEGSAQKRYEETATSDESGVSASAGIRKI
                     RMGTFEDSGKCKGFAFVDFDSASLATKALIEPRNGRLLGRLLQIEFASSDAVRRGASK
                     DLLPDYVPERRRRRSRSTFNDEDTKENALEEQDYDAAQEDNHTAPRRPGASRAPRRVR
                     PGAANASAPRQNYGIVPSEGKRTTFE"
     gene            <307291..>311151
                     /locus_tag="MRET_0191"
                     /note="MRES_02600"
                     /db_xref="GeneID:38736957"
     mRNA            <307291..>311151
                     /locus_tag="MRET_0191"
                     /product="pentatricopeptide repeat protein"
                     /transcript_id="XM_027626818.1"
                     /db_xref="GeneID:38736957"
     CDS             307291..311151
                     /locus_tag="MRET_0191"
                     /codon_start=1
                     /product="pentatricopeptide repeat protein"
                     /protein_id="XP_027483117.1"
                     /db_xref="GeneID:38736957"
                     /translation="MPLSAKLAGALARYTNELSSAVTAFAPMQCGAVPLESCLTEKES
                     ATSYTRHAPASIHFNPEAKASEEQTILAPRSILQRRYSVNLGSLFSKVHKEPVKQRRK
                     SIATLFPDKIKQTTLGAVSISHNQKISKEELALITQVSPDANIDFILKEYQSLPLHVK
                     STAGAYKLLSNILSSHRSCVDVDALYEMYLSLKHYGPSPDGAIYAILVDQLCQRDLEL
                     VRHHGSSYGKDYFELALQVVCDGFYSRHLFNSSGPFNQLFRCMIPRGCIDKAIYVLSI
                     MESCIGSVKDAESFSLLIQIFSSDTVPTFPGQSLEDRQRHCLYACIQIFQSFENIASI
                     LAQKEPRCMEFSEKKCVSVWLSMIDAYFLLGDVFGAVALFERMMAAHFQDCSIPPLDE
                     QVVSHMVTGFVHVGDCRSAIQWLRHLDASHMPAPSSEALENIVRAALEDEPTQVVTSL
                     RDIAQILLSRNVLDENLYDAASLCVTNFAERLGMRIVQESLNASDLASCYKAMEELAE
                     RLFQLYDASHILVTPEQTKPVSAVLNLAAQKSLHGHAEHASALFRLCMLALRFGDPSS
                     PAIVSLLCDACHLPMAIADAAASAPHRLSDACVRLIAFSTLVLPALEGLSGSLVATTQ
                     SAVVRQYEAASRDLNNNLAPLDLDETAWKRIVDAFCSAEQSSPSAFPGPDGYTGLGKL
                     LSELSRLPHRPQLNVDNITAMLTEKYGPDGASVTHGWTNPSSKSSHASFPSRKKFSNS
                     QSNTLVRKTPHPDTVRHLYVEGLLSPDLPVIKSLDHSLSHDIQNQCRSHGSQLDVSAV
                     HNRLMASVAQGLYPTPSSLGSMINVMGRNGQVDRIDELYKLGLHALTFKHCDMQWRIW
                     QWTHLEDCMMTALSHATLEDRANIHRLRIIALGKAPSASAYAALIATIQERTDDAVVA
                     EELFNESQKLGVRPNTYLYNTIISKLSRARKAEQALRLFDEMQKSNLRPSSVTYGAAI
                     NACVRTGDESRATQLFAEMESQPMFQPRVPPYNTMIQYYVHSVRNRDKALLYYEKMQH
                     AGVRPSAHTYKLLLDAWGTIEPIQPERQQALFARLSADRLVGAQGTHWASLIHTQGVV
                     LRDLDQAKEIFDSIADRAPTVPRGKSFTSTVPDAVVYEALFAVFVAHGRTDLMPIYLS
                     RMVSQGIWPTAYIANFLIKGYAQDGPMGLVEARRVFDAMIDPPAGIAASGNHLPRHHG
                     AGALGMRRERVAIRSDSSSNELDRANVLGALVNREPSTYEAMIGAELAYGHIDRAQRI
                     LTRMKARAFPAALLNRAQAMFDRV"
     gene            <311504..>313083
                     /locus_tag="MRET_0192"
                     /note="MRES_02595"
                     /db_xref="GeneID:38736958"
     mRNA            join(<311504..311879,311918..>313083)
                     /locus_tag="MRET_0192"
                     /product="alpha 1,2-mannosyltransferase"
                     /transcript_id="XM_027626819.1"
                     /db_xref="GeneID:38736958"
     CDS             join(311504..311879,311918..313083)
                     /locus_tag="MRET_0192"
                     /codon_start=1
                     /product="alpha 1,2-mannosyltransferase"
                     /protein_id="XP_027483116.1"
                     /db_xref="GeneID:38736958"
                     /translation="MIQRPKKLALVVALFIISIVISTYVSTSSSHGPSKFRTHLQQMP
                     AYLRQKACLMSPFGVNQSSGFMEGAVSVNDIVRYSTKSSQGNYMPPEFVSSSVNQAPR
                     VKAAFIVLVRNNELDGMIQSMNDYEFRFNRKFNYPWIFLNDEPFTDEFKTEVRKRTRA
                     PTYFGLVPSEHWSYPDFIDQEKARQSRIDMDQHGVPYATSESYRHMCRFQSGFFFEHP
                     LTYELGLEYYWRVEPYVELNCDIDYDPFMFMKINNKAYGFTITLLEYEETIPTLWDHT
                     KQFMKLHPDYFASDNLVEFVIDNGDFETSNYNLCHFWSNFEIGDINFFRSKQYKDYFD
                     YLDKTGGFFYERWGDAPVHSIAASLFLNKSQVYHFKDIGYVHDGMGHCPLGEKQFHEN
                     GKCDCNVVDSVTLLEDFCMGDWWFASKEGKPSEREEYKALIDELELEDVWVEEGEGEG
                     EGEGEGEGEGEGQEDENAGDENLEVFDRRHLKKRYSSALLRQKRRARMSQQRKLKKRK
                     WLSRT"
     gene            complement(<313250..>314716)
                     /locus_tag="MRET_0193"
                     /db_xref="GeneID:38736959"
     mRNA            complement(<313250..>314716)
                     /locus_tag="MRET_0193"
                     /product="transcription initiation factor TFIID component
                     TAF4 family"
                     /transcript_id="XM_027626820.1"
                     /db_xref="GeneID:38736959"
     CDS             complement(313250..314716)
                     /locus_tag="MRET_0193"
                     /codon_start=1
                     /product="transcription initiation factor TFIID component
                     TAF4 family"
                     /protein_id="XP_027483115.1"
                     /db_xref="GeneID:38736959"
                     /translation="MEKRAESGNTNQDAGPAKKIKTESASDDALLRLPPGHPSPSAMP
                     APGSDPSVTTASPSLSNFDKLVSLAAQRSDAANGASHSNQNDAAPLNLLSQTVPSPTA
                     SSLPLSLQRLQAMRQQQQQQQKQQEVQHSATQMSNSLPSAPQTSNANPSSTSYDQLID
                     VMGYSGVDLRAEEAFIQQNGSSWEDSHTASAIHAAGLVHGLYLNVYPLSNMVHRIARQ
                     YGLSVNAATLDYLSIATRMRFRNLLESMVRASRHRAWSTHQRSPPMYLETLSDGSRKA
                     MYHEELISNPVKQLAGIEKAERIEEGNWRRMRIEREENEAAALEAGGDDGTPKGKKRT
                     GTSSRNLSEDVRKRLADSTAMRHLGANNMASKYSWLQSPSTRTTASARVRDTTEPTSA
                     SNSPAPKANSALPKPKFAPSANRRGTAAQAAHAGAWSDVALRQAAQREQERVARSRVT
                     LHDALSALEREHAGGAGSGAGRRVLYMAQAYGSGRCSL"
     gene            complement(<314859..>316708)
                     /locus_tag="MRET_0194"
                     /note="MRES_02590"
                     /db_xref="GeneID:38736960"
     mRNA            complement(join(<314859..316045,316234..>316708))
                     /locus_tag="MRET_0194"
                     /product="inosine-5'-monophosphate dehydrogenase"
                     /transcript_id="XM_027626821.1"
                     /db_xref="GeneID:38736960"
     CDS             complement(join(314859..316045,316234..316708))
                     /locus_tag="MRET_0194"
                     /codon_start=1
                     /product="inosine-5'-monophosphate dehydrogenase"
                     /protein_id="XP_027483114.1"
                     /db_xref="GeneID:38736960"
                     /translation="MAKVASSGDILPISEAKNELTKYEHSDGLSMNELIDSRKNGGLT
                     YNDFLVLPGYIDFPASKVDLRTRVTKNIVLNTPFISSPMDTVTEVQMAISIALMGGMG
                     VIHNNMSPQEQASMVRKVKMFENGFITDPMVLSTRETVGDVLEIKERLGFAGIPITES
                     GSLKSKLLGIVTARDIQFRDPSTPLVEVMTRDLVTAPLGVTLEEANRILRDSKKGKLP
                     IVNETGDLVALLARSDLLKNQDYPLASKSPESKQLYCAAAIGTRPHDRERLAMLVEAG
                     LDVVVLDSSQGNSVFQVDMIAWIKQTYPNLQVVAGNVVTREQAATLIHAGADALRVGM
                     GSGSICITQEVMAVGRPQGTAVRQVAEYAKRFGVPVIADGGIQNVGHIAKALCLGASA
                     VMMGGLLAGTTESPGEYFYREGQRLKGYRGMGSIEAMEHQSKKRRFDGSTGRASKKVD
                     EVTANAANENAATQRYFSESDAVKVAQGVSGSVQDKGSVTKFLPYLYTGLQHSLQDMG
                     VPSVDDLRDNVMSGKVRFELRTASAQLEGGVHGLQHYEKRLFVGS"
     gene            <316883..>318352
                     /locus_tag="MRET_0195"
                     /note="MRES_02585"
                     /db_xref="GeneID:38736961"
     mRNA            <316883..>318352
                     /locus_tag="MRET_0195"
                     /product="RuvB-like protein 1 (pontin 52)"
                     /transcript_id="XM_027626822.1"
                     /db_xref="GeneID:38736961"
     CDS             316883..318352
                     /locus_tag="MRET_0195"
                     /codon_start=1
                     /product="RuvB-like protein 1 (pontin 52)"
                     /protein_id="XP_027483113.1"
                     /db_xref="GeneID:38736961"
                     /translation="MMSAVAPSHSGAGAVPISNASSSSSREARIATHSHIKGLGLDEY
                     GVALPSARGFVGQKSAREACGLVLDLIRQKKFAGRALLLAGGPGTGKTALALGMAHEL
                     GHKVPFCPMVGSEVYSSEVKKTEVLMENFRRAIGLRVRETKEVYEGELTELTPTEAEN
                     PLSGYGKTIVHVVIALKTVKGTKQLRLDPSIYESILKERITVGDVIYIEANTGAVKRV
                     GRSDAYATEFDLEADEYVALPKGDVQKRKEVVQDVTLHDLDMANAKPQGGQDIMSVVS
                     QLVKGRRTEVTDKLRNEINRVVDKYIQQGIAELVPGVLFIDEVHMLDMECFTYLNRAL
                     ESTISPHVILATNRGQSTVRGTEFEGGLSAGVVAPHGIPLDLLDRCMIVRTLPYVEDE
                     IRQVIRIRTATEGIAVSEDALNKLTELGKRTSLRFALQLLAPASVLTNVMGRSEITVE
                     DIEQTTELFLDARSSARQLADVRSDAAAPSAGENAMDVA"
     gene            <318886..>320130
                     /locus_tag="MRET_0196"
                     /note="MRES_02580"
                     /db_xref="GeneID:38736962"
     mRNA            <318886..>320130
                     /locus_tag="MRET_0196"
                     /product="uroporphyrinogen decarboxylase"
                     /transcript_id="XM_027626823.1"
                     /db_xref="GeneID:38736962"
     CDS             318886..320130
                     /locus_tag="MRET_0196"
                     /codon_start=1
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="XP_027483112.1"
                     /db_xref="GeneID:38736962"
                     /translation="MLNKIPGLSQVQNFTTKNPSKKLEQLSKTPGLKNDLIIRAARGE
                     RTERAPVWVMRQAGRYLPEFRKIRENFEFFECCRNPEVASEITIQPVRRYDGLLDAAV
                     IFSDILVIPQAMGMEVEMVQGKGPSFLKPLDSPKDLGRLTKVDVRKDLGYVLEAIRLT
                     RAKLAGRVPVIGFCGAPWTLMAYMIEGGGSKTWEKAKRWLFDYPEESKHLLDRIANVC
                     ASFLVEQVLAGAQLLQVFDSWAGELTPYDFRTFSLPYLRNIAIEVKDKLDTLSVEPPP
                     MILYAKGAINHSLVDISKAGFDVVGIDHTVEPAWARHCLAESQTSGRKFSQVESKKSG
                     QHPIALQGNLDPAILYAKPEVIEARVRRMFDPSVGGFGGQGALICNLGHGITPNVDPE
                     HLRVFLNAVHRVSREMVTDTNE"
     gene            complement(<320164..>321174)
                     /locus_tag="MRET_0197"
                     /db_xref="GeneID:38736963"
     mRNA            complement(<320164..>321174)
                     /locus_tag="MRET_0197"
                     /product="protein of unknown function (DUF2456)"
                     /transcript_id="XM_027626824.1"
                     /db_xref="GeneID:38736963"
     CDS             complement(320164..321174)
                     /locus_tag="MRET_0197"
                     /codon_start=1
                     /product="protein of unknown function (DUF2456)"
                     /protein_id="XP_027483111.1"
                     /db_xref="GeneID:38736963"
                     /translation="MLFGGSKKDYEEESKIGLYVRQDKSHCFAAPYESTGVVSSRGST
                     WKEWLTLGPLGPQQIFYLFVMHTFGAAILSGAANFGVACAMYRTTSLPIRMWPLSENT
                     IAGDMGVTVVIQQIVTYIVTSTLCNFDLRHGTRSLTRPWPPMMHFPSTSVSTGSWFGV
                     KMPSEVEQSGRRLYMGNAENKSRFVQFCLWFLRATCTGSERNIIFDRGLTHRHRFERV
                     LWTALQGGWWAVITFWWYWPIAIAITAPLYDHKNMHGTWIPPIIKLLFGGIMGMITNP
                     LMAMMALGAECHVHRFYPGHELWSESETAYPSTESESSVDHQAIPPPAPNDPDTCIVS
                     VK"
     gene            complement(<321346..>322579)
                     /locus_tag="MRET_0198"
                     /db_xref="GeneID:38736964"
     mRNA            complement(join(<321346..321504,321539..>322579))
                     /locus_tag="MRET_0198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626825.1"
                     /db_xref="GeneID:38736964"
     CDS             complement(join(321346..321504,321539..322579))
                     /locus_tag="MRET_0198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483110.1"
                     /db_xref="GeneID:38736964"
                     /translation="MEIPEPLLAPNQLQQPANNEGLFDVATRPGYCPELARYFLPGAA
                     KSRLEEYFSKYMPRNEPRLGFSYWSSLFDDFYVPTGTMRMLLMNEETKQRQRFDIAKE
                     FLPHFFTLCFAHNMRVMRMQFTDINEYLCDPSRPPAPPTGSYEPGYPTPLVLGGTTHI
                     VEAKNVLLSIVYENGWQCQAIGSCRALFAPYSKVRFDPAPPGVKGNAEGKAPRLHTQL
                     RFQYLCFNSLSKRIYVPFDEMVTHLESRVIPRQVVENIISYGNKRKKEPLEDRPEDCS
                     TKRQHLDTSDHDVSPSSEEPIDQKPPPPQADRDFVHDDAQLPTFTLNQPRLNALRFLD
                     GYGIPQQMNQTVTMMDTIAQLRTLLDIHMEEGRSPLQVMEEFQAQSEKQHSSFASKNS
                     DHPPIML"
     gene            complement(<322709..>323801)
                     /locus_tag="MRET_0199"
                     /db_xref="GeneID:38736965"
     mRNA            complement(join(<322709..322864,322899..323557,
                     323584..323633,323671..>323801))
                     /locus_tag="MRET_0199"
                     /product="DNA-directed RNA polymerase II subunit RPB3"
                     /transcript_id="XM_027626826.1"
                     /db_xref="GeneID:38736965"
     CDS             complement(join(322709..322864,322899..323557,
                     323584..323633,323671..323801))
                     /locus_tag="MRET_0199"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB3"
                     /protein_id="XP_027483109.1"
                     /db_xref="GeneID:38736965"
                     /translation="MYATQGLAMQGHGTSSAQEKVPNVIIREINHTHADFILENCDLS
                     LANSLRRTLIADVPTVAIDMVEISVNTTVLPDEFLAHRLGMIPLLSMDAYKVLIDQRD
                     CSCEDGCDRCSVELTLDALCTSDRGSMSVTSKDLVRSNTIANMYSDESMFGPVAPRHP
                     DFGKPVGHDDPNANGIVIVQMRKGQQIKARCIARKGFAKEHAKWSPVSAVGFEYDPHN
                     TLKHTTLWYEFDAAKEWPVSKNAREEEPPAEGAPFDPNLRASRFYFDVESTGSLHPAE
                     IVETGLTLLEYKTAQIVQELGMLFQQADVNASGAAAANGVYDPYSGAPVGGASYM"
     gene            <324002..>325291
                     /locus_tag="MRET_0200"
                     /note="MRES_02575"
                     /db_xref="GeneID:38736966"
     mRNA            <324002..>325291
                     /locus_tag="MRET_0200"
                     /product="alpha 1,2-mannosyltransferase"
                     /transcript_id="XM_027626827.1"
                     /db_xref="GeneID:38736966"
     CDS             324002..325291
                     /locus_tag="MRET_0200"
                     /codon_start=1
                     /product="alpha 1,2-mannosyltransferase"
                     /protein_id="XP_027482672.1"
                     /db_xref="GeneID:38736966"
                     /translation="MLEYILRRPQRLFTLVAAFFLIVFISTFFSVSSDNAKHFHKQLK
                     KIPKFLRNQTCPPGVMESKYRNEFHFLSNIDSVEELSKLAVPDVHGNYFPPEFNPAEI
                     NKAPRAKAAFISLVRNSELEELRQSMEEFEYRFNRKYNYPWIFLNDVPFTDEFKKGVR
                     KMTRAPIHFGLVPKEHWSYPSWIDQDKAAETRKKMEEADIVYGESESYRHMCRFQSGF
                     FFEHPLTYELGLEYYWRVEPGVHLMCDVDFDPFVFMQLNNKAYGFTISTHEYSETIPT
                     LWSETLKFVQKHPEYIAPDNAMKFVTDSDSLHGSDYNLCHFWSNFEIGDLRFFRGRQY
                     KQYFDHLDKAGGFFYERWGDAPVHSIAASLLLNRSQIYHFDEIGYEHSPWAHCPANRK
                     KYHDNGKCSCNPDDSFDFDDWSCNKLWWSLSVEGAPE"
     gene            <325467..>326774
                     /locus_tag="MRET_0201"
                     /note="MRES_02570"
                     /db_xref="GeneID:38736967"
     mRNA            <325467..>326774
                     /locus_tag="MRET_0201"
                     /product="alpha 1,2-mannosyltransferase"
                     /transcript_id="XM_027626828.1"
                     /db_xref="GeneID:38736967"
     CDS             325467..326774
                     /locus_tag="MRET_0201"
                     /codon_start=1
                     /product="alpha 1,2-mannosyltransferase"
                     /protein_id="XP_027482671.1"
                     /db_xref="GeneID:38736967"
                     /translation="MAFLDLVSRRPQRLLLVVAVCLIVILVSTYASMSSPKPGKISSH
                     FKSFPKLFGNHSCPPTVSLRPGFAEGASQYNYMGNVKDVYDLGRYATQNNAGNYMPPS
                     FTPAEINKAPRAKAAFISLTRNEELDDMRQSIMEVEYRFNRKFNYPWIFLNDVPFTAE
                     FKQGVRKMTRAPVYFGLVPKEHWSYPSWIDQNKAAAAREKMGQDGIIYGDSESYRHMC
                     RFQSGFFFEHPLTYQLGIEYYWRVEPDIHIWCDIDYDPFVFMQLNNKAYGFTMSLHEY
                     DATIPTLWKETMSFVQQHPEYLPKDNAQRFLTDQDDLQGANYNLCHFWSNFEIGDIRF
                     FRSRQYKDYFNHLDKAGGFFYERWGDAPVHSIAASLFLNRSQLYHFDDIGYYHAPWGH
                     CPTNRKLYHDNGKCTCNPEDSFAREGYSCMPQWWAVSKEGEPQ"
     gene            <326887..>327834
                     /locus_tag="MRET_0202"
                     /note="MRES_02565"
                     /db_xref="GeneID:38736968"
     mRNA            <326887..>327834
                     /locus_tag="MRET_0202"
                     /product="component of the NuA4 histone acetyltransferase
                     complex"
                     /transcript_id="XM_027626829.1"
                     /db_xref="GeneID:38736968"
     CDS             326887..327834
                     /locus_tag="MRET_0202"
                     /codon_start=1
                     /product="component of the NuA4 histone acetyltransferase
                     complex"
                     /protein_id="XP_027482670.1"
                     /db_xref="GeneID:38736968"
                     /translation="MAKNATSSAWDDAAEIALLRCISLYRPLGIDRHFHMVCILNALE
                     TMSGNPDLRDLLPCHVWDKLGEYYNLEGLNEQEDASDDDTEPKWLRNYEKNKELLQSN
                     EAARTRVLEGLDEEEFALHPRIMFESLLEPRRLEEQAADHVIQKDATCVVPSTSEDDL
                     SDDDPDPATGSHRSSDRDSRPSLASSTRRMTRKRQHEEEDAATGVKDGASAVPTRAGK
                     RRRNAKSEADSSDTLTRPITTRRQQRQAEERESVDAEDVKSGGVSNSTEEGAGSTPRA
                     SRSASARRQSSSAGRNQNVSGSSHASPSPASRTARPRRL"
     gene            complement(<327888..>330695)
                     /locus_tag="MRET_0203"
                     /note="MRES_02560"
                     /db_xref="GeneID:38736969"
     mRNA            complement(<327888..>330695)
                     /locus_tag="MRET_0203"
                     /product="nuclear cap-binding protein subunit 1"
                     /transcript_id="XM_027626830.1"
                     /db_xref="GeneID:38736969"
     CDS             complement(327888..330695)
                     /locus_tag="MRET_0203"
                     /codon_start=1
                     /product="nuclear cap-binding protein subunit 1"
                     /protein_id="XP_027482746.1"
                     /db_xref="GeneID:38736969"
                     /translation="MVYDDRGQWDMKPEPPRHDGNRGWYRNRGGSRGQRRGDSRHGPS
                     SGAYGPMDRGRMQQIEATRQIHQSLFHLGSDEGFQSAVEIPKVCAWLETQALEFPVAV
                     LSAFRIMATEQPQKTALTAAMIAHLVLKPGAHSTESGKASLGMRVMEHLIHMFGQDVD
                     AHYWRNARLVLHVFVALAPLGVVSSASLRRTIKAFVDVLSSDGVSRDVADPAADCVIE
                     AMCRGGTDLIQPEPGALEPLPSAREEMDAIVDGITLYGSQRSNAAMQLISPFRLGEPH
                     DFLDQDGFMDRVRALQSLKEHGYVRPAFLPSACDLLSVDVSPATSTAPAEQRTAHLPD
                     LHVAPIRSTAYDELDDDLLAPPKRLQTGKGTHETVRVRTGAPSLDAAARWFGSSVPAI
                     GSVEGVVLRGIVQDIIDLYVINRKECAHVLLTLPQWLRRGTFGGKIPPHIGIFGDEPE
                     PEVSVEWMLEDVLLEGALSTMLLLPRPPQLELYYSSLMREIVTLAPQQIAPSIGRTIR
                     RFYVASADGVVRAEVLRRVADWFSVHLSNFKFTWAWNEWADDMTRAWAHPRPALARRI
                     VELEVRLAYYDRIKGTLPPDMEAYILPPFEPSPNFVYNRPSHSYHGMAEQLFQSIKAK
                     ASVHVVQADLQSFQQSILAPATDVPDADDTHHVDSPAEAERVARDVGIQTLLFAGSRS
                     FSHLLNVIERYHELLRALSQSPEARVSILHSTCVFWTHSPQWFLIVCDKLLQYRIVEP
                     LDVVTFVFSEPSGDAVMEEASPFDVALHAPEWGNRTHRDWSSFHWWAVLRLTMDKVIG
                     RVNQLSRRVQDLRRVQAAPEAAASDTAQRHAPATLDEAQVHLDAVQLEQRKVLVTILS
                     KLVSHIQEHGGNTSLSDETDSSGWQSWWVREWYHAFVAVYYDVIAANRETILANVFAS
                     AGTDDTCAVLFEQACALAQTA"
     gene            <330855..>331204
                     /locus_tag="MRET_0204"
                     /note="MRES_02555"
                     /db_xref="GeneID:38736970"
     mRNA            join(<330855..330959,331002..331110,331140..>331204)
                     /locus_tag="MRET_0204"
                     /product="transcription elongation factor SPT4"
                     /transcript_id="XM_027626831.1"
                     /db_xref="GeneID:38736970"
     CDS             join(330855..330959,331002..331110,331140..331204)
                     /locus_tag="MRET_0204"
                     /codon_start=1
                     /product="transcription elongation factor SPT4"
                     /protein_id="XP_027482676.1"
                     /db_xref="GeneID:38736970"
                     /translation="MSTTAKLRACLRCHYAQTAAEFHAKGCPNCQDMLDMQGSQERVA
                     DFTTSNFDGLICMLQPEESWVAKWQRIEKRMVGLYAVKVVGRLPNADE"
     gene            complement(<331297..>333045)
                     /locus_tag="MRET_0205"
                     /note="MRES_02550"
                     /db_xref="GeneID:38736971"
     mRNA            complement(<331297..>333045)
                     /locus_tag="MRET_0205"
                     /product="type II pantothenate kinase"
                     /transcript_id="XM_027626832.1"
                     /db_xref="GeneID:38736971"
     CDS             complement(331297..333045)
                     /locus_tag="MRET_0205"
                     /codon_start=1
                     /product="type II pantothenate kinase"
                     /protein_id="XP_027482675.1"
                     /db_xref="GeneID:38736971"
                     /translation="MGLNFASPPVAVPVDIFMRTHGARIMDKDEETPQCTKRDGYDIY
                     LPNHVERVSHIAVDVGGSLAKVVYFTHAPSSPVSSDGGNESDVSRQGTLKPTNLGSSS
                     LFHPTSLRQRSLPEQFPGGRLNFTKFESSNMDMCMAFLRELIERSALANQVTIEEMQK
                     SVKIMATGGGAHLFYQRFKDELGVEVQREDEMGCLITGLNFMTLIPDEVFWFSDDLVD
                     DLYKRHPKLSLNMRRGDSRVLPSQDANLPRPSPTPPMYEPLFESEPTPKLPCLLVNIG
                     SGVSILKIDESGKFERVSGTSLGGGTLWGLLGLLTDASNFDEMLDLFERGDNSNVDML
                     VGDIYGPVGLDHLGLSASTIASSFGKVFRWDRRSASPEQADDARTASERRRARFSQED
                     ICRSLLYAISNNIGQIAHMNAEKYQLDRVYFGGCFIRGHQATIATLSYAIRFWSKGRR
                     RAYFLRHEGYLGAIGAWVRHIASDSSVDHPPEPPIQPMLADALSMNQMDQSPVTPSAA
                     GMSPSPAHTENQTLSDLLNELSTIDQSTMPSDPDSIEKLMLQLDRAHNVANAIESRVD
                     HLLEKIQTLLPREPSP"
     gene            <333356..>335425
                     /locus_tag="MRET_0206"
                     /note="MRES_02545"
                     /db_xref="GeneID:38736972"
     mRNA            join(<333356..333473,333504..>335425)
                     /locus_tag="MRET_0206"
                     /product="translocation protein SEC63"
                     /transcript_id="XM_027626833.1"
                     /db_xref="GeneID:38736972"
     CDS             join(333356..333473,333504..335425)
                     /locus_tag="MRET_0206"
                     /codon_start=1
                     /product="translocation protein SEC63"
                     /protein_id="XP_027482674.1"
                     /db_xref="GeneID:38736972"
                     /translation="MSGYKYDEEGGQFTTFALTAFLAFMVPYTYRSLRPKRDPAIIHG
                     WLDQRGHKHSHVQKLMRTSPISSIVRGLILVCGWAAVAYLFQRVIQVAKNSGFVAYDP
                     FSILGIATSATEREIRRQYRRLSLEFHPDKVSSDSNKTKEEIESHYIEITKAYKSLTD
                     EATRKNYEEYGNPDGRQEMTMGIALPTWIVDSKHNVLVLLVYGLIFGVGLPLLVARWW
                     YGSRSRTKDGVLNATALSFFLRLKPSTHVDDIPRMMAETEEFSKDFVDRLRERDLPAY
                     NELEKRTLNAYRELRDADLVTNDVPENVRRALVLLTAYQYRIDSGNANVEQIKLEMGH
                     YAEKMLMSLLAISTAHNRLEQSNEIRHLLPHFVQAVPLHGGRVSELLQLPYMTLSLAK
                     SLVPLEAVVKHGLQGLWKVPDAERRAILMRDKDGLTEEQYTTCMRALGEWPRLELVDA
                     YYTVVGEEQVNAGSLMHLVLKLRLLPLKRDGSLLRNGRRLDARDKKYGEDCVRPGTLE
                     ADTLNEANAGREPMGYVHAPYFLEERVPGWFMQMGDPKSDHLIMSPTRFGDMSTTQLR
                     IVTAPIIAPPESGVYTFQVEVNSDSYLGSRVVKVMKLTVSEPIVPRPDEEDEISDPEE
                     DTIAGQMALMRGERVKPSNVVYEDDDDEDEDDDEGDDDDEEDDARPHDDSDSDSD"
     gene            complement(<335438..>337036)
                     /locus_tag="MRET_0207"
                     /note="MRES_02540"
                     /db_xref="GeneID:38736973"
     mRNA            complement(<335438..>337036)
                     /locus_tag="MRET_0207"
                     /product="tRNA (guanine-N(7)-)-methyltransferase subunit
                     TRM82"
                     /transcript_id="XM_027626834.1"
                     /db_xref="GeneID:38736973"
     CDS             complement(335438..337036)
                     /locus_tag="MRET_0207"
                     /codon_start=1
                     /product="tRNA (guanine-N(7)-)-methyltransferase subunit
                     TRM82"
                     /protein_id="XP_027482673.1"
                     /db_xref="GeneID:38736973"
                     /translation="MRDDSSSEAQVPLPVHAVNASSRYVVALTAGNILVFDAHTGERR
                     GALDTCVDSNAPIPPHMVCFPRICAISPNEKYVAIASDDKALRVWCIDDLEYGKEVFV
                     QPLAKRAGTVHWVNDCEMVVADKFGDVWSFVIDPSHPKQVQSLADADTDVASSGAASA
                     QGPRPKLGHVSMITCLAFLRDASSDTPSTIVTCDRDEHIRLSRWGPHRAAHIVQQYLL
                     GSRSCVGALVVVPADRAESAGFPCSRRPVLITSDGGACLRAWCSDANGKYALQATCHF
                     AAEAMAQFVCVDAAVERRREKAANNLAHKGGFDPQEPEPATKRAKRDDLPEEDAKAGG
                     TSLVIHQLLYFHDGEHDWLVIRVEGAKALFTVRLDQLTSDVSAPGLPVRDACALDAPI
                     LDTSLVHEEGCIVLWVCCDDRPGMGTGPPLSKWTWDTDHFTQDAVHGDTPLHALTSIQ
                     ASNTTRATVSHAVQSKLCLYSQIMTWPKPPQTNPDGTPFSSFFLSHQSDQVSRGMLDR
                     FQSGKRAAGRAKNQASIQQQFGGS"
     gene            complement(<337099..>340362)
                     /locus_tag="MRET_0208"
                     /note="MRES_02535"
                     /db_xref="GeneID:38736974"
     mRNA            complement(<337099..>340362)
                     /locus_tag="MRET_0208"
                     /product="elongation factor 3"
                     /transcript_id="XM_027626835.1"
                     /db_xref="GeneID:38736974"
     CDS             complement(337099..340362)
                     /locus_tag="MRET_0208"
                     /codon_start=1
                     /product="elongation factor 3"
                     /protein_id="XP_027482820.1"
                     /db_xref="GeneID:38736974"
                     /translation="MTTSAAALQSLWDSVSTEDAHRHAETLTEYINTNGLRTLLSECI
                     LDELLDKLKDKKQAHLRERAAIGLGAVASKVAGKNAPMPLGAEPWLVNAIPPLLDGYG
                     DKNEAAKKAAEGAMGALVPLFPPEAAAELLEMLYSVITSGTAKWQAKVGALKIISRLA
                     DLAYEQVGDELTQITPVLTQGMHETKAEVSKQAIKTATKVCGVIDNNDIRPFIPDLVG
                     CMDRPDTVPDCIKKLSSITFVAEVTGPALAVMVPLLSRALNERSQTVQRQSVIIVDNL
                     CKLVRDPHTAAMYLPSLLPSVERIEQGASFPEVREHAKSAVQTLRAAFAEADKSKDDP
                     HSTDPVAAQAADREHALQCLAKAVQPHVPAGIVFSALGDSYTRTGLEYVARLLVRLAD
                     KRVVQAEPWNDVYVLPYLRRVCETPEGAQQATDAIRAEFEQRDLDRFGKPEDDGSELD
                     GEKLCDTVFSLAYGGLLLLNHTRLRLYRGHRYGIVAANGSGKSTLLKAMRDGKVEGYP
                     EQDKVRTVMVEHSLQGEDGSKPILDFVLGDPKLSHKSKEDVAEALRSVGFDDEKQQTP
                     VGSLSGGWKMKLELARAMLIGADILLLDEPTNHLDVQSVKWLENYLVSNTNVTVLIVS
                     HDSSFLDNVCTEIIHYEHKKLKYYHGNLSAFVKTRPEAKSYYSLAATTVKFTFPPPGS
                     LMGVRSNTRTILKASHVSVHYPSMPRPSLVDASVSVSLSSRVGVIGPNGAGKSTLIKV
                     LTGEIVPNEGKVEKHPNLRVAMMAQHAFHHLEQHLEKTACQYIRWRYQDGHDREITEK
                     ATRKMSAEETDQMKVPIVSQTGEKRVIEYIVGRSKLKKSYQYEIKWVGLEHRYNTWIP
                     RERLLELGFSKLVQKFDDFDASREGAGSRDLSQKAIRSELEAVGLNGEIAENNAMGGY
                     SGGQKVKVVLAAALWNNPQVLVLDEPTNYLDREALGGLAVAIREWAGAVIIISHNQEF
                     ISALCPEIWNVENGRIVSKQRTDIASENFADASQTSTPAGTEPNSAAPSAPGSAAPSA
                     PQSGDENDEEDMSKLKAKKGKKKLTRNEKKAQEERRRLRLSRWLMYGGEREPDTDDE"
     gene            complement(<340468..>341922)
                     /locus_tag="MRET_0209"
                     /note="MRES_02530"
                     /db_xref="GeneID:38736975"
     mRNA            complement(<340468..>341922)
                     /locus_tag="MRET_0209"
                     /product="peroxin-3"
                     /transcript_id="XM_027626836.1"
                     /db_xref="GeneID:38736975"
     CDS             complement(340468..341922)
                     /locus_tag="MRET_0209"
                     /codon_start=1
                     /product="peroxin-3"
                     /protein_id="XP_027482679.1"
                     /db_xref="GeneID:38736975"
                     /translation="MSSRARTWAKRSLRVVAITTGLIGGLYMFAQYALARFNDMQERL
                     LRDRVARENLRRRFLQNQEDCNFTIMALLPTLATQIFEEMDVESISHALREQNKKPEP
                     AAPPAVSEQTGPKPEIVPDQPASDEEKASAATHPQSTDMPQEPSHGENLATDAPPEPV
                     SAEAEPTVPVNEEERRATKLRLWNEIKHTSFERTFTTLYTLVFLSLQIHVQLNLLGRR
                     SYMTALEQQSKRDALGKTQQDGNYVEEPHYIELHGDGTDDTVRGDASADERLSQDTEK
                     KYLTSSYWFLHRGWREVAAYVRRAVHEEVDGMPLKTMLTFSHFEALVERIRDRVERCA
                     DNTGVVWAAPNGFRGILLPESERDEMQMLQDAGALESENPAMTPSLRALLDETKDYID
                     SPDFASVFAASCHQVFSLFLHHIASSYGVRASEVRRTDKPLLLAKVLPLVSQQAQVAL
                     NATPNDYVTAIVEGRELRALSVLMYTAWDEGLGW"
     gene            <342098..>343690
                     /locus_tag="MRET_0210"
                     /note="MRES_02525"
                     /db_xref="GeneID:38736976"
     mRNA            join(<342098..342126,342156..342245,342275..342288,
                     342318..>343690)
                     /locus_tag="MRET_0210"
                     /product="acyl CoA binding protein"
                     /transcript_id="XM_027626837.1"
                     /db_xref="GeneID:38736976"
     CDS             join(342098..342126,342156..342245,342275..342288,
                     342318..343690)
                     /locus_tag="MRET_0210"
                     /codon_start=1
                     /product="acyl CoA binding protein"
                     /protein_id="XP_027482723.1"
                     /db_xref="GeneID:38736976"
                     /translation="MSSSARVIDALFERTVDIVQSLPPSGPIQTSFEEKLALYGLYKQ
                     ATEGDITSRRPGMFDMLGRAKWDAWERQRGYTTQDAKQLYVESMLKVLRRFEDRPLAI
                     SLMAELEAYSGDVAEQVMSGTLAETASVVSSSVDHSPSQRAYGSMVQDDNETDDDEHP
                     ELLHRQLQEAHDARHRVLSSSNGTNTTQTNSGSHETVTVSDMPQDVSTWGKAQAPHAS
                     TRRPGVLSQPPAPPRPSAHPRRSAVRAEDSVIGSERGGTPSFTSAQETRSVHNGPMGR
                     YTPSASGRSSVKGGVPPTSRSAAAYKSTSSAPRGLRAQSAELDQTLRAMQASLTTLTE
                     RLERTESTLARRESKSLPRLFLHHTMAASYATLQDIGAFLGLVMRPDDTPTPSYEAWR
                     AHGLRSSKPYSLWPLIRSPFQFAALVVGLVLRILLDLSSLFVVASLLVAALRQISGRG
                     DPWIALRLLGRMNTRLTFLANAANRRAFVRALLASVVLGGVTLESTRNLTH"
     gene            complement(<343687..>344319)
                     /locus_tag="MRET_0211"
                     /note="MRES_02520"
                     /db_xref="GeneID:38736977"
     mRNA            complement(<343687..>344319)
                     /locus_tag="MRET_0211"
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /transcript_id="XM_027626838.1"
                     /db_xref="GeneID:38736977"
     CDS             complement(343687..344319)
                     /locus_tag="MRET_0211"
                     /codon_start=1
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="XP_027482724.1"
                     /db_xref="GeneID:38736977"
                     /translation="MKAVLEQIPRYEIEQQSASVVEHVLRLSCYERACTVSVYLSMPS
                     GEVDTWELCRHVLRQGKRLYIPRFSNVQHGAVAARAAHEFSTDMSMLRIMDLEELEHG
                     LTYNKWGIAEPSLTLADGTQREDALDPTTGGSGLDLIILPGVAFDLHGGRLGHGKGYY
                     DRYLDRTKKQQPQSPPATVALALREQIVGTVPHDAADQLCDTLVTPDGAF"
     gene            <344491..>347136
                     /locus_tag="MRET_0212"
                     /note="MRES_02515"
                     /db_xref="GeneID:38736978"
     mRNA            <344491..>347136
                     /locus_tag="MRET_0212"
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase"
                     /transcript_id="XM_027626839.1"
                     /db_xref="GeneID:38736978"
     CDS             344491..347136
                     /locus_tag="MRET_0212"
                     /codon_start=1
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase"
                     /protein_id="XP_027483065.1"
                     /db_xref="GeneID:38736978"
                     /translation="MDVGRGSSMRSRSSQPSQDLAQAHLNDKSRKHDSFTEKEQAAAS
                     EGAQQMLHRAAPVITRAELFLVGLLTLVALIVRFYHIERPSSVVFDEVHFGGFASKYL
                     SRKFFMDVHPPLAKLLITLAAWLYGFRGDHSFREIGLEYLTAPDMEQVPYVAMRSVSA
                     LFATLTVPLAYFTVRGLSMRPTSALLAALLVIFDNALTTQSRFILLDAPLVFFVAASL
                     CSWVYFCQLDARNAFSRRWWAMLALTGVCLGLGLSCKWVGLFTMASVAMAVAVQMWYH
                     LGNLRLPVQTVARHVGARAVCLGVVPLVVYMLTFAVHFQVLSLPGDGESFMSWPFRQT
                     LKDNSMPDTFADVALGSTVRIKHLNTLGGALHSHSHSYQTGSMQQQITLYPFMDENNE
                     WIMILAPREDEYEKKEDGHTVTPDDEYTRFYHNITHVKDGDMVRFLHKQTMVRLHSHH
                     NHRPPVSTGDYQNEVSGYGFPSERFGGDFNDNWVIEIYKQPRSVRSADKNRPITLRTI
                     FRLRHAMLGCYLYSHNVRLPNWAYDQQEVTCNGSPPMENSLWYFETSEHPLQDAKTSP
                     TINYERPGFLSKFLELNKVMWKVNNDIVDQHSYGSRPHQWPWMRRGINFWVKNHRQVY
                     LIGNPMVWWSVLASVLLYAGIRVLLILRAQRGYKDFTHTTVVQYDRICGFLAAAYAAH
                     YVPFFLMKRQLFLHHYLPALYIGILLTAAVYDLLSSRLRPMVRLYVTLAMGAWALYEF
                     SRYAPLTYASRWTNEACGSAIRLKTWDFNCVDFPDSKREYADFEPVVSHADGRGSADE
                     DAILPFHLGHVLPQHILPQHLTWRAKPTGAYPEEKPAPSGTSDGDVPVPNVSGLDQSQ
                     RQQAVLEGTGALKIPAEEGVTSIRG"
     gene            complement(<347171..>348346)
                     /locus_tag="MRET_0213"
                     /note="MRES_02510"
                     /db_xref="GeneID:38736979"
     mRNA            complement(<347171..>348346)
                     /locus_tag="MRET_0213"
                     /product="solute carrier family 25 (mitochondrial folate
                     transporter), member 32"
                     /transcript_id="XM_027626840.1"
                     /db_xref="GeneID:38736979"
     CDS             complement(347171..348346)
                     /locus_tag="MRET_0213"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial folate
                     transporter), member 32"
                     /protein_id="XP_027483066.1"
                     /db_xref="GeneID:38736979"
                     /translation="MSGRRATTAETAVSYFSTPAVDHAVAGVVAGTVSTLCMNPLDLL
                     KTRFQVNQSAFSAVPTERSPFYQAIARRRWLYWGMGGRQIVDIADGIYGIYKNYGWGG
                     LYRGVVPNVVGNASSWGLYFLWYTMFKEAMAPQKEGAEPTRLSPGGHLLAATESGVIT
                     AIMTNPLWVVKTRMFTTTMAELPLRPGVNGSVAGDPARAGLAQYLREPGAERPVAYRG
                     LVHGLVHTLRTEGIVGLYKGVGLAILGVSNGAIQFMAYEQLKQWRSISQLRRSDATRK
                     NAYSEQELDNVKLSNTEYTILSGVAKLVAITLTYPYQVVRSRVQSHATAHLYPNVWTC
                     VKRTAQEEGFHAFYRGFATNAVRILPGTCVTFVAYENVAWMLRTAAQARAPAVTTSA"
     gene            complement(<348378..>350378)
                     /locus_tag="MRET_0214"
                     /note="MRES_02505"
                     /db_xref="GeneID:38736980"
     mRNA            complement(<348378..>350378)
                     /locus_tag="MRET_0214"
                     /product="polynucleotide 5'-hydroxyl-kinase GRC3/NOL9"
                     /transcript_id="XM_027626841.1"
                     /db_xref="GeneID:38736980"
     CDS             complement(348378..350378)
                     /locus_tag="MRET_0214"
                     /codon_start=1
                     /product="polynucleotide 5'-hydroxyl-kinase GRC3/NOL9"
                     /protein_id="XP_027483051.1"
                     /db_xref="GeneID:38736980"
                     /translation="MAPKSALEVRRERAAQQAQQTPLVPQAQPEDVPLASPSPPPAPG
                     SDVVDTSMTSDVNVSMTEPMKADSPLVTSRRVLSYASKDQCILQHDSVCCGVHDESIV
                     VRGTCMLQVVRGAVLLGGARLTPCSPPHPIYAPETFPAAEILPVPYSADSEHRDILPH
                     YDTVVRLQSIKCGIEQLARVCPLAGMDPFALHRAVPGCTFTLESNASDTLCVPTEWRD
                     VYDELGSLPSRVPMTLAVRGGKNTGKSTLARLLLHALLTNGEHRFVAFMELDVGQPEF
                     GPPGMLSLHVFDAQRESGVFGPSWCTARVPVRAHFLGDVTPRNDPARYMAAVTDLMET
                     YRQHFASYQSTQHVEALLHVSELMPHTSRASHTIPLIVNMHGWVKGLGLELVQHATAA
                     LCPTHVIDLGAMPLADTTHTITPFGDTLVGLGAMPARRLNAAESRTLSLLSYLHTTRL
                     AQVGVHAHWDFACALVAQRPWIVDVHAGLGAGWATLDTGAHVDEALSLLAMNGAIAAI
                     VQAPRPLPREESDNELDVWHVALRRGAVLSAVASPPALGLALVRSIDMERGEMHLLTP
                     LDGHILKRAQDDTGLPLGLLQGALDLPFWGALDSDAYADIVQWRHDRPAPLLAGVPRE
                     QVPYLLWPSELLGMQNEGAEPLGARPRKVRRNLMRRRQMHPP"
     gene            complement(<350483..>352516)
                     /locus_tag="MRET_0215"
                     /note="MRES_02500"
                     /db_xref="GeneID:38736981"
     mRNA            complement(<350483..>352516)
                     /locus_tag="MRET_0215"
                     /product="transcription factor"
                     /transcript_id="XM_027626842.1"
                     /db_xref="GeneID:38736981"
     CDS             complement(350483..352516)
                     /locus_tag="MRET_0215"
                     /codon_start=1
                     /product="transcription factor"
                     /protein_id="XP_027483052.1"
                     /db_xref="GeneID:38736981"
                     /translation="MPPNVPEGQIFKATYSGVPVYECIIKDVAVMRRRSDAWLNATQI
                     LKVVGLDKSQRTRVLEKEVQKGIHEKVQGGYGKYQGTWIPMDVAIALAEHYRIRDVLD
                     PIISFVPSETSPPPAPKHAIASSGRLKKSAHDMLDPSASRLSSDENSSEIFPAEDENG
                     SEGSISPSPSDVSSSSRTPSPIAADAAKMEYHPYTDPRNTTAMYTPNGRIPTAYAPAA
                     YRDPYSVPMQPSYDNLDPQARYAEIILDYFISETTTVPPLLVNPPPDFDPNMSIDEDE
                     HTALHWACAMGRVRVVKLLLTAGADMFRVNSNGQTALMRAAMFSNNYDLRKFPELFEL
                     LHRSILNIDRNDRTVFHHVVDLALSRGKPHASRYYLETMTRRLAEYGEQLADILNFQD
                     DEGETALTMAARARSKRLVKLLLEHGADPKIRNREGKNAEDYIVEDERFRASPARAAS
                     LPYAPNTNAPHTSEAGQRAAGRSVGLVSTLLHDLADSYDTELSVLERKLTHAQTLLMQ
                     IQNEISDSSRIEATLLPKGQEGEDASALQRLASHYLARKRHAESMAAQHAWDRVLEQV
                     QQARPDLTLGEAPTAPTDVQLICAKSSSDSLYAELTMLRKRADDIVKRYGAMQQLHFD
                     TVREEDADRTMAMYRRLIATGCGGIPTSEVDAVVNVLGDLLEEDHRANAAPAP"
     gene            <352739..>353833
                     /locus_tag="MRET_0216"
                     /note="MRES_02495"
                     /db_xref="GeneID:38736982"
     mRNA            <352739..>353833
                     /locus_tag="MRET_0216"
                     /product="rRNA small subunit pseudouridine
                     methyltransferase Nep1"
                     /transcript_id="XM_027626843.1"
                     /db_xref="GeneID:38736982"
     CDS             352739..353833
                     /locus_tag="MRET_0216"
                     /codon_start=1
                     /product="rRNA small subunit pseudouridine
                     methyltransferase Nep1"
                     /protein_id="XP_027483053.1"
                     /db_xref="GeneID:38736982"
                     /translation="MSESDYFSSDDEGARTTISAPAAHRPIGGAMPQPEKRQPRATRS
                     FAALRNTYLDTAGPEEDMPETPEENQADQREKEAEEETDAGESTSKKSRLSATAPPHT
                     PASLLRQTMATASSKRTRVGPSLVPMAPKLPKTHTEKESQPRLIVVLEQACLETYKAS
                     SGSATHARGNKEAGEKYALLNCDDHQKVLAKMGRDISEARPDITHQCLLTLLDSPLNK
                     AGLLQVYIHTSKGVLIEVNPQVRIPRTFKRFSGLMVQLLHRLSIRSIKGSEKLLRVIK
                     NPVTDYFPANTHKITLSYNAPVQRLSSYLATIPSDRNIAVFVGAMAHGEDNFADEFVD
                     EKISISEYSLSASVACGKFCCSLEDLWGIV"
     gene            complement(<353859..>355712)
                     /locus_tag="MRET_0217"
                     /note="MRES_02490"
                     /db_xref="GeneID:38736983"
     mRNA            complement(<353859..>355712)
                     /locus_tag="MRET_0217"
                     /product="cell division cycle 14"
                     /transcript_id="XM_027626844.1"
                     /db_xref="GeneID:38736983"
     CDS             complement(353859..355712)
                     /locus_tag="MRET_0217"
                     /codon_start=1
                     /product="cell division cycle 14"
                     /protein_id="XP_027483056.1"
                     /db_xref="GeneID:38736983"
                     /translation="MPEANGASSSSADAILHISPDDSDLVDFSLTQVQDTVLPTTSAV
                     PSTTTPLTSPAPTLPATSLPPLEHGLIPVSTRFWFGVFRELVDPDLLNKDAPSTTRYV
                     PADVPLCERPSKLQWFCIDDDLVYMSFSNDWGPLNIAMFYRFCVHVHQMLMDPHMDGT
                     HLVLYTSTHPHHKANAALLCAMYAMTIDHISPADAFYPFSEMEFQPFRDAGYGRADYS
                     LTIQDILYGVRRALDHDLLDLTTFDLESYEYYEQVHNGDWNWITPHFLAFASPKDRAY
                     MSTLASQGPHAAACMAKRMPMNPALRKTVEYFQDHKITLVVRLNNALYYSGAFEQAGI
                     EHKDMYFDDGSNPSDEIIRAFIREADRTIKAGGVIAVHCKAGLGRTGVLIGAYLIWRY
                     GFSASEVIGYMRLMRPGCVVGPQQHFMYENTAKWIQWGAEDRLRAELARELSAPAAPQ
                     TPAPSKRVVDAPATAPVNRMAKTTPCVGQPRKSPTSKRRRLDEVPSCLRVPSDESDAK
                     TVAAQLDSAPSSPRTDAEVLGVLDPEPSPTATSPTSTAGEKAPRLAQPGTASPTRARR
                     VMTPSQPSALSPARSPVPKVRASPRMSPARVGAENRPPTLRSTVRSPRART"
     gene            <355906..>356478
                     /locus_tag="MRET_0218"
                     /note="MRES_02485"
                     /db_xref="GeneID:38736984"
     mRNA            <355906..>356478
                     /locus_tag="MRET_0218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626845.1"
                     /db_xref="GeneID:38736984"
     CDS             355906..356478
                     /locus_tag="MRET_0218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483068.1"
                     /db_xref="GeneID:38736984"
                     /translation="MPSSSSPQATPKSGWIRAQRSTSATPVKTGRDECVLFPWQQDLD
                     AHLPKYRKLAHMSPARTLPTTPPPRRYRAPLRLEPGSARVERKADTFAMVKEVWRGAM
                     DTPSAATPAPARKPETRQAQQTTLDAFTRPTTKTTHVPESRALPPSPPDSLSSCSTIP
                     GDSDDEIASPARTWIRALGSSPSEWLHSSP"
     gene            complement(<356487..>356711)
                     /locus_tag="MRET_0219"
                     /db_xref="GeneID:38736985"
     mRNA            complement(<356487..>356711)
                     /locus_tag="MRET_0219"
                     /product="protein CMC4"
                     /transcript_id="XM_027626846.1"
                     /db_xref="GeneID:38736985"
     CDS             complement(356487..356711)
                     /locus_tag="MRET_0219"
                     /codon_start=1
                     /product="protein CMC4"
                     /protein_id="XP_027483069.1"
                     /db_xref="GeneID:38736985"
                     /translation="MPDQANPNPCKPYACQIQACIQRHQYNQDRCEHLVKQLYHCCAS
                     YYKKYGLDSECASCPKPDALNKKLAAWGEL"
     gene            <356904..>359969
                     /locus_tag="MRET_0220"
                     /note="MRES_02480"
                     /db_xref="GeneID:38736986"
     mRNA            <356904..>359969
                     /locus_tag="MRET_0220"
                     /product="folylpolyglutamate synthase"
                     /transcript_id="XM_027626847.1"
                     /db_xref="GeneID:38736986"
     CDS             356904..359969
                     /locus_tag="MRET_0220"
                     /codon_start=1
                     /product="folylpolyglutamate synthase"
                     /protein_id="XP_027482620.1"
                     /db_xref="GeneID:38736986"
                     /translation="MYQPDAGSRGMVKQQPLLILRSEPPLPLFCMPFPIPPFASDISL
                     LRLSVLRILTGQKGLPAPQLLTHSEKLKQMTVQGWRLKMLELIQVQAGSQRPEDDQVF
                     YGLPLEDSHDCSALEHGDEVVVRLRRGYTLADLQLPDLGPNHDYSVNLDDTETLYRLP
                     ESEVTRPTEPSSHSSSIQANPNGNYQAFQYPDYRHGYRVVVAKGVGNGVVSRSSGAEL
                     AAPPLSYADPHMAIDAHALAQLKGLARSNGRVGADARARLAELGYGVPEYKAKAKKRS
                     QRSPYENLVPGSAPLRLVPGVPETSAGGDSWLPPSAPTSLPRYAAPTHSVSKPLRRSH
                     AAPAPVSAPAAMPARMRVSEPVLTTVAPASAPMPTAPASYPSLAPAAMTAAAPPTTET
                     MHALPRPVLGHDRNTQAQLGPMVAPLHAKPKTKKKKKTTKSSTMSTFFATMRANDSAA
                     TSQLFVPLYSAPFLGTQAKDSVTGSKILGLIKGMGKPKHQPTDEPIPVAEEDVAEVTA
                     APSVPPSYSQARLHDHLPAVPADAAEVTGEPIVPAADVYPPPVLSNEPPHYMWSTHAS
                     SDEYRSAPMLPRTETQPQAVYEMQQPTDYAAARTVQAPAVYPAEQPASFAAQRTALPA
                     VYETQPYTTQRVAPDVYAAQRPTSSATPRTPPLPTMYETPQPMGYTTQQSAQAPAVYE
                     TLQPTGYTTQRTVETARPDGARLKESSVPITPSSAHLAPPSGVSVYTYGSPAGVVLPQ
                     AEPAAVPAHTHHGVMDHLLHTSVTGQDLHDPEEITTPKRSTKREFLSPGMTDHDGVEL
                     PFHDSVDEPSVGAITPSASLQRTPTVAVTPSSSARRGIEPAIPISTLALVPPSTRPTA
                     QPAAGAARYWSAYSHTSPRVEPTGTTHSHRGLTAASERMAPSSRASYPVATYSDREAQ
                     PAPAVPMDVQKSAPFVRHTASAAPLQRWATYTAPSSMQAQPPLVQPSLPSALPSSQDA
                     RVVSSVSPGDMMQPGQLYQPGPAVYVPVDAPADLSRRHTLAAMVPHSFA"
     gene            complement(<359982..>362261)
                     /locus_tag="MRET_0221"
                     /note="MRES_02475"
                     /db_xref="GeneID:38736987"
     mRNA            complement(<359982..>362261)
                     /locus_tag="MRET_0221"
                     /product="telomere length regulation protein"
                     /transcript_id="XM_027626848.1"
                     /db_xref="GeneID:38736987"
     CDS             complement(359982..362261)
                     /locus_tag="MRET_0221"
                     /codon_start=1
                     /product="telomere length regulation protein"
                     /protein_id="XP_027482619.1"
                     /db_xref="GeneID:38736987"
                     /translation="MEPSDGARESDGRVYPMFAAAAGDESAYKRRRLPPSKPRAAKSR
                     ARLSTTTLLAAWGQEARAPTPPPAQPMQRTVRGTATSDMAHPFFAKRETKSAPMARVH
                     AHATRPLQTVPAPWPEAPMVHVVPSQEPRMTRQGVSWPRRARSCSQSASDLTWSYTMH
                     PSSKAADPCMVCEAAMVPSSSSTAWHMEPRSPLTYLAADPACQRSDTHASPVIAYMHE
                     RLSRQERQALSPQPHASAHASLWMDHWRPTCAAHVLGNEASATILRDWLQDLRVSFSG
                     ATQRPAMTRRASRRRDRPASAESSEDEFQPEEAAWFDQFRAPASPPPPAPTALTNGMV
                     LVGPTGVGKSAAVYACASELGFEVFELYPGMGRRSGKDLAGAVGQLTRNHMVLGDARA
                     RIRDMPHQSLILLDEADVLFDDDIGFWPAVAELMSDSLRPVVLTCTDLDAIPLADLPI
                     QRVLTWHPAPVPAAATYLQLVALAEGYIVSHAAMQALYLRTLPPPDALTPRSGPVMPT
                     SHAYPSSRVVSTAAACDLRAALAQLPWLCMRTRAKEMLEGTVSDARPGVLSAPSEVSA
                     LRAPQDDAQALRAMCRDAEALSVADVVCRHGEYVDEYVPLPKSRAHVSPVPSVPCASV
                     HVPATLHLGPRLYAALAPRTASQLASLAARMDHDRVDHCRYLATLVRLLHVPPHEQLP
                     RSSIPLDYAPYVRILQQCDAARQHAWAAYLYNAQQGLSGRATRNSARFALDGMGVRGW
                     QAWLPFGPAELAAVRATAL"
     gene            complement(<362365..>363840)
                     /locus_tag="MRET_0222"
                     /note="MRES_02470"
                     /db_xref="GeneID:38736988"
     mRNA            complement(<362365..>363840)
                     /locus_tag="MRET_0222"
                     /product="transcription factor"
                     /transcript_id="XM_027626849.1"
                     /db_xref="GeneID:38736988"
     CDS             complement(362365..363840)
                     /locus_tag="MRET_0222"
                     /codon_start=1
                     /product="transcription factor"
                     /protein_id="XP_027482622.1"
                     /db_xref="GeneID:38736988"
                     /translation="MSEDALRFVSTSVGSRESQASPGVGSVETLHHSQEAPTYPMHTS
                     GGKGEGSDLTPFHHNQPPAAYAPPTAASSSPKKGMNEASAPASSMDPSLTGARRNEGA
                     QTGYPNMRQDQHSYRLDLLQTDPNLESNASLHGDAHEHENVARAFPFLSNSMAPQDGD
                     GRASIFPPNFSSVDAATQEAAAEGGNLGYKKADAHPQEAGASNLHAKDSREASYDTLS
                     PPEKKETPYSRSPSLRVTHKIAERKRRKEMKDLFDEIKEYVPVDRGPKTSKGDILTKA
                     VLQFQTLHREREQLIEALEAAHHELNQLRQVTGNADHAANTAAALPHHVYPPSSAAAP
                     YLSRAQPPRLSGSLVHGNQEQHLSLARADKGDLSAHAAAGAAAVSIPPSAPRTGEPFL
                     SDLRLDRLRQTDDAVHPNFKQLEHSTGVFQPESYQATSLVSSELAGGHDPAAMSAAEA
                     SNMHAGRAVTRDPSFSAQRYMPRADAGDLMQDSAHAEPPNM"
     gene            complement(<364039..>364771)
                     /locus_tag="MRET_0223"
                     /note="MRES_02465"
                     /db_xref="GeneID:38736989"
     mRNA            complement(join(<364039..364186,364216..364436,
                     364466..>364771))
                     /locus_tag="MRET_0223"
                     /product="variant SH3 domain protein"
                     /transcript_id="XM_027626850.1"
                     /db_xref="GeneID:38736989"
     CDS             complement(join(364039..364186,364216..364436,
                     364466..364771))
                     /locus_tag="MRET_0223"
                     /codon_start=1
                     /product="variant SH3 domain protein"
                     /protein_id="XP_027482621.1"
                     /db_xref="GeneID:38736989"
                     /translation="MFALPEKDRQAFFGILDEYFSQRPHLLNGTTHAVESNTTNTSAT
                     TKKAAPPPPPRQRQHTQAATSSSYYPPKDESLASAVSGMSMSSIHKDIRRPEGLTTGK
                     SIGKLDVSSPGSALKSALKNTSEMVQNRIQQNAREQETAHAVPSVDAAAHADAPPAEA
                     TAATSSGLGEATALYTFQGAQAGDLSITQGERIVLLDKVNDDWFRAQSVNGAVGIVPS
                     NYIQRT"
     gene            complement(<364841..>366424)
                     /locus_tag="MRET_0224"
                     /note="MRES_02460"
                     /db_xref="GeneID:38736990"
     mRNA            complement(<364841..>366424)
                     /locus_tag="MRET_0224"
                     /product="cytochrome c oxidase subunit 15"
                     /transcript_id="XM_027626851.1"
                     /db_xref="GeneID:38736990"
     CDS             complement(364841..366424)
                     /locus_tag="MRET_0224"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 15"
                     /protein_id="XP_027482618.1"
                     /db_xref="GeneID:38736990"
                     /translation="MSVLAWSGLRACSKRSVPSYLNHGKSMPILGTLSPMSGVSVAPA
                     RFASTASRHRSFMVTRMSQLTLARPSLYRPMSFQKYSTSSVSPAFESTTSTPPASEKA
                     MPVPETTSKVVAYHLLASAALVFLIIIVGGITRLTESGLSITEWNPGLKGMRLPQTDE
                     EWNEEWDKYKQSPEFQMLNANMSLDDFKRIFLWEWSHRILGRFIGVFFAVPAALFCMR
                     KGMTTPDTRKALLAIATGIGFQGFLGWYMVASGLKNPHADEPASAVPRPDWTPRVDHF
                     RLAAHLGTAFIVYIGMVYKAVSILRDNALVKNLKKSPNETGKMTEAFMYLLQNPKARA
                     FRRVGTGMLLFAFTTAIYGAFVAGLDAGLVYNEFPFMGHHRLLPPKEEVLDPRYSFRL
                     KNSSEPDASMVAFGNMTQNPVTVQAIHRVLGISTVVAMIAFSLYAKRLKAYIPKAAPR
                     FATGAAHMSGLQALLGISTLLYMVPLPLASLHQAGSVVLLTMLTCALGVTRKPNALIR
                     AFAQRQRMMAGSTKPSKSP"
     gene            <366925..>369495
                     /locus_tag="MRET_0225"
                     /note="MRES_02455"
                     /db_xref="GeneID:38736991"
     mRNA            <366925..>369495
                     /locus_tag="MRET_0225"
                     /product="vacuolar transporter chaperone"
                     /transcript_id="XM_027626852.1"
                     /db_xref="GeneID:38736991"
     CDS             366925..369495
                     /locus_tag="MRET_0225"
                     /codon_start=1
                     /product="vacuolar transporter chaperone"
                     /protein_id="XP_027482617.1"
                     /db_xref="GeneID:38736991"
                     /translation="MKFGRTIKTSLYPEWSSQYLQYSDLKKDIKRRLAENQGTWTDKD
                     EDEFVEELRMELDKVYSFQKSKVSELTGRIEQVNTEVNQLLAARAEHEAGHHREHAHN
                     GEGQGDEQHHPNDQHRDTLYKACHNAGSDDEFDSDSEETDHFEERFQDLEENLANVIA
                     DVHDLALFTKLNYTGFLKIVKKHDKQTDRLLRKEFVQHYLSTRPFYKENYDALIVKLS
                     RMFDIVHTRGNPVRGDSSAGGSQSAFVRQTTKYWVHPDNIVPLKLFILKHLPVLIFNT
                     EKEYQPEDSAITSIYYDNEDLELYLGRLEKTEGAEAIRLRWYGGMDNKTIFVERKTHR
                     EDWTGEKSVKARFPIKEELVNAFMRGEYRMNDTFEEMRKKGKKSDKEIDSMIQLASEV
                     QYSILSRKLQPVMRSFYNRTAFQLPGDARVRISLDTELTLVREDNWDGKQRSGNNWRR
                     MDIGIDYPFEQLPEADVERFPYGVLEVKLQTQMGQEPPKWVRELVQSHLVEAVPKFSK
                     FIHGCATLLSNRVDLVPFWLPQMDIDIRKPVSMNLALDRPHHSSNSSDHTHSSGRNPQ
                     YEPVSEDEFEGDDGDEHMKSQIASAQQEADNVGLSAFDPRIKEIREQREKYLVEHRKE
                     SEGAHKDASKAPTKDKASTSRSDLHVPMSRDDILAPSTVFDKNYVKKFGNNISRLLGS
                     ADQAGDENEADERAIRALQGRDEEEPRGSGSGPPKGVEYVTDFRTEPGKKVSVPIRVE
                     PKVYFANERTFLKWLEFSVMVASIATGLLNFQRVGDVVGLVTSTLFTVIALFTIAYSG
                     ALYMWRALKIRERSSSNVYSDSYGPTFICATILGITVVNFVMRYFETNESRLFRGVPN
                     "
     gene            <369633..>370925
                     /locus_tag="MRET_0226"
                     /note="MRES_02450"
                     /db_xref="GeneID:38736992"
     mRNA            <369633..>370925
                     /locus_tag="MRET_0226"
                     /product="Lhp1-RNA binding protein"
                     /transcript_id="XM_027626853.1"
                     /db_xref="GeneID:38736992"
     CDS             369633..370925
                     /locus_tag="MRET_0226"
                     /codon_start=1
                     /product="Lhp1-RNA binding protein"
                     /protein_id="XP_027482823.1"
                     /db_xref="GeneID:38736992"
                     /translation="MSQEEASSSRAPLSPEEAKAATLKQIEFYFADANLPFDKFLFTL
                     TRKDPEGWVPIETLASFKRMRPMREVLNTQEMAEALRKSEALLEVDAEGLRVRRKAEL
                     KPVTDAHTRSIYAKGFPDEYEGLQEELEAFFAQFGKINGVRMRRENEKPRKFKNSVFV
                     EFADAAEKDALLAKAKAVEPVEDGGHGVQYKDVQLQVMSKPAYVEMKMKEKGIDPSDN
                     KPSKGGRKFNAFREMERERHSGSDEPKSTRSDPLEFEYNGQLLCTKPDGTVDAEKVTF
                     PAQSVLRFTNAAQGGSWKDLKDTLTTLHPTSFVDFPADAVEGVVGFRESVSDDKLREI
                     QDKGITVGGSAVSWERVNEDKARDFYVERANFRASFLLDRREADRHAPRRGHRGHARG
                     GGRGGRGGRPAPAPPSSDKRKHADEPPQVEAKRSKTDE"
     gene            complement(<370934..>373162)
                     /locus_tag="MRET_0227"
                     /note="MRES_02445"
                     /db_xref="GeneID:38736993"
     mRNA            complement(<370934..>373162)
                     /locus_tag="MRET_0227"
                     /product="ATP-dependent RNA helicase DDX31/DBP7"
                     /transcript_id="XM_027626854.1"
                     /db_xref="GeneID:38736993"
     CDS             complement(370934..373162)
                     /locus_tag="MRET_0227"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX31/DBP7"
                     /protein_id="XP_027482822.1"
                     /db_xref="GeneID:38736993"
                     /translation="MEHDDGLLLNLDAVAPAPTRASHRDKKRRGRDSTNHRGLKRARP
                     MPRQQENVLDGEADQAALRKARAMAAQPSATKSGLYISSLFSRDEANADKPTELPSIP
                     RAAPTNAPSADASFEQLGLEYILAAHLRERMDIRDKPTEIQRLAIPPLLSAPPMPQRD
                     VLIQAQTGSGKTLTYLLPIVQSLLPLSEESFIDRSVGTLAIILAPTRELARQIYQVLE
                     RLLTLSLASPDEQAEGVPRRRARWIVPGLLTGGSTKNHEKQRLRKGCPILVSTPGRLL
                     DHLQNTASLDVGKCRWLVLDEADRILELGFEEQLTGIIKALDGRRRLALSTARSALVE
                     SGALSSDAPDDQVTDSLGMAWWAWRRRVVLCSATLDERVQAFSGTTLCDPMLVRVGMK
                     TEASAAEPTFAAPAQLAQHAVIVPPKLRFVSLLALLRQSLPRVADAAHQGAARIMVFL
                     TCTDTVDFHWHAIGGARLGDQEASKEAALETPLAQHSQLFPGVPIYRLHGSMSQKDRI
                     ASLRAFHTLTDGTEAPPATRGGILLCTSVAARGLDLPHVSCVIQMDVPTEDGVEEYVH
                     RVGRTARVGRQGTSWLMLMPHERPWLDTLTRRMVVASRPAQVPLVGYDTVLFQGFGGA
                     AREYESRATDVQMALERWVLASPSHATLARTAFLAHIRAYATHPAAEKDIFHVHQLHL
                     GHLAKAFGLREAPQTVQRTAKKEHERQQKPKLAAAAATGTDAASESRRQRMLAHLPTE
                     SM"
     gene            <373242..>375707
                     /locus_tag="MRET_0228"
                     /note="MRES_02440"
                     /db_xref="GeneID:38736994"
     mRNA            <373242..>375707
                     /locus_tag="MRET_0228"
                     /product="protein SDA1"
                     /transcript_id="XM_027626855.1"
                     /db_xref="GeneID:38736994"
     CDS             373242..375707
                     /locus_tag="MRET_0228"
                     /codon_start=1
                     /product="protein SDA1"
                     /protein_id="XP_027482955.1"
                     /db_xref="GeneID:38736994"
                     /translation="MVAKAPPRPTAVVVDQGLRYRSKTRGLLHTHNLPALQNLLKRDP
                     SAYTEDFLAQWNHYESLRRIFASGVGQQVEGAALDGNVSAVRMSKDQQSQFDQLLSFV
                     AQLAPSYPDITKALPEHLSELLLEHHASLSPETRKTCFRALSLLHNRQMISSEFFLKT
                     LFPLLSMTSSSDMRTMLLHAIVQDIKLANQKSKDPRLNRMVQGLLFGMVERGMNPDDT
                     SVVLRRADAELKGRTEALWAVRVASEMWRRRIWTDERTVALLAMACTHPHPKVQASAV
                     RFFLGDLHAAENAGHDSDEEQGESEDVGRLQHQNRVGKKTKAAERRLKLAKAHARRRR
                     KEQSEKALDEADQETGNLAAIHLLYDPQSFGENLFENLSRGDKRHSLEVKVRIMQLLS
                     RVMSVHRLTILSFYSYMAKYLMPHQLHITLILVSLAQSVHEQTPTDVLTPAIRKIAYA
                     FVHPGVSAEVVAAGINTIREICRRQPWCMEQDLLEDLVAYRHSKDKGVSAASRSLMLL
                     YREVNPGMLHRTERGKAASIAMAQGKEAERYGVDRREVHGIQGLELLEQHLKERDDEA
                     ADDDAQWDGWEVESDDESDMSGGWVNVSSDDEQDYFELEKSDDDEEEKDDTKEVDTRP
                     MSVRVREARRKRKEEQKQEGEDESESEPQPEPASHEEAPDAFSELATTRILTPADFAK
                     LNELRLQAAEETAKTGGAAGARARRELAALQLTKKRTTGSHEVLDESDILGPRKKTKA
                     DYEERMASINAGREGREKFGSNKGKKKKEVASSSTNRQKAKGKNFQMVAKSWGVRSKK
                     NASLREKSKRLRAHVNQAKKRMK"
     gene            complement(<375708..>377021)
                     /locus_tag="MRET_0229"
                     /note="MRES_02435"
                     /db_xref="GeneID:38736995"
     mRNA            complement(<375708..>377021)
                     /locus_tag="MRET_0229"
                     /product="putative membrane protein required for lumenal
                     ER protein retention"
                     /transcript_id="XM_027626856.1"
                     /db_xref="GeneID:38736995"
     CDS             complement(375708..377021)
                     /locus_tag="MRET_0229"
                     /codon_start=1
                     /product="putative membrane protein required for lumenal
                     ER protein retention"
                     /protein_id="XP_027482552.1"
                     /db_xref="GeneID:38736995"
                     /translation="MRTAALGVWAWAAVARAAPDRADTVLDASFEHFLPPIFRAVLMT
                     ALCMCGFGVILQVLQHWDMNVFHGPGPASRLPLAHTRTDPTRESGALPLYLLALCHVA
                     WSTFCWLMYRLHVEPRTGLRTLHAQAWETATLAGLLVLWIVPGPFRHLLRAWNRSLVR
                     LFTPSLQQPILFTDVVLADILTSFAKVLGDVWLSLVLLAYFVMGQRADDRILLQAQTH
                     VAVPVLISVPYVIRFRQCLSEYYTSGTRVRRPLYNALKYLSSLPVIWLRSWPVFMSLS
                     PGAARIVDVAWYACVLLNTLFSFWWDVTNDWGLDLLQPHSFHALVTHPPTQLPTLHRR
                     SSSEHDHTHAALPMKPQGHVRRPTVLRMPEKPLPLPPSLYWAILCVNLVLRFTWSVKL
                     SSHWQFLWDWQRGLLLLEALEIVRRCVWVLLRVEWELVRQHPMDL"
     gene            complement(<377200..>378066)
                     /locus_tag="MRET_0230"
                     /db_xref="GeneID:38736996"
     mRNA            complement(join(<377200..377806,377842..377989,
                     378057..>378066))
                     /locus_tag="MRET_0230"
                     /product="large subunit ribosomal protein L8e"
                     /transcript_id="XM_027626857.1"
                     /db_xref="GeneID:38736996"
     CDS             complement(join(377200..377806,377842..377989,
                     378057..378066))
                     /locus_tag="MRET_0230"
                     /codon_start=1
                     /product="large subunit ribosomal protein L8e"
                     /protein_id="XP_027482656.1"
                     /db_xref="GeneID:38736996"
                     /translation="MGRVIRAQRKSGGIFTAHTRLNKAPAKLRPFDFAERNGYVRGLV
                     KDIIHDAGRGAPLARVTFRDPYHYKQVTETFIAPEGLHTGQFVYCGKKAMLNVGNVLP
                     LSSLPEGTIVCNVEEKVGDRGALARTSGNYATVIGHDLDSGVTRIRLPSGAKKTVPSF
                     GRATVGVVAGGGRIDKPLLKAGRAYHKYRVKRNCWPRTRGVAMNPVDHPHGGGNHEHI
                     GHSSTVKRGSVPGQKVGLIAARRTGLQRGTIKVRDA"
     gene            complement(<378422..>379690)
                     /locus_tag="MRET_0231"
                     /note="MRES_02430"
                     /db_xref="GeneID:38736997"
     mRNA            complement(<378422..>379690)
                     /locus_tag="MRET_0231"
                     /product="A1 cistron-splicing factor AAR2"
                     /transcript_id="XM_027626858.1"
                     /db_xref="GeneID:38736997"
     CDS             complement(378422..379690)
                     /locus_tag="MRET_0231"
                     /codon_start=1
                     /product="A1 cistron-splicing factor AAR2"
                     /protein_id="XP_027482657.1"
                     /db_xref="GeneID:38736997"
                     /translation="MSVADWYARHAFILLQNLPRGSYISIDQHAYRTDTSFEGFKLVP
                     PGIHCIAWQSAAASADDGDRHDGLSEGIRSIWFFYVQEETVLVRMYDATSDTWMTAPG
                     TGAETPVIVSRDHLQSMDRHLAAYPMDSSPLWHRLTHFLRLSRSTIDRVFGIDARSAD
                     ATCDSFTPVTDRNARSSLRELRTDPRLQEEISLPGLAFTSFSLSHSWPPEAHGEERTR
                     WNMDKSWLLEHVMQRACDAEKVSLSHEPLLREFELCFLLFRCTSNAAALDHWMAMVSL
                     FSRAAAYIGAPTPPHTLHPCEWDTALPSHVWAPRLEAHRAWIQTLVSQFEALPSTIWT
                     EDLLTFEAQILEDMASLRMNISRSLGAWAATSSSSPSTEHEQLVQAWRKLSAMAQKQF
                     EWSLDYLLDEEVEADDAEEGEDAPVIVHMS"
     gene            complement(<379728..>380456)
                     /locus_tag="MRET_0232"
                     /note="MRES_02425"
                     /db_xref="GeneID:38736998"
     mRNA            complement(<379728..>380456)
                     /locus_tag="MRET_0232"
                     /product="translation initiation factor IF-3"
                     /transcript_id="XM_027626859.1"
                     /db_xref="GeneID:38736998"
     CDS             complement(379728..380456)
                     /locus_tag="MRET_0232"
                     /codon_start=1
                     /product="translation initiation factor IF-3"
                     /protein_id="XP_027482654.1"
                     /db_xref="GeneID:38736998"
                     /translation="MKSFALLSPTLRGRMTPLRAKWPTGPLGAATLPFHTAAPRAAND
                     KSAQDKLVDERITAPLIQLVDPTSGQLHGPFKPQDILAKIDRKAYLLMQVTKGAMDDP
                     TQKKEWSLRDLPICRLINKRVEYERQREKKKKPTSTQSKALTLSWNVSDHDLSHKLSK
                     ARRELERGHQVRVEISAKSGTPRALPGSQEADDRLQLVEHILSQLTQASPTSEATLAR
                     ITSPPSWNRSRTLVAFVLQGSGAA"
     gene            <380827..>385536
                     /locus_tag="MRET_0233"
                     /note="MRES_02420"
                     /db_xref="GeneID:38736999"
     mRNA            <380827..>385536
                     /locus_tag="MRET_0233"
                     /product="golgi-specific brefeldin A-resistance guanine
                     nucleotide exchange factor 1"
                     /transcript_id="XM_027626860.1"
                     /db_xref="GeneID:38736999"
     CDS             380827..385536
                     /locus_tag="MRET_0233"
                     /codon_start=1
                     /product="golgi-specific brefeldin A-resistance guanine
                     nucleotide exchange factor 1"
                     /protein_id="XP_027482655.1"
                     /db_xref="GeneID:38736999"
                     /translation="MRGVQEGAVGARAPQRCTSQKRLVLRYINAVTSAMRTSPRWSQA
                     AGAPNAVLSSATTSTMALSLTRAAQMLARSELSLQEKEQDDLKEDARSEPASVGLLGG
                     FTVLCAQLRMVSDVAEIPLPTLLSHFIGVILSPRTTGAVTQVALEAVAAFLDGGLFRT
                     SSIGLEQAVQEVAHATSHCRFEPSDAGKDEVVLLAILDVMYALVRGRAVRDDDDANRE
                     GKPFVDMLGDESVCELMETCLSMGCQTRLSSALRRTAERKMQGMIREVFSRLQTMPLQ
                     ADEAYTETGRPQEPDVATLMADRVGADAEDDKQLRMATPDPKSRSIPAAGGGTEPEEE
                     PLRNEQEESEPPGEAQGEPNMDEQRDKEALDKPADPAPEPREPFDAHHHAPTPGASNA
                     DEVRTSTDVDRRMRSAEPVVPFGMPALKEILRVLISLLDPGSVRHTMTMRLLGLSLLG
                     SVLDTHGAWLARFPSLRALLGDSACRYLFQLANSEYGPLVAHSLRVLHVLFVELRGHL
                     KMQQELLLQFYVQQLRSAQTLVDKPWSDEESQPESPPVLASFHASASGEQRELFTEAL
                     CHHLAGDDDAADPFVVLWRNYDCDMDCANLYDHVTQFLCRAIFAQPMPGAAAMAPRTS
                     PSGLQLVALDMVLGMVERMAARHESGGTDESGLPSTLRMQRERKALLAAGAAAFNHKP
                     KDGIAFLAQQALLAPSGRERARSIARFLKDSPLVDKRLLGDYISRAENVDVLAEYMDM
                     FDFGECDVAEAMRALCEAFRLPGEAQQIARITETFARKYFASKPPGIRSEDAVYVLAY
                     SIIMLNTDLHNPQVTRRMTTADYQRNLRGVNDGADFDQAYLAAIYDGIRRREIVMPEE
                     HAGQLGFDYAWKELLRRARAGNTLHLYTGAALDADMFRHSWRPFVASIVHAFSTLQDE
                     HLLHRVIAGCRQCVVLARAYDVPGVLDYMVEHLASATGLMPGTELDDARTDAVVEHDG
                     TRLTVSPLSVAFGSQFKQQLAAVVLFTIAHGSGASLRSGWSSLLACIETLLVHGLLPR
                     GTAQMYVARDTYAPIPLTGKGAMTASTAPATAAAGGLFSTLSSYFLSPYPAASEPMHV
                     SDADLESTLCALDCLASCKIHQMHSHIAELPDDALAAYVAAVYERLGASARLRPDYSP
                     VPVFWLEQLTTLVCTRPACVSQQQALDVHLARIKEAPHTPPTELERATLGAMRIAAAT
                     DHVHDALMAVLDALRSVPSTLHATVSAAFLTGLVTIIERGMPPVSDDEWRTLLHLVTS
                     YARVRRAATARAALELVVHMVPQHVQPVTYAALVELVRETLSDADRAMWHGEDHAPRR
                     TLTEKRELSDWMAAVHAASPAALEALARVRTQIPSMVAPATWPEYWLPLVTAFAQPCV
                     SVHAPTRHAAVSHLPYVVLAPEMHQHIDPAHLAPHMEAMFGHILLPLLETLMAPETTR
                     ADTPDKTPPTIAETRALVCLLVIRAWVRNVGTLMDGVPNDLEKPAAARVLRLWIGVVH
                     ATAKLLRTPQPHSEAIDEQLKNMVLVMHTAGHLVEGPPGSLRRALWVETWRRIDPIRP
                     DLRASLQQPTAPTDKGT"
     gene            complement(<385554..>386180)
                     /locus_tag="MRET_0234"
                     /note="MRES_02415"
                     /db_xref="GeneID:38737000"
     mRNA            complement(<385554..>386180)
                     /locus_tag="MRET_0234"
                     /product="Ras-related protein Rab-1A"
                     /transcript_id="XM_027626861.1"
                     /db_xref="GeneID:38737000"
     CDS             complement(385554..386180)
                     /locus_tag="MRET_0234"
                     /codon_start=1
                     /product="Ras-related protein Rab-1A"
                     /protein_id="XP_027482652.1"
                     /db_xref="GeneID:38737000"
                     /translation="MTGLSPDYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTI
                     GVDFKIRTIELEGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDESTFANV
                     KQWLQEIERYACEGVNKLLVGNKADLTSSKAVDFDAAKQLADELGIPFLETSAKDATN
                     VEQAFLTMAKQIKDRMGVSAMQNGSAGKSSLKVGQGQSVQPTNNGGCC"
     gene            <386359..>387318
                     /locus_tag="MRET_0235"
                     /note="MRES_02410"
                     /db_xref="GeneID:38737001"
     mRNA            <386359..>387318
                     /locus_tag="MRET_0235"
                     /product="solute carrier family 25 (peroxisomal adenine
                     nucleotide transporter), member 17"
                     /transcript_id="XM_027626862.1"
                     /db_xref="GeneID:38737001"
     CDS             386359..387318
                     /locus_tag="MRET_0235"
                     /codon_start=1
                     /product="solute carrier family 25 (peroxisomal adenine
                     nucleotide transporter), member 17"
                     /protein_id="XP_027482653.1"
                     /db_xref="GeneID:38737001"
                     /translation="MVSESFVHACAGGAGGLVAMTATYPLMGISTRAAVDQSKNPGES
                     LVKAITTVMAKEGITGLYDGLSSSLIGIGVTNFVYYFFFEAMREFILTSKRITRSSKA
                     KLGALTTTESILSGLVAGITTALISNPIWVINTRQTVRVSQQDTTGANKVVARKSFLQ
                     TLNHIVEKDGVRALWKGIGPALVLVTNPVLQYTAFEQLKNWLVNIRFVSRGNTPAAAK
                     PLLSDLDFFWLGALSKLIATSITYPQIVIKSRQQAMSHDSSSDRKKVNVWSAMTEVVH
                     NEGVGGLYRGISSKLLQSILTAAILFASKERIYKMTKAVLVHV"
     gene            complement(<387338..>390253)
                     /locus_tag="MRET_0236"
                     /note="MRES_02405"
                     /db_xref="GeneID:38737002"
     mRNA            complement(<387338..>390253)
                     /locus_tag="MRET_0236"
                     /product="transcriptional repressor NF-X1"
                     /transcript_id="XM_027626863.1"
                     /db_xref="GeneID:38737002"
     CDS             complement(387338..390253)
                     /locus_tag="MRET_0236"
                     /codon_start=1
                     /product="transcriptional repressor NF-X1"
                     /protein_id="XP_027482650.1"
                     /db_xref="GeneID:38737002"
                     /translation="MSSSSTPSSAPPQRGTRRSRGRGRPSRATKNKEHSHDQEHTPSH
                     HHASDRKSSRKFGAKLTHQKEASAPAPPPTVREYTDLRSRIVTEISQGEYDCIICYNA
                     IKRKHPIWSCTRCYAVLHLSCVRTWAERSVTQIKEQNALHQEASIRDMPGHWRCPGCQ
                     DVKHDVPRTYKCWCHRVSNPHPPSHGVPHSCGGRCKRGCKRHGCPANKCHPGPCPPCA
                     ATVEVACFCGKEPHMHVRCSQLPPETGGRLSCGNACGKSLACGHHTCAQPCHAGPCAP
                     CAEILADVPCFCGRHARTITCGERPPEAAGLRACWSCQEPCGAPLACGHHTCQKPCHI
                     RTGVAPCPYGPDQVRTCPCGRTPLLDRLDCRDPIPTCEASCGKIHASCGHACSATCHI
                     GPCPPCEASVLQVCRCGASKRRVMCCEAKVSNEPFLCDQICKVSRHCGKHVCQQRCCP
                     LAYQASVPKKMLPTDLSLLDPMHYHACHVRCQKPLSCGRHTCDAPCHRGACAPCLRST
                     FTEVSCTCGRTVLDPPVPCGTQVECSYPCSLPPPPCGHPKISHTCHPPDTPCPPCVHL
                     TNKVCMCGRTTLPAVPCSRKNVRCSAPCRRTLACGQHTCSGACHAEGECPPCKQVCGR
                     PRPLCGHPCERPCHAPVACDTSEPCRAMILRHCECGHREQLDVCGAAPGVDREPVPML
                     SCTPACKVAQRNARFARALGLDVRSEHVSYAPALVQYVAQDPRGAQAVQDVLNEFVQS
                     PRAAAQVHSLLASYALRRGCEPIKVHMDLLTFVEQLARMYHLETELCTLSGLLYTGPL
                     VSPARDADVRVRRTRDTRIPSVLLTEYAATQPARSALEARRHVSPRTPYGNAVWIDGV
                     LDDAALSVALQRVNLNGQRSWHVRQVQTATLLTHIRLEPQSLASVASGPKPQGNESLS
                     TPTERRLLRLCEDVQHAWESAGAKAPATVALCACADDERITHLFRQGRWERYEASLA"
     gene            <390367..>390981
                     /locus_tag="MRET_0237"
                     /db_xref="GeneID:38737003"
     mRNA            join(<390367..390805,390833..>390981)
                     /locus_tag="MRET_0237"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626864.1"
                     /db_xref="GeneID:38737003"
     CDS             join(390367..390805,390833..390981)
                     /locus_tag="MRET_0237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482651.1"
                     /db_xref="GeneID:38737003"
                     /translation="MSAVRSAAHPPVRLVPISPAALQPPSAVVKMNCPPALQYRTQLF
                     SLSLYPLHARIDQPRQNRMPPVLGPPWLPFPPSPDTHNARHIRRYRELMYDIEHKTPR
                     LYASILISKKRVHKHAVVRNRCRTRLMAALQQLIRREKDMPVHSLHAYIFFGTSYLFS
                     AESVVIEQEVRRALLAVGSKALRLTARHPSRSKPL"
     gene            <391169..>392176
                     /locus_tag="MRET_0238"
                     /note="MRES_02400"
                     /db_xref="GeneID:38737004"
     mRNA            <391169..>392176
                     /locus_tag="MRET_0238"
                     /product="DUF250 domain membrane protein"
                     /transcript_id="XM_027626865.1"
                     /db_xref="GeneID:38737004"
     CDS             391169..392176
                     /locus_tag="MRET_0238"
                     /codon_start=1
                     /product="DUF250 domain membrane protein"
                     /protein_id="XP_027482648.1"
                     /db_xref="GeneID:38737004"
                     /translation="MSQPTSTGVQAHRGAEKLEQDTKGESGLPQPAVHSQRPNKRVLH
                     PSIIIAIWIAFSSGVIVYNKYLLVNLHFPYPVFLTTFHMAFAAVGTRLLARYTNLLDG
                     LANVDMTMERWYRNILPIGVLFSASLILSNMAYLHLSVPFIQMLKAFTPVAVLIISFS
                     FGLKQLSTTLTAIVVMISFGVATASYGELEFNMTGFIFQVLAIAFESTRLVMVQVLLQ
                     GLKMDPLVSLYYFSPVCGALNMMVLPLLEGLQPFRALAQLGPLVLLSNAGVAFGLNVA
                     SVFLIGAASSLTLTLAGVLKDILLIIGSMWILGSTVTGLQFVGYGIALAGLVLFKTHK
                     G"
     gene            complement(<392243..>394366)
                     /locus_tag="MRET_0239"
                     /note="MRES_02395"
                     /db_xref="GeneID:38737005"
     mRNA            complement(<392243..>394366)
                     /locus_tag="MRET_0239"
                     /product="DNA damage-responsive transcriptional repressor"
                     /transcript_id="XM_027626866.1"
                     /db_xref="GeneID:38737005"
     CDS             complement(392243..394366)
                     /locus_tag="MRET_0239"
                     /codon_start=1
                     /product="DNA damage-responsive transcriptional repressor"
                     /protein_id="XP_027482649.1"
                     /db_xref="GeneID:38737005"
                     /translation="MACEAIQPSYFYATDSEAHISAGPDANPSASLPGVPVFEPTMAQ
                     FADFYAFCQAIDAWGMQTGIVKIVPPREWVEALPRLRPDADPKHAHLGKVRIRHAITQ
                     HFLAAGPGRWKQTNVTRAKPYDAKQWSDLCMCQRGPAMSRIRRQVAANRAAEVAHQHS
                     RSYTSSDAPPIDAPGKLTRSGGLSREASQRSVPKCKATTPQDWDTFDFEHGWLNEALT
                     DAERDAGHHVSVRDWDVPSCRAIEAEYWRTLNLGMPPMYGADQQGTLFDDRTTQWNVG
                     TLDSLLSRTLKCALPGVTTPYLYFGMWRASFAWHVEDMDLYSINYIHFGAPKQWYAIR
                     QADRKRFESVMASTFPAEARKCAHFLRHKSFLVSPSVLASHGIQPLRLVQHAHEFVIT
                     YPYGYHSGYNLGFNCAESVNFALPTWIEIGRRADYCRCPLAQESVHFDVNAWWPTEQQ
                     SEPVALGHKCIFCPHDTSLDTLVPVPAEACAALERTNAKKSLSASASPYMAHRLCACF
                     LPETWVDASSQVQGAATIERSRWTLKCQVCTDPADRLHGAKIQCTKGRCVHAVHVSCA
                     LNETSGWLLDICARETADQLEGVRSSSDAPEERAVVLCRAHNPHRRAIDMQRRHEAVR
                     DKLRALAFPMPVRIKMQGAVWTVQLLGVDEAKHEVVVQESSTAAAKQVPWTCLVLDEK
                     PSPDTHRESKKRRVHCARDVDIYEN"
     gene            <394483..>395073
                     /locus_tag="MRET_0240"
                     /db_xref="GeneID:38737006"
     mRNA            <394483..>395073
                     /locus_tag="MRET_0240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626867.1"
                     /db_xref="GeneID:38737006"
     CDS             394483..395073
                     /locus_tag="MRET_0240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482897.1"
                     /db_xref="GeneID:38737006"
                     /translation="MSTSAKTAGPASKPHDYKAHFTRTRGKYDTAMERNAALQGAAAK
                     MIAKQQKLQEELDFLLDAIHDVETKARTGDLVFRPIAIPPQRDEPVTAAKPKAPKRAR
                     AKPRRQPRASTAAVTEYSDDDVPAQPEHRQDGDAEADHTDADPSVTMQPIDDMPSSTP
                     EHDASAKRPRDDGESPDAHVPDDDHGSPKRPRLFVA"
     gene            <395119..>397092
                     /locus_tag="MRET_0241"
                     /note="MRES_02390"
                     /db_xref="GeneID:38737007"
     mRNA            <395119..>397092
                     /locus_tag="MRET_0241"
                     /product="seryl-tRNA synthetase"
                     /transcript_id="XM_027626868.1"
                     /db_xref="GeneID:38737007"
     CDS             395119..397092
                     /locus_tag="MRET_0241"
                     /codon_start=1
                     /product="seryl-tRNA synthetase"
                     /protein_id="XP_027482516.1"
                     /db_xref="GeneID:38737007"
                     /translation="MAFLLRHGRWGVACPRFVRAYAQRVAQYRPLPDPSVAWRADEAE
                     EARRVALQRHMPFAEADAVALPAMHASLAHMRAERTKLENEQQHIGATIPRLAQSQGD
                     PERLMQLRGRARELRTVLRELSQRIDDASARSLEIRSAWPNRMHPDVPIGPESASRVV
                     VVHDARAGASALPGVSLPCSQHEFDACMEQALVPRPERDHLSLAHAMPDGGVDMAAGL
                     TTTGPSWPYLIGTLSMLEHALCQYALHVAQKHGFVPVSVPDVVKTDIAERCGFRPRDE
                     AAAQTYFVDTRRDVSDAAGLCLAGTAEIPLAALVAKHTYDARGPSGTGDVRHMALPIR
                     LTALGHAFRAEAGARGADTRGLYRIHQFSKVELFAVTTPDESDRMLESLREVQQDMVE
                     GLGLLYRVLDMSSEELGASAYRKYDIEAWMPGRGAWGEICSASNCTDYQARRLAIKYR
                     DAESGKNTYAHTLNATAAAIPRLQLALLETYASTRLALPSTLRPFWLGGPKDPRVEWI
                     DLRAPSTIARAHAQLRAIAQRTGAKPAPLLLAFAILHELTALVPLFVLAFVLTTLGAG
                     DAILRSIDAAIQHVAPSEHDRLSAWIDRGSHMARRLSHRLGTDASANPAAWLTSLTAS
                     YVVVKLLLPVRIAASLALAPVTARAMVRCWRRT"
     gene            <397122..>398162
                     /locus_tag="MRET_0242"
                     /note="MRES_02385"
                     /db_xref="GeneID:38737008"
     mRNA            <397122..>398162
                     /locus_tag="MRET_0242"
                     /product="dCMP deaminase"
                     /transcript_id="XM_027626869.1"
                     /db_xref="GeneID:38737008"
     CDS             397122..398162
                     /locus_tag="MRET_0242"
                     /codon_start=1
                     /product="dCMP deaminase"
                     /protein_id="XP_027482895.1"
                     /db_xref="GeneID:38737008"
                     /translation="MLVAIVGLACAGKTAVAEYLETQHGFQRITLSGEDGPTDFASPD
                     AMLHHVTAHWRTRFVTLDLDTAPLIDLFEKRPFFLLIGVEAPLMQRWHRACMRAHVGG
                     QAPMSLESFVSYDDAILYGVPPETDDADTSVSTDIANMSLMSHSGATVSASLPSAGHT
                     LTGLLQRCHLRIANTFAHVDDLHAHLHTLALPSLHRLRPTWDTYFVRLCTLAAMRSNC
                     MKRRVGAVIVRQHRVLSTGYNGTPSGLLNCNEGGCARCNESAPCGSSLDECLCLHAEE
                     NALLELGRDRGGAQGTVLYCNTCPCLRCAVKIVQTGVMEVVYQLEYSMDDRSARIFQQ
                     AGVAVRKYIPPF"
     gene            complement(<398159..>398803)
                     /locus_tag="MRET_0243"
                     /note="MRES_02380"
                     /db_xref="GeneID:38737009"
     mRNA            complement(<398159..>398803)
                     /locus_tag="MRET_0243"
                     /product="solute carrier family 31 (copper transporter),
                     member 1"
                     /transcript_id="XM_027626870.1"
                     /db_xref="GeneID:38737009"
     CDS             complement(398159..398803)
                     /locus_tag="MRET_0243"
                     /codon_start=1
                     /product="solute carrier family 31 (copper transporter),
                     member 1"
                     /protein_id="XP_027482894.1"
                     /db_xref="GeneID:38737009"
                     /translation="MDHAMMHHDMAGMDGHAGHDMSMHEVHQGHGSMDMCRMAMVWNT
                     DTKGMCVVFKSWHVRTERQMLVSCVLVCLFAFAYEWLKLALRRVDEAVAHTEAAHNGT
                     LLYRASDDVPMRTRSGPRRVMPLVHDDALEGDVSKHSVILRVMPRTLQTPARLRMVST
                     VLYGAQVSLSCFLMLVMMTYNAWLLGALVIGAMIGASYTRHVRTAVGESGAVCH"
     gene            <398802..>400021
                     /locus_tag="MRET_0244"
                     /note="MRES_02375"
                     /db_xref="GeneID:38737010"
     mRNA            join(<398802..399880,399913..>400021)
                     /locus_tag="MRET_0244"
                     /product="UDP-glucose--hexose-1-phosphate
                     uridylyltransferase"
                     /transcript_id="XM_027626871.1"
                     /db_xref="GeneID:38737010"
     CDS             join(398802..399880,399913..400021)
                     /locus_tag="MRET_0244"
                     /codon_start=1
                     /product="UDP-glucose--hexose-1-phosphate
                     uridylyltransferase"
                     /protein_id="XP_027482893.1"
                     /db_xref="GeneID:38737010"
                     /translation="MIQARGRWRHGTRPTMPPFQPSQHPHRRWNPLLQTFVLCSPHRT
                     QRPWQGAQESADLPPLPVYLDTCYLCPGNTRATGAHNDPYTQTFVFENDFAALKDVHV
                     EAQDTDTHFGLFRMAPARGKCYVVCFHPHHNLTLAQMTTAPYSAESHIIPIIHTWRDM
                     YMRITAENPFVQYIQVFENKGSAMGCSNPHPHGQIWALDYVPSEPMKVMKSMYDFSAD
                     PANEHAPGPRHPHGRPHLLLAYAHMELHAPGRPRIVTLNDDFVALVPFWAVWPFEIMV
                     LPYKRFLGSLQDLTDAEIASLAHILGEVTCRYDNLFRTSFPYSMGIHQKPVSHAQDSL
                     ALYALFHIHFYPPLLRSATVRKFLVGFEMMAEPQRDITAESAAERLRACDTTHYLSSD
                     ART"
     gene            <400285..>403017
                     /locus_tag="MRET_0245"
                     /db_xref="GeneID:38737011"
     mRNA            <400285..>403017
                     /locus_tag="MRET_0245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626872.1"
                     /db_xref="GeneID:38737011"
     CDS             400285..403017
                     /locus_tag="MRET_0245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482512.1"
                     /db_xref="GeneID:38737011"
                     /translation="MQYKRFVAVEYDLLQGSFQRLDPTTSSRHSFSMKFITVSKVAVA
                     ITLANIAAHVSAVPVESTPGSVDVVVRNLGQANSSYSHYAPVAKFEATQLRRSDLLNV
                     KEDCVDIDHDDSHIGDDQTSGNGGNGGNGGDGGNGGSGSSGGDGGNGGNGGDGGNGGS
                     GSSGGDGGDGGNGGNGGNGGNSSPGKPKHHPSHGGNGGNGGDGGSGSSGGNGGNGGNG
                     GDGGSGSSGGNGGDGGNGGNGGNSSPGKPKHHPSHGGNRGHGGNGGDGGSGGSGIPGG
                     NGGHGGNGGNGGHGGSGSRGGHGGDGGNGGNGGNGGKGSPGSPGGVGSPGGNGGKGGP
                     GGSGGNGGNGGPGSAGGNGGNGGNGGNGGNGGPGSAGGNGGNGGNGGNGGNGGPGSAG
                     GNGGNGGNGGNGGDAGSESSGGNGGNGSPSKPKHHPSHGGNGGHGGNGGNGGNGGNGG
                     PGSPGGNGGNGGNGGNSSPSKPKHHPSHGGNGGHGGNGGNGGNGGPGSAGGNGGNGGN
                     GGNGGDAGSGSSGGNGGNGGTGGNGGNGSPSKPKHHPDSGGNAGNGGNGGDAGSGSSG
                     GNGGNGGNGGNGGKGGPGSPGGNGGNGGNGGNGGNPGNGGNTSPGGSGGNGGNGGNGG
                     NGGNGSNSPNRSPRKSSNWPLKTGTPRKTANNKSATPTAVTKSRKPSPISTSCDTETS
                     ETTSILKSSTSTTTESMPNAKTTTSSSKKSPKPTKTPPNTTTAAPKTTEAPKPKETSP
                     TTTSSDSPGGFSLPDIVPSHDHDSNGPDTQPWFPNGGNDSNDSNAPWIPSGSPNTGEM
                     PCPTCDEQPWAPQPVDCPFSNQQPSMPSQPEDCPFCDQQPDIAPQPEGGCDICDQQPQ
                     IDSPFGDFGGGIGGDFDNISQGPGEDMMPGGFGDMMPGGFGDNMNIFVSGSSAQ"
     gene            <403253..>406033
                     /locus_tag="MRET_0246"
                     /note="MRES_02370"
                     /db_xref="GeneID:38737012"
     mRNA            <403253..>406033
                     /locus_tag="MRET_0246"
                     /product="NET1-associated nuclear protein 1 (U3 small
                     nucleolar RNA-associated protein 17)"
                     /transcript_id="XM_027626873.1"
                     /db_xref="GeneID:38737012"
     CDS             403253..406033
                     /locus_tag="MRET_0246"
                     /codon_start=1
                     /product="NET1-associated nuclear protein 1 (U3 small
                     nucleolar RNA-associated protein 17)"
                     /protein_id="XP_027482891.1"
                     /db_xref="GeneID:38737012"
                     /translation="MPLERKESAMPSPASKGKKAPQNEEDIPWISLQDVTVSNIPPVL
                     TRDGSYLFIVQDTTVLIVSRLTNRIVARLSDTSMAEENRHVRPITGMMLSLSNPLQLI
                     TCSLDGTIKVWDYLESTLHDNVHVGHPIVRMCASSHWKNRLFIAVCKHANEQAGPSSG
                     PRTKEASSTMYSVQMSRGVPHAHKPQKIVRLGKTRPVSHLILSPDGRWLVATSQAKLH
                     VLDLNDTSAGFTKFATESHITSLTFHPHTDPVRFATGETNGKIKIWHCLEQSNRPAPV
                     ESSGWEPVSLTTVLHWHAHAVSALQFTPDGAQLLSGGEEGVLVLWKMHSGTAAGSDGR
                     EFVPRLGAPIVSLAVASGYENTEQEYVARLADGSAVFVASLSLKPTRVFSTIKCDAMR
                     AIAPENTHANVSPQPLAADLAAGHLVLLSGHPSTVQFVDMATQSHVHDMEIAPSNRVS
                     RPDEAILTPITVCNVVFSAPLRDAMHAEWMATIDGREGGSFTTELSLKLWQWESRSKT
                     YVLNTRIDHPHNKGVTCVRFSPCLSEDPLNAFLLATTGGDGQVKTWRIASRSLKGART
                     EHFWLCRSSFSYRESLPHHVAWAPDGSLLAVAQGLFVTLWDPQTLVMQARLATPELKD
                     VHTCDFCGRKGRYLAAMGSPSRLVIWDLVSQSVVWSVSDTFYAQTVYGDGILSLRSTN
                     QGSALDYVRPDKPGVERSYRVPFQLDGAPINVSRTKELDDICLFGMRRQSSSASLVGI
                     GSAIMSHVARANVSTSLHSVSMNDARATLFDELFGVADAEQQRVSEAMESDAQYLQKT
                     MSTSDTSSATAAMELFAVPPHLLPAMSTLLDPYVDAILPPSVLSKSAKAADMSALPDA
                     EAAMAEQMTPPRLDAVDHVAQARDADISHLTAVFDKLMTEAVASTASSTRLPSLSRGS
                     KGKRRSLRSSSS"
     gene            complement(<406035..>407845)
                     /locus_tag="MRET_0247"
                     /note="MRES_02365"
                     /db_xref="GeneID:38737013"
     mRNA            complement(join(<406035..407748,407781..>407845))
                     /locus_tag="MRET_0247"
                     /product="RNA polymerase II subunit A C-terminal domain
                     phosphatase"
                     /transcript_id="XM_027626874.1"
                     /db_xref="GeneID:38737013"
     CDS             complement(join(406035..407748,407781..407845))
                     /locus_tag="MRET_0247"
                     /codon_start=1
                     /product="RNA polymerase II subunit A C-terminal domain
                     phosphatase"
                     /protein_id="XP_027482890.1"
                     /db_xref="GeneID:38737013"
                     /translation="MECTHPIQVTGLCALCGKEIDENTFGQPTFATLHSSANVKVSRE
                     EAIRMDTEDMRHLIEMQKLALIVDLDQTIIHVTVDPTVKEWAHDIHNPNWQVLKDVRA
                     FQLGSDGVTVSHPPVHLDENNVTSFATDGDEDGCWYYVKLRPGLSDFLQTMASKYELH
                     VYTMGTRSYADCICRIVDPDGHLFGARILSRDENGSDMQKSLARLFPISTDMVVIIDD
                     RADVWSWSPNLIKVEPYEFFVGIGDINAAHLGPHQPLAPATNEKQDANPHGLSDEEHQ
                     RAIAEQCDDRPLQRAAEEKQKKDTENTIIEPEQVLTDEDTELELIQALLLEIHQQWYS
                     AYSSRKAEEKRPDVTQVISQMKSEVLRGCELAFSGLIPLHEAPETTMIWRMAEEFGAK
                     CHRTLTSDVTHLVATSARTAKAEQAYRTKKIHVVWPSWLNDSMCRWVRQGEVAYAIPP
                     DTQNLIFPEPEEEDESQGAEINLADMDWGDAEEEVDAFLEEDDEEEENSEAPETADAE
                     TTSGKRQRSGASMGSSTVHHLDEDSDQEHANRKCSRPNLSERVKASQDDALRQQDGAD
                     RHELSAPTEDLLQDLASEMERELGDS"
     gene            <407931..>408759
                     /locus_tag="MRET_0248"
                     /db_xref="GeneID:38737014"
     mRNA            join(<407931..407964,407990..408275,408303..>408759)
                     /locus_tag="MRET_0248"
                     /product="anaphase-promoting complex subunit 10"
                     /transcript_id="XM_027626875.1"
                     /db_xref="GeneID:38737014"
     CDS             join(407931..407964,407990..408275,408303..408759)
                     /locus_tag="MRET_0248"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit 10"
                     /protein_id="XP_027482521.1"
                     /db_xref="GeneID:38737014"
                     /translation="MACWKDILDVQDLSTKRDVGSIEGTSWMLSSAKSQNGIAQLTSD
                     DVETLWQSDGTQPHTVTIHFPRRTAVTHVSIYLDILRDDSYTPTRILVKAGTHPYDVM
                     DVRYREFQEPQGWYHFVLSTTHEHVLEEDDALEYRRSEKLDAIEVFVLQICVLGNHLN
                     GKDTHIRCLKVFGPPTPGLQRQNTSQSVSQCTMTKRLVKQGMQTEAFHRQVERVGYHR
                     AVTQLERIMQQSSQNMPDQAPRPAQSSVERSLMSLSQTLR"
     gene            <408860..>410188
                     /locus_tag="MRET_0249"
                     /note="MRES_02360"
                     /db_xref="GeneID:38737015"
     mRNA            join(<408860..408916,408950..>410188)
                     /locus_tag="MRET_0249"
                     /product="DNA replication and checkpoint protein"
                     /transcript_id="XM_027626876.1"
                     /db_xref="GeneID:38737015"
     CDS             join(408860..408916,408950..410188)
                     /locus_tag="MRET_0249"
                     /codon_start=1
                     /product="DNA replication and checkpoint protein"
                     /protein_id="XP_027482520.1"
                     /db_xref="GeneID:38737015"
                     /translation="MEAILRRQLKEWQREFRKYHGREPTKSDMQRDPDMVSTYDTWRA
                     LSESTKASSKPQKVPREKDNHAPTTPRKKQKFHAPPVSPGNPFRSPQKPTKHYTKQGA
                     FPSCNMEQDTTYESDVSEEDEPMQPYVALTPKKPSPAVSGTSPMPLYTPRTKARKRLR
                     GEDVRTPPQAKMQRIPSQSRTLPLLAQSPSSMKTDERRSFSRILSGHHDHQDDVIGPS
                     PSKNAAHREFLPLFSQPDTHAQEHDHDMLSDPASPAISASGTHDPISPKPLSQLTETA
                     VHINDDTSKCIKILPYRRFGSTKSQASLHPDELDLNLPRVPSHEEEEMGHDETVWGDH
                     LTDLETHSLLKSMMHGKRAVSEQRARSDQLVQHLFSDDTSKPNSAIIQRQGRAGLDAE
                     EDMAPPSENGSTHDDDWASESSSIDYGLGDGDMDSYDVE"
     gene            <410254..>413103
                     /locus_tag="MRET_0250"
                     /note="MRES_02355"
                     /db_xref="GeneID:38737016"
     mRNA            <410254..>413103
                     /locus_tag="MRET_0250"
                     /product="DNA repair protein RAD5"
                     /transcript_id="XM_027626877.1"
                     /db_xref="GeneID:38737016"
     CDS             410254..413103
                     /locus_tag="MRET_0250"
                     /codon_start=1
                     /product="DNA repair protein RAD5"
                     /protein_id="XP_027482508.1"
                     /db_xref="GeneID:38737016"
                     /translation="MATDGGATDDAPLFFSDEVADSADIIPKKRLEPLPDTDAGEWKR
                     RYMGTFVLCGYSMTKGDGHAHAGDSVLIQRKAKNKTGKPSRFREHADYVVRFSTTRGF
                     ELGRIPVDVASWMARLLDDQLVDFEASIVDCPLNLEVGSDILLQVKAYMHRTAFSSSV
                     SRQCHIDTSSSSSMTESRESEQERLLRHRKVALQRMFRACHLTPRRRGSGANNASSYL
                     PPRTPAKQSDEPDDGTEISSDYLRDIYARARENPMSLPEVNPPPTFALELRPYQKQAL
                     GWMQGMEEAQPSSAQTTELHPLWEEYAFPLTDDVDCGVGTFYLNPYIGDLSLEFQPAS
                     RGARGGILADEMGLGKTVMLASLIHANRCMDAPQMQPRSSQRSGPLRQASLRFGKMPR
                     IQRTQATLVVAPMSLLSQWRTELERASLPGTLSVDLYYGDVREQLAHKLSHGNTDVII
                     TSYGTLTAEYKQHEKRGSSVLFSGTWHRVILDEAHTIKNRSTIAARAACRLQADRRWA
                     LTGTPIQNRLTDLYSLLRFLRVEPWGDVRFFNSFLAKPFASQNAKVLDIVQAILASIL
                     LRREKHTPGPDGRPIVEIPPKTLDTQYLTFSQTERDIYMSVYDRARMRYRELASQGLI
                     GKNVSMIFAVLMRLRQAVCHPYLVMPKQAETAPEERSYEDQLRDLVKRYEAEGQSGDK
                     YALSVLDTLLTSDANEDDGEECPFCMELKPSKCFLPRCMHHGCRECLVQYLQACEDRG
                     DEPHCPVCRRGPVQAEDLVESIRPKTEAPAPSAIPVRGSTKLDALMRQLHVLTQQSDC
                     KGVIFSQFTGFLHLIQSHMAQRGYAFVRLDGRTSQKDREQVLHTFANEPGPLFLLMSL
                     RAGGVGLNLTAANHVWLMDCWWNSSIEDQAIDRIHRLGQTRPVTVHRLLLEHTIEDRI
                     LEIQRRKKQLVDHALSVKPYDASSDTLENLRMLFD"
     gene            complement(<413100..>414584)
                     /locus_tag="MRET_0251"
                     /note="MRES_02350"
                     /db_xref="GeneID:38737017"
     mRNA            complement(<413100..>414584)
                     /locus_tag="MRET_0251"
                     /product="alpha-1,6-mannosyltransferase"
                     /transcript_id="XM_027626878.1"
                     /db_xref="GeneID:38737017"
     CDS             complement(413100..414584)
                     /locus_tag="MRET_0251"
                     /codon_start=1
                     /product="alpha-1,6-mannosyltransferase"
                     /protein_id="XP_027482570.1"
                     /db_xref="GeneID:38737017"
                     /translation="MALTRLAALVLLGMMWAQVCFVPYTKVEESFSLQAVHDILTHGV
                     MRRDQYDHLSFPGAVPRSFIGALLLSVASLPAALCATSAGVQLGVRLVLGTCAWAAMV
                     HMACLLCPKASRVRALFYVLCAIQYHLTFWTSRTTPNGLAFPLATVALTHVVHGRHAY
                     KGLALLAATAMMLRLELVCLAVPAYLWTWWHHQRRFVYVFMTGAVTCAGSIALSVLVD
                     SYFWRKRFLWPEGHAVIFNVIEGRSAEWGVSPPWTYVVRDLPRILFAAFPLALLGCTR
                     RSSFRSPLVLLICTHVGLMSFLAHKEWRFLVYIVPLCNMLAAQGASMLIRTYLGRWLM
                     LGLVGTSAALWILGTHVSIYNYPGGEALRILHTQMQEAQVVHIDTLAAMTGVSLFQSI
                     HLARPAHSLVPSQAPVWVYDKREHVLDDCTWTLAISERACHAPYAPVGEPISGYDGLR
                     LRRTYVQDLLHAARGGTWPTISELFPLEIRFTPRLWICRRTEPC"
     gene            <414686..>415555
                     /locus_tag="MRET_0252"
                     /note="MRES_02345"
                     /db_xref="GeneID:38737018"
     mRNA            <414686..>415555
                     /locus_tag="MRET_0252"
                     /product="very-long-chain (3R)-3-hydroxyacyl-CoA
                     dehydratase"
                     /transcript_id="XM_027626879.1"
                     /db_xref="GeneID:38737018"
     CDS             414686..415555
                     /locus_tag="MRET_0252"
                     /codon_start=1
                     /product="very-long-chain (3R)-3-hydroxyacyl-CoA
                     dehydratase"
                     /protein_id="XP_027482571.1"
                     /db_xref="GeneID:38737018"
                     /translation="MAAGTKRAQAPAKTYVTFYLVLYNLLSFVLWLRVFLGALLFLAQ
                     GSPSRRVVSGWFVDIMSRYAPNMLAAPPRDYSLHHPILAELLKRASSLHDYVAPLLLF
                     TQSLAVLEVVHVAIGIVKSNLVLTTVQVISRLLIVWLVSEKYAASAYSPFYATLVLAW
                     SLSEVARYPFYVNQLLNTPSFMALWARYSFFIVLYPIGVMSEVMLIWNSLPHDAPWPW
                     QDASAWSLRDLVFLGTLVLYPPGLFMLYTKLLASRRKVLGTDFIGSKGREEMRKLQSA
                     KYERLRTLHEKSK"
     gene            complement(<415588..>416127)
                     /locus_tag="MRET_0253"
                     /note="MRES_02340"
                     /db_xref="GeneID:38737019"
     mRNA            complement(<415588..>416127)
                     /locus_tag="MRET_0253"
                     /product="alkyl hydroperoxide reductase Thiol specific
                     antioxidant Mal allergen"
                     /transcript_id="XM_027626880.1"
                     /db_xref="GeneID:38737019"
     CDS             complement(415588..416127)
                     /locus_tag="MRET_0253"
                     /codon_start=1
                     /product="alkyl hydroperoxide reductase Thiol specific
                     antioxidant Mal allergen"
                     /protein_id="XP_027482572.1"
                     /db_xref="GeneID:38737019"
                     /translation="MSNKSRPPFDPSTMHLVGHPLPVLVSLASTDNSTVDLFRDSFLR
                     PILLSTFALSGHTAESVQSCEAAHQLESFKLHMSALKEVQSNLAVFGLSADDVSTLTR
                     IRDTLQLPFELLSDAQGELADKLDLPRFTDADGRVALRRCILVLEEGRVSRLLYPLAD
                     ARDAGARAFRLLRHGMEPF"
     gene            <416530..>421584
                     /locus_tag="MRET_0254"
                     /note="MRES_02335"
                     /db_xref="GeneID:38737020"
     mRNA            <416530..>421584
                     /locus_tag="MRET_0254"
                     /product="antiviral helicase SLH1"
                     /transcript_id="XM_027626881.1"
                     /db_xref="GeneID:38737020"
     CDS             416530..421584
                     /locus_tag="MRET_0254"
                     /codon_start=1
                     /product="antiviral helicase SLH1"
                     /protein_id="XP_027482573.1"
                     /db_xref="GeneID:38737020"
                     /translation="MNEDVRRHLVTLIDEHVRPIPPLSAALSELASHACPSSPMHAKL
                     PPIWHQLSLLVPTEPAAQDTETSGAAHVLLQSLDVKALDHDEKEHILQLVIDTLDPHD
                     LRFDADTASAVLVDVLGFDMIELVAMLVANPQATAFQLRRAQALRAQGVGSAKDPLVL
                     APSSTNEEKYPNVYGATEHGSVLSVYGTRFSLPEGTQRVHESYFEEVTIPRSKPLPFR
                     SHERLILKDEMDLLCRGAFKQYKSLNRLQSAVYPMAYKTSENLLVCAPTGAGKTDVAM
                     LSILQCVGRFSKYGANESIHVDANAFKIVYVAPMKALVSEIVSKFQKRLSYLGLKVRE
                     LTGDMQLTRKEIAETQMIVTTPEKWDVVTRKPMGDGDLALSVRLLIIDEVHLLHEERG
                     AVIETIVARTQRLVEASQTMIRIVGLSATLPNFVDVADFLSVNRYRGLFYFGSAFRPV
                     PLEQHFVGVRGKHGSSQSRSNLDRVTYEKVLELVQGGHPVMVFVHTRKDTVKTAQMLL
                     ELGKEDDLHSILVEGRDATRFERDVTSSRNRELRELFEHGIGIHNAGMLRSDRDLSER
                     LFASGATRVLCCTATLAWGVNLPAYAVVIKGTDIYDAEQGKMVDLGILDVLQIFGRAG
                     RPQYEDMGVSYICTSGEKLPHYIESITSAHPIESTFLRGIVDALNAEVALGSVTSLDD
                     GISWLGFTYLFTRLCKAPRVYGLDAHDFEADPTLTQRRRQWITYAANILAQHQMIEFD
                     LAAGTLRPTNMGRIASRYYLSHKTVGIFHERLRNNLVEADALSLMSRAADFDQIPLRE
                     SEEEELTSLLESVPCEVDGGTATAPGKVNILLQAHISYLYVDDFALVSDMRYVAQNAG
                     RVLLSLFELALDKGFAMSASAFLQLAKAVDKRIWPYEHPLKQYPTFTPDMTHRISTWV
                     DELEVSQIRSLSIPALAQLLHTNERTATVAHNAAERFPALHARITARPTPDGYVCVDM
                     YLKSRFVWDERIHGTSLPIVWWLEDDAQHVVFSDRLTLRNSPPTLVYDGDVYDHHLRV
                     YVPLSPPDLRPTSEARCHFVWSSLHWLQAEGTVDVELDHLTCPTPTPSTSLLPLPLLP
                     ISENAMSDVLGISTLNAIQTQVYHTLAHSRANTLVCAPYASGKWTVVLFALARAWKED
                     NGAVLVIEPDEARMKERVRLLDMLAPLLGGQVVPPSPTWAFHQRAITVMTPDMAARTL
                     ASVTQTHLSLVIFLHVHKLSPMYEHAVMHVHRLRPARSIATSLSTSTAASLGAWLQIP
                     THAMYAFAPHDSPYPVSVSFDTVDIPYSDTLVRAYAKPAFDRIETQDDVALLFVPTRS
                     QCMTAAHELAARFAMKGYTAHPDADEAAQSIEHQGLAHLVRQGLAVWHANLSRRDQRT
                     VERLAEMQCLRAVLCAHDVAGHVPIRAPIVLVLGTQYTAHTSRHVQDYTMEQLWSMQC
                     HAVRPNASSGEFVVLCQQRIRPVMERLLQTPVAIESSLGDAAPTLEALAQELVARRVH
                     TRSDTVAWLATSYLAVRVRANPAWYADPGENERADPSAYLSELCDALVRSGEQLGLWC
                     VVSINTVQPTQLAHNIPPGGVEKLCALQESVLHWQTVPHQVHRLLQNDETVEEEGLQA
                     QCASLMLKVVQADKVPSLHRIVLAHWLTPLVSARTLAEMDDVLVKTIGGEAAGRVKAS
                     RQALLQRIMQDPNTQP"
     gene            complement(<421556..>422662)
                     /locus_tag="MRET_0255"
                     /note="MRES_02330"
                     /db_xref="GeneID:38737021"
     mRNA            complement(<421556..>422662)
                     /locus_tag="MRET_0255"
                     /product="glutaminyl-peptide cyclotransferase"
                     /transcript_id="XM_027626882.1"
                     /db_xref="GeneID:38737021"
     CDS             complement(421556..422662)
                     /locus_tag="MRET_0255"
                     /codon_start=1
                     /product="glutaminyl-peptide cyclotransferase"
                     /protein_id="XP_027482574.1"
                     /db_xref="GeneID:38737021"
                     /translation="MKLWRAALALCWVVYAYVSALDDAAVEQVLAPDASPWLAIDSDK
                     SLLSRILIPRVSGTQESAKVREILSHPFREAKNKHGKSKWHIEIEPFEARTPLGERTF
                     ANVILTRDPDAARKLVLAAHYDSKYFPPGSAEEGFVGATDSAFPCAMLVDVAMALDAP
                     LDAYTANRTAARRSYLPAHEDVTLQIVFFDGEEAMHQWSSTDSIYGARHLASQWLRTW
                     DVPAWPPSHAEPRHVTGNHAPIRRIHSINHFVLLDLLGSPNASVPYYFGNTRHLHSQF
                     HDIEGRLLMQKRLWPEGAAYERLFRDERGPSGIGDDHVPFLQQGVPILHMIPYPFPSV
                     WHTKDDNKSALDQATLYAWTRILRIFTAEYLGLA"
     gene            <422796..>424886
                     /locus_tag="MRET_0256"
                     /note="MRES_02325"
                     /db_xref="GeneID:38737022"
     mRNA            <422796..>424886
                     /locus_tag="MRET_0256"
                     /product="nitrogen permease regulator 2-like protein"
                     /transcript_id="XM_027626883.1"
                     /db_xref="GeneID:38737022"
     CDS             422796..424886
                     /locus_tag="MRET_0256"
                     /codon_start=1
                     /product="nitrogen permease regulator 2-like protein"
                     /protein_id="XP_027482575.1"
                     /db_xref="GeneID:38737022"
                     /translation="MTALSERQGFLPRLEGTFLSIFHPLQGPRVLFQMPEDLFYDPEK
                     EAALSTSSASSQQRFRLEFSTLSDYVIPKNPLCGRMIICNISSCPDGQGRRHHYKVMG
                     VPVLLEHEQKYERNHFIFNLCFVFQSNTDTRSYEPIVHKCARSLRMLEEEQSFVSRLD
                     NLPRLYAIVEQLYEEMNSFYEVFIALPEASNAHRFDAARKSCSDVALDRNLTRVDPTE
                     LDELLLSASGPLARVREQTYGMNAKTDSSGNQDVRMREKPSGEPSSTMPDQCQASLAY
                     TRSLAGEQTQGLGSTVRDAINLKLFPSFVQPPPVHDWDVPVLLLDMSKFMNDSWDLTL
                     VRLIPFLNGTSHVRRIAQLADADVLLVKQCVQHLLYYSFAMLIDIFQFSNIYVLRPQV
                     APMLSDPHIESECASYVMLPGCDALPGPVLWHMYSMLRYGRTLHDWIGLLGNQVQAVD
                     VRRFITFGVIKGFVRRVHQYPIYSSYQKPLRNSVDTLSSPLFAFPPDSMSFAKSNKTL
                     SYSSGQNVSEFSLDPNTKLNGSANATASRLQDVQLSNKASQRSDAKRRLSTAIDVASV
                     AHGTFSDDAVRKRAASPSVFGSAPVEPKIPVDLPSLLDGTRCDDELCVQFGMSWTDLQ
                     RWFAHLSTQPVPFDFTSDKEASPKMKPTFSRSSSNYSYMYSNSHEHVDAISSNHKADD
                     VQHTAWGHISIVAI"
     gene            <425059..>426169
                     /locus_tag="MRET_0257"
                     /db_xref="GeneID:38737023"
     mRNA            join(<425059..425187,425219..>426169)
                     /locus_tag="MRET_0257"
                     /product="mitochondrial inner membrane carnitine
                     transporter"
                     /transcript_id="XM_027626884.1"
                     /db_xref="GeneID:38737023"
     CDS             join(425059..425187,425219..426169)
                     /locus_tag="MRET_0257"
                     /codon_start=1
                     /product="mitochondrial inner membrane carnitine
                     transporter"
                     /protein_id="XP_027482576.1"
                     /db_xref="GeneID:38737023"
                     /translation="MSDSAPRSVLQMRYRAFINFAKEHPTVVSAGPASLVSTIASFPL
                     DSIKSRLQVKHYTSAWACTRDVLRAEGIQGLFRGVTFPLITITFVRTLSFSVYTHTKE
                     LLARSWRKKKDKLSDALIFGAAGGITSGTIICFMSAPFELTKVERQLEYLIWTQRNKN
                     NGTLGTNKFIPRSGFQAARDIYRLHGGLRGFYIGLRLHMYRDMTGSCIYFGLYDTMRM
                     LSDRLEPHRQSYGIPAPFVSFLIGSASGIMSWLSIYPLDLIKTQVQRDVLAGAPRRSG
                     FTVLRRLLMQHEGEHEPVKKARSIRDLPIHRFLRLYRGLGISAMRSFISHGLTWTLIE
                     SITRHIESEAVNHDLDVSYDFVDFQ"
     gene            complement(<426225..>427106)
                     /locus_tag="MRET_0258"
                     /db_xref="GeneID:38737024"
     mRNA            complement(join(<426225..426744,426777..426951,
                     426989..>427106))
                     /locus_tag="MRET_0258"
                     /product="CDP-diacylglycerol--inositol
                     3-phosphatidyltransferase"
                     /transcript_id="XM_027626885.1"
                     /db_xref="GeneID:38737024"
     CDS             complement(join(426225..426744,426777..426951,
                     426989..427106))
                     /locus_tag="MRET_0258"
                     /codon_start=1
                     /product="CDP-diacylglycerol--inositol
                     3-phosphatidyltransferase"
                     /protein_id="XP_027482500.1"
                     /db_xref="GeneID:38737024"
                     /translation="MAGAKRKQSNLQVSKMAGKQEKGADVPRENVFLFVPNLIGYARI
                     IIAAISLYYMRDNPRLCTVLYLVSCILDAFDGKMARLLNQSTRFGAVLDMVTDRCTTA
                     CLLCFLTAAYPQYALLFQGLVTLDFSSHYIHMYSSLVSGSASHKKVDVKTSRILALYY
                     TDTRVLFVLCAANELFFVCLYLMAFYTRPLGVNIAPFLPDAIFNLVTSSKDNLMFHIV
                     HEIIPSLTWPQIVGGLLFPMCAIKQIINCVQFWKAAKMLTDMDHSERRKRRM"
     gene            <427247..>429424
                     /locus_tag="MRET_0259"
                     /db_xref="GeneID:38737025"
     mRNA            <427247..>429424
                     /locus_tag="MRET_0259"
                     /product="origin recognition complex subunit 3"
                     /transcript_id="XM_027626886.1"
                     /db_xref="GeneID:38737025"
     CDS             427247..429424
                     /locus_tag="MRET_0259"
                     /codon_start=1
                     /product="origin recognition complex subunit 3"
                     /protein_id="XP_027482501.1"
                     /db_xref="GeneID:38737025"
                     /translation="MASETSGLLEAEPISIITAENNSFDECEFSPISLFEKDSVPSRM
                     RSDAFNATWQGAYGRLTSLVRTLYEPCIANVCERMPVKTSPLLPVTILDASGSATYEA
                     FPTLLMHHLSNMDHVTVQLSPFHCINLSTMISAFVSQILHHIPCTPEISGLCQAYEPN
                     DLTLVMTAYRAAGLHLPRIVILLHEIQTFPSSVMNDFLSAVMSWSDITSPTPSIHLLI
                     TYTAPLPLLPRSKVSHDLYETTTWVTSLFAEQVRMYLDPTTIVLPDKSEFWESVGCAF
                     FAEPRSGLWLGRSIFELVRRRYWHTTASWDAMAQCIRLAYLEHFRTRPLSAFVQGIPD
                     VETLSAHWTSEIYAELRLSFFLRAAIPSSVSPHMRELAYDNSALLHALSGLQSDMAVS
                     MSSRATALAALHEVLCVLGLTGAYGTKLGLTGCTAIALEWIPPFTDWDASRTTANALT
                     ATTPTAQQVDALLSHLCSTLENKQVSELVDGISRRLYAIESNLDAAVAAAVRSTHESL
                     LSVQHAAHTKVRAQNSMGEALASWVSGIWRKSVELPPSLGLSIWTYDFGEPISTMLEG
                     AARSTIILALDAPSDTLASMSAAACTAPGQRELSDQAPWYEWEEHMSEVHTLRETGKD
                     LVNASVPDVCRLFSLYKDSSRFINLADWYEAFVQSLQGEEIRRKHAGLDMENEDTVAS
                     TQMRFSLALNELAYMGIVGPAGRKIEHVSRLIWDLPVNGMHEA"
     gene            complement(<429421..>431250)
                     /locus_tag="MRET_0260"
                     /note="MRES_02320"
                     /db_xref="GeneID:38737026"
     mRNA            complement(<429421..>431250)
                     /locus_tag="MRET_0260"
                     /product="ATP-dependent RNA helicase MSS116,
                     mitochondrial"
                     /transcript_id="XM_027626887.1"
                     /db_xref="GeneID:38737026"
     CDS             complement(429421..431250)
                     /locus_tag="MRET_0260"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase MSS116,
                     mitochondrial"
                     /protein_id="XP_027483200.1"
                     /db_xref="GeneID:38737026"
                     /translation="MLLYGERMLIRCLSVRQTSQSLKRTSIWNALRLSHSSSKSEHDM
                     NARLKAMALAKPLRLSLLGNPFHFTAFTDVQEQVFSLLPQISSGKKLLDDGKGRDLLC
                     KARTGTGKTVAFLVPALQARIHAYNQLAHGQTTEPFRRYLEENDLMYLLERGDKAAVS
                     ELQRLFSRHCAGVLIISPTRELAMQIASEARKLVLNHKKLRVHELVGGISSKRQYLNW
                     KKNTPDIVVATPGRLLDMLDDQSIRDAISRTQTLVLDEADMLLELGFRDKIQMIASML
                     PPVEERMSFMFSATMDPHIMEVAKTSLHPQHRVIDCIPPGEENVHVRIPQYVTTIPDQ
                     TRVLPFLLQLLEHDQMLYGNKSKVIIFTSTTALTSAMHKMLESITSSLPGQEKTSVLC
                     LHGMLSQTLRSRVSQQFRAYESAPSILLTSDVSARGVDYPSVTRVIQLGVPCSKEMYV
                     HRVGRTGRRGREGRADMLISPFESGFVAFQLHDIPLQPLSMEDHAKSMNELVASKEAQ
                     TTFDASRVQTAMDHARYCVRETMDMRHLLNTVFNSYVAMRQLLRVSRLQILHPVQNWI
                     RAVFGLEEKPTLSPQMMSVIHSKKRGSHERQTSKRPFSVRKRR"
     gene            <431365..>434024
                     /locus_tag="MRET_0261"
                     /note="MRES_02315"
                     /db_xref="GeneID:38737027"
     mRNA            join(<431365..433661,433693..433824,433859..433931,
                     433962..>434024)
                     /locus_tag="MRET_0261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626888.1"
                     /db_xref="GeneID:38737027"
     CDS             join(431365..433661,433693..433824,433859..433931,
                     433962..434024)
                     /locus_tag="MRET_0261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483006.1"
                     /db_xref="GeneID:38737027"
                     /translation="MVAEPHFLDLTRRTQSQPQEKNRLNVRLDVPGGISFAPDRLNPH
                     NSAKRVFRVPQLPEPAQLFYDFEREISEHEGVPYVPSSSFVIGEDDELTPSQKIAQDV
                     REKYESATGPIKSGKSEDDKMELLLDAMNLEKGSDEKESSNPSDLRSKDPVSNDALPE
                     TKDDYVRNEQITSPEPKNKSDTIVNEDKLEKNEPSIEENSHQSRSRESVIQGEANPME
                     LVSGSQNSQDGESKPQKRQGEKSQNPTTNKSVSEDGTFPRPSSPDETPATEEINAKVS
                     NTPSEKKDNVSSSESRRNEKNELGVDKEVQKTGTSISKSGMTKSQAKRAKEKAKKMAR
                     NQEAICKNERADERSDLTNTSNEDTNFTPRNGELENITDLPEESEDQNTSQGSGINHE
                     VDVNAKINETNDTSDNNVLDHLKTKMDGEQLGEEHDSMTEKKIESRHSAGLENEDMFA
                     KSSINSKVNTHTVNEAEDAVHNLNVEVAEIRSERPADAMSMQTARTQLSTFAPTVSGF
                     SVLADKTRQGGADGLPAVVRKKLNLIDYKLPPSISDGSYAKKPWNNKSYLKSRAFERL
                     ASQPEGRDAGTQWNAINGPGEEALAFPSNNLQSITFETLSALFIPDPRHWHPYRFVRR
                     TNPRQVLLMCAGTALTQKQLQTSELARKVASGQMGPINDAKSLASYFTTTENTSLQGG
                     LGFVYSPNEALCHAMHEKVDLGRSETNFSRRLERPEFPNETTKRRAALRSVIAALEYI
                     RWEEEGFDKIVIATHHGWIVRGIAYDIWEWRQNNWRFTHDAPGAIPGGDVPDRDLWEL
                     LDYVVRQYELVDCNCRFWHIPSKLNEEAIRLSEIGAAKTNQHFTTVRWTKKPYSST"
     gene            <434216..>436096
                     /locus_tag="MRET_0262"
                     /note="MRES_02310"
                     /db_xref="GeneID:38737028"
     mRNA            <434216..>436096
                     /locus_tag="MRET_0262"
                     /product="phosphodiesterase"
                     /transcript_id="XM_027626889.1"
                     /db_xref="GeneID:38737028"
     CDS             434216..436096
                     /locus_tag="MRET_0262"
                     /codon_start=1
                     /product="phosphodiesterase"
                     /protein_id="XP_027483201.1"
                     /db_xref="GeneID:38737028"
                     /translation="MLSGICSAALCLLATANFVVAGQWTNDLYDQTSMVPKAKGCWNP
                     DPDCGEFTFVVMPDTQYLFDQHSIHPVPVEKSFEYILTSSNRSDTDTNIVFMAHLGDV
                     VQNGLKQEFDQARKVFDYLDEAGAEYSVLAGNHDVDPSTTDKRGKTPYLEAFNPERFH
                     KIRSWRGASPTGYNNYHIFKAGGREWLVLALDWRMSNSSFEWAESVLKSHAHIPTILT
                     THEIVTADTGKAEFTEYGEEVWNKLIKHNNQVFLTLNGHFWPSGRTSRTNAAGNKVES
                     HITNYQNRYYGGSGMIRSYRFKMRENKIDVSTFSPWSRELVQKGQANPLSRKEAELTT
                     STDKFTMHINFESRFQALDNSKRSESSDDTVITGTQAYWRFDRHKAGSPLSQSDIIKD
                     LSGNCNDLILKTHFPSDNTTLRWSDAHHPLQPGHGSLNFTAQKKPLQGMYLQTRDDAK
                     INSNKFENGYTFEAFYYLPSSWDSEQNAWSSLFSRRGSASDAGIHGEEADKDEPIVTL
                     SISNDRELQWRVYPLGSQNGTTNWGHETPFDHWWHAAVVNNGTMTKMYVDGSEVARNP
                     AQKAHGLTTLNKPWMLGGFEYGGKLDQIFYGSIGDVRIVDRAISPEEFMFRPDLNSTT
                     GK"
     gene            <436256..>437359
                     /locus_tag="MRET_0263"
                     /note="MRES_02305"
                     /db_xref="GeneID:38737029"
     mRNA            join(<436256..436431,436462..>437359)
                     /locus_tag="MRET_0263"
                     /product="nicotinamide mononucleotide adenylyltransferase"
                     /transcript_id="XM_027626890.1"
                     /db_xref="GeneID:38737029"
     CDS             join(436256..436431,436462..437359)
                     /locus_tag="MRET_0263"
                     /codon_start=1
                     /product="nicotinamide mononucleotide adenylyltransferase"
                     /protein_id="XP_027483007.1"
                     /db_xref="GeneID:38737029"
                     /translation="MFAPKAPCTTGRDSVSTLRYKALNSESYRLDSPPFTGAAVTGGG
                     PVTKELGQDGSNPNVHRMNNSHDTDVQPWDLDSGMDEELDEAHSQRDMDTAKTRTPFF
                     QSVPRQGETMDTYTFPRHRLPTHMHDEEKIPLIIVACGSFSPPTYLHLRMFEMAKDQV
                     IESGNYELLAGYYSPVSDQYKKEGLAKAVHRVRMCELAVERSSNWLMVDAWESLQGEY
                     QRTAVVLDHFATEINGKNGERGIKLRDGSYKPIKIMLLAGGDLIQSMGEPGVWAEEDL
                     RHILGEFGCLIVERTGADVWSFLLSHDLLWHFRRNLIVVKQTIYNDISSTKVRLFVRR
                     GYSIKYLLPNSVIQYIEQNGLYR"
     gene            complement(<437383..>438735)
                     /locus_tag="MRET_0264"
                     /note="MRES_02300"
                     /db_xref="GeneID:38737030"
     mRNA            complement(<437383..>438735)
                     /locus_tag="MRET_0264"
                     /product="homeobox transcription factor"
                     /transcript_id="XM_027626891.1"
                     /db_xref="GeneID:38737030"
     CDS             complement(437383..438735)
                     /locus_tag="MRET_0264"
                     /codon_start=1
                     /product="homeobox transcription factor"
                     /protein_id="XP_027483009.1"
                     /db_xref="GeneID:38737030"
                     /translation="MSTESEHHIPALHVHRHDTASHEKKRRRRTRPHEVNILMSAYVR
                     NAFPSENKRSELARMVGMSTRAVSVWFQNRRQAEKKRSQRYQSSSALSAPTHSVPFLA
                     PVFPPREPFTRSQSTPSVSLMTTTAGRAALRECPTAMHQPEPPMSCTLDSTRDGHGII
                     TGDVHNDDRAIWQRMESSSALGSCSSEANDELHTVNSTANVGMDEDDDEERTLRRLAQ
                     RRTKRLMERKRTRSLDDMKRHESDARLVMHENMNKRRCHSFQRKPSLRLEMAADGNLH
                     QNKENVPPNASSGVRMQRVHSMPNRPLQELTLHNSAPSFVNLHVQPQQPPRRAPLMSR
                     RPLNRRAISATSHMPNKLTTNWTRTSSARSCDMLPLVGKETSSTEKEPVHDDSGFFDD
                     NEQAESCSPPNFAQPQHVLVMLKDNGDTDGHAWTEHDRQAAELLLGLGGGNSQRAWHS
                     "
     gene            <438946..>441069
                     /locus_tag="MRET_0265"
                     /note="MRES_02295"
                     /db_xref="GeneID:38737031"
     mRNA            <438946..>441069
                     /locus_tag="MRET_0265"
                     /product="ATP-dependent RNA helicase DDX24/MAK5"
                     /transcript_id="XM_027626892.1"
                     /db_xref="GeneID:38737031"
     CDS             438946..441069
                     /locus_tag="MRET_0265"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX24/MAK5"
                     /protein_id="XP_027483008.1"
                     /db_xref="GeneID:38737031"
                     /translation="MRKETRRQQRHMKTHGPAVRQSDVPWVTMPYTFASESVNETTDD
                     GFEGLDMADDDFLGLQTAEGFDVVYETDETGNRRAKIVKLNETNKRKQKQKEAPIKPY
                     PAEPIKKRKVDDDEDVGAMLQAARERGILEQDDTGDDGKEDADASAPGWAPYALHPVL
                     KKAMVALGFNTPTDVQAATLPPSLGTDAMPPRDVVGVAQTGSGKTLAYALPILQYILE
                     NTAHSQDPARSLEALVLTPTRELALQVCSHIRAVVEAGGRFANVAAICGGMSVQKQER
                     VLLQHGGAHIVVATPGRLWDMIKHDDALALRVRRTRFLVIDEADRMIEAGHFAEMDLL
                     LQMVRRTKGAAADANPDMQTFVYSATMSKALQTNLKRALWRKKQRREAEPSNTLDDLL
                     ARVDFRDAEPVVIEMATQRHVADTLYEAKMECVGQDKDAYLYYILLRYPGRTLVFVNA
                     IDGVRRLVPLLTLLGIPAYPLHGQLQQQQRLKNLDRFRRAPHAALLATDVAARGIDIQ
                     GVDHVVHFQVPRSADTYVHRAGRTARAGREGVSIALIEPSELRLWRAIWQALERQDTV
                     PTMPVEYTFLTPIRERLALARDIDALSHAQTKESHDDHWLRSLAREADVEYESDEEPD
                     PDANVSHHRRHSSTKARVAQLKAQLAHMLSRPLQARGMSQKYLTSTTRPGYVHALLEG
                     RHAPHMLGMTRSKIHDDMSAKKQRT"
     gene            complement(<441071..>443431)
                     /locus_tag="MRET_0266"
                     /note="MRES_02290"
                     /db_xref="GeneID:38737032"
     mRNA            complement(<441071..>443431)
                     /locus_tag="MRET_0266"
                     /product="U3 small nucleolar RNA-associated protein 4"
                     /transcript_id="XM_027626893.1"
                     /db_xref="GeneID:38737032"
     CDS             complement(441071..443431)
                     /locus_tag="MRET_0266"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 4"
                     /protein_id="XP_027483010.1"
                     /db_xref="GeneID:38737032"
                     /translation="MSVDVSKPGASVPVHRVRFVDWSPSAITALALSPVAWTESAAAG
                     RSVLAIGRDNGNIDLCTWCEGQSGSIAQGWSPVWTLLGEENYKIESLAFTASASHLRL
                     FSTSGGSIVSEHFLPSSLTGQQAADTRTPTRTLSSHGGAIWSMAASPTGKFLAIGCED
                     GVVRLIDVAGDAFEHVGTGMHVAPRMTRVASRILSLAWGPPRRQMATSNDSDDDDDEA
                     WRDTYLLGGLGNSTAAVWDVPTGQLKSRLTVLKNRQEHTIVWSVAVLRDGTLVTGDST
                     GRVTFFDARTRIPIPGATFQSHTAGADVLTLCVSSDARAVYSAGVDQKVVEYTHVGHA
                     WAHTGTRRLHAHDIRALAMDPPLQLGPVPSPSRVPILLSGGLDFQLVLTPASHASWRA
                     PNHNPVSSSVSTSFADTVQRRVSFVPAHARDSVVGVAPLHRWIMLRRERSVAIWALRD
                     ESWSKVWELELRMHSNLGAAAISADGRFLAASDLYETRLYDLGSGTPRRIRSLGEAVH
                     GRNAPAPGASALAFTPDCTRLVLCTAHGSFVHVLQLPTSSEAPHLLRSFAQHRTTRTA
                     LDGRVLSGGHGQAAATPTPIVLAAVSSDGQWLVTADTARRMHVFHLDTLSHQRALATP
                     AYVPSGACFHPTHPSLLALVLPTNQVSFYDLEADGEAPAWEAALRRDLDAALSRIREP
                     VVGCTWLPGPDGHASLCVYGPTWICTARPLTTLSRTSRKKRRSGHVVESDDAWSVRTT
                     FRYQPLLYAGVLPSPSGSELLVIERPYFALAPTLPPAFYRGAKYGM"
     gene            <443543..>444754
                     /locus_tag="MRET_0267"
                     /note="MRES_02285"
                     /db_xref="GeneID:38737033"
     mRNA            <443543..>444754
                     /locus_tag="MRET_0267"
                     /product="glutamate 5-kinase"
                     /transcript_id="XM_027626894.1"
                     /db_xref="GeneID:38737033"
     CDS             443543..444754
                     /locus_tag="MRET_0267"
                     /codon_start=1
                     /product="glutamate 5-kinase"
                     /protein_id="XP_027483202.1"
                     /db_xref="GeneID:38737033"
                     /translation="MQQGKTVVIKLGTSSILSDVSLEPKIRIMASIVETVSQLRLRGH
                     RVVLVCSGAIGVGRVRMGIKERPQELSVRQALAALGQLRLMTLWENLFGMLGIHIAQV
                     LLTRADLADSPRYVNARATLETLLSDKFNAVPIVNENDTVSVFEMRFGDNDSLSAITA
                     GIIDADYLFLCTDVDGLYTDNPRVNPDAFKLDVIQNMDEARRLTCVKTMGSSFGTGGM
                     QTKLVAAELATAAGIATVILNGEHPENMAHIVEQDIATQAFRTPHMQLRDPPCTLFLP
                     HQQRMPAHKWRILHAMHPSGALIIDQGAYERLSRKESGGRLLPVGVIGVEGNFDRLQA
                     VRLKIYKPSLPGEPPETVEVGRALTNYTSIECERIKGLQSAQAVEVIGAVDTMYITDQ
                     AVLSLRAAAPT"
     gene            complement(<444759..>445173)
                     /locus_tag="MRET_0268"
                     /db_xref="GeneID:38737034"
     mRNA            complement(join(<444759..445143,445169..>445173))
                     /locus_tag="MRET_0268"
                     /product="small subunit ribosomal protein S6"
                     /transcript_id="XM_027626895.1"
                     /db_xref="GeneID:38737034"
     CDS             complement(join(444759..445143,445169..445173))
                     /locus_tag="MRET_0268"
                     /codon_start=1
                     /product="small subunit ribosomal protein S6"
                     /protein_id="XP_027483204.1"
                     /db_xref="GeneID:38737034"
                     /translation="MPLYELFCVAIAQAESAPLRDLVHTTSRLVLDHGGVVRNVQYWG
                     KRTLPQRAKRHQQLHYSGDYWLMQFDTNAPTLKVLNDRLRQDPRVIKWNTLKLGEKLR
                     EIVPPTASGGATPAQSTMGGKTVDYLG"
     gene            complement(<445244..>446379)
                     /locus_tag="MRET_0269"
                     /note="MRES_02280"
                     /db_xref="GeneID:38737035"
     mRNA            complement(join(<445244..446105,446135..446214,
                     446241..446319,446345..>446379))
                     /locus_tag="MRET_0269"
                     /product="replication factor C subunit 2/4"
                     /transcript_id="XM_027626896.1"
                     /db_xref="GeneID:38737035"
     CDS             complement(join(445244..446105,446135..446214,
                     446241..446319,446345..446379))
                     /locus_tag="MRET_0269"
                     /codon_start=1
                     /product="replication factor C subunit 2/4"
                     /protein_id="XP_027483203.1"
                     /db_xref="GeneID:38737035"
                     /translation="MSVESQPWVERYRPKTIDEVSSQQHAVNVLRRSLSSANLPHMLF
                     YGPPGTGKTSMILALARQLFGPELMRSRVLELNASDERGIAVVRDKIKSFARAAVSAP
                     NPDYPSPPFKIVILDEADSMTQDAQSALRRIMEQYSRITRFCLICNYVSRIIDPVTSR
                     CSKFRFKPLDASSAEARLQYIAQAEGLRISPEVLSMLIHTSDGDMRRSITYLQSLARL
                     VSARGNDASLMSSTTVGELAGIVPMPVITSLAQTMAVPSYDTNDEATPTAQGSAFDAV
                     YDAVHHIVREGYSSLQVVLQLHDYIISHPMLSARQKTKCALHLGAADKALMDGGEESL
                     QLLTLCLSLHQDVTNST"
     gene            <446503..>448617
                     /locus_tag="MRET_0270"
                     /note="MRES_02275"
                     /db_xref="GeneID:38737036"
     mRNA            <446503..>448617
                     /locus_tag="MRET_0270"
                     /product="chromatin assembly factor 1 subunit A"
                     /transcript_id="XM_027626897.1"
                     /db_xref="GeneID:38737036"
     CDS             446503..448617
                     /locus_tag="MRET_0270"
                     /codon_start=1
                     /product="chromatin assembly factor 1 subunit A"
                     /protein_id="XP_027482432.1"
                     /db_xref="GeneID:38737036"
                     /translation="MATNEATHSPKRKAEDAPEHARAKQTKKAPSLVTLKNTRLSLRQ
                     KAVGWDRTMPVLRAVLAFQSFFSDNQTHVLMEIPTEHLGVIASLAQESDKNETELAKR
                     IHATLLPEGSTTTIQNGENVDVLSVTTIQKCLNHIAARVNYGIDQTGEETVPASLQLW
                     RWEVHDMSLLPKENLDKLVARRQERVQAKEEALQLFEALPQEKQQSLLSPKKPPRTKT
                     RAVELDPPSEDAAPPPSSSPVHVDMPEESPKPTPVPREKSERTKLRESRRAERQAREE
                     RQEKDKQAQVRLFNAFFQQPVAKSVSKKDEEKNKTDFELTFPPCEYKDVAEPNQFYHP
                     VDDTFLQQLDARNASPQVLLAEFQQAFRKRSIRQTSSGIHPPVCVRDIMKTVTESDVL
                     GGNAEEQAKRSLEKLNDRRLVPIKLLQFHLERRPGWVGTNTRSSNFITPRRPFGQDPL
                     SIDYTFDSDAEWEDVDEGENVDDAMDDREEEAESVASSEEDSELDDWLEDDLEEEDAA
                     PMEEDTVSSSRSALVRESPLSHKTKKKLKLLGRRFDSKLVPYITGPHWETTLSAASYE
                     SFEPYQVRLLNEAHVGLNPFTFVSTTMTIADDDKSSDTIPQAATTSPESSTLQNSVPP
                     RTTKFLFPDTHMPELVSKIHGSTRSKPALIEDLWEYFAPSIKGVSKAAIESRLQECAI
                     RESKKPGAKWIIKEDSKHYMAP"
     gene            448744..448849
                     /locus_tag="MRET_t0001"
                     /db_xref="GeneID:38741195"
     tRNA            448744..448849
                     /locus_tag="MRET_t0001"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:38741195"
     gene            <448939..>449671
                     /locus_tag="MRET_0271"
                     /db_xref="GeneID:38737037"
     mRNA            join(<448939..448985,449022..449158,449192..449438,
                     449470..>449671)
                     /locus_tag="MRET_0271"
                     /product="kinetochore protein Spc24"
                     /transcript_id="XM_027626898.1"
                     /db_xref="GeneID:38737037"
     CDS             join(448939..448985,449022..449158,449192..449438,
                     449470..449671)
                     /locus_tag="MRET_0271"
                     /codon_start=1
                     /product="kinetochore protein Spc24"
                     /protein_id="XP_027482433.1"
                     /db_xref="GeneID:38737037"
                     /translation="MSEHHSDAAMTESTLPEMINELNGVLVPDEELVRIREFKTMLEE
                     VQERRDAERSKFEEIIKQLEASVSELRESSTRASAEWRSFEEHASIMKGMENEKFDLA
                     KKINDQEATLSMLESEIEELRRESEVMENWDIEEEVGMDRNVLALQLFRGMGFVPHHD
                     NDEASAPITSLLVRSAKRNVAASFDIDHEALQNSVQARYDLASRLWTAAN"
     gene            <449808..>450547
                     /locus_tag="MRET_0272"
                     /db_xref="GeneID:38737038"
     mRNA            join(<449808..450504,450537..>450547)
                     /locus_tag="MRET_0272"
                     /product="C-8 sterol isomerase"
                     /transcript_id="XM_027626899.1"
                     /db_xref="GeneID:38737038"
     CDS             join(449808..450504,450537..450547)
                     /locus_tag="MRET_0272"
                     /codon_start=1
                     /product="C-8 sterol isomerase"
                     /protein_id="XP_027482430.1"
                     /db_xref="GeneID:38737038"
                     /translation="MRKTSSTTSSRGSFYWLAILAVFFALFGAVIKLLDNRLRHFYIF
                     DQAQLHDISRAAIARHGNATDLIFDEIVSKLGQDPKIGPTLNKNSFRDHNEWVFNNAG
                     GAMGSMYIIHASITEYLIFFGTPIGTEGHTGRHTADDYFHILQGEQLAFRAGDLTPER
                     YPAGAMHHLKRGQVKQYVMPESGCWALELAQGWIPPMLPFGMADSVFSTLDLPTFLRT
                     CVITGREMIANLLRGKF"
     gene            complement(<450552..>452051)
                     /locus_tag="MRET_0273"
                     /db_xref="GeneID:38737039"
     mRNA            complement(<450552..>452051)
                     /locus_tag="MRET_0273"
                     /product="MFS family protein"
                     /transcript_id="XM_027626900.1"
                     /db_xref="GeneID:38737039"
     CDS             complement(450552..452051)
                     /locus_tag="MRET_0273"
                     /codon_start=1
                     /product="MFS family protein"
                     /protein_id="XP_027482431.1"
                     /db_xref="GeneID:38737039"
                     /translation="MANEEAVGDEEASHTSMEQDIPFKPAVDLPDGQDPKRWSVPRKV
                     YVNTIFMLMVFVNTYISGIYSPGIKAMLHDVPMSREVADLGTGMYMFGIAVGSLLWGP
                     MSQVVGRRPVFLVSLVGMVFFNLGLCLTMHVSGSIICRFFGGAVGATTFSNVAGSIID
                     MTTERERTPYNTLFRYFTFIGPPCAALLGTVVVRDSTWKWNLRSAPIACFVCLVLYTF
                     TVPETYAPVLIQRKIERDREVYDEKKHHHSWIHRELHHIRHKIPDFALWTMVVSQIAE
                     SLPVPWILLFEEPLVIVVTFYTSMLYGLLYGSLLFFPIIWGDVRGYTNVQVAYCYFAV
                     ITGFTLSTMMVGLWIQNSEYKRAYDRNQHTPELRIRSGIFSIFFVPIGLFIFGWTAPF
                     LHVHWSGPCIGVLLYTFGMLSVFSSWMTYLTDTYVNNAAAVVCINSFVRCSIAGAFPL
                     FTRQMVHGMTFQGSMSLFGGISIPLTAIGIYIAFHGHRIREKSKHAVYG"
     gene            complement(<452198..>453237)
                     /locus_tag="MRET_0274"
                     /note="MRES_02270"
                     /db_xref="GeneID:38737040"
     mRNA            complement(join(<452198..452503,452530..453105,
                     453133..>453237))
                     /locus_tag="MRET_0274"
                     /product="E3 ubiquitin-protein ligase RAD18"
                     /transcript_id="XM_027626901.1"
                     /db_xref="GeneID:38737040"
     CDS             complement(join(452198..452503,452530..453105,
                     453133..453237))
                     /locus_tag="MRET_0274"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase RAD18"
                     /protein_id="XP_027482436.1"
                     /db_xref="GeneID:38737040"
                     /translation="MDEALLQDVSDPSDWTGSWSELRHLDMTLRCGLCFDIFRAPVAF
                     RECAHVYCSSCIRMHINQPGGAGAFCPNCRQKKAYDSELVVQPVLEAASNHWRHTRSF
                     LMKQWQKMQELESKRSEMKGAEANGEPHEILARSRKRVRGTPDEDQDYRALDAGTIVQ
                     CPICQREFDAIAINAHLDRGCGTEDPGPPTMDHWLRASSPVTHSPEKRLTRPQYQLKT
                     ERDMRKLLEALQLPTSGNKDRMVERHRHWVNLYNANLDAAPALRASLPSLRKQLMQWE
                     RSHGEMTAKNVPTEKQAKAWLKANQHAYTDLIAQARSTLPSNISEHAKNSEK"
     gene            complement(<453346..>455286)
                     /locus_tag="MRET_0275"
                     /note="MRES_02265"
                     /db_xref="GeneID:38737041"
     mRNA            complement(<453346..>455286)
                     /locus_tag="MRET_0275"
                     /product="zinc finger protein, C2H2 type"
                     /transcript_id="XM_027626902.1"
                     /db_xref="GeneID:38737041"
     CDS             complement(453346..455286)
                     /locus_tag="MRET_0275"
                     /codon_start=1
                     /product="zinc finger protein, C2H2 type"
                     /protein_id="XP_027482437.1"
                     /db_xref="GeneID:38737041"
                     /translation="MQAGDFILYDDQERDVNYPIASPFSRPSFQQHRGQLADTSPLFE
                     EAQFYAPNDPTQSQSSSENVSRVSPVTLENVSPDATPPKQPSSGTLGTPLDLLSLHGS
                     TDAYQRTTPKMAPLFPRLPQENQASPTASMSQQPPQNNDMNAATASLLFKSPENDTHS
                     NMQLWRSYWSTHGGNAPVPSMIMHPDMLRSTNEAMGLQRAQPNDKLTVSPRDLHLDYN
                     EATTPPAKLKEPPALVDTAPLFPAAPTTEDSLWKAPYGASSGIETGSSTEEEDDEDEK
                     PLVNGASLGTTVPNEQLLQQWSQAMFGSVPTDETMQTQPFRDSESVWPSVGPVFSTVS
                     TSSESEDDSERVHKTPQTSRFSSYTPHQAMYRDGSGAMGAYGFMPASSQGSAMSTNMS
                     TDSESRRSSAVSMSISESEAGGQDATGNRSPSIRRAAQVVDPTTDAQPSPSSPAQPAI
                     RPRRSSSRNRRQEEMEASSATMGPPSSESSSQDGEGDGDSDYEQTHHVAQPVSRSVPR
                     RGRPPRTISGHNKTHGSGSHHSLSTSPTSHGLPRRNASPPASGSVIRCEYVSPVTRQM
                     CGTVFHRMYDLARHRITLHVREEAQLVKEGVLKVDQCVVLGKEVDVEKALSDLEWTCR
                     ICGASFSRKDAMLRHERLRHHA"
     gene            <455596..>456450
                     /locus_tag="MRET_0276"
                     /note="MRES_02260"
                     /db_xref="GeneID:38737042"
     mRNA            <455596..>456450
                     /locus_tag="MRET_0276"
                     /product="RNA recognition motif domain protein"
                     /transcript_id="XM_027626903.1"
                     /db_xref="GeneID:38737042"
     CDS             455596..456450
                     /locus_tag="MRET_0276"
                     /codon_start=1
                     /product="RNA recognition motif domain protein"
                     /protein_id="XP_027482434.1"
                     /db_xref="GeneID:38737042"
                     /translation="MPPKQSSKVVIEPIPLTATTVDIVRLLHPLQVESVSTTVQGGKG
                     TATVVMSSTDDARNACRISSGVILGRPVRIRSMDEGVRSTLLQPSWATVAKSAGQEAD
                     YEQNGYRNLYVLNLPLDVSANELNELFGRYGRVVHSVILAMLDTQARRRGFIDMVTPE
                     SAQAAMHALNGHIWHGYPIEVSYALVQRSDGSLDDDKILVSTPMVLLQGLLPAATIDA
                     DDVRLLVEPHGRIIDMDFPANLAGNSTFSVCLTMGSGQYAYNVCNALNDTDVNGQHLQ
                     ADRIKFSP"
     gene            complement(<456532..>459276)
                     /locus_tag="MRET_0277"
                     /note="MRES_02255"
                     /db_xref="GeneID:38737043"
     mRNA            complement(<456532..>459276)
                     /locus_tag="MRET_0277"
                     /product="protein JSN1"
                     /transcript_id="XM_027626904.1"
                     /db_xref="GeneID:38737043"
     CDS             complement(456532..459276)
                     /locus_tag="MRET_0277"
                     /codon_start=1
                     /product="protein JSN1"
                     /protein_id="XP_027482435.1"
                     /db_xref="GeneID:38737043"
                     /translation="MSAHDTASSSGSASPGTWSSAPMWRSTPSTNAAATLSNEDFMPT
                     LDFPSMQDLPLREMQPILTMSRGRHAATSSLSTIPSFDSRSNLSTFDTGIAAGTSQPR
                     GRARAGTLPSSFDATAPGVPIAGLKEQSSQAPIGGTEHLGIPSLNDNNGFPFFTGTDD
                     TDALGQTQENSLAKTLDYLGLSDEPRILPLPRDRARTDAAMMNMRYNDSIPLSTYRFL
                     HPQGPSQVVPTAPSMAAALGPAPRLISRAPGYGRARSGTVAAMSGPDGRQRTETELQR
                     AFGLLSSDAHTTRLRSNSMHLLSGSTRKDSEECYLCITRLSTQVTTRLLLRLFEPYGL
                     IKDILLFPQHGAALIQFEEPSHAEQAAEAGATFIGAYLMECLGDQTVLPQFLANSGAL
                     PDSAIEGEPISTRVVEVSPVPPGITHADLMHLFSIAGPIEHISLKANVSQITYDSAEE
                     ARMALQLNGSLPFGGTWPLCVFSVPEEKIWPLRQPRTMRVGGSGTMVPSSDKGGVPLP
                     SDLTPAPDSEMQQALLKLLHFQQGEDPEMQTMDSPVEHTYAINIPMPADGGRASRRMD
                     HAKYRELRKTLEAHQLSQEEVDNVAREQLSVIVDLARNYIGNTVVQRFFEQCSETVKT
                     EMLERLAPHLASLGTHKNGTWAAQKIIVCVRTEEQQDLITTHMQPYVPSLLLDQFGNY
                     VVQCVLPFGFPKADFIMDAMVDRCWEIAQGRFGARSMRTCLEHPGMPRKHIKRVALAI
                     ILHCVPLSTSPNGTLLLTWLFESSGMSGISQLIAPRFIPYMPLLCTHKLASGIVLRIM
                     MQADDLESARLLLNALFDVPRFQVLEEILLDPVHGVLLVGRALLSPALDAEAKASFTQ
                     AVSELLQANDLLQVRAYQRLADELSSLTFHGTQLPLVGLQRSPPGLMYPVAASLQPQI
                     "
     gene            <459870..>461630
                     /locus_tag="MRET_0278"
                     /note="MRES_02250"
                     /db_xref="GeneID:38737044"
     mRNA            join(<459870..460398,460429..>461630)
                     /locus_tag="MRET_0278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626905.1"
                     /db_xref="GeneID:38737044"
     CDS             join(459870..460398,460429..461630)
                     /locus_tag="MRET_0278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482438.1"
                     /db_xref="GeneID:38737044"
                     /translation="MNKEAEQMEKNAPRRAVRSRKLPSSLRSPSPTPLSTPRPPSDPT
                     QRISAQLETTNKLSSPPINPEETHATGPGKRIRRPNSMYKPPEALTADSKRASPPNTV
                     PKCKSTPTSSSLRPKSKSHFKSEENLDSPTSARITLRFFSRSPQPSTNDLQMPPTFTR
                     RGERITEPTRRRQSNNGIMSPKPVRTAAGIGRVGPAPVSDDDDDDDGDDNEVDELARD
                     ALHVEFAERAWSVSVQDAPKSGAHAVAASAPDAESDGDDDNDFHRTMLLDAELDMLTR
                     VDSPKGSEYDGPLTDGHMTTPASPGSRDSPSWTRSCSPTSDENKDTVFVHALPVPHSR
                     SSESGAHAGSITLSLPYEFAPGMHHDPLQHEAALASPILDAHGDTPLTPVHTVTAAEL
                     AEKSDKEDDKNILPSLVTPSLPSDLSRVSPTLIPRSPDALMGSMMTGVDAAGSASTNG
                     DLDSLPAAPLLEDAFESSDQSPTPRGDIIPRSEIWLDTSMSMKLPLRDDADMDHLFNV
                     PDKIMALTDLDRAWGSSENLEPTTCPVNDRKRSTHSTHAQSKRRHSGNASTCATYPRS
                     HSTRLRSRAL"
     gene            complement(<461733..>464020)
                     /locus_tag="MRET_0279"
                     /note="MRES_02245"
                     /db_xref="GeneID:38737045"
     mRNA            complement(join(<461733..463292,463322..>464020))
                     /locus_tag="MRET_0279"
                     /product="M-phase inducer tyrosine phosphatase"
                     /transcript_id="XM_027626906.1"
                     /db_xref="GeneID:38737045"
     CDS             complement(join(461733..463292,463322..464020))
                     /locus_tag="MRET_0279"
                     /codon_start=1
                     /product="M-phase inducer tyrosine phosphatase"
                     /protein_id="XP_027482439.1"
                     /db_xref="GeneID:38737045"
                     /translation="MSSSLPFTSKNIPALAGWGDNVPTVRPSSPANLSRDGFIINDLD
                     RSFGSSMSISSLDSPHRSVRRERASTQSAIGVHLDDPFAATAYEGFLVPTSIPPTFAH
                     VSSIPYRGIPDSSPHAMDISSPAVIMEPPAGKTPAAFRSIQPSSVSFLGRDSGTMRYS
                     MPALGHHSNLMSHQSTPDSPDYRRPPKKRLASTSQLQDASFETDGPGRCVFFDEKKGR
                     IPVQNKSRLHSRTQSELLWWEKTELDWNTADAKDPTSVSPTDTARPDWLTADDSTASD
                     SFLAPTQPAKSVSPMANYFYDPQSPYVSMISAVPSPVSSPSLTSTDQNWGKRYHTSTL
                     PLPEVRAPLSSTSFNADPIMLDEPSEDGPVQTGSPVRSSVRRSSLSGPRRTKTTNDAL
                     TSKENVPPVPSTALSHILPGFGNHELEHKVLPCFPVKSDGLMRVSCQTVRDLMKGHYD
                     DRVSGYQIVDCRFAYEHEGGHIAGSINLNSIEQIQQHFLTPGSGLHAEHALPPRTQSG
                     HPDEQGSTRKFVLIFHCEFSFKRGPCLALALRQADRSLSNDYPKCHFPDMYILQGGYA
                     EFFRTCPEMCEPRAYVGMDDPRYLRKRSSELSGFRRQFSRNRSFAYGDGQVTGSAAAP
                     IGSMRRAPSLMPSLPLPTVTGSPPRFSSTEVATAAKTKIGSTTAAQHRMGHIPAFGKA
                     SSLAPPDLARDVSYSSCDSSFDGSTTDSPCAVARSGRPALMDLPQPQQRAAMANRLLR
                     RADTTPSVTLPP"
     gene            <464423..>467878
                     /locus_tag="MRET_0280"
                     /note="MRES_02240"
                     /db_xref="GeneID:38737046"
     mRNA            <464423..>467878
                     /locus_tag="MRET_0280"
                     /product="DNA polymerase phi"
                     /transcript_id="XM_027626907.1"
                     /db_xref="GeneID:38737046"
     CDS             464423..467878
                     /locus_tag="MRET_0280"
                     /codon_start=1
                     /product="DNA polymerase phi"
                     /protein_id="XP_027483084.1"
                     /db_xref="GeneID:38737046"
                     /translation="MSNTLALFWNLAATDREARIDASNELVNALLQQSSDFGNVDDTT
                     LMESPLSEQVTDDEVAGAEQRIDDANTQDVSYAIRRLVRGLASPRENARIGFAVALSG
                     LLTHLKTVSANDVLVLILKYSVVHGNMNGQEVRDLQFARLFGIYALVRSRLLYRAYLS
                     TFQRAFHILIHVASYKSWLSEPCGWVLTELVEPLARNEPDRPSWADDALGWIADQLSS
                     HRSLSPETLALALQLTHMDPTIKLGERMIPPFKTPNFLASANLPVLASVLREAAPMHW
                     QPDTPVPKAGSWSTKLPFVWDKLLNLYLNDKIPEGVAPFADFFRVVVDESLFAPQASP
                     ERKSWGFQVLHRTLAHASEDVLPFLFTPHVMRTWVNQLSVPDRLLHSMAQKTVSLVGE
                     AVKRSPTAGIALVTQLTGEHGRQNFDRVTHTKTIESILSSLDEEGLQRYLAYLRVIIY
                     APTSAAPEDAKGIAMQRQSACDQMLGLVRSHLVQSSSGWVRDVLIFFAGHGYYAVKNP
                     VKGPWSGILQVPTVPFTDALREVCRSRLQACLIELSEPDERGTPWSLAVMDMLDTMEK
                     DHKHFTTTARPIAQERIQHAKSMLHQMRNASKKEKNETRKLHLRAFEILLASVILVTF
                     EDGDDAPDMVDSVVDAAKLLFFDDKASQREMDGMELLTDALIGLLEISSAFLRSMTIQ
                     VFSAFSSSMTRDSLNHLVDQLGMGENEDAEDDEIKEDEEDDGDEEEEEEADDDDDDDE
                     DDEDDEEEGDEEDMDDSDVDPVLRSRVEEAFRSTGMMDDDDDDDDDQDAVMDDDQMAQ
                     LDDKLAEIFQQHTSSKRKEREWIQRDTALFHNKILDLLDIYAKEQSGNILVLRLVTPL
                     LALARGSGDTSQQVANRASQILRQRLCKSKDLPHGDHWDVDEVVSELKDTHELLRTSQ
                     DAKLADLAAAVSHLYTKVLVRHGHVHATVDVFKTTLDDFLERKSSPIRPAFLIEAIRR
                     YPELSWGLRHALLQGCRVSKAARAFRQVQVFTMLQVLLQQQQHEDMRQANMEEILSFI
                     EHVRAVVLETVQAAVAQGDDNAGSLNSQRLKDVLRFILQSVRITLRITDGQMSQAHAC
                     WPPAELTNMLERLQQSERFKNSTSLHSILKEAHSLLCKDSTNIKKKRSATESAPGKRA
                     KARHT"
     gene            <467978..>468298
                     /locus_tag="MRET_0281"
                     /note="MRES_02235"
                     /db_xref="GeneID:38737047"
     mRNA            join(<467978..468168,468201..468225,468260..>468298)
                     /locus_tag="MRET_0281"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM8"
                     /transcript_id="XM_027626908.1"
                     /db_xref="GeneID:38737047"
     CDS             join(467978..468168,468201..468225,468260..468298)
                     /locus_tag="MRET_0281"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM8"
                     /protein_id="XP_027483083.1"
                     /db_xref="GeneID:38737047"
                     /translation="MSQNLSEADQKELSTFLDSEQSKARMQSTVHAFTERCWDQCITS
                     SIGSHFGRGEEACLSNCVERFLDTSLFIVKKLESQRDLAA"
     gene            <468696..>470204
                     /locus_tag="MRET_0282"
                     /note="MRES_02230"
                     /db_xref="GeneID:38737048"
     mRNA            join(<468696..469049,469077..>470204)
                     /locus_tag="MRET_0282"
                     /product="casein kinase I"
                     /transcript_id="XM_027626909.1"
                     /db_xref="GeneID:38737048"
     CDS             join(468696..469049,469077..470204)
                     /locus_tag="MRET_0282"
                     /codon_start=1
                     /product="casein kinase I"
                     /protein_id="XP_027483147.1"
                     /db_xref="GeneID:38737048"
                     /translation="MASHSNASNVVGGHYRVGKKIGEGSFGVIFEGTDLLTHQRVAIK
                     FEPRKSDAPQLRDEYRTYKVLSGIQGVPQVYFFGQEGLHNVLVIDLLGPSLEDLFDLC
                     GRRFSVKTVVMVAKQMITRVQSIHERNLIYRDIKPDNFLVGRGPGKSANIVNVVDFGM
                     AKQYRDPRTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDLEALGHVFLYFLRGS
                     LPWQGLKAATNKQKYEKIGEKKQSTTIKELCDGFPEEFGIYLNYVRKLGFEETPDYDF
                     LRELFSKVLRDLGEVDDGVYDWLLVNHVKGTEGDASRQGQTGRAAHDATPPVDSAGAG
                     AITGASGAGAGAPTAQGARNRQRVGEMGTRLSTAEIRTEQGFAPIREATQSGGALHGM
                     GASRSQNVTSASAAAVRGSPATGQVEERPRPSARRQNTRVSTMASPMSTGMGAGAGSP
                     SPFDANPTQIPARGAPNVPQGPKAPERRTFGQRLVDFFLCRCD"
     gene            <470408..>471888
                     /locus_tag="MRET_0283"
                     /db_xref="GeneID:38737049"
     mRNA            join(<470408..470689,470716..>471888)
                     /locus_tag="MRET_0283"
                     /product="monooxygenase"
                     /transcript_id="XM_027626910.1"
                     /db_xref="GeneID:38737049"
     CDS             join(470408..470689,470716..471888)
                     /locus_tag="MRET_0283"
                     /codon_start=1
                     /product="monooxygenase"
                     /protein_id="XP_027483082.1"
                     /db_xref="GeneID:38737049"
                     /translation="MHRFAIIGAGAAGLAAVQQLRAVAGELPIEISVFERRACVGGLW
                     NYEPQPGPCHIHQPIPAKLCEVGYATSSEDPQKVIAPSAMYEGLRTNVPSPVMAFRGV
                     PFPPNTHMFPSRAHVHNYLQHFASSQSMLDVIRFRTEVVHARRVQNGWHVTSRSLDEQ
                     SESNDVFDAILVANGNCATPHIPSVPGLDHFRGRQMHSAWYRYPDTLNARRILIVGSN
                     SSGSDIARELCGGAVRQWRTSEEWQRTSENVTVYQSYHDLAKPPKSDYDPRDPASPAW
                     CRRIHVVGPIQHIDEQGALVFSDGARLEDIDLIIWATGFLHNVSFFQANDEPFCQAPL
                     IVHNQQTSTAATIASADTLHHLDDWMMFYKPDPSLCFIGLPKHVVPFPLVQLQSRVAA
                     HVLLGKIPPLPRVRAQLPISDPERWIIDEYNEAPGPEAWGNFILGREAEFVYTDTLLS
                     LLPRSQPPEWQPFPRWRRELRRKGIEKRRELLGY"
     gene            complement(<471885..>472859)
                     /locus_tag="MRET_0284"
                     /note="MRES_02225"
                     /db_xref="GeneID:38737050"
     mRNA            complement(<471885..>472859)
                     /locus_tag="MRET_0284"
                     /product="mitogen-activated protein kinase organizer 1"
                     /transcript_id="XM_027626911.1"
                     /db_xref="GeneID:38737050"
     CDS             complement(471885..472859)
                     /locus_tag="MRET_0284"
                     /codon_start=1
                     /product="mitogen-activated protein kinase organizer 1"
                     /protein_id="XP_027483088.1"
                     /db_xref="GeneID:38737050"
                     /translation="MAFSVTHCIQAHAGAAHVARFNAGGRYLLTGGSDQQIHLWNART
                     GVSDELDTKGRSACIQRYSAHSYEVLCLDIAPDSLRFASAGPDRAIMLWDVATGQVFR
                     RFHSHTGRIHDVKFGGAREEGSLLYAAGSDKVLRAFDLRASNAWRPIFEAREAHDAIL
                     TLALTPGSVHTGSVDGVLRTYDVRMGELRSDTLDEPITSLTPGKDGVTMLVSQLASTH
                     RLMDLADGTQLQCFRGHTQTSFRCHSDMTLDEALVISGDETGHLFAWDILSGRKKWDA
                     RPDFRGSARHRRAPNVPVTMLWTEAGPDAQDPQVVTASSCGTVHIWSR"
     gene            <472959..>474065
                     /locus_tag="MRET_0285"
                     /db_xref="GeneID:38737051"
     mRNA            <472959..>474065
                     /locus_tag="MRET_0285"
                     /product="metallo-beta-lactamase superfamily protein"
                     /transcript_id="XM_027626912.1"
                     /db_xref="GeneID:38737051"
     CDS             472959..474065
                     /locus_tag="MRET_0285"
                     /codon_start=1
                     /product="metallo-beta-lactamase superfamily protein"
                     /protein_id="XP_027483087.1"
                     /db_xref="GeneID:38737051"
                     /translation="MSWPTVKSTWLDKVIFLGTGTSSQVPAIHCVTGSRSHCITCTDA
                     MKPGSKNRRFCTSLVAIGSEPGRPDTSSTILIDCGKSFYESALRYFPSNGLSKIDAVL
                     LTHPHADAVLGLDDLRSWTMNGCIQDYVDIYLTQECMQTVGQMFPYLVDTSRATGGGD
                     VGALRWHLIDASTPFQAGPHQVHVQPLYVEHGFVQNGRMPFGCLGFRIDSMSYISDCH
                     YIPSETLDKVVGSDVFILDGLKMKRHKSHFSIPQAITCVLDISIRHVQQNLPPPTLAL
                     ITDITHGIEHHDFSAQLQRHMKGLAAWLYEQNMDVKSASSEWWKTIWDELENEEHERL
                     QLSVSCTTDKSHPLVPSMHLAYDGAQVCMSKNRL"
     gene            complement(<474963..>476129)
                     /locus_tag="MRET_0286"
                     /note="MRES_02220"
                     /db_xref="GeneID:38737052"
     mRNA            complement(<474963..>476129)
                     /locus_tag="MRET_0286"
                     /product="Ran GTPase-activating protein 1"
                     /transcript_id="XM_027626913.1"
                     /db_xref="GeneID:38737052"
     CDS             complement(474963..476129)
                     /locus_tag="MRET_0286"
                     /codon_start=1
                     /product="Ran GTPase-activating protein 1"
                     /protein_id="XP_027483086.1"
                     /db_xref="GeneID:38737052"
                     /translation="MANDARTGVFDISNKNLKLDTEQDIAPYISQLEKIEPLYEIHLS
                     GNTFGVGACQALAEVLKKKKTLRIAGMSDIFTGRLITEIPDSLRALCDALVDHEELEE
                     IHLSDNAFGGRSSEPMVNLLTNNHHIRLLNLSNNGLGVTGGTIVADALYEAAKSLKDG
                     EKSALRVVICGRNRLENGSAPVWARAFAAHRGITAVHMYQNGIRMEGVRALCQGLSHC
                     KDLEVLDLQDNTATLRGSRAVANALPNWPHLRTLNLSDCLLKSKGGSLLFETLSLGLN
                     KKLQTLHLQYCDLNRGSLDKLGHAIEQHLSELETLEINGNFADVDDDCISKITASLSK
                     WGHATALDELDEMDPEGEEDEDEEEEEEDIGEEEKPDPEADKLADELAKTHIQS"
     gene            complement(<476200..>478528)
                     /locus_tag="MRET_0287"
                     /note="MRES_02215"
                     /db_xref="GeneID:38737053"
     mRNA            complement(join(<476200..478142,478167..478347,
                     478373..>478528))
                     /locus_tag="MRET_0287"
                     /product="myotubularin-related protein 6/7/8"
                     /transcript_id="XM_027626914.1"
                     /db_xref="GeneID:38737053"
     CDS             complement(join(476200..478142,478167..478347,
                     478373..478528))
                     /locus_tag="MRET_0287"
                     /codon_start=1
                     /product="myotubularin-related protein 6/7/8"
                     /protein_id="XP_027483085.1"
                     /db_xref="GeneID:38737053"
                     /translation="MHDGVVEPDFGSTATSFESITAWLWRDDKFTRISIQVTRFHLIL
                     TDEHGHERIDLPLISYAVRRPMAQSAWAQACIYPLSIYLATHEHLILGFYDEATTLRT
                     LERLREAASMDSVERMYAFNSGMPAGNGWQLYNVAREFKRQGVGSSTRAWRFSSVNAS
                     YEMAPTYPSMLVVPSNISDMTLIHAAKHRSKGRIPVLTYLHWANLATLSRSSQPMVGI
                     TQNRSIQDEKLVEAIFSSHERTHGLVSSSSEPVYGSTMTNLIVDARPTANAMANHARG
                     AGSENMEFYKNCKKVYLGIDNIHVMRDSLAKIQTALRLQDERPVFEARQEAAVLDELA
                     LQRSQWLKHLGAVLQGTRQIVQNIHIHSSHVLVHCSDGWDRTAQLVSLAQICLDPYFR
                     TLEGFAVLIEKDWVSFGHQFQERHGLVHQSSSKFDMRAPQHDLLLDAEAKNDEINEEQ
                     SRAAPSLWDFTKSLTAHFQGHASSQTAPIFFQFLDCVWQLQCQFPERFEFRGSYLTEL
                     VRQAFSGTSGTFLYNSERERRLSSSPNKPAPAEMTPSVWDALLSDTSWKNPRYDPSLD
                     RRDGRDDQGVLYVEPKDVRFASDLFRRSDDSLNAHLDAERRQKVYLQQQLAESVHESR
                     PKALSHQDPLFPEETFHNAARKVRSLFSDGWNRVQEAVRKTTDEANVVAQRHDSGVIP
                     TSDSNNESSSFAAINNPWIEQTNKVRNELDSLSSCSWEPPPSSTATGDALPPPLPRSI
                     STPEPDAMTSTDPLGASYL"
     gene            complement(<478620..>480266)
                     /locus_tag="MRET_0288"
                     /note="MRES_02210"
                     /db_xref="GeneID:38737054"
     mRNA            complement(<478620..>480266)
                     /locus_tag="MRET_0288"
                     /product="elongator complex protein 3"
                     /transcript_id="XM_027626915.1"
                     /db_xref="GeneID:38737054"
     CDS             complement(478620..480266)
                     /locus_tag="MRET_0288"
                     /codon_start=1
                     /product="elongator complex protein 3"
                     /protein_id="XP_027483081.1"
                     /db_xref="GeneID:38737054"
                     /translation="MGVASTSTSTECLLRVCADIAAQLVQAHEESQAVSLNAIRGAAC
                     KKHGYGGVPRLTDIIAAIPDTHKRALVPALRAKPIRSASGIAVVAVMCKPHRCPHIAL
                     TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQSRGRVQQLHELGHSV
                     DKVEYIIMGGTFMSLSEQYRNEFIAQLHNALSGYTGLDVDEAVRYSERSQTKCIGITI
                     ETRPDYCLRPHLSQMLRYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCETFHLAKDAG
                     YKVVAHMMPDLPNVGVERDMEQFKEYFENPAFRSDGLKLYPTLVIRGTGLYELWRTGR
                     YKNYTPSFLVDVIARILALVPPWTRVYRVQRDIPMPLVSSGVENGNLREMALERMRDF
                     GATCRDVRYREVGIHEIHTKVRPEEIEFLRRDYTANGGWETFLSYEDPDKDILVALLR
                     LRKCSETGTYRPELIKDGQTSIVRELHTYGSAVPLHSRDPTKFQHQGFGTLLMEQAET
                     IARDEHGSVKMAVISGVGTRDYYRRLGYELEGPYMVKRLV"
     gene            <480417..>483140
                     /locus_tag="MRET_0289"
                     /note="MRES_02205"
                     /db_xref="GeneID:38737055"
     mRNA            <480417..>483140
                     /locus_tag="MRET_0289"
                     /product="fatty acid synthetase"
                     /transcript_id="XM_027626916.1"
                     /db_xref="GeneID:38737055"
     CDS             480417..483140
                     /locus_tag="MRET_0289"
                     /codon_start=1
                     /product="fatty acid synthetase"
                     /protein_id="XP_027482962.1"
                     /db_xref="GeneID:38737055"
                     /translation="MRGVLCVWLSVLVTGILGTGFASTSKAEIQDINLVDLISTYPEL
                     SAFTRHLQRTRLIPTLNRIQTYDANSTGVTIFAPTNAAFDNAKIGHESFWMDELPSHS
                     DNVQAPLRQQLLYHILNHTVSLTESNATYLETLYFPSRKRLAEPTHPGNIPQKPFTPS
                     HPGAEDKGGLLGGSGQMLRVERSTNGSILHVGSDANGSHGANVIHVDQSSPYGDLYVI
                     DRVLDLPPSLDVFLREQKACALFQHMPSDILHSLALTAHLTIFLPSDRAWNRLHSLEQ
                     AYLLGPSPQAQDDRLRVFGWHASSTGIHDGHVAYASSLRSAPHAQFTTILGGDIHVSR
                     AENNSLFVNGMPIIQEDLLTENGVVHILDGMLLPHGDLGMTPEQYLLALNATKFVSLI
                     RQAGLESYISQDPHKVPPDSKSGPFTFLVPSNEALERWDAQFNNLSKKKALKFGTLLR
                     EMLLYHILPGHQRALHNSSLPVTELRPSGLSGAAQRMRVHILDNGTVLFGENSVSRKS
                     IFLNSTTLYLLDDMVEMPKDPVQTASEASLSTYVEALYKVQMDKNVRQAPYMTYIVPS
                     DFAFESAGLVSKYLLSSANTKLSHVLSSQVLNGAWYGAVLRDKWTQISTQDGSFLWMR
                     RDAVSSDTVVRTNSSDLDIHVTRPDLLTDTGVMHVVDRLTIPASAPISLYQLAQSAPT
                     GKMVSLLHRAGFDWVWNETHKLEAGGTCGRQKLVLLVPEDRAFAKLKSHAYEHNMEQL
                     RALMSLHVLVVDDCAAQQPGTEDVPMPVVDEITHVSLLDKSMGGTSPYGTVAFRRVSP
                     TNENRLGYMVGIKGARSTRGKEHSAHVLEYGRTSCMQVHAGRVTPGGILTIDTVLEPF
                     ESGWFFRWDWARKVCLLGALSLGAISAGIYTWHWRCGYTRVQTEALEGEEE"
     gene            <484740..>485510
                     /locus_tag="MRET_0290"
                     /db_xref="GeneID:38737056"
     mRNA            join(<484740..484769,484801..484944,484974..485101,
                     485131..485266,485304..485440,485483..>485510)
                     /locus_tag="MRET_0290"
                     /product="glycolipid transfer protein HET-C2"
                     /transcript_id="XM_027626917.1"
                     /db_xref="GeneID:38737056"
     CDS             join(484740..484769,484801..484944,484974..485101,
                     485131..485266,485304..485440,485483..485510)
                     /locus_tag="MRET_0290"
                     /codon_start=1
                     /product="glycolipid transfer protein HET-C2"
                     /protein_id="XP_027482634.1"
                     /db_xref="GeneID:38737056"
                     /translation="MTTYFDTLRTPYQNVPITEDGVATSEFIDATEGVVKLFDLLGSS
                     AFAVVQNDMNGNIKKIRDRLLSTGPDLSGTLQLLVKNEGLPGDKKRTATEGLLWLLRG
                     LEFTAKALRFSLDNQNEELATSFTKAYEQTLRKHHSILVRPVFTLAMKACPYRKDFYA
                     KLGPSEDDVRPQLSTWLNALEKIVQDMQQFFEQGQYAKGF"
     gene            <485710..>486786
                     /locus_tag="MRET_0291"
                     /note="MRES_02200"
                     /db_xref="GeneID:38737057"
     mRNA            <485710..>486786
                     /locus_tag="MRET_0291"
                     /product="fructose-bisphosphate aldolase, class II"
                     /transcript_id="XM_027626918.1"
                     /db_xref="GeneID:38737057"
     CDS             485710..486786
                     /locus_tag="MRET_0291"
                     /codon_start=1
                     /product="fructose-bisphosphate aldolase, class II"
                     /protein_id="XP_027482635.1"
                     /db_xref="GeneID:38737057"
                     /translation="MGILDIVPAGVISGHDVYKVYDYARENHFAIPAFNVTTSSVANA
                     ALEAAREAKAPVIIQVSNGGAAYFAGKGLPNDKQQASVAGSVACAHYVRSVAKHYGVP
                     VILHSDHCAKKLLPWFDGMLAADEEWFAKHGEPLFSSHMLDLSEETKEDNIKICLEYL
                     KRMAKIGVWLEMEIGITGGEEDGVNNEHVHNSALYTQPQDIWDIYKAFSEITPNFSIA
                     AAFGNVHGVYKPGNVRLHPELLREHQDFVREQLKINKENPVFLVFHGGSGSEKHEIAT
                     AVNNGIIKMNVDTDTQYAYLEGIRDFILTKKDYLMSQVGNPEGADKPNKKQYDPRVWV
                     REGEKTMGKRCQIAFDDLKTSNHL"
     gene            <487448..>490454
                     /locus_tag="MRET_0292"
                     /note="MRES_02195"
                     /db_xref="GeneID:38737058"
     mRNA            join(<487448..487565,487606..>490454)
                     /locus_tag="MRET_0292"
                     /product="Ca2+ transporting ATPase,
                     sarcoplasmic/endoplasmic reticulum"
                     /transcript_id="XM_027626919.1"
                     /db_xref="GeneID:38737058"
     CDS             join(487448..487565,487606..490454)
                     /locus_tag="MRET_0292"
                     /codon_start=1
                     /product="Ca2+ transporting ATPase,
                     sarcoplasmic/endoplasmic reticulum"
                     /protein_id="XP_027483154.1"
                     /db_xref="GeneID:38737058"
                     /translation="MEQGWTYSVDNALHYFNVSRTQGLSSEAAKAKLAKYGPNELKEE
                     EPTPLWRLVLEQFQDQLVIILLVSAFVSLVLALAENEGSLLNALVEPSVIFLILIANA
                     TVGVLQERNADQSIQALRAYSPEQAFVIRDGKTCHMDARDIVPGDIVIVSAGDRVPAD
                     CRVIELRSSVLQVDQAILTGESESVYKTSNKVEDEKAVKQDMTNMLFCGTTIVNGACL
                     ALVCLTGEQTAIGDIHAEIGEHEDAKTPLQERLDEFGDLLAKAIMVICVLVWVVNIRH
                     FGDPSHHGWLNGAIYYFKIAVALAVAAIPEGLAAVITACLALGTQKMARKNAIVRHLP
                     SVETLGSTSVICSDKTGTLTTNEMSVTAMYLVGDNTEYQVTGTTFAPEGSIMLDGNAM
                     TGLSRPGNAVQALAETCAVCNDATIVVDSNGRHKAIGQATEAALRVLVEKIGYHDHVQ
                     QAHVSSLQPALRVSAVSDLYAKSLTRLATLDFTRDRKMMSTFVRRSANKLRLLVKGAP
                     ESVLLCSTHVYLNENERIPLTDDMRVSLQQKLDAYGNDGLRVLAVAVRDDMSLPDLFS
                     PLDPSKYAEYEHDLSLVGFVGMRDPPRSEVAQAIRSCMDAGVRVVMITGDNQRTAEAI
                     CRQVGLFGPTEDIGDRSYTGREFDAMTPEEMLSMSRRVVVLSRTEPSHKSRLVDLLQK
                     SNEVVAMTGDGVNDAPALKRADIGVAMGTGTDVARLAADMVLSDNNFATIVSAIEQGR
                     SIFNNTSSFIRYLISSNIGEVVSIFLTVLLGMPEGLIPVQLLWVNLVTDGLPATALGF
                     NPPDGAVMHVPPRKRNDSLVSQWMLVRYMIIGVYIGVATVLGYAWWFVAYSGGPQISV
                     YQLTHFHKCESEFNEIGCGIFTGVEAQHGSTMSLSILVTIEMLNALNALSDMDSLLFH
                     TPFKNLWLIGAIMLSMALHMVILYVPTFQTIFSVVPLGWNEWMGVLALSVPVLVIDEA
                     FKWAARGWLPKSKKTA"
     gene            complement(<490554..>493526)
                     /locus_tag="MRET_0293"
                     /note="MRES_02190"
                     /db_xref="GeneID:38737059"
     mRNA            complement(<490554..>493526)
                     /locus_tag="MRET_0293"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626920.1"
                     /db_xref="GeneID:38737059"
     CDS             complement(490554..493526)
                     /locus_tag="MRET_0293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483155.1"
                     /db_xref="GeneID:38737059"
                     /translation="MNVPLQNYGVEAVEHVSIASNEWSNQNINPEEQNQAPNVQVQKS
                     SPMRRLHLDTTSNQPYVDVNHLAPGGVVPLNQGNLASTVSQNQIPIGLGLSPPTPGVS
                     SDATGLTGPSIKGTSTFPVIELTQAAHATTPTSPSNLSVPAMTPNTASSDRTEHLCLS
                     PSKYIQEPMKLLPDIGNSIDELAAAAADARVHFHGGRFDMCTDKMDTIKHLIRRVAEM
                     GVTGLSLSSEMQQQCRNSGQPLSFSALGTPEQERVINSAAAFSTLIDDIESRKRRMKN
                     EIQSALPIKSLCSEKTGMGMRARSRSELAEVPSSLSNANLSTTTAFSPSLQSGVFDFS
                     MPAPSSFPTNQNLQPSAPSFGLQEAAPVTHDVNSLPTSSDPSGVLNNHVLQSNSPQAV
                     LNSKRPSVNPDQLNFTSTPVNESSFQSAPDSSIVSISAAEALKVALNSGNGPSDSWNL
                     DPANPLQPSAQMNPITETPDLSLDPNASAAKDGGQDDWSDWSGDRAATGLSELSPELR
                     AKFEAVFHEFLTSLCSNLEAKDERGELIHQTLMPKKMARLDESPDFRPFKFRIQAFTM
                     AFKTELRRRGISEESASMRRIKQFLWSHPFISRFNEDGKKAKSKGNHIWIIQARRLPA
                     GGWEFFTFSPKIAGASSKVAYVNEPWTWNLRIWDPQASSMNIKVVYSANTMPSWLHWE
                     DNEKVLTGVPTSTSQGGNLSVTALYVQNGQLHRLEHSFYLHVMNRPDETGSGEPLQSS
                     DASLSDLPLEPKHLCTSPPPPTSTSVTIPPVSGDPKPAAVNVVPPELRHPPVQAQLSV
                     SPSQPTPAGPNMLESQTYEVVEPSRAHDVLASIPYPFTPPVYMNKNVQAAQGFDPALI
                     QQHYPDVSTQAQPSISDPLHQTAIFVDNTSASTAQTPSLHGTSPVSTLSPPAQTPATM
                     SFSPNQSEHQDSRPSMQLWRLIDRRQREQASSFMLHMFHRPQSFTLSEHPGQGSPMTN
                     MPNDINASLPSMNPSHNP"
     gene            complement(<493969..>496353)
                     /locus_tag="MRET_0294"
                     /db_xref="GeneID:38737060"
     mRNA            complement(<493969..>496353)
                     /locus_tag="MRET_0294"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626921.1"
                     /db_xref="GeneID:38737060"
     CDS             complement(493969..496353)
                     /locus_tag="MRET_0294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483150.1"
                     /db_xref="GeneID:38737060"
                     /translation="MNGLGIDLGIPDTALNDVRMNVQNISQKTSAPPKSSRRRAIVRQ
                     KNHDGHLAQASTTQGVCASLPSMPLRENRLITNKSVNVSPMCVMKHPLPPKPAVEWSV
                     FDDVHSASATRRADTPSDSATSSPRPQVQFPGSQVKLPPVSSCDAQPIPYPQAPPFLP
                     VHHVSLSPATPMVHSLPSKPIVSMYPPERDERIGIELFVENNLIVEGGLLHGSIQLNI
                     PNHTDRSTAMLLAQPRVRLIGYECMPDEDIRHIFYRHMSVIDGDRSLDGPSEPYILHG
                     TTNTCEGEGGGDAILPCFASLPDKEGFSLGQEGHHAIPFSLSVPMGKGAKGCYESASS
                     EVGYILIASVRVKAFGEKHSGIAHCFQKMQLYPYLNPTAELSSSPRPIISQANTPEAK
                     ARNIRLAAALHRETWVAGQRVYFEAGVFNGGNQLLNVLRIALVRVETLYRAHDHIPGS
                     KDIISSTSTIVTDETLAAGQLGSWWTGARPGKPIYLHHSLVLPENTATIEPGRHINVQ
                     YVLRVGVGAETSTLVEVDVPLRIIKYVSLDPPPPRRTWMGATGLMGQLLGDSENQNIT
                     VKRLQSLDTMRSPCSMPSAVVVSPNVSQQPGNSRTAQHKRSLDFINSAIRSATARHTS
                     PLAAGEASTTGLGIELSSTEPRNELTSVATTHQRASLGPALPFLEINDVQPEPQGDVS
                     LPLGDETVDDVELFFGEQGRKKIEDESTRAQQSCQDGLHDLTLQDAHYEMDRSSSSSQ
                     VCDESSAMPSTPRRESILRYPASAPRTLRPKSSFTITSSITPLKVRRSNTLSQG"
     gene            complement(<496630..>497541)
                     /locus_tag="MRET_0295"
                     /note="MRES_02185"
                     /db_xref="GeneID:38737061"
     mRNA            complement(<496630..>497541)
                     /locus_tag="MRET_0295"
                     /product="cytochrome c peroxidase"
                     /transcript_id="XM_027626922.1"
                     /db_xref="GeneID:38737061"
     CDS             complement(496630..497541)
                     /locus_tag="MRET_0295"
                     /codon_start=1
                     /product="cytochrome c peroxidase"
                     /protein_id="XP_027483151.1"
                     /db_xref="GeneID:38737061"
                     /translation="MSKLGDFDAVRKDIASILKKKGYDDGSIGPVLVRLAWHASGTYS
                     KEDETGGSNGAGMRYEEEGGDPANAGLENARAFLEPIKEKHPWITYADLWTLAGVVAI
                     KEMDGPEIEWKPGRTDFTNKRYVPPRGRLPDGAQGQDHLRHIFYRMGFNDQEIVALTG
                     AHNLGRCHKNRSGFDGPWVVNPTRFSNTFYKFLLNLKWEPRKWDGPFQYSAYAPGMDE
                     DDEPLMMLPTDYSLAQDEKFRPWVEKYAADRDLFYADFAKAFAKLIELGVYRDEDGIA
                     RCDKRDAKGSYIPAPKKSSSTGARPNL"
     gene            <497870..>498760
                     /locus_tag="MRET_0296"
                     /note="MRES_02180"
                     /db_xref="GeneID:38737062"
     mRNA            <497870..>498760
                     /locus_tag="MRET_0296"
                     /product="cytoplasmic inorganic pyrophosphatase (PPase)"
                     /transcript_id="XM_027626923.1"
                     /db_xref="GeneID:38737062"
     CDS             497870..498760
                     /locus_tag="MRET_0296"
                     /codon_start=1
                     /product="cytoplasmic inorganic pyrophosphatase (PPase)"
                     /protein_id="XP_027483152.1"
                     /db_xref="GeneID:38737062"
                     /translation="MTTAQDIQTRVIGAANTLDYRVFLESKSTGQPLSPFHDVPLYAD
                     EANGILNFIVEIPRWTNAKIEISKEDSFNPFKQDTKKGKLRYVRNSFPHKGYIWNYGA
                     FPQTWEDPAFAHPDTKANGDNDPLDVVEIGETVGYTGQIKQVKVLGVMALLDEGETDW
                     KVIVIDVNDPIAPKLNDIEDVEKHLPGLIRATNEWFRIYKIPDGKPENQFAFSGEAKN
                     RSYATEVIHECHEAWRRLITGQANAGDIKLENSTVQGSKSLVAPNDTVITSIPSASPQ
                     PPAPIDPSIDKWFFISSSAN"
     gene            complement(<498857..>499969)
                     /locus_tag="MRET_0297"
                     /note="MRES_02175"
                     /db_xref="GeneID:38737063"
     mRNA            complement(<498857..>499969)
                     /locus_tag="MRET_0297"
                     /product="pyruvate dehydrogenase E1 component beta
                     subunit"
                     /transcript_id="XM_027626924.1"
                     /db_xref="GeneID:38737063"
     CDS             complement(498857..499969)
                     /locus_tag="MRET_0297"
                     /codon_start=1
                     /product="pyruvate dehydrogenase E1 component beta
                     subunit"
                     /protein_id="XP_027483153.1"
                     /db_xref="GeneID:38737063"
                     /translation="MIAAAVRARCIRPQLLRSTLMPSLTMARMPVRAFASESGAQEMT
                     VREALNSAMEEEMHRDSKVFLLGEEIARYNGAYKVTKGLLDKFGEDRVIDTPITEQGF
                     AGLAVGAAFAGLRPVCEFMTFNFAMQAIDQIVNSAGKTHYMSAGQVTVPVVFRGPNGA
                     AAGVAAQHSQDYTTWYGQIPGLKVVSPYSSEDARGLLKAAIRDPNPVVCLENEILYGH
                     SFSVSQEALSEDFLIPIGKAKIERPGKDVTIVAHSMGVAHGLEAAESLAKEGIEAEVI
                     NLRSIRPLDIDAIVESVKKTNRLVTVEGGFPAFGLGSEICAQVMETEAFDYLDAPVER
                     VTGADVPTPYAYNLETLSFATSEIVVKATKRALYRV"
     gene            <500165..>501046
                     /locus_tag="MRET_0298"
                     /db_xref="GeneID:38737064"
     mRNA            <500165..>501046
                     /locus_tag="MRET_0298"
                     /product="casein kinase II subunit beta"
                     /transcript_id="XM_027626925.1"
                     /db_xref="GeneID:38737064"
     CDS             500165..501046
                     /locus_tag="MRET_0298"
                     /codon_start=1
                     /product="casein kinase II subunit beta"
                     /protein_id="XP_027483148.1"
                     /db_xref="GeneID:38737064"
                     /translation="MEELSSGSSDYAASTWIAWFLSTKGNEYFCEIDEDYILDRFNLT
                     GLNTEVQHYTYALDLITDALDENINELHREQIETQARILYGLIHARFIVTTHGLAKML
                     EKFKRADFGRCPRVLCYQQPLLPVGLSEFPFQSPVRLYCPRCEDLYRPKSSRHGALDG
                     AFFGSSFPHMLLMVYPHMIPTKVTVLPPPISIAQKQYGGVSADILHQRAAALERRGEC
                     LASAGEETDQSGNVNDRSLDVSAPVDFVYERVVPRIFGYPVHETSQLMAWQDRQQKKQ
                     TATITNFRQQKLHSGDA"
     gene            complement(<501147..>501764)
                     /locus_tag="MRET_0299"
                     /note="MRES_02170"
                     /db_xref="GeneID:38737065"
     mRNA            complement(<501147..>501764)
                     /locus_tag="MRET_0299"
                     /product="translocation protein SEC66"
                     /transcript_id="XM_027626926.1"
                     /db_xref="GeneID:38737065"
     CDS             complement(501147..501764)
                     /locus_tag="MRET_0299"
                     /codon_start=1
                     /product="translocation protein SEC66"
                     /protein_id="XP_027483149.1"
                     /db_xref="GeneID:38737065"
                     /translation="MTLSIFVPIAYIAALYLSLSLFSKIYRRRAQRTMQKYQNTSSQD
                     AETQPARAIYKALSEIQEAYPDEPAESEDWIVPRETLQASLLARAVAVLRIMSRLRLD
                     KQALQSLLESGSLGDDAATMLEAKETEIRDEAFQIVREANRFHPSWGRLIFENANQIS
                     SNLNHRDILLNISKQRTDEQAKMRQMGMNVPELKFNIKPVAAPTS"
     gene            <502018..>504332
                     /locus_tag="MRET_0300"
                     /note="MRES_02165"
                     /db_xref="GeneID:38737066"
     mRNA            join(<502018..502041,502071..502230,502264..502572,
                     502597..>504332)
                     /locus_tag="MRET_0300"
                     /product="serine/threonine-protein phosphatase 2A
                     regulatory subunit B'"
                     /transcript_id="XM_027626927.1"
                     /db_xref="GeneID:38737066"
     CDS             join(502018..502041,502071..502230,502264..502572,
                     502597..504332)
                     /locus_tag="MRET_0300"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 2A
                     regulatory subunit B'"
                     /protein_id="XP_027482481.1"
                     /db_xref="GeneID:38737066"
                     /translation="MKGLKKAVLSRTRQADTQNRNNNHGSGSFVAPAPPSKDHSSRGF
                     FSGPNHQSSNQSYTSTSSNYTSQSSATTRAPAKASATSGAPASSVSYVSVPPGNISQA
                     VSSTQHTYAPPKLPSRSSTHVPSPVVPGSSSLPVQDMSNSKAAAPAAALPASAQKVGY
                     MGNSAPTLQPVTPTVAPKDTIPSPRTAPRKQRSSRIQTADHVQLEPLPSFSEVLPSDR
                     PQLFVKKLRQSAVVFDFTDASADLSGKQIKAQSLQDMLEFVTTQRGSITELVYPDMVN
                     MFASNLFRTIPPSSNSLSEGFDPEEDEPVLELAWPHLQLVYELFLRFVESTDLNTSIA
                     KKYIDQSFVVQLLELFDSEDPRERDFLKTTLHRIYGKFLNLRAFIRRSINNVFFQFIY
                     ETERHNGIAELLEILGSIINGFALPLKEEHKVFLSRVLLPLHKVKCLAMYHPQLAYCV
                     VQFIEKDSTLTERVVLGLLRFWPKTNSQKEVMFLNEIEEVLDVIEPEDFAKIQVPLFQ
                     QLARCIESQHFQVAERALYFWNNEYVLNLMGDNIQVILPIVFNSLYENSKNHWNPTIH
                     ALVYNAFKLFMEINPAFFDLVSNEHQHHLMLADQHERERYQAWKRIHEGALQNSIKFG
                     IKAPDAVLKSQLESPAVTPRSLTIQDNGTFADMIPLANSLSGLAPPALSLASTSGVVQ
                     GLGPSKIYVSSGNLSPDHDIARDSNLSSNSTNGASTGEYEDAEQSILRDLADHIDPSY
                     LG"
     gene            complement(<504477..>504878)
                     /locus_tag="MRET_0301"
                     /db_xref="GeneID:38737067"
     mRNA            complement(join(<504477..504654,504679..>504878))
                     /locus_tag="MRET_0301"
                     /product="prefoldin subunit 1"
                     /transcript_id="XM_027626928.1"
                     /db_xref="GeneID:38737067"
     CDS             complement(join(504477..504654,504679..504878))
                     /locus_tag="MRET_0301"
                     /codon_start=1
                     /product="prefoldin subunit 1"
                     /protein_id="XP_027482482.1"
                     /db_xref="GeneID:38737067"
                     /translation="MSDMNEDSLPVLLNSIQSRLVSSQRQLSIVNAQMKGRAREAKLQ
                     ELTMEQLQGLGDQTRVYKGVGKLFIEENFQNAVSEAEKRRTEALEENRMLEKKCAFYE
                     KEVAEARKHLQDLVKSMEKASVA"
     gene            <505043..>505870
                     /locus_tag="MRET_0302"
                     /note="MRES_02160"
                     /db_xref="GeneID:38737068"
     mRNA            <505043..>505870
                     /locus_tag="MRET_0302"
                     /product="cleavage stimulation factor subunit 2"
                     /transcript_id="XM_027626929.1"
                     /db_xref="GeneID:38737068"
     CDS             505043..505870
                     /locus_tag="MRET_0302"
                     /codon_start=1
                     /product="cleavage stimulation factor subunit 2"
                     /protein_id="XP_027482479.1"
                     /db_xref="GeneID:38737068"
                     /translation="MSKRGGSNVVFVGNIPYDISEEQLIKVFSEVGRVVDFRLVSDRE
                     QGKFKGYGFCEYEDAETAASAVRNLNDVEVGGRPLRLDYADADPMQDNGRGRTPNVQP
                     TLPEGVPIPLGVSATDVITQTIASLPPNQLMDILTQMKALTTHAPEQARHLLVTNPQL
                     AYAIFHAMLMMNVVDPVVVQTVVSETAPAAGMPPASMHMEPVMTPVPPPQPHPPQGYP
                     PMSAQPMPAAPPLQAPQLDEQQRMLLHQVLQLTPEQIQALPPDQRAGILQLKAQFGQ"
     gene            complement(<505872..>507473)
                     /locus_tag="MRET_0303"
                     /db_xref="GeneID:38737069"
     mRNA            complement(<505872..>507473)
                     /locus_tag="MRET_0303"
                     /product="dTMP kinase"
                     /transcript_id="XM_027626930.1"
                     /db_xref="GeneID:38737069"
     CDS             complement(505872..507473)
                     /locus_tag="MRET_0303"
                     /codon_start=1
                     /product="dTMP kinase"
                     /protein_id="XP_027482480.1"
                     /db_xref="GeneID:38737069"
                     /translation="MAEFRIVIPFPGGNQVESDKGHGYHGILRLVNVQEDTPLPAPGA
                     RQGRPLAVFNHGLLADKNALFFQSLASELPIDSFRWDACGEGQTPGDWRYSKYNECAE
                     DLFHVVDYLHRRFGYFTDLMINHSKGCAVSAVYISRYCNPGPLYKHRSPSRVIFACGS
                     VDMSLQRRKDAEFQPFFDSYGYVPMRANVGDLIIERRIHPEDHASMRSFPAHIHYANI
                     PPHVQCFIAHGSNDEDVSVENLGILSNILMSQVGRPAGSVVTQIYEKADHNLSHGAMD
                     KFMDQVRSWLKKSEPPVLLSESIPIKNALNGKRGAFIVVEGLDRSGKSTQVARLVETL
                     EARHVKFPERTTSIGMMINSYLTNRCDINDQAVHLLFSANRWEMLSSILQTLQRGQHV
                     VCDRYAFSGMAYSHAKGLDLSWCISPDVGMPLPDITLFLDLDETTATKRAAYGEERYE
                     KKAFQSLVREAFQNIALLMERSGARWERIDASGSPDEVWQAVHTRVQNAIADAQTSEH
                     LRSLHFCFAALGMGMLHQIKTTATF"
     gene            <507611..>508432
                     /locus_tag="MRET_0304"
                     /note="MRES_02155"
                     /db_xref="GeneID:38737070"
     mRNA            join(<507611..507668,507694..507791,507824..>508432)
                     /locus_tag="MRET_0304"
                     /product="U1 snRNP splicing complex subunit Luc7"
                     /transcript_id="XM_027626931.1"
                     /db_xref="GeneID:38737070"
     CDS             join(507611..507668,507694..507791,507824..508432)
                     /locus_tag="MRET_0304"
                     /codon_start=1
                     /product="U1 snRNP splicing complex subunit Luc7"
                     /protein_id="XP_027482485.1"
                     /db_xref="GeneID:38737070"
                     /translation="MGRKAELQRIALERLMGPEVMGTVDKDVHFTDPKVCRNFLCGTC
                     PHDLFSNTKMDLGPCPKSHLPRYKELYDAAVERGETFPVIVGDFQRNIQMFVGDIDRK
                     IAANRRRLEQTPEEMERYNSMMRDINEVEEAITAATNEMESLGEQGRVEESLKELEKV
                     EALKMERSDKEKELQTLQENSGASGHQKLRVCDICGAYLSILDSDRRLADHFSGKMHM
                     GYQRLRDLFRDMQSERRSTEQNPLRDRYRSRSPPTR"
     gene            <508842..>509741
                     /locus_tag="MRET_0305"
                     /db_xref="GeneID:38737071"
     mRNA            <508842..>509741
                     /locus_tag="MRET_0305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626932.1"
                     /db_xref="GeneID:38737071"
     CDS             508842..509741
                     /locus_tag="MRET_0305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482486.1"
                     /db_xref="GeneID:38737071"
                     /translation="MNLDEMDHEALSTPQKSPSLLSRKKLSFELHDVFSAIDKNDVDK
                     IMAIRDARFELLLGSKADEPGTRACTPLEYAIGLGPKHERICLFIVGALSRYVNHLPE
                     DKPLDLTQKDMLRKVRSNLKLAMDQSLFKDDTSLVASYLQVLVMSEGNAWLEHAIKTV
                     RYELKTWLSGPQRHGGIEAQPLSVAHESIENFLTTHMRIRRKKEHVVVAAVDDYVANA
                     SSDLLLLALWSLLPEHDELPLYAFARDDRCTALFCDEVSRKAPSSSLRVARVAMSIVE
                     ALHDGLHSHTSRERWSILQRIIK"
     gene            complement(<509752..>512820)
                     /locus_tag="MRET_0306"
                     /note="MRES_02150"
                     /db_xref="GeneID:38737072"
     mRNA            complement(<509752..>512820)
                     /locus_tag="MRET_0306"
                     /product="inositol polyphosphate phosphatase"
                     /transcript_id="XM_027626933.1"
                     /db_xref="GeneID:38737072"
     CDS             complement(509752..512820)
                     /locus_tag="MRET_0306"
                     /codon_start=1
                     /product="inositol polyphosphate phosphatase"
                     /protein_id="XP_027482483.1"
                     /db_xref="GeneID:38737072"
                     /translation="MGSKAPDLPKRPLPSPEPHRHAVHELGSPPRHHLAQPKPIPAQS
                     AQLHSSADAYRSFQTPPPQQMHMVSHVPMSSGLSGGASPQRLSPMPQPTSVSVPKVSL
                     PSASPPGITSPHHIEMPPRPTMMPTQQMASQLKPQVTSPHDIPRLLQPPIDVPTHHTP
                     DVKYPQAYTSPNSAGLSPNIHAFSGSAAVASVPLTEATPSISSAHSAERGDPAASSEE
                     EDDMTNELGDLHLTSHDLPDMSYVNRVPPALDPPRSVPFSTPITTGALFGEKLVVASQ
                     DKIRVLVVRRGAQFHTDTPEQSSEVIVPQTAEHYAWLDSPSNLSPTSRDLRATTLAFC
                     PSVQVGNELVPEGRIVWYGTPTGHIGELDTLTGKITALRINVHKSPICHVARIGKAMV
                     CIDESGKISTWVPRLSPLHLPSTTPETIRITIPKNTYCSVEGSLLWLCTPTLVTKSAP
                     KHTQKVLSVRCFSPVSDTRPFNVMSQAGQWPMSGPDGGGAVTCSASLPTTPGLVYFGH
                     ESGHISVWNEQGECLEHILVSSSPIMSMTGVLNAIWSGTRDGRMIVHLANSQHLRMVK
                     LWQAHRDNIFSLLFDGYSINTQAPEIMACSLSTDNYATFWDATLSKDWINAEVSSKAD
                     LYSTSSSLRALVMSFNLDAAAPADLFGMVDNMDLFQRILRSSCSTTQNPDGSSFQVPP
                     DVIVFSFQELVDLEDKRQTAKRFLLGGSKQRRGTGKESAEERERLPSRYRAWLDKLVA
                     YVRLVMPPESPFSVLLTENLVGLFTCIFVRSDLLPRIRLPGSYAVKTGLGGRYGNKGA
                     LLTRFVLDDTSLCFINCHLAAGQRNVRRRNLDVADILQSSNQTLTSNDLAFALGSDGS
                     MAMDHEICLLAGDLNYRLDLSRDTAMTLIEQNRFSDLFAADQLQLEIRSNPQFGLRHF
                     LEAPICFAPTYKFNRLTNDYDSSDKARVPAYCDRILYRSRTGNMVQCTSYKRWDATVS
                     DHRPVSATFSMRVKSIDRNAWKLVADRSVAEFLHYRAQLLRTTSEYFHCI"
     gene            <512960..>513787
                     /locus_tag="MRET_0307"
                     /note="MRES_02145"
                     /db_xref="GeneID:38737073"
     mRNA            <512960..>513787
                     /locus_tag="MRET_0307"
                     /product="protein N-lysine methyltransferase METTL21A"
                     /transcript_id="XM_027626934.1"
                     /db_xref="GeneID:38737073"
     CDS             512960..513787
                     /locus_tag="MRET_0307"
                     /codon_start=1
                     /product="protein N-lysine methyltransferase METTL21A"
                     /protein_id="XP_027482484.1"
                     /db_xref="GeneID:38737073"
                     /translation="MSATLSLFGVHEDDLPMSPDLEPTEDIVPEQIPSILDQRACIVY
                     STAPDVEPRVVSTRDLESDTQAQQEYRIHLRLDMTNGCGGKIWPAAEVLGAYIASMPS
                     RYAPHATDLALAQHPWRGKTVVELGSGTGLIGFLVAKIGVGCKTWITDQVPMLPLMEE
                     NVTLNPDMVDACHVAELNWGETIPENVPSKPDVILLADCVYREEAFQPLVDTLCMLST
                     PSTEILFCYHKRRRADKRFFQLLKHHFTYENVNDDDERRRRAYQTSGTFLMRFTKRA"
     gene            complement(<513784..>516171)
                     /locus_tag="MRET_0308"
                     /note="MRES_02140"
                     /db_xref="GeneID:38737074"
     mRNA            complement(<513784..>516171)
                     /locus_tag="MRET_0308"
                     /product="cysteinyl-tRNA synthetase"
                     /transcript_id="XM_027626935.1"
                     /db_xref="GeneID:38737074"
     CDS             complement(513784..516171)
                     /locus_tag="MRET_0308"
                     /codon_start=1
                     /product="cysteinyl-tRNA synthetase"
                     /protein_id="XP_027482477.1"
                     /db_xref="GeneID:38737074"
                     /translation="MSSASEDRVWKMPEPKEPAPQLHVYNSLTRSKELFVPQRGRLVT
                     WYNCGPTVYDASHMGHARNYVAQDVIRRIMRDYLGYDVHFVMNVTDIDDKIIVRGRQE
                     YLLQQFQAQHPHLTPALLNIVQTAWSQFFSHTLMPLTPPAPSHEEASDPQAAERSRAG
                     EGGWEQIVRMAQDPKWREEAAQRMPKFHMWFATLQASRDAQVAAAVSLGAGDASEAQA
                     RALISASSDVLSEHLDGTLAHTVNDPAIFRKLAAYWEAAFFQDMKRLHVEPPSMLTRV
                     SEYVPEIVQFIERIIENGFAYVDDAASESKNVWFATSHFDGGACGAEHHTYAKLAPWS
                     KGNSELLEEGEGSLAAKGKRHAADFALWKRAKPGEPSWPSPWGPGRPGWHIECSVMAS
                     QVLGKQIDIHSGGIDLTFPHHDNELAQSEAFHGCTQWINYFLHTGHLHIEGLKMSKSL
                     KNFISIDEALKRYTARQLRLAFLMHPWHAKMDFRESSMAEVRSVETTLNNFFSVVTAL
                     ERESRAKGEAFSDGQHHYGPGAQHLNAALQDTQAAFRLAMCDNFDTPRGIEVLLELVS
                     RANVYERGTSRDDLNVCVLVNVSQYVARMLRMLGLGEGPTREGDLSWGTVAAKDGAVD
                     RNEVVAPFVRVLSSFRDRVRQLARSNASGADLLQLADTIRDVELADLGVALDDQENGQ
                     ALFKFVPAEQLRAQRAEKERMIAEKAARKAAAAEAARVKRREQLERGRIAPQDMFRAP
                     HTNQYTAWDQQGIPTQDEQGEALGKKRRKNLEKEYERQLKLHADYLAAREANEID"
     gene            <516338..>518242
                     /locus_tag="MRET_0309"
                     /note="MRES_02135"
                     /db_xref="GeneID:38737075"
     mRNA            <516338..>518242
                     /locus_tag="MRET_0309"
                     /product="vacuolar protein sorting-associated protein 33"
                     /transcript_id="XM_027626936.1"
                     /db_xref="GeneID:38737075"
     CDS             516338..518242
                     /locus_tag="MRET_0309"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 33"
                     /protein_id="XP_027482478.1"
                     /db_xref="GeneID:38737075"
                     /translation="MVAVPADGAGDSSGWDGIDVVPLVQLAQNQLESILRLMPDSKTL
                     FIDPTLAGPLGLMADLAALRQRGVERMFWMEETPASVTAVHIHASTKHLLYLCRPDTR
                     WLRTILAHYTADKAEGDLQHEYTVAFVPHRTEPCVQFLRTHHCLDSIQLLDLGLEFSV
                     LSQDVLSLEDPFAWPRIFLQGDHTSLFHAAQALITLQRMWGLFPRIVGKGDWANRLCD
                     LLVRQRQEALVSDEDPAALKTPAPDIDALIVLDRMVDLATPMLTQLTYEGLIDEVMGM
                     SSGFLEVDASWVGAAQSAGTGAHRKIRLNGAQDALFDSVRDDNFAVVGEKLHAAAKQL
                     SSDYEGRHQANTVQELRAFVNRLGTLQSGHSSLRLHTCITEHLLQTTNTDHFHFLLEV
                     QQNLVAGAPIAPLLQAIDELVDLGAPFLDIIRVACLASYIHGGLKATWLDSFRTTVVH
                     AFGSVCLPQLIALERMRILYPAPPSSVKVPRVSKFTNVLKPLRLIDDDVNERAPSDVG
                     YVYSGYAPLSVRLVQTICQHEQTLRERQKNPHVYPQAARIAGWHGVDETVLQLPGATF
                     DFIPTDMIEAPPMADDKIRTTVIFFVGGVTYAEIAALRLMSRQQRTRRFLIATTSIMN
                     GNKMLKDLYV"
     gene            complement(<518252..>518842)
                     /locus_tag="MRET_0310"
                     /note="MRES_02130"
                     /db_xref="GeneID:38737076"
     mRNA            complement(<518252..>518842)
                     /locus_tag="MRET_0310"
                     /product="component of cytosolic iron-sulfur protein
                     assembly"
                     /transcript_id="XM_027626937.1"
                     /db_xref="GeneID:38737076"
     CDS             complement(518252..518842)
                     /locus_tag="MRET_0310"
                     /codon_start=1
                     /product="component of cytosolic iron-sulfur protein
                     assembly"
                     /protein_id="XP_027483244.1"
                     /db_xref="GeneID:38737076"
                     /translation="MNFGSTELENANPIVYDIRAPTLRGPSYSDSPDSWWKCDGLRPN
                     STLFTDAQEEWEEQEEGEPIDAREVFDLVRSVTDPEHPLTLEQLAVVNEEHITVDTGN
                     ENTSPSVVLEFTPTIPHCSMATLIGLSLRVRLLRALPTHYKLGVLIRPGTHQSAGTIN
                     KQLSDKERVAAAVENKYLMGVIQGCLSTAGLRGVPA"
     gene            complement(<519034..>522375)
                     /locus_tag="MRET_0311"
                     /note="MRES_02125"
                     /db_xref="GeneID:38737077"
     mRNA            complement(<519034..>522375)
                     /locus_tag="MRET_0311"
                     /product="transcriptional enhancer factor"
                     /transcript_id="XM_027626938.1"
                     /db_xref="GeneID:38737077"
     CDS             complement(519034..522375)
                     /locus_tag="MRET_0311"
                     /codon_start=1
                     /product="transcriptional enhancer factor"
                     /protein_id="XP_027483243.1"
                     /db_xref="GeneID:38737077"
                     /translation="MFFYPGAQPLSTPSSASTPTAPTGAGTATGGDDMPRHYVGPARG
                     PPAVPTSMGAEPTLSTPMRHSLSENTLDGASMSPTLLWQMQMGHAVNLSSSLGSRPVL
                     APPSSDSKRRRMSASQFTSPIHMPPTAGHDPHHGSPFGGMVPHATPHHPGAIFYPPSM
                     VSLSTPDSPSSSPTMDPSMRGLSITPSNNLSPLAHRTLRAASTSAASPSGGMHPSALP
                     TSSIHESPVMRRANSYNSVGSPWTHPENLYMFNMAQNLSPTTAPAPMAPPMSAPVQMQ
                     RHFSSPQPRTVRERASRQSSTDVWPDDVEVAFWEALRLIPKLGRRKVLVHGKPCGRNE
                     LIADYIERKTGKTRSRKQVSSHIQVLKNVKRNDMEFQQLISEPTSEEDYYTPAGGMMY
                     SHALSEYSVGLLGFSLASSESAASPMTSTISPALSSPLPYTHSPMQSPASGMISKALD
                     NLHVSHSPCANDIRSLSPRGPTVTSSFLSTSSLAQRPSRATQTLSSLQPMPVLIPTAF
                     SMWTYSTKTDERHTYSKLDALAMSRTLHSGGEISIMPCNDAAMTSFRFPQLADMYKRM
                     DCPFVHVHVPMSLPRSDASNAQFDRMGVALSMASTKDTPLTSVLSIYSHGKCILSMAD
                     RLEAPRVLARARSDSTRSSAQPADNTQPPSPESSPKKQSSAFSDSDAGFSWAYQVPFA
                     TDFWADFLSRNHPVHIYGSDGMVPVASYCKEPSERASVGMALIGLAFVQEFVIPRSDV
                     ATSVPHVPLTSESPGAQLGNIIGVVAWDFECVESLGREPGTPVVSVVGPDTRANVPNT
                     PQKPTLHRGPTSSLHARNDAPGAKKGLLGLQIHEPASEAEPLSVSTSQDATNTEASCI
                     SAPTVPDPALLRPNTPPQPLPTLIRTQASPQTETNPVKVENKSDAITPKSRSTSTSAL
                     SSSGPMASLQVLDRSLSSGTDTISMTASLSASPTTMSPYDADAPLTSLSVRPPNLDIS
                     DAFRQKDGLPDGMTTTLSPAASHTDLLSNHHMSSSPSSLLTPTRSLTTSSLPVPLRSH
                     SMSVLDDQALRHHIQDQHVTTQSLSPPASSPSLLPDAIPSYLDPTDVGGRLGLSAHVQ
                     WNTQQDLMDAFLNSSMMEPSGVPPC"
     gene            complement(<522933..>524291)
                     /locus_tag="MRET_0312"
                     /note="MRES_02120"
                     /db_xref="GeneID:38737078"
     mRNA            complement(<522933..>524291)
                     /locus_tag="MRET_0312"
                     /product="ribonucleases P/MRP protein subunit RPP40"
                     /transcript_id="XM_027626939.1"
                     /db_xref="GeneID:38737078"
     CDS             complement(522933..524291)
                     /locus_tag="MRET_0312"
                     /codon_start=1
                     /product="ribonucleases P/MRP protein subunit RPP40"
                     /protein_id="XP_027483246.1"
                     /db_xref="GeneID:38737078"
                     /translation="MVAHSTHKRKRSAIRADHARSHRLGRLHASLYTWSEESREELKE
                     AIPRHPFNFALQVIAPHTTEDHDVVRALRDAVKDAGPGPCIAQVSLSLFLEPRFVAQY
                     VRTGSLYALSTTCLDTQDTVCLDGRGMLVLSLLKDTYQQLGLVGRPCRFAHGASGRMG
                     DRQSGPVSRYMVELPLCDPSFVPGKRGYERALRCLRAWDLRRSAAGTASHTHGTPATW
                     SMLLVWTPPASPNAQRPRVWAPVEYDALRSVRHLSPDVCLDIHSDVWVPASVDICQDT
                     MQDMWSSLHAHLEWLGLAMWPSPRLRTYDRCDHRIAMYEPPAPSSPSSFVQMTVRGFL
                     TPMLLVRVLECLWASSLPWASLTVSGFADAPIAWASKYPGVGLALGSATALPEGMHDG
                     LNAAQRARKVRRKSHTRRGESEHGFFQTGENGWTILLSPPSRKREGAVALIESVELDT
                     HM"
     gene            <524494..>526170
                     /locus_tag="MRET_0313"
                     /note="MRES_02115"
                     /db_xref="GeneID:38737079"
     mRNA            <524494..>526170
                     /locus_tag="MRET_0313"
                     /product="sphingolipid long chain base-responsive protein"
                     /transcript_id="XM_027626940.1"
                     /db_xref="GeneID:38737079"
     CDS             524494..526170
                     /locus_tag="MRET_0313"
                     /codon_start=1
                     /product="sphingolipid long chain base-responsive protein"
                     /protein_id="XP_027483245.1"
                     /db_xref="GeneID:38737079"
                     /translation="MSLFRKAQSAVAHNSMIPSLGNNDLKLLQDLIHAEKSFVASNAK
                     TANELKYTCDALRAWGSNEGDDLEDILPKVALLFEHLSRAENRYNYYVSTMRLHLKSI
                     RSREEKFAEFKARRRALVTKIDGMERKLARMGPENKDLAKVTSSLRELRSDMDVLNNE
                     IAHEYATLGDYKRRAIVEALHLKSSGLMELAEKAIVIAESTRRLADEVPLTPTNPNEE
                     RAPYRNEARTNRVLSEAVRQLDHIRFEPHDAPLAVDPTEPSPSSPMPTHPRYDMPEAN
                     ETAAVVDTNGQRVAVIQDTERGSQGWVAPPEADISAETTFPQATWSRPPTMGLATVPE
                     SIDGVDEVQEAEGVRAPEQVIMPPEPSYYGYHEPPPADERDTSGMQRMLTDSGLNHVS
                     DAIPSFPPMPAPHPPPPAGPTSSVYTYDRMPTHAAPQADAYAAYPQVPNAYVAESTYQ
                     APLTNGASMQPMPAMSPHDAESYSQPTPSATYAPVARSEPMVTQPQSATGAAPSLSPS
                     VYQAPFAQAAYQAPPPSYLQQNAPSGYVLPPPSHTGASVIAPPSPRYPSM"
     gene            complement(<526244..>527053)
                     /locus_tag="MRET_0314"
                     /note="MRES_02110"
                     /db_xref="GeneID:38737080"
     mRNA            complement(<526244..>527053)
                     /locus_tag="MRET_0314"
                     /product="precorrin-2 dehydrogenase/sirohydrochlorin
                     ferrochelatase"
                     /transcript_id="XM_027626941.1"
                     /db_xref="GeneID:38737080"
     CDS             complement(526244..527053)
                     /locus_tag="MRET_0314"
                     /codon_start=1
                     /product="precorrin-2 dehydrogenase/sirohydrochlorin
                     ferrochelatase"
                     /protein_id="XP_027483247.1"
                     /db_xref="GeneID:38737080"
                     /translation="MTPTPVATPGGGLCVAWQVRGKPVLLVGGGEVAASRIVHLKHAD
                     AHITVLAPQDALHPDVAAWIQQGVVQHYIPGLYTQTDQLVREDGSDYAMVLTAIDDAE
                     KSREICKWCRSRRIPVNVADVPPECDFYFGSMIRRGPLQVMVSTGGQGPRLARKLRQC
                     IEATIPESAGHALSRVGVLRAKLRQVSPEPALSAARMDWMSRICDAFPLEELARLDDA
                     TMDRWVQHHWPRRSVPASKGRRCTVHLMTRDVVSCIIGGIIGLYISSRLRK"
     gene            <527080..>529590
                     /locus_tag="MRET_0315"
                     /note="MRES_02105"
                     /db_xref="GeneID:38737081"
     mRNA            <527080..>529590
                     /locus_tag="MRET_0315"
                     /product="telomere length regulation protein"
                     /transcript_id="XM_027626942.1"
                     /db_xref="GeneID:38737081"
     CDS             527080..529590
                     /locus_tag="MRET_0315"
                     /codon_start=1
                     /product="telomere length regulation protein"
                     /protein_id="XP_027482600.1"
                     /db_xref="GeneID:38737081"
                     /translation="MTWPGRLTAATEWEQVLEAILPPLALVDALPQAYASYAELAPRD
                     KEDDGWWGACQHTLLTETLVTWAPILQEHALYEPVLNGWFVPPASARVWPHTLHTCSA
                     LLSGSIQCHASTLDAVAHILTRFHAPLVLLRTLEAVRAEPHMARRDLMWSDAVAQIAA
                     LPTRVANTFGPLDHALLDVYKPWLLQLMCACPDVLPNEAERIAVLITRLSRIGVVERM
                     WDAILPHAQARAWRSVLGLCDAPTQEALITSLVRTMQTRLLPSQYAWPVAHDELTPGT
                     EGRAFLSHDAWRWGFTAYDTLHTIAAEVLDRLHVLLHVVNTPLMAMAAASWAMEKEAA
                     ITLEGLVQWWSDPRRIRYATYPLEQCVTTQVLTAIRHSDATTLGAHAHSPMFLRGVSS
                     HLEHTDARIRRLGMLIAEVLSQATNPKPLAFPEQVWEGRGDGRGACRVLRAMYLREMW
                     WPDEPPYPWPTEPVWPVYPPPRTMSPPPRRRPLVQDLDASSDSETSTHDDPNDTSTML
                     GDALQKKTRVPVYVHELAPLARQRDYEANKCVIKHAEALIRRKTGWGHEIAEHGTDLA
                     MALASMQDTYDLEAFDERRTRALSALCIAAPMPVVDTLYEQFFTPHYSLAQRLSMLRA
                     VASAAVEMSGSRACTADTLAEAAVQRTTAAGEARISKAHAMARVSLPFAPPWSVRPTA
                     PYTAVATDTFIYPLIRRLDRARQETSRMYAGSDTALVPGATSALLHTLCVLCYHARNA
                     AFFMTRVLPDILEVIEVWGSDAHADVGTAAMSLAIVVLDMATEADGGAHLARSHSAQL
                     LRIQTMAHASADVSQQAAAVVLCIADMQERMHQALLAK"
     gene            complement(<529609..>530916)
                     /locus_tag="MRET_0316"
                     /note="MRES_02100"
                     /db_xref="GeneID:38737082"
     mRNA            complement(<529609..>530916)
                     /locus_tag="MRET_0316"
                     /product="transcriptional regulator CBF1"
                     /transcript_id="XM_027626943.1"
                     /db_xref="GeneID:38737082"
     CDS             complement(529609..530916)
                     /locus_tag="MRET_0316"
                     /codon_start=1
                     /product="transcriptional regulator CBF1"
                     /protein_id="XP_027483249.1"
                     /db_xref="GeneID:38737082"
                     /translation="MAQPTGAGHPAPTEAPHAYVDQSAAYTEATNPTHESTDAAGARS
                     TDSGAGAGQSGIEKDVGTILAGLNQEQLESIVAAARATDSSDHHGYGSNQYDTANVLA
                     HLPPGLGQAASTLTSFASSFKRTNPPVIPSEEEITGTAALSEPPSHHHLGDAPPPPGM
                     EHDMQHDRHVHSQAHKSAASAAHDSAATAAALAAMGTLAGRQLPAHSQAHALGERDGG
                     ALGTDPSMDAKFVNDHSLNSAQYKRKGPELDRQRKDNHKEVERRRRSAINDGIVQLSQ
                     IVPGCDVKNTNKGSIIVAAVRYIQDLKNNEASNIEKWTLEKLLMDQAMNDLSMSLDES
                     RREVERLRAQLGMAEAHRSGDKSAAGNAANGTHYAGGAPHQRFPPPQQAFQGESSEGT
                     DLGVSLDQSHVGHGAPTATGLEHANMLGSHALDTEANKRARLV"
     gene            <531270..>531794
                     /locus_tag="MRET_0317"
                     /note="MRES_02095"
                     /db_xref="GeneID:38737083"
     mRNA            join(<531270..531272,531315..>531794)
                     /locus_tag="MRET_0317"
                     /product="translation initiation factor 5A"
                     /transcript_id="XM_027626944.1"
                     /db_xref="GeneID:38737083"
     CDS             join(531270..531272,531315..531794)
                     /locus_tag="MRET_0317"
                     /codon_start=1
                     /product="translation initiation factor 5A"
                     /protein_id="XP_027483248.1"
                     /db_xref="GeneID:38737083"
                     /translation="MSDNEAENVNFETAHAGASVTYPQQCSALRKNGHVVIKGRPCKI
                     VDMSTSKTGKHGHAKVHLVATDIFTGRKYEDISPSTHNMDVPNVTRREYQLINIDDGY
                     LNLMSNDGSSKDDVKVPEGELGDQITNDFEDGKDLMVTIVSAMEEEHCLAYKEAPQGK
                     "
     gene            complement(<531918..>533867)
                     /locus_tag="MRET_0318"
                     /note="MRES_02090"
                     /db_xref="GeneID:38737084"
     mRNA            complement(<531918..>533867)
                     /locus_tag="MRET_0318"
                     /product="chitin synthase"
                     /transcript_id="XM_027626945.1"
                     /db_xref="GeneID:38737084"
     CDS             complement(531918..533867)
                     /locus_tag="MRET_0318"
                     /codon_start=1
                     /product="chitin synthase"
                     /protein_id="XP_027483242.1"
                     /db_xref="GeneID:38737084"
                     /translation="MSNLPELPSGFGRDSAYPPMPTRHTDHGAKKHQSAAPRPAFMVS
                     PPNDLTGVGGGMPRSSSHNDILQADAPVAVLNSDTSANTNIPGTSRILRRPRSFQPLA
                     PETVAAPTIQPVPAPIASPPPQQEPIVQRQAAHEVQHRARSRVEAQAQARDAQVHEAG
                     TRERHERGTQEVQAANTASLPTIRVSLPDTNSLREQRERTMSTNNELDKLRWSVQVLK
                     FVERMRASETETDESVQIWIEEAITEIVQCASHPQPKPEALYARGDLLASGAFPTYVS
                     KDLRSAFSDFERSARMGWAPSWFRIGRDYEMLGDIARARAAYGRGVNLSDVGCMYRIG
                     MAKMLGQLEVPEDMPGGASLLQAAADASTVDTPHPAYVYGLILTGELPSVPIPLEYFA
                     SPEHPSPTYETLMPLGREYLQRAAYLNLPAAQSKCGWCYEHAQLSFPFDPLMSVQYYS
                     AASQGGEPEADMALSKWFLCGAEGCFDKNESLAWTFAERAAKHRIPTAEFAMGYYLEV
                     GIGTKIDLVAARAWYARAAAQGNTDAAQRLAALESSQSEALSRAQHQAHLNERLYSAH
                     QEARKGLRETQPTRGDLARRRTLMMAEASAQRRRAPRDARAPPVTSQNLHIPSLPATA
                     RPMRAPQSFSDMGYQPRNDKDCVIC"
     gene            <534506..>535624
                     /locus_tag="MRET_0319"
                     /note="MRES_02085"
                     /db_xref="GeneID:38737085"
     mRNA            <534506..>535624
                     /locus_tag="MRET_0319"
                     /product="mitogen-activated protein kinase 1/3"
                     /transcript_id="XM_027626946.1"
                     /db_xref="GeneID:38737085"
     CDS             534506..535624
                     /locus_tag="MRET_0319"
                     /codon_start=1
                     /product="mitogen-activated protein kinase 1/3"
                     /protein_id="XP_027483241.1"
                     /db_xref="GeneID:38737085"
                     /translation="MSQSDANAPNGALPSYQPQMSVQAPRRDVSSGPLLGGSYKLVKK
                     IGEGAYGVVYSAIHVPTSTRVAVKRITPFDHQMFCLRTLREIRLLRHFHHENIISILD
                     ILPPASFEQFTDVYLVQELMETDLHRIIRTQDLSNDHFQYFVYQILRGLKALHSAGVL
                     HRDLKPSNLLLNANCDMKICDFGLARSAEQPEAENKAYLTEYVATRWYRAPEIMLSFK
                     EYTKAIDLWSVGCIFAEMLTGRPLFPGRDYHHQLSLILGVLGTPSLDDFYSITSSRSR
                     DYIRSLPYCDRANFAELFPRAEPLALDLLEKLLAFSPKKRITVEEALAHPYLEPYHDP
                     SDEPDADPLDPKFFDADFSKEPLTRAQLKELIYREITH"
     gene            complement(<535698..>541178)
                     /locus_tag="MRET_0320"
                     /note="MRES_02080"
                     /db_xref="GeneID:38737086"
     mRNA            complement(<535698..>541178)
                     /locus_tag="MRET_0320"
                     /product="chitin synthase"
                     /transcript_id="XM_027626947.1"
                     /db_xref="GeneID:38737086"
     CDS             complement(535698..541178)
                     /locus_tag="MRET_0320"
                     /codon_start=1
                     /product="chitin synthase"
                     /protein_id="XP_027482577.1"
                     /db_xref="GeneID:38737086"
                     /translation="MGTGEQDVDDGLVTQLCHRYYQGLYYTQIQESLLVVLNPFRPAI
                     DVNSEDILRAYRREFRNTRITQHHAPLPPHIFRLAHNAYFYMQRTGQDQCLFFLGETA
                     SGKTETRRLAAHALTGLGAALPGKRGARLSFQLPAALYALECMGRVVTDENDQASSMA
                     LYTELQFSQNGRLVGFKMLNYFLESARATVQWDTTSTFHVFHLLVHGASAEHARRWQI
                     MQDTSFRLLEHVHDAKSMQVNTDAKFSLWLDALSQLGITASQCDALLDVLAALLHLSN
                     IDFVQDDGPLCPARVASEEPLYIAAALLGVGASSLANALTHHTRAVNGQLCTALLDRE
                     HATKSRDRLMRMLYSQVFAWVNEHINSCFSHEHFDTYIGLMDLPGWRNRVRNNLDAMA
                     INFAFDLVHRHLTHVMCDRRIGEMDHEGLSHLAPLPSATDESSLLRLFTHFPGGLIHI
                     MDDQTRRRPRKNSRTMVDAMQRRWVNHRALKIDPPDHLGPQAFTVKHFHGHVTYDPHS
                     WLEQNDASYALEHVSLFRGSSHTRQSTFGSSNAFVRGLFRHVSQDAQTHPRPMRAPSG
                     KRLMRQRTLRAATSRNPDDDDNVYGSALQETAASASSDDGAPCVLGEFSASLNTLLDI
                     VDEAKAYFVFCVRPNANGLANQCEPRMVQRQVHAFDMSRFCSSRLNDYSVTLTFNEFC
                     DRYGILPAFESLHMLGAPAAESKMRVSDACAYMNWTDAHVTIGMHKVFLSHAVFRELE
                     DELRARDTEEMQYQLRKSQADDEDAKNQLIDPYSPYADMAAMNEILVNPHEEYTPPAA
                     YSSWGEYDDDETRGLMEGQLPDEELLDDAKDAGPGECAPPTGETVTERLQVSNERRLW
                     VATTWLLTFWIPSFVLKRFKWSKRSDVRMAWREKLAINMLIWFVCAASIFVIVFLGNV
                     ICPKEHLYSTGELSGHKGKDAFTAVRGEVFNLNGIIDAHLSMIPIISRKVLMQYAGQD
                     ATSIFPVQVNALCNGPNGPISQWVTMDSSNSTDPNAKYHDFRAYRATDVRPDWYYEQM
                     WYMRNRYRVGFIGYTPKEIEHMKEDGRTLGIYDKYIYDLTAYIGQGNQGGYRMPQGVA
                     PPPNLNRTILAQDVVDLMARNPGKDIKDQFDKLRLDSRVLDQQRVCLRNLFFIGKVDE
                     RNSPRCTFSKNLLLALSIVMVATVGFKFFAALQFVRSSPPEEHEKFVVCQVPCYTEGT
                     ESIRKTVNSIARLRYDDRRKLIFVICDGNIMGAGNDKPTPQLVLEMLGADPDAHSEPR
                     SFVSLGQGAKQHNMARVYSGLYEHAGHLVPYLVVVKCGTPQETARPGNRGKRDSQLVL
                     MRFFNKVHFGSPMSPLELEMYHHIKNIIGVNPSFYEYLLQVDADTEVESSALARLIAA
                     FVRDKKVIGLCGETAISNEYQSITTMLQVYEYYISHYLVKAFESLFGSITCLPGCFSM
                     FRFRTPDTQRPLLVSNAVVDDYAENRVDTLHLKNLLYLGEDRYLTTLVLKHFPDHKTQ
                     FVQHAKSLTLAPDSWKVLLSQRRRWINSTVHNLVELLKTPQLCGFCLFSMRFIVLIDL
                     LSTIIAPVTIGYLVYLVVVVAVDGGTIPMTSVILLVAIYGLQAVIFLLHRRFDMIGWM
                     IVYILGLPLWSLILPLYSFWHMDDFSWGNTRIVTGEHGEKLLVHQEGSFDAKEIPHRT
                     WEDYENELWTHRNTDEAPQVLREPSPTILSHDIASTMKAWPNVAEDATSLIDDAGGKY
                     ASGVSTMDESGLAWPDGDLPMQPTHTESAAREAPLDSRPAGRLPPNEIIRLDIRRIIA
                     SSDLTTITKRQLRAQLQDMYGCPIDEKKAYINTQIEAALRDM"
     gene            complement(<541344..>542244)
                     /locus_tag="MRET_0321"
                     /db_xref="GeneID:38737087"
     mRNA            complement(join(<541344..542206,542232..>542244))
                     /locus_tag="MRET_0321"
                     /product="zinc finger protein"
                     /transcript_id="XM_027626948.1"
                     /db_xref="GeneID:38737087"
     CDS             complement(join(541344..542206,542232..542244))
                     /locus_tag="MRET_0321"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_027482578.1"
                     /db_xref="GeneID:38737087"
                     /translation="MDLLELLESDCFGSSRPYKCTHAPCTKSFARRSDLQRHMRTHTQ
                     ERPYACPFAGCEKRFIQRSALSVHINVHTGERPFVCSECLKAFADTSSLARHRRTHSG
                     RRPYKCQVLGCEKEFCRRTTLTKHMQRVHPEEDHPMTPSSVLTFPHMPPMPPTTAIKN
                     VPGPPTSAPVSAPSMVPMLSFLPPPTTPVSNKSGTTLPPAMNTESCLPSSVQVHHRMS
                     VQVPTPAVPLTSSPSVGGSSMTASPYCWTSPLTSTFPHTPMSAPLYLPFQTASSSLPL
                     DEKQAPPRYPCLEYS"
     gene            complement(<542362..>543395)
                     /locus_tag="MRET_0322"
                     /db_xref="GeneID:38737088"
     mRNA            complement(join(<542362..542417,542442..543342,
                     543372..>543395))
                     /locus_tag="MRET_0322"
                     /product="serine/threonine-protein kinase
                     receptor-associated protein"
                     /transcript_id="XM_027626949.1"
                     /db_xref="GeneID:38737088"
     CDS             complement(join(542362..542417,542442..543342,
                     543372..543395))
                     /locus_tag="MRET_0322"
                     /codon_start=1
                     /product="serine/threonine-protein kinase
                     receptor-associated protein"
                     /protein_id="XP_027482579.1"
                     /db_xref="GeneID:38737088"
                     /translation="MTDPVPRKSVPLTCHGHTRPVVHLEYSERQDDGTFLLLSSCKDG
                     SPMLRDWVGDWVGTFLGHKGAVWSAKLNGGDAARAVTGSADFSAKVWDTYTGECLHTF
                     THGHIVRSVAVDSDATNVITGGNEKKLRLFDLQKPSTNADDAQLFRARFDNNATHEGL
                     IRSVVLGRGSSQNILVTASEDKLIQWWDLRTMEPVHDMILDEPFVSMERCVGAFGEYV
                     TVTAGHDAMFIDLATHEVVKRHTLDVPPSSIYLHPTTAHTFVAGSTADEWVRIYEYES
                     GKELDLNKGHHGPVHCVSYTPDGEAAASGSEDGTIRLWQTTPGKKYGLWS"
     gene            <543496..>544452
                     /locus_tag="MRET_0323"
                     /note="MRES_02075"
                     /db_xref="GeneID:38737089"
     mRNA            join(<543496..543585,543609..543672,543698..>544452)
                     /locus_tag="MRET_0323"
                     /product="cell cycle checkpoint protein"
                     /transcript_id="XM_027626950.1"
                     /db_xref="GeneID:38737089"
     CDS             join(543496..543585,543609..543672,543698..544452)
                     /locus_tag="MRET_0323"
                     /codon_start=1
                     /product="cell cycle checkpoint protein"
                     /protein_id="XP_027482580.1"
                     /db_xref="GeneID:38737089"
                     /translation="MSDPVGRVLSASIVDISALFQALVSLDSSINAKFTLSESGVEVV
                     TSSPVSQAHAYLYAGMFDVFDFHAPENWLEREQQRAPEPDADVTLQPCVSFELHMKKF
                     IEVINVLSTRKSMTKDQATMLIKYDGVGEPLYLALKHPGGGVAFEMRTLDMPIVADIP
                     FESDKTQAQLIMDSNTLLPYWREAVQNAKDTIHIAFYPSHGASKGRLELSTENEIGTS
                     DVVIPYDDAIMEKFTCHTPVRRRYQLTPTKAIGLSATFSNKTSLRVDVNGILSAQFMI
                     QRTVPVTVAHTDPQLFFVDHKICPLE"
     gene            complement(<544453..>545283)
                     /locus_tag="MRET_0324"
                     /note="MRES_02070"
                     /db_xref="GeneID:38737090"
     mRNA            complement(<544453..>545283)
                     /locus_tag="MRET_0324"
                     /product="SNARE domain protein"
                     /transcript_id="XM_027626951.1"
                     /db_xref="GeneID:38737090"
     CDS             complement(544453..545283)
                     /locus_tag="MRET_0324"
                     /codon_start=1
                     /product="SNARE domain protein"
                     /protein_id="XP_027482581.1"
                     /db_xref="GeneID:38737090"
                     /translation="MSTGDATAAAIVDLEIPEATQRFQSLWNSTFGMIQERNRLAHEL
                     ETSADTQDHAFLRTFPYFARNKSIMKHMCTLMQALDTWKKRASASDSRVPTMEQLDAW
                     TATVAQLLELLSETGQTMNDPHGSEMVQELRSKYPSALEARKKSEDHGSRLDLIQSMA
                     DIPTSRFSTSQGNYAEREASALFAQNEAWNDQERHLEQLNASISRQHNISLRMNEELE
                     LQTGIIGRLDTDVESTGLRLGGASTRLERFRESVKEHGSLWTIFVCIVILILLIAWVK
                     "
     gene            complement(<545359..>546442)
                     /locus_tag="MRET_0325"
                     /note="MRES_02065"
                     /db_xref="GeneID:38737091"
     mRNA            complement(join(<545359..545367,545396..546319,
                     546353..>546442))
                     /locus_tag="MRET_0325"
                     /product="DNA repair protein RAD51"
                     /transcript_id="XM_027626952.1"
                     /db_xref="GeneID:38737091"
     CDS             complement(join(545359..545367,545396..546319,
                     546353..546442))
                     /locus_tag="MRET_0325"
                     /codon_start=1
                     /product="DNA repair protein RAD51"
                     /protein_id="XP_027482509.1"
                     /db_xref="GeneID:38737091"
                     /translation="MASTEPVEAEPEYDEMEDDMMGPLPVSKMEEFGISAADCKKLKE
                     AGYHTLESVAFTPKKSLLLIKGMSEQKVDKILSEAAKLVPLGFTTATEYHQRRSDLIT
                     ITTGSPALDLVIGGGMETGSITELFGEFRTGKSQICHTLAVTCQLPVDMGGGEGKCMY
                     IDTESTFRPVRLLAVAERFGLDGQEVLDNVAYARAYNADHQLDLLVQAAAMMAESRFA
                     LLIVDSLTSLYRTDFSGRGELSARQTHLAKFLRTLMRLADEFGVAVVVTNQVVAQVDN
                     AGFGGMDTKKPIGGNIVAHASTTRLSLRKGRGNQRICRVVDSPSLPEAEAVFAIKPEG
                     IADPDD"
     gene            <546600..>547892
                     /locus_tag="MRET_0326"
                     /note="MRES_02060"
                     /db_xref="GeneID:38737092"
     mRNA            <546600..>547892
                     /locus_tag="MRET_0326"
                     /product="amino acid transporter"
                     /transcript_id="XM_027626953.1"
                     /db_xref="GeneID:38737092"
     CDS             546600..547892
                     /locus_tag="MRET_0326"
                     /codon_start=1
                     /product="amino acid transporter"
                     /protein_id="XP_027482583.1"
                     /db_xref="GeneID:38737092"
                     /translation="MHKASLSASISSLTNTIIGSGMLALPSAFATMGWFLGSFFILFC
                     AATTLFGLVLVKLSCDKIDKKASGFYDLMFRINPYKMWIIDLVIGVKCYGVTISYLII
                     GGTLMPQVVLSLSNSLGISSAQVPNILINKYFWYMVVVSCMIPICSVRHLKSLSMVGY
                     LNMMAVAYIVAIMTYFSLAPDSWHLLPMPGPVVAVKWGKEALRTFPIILFAYTCSQNI
                     IPVYNELYNSTLERTSIVTFTSVLSCAFVYLFVGLVGYFSFGAHVGNNVMAMYPDKGL
                     FVGLGKLCVVLLAITSYPMQLYPSRASLLSLSRSWSYKPTIRTNEDGTEVVPLLPEES
                     HSVVDSMSSLWFYGVTLAEILSGVLIALLIDDLSIVLGFVGALGSTTISFIVPAYVYC
                     MLHANDTTHWLYRASLALGVYGVVVLLLAFGANVYKLL"
     gene            complement(<547899..>548951)
                     /locus_tag="MRET_0327"
                     /note="MRES_02055"
                     /db_xref="GeneID:38737093"
     mRNA            complement(join(<547899..548011,548045..>548951))
                     /locus_tag="MRET_0327"
                     /product="ATP adenylyltransferase"
                     /transcript_id="XM_027626954.1"
                     /db_xref="GeneID:38737093"
     CDS             complement(join(547899..548011,548045..548951))
                     /locus_tag="MRET_0327"
                     /codon_start=1
                     /product="ATP adenylyltransferase"
                     /protein_id="XP_027482584.1"
                     /db_xref="GeneID:38737093"
                     /translation="MTAAKLQHIPQLVRQQYVAAIEAGDAFFFESDVRIVRGQNVQRP
                     VPWQIRIVPALLKKPKAPVSAEEEVRPKQNQVDVFAPPYVPNLLVKELDDFTVLLNKY
                     CVLPHHYLLVTRDFVSQEKPPSPSMLALVYSMITSHTPSSDGAELLGFFNCGPNSGAS
                     QPHCHFQLVELTPSENATKAVPIEHMLDTQSAPDEDKEEILGLAVPWRHFVARLEPPS
                     DPEKLENYFGKRFSHLLEAMFSLALEKNDENKGRPNFNVLLTRHFMHLIPRRNETFDM
                     KEAGWEEYGPGGHPPKYTGRLSINALGYAGLLLTRHASELDALYASSNDERIVQVLTH
                     TGVPL"
     gene            <550092..>551120
                     /locus_tag="MRET_0328"
                     /db_xref="GeneID:38737094"
     mRNA            <550092..>551120
                     /locus_tag="MRET_0328"
                     /product="ribonuclease P/MRP protein subunit RPP1"
                     /transcript_id="XM_027626955.1"
                     /db_xref="GeneID:38737094"
     CDS             550092..551120
                     /locus_tag="MRET_0328"
                     /codon_start=1
                     /product="ribonuclease P/MRP protein subunit RPP1"
                     /protein_id="XP_027482585.1"
                     /db_xref="GeneID:38737094"
                     /translation="MFCDLNVPWPTRDSPTVLNSKKSKKQPQKKAIAEDDNNIQEALD
                     LLTPSEKQRMSELTYELMEMGYTTLAFNHVVRSKYDPVSQKYPFGKSHCQPPFPKLDP
                     RTRKAHGIEAYRAGIKQLSRLTVVFDSDEAVKSGSGFVSANAQALQQYDLLSVTPTTE
                     AAFQHACITLSELKPFSIDIISLDLAAAPRLPFYLKRSTVGAALANGVVFEITYGAAV
                     ANTQDTPDVSAARRNLFAGARDLLRATNGKGVIISSSALDALGIRAPYDVMNLAALMG
                     MTPNAAKDAISTTCQSLMIRAETRQTFRGTVSKPYVLPAEHKPTSGIDESSKKRAKRK
                     LSNDDECM"
     gene            <551688..>552677
                     /locus_tag="MRET_0329"
                     /note="MRES_02050"
                     /db_xref="GeneID:38737095"
     mRNA            <551688..>552677
                     /locus_tag="MRET_0329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626956.1"
                     /db_xref="GeneID:38737095"
     CDS             551688..552677
                     /locus_tag="MRET_0329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482586.1"
                     /db_xref="GeneID:38737095"
                     /translation="MSNVIKKVFNTEKPEAEANKAQDAVNGAENNVHRGEGFLGDAKE
                     KLSNLVPHHHQNAQSAAAQAPQSATASQVPASASVSQGVPAESEAIRTQAQGVPASES
                     DAFGRSGMTQTTSVNSGVNVAAGNVDQDVQHLAPVTRHIHHRHEIEELLREREHHIHQ
                     HHIQHHVQPVLESEHLAEQIHSRVVPTTTIREVHANTDKDAALMRAVAGNPKDTFTQA
                     ATDRSVIDKGETVREIVHHHIHNIVQPIIERETHEYHRIRTTIPTTHITHEAPIVHES
                     TAHQPIRKDDFVKGGGVLTSTTRSIEDAGLLNLGSHQRTVEGEPYNGGAPFAQ"
     gene            <552894..>553492
                     /locus_tag="MRET_0330"
                     /db_xref="GeneID:38737096"
     mRNA            join(<552894..553004,553033..553110,553136..553282,
                     553307..>553492)
                     /locus_tag="MRET_0330"
                     /product="DASH complex subunit SPC19"
                     /transcript_id="XM_027626957.1"
                     /db_xref="GeneID:38737096"
     CDS             join(552894..553004,553033..553110,553136..553282,
                     553307..553492)
                     /locus_tag="MRET_0330"
                     /codon_start=1
                     /product="DASH complex subunit SPC19"
                     /protein_id="XP_027482541.1"
                     /db_xref="GeneID:38737096"
                     /translation="MAPNVPRQSVYFNPHASASQLQNIHACTGKIRSACATLSATNAS
                     MDIHTGDFRRLHQVLLNQRHFDLVSERDVRQAREHVAAEIAPFLRELIMRAEEVLARD
                     EREARALRSKATQELSKNESKSQLHTAGSDDELKSPSMAALVADYELDEQRRELELLR
                     KERLRLMERVQSL"
     gene            complement(<553511..>554252)
                     /locus_tag="MRET_0331"
                     /note="MRES_02045"
                     /db_xref="GeneID:38737097"
     mRNA            complement(join(<553511..554007,554035..554180,
                     554206..>554252))
                     /locus_tag="MRET_0331"
                     /product="acylpyruvate hydrolase"
                     /transcript_id="XM_027626958.1"
                     /db_xref="GeneID:38737097"
     CDS             complement(join(553511..554007,554035..554180,
                     554206..554252))
                     /locus_tag="MRET_0331"
                     /codon_start=1
                     /product="acylpyruvate hydrolase"
                     /protein_id="XP_027482540.1"
                     /db_xref="GeneID:38737097"
                     /translation="MSSLASFRTVGRKIVAIGRNFADHAKELNNAVPTEPFFFLKPTS
                     SYVESGHAIQVPQGVMVHHEVELAVVFGKSGRDITRTEADSYIGGYALAVDVTARNMQ
                     EKAKKSGLPWSAAKGFDTFTPISPLIPKAHIPDPHNVDLWLQVDGQLRQHGNTRDMIF
                     SIPELISHVSSIMTLEAGDVMLTGTPKGVGQMVDGQQIHAGLQLPTAPNTLAELKLHV
                     KNRAGGYAFQG"
     gene            complement(<554386..>554821)
                     /locus_tag="MRET_0332"
                     /db_xref="GeneID:38737098"
     mRNA            complement(join(<554386..554437,554467..554562,
                     554592..554721,554755..>554821))
                     /locus_tag="MRET_0332"
                     /product="mitochondrial pyruvate carrier 2"
                     /transcript_id="XM_027626959.1"
                     /db_xref="GeneID:38737098"
     CDS             complement(join(554386..554437,554467..554562,
                     554592..554721,554755..554821))
                     /locus_tag="MRET_0332"
                     /codon_start=1
                     /product="mitochondrial pyruvate carrier 2"
                     /protein_id="XP_027482539.1"
                     /db_xref="GeneID:38737098"
                     /translation="MASAAFGNRFRAFMNHPAGPKTVFFWAPMMKWGLVVAGLGDLAR
                     PADKLSASQNSALAVTGFIWVRYCFVITPVNYSLAAVNFFVGSTGLVQLLRIAYHRYT
                     HPEPLPSMSNKA"
     gene            <554984..>556369
                     /locus_tag="MRET_0333"
                     /note="MRES_02040"
                     /db_xref="GeneID:38737099"
     mRNA            <554984..>556369
                     /locus_tag="MRET_0333"
                     /product="pre-mRNA polyadenylation factor fip-1"
                     /transcript_id="XM_027626960.1"
                     /db_xref="GeneID:38737099"
     CDS             554984..556369
                     /locus_tag="MRET_0333"
                     /codon_start=1
                     /product="pre-mRNA polyadenylation factor fip-1"
                     /protein_id="XP_027482538.1"
                     /db_xref="GeneID:38737099"
                     /translation="MSQASEAPTIDDEDEFLYGSSNTEPGTGAIPSTQSELPTVESAV
                     DAKDSNDEDQYDSDDSDVEFIIDPNAPLVAPPPRVSTTFAPATISTPPPKPAQTVAEG
                     AAQTSTSVPPAATNIAEDVPYQPPPQPAQSQAVDEASLGPEGPPPAAPSTGPHLNLDP
                     SASDLYYPPSDGLYDARTEAQKAQDLPPMTIYQVDIDSLPEKPWRRPGANLSDWFNYG
                     FDERSWSLWCGKRHEMEQMREDLQPLNASESAGAPVLPPGFSGGMPDFSALLGGGMLP
                     PVPPPMQAWMNGMMPGGADAPSPVPIPVQPPMTLPEKNAAADDIDDDDEAPYEPQMPP
                     EESAEAPARQESSRRHRQRSRQDRERQQDEQVRYTDRDMVHGMGDTLDYGLHTGDTRR
                     HGRHEATPGEEHHADHGRHHRPSRRERARQERRSGRGGQKRGAPDGPHEDHEREHVPK
                     RAHHGRSRRET"
     gene            complement(<556366..>558078)
                     /locus_tag="MRET_0334"
                     /note="MRES_02035"
                     /db_xref="GeneID:38737100"
     mRNA            complement(<556366..>558078)
                     /locus_tag="MRET_0334"
                     /product="protein ATG11"
                     /transcript_id="XM_027626961.1"
                     /db_xref="GeneID:38737100"
     CDS             complement(556366..558078)
                     /locus_tag="MRET_0334"
                     /codon_start=1
                     /product="protein ATG11"
                     /protein_id="XP_027482537.1"
                     /db_xref="GeneID:38737100"
                     /translation="MRLIVTYNGRAIDVKQSLSQFPIYEHLLDCISLATGILYDALIC
                     ITKDGLQIDQQVLDQLLCQDQDADTEIFIFDRDLLTSDTDSMVQMLAVSIENTPMTEP
                     PMMLMGSTTPPRLWDAFKSWCHELQQHIRATYAEAESLYENIELIHRSTLVALAHVRL
                     HASNIKSAAEKLASIALRDFAWMEELLVRNEKDMAILRRVPVHPQLLTSKSASTTTES
                     TSSSVVRSTLSDLFDTERVRQSAQSCEHTFERLRKSYTQITQTEAQLNQDLHELAAEI
                     EQTEIEPSNKTFQHMKKLQRELQDDCDAFVIENEKAGFRKPAEWLQIHHRAEVLRGQG
                     AAVLSTLDCLAQDRNELMQWHMNLVQDISSLQSDFSELGELMADTDTALEACVQNDFK
                     VLNQVHTIYGAYGATLVEAVRRSEFTQMYLNKAQRIAELMAKVSEKETLRRKRHTQII
                     SDAFPHNAISIETPLPLFDITTRRHDAAPTITRRDEADFRAHLKALDSEAREAHLHPA
                     LEAAVLAYMAPLDLEPGDCDASFAAMARHELGLEEALSYDAGDDDDEEDEDDDDESIK
                     YRPT"
     gene            <558219..>559244
                     /locus_tag="MRET_0335"
                     /note="MRES_02030"
                     /db_xref="GeneID:38737101"
     mRNA            <558219..>559244
                     /locus_tag="MRET_0335"
                     /product="large subunit ribosomal protein L35"
                     /transcript_id="XM_027626962.1"
                     /db_xref="GeneID:38737101"
     CDS             558219..559244
                     /locus_tag="MRET_0335"
                     /codon_start=1
                     /product="large subunit ribosomal protein L35"
                     /protein_id="XP_027482536.1"
                     /db_xref="GeneID:38737101"
                     /translation="MTYFRRSCWQRAVPSCVRMQSTHAWKPVLKPGTLPVYDEALKFI
                     EQDAASLREQIAQAKQAGSASSEEAKRRIFALEVAAGINEPSVRAQFRRGDYDLSRPV
                     FRHLREQSWRRNGALARLEERILNMHILPDVVPSITPTVDLEILFGAGDGIGDHGGQA
                     GSVLPGVFLDPAMTMQAPSIRATAFHEDTRKYTLMLVDPDMPNEETQSFKTFVHWLVS
                     DIPLSIHASTIPKDHPELLPYIPPHPSRGTPYHRYTTLLFEQGPQTQLVEVPRELENV
                     TSFAETHDLHLAGIHFWRAKWSESCQDTISHIYKNVLNMPEPHYGRPARQDRLRDEVG
                     ERLSKYY"
     gene            complement(<559241..>560851)
                     /locus_tag="MRET_0336"
                     /note="MRES_02025"
                     /db_xref="GeneID:38737102"
     mRNA            complement(<559241..>560851)
                     /locus_tag="MRET_0336"
                     /product="mitochondrial transcription factor MTF1"
                     /transcript_id="XM_027626963.1"
                     /db_xref="GeneID:38737102"
     CDS             complement(559241..560851)
                     /locus_tag="MRET_0336"
                     /codon_start=1
                     /product="mitochondrial transcription factor MTF1"
                     /protein_id="XP_027482535.1"
                     /db_xref="GeneID:38737102"
                     /translation="MSAMPLRTLHTFRLPYLLKKRIQIPTHTFGNMIRSASSESVPVT
                     SAPRKRRGRPKLSDKLTGASKNPVGTYQHKTIETPEKSTTLDETSNVLPERPKRTVTS
                     QAGSSAIPKSSTLTRRRKMQDHFLYTEEPLYTYNPPLNSEDIAFCHPHLPHPSMWKSM
                     FAFNRDQLAQNRYFVANRGTVDRIIDCLGLNERESQGIKTTIVDAYSGPGTFTRAFMQ
                     HPNVESVIAIDQAPRFLKYLEHLYHDPALSEVQHKLSIVHDSAFNWSSYESLVNDGHL
                     RHLEGRIPKLGSNPPPMDWHATSPIIYFAQLPNTVHGEQLFAQIVHAISSRSWLFKFG
                     RVKMVFVCGDTVSMRSLASPQDLRSRAKLGTVVQSLSTPRLLLTGDDLEPYASHMFPP
                     TPSVGPRVPLTSVLIPNTNISSGLLKRKLSVLEVEPLKDPLIDARDMESFEFLTRNMF
                     VLKTKTVEEGLKHVMPGANNVLRLLSPSHPRMRDRPEDVVLPDTPIVQLTNRQWASLA
                     EAFEKWPFKPTIYMDEGRIRHQLSDSLV"
     gene            <560950..>561969
                     /locus_tag="MRET_0337"
                     /note="MRES_02020"
                     /db_xref="GeneID:38737103"
     mRNA            <560950..>561969
                     /locus_tag="MRET_0337"
                     /product="DnaJ subfamily C member 17"
                     /transcript_id="XM_027626964.1"
                     /db_xref="GeneID:38737103"
     CDS             560950..561969
                     /locus_tag="MRET_0337"
                     /codon_start=1
                     /product="DnaJ subfamily C member 17"
                     /protein_id="XP_027482534.1"
                     /db_xref="GeneID:38737103"
                     /translation="MELPGSNAVEWEDAFKLLGIDERASESQIRTAYRKRSLQFHPDK
                     ARDIPPDAAAERFHRLTLAYEALLDPSSRARLLETLENEKARRKRQSAFDDRRKSMAA
                     DLERREELDRVQRVKSEQKRRERERRISALREEGRTMRVERHERLLERWQQSSRTSQS
                     FASTASTLSADGLPPWGPSDSSVLIRFPSEQAVSMWGADTLPHNLLQTPLGEALTLSY
                     GPLSSVHIKPSQKKRREVSVIASFEHGVHAWRAVTEGSDLRCSHILLQDCWIGWWDPS
                     TGKAATHPPARVQAWIQGGVSARDAPVETRTPHDAADEFDYEYEASTLARLRQVASTF
                     PQHER"
     gene            complement(<562025..>562608)
                     /locus_tag="MRET_0338"
                     /db_xref="GeneID:38737104"
     mRNA            complement(join(<562025..562312,562339..>562608))
                     /locus_tag="MRET_0338"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM23"
                     /transcript_id="XM_027626965.1"
                     /db_xref="GeneID:38737104"
     CDS             complement(join(562025..562312,562339..562608))
                     /locus_tag="MRET_0338"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM23"
                     /protein_id="XP_027482533.1"
                     /db_xref="GeneID:38737104"
                     /translation="MTMLGAPRPSLVRQFPSRRGILQHIPKAQYSTSEPKDNQERLNW
                     DAYLRLRKQRRLAGVVTTWPTTLLAAFGSSTYFLSQKMDPTQPLFGFDPMIVFLCATA
                     ACTGLGWLVGPSFGSGIWNLLHRGQAGQMARRDKEFYEHIHRMRADASKHNVHKPMPD
                     YYGEKIGSLHEYRHWLRKQVCWMHD"
     gene            <562876..>564351
                     /locus_tag="MRET_0339"
                     /note="MRES_02015"
                     /db_xref="GeneID:38737105"
     mRNA            <562876..>564351
                     /locus_tag="MRET_0339"
                     /product="ATP-dependent RNA helicase DDX6/DHH1"
                     /transcript_id="XM_027626966.1"
                     /db_xref="GeneID:38737105"
     CDS             562876..564351
                     /locus_tag="MRET_0339"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX6/DHH1"
                     /protein_id="XP_027482532.1"
                     /db_xref="GeneID:38737105"
                     /translation="MTSVAPGMEVRRLPKDTRPQTEDVTVTKGNDFEDFFLKRELLMG
                     IFEAGFEHPSPIQEEAIPIALSGRDILARAKNGTGKTAAYVIPTLERVNTKKNKIQAV
                     LLVPTRELALQTSQVAKTLGKHLGVEIMVSTGGTTLKDDILRLGQTVHILVGTPGRIL
                     DLASKGIADLSQCTTYVMDEADKLLSPEFTPVMEQLLGLMPKERQVMLFSATFPLIVK
                     DFKDKHMVKPYEINLMDELTLRGVTQYYAFVEERQKVHCLNTLFSKLQINQSIIFCNS
                     TNRVELLAKKITELGYSCFYSHAKMLQAHRNRVFHDFRNGACRNLVCSDLLTRGIDIQ
                     AVNVVINFDFPKNAETYLHRIGRSGRFGHMGLAINLITYEDRFNLYRIEQELGTEVQP
                     IPATIDKRLYVAPSLIEEAENRERDAKAQGKPTQGPGIMQQGLPSIPPTQAAMHAVPM
                     NQNANFTNTVPHRRGGRRNRRGGHAGHGNANGAANGAQGGA"
     gene            complement(<564614..>565556)
                     /locus_tag="MRET_0340"
                     /note="MRES_02010"
                     /db_xref="GeneID:38737106"
     mRNA            complement(join(<564614..565490,565519..>565556))
                     /locus_tag="MRET_0340"
                     /product="small plasma membrane protein"
                     /transcript_id="XM_027626967.1"
                     /db_xref="GeneID:38737106"
     CDS             complement(join(564614..565490,565519..565556))
                     /locus_tag="MRET_0340"
                     /codon_start=1
                     /product="small plasma membrane protein"
                     /protein_id="XP_027482664.1"
                     /db_xref="GeneID:38737106"
                     /translation="MALFGLTGNRRELKPTKRHVFLFFIILFSILVPPLAVFIRFGIC
                     FDFFVNILLTVAGYIPGHLHNFFIQRVRDNSRRPDRTPKWLKRAGLVDDTRGGSSNRQ
                     WADRYINTSRPTQYDDEGRAYYLYEDDDDETVEMSDPHALVEPDRFINDGPSRHRSAI
                     RPKASASSLMQQSTYDTMPSSTKNHSIKSRTMRFFGLRSGPPRTQSNARDDPLTRRYM
                     EGRSTFDYDDEDWPPMDRELQRRTARDANDPEYDDWDRELMGLSTRSNYPPVRASRRA
                     ASNAPAAPKATEIDDEPTRDILEYEHTF"
     gene            complement(<565666..>566972)
                     /locus_tag="MRET_0341"
                     /note="MRES_02005"
                     /db_xref="GeneID:38737107"
     mRNA            complement(join(<565666..566870,566900..>566972))
                     /locus_tag="MRET_0341"
                     /product="histone-binding protein RBBP4"
                     /transcript_id="XM_027626968.1"
                     /db_xref="GeneID:38737107"
     CDS             complement(join(565666..566870,566900..566972))
                     /locus_tag="MRET_0341"
                     /codon_start=1
                     /product="histone-binding protein RBBP4"
                     /protein_id="XP_027482665.1"
                     /db_xref="GeneID:38737107"
                     /translation="MSNVEIAEDEASANMAMISNEEYKIWKKNSPFLYDMVVTHALEW
                     PTLTMQWMPDKEVFSDKGFTRHRLLLGTHTSGQDNNYLQIANVNLPNTDSTTLDMKDY
                     DEEKGEIGSYSSASARIQVTQRINHEGEVNRARYCPQNCDLIATRAVSGLTYVFDRTK
                     HSNQPDSDGKCRPDIVLEGQTREGYGLSWNPIRQGHILCASEDTTVCHWDLNAYQKES
                     KTLHPLRTYRGHSAIVEDVAWHNHHENLFASVGDDRQMLLWDTRDSNEVPKYRVEAHT
                     GEVNAVSFSPASEYIVATGSSDKTVGLWDLRNLSTHLHSLEAHTDEVLQIAWSPHHET
                     VLCSASSDRRVNVWDLSRIGEEQAPEDAEDGPAELLFVHGGHISRPTDLSWSPKDPWK
                     IATAAEDNIVMVWQPARSIVEPAEAEPDAADLE"
     gene            <567103..>570903
                     /locus_tag="MRET_0342"
                     /note="MRES_02000"
                     /db_xref="GeneID:38737108"
     mRNA            <567103..>570903
                     /locus_tag="MRET_0342"
                     /product="TELO2-interacting protein 1"
                     /transcript_id="XM_027626969.1"
                     /db_xref="GeneID:38737108"
     CDS             567103..570903
                     /locus_tag="MRET_0342"
                     /codon_start=1
                     /product="TELO2-interacting protein 1"
                     /protein_id="XP_027482662.1"
                     /db_xref="GeneID:38737108"
                     /translation="MTTASGAPTSGASNANFQKLRPVCVNLLRLINKAPDDNALEDAL
                     AQLHVCLEVVDTLTPSLVHYVFYPVSQLLNTHENGIFSFPNRVRTLIFRVLAQLATDW
                     WQTWTWAHIQSCSKAETCPTTISGSPDWRVWEQLLFLGVMTLSGGPRSCPVQNNYETR
                     EATAQFLARVLQPRISQLPPSNDHWEWDGVSSLPSLEEFDGPNQIYPATQHVAAVRDS
                     RASSGALAHALKLALDMSREPSAPASLCRTALTLVGIVSISWMGGCTLVLDNTMQVDH
                     SALRERAIHADTIACSERLRMILPGVASSLVKVATRASSAVNVAYAVDLLTAMLVLCL
                     QDPLTAPYRTNSLDSEVPSSLEDFGKLDINSLMSPNSELEEETETLSAKSEMSTPATS
                     ITSDAIENSWLERTMNPVLIALKALVPLGERNDVPVQLAMTRMAHTLLTCMPETLQWA
                     RQDMEADPCEDLTCTLLDMSCDWHTERVTQQARDAVRALGSSLLVLMDRIMTHALLSL
                     ASAVKRIHDADVQMHARRVRMCASLLSHDLLDVQMGSPHMAFLRVASHHGDFHWWFDA
                     LMQAFCVHELTNGVMAADTIPYIRPALGQLEPGSMYALGRMWFAWGEATAVLLCAAVQ
                     RRSALSPRYQSAFSLPLYAMHVARMCRITDINRARVHLLVVNEVMLGTSHILTTRDLE
                     TWMTLPEGRALRKAAHGFARHVVHELQHAWHAEVEEKEEPEMQEVVESIPTSDTTMVR
                     GLPAFTDRIGRLNAGPALDVSFVDSARIDVSNLKSKGPEMAKKERALERRNAMRDHCD
                     ALSLCILASAASLLGVSCRPLLLQILYPVLGAFGRRDEVVRNAAQYALERMSDACAYP
                     SIQSCILHHTDYVLGAASHRLISGLRSELYAGLSIAPIRPTQQTVLMSARAAPWVLVQ
                     VIQMLGAEAVPWVEDAVDEVLAALDQFHGHEDVCDGLLAVLARLVAVLAPMQPPKERI
                     QPKMKSPIEDFRQWLEMHMTGTSRDESLADLSVPDEDANQDANPAPNRLQSVLNEILI
                     RCIPFLSHGSAYLRMRALDMLRDGVAILAPQERTAELYPVLDRAWPLILARFGTSATS
                     VSLNVEYDVNVWIHATGLVSTIAQHVSEGFGRRILKDIWPQWRQMLYTLCTDRSAQPR
                     VMPRPERGAVAKRAHVHLYNQHATEGQVLFAILEALKSIASSIGQKMENAVLWDMATH
                     PRLLDTLDVRQPGKIRNAGVIMYQSFIQADDMTLWTILRAVAGQGAPWYLQRSIQWAP
                     EFTW"
     gene            complement(<570893..>573247)
                     /locus_tag="MRET_0343"
                     /note="MRES_01995"
                     /db_xref="GeneID:38737109"
     mRNA            complement(join(<570893..570981,571009..>573247))
                     /locus_tag="MRET_0343"
                     /product="DNA repair protein RAD16"
                     /transcript_id="XM_027626970.1"
                     /db_xref="GeneID:38737109"
     CDS             complement(join(570893..570981,571009..573247))
                     /locus_tag="MRET_0343"
                     /codon_start=1
                     /product="DNA repair protein RAD16"
                     /protein_id="XP_027482663.1"
                     /db_xref="GeneID:38737109"
                     /translation="MAMRRLRDRKARIVYEVESDESDDQQDSDFQGSAYSEEDLPTLK
                     KDNSLAQEQESSDDEFYAEIRTENTLRHIPPIKKEPTPSETDSDTPLAQRVRHKKPTK
                     PKLTRFQRSLAQLNHIHPELVPVWDKLRAMRRDKSKPAPRAEQPSNICISLLPFQLEG
                     LYWMQQQEQSEWRGGLLADEMGMGKTIQMVSLLVADPKRPSLVVAPTVALLQWRNEMR
                     KYAPSLQVLVWHGAQRAKDAEALHASDVVLTSYAVLESTFRRDRYGVMRNGRRVHDRS
                     LLHTMLWRRIILDEAHHIKERTSNTSRSAFALQSDFKWCLSGTPLQNRVGELYAMVRF
                     LGGDPFAYYYCRQCPCKSATWQFHHNSYCVQCGHKPMVHLSFWNFMILRPIQRDGTDE
                     GDGEEAFARLRLLLDCIMLRRTKLERADDMGLPPRTIEVRRDFFSPEEEDLYKSLYSS
                     TTRSFSTYLDQGTVLNNYSNIFTLLTRMRQMSNHPDLVLRSTTRSNADLLGKIDEINV
                     CKLCLEEAEDGIMSQCRHVFCRACMQQYLNSFEGDQDPSLRRTHDEPDCPYCHAVLSV
                     DLDAPALEPPQPVATPSDPKRQGILTRIDLSNWHSSTKIEALVEELTKLRELPDRTIK
                     SLVFSQFVNFLDLIAFRLQRAGFRICRLEGNMTPEARDRTIQHFMENPGVTVFLVSLK
                     AGGVALNLTEASRVYLMDPWWNPAVEVQAMDRIHRLGQHRPIVVKRMIIENSIESRII
                     ELQNKKSAMVDAAIGQDDTAMGRLSVDDLRFLFTM"
     gene            complement(<573296..>579823)
                     /locus_tag="MRET_0344"
                     /note="MRES_01990"
                     /db_xref="GeneID:38737110"
     mRNA            complement(<573296..>579823)
                     /locus_tag="MRET_0344"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626971.1"
                     /db_xref="GeneID:38737110"
     CDS             complement(573296..579823)
                     /locus_tag="MRET_0344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482660.1"
                     /db_xref="GeneID:38737110"
                     /translation="MAFGGLKVKKKSEKKKGNQVGGEAAPPASATPASSIDLPTRKNT
                     KFISGFGKNRSDVAATSSDKASVSSTLLPNIVGDTTNEVKSSRASSSAPDSRRRLRMP
                     SGMSLKNKRSFNRSVTVGDRPSTQNPQGSKELVPGTPRSVSAYGQGLPVEQTRDLPRT
                     PASETVISSSHPNDKDKDTKGIPGSLLTEKSKIFAPGPLMRKKSAASLRSEVASEKPG
                     DIITLSSPLRSTSFPASPVYAPATPSYSTGTRNGLAPSISGAGLNLPLTSYQSPNEVV
                     SKAQETNTTNSIQKTSNALSYLTTASVIPTTDPADLTTSTVVQHSLKEPPSSQFPQPS
                     GANRDDMASLYDSDEDSIDGTYTSHNETIMYDALDSIDTGSGAHGGHPDDNYPELASQ
                     PSEKNALNSASIADILKGSKDPFQPSDDTSFKMKKLAISNAKDHDDSLEAVQISKAAP
                     GINKGKSVESPIEADEISPGTNSFQPPLDTKPDLPDPQTSGTSALSPRDKEASNVSTL
                     AGTSPSAPAESMKEPYEQSHVVEQVKENLAKNHIEVLEPVAASDKPSKAFDTISTEAF
                     KLQGTEDSEHAAHPPPTSSNPLILEAREPNVDEKDVSGAASVPPINSISLAPVASSQT
                     KPTNPISKHTNLLANPIDIMPVGQKSTERAEPVAAPTKQDISPMDQVAPPESNLVETQ
                     PSKVPTKPEVASIDSAPDPQLESSTNVPEPEATKNILTHPVHVNPEINESSTKQSASA
                     AISGVWSNLLPFGKLEAQSNKIDEETTQANGPNTSESSFTAASAIDGAAAGPVLLGVS
                     TTADETSQDQHVKPEKLEDAAPNSSSNSELEARTETNSAILRSGNVDVKSETLLSEER
                     SKDSSFVEEVPKTADIPGIPEKDAAVLEDEAASEYTTKDEADTSVHMGNKLKDQELVA
                     EKAPVLEPLVEKDSRPVNTVIAAAPIVGSSSGNDLPSISTVEDRPSPTVQESINDEIS
                     TGPVPVEPLRIPKRGNVDTMLPVASPSQEPMPPAQLSSDTNETPQPLRMESNEAPVPT
                     DEQSSKRHSVAMTTQQTTDSDKLSKASNDSQRLIPTSLDESEAPKRRSSLIKAAGEFL
                     GSNLPFSLSSRFGDVSKNSSKESTKESTPESKLEPEPKSKPEVESVLGPEIKTEPELE
                     LKPEPKLEPQSEPEPKPDSESGLKSTPELQNMQEPPSQPGDVSAMDRENQMLVCQPNF
                     QHADHAKQALAANPEPQESIPVAEPLEKAVPTEEGEVKLETQAELASAAPEAHHEPIM
                     PQSAASPELPHRPMFAPLAPGTTLPWAMGTMPLPQRTQGKMQGTSPAVPSASLTGVDD
                     ELPTPPEPFHPPEILTHHEQPDPTQLVQPPQEALQPAVSLHAAPGELVPNHFASSFVH
                     QPWPRQEQTEAKSDLSVPLEPTQSFAPGPPLPTKKEEANGQNEPTPSWPVLGPAVPQP
                     MLWQPNEDEHDLAEEQLSRRYTLEKQPELENYGPSFEPRFLHTVPEEQADTSATDATQ
                     INDLAEVKGTDELVAAPALPMQAPNTFSVDPNAPLQGTGQYDPHQVRGFIRAMDTDNY
                     EHAMRRASRMGVPLDVIPSNSPVPYPDPPENLPRPSELFAGKGVRWDSPDWLRSQLRK
                     NVEAPSQAKFHAFLKSRRQVIPAFVWHDAASNPALHGEEYVDLAAPSTVPKNEPESEQ
                     LSTSERHQEPQPSETTLKTENEPLHAEDKTSGLQDAADIVPTLPLLLPDSYLLSDSDP
                     IETSLLNLDELERSYQSKMHPPKPVESDEGYTKYPYNSELLTHDRAVVADAPPSLPPK
                     IPSPYEYTPNRPSADGRPWNEHYGQAPFAQPQFMPPAPHAEMPPNDVYQQQFVPLPEQ
                     VPVYDGGLHGPTEYAHEPRYRPDEPQNGQDLPGQEYGHVPYPEPTQPHHYHNVGFPRA
                     EEFEHGAHPHHQPAEPQVHYGNPAFGTYAGETFGPYPGQLVQYHDPAMHGLQPGFAQP
                     YPGPDSQVYQMPMQPRPDLHTQPFVQQALLPQAHITPYQQFSSLSVPQHEPQPYDGNQ
                     GTVYDENYMDSQQAWLRQQFSDQQPRPEFYQHEPHRFGFSHEEQAHESHQPQLDYAQQ
                     QPRLHTWDDGVVSASAPSSPIALRDPHLASDMANTDANAASISPGWQSSAYQSMNTNG
                     FTPILSSTPTQKYDTKKSKRRGGSSHRTGWAALLHNDPLSALQ"
     gene            <580097..>581830
                     /locus_tag="MRET_0345"
                     /note="MRES_01985"
                     /db_xref="GeneID:38737111"
     mRNA            join(<580097..581659,581699..>581830)
                     /locus_tag="MRET_0345"
                     /product="T-complex protein 1 subunit gamma"
                     /transcript_id="XM_027626972.1"
                     /db_xref="GeneID:38737111"
     CDS             join(580097..581659,581699..581830)
                     /locus_tag="MRET_0345"
                     /codon_start=1
                     /product="T-complex protein 1 subunit gamma"
                     /protein_id="XP_027482661.1"
                     /db_xref="GeneID:38737111"
                     /translation="MSGQQPVFVVNTGPERHSGRKAQISNITAAKTVADVIRTCLGPK
                     AMLKMILDPMGGILLTNDGHAILREIEVAHPAAKSMIELSRAQDEEVGDGTTSVIILA
                     GEVLAHSLPLLERNLHPVVIISAFKKALARSLQIIDSISIPVNVDKDEEMLALIKTSI
                     GTKFVSRWSELMCRLALKAVRTVASIDTNVQRSNDPFSNGVTIDLKRYARVEKVPGGE
                     IEDSCVLDGVMLNKDVTHPKMRRRIENPRIILLDCSLEYKKGESQTNIEITREEDWSK
                     ILEIEEQQVKQMCDKILEFKPDLVFTEKGVSDLAQHFLMKANVTCIRRVRKSDNNRIA
                     RATGAQIINRVEDLRDADIGTRCGLFHIEKMGDEYFTFLEKCTDPKACTILLRGPSKD
                     ILHEVDRNLADAMSVARNIVFHPMLAPGGGATEMAISVGLAQYAGQAMEGVEVAAVHA
                     VADAMEVIPRTLIQNCGGNTIKTLTQLRARHANAEHSYGVDGNTGRVVEMKQYGLYES
                     ASIKIQILKTAIESASLLLRVDDVVSAKRNGQSGLGAAPQAQNMAMAGGEEGMNVA"
     gene            <583002..>586235
                     /locus_tag="MRET_0346"
                     /note="MRES_01980"
                     /db_xref="GeneID:38737112"
     mRNA            <583002..>586235
                     /locus_tag="MRET_0346"
                     /product="H+-transporting ATPase"
                     /transcript_id="XM_027626973.1"
                     /db_xref="GeneID:38737112"
     CDS             583002..586235
                     /locus_tag="MRET_0346"
                     /codon_start=1
                     /product="H+-transporting ATPase"
                     /protein_id="XP_027482658.1"
                     /db_xref="GeneID:38737112"
                     /translation="MSQYGQSELPPPIVAADNAYTQEHPMTQPGQFQSSEYQTQPGEN
                     VIHYEPNGYAQQYSQTYYQPQGDDEARYAAEQEAQQQNYQQPQQESQKTEKPQEDGEK
                     KGGLDFDDLPDDEYGALVTFIRAQKRSGGGDDEEESDIRIVKKRSLWTPWKVREVRVN
                     KNGEEEAVAQKVPQAWLETDVFQGVSESEVPNRRAMFGYNELESPTENLVLKFIGFFR
                     GPILYVMELAVGLAGGLRDWIDLGVICGILMLNAFVGWYQEKQAGDIVAQLKKGIALK
                     SKVIRDGQEREIEAREIVPGDIVVVEDGMTVPCDGRLLADYDDKDLSQATAIRQRMEE
                     TKHQGDGGEDDETGVDKGPAIIACDQSAITGESLAVDKHIGDTVFYTTGCKRGKAYVL
                     ATDIAKQSFVGRTAALVTQGGGGGHFQKVMTLIGTTLLVLVIVFVLVVWFAGFFRNVG
                     IARPSENNLLIYTLIFLIIGVPVGLPCVTTTTMAVGAAYLAKREAIVQKLTAIESLAG
                     VDVLCSDKTGTLTANKLSIHEPFTSEGVDVNFMMAVAALASSHNVRSLDPIDKVTLTT
                     LKDYPAAIEELESGWSTKRFTPFDPVSKRITAEVAKNGKDYVAAKGAPNAILKLCNPP
                     QEQASQYRQVAGEFASRGFRSLGVAIQEDNKWRLLGLLPMFDPPRADTAATIAEAQSL
                     GVSVKMLTGDAVAIAKETCRMLALGTKVYDSQRLIGSGGMAGSAIHDFVEAADGFAEV
                     FPEHKYQVVEMLQHRGHLTAMTGDGVNDAPSLKKADCGIAVEGASDAARSAADVVFLD
                     EGLSTIITSIKVARQIFHRMKAYIQYRISLCIHLEVYLLLSMIILNETIRANLIVFIA
                     LFADVATIAIAYDNAPAAREPVEWQLPKIWIISIVLGLLLAAGTWICRATMFLRGGGI
                     IENFGSIQEILYLEVALTENWLIFVTRLGGGESEITLPSWQLVGAVGVVDILATIFCL
                     FGWLSGAEHRNPLTALHGGWTDMVTVVRVWAYSFGVIVVCAIVYWVMCRIPALDNLGR
                     RNRSVKNEVLEDFFANVQRLTLVHEKGNEEGHDVYSFQTRLDVGDDE"
     gene            <586711..>587529
                     /locus_tag="MRET_0347"
                     /db_xref="GeneID:38737113"
     mRNA            <586711..>587529
                     /locus_tag="MRET_0347"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM22"
                     /transcript_id="XM_027626974.1"
                     /db_xref="GeneID:38737113"
     CDS             586711..587529
                     /locus_tag="MRET_0347"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM22"
                     /protein_id="XP_027482659.1"
                     /db_xref="GeneID:38737113"
                     /translation="MASKMPLVAPVYLPGQEPLPPGISEEDRMQIMQSLKYQGYIVKT
                     MESCVGKAAISGVLGFGLGAFFSLMSASLSIDDPLRQTMIDKAAAEKARKLEEEREAT
                     KKKNSAPNARSSTTSSLTNTTEATPRLNTEQLNGNSNTKIGSTTPATKTQAFLTKLPG
                     GNYFKNLPAPPPQLPAATMQSTKEFFIQTGRSMYSSGRGFGKVGALYSGIECCIESYR
                     AKNDIVNPVLGGFLAGGILARNTGPATAFSSAMAFAAFSGAIDLFLRRETKDED"
     gene            complement(<587569..>588928)
                     /locus_tag="MRET_0348"
                     /note="MRES_01975"
                     /db_xref="GeneID:38737114"
     mRNA            complement(join(<587569..588831,588866..>588928))
                     /locus_tag="MRET_0348"
                     /product="26S proteasome regulatory subunit T2"
                     /transcript_id="XM_027626975.1"
                     /db_xref="GeneID:38737114"
     CDS             complement(join(587569..588831,588866..588928))
                     /locus_tag="MRET_0348"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit T2"
                     /protein_id="XP_027482666.1"
                     /db_xref="GeneID:38737114"
                     /translation="MGQVPSGNAPGRGLNKDKDNKKKEGSKKWEPPVPTRVGKKKKHS
                     ESAAKLPVVHPTTRCRLKLLKLERIKDHLLLEEEFVMNQDRLRPKDDHDEEERTRVDD
                     LRGSPMAVGSLEEIIDDEHAIVSSSTGPEYYVGIMSFVDKDLLEPGCSVLLHHKTMAV
                     VGVLSEDTDPSVSVMKLDKAPSESYADVGGLESQIQEIKESVELPLTHPELYEEMGIR
                     PPKGVILYGVPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD
                     EHAPSIVFIDEVDAVGSKRYDSSSGGEREIQRTLLELLNQLDGFDSRHDVKVIMATNK
                     IESLDPALIRPGRIDRKIEFPLPDQKTKMQIFRLHTSRMNLDPDVNLEEFVAMKDDLS
                     GADIKSLTTEAGLLALRERRMRVTKKDFITARERVIDRKNEGTPEGLYL"
     gene            <589262..>594271
                     /locus_tag="MRET_0349"
                     /note="MRES_01970"
                     /db_xref="GeneID:38737115"
     mRNA            <589262..>594271
                     /locus_tag="MRET_0349"
                     /product="histone demethylase JARID1"
                     /transcript_id="XM_027626976.1"
                     /db_xref="GeneID:38737115"
     CDS             589262..594271
                     /locus_tag="MRET_0349"
                     /codon_start=1
                     /product="histone demethylase JARID1"
                     /protein_id="XP_027482667.1"
                     /db_xref="GeneID:38737115"
                     /translation="MGALVDLNQAPPLTIKEEEGSRATPAAAHRRSTVSTRPARKLPA
                     YVSCRDLGHFIDGVDASVLQEDEAPSKRRSKKHALQALSGGAGDSPPESSLPPPPNPL
                     RHATRKVSRMTCTPPLVFDTSTSSRPMHGPPPIPTGATTPRSMAPRTQPRLFGLEEAP
                     TFYPTWDEFNDPLKYIEWTARPDGGNGVAYGIAKIVPPEGWHMDFSVDQSTFRFRTRV
                     QRLNELSAERRVAQNYIEQLEQFHAQQGHGRVYIPQLCHRPVDLYALKHAVNVHGTNA
                     WERVAHLLGYDEGDVPKCASVLESAYTRLVEPFEAFLSRTRAGDTPAVSHVPFKAADT
                     CSVCQDESSSPLITCVECERAYHLACVTPTLSQVPRGVWVCPTCLVHTGGDFGFEDGE
                     THSLYSFWQRCHAFEQIWAERAGWDDWHSLTLSEREDRVEAEFWRLVHCMDEHVDVEY
                     GADVHSTTHGHASPTMESDPLNVYARSGWNLSNMPILADSLLRYIRSEISGMTAPWIY
                     IGMMFSAFCWHNEDHYTYSINYQHWGATKTWYGVPGADAEAFEAAMERIAPELFAACP
                     DLLLQLVTMMSPALARREGVRMYACNQRPNEFVVTYPKAYHSGLNQGFNLNEAVNFAL
                     PDWVMDGLACVRRYQKHARQPVFSHDELLVSIALHNQQLHTAAWLHPAFEDMVQREIH
                     GRDRVRSLIRAAVSGVEDEPFDDDTEIACAHCKTLCYLSHVVSTAANSTAAACLSHAE
                     QVHGTQAAGWTLRVRHPDTFLTSHASRLAERAAAPVAWQQRVRRFLVQHPRPPLRMLR
                     GLVQEGQKIAMAPPELDQLERFIKRAEPWIEHARIFLSKRQAKPGRRTKDSRRRTSPS
                     PPPMAADVDRSPEALLALQQRAASLPFEAPELQQLDAVVDQMHAFSVQAAAYLDRDPE
                     ARESMSYVDEAERILAQGELLHVHIPQVHALQQWIAHVRWFAEVHGIGEGFLTRDEVH
                     ELEQEADACGIVSTHPMREALSQRLRLGAAWDEKAMQLLHHAPSITLDSLRALLDAPP
                     DAATSSEIRKRVSALEHKAAQWHEAVATLHQRTHPADRHTTVDATDTVPYLAEARQLL
                     DEIRAARVHVLNADVIEAAIIVHDQWNDELARILQLTGSDTVDEARVLCERTIRTAQA
                     DAINMRVGDEPTYEPIYSYPPVPYPPPRSAVPPCLCFEARTDRAASVTCAKCFTVYHV
                     RCLDRKAKPPLGWQCAFCDTSQLKSWLSHRRAFSQLPLVALLQNPKYQRDQLRFVPSN
                     HARLQAAMRATVEFGVAVSMQFRGGHLPESLLARPTPYYPSNTPPTPQLRHMARRAFA
                     CPFNILLIGDTVPQQNQHVPTVLDVFLPAFHLSSKNSKAKRVNPQQDSTDGKSGPQAP
                     RKRAKRARFMFREESVLASLPPDTYCLCAAPDNGTMVQCDRCSHWFHSACMFIDDPAI
                     LRDKWYCPVCCFRLRIKYPHAEVKIRDMTRSVQDSSSDLFVDIVASLKSQAHPILKRQ
                     LSLSPKCIILHLCEFEPAIPATETTSQPATKRVRTDNNVEPLAHPPPAPKPFVPKPDL
                     LSEEERHRMGRSNLLRRGVSESMMQTYSMGWNGESIVCQITRECHILLGPYIALAQDD
                     PNGTRLLRMALDGLIPWATVVRPTPWTAPAPTSPSLPPLARITQPTIPPTMENPPHTP
                     S"
     gene            complement(<594266..>594970)
                     /locus_tag="MRET_0350"
                     /db_xref="GeneID:38737116"
     mRNA            complement(<594266..>594970)
                     /locus_tag="MRET_0350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626977.1"
                     /db_xref="GeneID:38737116"
     CDS             complement(594266..594970)
                     /locus_tag="MRET_0350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482628.1"
                     /db_xref="GeneID:38737116"
                     /translation="MRRHGRAECDPDKSLGGHVKLKRLHAFVLDKLCELAYEVHTLHR
                     IWYKGAAQYRHMVWWRPLQRVKRLGALVATGPLSESVPLARQTSLQHKRPRGAAPELQ
                     VLGVQALAAISAVYAACWNEQAPEYWQVLPKHTTPPNSHQRIDSRMQSQTYDALTRLL
                     DTLMNMKQASRVCYARSHAHLVTPPAPMYAPTCMALMAICARICTLCELLVRGQGPNE
                     GIKAWCRVLSQNELIL"
     gene            <595084..>596008
                     /locus_tag="MRET_0351"
                     /db_xref="GeneID:38737117"
     mRNA            join(<595084..595090,595125..595228,595260..595894,
                     595927..>596008)
                     /locus_tag="MRET_0351"
                     /product="replication factor A2"
                     /transcript_id="XM_027626978.1"
                     /db_xref="GeneID:38737117"
     CDS             join(595084..595090,595125..595228,595260..595894,
                     595927..596008)
                     /locus_tag="MRET_0351"
                     /codon_start=1
                     /product="replication factor A2"
                     /protein_id="XP_027482627.1"
                     /db_xref="GeneID:38737117"
                     /translation="MDAGYEDNQYGYSASYDDVKGGGGFFGSRDGGDQGDRSAGSDSV
                     RPVTVRQILNAKQPNSDAAHVSDGAVLNRLTLVGWLRQVNRTATFIQYTIDDGTGQLD
                     LRQWIDNSLDEGSKADEFAPNEFVRAMGEIKVFNNKLYIALGALNKLEDHNEYLYHQL
                     DVIHTHLELTKGPPNAVNKTSQTGAVDVSAYDDSALQTASSMAADLSHLNPLQRRIYQ
                     AIDAEAPDWPEGVDIQQIMQRCKNTDPKQIQDAIDDLANDGYIYQASDETHYLTTAG"
     gene            complement(<596106..>596385)
                     /locus_tag="MRET_0352"
                     /db_xref="GeneID:38737118"
     mRNA            complement(join(<596106..596140,596169..596257,
                     596294..>596385))
                     /locus_tag="MRET_0352"
                     /product="V-type H+-transporting ATPase subunit e"
                     /transcript_id="XM_027626979.1"
                     /db_xref="GeneID:38737118"
     CDS             complement(join(596106..596140,596169..596257,
                     596294..596385))
                     /locus_tag="MRET_0352"
                     /codon_start=1
                     /product="V-type H+-transporting ATPase subunit e"
                     /protein_id="XP_027482630.1"
                     /db_xref="GeneID:38737118"
                     /translation="MSGWTTIWVLFVAVCIGAIVWNTAPKGPNQELIRWSVALGLACC
                     YMMWACVYLAQLHPLIQPKRSDVRFFD"
     gene            <596532..>597980
                     /locus_tag="MRET_0353"
                     /db_xref="GeneID:38737119"
     mRNA            <596532..>597980
                     /locus_tag="MRET_0353"
                     /product="dihydrofolate synthase"
                     /transcript_id="XM_027626980.1"
                     /db_xref="GeneID:38737119"
     CDS             596532..597980
                     /locus_tag="MRET_0353"
                     /codon_start=1
                     /product="dihydrofolate synthase"
                     /protein_id="XP_027482629.1"
                     /db_xref="GeneID:38737119"
                     /translation="MDLGLGRVQALLQRVGSPQFKFPVIHVSGTNGKGSTTAYLDAFL
                     THAVGLRSARFNTPHLVTARDSLRTNGGIPIDDKTWDIAVQKTRLADARDVPIGATPF
                     ELLTVQALLACTLLPIASQPDILLIEVGVGGRLDATNVFPSENVLASVICSIARDHEA
                     ILGNRLSNIALEKAGIIKPQGLCIVSDQTTGSFGSNLTTNFELLEVLETLHSACQAQH
                     ARVVYTQVPWASLKPCPRKEPFGASVDLTLPLSYACDATKITYNPSSNASQRHIRFSL
                     EATLARISGASTALQTLWSIAHDISSDQWNGIRELIRKRLFQADPSLIAQAAAQYRWE
                     GRCEWMKLGEVPLLLDGAHNEASAFALRQYLDHCLAETPSADITWIMGFSSGKEVHAM
                     LHALLCPRKGLHHRVSLVPFSIPVEGMPWVKPMLPEECKSAVRSMNIECVTHRSLRDA
                     LTWASLYDQRPHIVVICGSLYLISDYYRQLSF"
     gene            complement(<598019..>600531)
                     /locus_tag="MRET_0354"
                     /note="MRES_01965"
                     /db_xref="GeneID:38737120"
     mRNA            complement(join(<598019..600252,600453..>600531))
                     /locus_tag="MRET_0354"
                     /product="MYND domain protein (SamB)"
                     /transcript_id="XM_027626981.1"
                     /db_xref="GeneID:38737120"
     CDS             complement(join(598019..600252,600453..600531))
                     /locus_tag="MRET_0354"
                     /codon_start=1
                     /product="MYND domain protein (SamB)"
                     /protein_id="XP_027482624.1"
                     /db_xref="GeneID:38737120"
                     /translation="MRESNFSNPLQNRACLSISAVVYDRRALDCTATLPLVNSLNHFA
                     YLASTSPRIREMVMLDGGLERLIHILRCPPQRVSNVLRSNRSAVPMAEMQANWKWSLA
                     FQCVVNIGVRGSEAIRTRVVEAGMVPIIVKVLDNYLVTSEQIHSQQRKAMTIRENLTY
                     KQSYRAIYPQDDPTVRPATPMDMDTNGPSTEQVYWSAERGRHGPRDTFALQQRGPGDA
                     SASASASECAEDTEMYNEEENACPGASAVLENKSDMQETETPRVPRTSTLEPCADEST
                     GITRTPRPERAAVHEGMHQDELNTWQTSASAMIPEPVSPVQPPLYREEEVLLSLQLLA
                     YLSKYPHVRYFFHNANVREDMIFCPEWPEEGLPNRSWQPTDPSRLNVFCIAERFTHRP
                     TRSSLAPGVLCSLYPRLASDIQYWAGVVMRNACRKDESRGGIRQCANMLCGKWETYPR
                     EFAKCRRCRKAKYCSKQCQSKGWQMGHRFWCSARSDEDKSRASESHPTVHSNFVPDAS
                     RNVETPATIPTMPDTAREVPEDYSHPLGPRNMPSTLRENQLPALRGVSAASIESNDLH
                     EMSDDVTIRPGETPSVDSPAGPSNADHTLPPPIIASGLHMHETDTATATLRVQEAQNI
                     QDHGGPLDYVTASWTSRPIVSDHATESPLPNHTSTDSPFDLGITLPSQNPIPALRSND
                     DNASSHDSYTAPWRHMAISAAFLGAHQTPRAMTMFDANPSSPSLDGGETSQQDTQMLS
                     PTSHLLASLHHHVSSSHGQSTDTRDMSDAQ"
     gene            <601128..>601662
                     /locus_tag="MRET_0355"
                     /db_xref="GeneID:38737121"
     mRNA            join(<601128..601292,601328..601396,601423..>601662)
                     /locus_tag="MRET_0355"
                     /product="mediator of RNA polymerase II transcription
                     subunit 22"
                     /transcript_id="XM_027626982.1"
                     /db_xref="GeneID:38737121"
     CDS             join(601128..601292,601328..601396,601423..601662)
                     /locus_tag="MRET_0355"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 22"
                     /protein_id="XP_027482623.1"
                     /db_xref="GeneID:38737121"
                     /translation="MSDSAHHLRSMDHAVEHGTGHTAHLDALEESVNRQIDADIRVLL
                     DNFREMIHLSRIGEKDHFDVSRDSFILETRADSMVRAAQSLYLLSDSLKLSLLLSQSQ
                     MSEARDQEAKYLLDQTKAHMHSCSELLSQHWLSGAISQSGPDPVQSRQAVTLDTS"
     gene            complement(<601896..>603245)
                     /locus_tag="MRET_0356"
                     /db_xref="GeneID:38737122"
     mRNA            complement(<601896..>603245)
                     /locus_tag="MRET_0356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626983.1"
                     /db_xref="GeneID:38737122"
     CDS             complement(601896..603245)
                     /locus_tag="MRET_0356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482626.1"
                     /db_xref="GeneID:38737122"
                     /translation="MVLPERYSLATPSQASQGMPWAPNPKTLMLIRVVFTFLVCLMAL
                     ASAIMTAIIINYYLSHQPMIFPPLSSMIFILFMGIFTSIMYFGYYIFLPSLKTMRRGS
                     MLAVLFTMKLEVLFQFAMASIWISGALAYAADYRGHENCLWDGYYHYKKPDDWNHLCD
                     MVNWLVGMSYATFGVQAGFLAFDVLMGAYIFMFLDQDSVSEPFYEWGTRAWEYKYKPS
                     APLSSIHNPMVYRSSPENHIHSTRGTSAPYGYNEKYLDGRAEQERFSDKWSESSSSHR
                     SNRRGASYNGLSMSDHFTDESSTNGSGTKYYGGAYSRSSVNSRRADLAEAPRPAGTGG
                     TSSGGAPSWHAPTITDADSIRSPTSLRDMSWKSRYVSAPSSLSTRGRRGSQYNNMLSE
                     LGTIEDEAETQEMDEKYNLIDHKNVEEEEEEKEARRVRRRHSMDDDNPWLLEDDEMV"
     gene            complement(<603618..>605243)
                     /locus_tag="MRET_0357"
                     /note="MRES_01960"
                     /db_xref="GeneID:38737123"
     mRNA            complement(<603618..>605243)
                     /locus_tag="MRET_0357"
                     /product="thymidylate synthase"
                     /transcript_id="XM_027626984.1"
                     /db_xref="GeneID:38737123"
     CDS             complement(603618..605243)
                     /locus_tag="MRET_0357"
                     /codon_start=1
                     /product="thymidylate synthase"
                     /protein_id="XP_027482625.1"
                     /db_xref="GeneID:38737123"
                     /translation="MTERKRMPRLIVIRHGVTEWSKTGQHTGRTDLPLLDEGVHEAIE
                     FGDRLVGYSDQAVLCLPEIGYILRSPRTRCVQTLECMLGTEEQRKMMGMPNVQVLDDC
                     REWDYGQYEGQTTECIRKSRPGWNVFEHGTPSHETNPDLPGESPEQISERADRVVKLI
                     REWHQTTKKDVVVFTHGHFSNVLIGRFLRLPLSMSKVLVMSATGTAILSYTHHTFDEP
                     VLIGLLSPGFDMQTGSSPVSTKSHEEYQYLELVSSIIRHGEIRKDRTGTGTIANFAPP
                     KTLKFNLTGGKLPLLTTKRVFFRGVLEELLWFISGSTDAKRLSDRDVHIWDGNGSLEF
                     LHKRGLTDRREGDLGPVYGFQWRHFGAKYVNADTDYTGQGVDQLANIIHQIRHNPTDR
                     RILLSAWNPADLDKMALPPCHILCQFFVSLPTEEQKGRGQRPRLSCQMYQRSCDLGLG
                     VPFNIASYSLLTHFIAAVTDCEAAEFSLVMGDAHVYLDHVEPLRHQLNREPRDFPTIR
                     FRRTFDCIDDIRPEDVELQAYSPHGKIEMRMSV"
     gene            <605482..>609111
                     /locus_tag="MRET_0358"
                     /note="MRES_01955"
                     /db_xref="GeneID:38737124"
     mRNA            <605482..>609111
                     /locus_tag="MRET_0358"
                     /product="protein transport protein SEC24"
                     /transcript_id="XM_027626985.1"
                     /db_xref="GeneID:38737124"
     CDS             605482..609111
                     /locus_tag="MRET_0358"
                     /codon_start=1
                     /product="protein transport protein SEC24"
                     /protein_id="XP_027482632.1"
                     /db_xref="GeneID:38737124"
                     /translation="MESRPPTMRGPSPRPPAGFTGPSTQTGRPRPPQPQRSPAPPSGT
                     TGVRPAQGPISGRRSPMPPTRPIMHGSRSPAPGTRPSMQPARSPAPGSRPPTSPARPP
                     TQSVRPGIPPSRSPAPTMRPSPARSPMPRRTAVTPQPGMQTSPTKSQAPVRRIGAISP
                     RPGPPVRPNSAMTAPGAPVAGNTAAAVRPVAPPPSGPARSKRAARAYHQDASAAPASS
                     GWNDVIAQPPPPQAAWQQQAAARVDYRAAQAPQPPPDDSLDSALDQMPGYRNVLSQSQ
                     QASNLAAMRSSRQMHPSAVASGVAAAGAMPQTGAQDRGARPKIDPDHIPSPVDAQHAD
                     QQFFYHDMFGTCSREGMPLSTTNFAAMDQGNCSPKFMRLTTYCMPATEEVANASRMPI
                     ALNIQPFAQLRSDEERVPLANTGESGPPRCKTCRAYINPWCLFVEGGMKWICSLCGAA
                     SEVPQDYFCNLDINGRRADLELRPELTHGSVDFCVPREYWAVQAPTDVSSMLPVASVV
                     PAYTAELSTSTGLQESIDRLDNLDSHSEGTKTAAKAAKAAGHAALDTLNLGKGQTTVR
                     APRPLTHVFLIDVSFSSVRCGALQTCVRAIKQALYGTEVQASNESGVPGFGLPPGSQV
                     CIITFDQAMHFYNLDPSLEQAQMLIMADMEDPFIPISGGLLVDPWASRHVIEGLLNDL
                     PNNFANSTVAEASLGAASRAAQGVLNGIGGQLNIFLSTIPTVGPGKLRHREDTKLYGT
                     DNEKNLFGPQDPFYLKLGNEFALAGVGVNVFFFPSQYIDVASIGYMAAQSGGQVFFHP
                     RFDPVRDGSRVMAEVQRIVLRETAYNVTLRIRCSPGLRVVKQFGEFHLHGATDIETGT
                     WDADKTFSALIRHDGRLEESREAYFQCAILYTTATGERRVRCHTLATPVSSVLGNVFR
                     YADMDSAVAYYAKEAATLALTKPLKDVRNYLTSKCVAILLAYRRNCASSTSPGQLILP
                     ESFKLFPLYVLALIKNKAIKGGNVTSDVRVFFFRLLLSQSVGSIMTLLYPRMMALHTL
                     GPSDGMPVQPAEGLSPEKQAIDDALLKVVQLPNPMRPAFMRMEPHGAYLLDNGEWCLL
                     WLGANISPRFLEDLYGVASLDELDPRMTTLPVLPTKLSNQVRSIVQGLADLHGKVSLQ
                     VVMARQNRDGMEVEFANNLVEDQNNDAMSYVDYLCHVHRVISSDMNSGREEKDASASL
                     WKGFI"
     gene            <609253..>610350
                     /locus_tag="MRET_0359"
                     /db_xref="GeneID:38737125"
     mRNA            join(<609253..609394,609436..609442,609480..>610350)
                     /locus_tag="MRET_0359"
                     /product="solute carrier family 25 (mitochondrial
                     phosphate transporter), member 23/24/25/41"
                     /transcript_id="XM_027626986.1"
                     /db_xref="GeneID:38737125"
     CDS             join(609253..609394,609436..609442,609480..610350)
                     /locus_tag="MRET_0359"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial
                     phosphate transporter), member 23/24/25/41"
                     /protein_id="XP_027482631.1"
                     /db_xref="GeneID:38737125"
                     /translation="MSCTKKDERLSSGEEQSKSPELWTSLIAGGCAGATSRTIVSPLE
                     RLKIIMQVQPPSADGKKTYPNVWRGLSRIWQEEGFLGFMRGNGLNCLRIAPYSAVQFA
                     TYELMKRIFSQIQGSSNINADGTTRPLHQLSTSEKLLSGAVAGFTSVVSTYPLDLVRS
                     RISIASASMYTSGGKSKTVLPRVPGVWETTLKVYREEGGIRGLYHGCLATSLGVAPYV
                     AFNFFFYESARSFLTKSDGTPPSSITKLFIGAFAGSVSQTLTYPVDVVRRRMQVSGMK
                     NSSLGVQDKSGLDSLRNMVAQHGIRGLYHGLLPNLLKVAPSTGAYFLTYDLVVSALKR
                     LHEYK"
     gene            complement(<610507..>613164)
                     /locus_tag="MRET_0360"
                     /note="MRES_01950"
                     /db_xref="GeneID:38737126"
     mRNA            complement(<610507..>613164)
                     /locus_tag="MRET_0360"
                     /product="glyoxal/methylglyoxal oxidase"
                     /transcript_id="XM_027626987.1"
                     /db_xref="GeneID:38737126"
     CDS             complement(610507..613164)
                     /locus_tag="MRET_0360"
                     /codon_start=1
                     /product="glyoxal/methylglyoxal oxidase"
                     /protein_id="XP_027482794.1"
                     /db_xref="GeneID:38737126"
                     /translation="MLCARFFFLMAMLNTVGSVLASGKNESFKLQYRVVAQDSLASAM
                     MLGLANEDTAFIFDKVENNKKKTASGRPTWASLVQLSDYSVRGIDATTNPFCAAGTTL
                     GNGSYIVAGGNSAISYGGINVKNSDGSMNLNGPAPPYNDMDGRRVVRMMQPNADSSKL
                     KWIDDFDSPNQMDSPRWYPAIEGLADGSVVMIGGATSGGFINRNYPNVDPVYATSSSN
                     PKAGVWDQGGANPSYEFWPRDNKPKPAVHDFMVKTSGLNMYAHTYLLPSGRIFMQANY
                     STTIWDWTKDKFHDLPDMPDRIVRVYPASGATAMLPLTPKNKYTPTILFCGGFNNATD
                     EEWGDFTAPRVNMFERAGSDDCSSITPEDADGRIKKNVGYVREEKLPEPRSMGQFIHL
                     PTGQMVIVNGASRGVAGYGNTTWNTVKDMNGNTVHLEGMSQMPTYRPVLYDPERPQGK
                     RLEYADYGSSKIARLYHSSAILVPDGSVLVAGSNPHMDVSYLPPNDQLDTKYEAFNTT
                     YALEQWYPSYYFERRPEPMGMPEVIKYGGDSFNITVDAHYMNPNKNANAMANNTKIMV
                     IRPGFSTHAVNFGQRSLQLENSYVVNKNGSVTFIVNPMPSNMNIFVPGPALLFVTVNG
                     IPSKGKYVFLGGKDLGSVPFDLKAGFTPAPLPDPVLNPHFTNEAAPYGTTYDSDEQNG
                     MSGGAIAGTVIGVILGVAVLAGLAFYVWRAKRNDDNEANYAAVRHPHASHGSQMTGPE
                     ANAGAWTRPPPLSDSSKFPLMQPNDSAISLSDASAVTPLSSDVHKTHPLSITGSHPAS
                     ASTSGASAERYNMFFAAQDSGIMTPVNSQGSHLYHNMPSSSRGPILMPEQPHWNDIPR
                     QLHGPRSMPRSNLQQHFSMAREGSMPSHQ"
     gene            <613886..>614479
                     /locus_tag="MRET_0361"
                     /note="MRES_01945"
                     /db_xref="GeneID:38737127"
     mRNA            <613886..>614479
                     /locus_tag="MRET_0361"
                     /product="glycine-rich RNA binding protein"
                     /transcript_id="XM_027626988.1"
                     /db_xref="GeneID:38737127"
     CDS             613886..614479
                     /locus_tag="MRET_0361"
                     /codon_start=1
                     /product="glycine-rich RNA binding protein"
                     /protein_id="XP_027482795.1"
                     /db_xref="GeneID:38737127"
                     /translation="MAKVYVGNLSWNTTDDGLAQAFSPFGQLTDYIVMKDRDTGRSRG
                     FGFVTFMTQQEADAAIMSMNEKELDGRRIRVNMANSRPSMMHGGLTGASLGYSGLTGG
                     YGAGAYNAAQSGFGTYAQMPTGYAYGQAYPGYQQQPYGAQMTSPVQTAPAVYPPPPGY
                     APQHTAYSYGGQQFAPQLSQVSQNASPHIQGYGNQGY"
     gene            complement(<614971..>616254)
                     /locus_tag="MRET_0362"
                     /note="MRES_01940"
                     /db_xref="GeneID:38737128"
     mRNA            complement(join(<614971..615387,615674..616196,
                     616253..>616254))
                     /locus_tag="MRET_0362"
                     /product="guanine nucleotide-binding protein subunit
                     beta-2-like 1 protein"
                     /transcript_id="XM_027626989.1"
                     /db_xref="GeneID:38737128"
     CDS             complement(join(614971..615387,615674..616196,
                     616253..616254))
                     /locus_tag="MRET_0362"
                     /codon_start=1
                     /product="guanine nucleotide-binding protein subunit
                     beta-2-like 1 protein"
                     /protein_id="XP_027482796.1"
                     /db_xref="GeneID:38737128"
                     /translation="MSESLTYKGSLSGHKGWVTAIATSQENPDLLLTASRDKTIIVWQ
                     LSRDDTNYGYPKKILHGHNHFVSDVVISSDGQFALSASWDKTLRLWDLNTGMTTRRFV
                     GHTGDVLSVSFSPDNRQIVSGSRDRTIKLWNTLGDCKFNITEDGHTEWVSCVRFSPSP
                     ENPAIVSAGWDKVVKVWELNRCKLMTNHYGHQGYINTVTVSPDGSLCASGGKDGVTML
                     WELSDGKHLYSLEAGDVVNALVFSPNRYWLCAATASCIKIFDLESKSIVDELKPEFPG
                     LGKNAQEPQCLSLAWSADGQTLFAGYSDDIVRVYSVI"
     gene            <616518..>617093
                     /locus_tag="MRET_0363"
                     /note="MRES_01935"
                     /db_xref="GeneID:38737129"
     mRNA            join(<616518..616628,616707..>617093)
                     /locus_tag="MRET_0363"
                     /product="large subunit ribosomal protein L12e"
                     /transcript_id="XM_027626990.1"
                     /db_xref="GeneID:38737129"
     CDS             join(616518..616628,616707..617093)
                     /locus_tag="MRET_0363"
                     /codon_start=1
                     /product="large subunit ribosomal protein L12e"
                     /protein_id="XP_027482797.1"
                     /db_xref="GeneID:38737129"
                     /translation="MAPKIDPNEVRIIYLRTTGGEVGAPSALAPKIGPLGLAPKKVGE
                     DIAKASSEWKGLRVTIQLTVQNRQAAVAVVPSASSLVIKALKEPPRDRKKVKNVAHSG
                     NIPLDEIIEIARTMRYKSFGRTLASTVKEILGTCQSVGCTVEKKPPHDVIEGIDEGSI
                     EIPEE"
     gene            complement(<617371..>617907)
                     /locus_tag="MRET_0364"
                     /db_xref="GeneID:38737130"
     mRNA            complement(<617371..>617907)
                     /locus_tag="MRET_0364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626991.1"
                     /db_xref="GeneID:38737130"
     CDS             complement(617371..617907)
                     /locus_tag="MRET_0364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482790.1"
                     /db_xref="GeneID:38737130"
                     /translation="MYNCMVHGYPQSPVQSHQPSPSRSIKRKFHNDEDASTSPFCSEK
                     VDSLCSQPISTPRTQQTLAGSNEFAEFYPIPKDLDQAVLASMGVGGSRQRDIPMHVWG
                     KRPQHSVPCLLEPPTNMEPMMNSDDMDENMDKAANGVHGPHCRSIPRLSVRDTGHESS
                     ELWAFCPDCHAFGKVQDT"
     gene            <618575..>619228
                     /locus_tag="MRET_0365"
                     /db_xref="GeneID:38737131"
     mRNA            join(<618575..618835,618866..>619228)
                     /locus_tag="MRET_0365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626992.1"
                     /db_xref="GeneID:38737131"
     CDS             join(618575..618835,618866..619228)
                     /locus_tag="MRET_0365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482791.1"
                     /db_xref="GeneID:38737131"
                     /translation="MTFRTETVQCTVFPIQKYSREGRVSQQAQVLGTRDEEPQAYHKS
                     TGWEHLSLQPLTCRVALHYRDPDTCITMLSVEWIPPNAVSIVLESLCLQGACSSHENS
                     SVQITYHGTRIGVRYTGEPDARACRPLRRFQLQLHDAHDTRALVSLIEHKCTCVPAQI
                     DTSISKTLTPPSTPVPVERGVHSTILTPPLRQSARSARAIRGHTFDD"
     gene            <619373..>621130
                     /locus_tag="MRET_0366"
                     /note="MRES_01930"
                     /db_xref="GeneID:38737132"
     mRNA            <619373..>621130
                     /locus_tag="MRET_0366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626993.1"
                     /db_xref="GeneID:38737132"
     CDS             619373..621130
                     /locus_tag="MRET_0366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482792.1"
                     /db_xref="GeneID:38737132"
                     /translation="MTTALTEGESRHEYPRRLSEIPVRSRSGTNIEALLRRQRKRSNS
                     RARMREKRNREASDSQWDSSSVSSGDEENGQMLEVQAKLPPRGSPTGRSAAAKPPPTP
                     PVPETAPLPPPASAPATPKLARSQSSTASIHSFFQGHTKQTAAAPVVNKQTVSSGAHG
                     VDDDTMDMSQHSATSHADEGLYMHHGGSTSSVTLDRMNKMTATGRIPIMTSLPQELDL
                     PLRRSMSTQSLHEPTGLRQSASQQQLSQLLTGQASARAPQTAASRIRPPGRIAASSIA
                     HLLIGSRHHTDKGSKPVVSRFSEPTQSASAASLERSRRLTSSGAFHGLNGSLGRVVSV
                     DVPPSSVFSASFVDRVQHHIDMDAPPTERDRMQHRYLLDYGLSGPPIDCATLSQAELT
                     PCLESGVFLEEHEQARNWHSTAPRRMLLVPDSTTTLGPNMIPFHFIHALTSTLDHALA
                     LDHAEVPAMASLLPGVSERLDDECDPTLTSSPSSREGAHYIDNISMRAIAYTAQAVSV
                     QRSHTVTRRFADPLRSSLGRVVRLSGYASQLSSMEPETHWHARHASRSPPDHVSVAAG
                     SLSEHLQTLVSQSERQARA"
     gene            complement(<621127..>622242)
                     /locus_tag="MRET_0367"
                     /note="MRES_01925"
                     /db_xref="GeneID:38737133"
     mRNA            complement(<621127..>622242)
                     /locus_tag="MRET_0367"
                     /product="UDP-glucose 4-epimerase"
                     /transcript_id="XM_027626994.1"
                     /db_xref="GeneID:38737133"
     CDS             complement(621127..622242)
                     /locus_tag="MRET_0367"
                     /codon_start=1
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="XP_027482793.1"
                     /db_xref="GeneID:38737133"
                     /translation="MAEKKRILIPGGAGYIGSHVALTVLNTRKFRVTIIDNFHNSKPE
                     AVRRIEELALRELPADATEEEKEDCRIELIQADLRDPVAVERLFADRPEHDRIYAVIL
                     IGALKAVGESSEIPIDYYNVNVGGLLHLLSAMDKYDARRLVYSSSATVYGAPETIPIP
                     ETTPMDPHSPYGRSKQICEMIIRDVCAANPKWRAITLRYFNPAGAHPSGRMGEDPRGK
                     PGNLLPLLAQMAVGKYREPGLKVFGNDYPTPDGTCVRDYIHILDLAEGHLNAMVALDN
                     DATFDHAEAGHGKCRAFNLGKGVGMSVLNMIEAMRKVTGYEFPYDIVERRPGDVPDLT
                     ANPALAERELGFKATRSLDDMCRDLWNWQKNNPNGYD"
     gene            <622382..>623740
                     /locus_tag="MRET_0368"
                     /note="MRES_01920"
                     /db_xref="GeneID:38737134"
     mRNA            <622382..>623740
                     /locus_tag="MRET_0368"
                     /product="DUF453 domain protein"
                     /transcript_id="XM_027626995.1"
                     /db_xref="GeneID:38737134"
     CDS             622382..623740
                     /locus_tag="MRET_0368"
                     /codon_start=1
                     /product="DUF453 domain protein"
                     /protein_id="XP_027482788.1"
                     /db_xref="GeneID:38737134"
                     /translation="MRVAAGLYRGGTSRGLIFSASDLAMYSQRAREYIICSAMGSPDP
                     DQRQIDGVGGGVSSLSKAAVVSVPSRDRHMVRLSKMGEEWAFPGVPWADDVARACDAE
                     TGYDAVYRFGQVPVSGGTGIDWSATCGNMMSAVAIHTYMKYWRHFRPFLLHVDPGASF
                     TKLPMRILMANSGERVTVHVPLEKRGENAWFLSSEADTHIAGVPGLAPGILVETPLPS
                     SPWPTGRPLDTLRLGDQDIRVSIVQAGLPTVFVHAADLGVSSDQIVQPAHALDTDTQL
                     HERIEALRYQAAQCAPDLQRQWSMSAPKVCLVHPRTAYTTSGGTHVPANAMDILVRAV
                     SVGNFHRSIMATALSALAVASTCPDTVVYEAYAAGGSMPCASSKDRASSLLHAFTVGQ
                     PAGTARSMVRMSKEDPTRTPTAVVMERTARRIMHGFVDVPPHELLRSKGTYFGLPSNR
                     KH"
     gene            complement(<623742..>624362)
                     /locus_tag="MRET_0369"
                     /db_xref="GeneID:38737135"
     mRNA            complement(<623742..>624362)
                     /locus_tag="MRET_0369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027626996.1"
                     /db_xref="GeneID:38737135"
     CDS             complement(623742..624362)
                     /locus_tag="MRET_0369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482789.1"
                     /db_xref="GeneID:38737135"
                     /translation="MSRLLSSVVRRATRPAGMTRGVHTSRALWRPWHEANSAASIQCT
                     ASGTVRLRQGDATWHTERDAWHAYSVAKAAAMLAAKRAPTDVPMHLPTSLDHVEVWIE
                     PLEWVGEMPSEIPDTPSRDDGGFSAESLMDPDAWMAREPQECVSETLKMPKLGAIQVV
                     CRTNAHVPTHTEAMAGCLSGCLSLCDAVHAHTGHFPTIEHVHTVAS"
     gene            complement(<624402..>627527)
                     /locus_tag="MRET_0370"
                     /note="MRES_01915"
                     /db_xref="GeneID:38737136"
     mRNA            complement(<624402..>627527)
                     /locus_tag="MRET_0370"
                     /product="centromeric protein E"
                     /transcript_id="XM_027626997.1"
                     /db_xref="GeneID:38737136"
     CDS             complement(624402..627527)
                     /locus_tag="MRET_0370"
                     /codon_start=1
                     /product="centromeric protein E"
                     /protein_id="XP_027482730.1"
                     /db_xref="GeneID:38737136"
                     /translation="MPLSCDGTGVVNGPNARENVVVCVRARPLDSDEEDGVWRVDKEQ
                     SSVVPTELHPSLARRAGSSTQASTDEDDGSHGLTTYDFCYDNLVLGHEQTTALYEANV
                     YPVVRAAMDGYNGTVFAYGQTGSGKTYTMTGTEADPGVITRAVKDVFQMIRENPTREF
                     LLRVSYLEIYNETLRDLLAGDVASKKKLKPPRIFEEKGRVVLGGMQEEIVTTPREVFS
                     LLEQGQRNRHIGATDWNTRSSRSHCVFQITIESRELDNTSQVRVSQLNLIDLAGSERA
                     ASQIDRRKEGAYINKSLLTLGTVIAKLTETPASNDVHVPYRDSKLTRLLQTSLSGDAR
                     VAVICTIALDKASAIETLSTLKFGRRCKMVVTKAKRQMVMDDKALLEKYTQEIQDLRA
                     RLESSSSDSDNVPHTPTSDADAEREAAALEVASMQETRQDLRKQIDHLTRLILTSRTV
                     AAQTPARSPLGHADADPYASPARRGPRMSDLPTRYKSGHDDADALRREIAELRSQQLA
                     EREAHKRAIRALEEEVRDWEESTKSARKQNQGAERELLRLREEHATDAAHREFRELVS
                     PPASQRDDECKDAAHLQARVAALERALSEERAMRDLSSLPERPLALPMESRSGMTPPC
                     VPIRSRSQGGSPVGGTAERVSSLQRELAEQKALVSTLSACVQSWQSRVKQQADMISRL
                     AALVVDDEEMDLETPGLSTVPDTTKPKKTRHSGIRPSDVVQGRAKIGEVESAHRNDPP
                     SGSKMMPGKLSPSALGLSEKSQDCNEDVPRPSTPPATNRSAASSAFQTKAPTHAFTPE
                     RRVKEASKPTADVKPLQPQVQVPQAVRPEPRRSAVASARSAPASAPARALPSPPRAVQ
                     PLPTPPSGPTRSLPAPPNSSVKALRASLMASADKTSMPRVHPAPSHEQRKRPPPSPAD
                     AHAALPAMPEPPSKRSAATSAPDSHAKLRARLSAYTAVASEQVPPPPRSQSGMVRGLA
                     LKPVQSMMQIPEGRRPQDAAILRELNELKSMPRVESSRVMYMPQTLPSNASMARLSAS
                     NYKTDASAYYI"
     gene            <627735..>629321
                     /locus_tag="MRET_0371"
                     /db_xref="GeneID:38737137"
     mRNA            <627735..>629321
                     /locus_tag="MRET_0371"
                     /product="GTPase binding protein Rid1"
                     /transcript_id="XM_027626998.1"
                     /db_xref="GeneID:38737137"
     CDS             627735..629321
                     /locus_tag="MRET_0371"
                     /codon_start=1
                     /product="GTPase binding protein Rid1"
                     /protein_id="XP_027482729.1"
                     /db_xref="GeneID:38737137"
                     /translation="MVSVDQENVPPSFGLGDAPQTPRRGIKRNAFASLPLNAPKRVFR
                     TYKQHDSHAVVPSVPDYDVVHSLLDEIESLDIDSGTRDHIIGIHKQSVAQPARSARRS
                     IFSRAESHRPRRMRPGHVLQHISQPLSSISIEHMRRLRVALASESPAWLHDFLQAGGY
                     ETLLAHLDSLLRMEWREEQHDDTLLFEILRCMVALGSSQTGRRALLRHAPMPFEHLCV
                     AMFEGNIPKELETRRLIIVLLHILAQEQLHSDALAQRTMHKVRDEDAACIAHAPDKCH
                     GAILAAMLLHTPSPPSKRNTVDFLQNVHEHRPLRCYVEELHRVCHDFFWIFCHEHNQV
                     WDWDNMDQRAAFAPRVPSGMTGSVEWEAIMYLTTHLCFLNTILSFFVQNDPPGARAFV
                     SELTKSNFPKVLNILRKASQTYYSALHAELAHWHSLSDQVRYADLANLRPITSKPKRT
                     PSTESKTSVRNASIYYTPLMPSEPWMPRQGVSNIRHVSTESESFRISPSIPDEPLDVH
                     SDVAQPLNILGDVEIAHVGF"
     gene            <629405..>631603
                     /locus_tag="MRET_0372"
                     /note="MRES_01910"
                     /db_xref="GeneID:38737138"
     mRNA            <629405..>631603
                     /locus_tag="MRET_0372"
                     /product="nitrogen permease regulator 3-like protein"
                     /transcript_id="XM_027626999.1"
                     /db_xref="GeneID:38737138"
     CDS             629405..631603
                     /locus_tag="MRET_0372"
                     /codon_start=1
                     /product="nitrogen permease regulator 3-like protein"
                     /protein_id="XP_027482728.1"
                     /db_xref="GeneID:38737138"
                     /translation="MSKSPLLAVMLIVSTVRGTNIAFHWPPSLRNSRHLDQVHDGRPM
                     AHDDDDESNSLSDDYSDDCNSTSSEDSFNEDAARIGYEEEERLPRSSAGSRFVRDSSF
                     SAMGRMRSTAGSSRARSQTRPRTTASPDARENSGRSRSRSRAPPPYAFPSPSHTASNP
                     KHEHGYHFASFAGFELGMLASILIPRTQQCHQRFEMTIDDLTFLGHPVAEEHQPSHAK
                     HAETSIFNLVFVFDRLNMFPSIRFVETQHWLQLYYTIIFKLTAVLAMEEARAKYVSEE
                     SYKLIQIREDALQEGSSIEECTKFCLEESTLATILRDVYRCVKKNHDLEVNINNRFRM
                     ILKIPPLLQQSNKAIKATELQPVYDIHDNIILRGDQPEPFDSTPLPLYQNAPLRSVLQ
                     EWSQSTGPFLLPWKTLLLPEDVFDPVLSRYTKSEIQNLVNMFDPSPSGFKTFAETADL
                     LQWDLYKNVYPLIRHLIYYKSAQVIDVPRLQNLYTIHPLFDAEDLPTLNDKWQQKFPR
                     MVPLNKFVTALSSSLRPFASHCRALGAGSAAFNMLVWLLREKVIAQTHVYLRLFITER
                     DQLRAVELRKNRRERQLRFPSHHADVTSPERQAPSDRSHARVKLETPTSFVPEWPTNN
                     KTSTIQNQKNVLAMDVEDDHVDDLLPQGKPCPVMIPEPARASRTESEWISALLHGRHS
                     WYSYWLIRLFPYMNGMHSVDEMVAREKIRRRDLKSLLTEFDANILHFYHP"
     gene            <631719..>634740
                     /locus_tag="MRET_0373"
                     /note="MRES_01905"
                     /db_xref="GeneID:38737139"
     mRNA            join(<631719..632320,632343..>634740)
                     /locus_tag="MRET_0373"
                     /product="ATP-dependent DNA helicase MPH1"
                     /transcript_id="XM_027627000.1"
                     /db_xref="GeneID:38737139"
     CDS             join(631719..632320,632343..634740)
                     /locus_tag="MRET_0373"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase MPH1"
                     /protein_id="XP_027482727.1"
                     /db_xref="GeneID:38737139"
                     /translation="MDEFDEFDDNVNDEILAQLDAIEAKHTNASPEADDEFADPSLDA
                     MLLHDLPPSNTSALHSEVSDSTSHGAISSASGSSGLVQQGLWGQAVLSRNNSGKSSEE
                     YSSQVQASQGQVSLAPQDGFGISSDKIWDHRAFLLQNRAKLVQKNPKNEQDALEEHLR
                     TYKAPPMKLCLDQEQAKTWIYPVNKPLRTYQLNIVKKALFDNVLVALPTGLGKTFIAA
                     VVILNMFRWYPQGKIIFVAPTRPLVTQQQQACHSICGLPWDTAIELTGSTKRSLRDDE
                     WSAKRIFYMTPQTFENDLLSTTCDPTDVICVVVDEAHRATGNYAYCKVVRHLMYFNPH
                     FRILALTATPGNSAERVQEVVTNLHISRIEIRTEDALDIQPYMHKKKEDLVRVTLSEP
                     HEALRAAWASLILKVAEPLQKHGILQSHDPAHLRAFAVRASAAAPFAQSILRQHPYLR
                     GSIHKMAIMAQNMQYLNEQSVRVFCDRVMESWGPDARGKKQDKILNSSNSAFNDLMKG
                     IERVRANPFLLVHPKMRKMLQVLKMHFARDTAHTTRAMVFCSFREVVHEIVDLLTSSG
                     IRATPFIGQASDAKGHRGLTQRQQEQVIRTFQEGKFQVLVATSIGEEGLDIGEVDLIV
                     CYDAVRDSVRGLQRIGRTGRIRDGRVVVLMTAGREESNWTQSKESYKNVQRLVRTANT
                     IALYTDVTRLMPPHVKPEPVMCEVEQPPFDASMLRQTKAKGPKRVKPQARRGQPIPKG
                     ETGRFCSAAEFSRRNDDREYTYSDTESDISGDDRPTLPSEASRPSSRSSLLRSSSLKN
                     AANLSDDPDDADISHSHAGIPLPLSRFEPHPLIGVLDNSPVREEPLFLLSPTRTPDPS
                     PSLHVPDKPTSPIRKRRRPQHTNAFICTEAERETDSEEHGDSDEKYDGPSSADENDED
                     RAAVGDFQPTQQAGYEQQAVYLRSMLSQQAPTPFKRRDRLAELLENRHAKRLSSEPDA
                     EADHYTQDSFVVDDDIVSWASSASDAV"
     gene            complement(<634750..>635720)
                     /locus_tag="MRET_0374"
                     /db_xref="GeneID:38737140"
     mRNA            complement(join(<634750..635555,635585..>635720))
                     /locus_tag="MRET_0374"
                     /product="amidase"
                     /transcript_id="XM_027627001.1"
                     /db_xref="GeneID:38737140"
     CDS             complement(join(634750..635555,635585..635720))
                     /locus_tag="MRET_0374"
                     /codon_start=1
                     /product="amidase"
                     /protein_id="XP_027482734.1"
                     /db_xref="GeneID:38737140"
                     /translation="MKIVCAQFCPQFKKVQENADHVKKLVSKISADQVDLLVLPEMAL
                     TGYVFDSFDEIEPYLENPYENMSATFSLLSSISKHLECYVVAGFPERASDQTLREFGP
                     TDIRHDARHKEEETISNAHLPRIPRKAYNSAMLVGPCGSLIKVFRKHFLYEVDTTWAD
                     EGPGFEYIELPRIGRLCVAICMDLNPYTLDTSFNKYELTSFCDRNQIDILVMPMNWLL
                     PEEDIREVNKDLAQPSVPTINYWVARCVPLWVPGLCQPGHEGHNTFLVASNRTGSENG
                     LTFAGSSSVLQFTLSESANLLGALGVDTDGLLYVSTT"
     gene            <636274..>637092
                     /locus_tag="MRET_0375"
                     /note="MRES_01900"
                     /db_xref="GeneID:38737141"
     mRNA            <636274..>637092
                     /locus_tag="MRET_0375"
                     /product="protein involved in negative regulation of iron
                     regulon transcription"
                     /transcript_id="XM_027627002.1"
                     /db_xref="GeneID:38737141"
     CDS             636274..637092
                     /locus_tag="MRET_0375"
                     /codon_start=1
                     /product="protein involved in negative regulation of iron
                     regulon transcription"
                     /protein_id="XP_027482733.1"
                     /db_xref="GeneID:38737141"
                     /translation="MVSQADLERAIHQKLGHIDTLFVSDVSGGCGQAFDVVIVSEQFE
                     GKRTLQRHRLVNDCLKDEIASMHAFSQKTYTPKQFEELKFMYSRQTPSEKPGVSAPAP
                     SFSQPTGTNVEAAKKNTKADGGIVPKIEIPTGINENIHVPELTLTPVSESKHPFRSYH
                     PDLESESASVGSVDIRHTSSLEGTGISRLHHATISNPSFWQHLRELLRNEVMQEPQDM
                     NVDDDVVSQRRNHELGGSEVEQLFEDFFLTQKNHLSANDIARIRDITGMHGMSS"
     gene            complement(<637110..>639938)
                     /locus_tag="MRET_0376"
                     /db_xref="GeneID:38737142"
     mRNA            complement(<637110..>639938)
                     /locus_tag="MRET_0376"
                     /product="F-box protein, helicase, 18"
                     /transcript_id="XM_027627003.1"
                     /db_xref="GeneID:38737142"
     CDS             complement(637110..639938)
                     /locus_tag="MRET_0376"
                     /codon_start=1
                     /product="F-box protein, helicase, 18"
                     /protein_id="XP_027482732.1"
                     /db_xref="GeneID:38737142"
                     /translation="MQVLEPAPTRHRPRLPLLSTRDPAAHMPGSKGKVECARTRQRRT
                     LLECMSRRTVLRMLSFLSFHDINNLLCADKRLRPFVNMPFFARWRKQYLKFQECEHTY
                     ERHLRAVPTQETPQDQVIDESYVLVYMESLRALHFCKPPLQMHEILYSILQSQSEHFP
                     PVKAACAFVIEWILGRVSVQNAFSRFDHAHAVELLYFLRLFLAVFRLSRYFDTDYSVS
                     QYPQSIHTLDGDCASALGHFFAPGQPVCSSGELTEEQSRFVHYQVRRNDLLCVQAYAG
                     TGKTRSLLAYAKLRPHQRFLYITFNAAAAKSARSVFPPNVDCRTMHSVALRHVLLPED
                     QELRTLRPRDVVRLLGDRIPEGKRTTEPVHDRSNALAPTTVALYILRTLDRFMQSTDD
                     HIRPDVHIPKNMSLSTDLRVEAIAEATQTLWEMICSNKSRGRMKAPCPHDAYVKLLQL
                     QPLATLRFFAEYNALLLDEAQDLSACQTAILLRARGQCGVIVVGDIHQKIYGFRGGSA
                     SAFNARLYSPTATFHLTKSFRFGSQVAALATKVLRLKAPPPWHNEEQHGVWQHPSITG
                     HGSDKVYRDIRAISKPHTRIYRTNALLTRDLLQLSLTLPENEFLFLKTSQNLSHRSII
                     DLLHDGHRLYHGDSSGMTPNSSLREFSAWKELVEHVEAEDAADGKLTLVLSLQEMIAS
                     PDFLAQLEGLDRKFCANEESASIVLTTVHQAKGLEWDSVVMANDFSPSLDACTPFSLQ
                     PQVSQLFAQDELNHMYVAITRARCELFIPNCVLQWLVVLDGLFRYRFCEKKRSRKCPQ
                     CQQVSSLVQLCEPFAGTLQFDARTETLGCLLCMRSQLSTDDDLHDFVRFIDECGVSTV
                     TGRLTSASITRYEHKMKIPSRLRSKRARLEVSSQQDTPACAGSTALDVLLPHVRAQKY
                     TNMLESKMQSIDTWFTLEQFWLSPRESS"
     gene            <640061..>641458
                     /locus_tag="MRET_0377"
                     /note="MRES_01895"
                     /db_xref="GeneID:38737143"
     mRNA            <640061..>641458
                     /locus_tag="MRET_0377"
                     /product="COP9 signalosome complex subunit 3"
                     /transcript_id="XM_027627004.1"
                     /db_xref="GeneID:38737143"
     CDS             640061..641458
                     /locus_tag="MRET_0377"
                     /codon_start=1
                     /product="COP9 signalosome complex subunit 3"
                     /protein_id="XP_027482731.1"
                     /db_xref="GeneID:38737143"
                     /translation="MAHQDLLTTDSFLAAAERALDANSASEALKQFLPDPPSKDVDDA
                     VLGPQSTGRTAELFSQSTPPLVPLVCFAAEIRGLNSQIDAASVISPLREVLSHPDLHS
                     NLLHMPRLVSQLAHAVAEKASLFPGLCATDILEQLYKVLSHEYQGVTNVHAPLLSELI
                     RTSQIQKAEHVCRGTDITKSDFTLYLPQALGFLEYLYLAGMIYLQIGAYDEALHMWET
                     AVSLPLEPVQAHQCASLKRAILLRLLRDGSIPSAETFFPFLDAVACSNYKRECNVYFE
                     FAQAYGAYVLDSQNLLCDLVENSKLGFEGDNTLGLVEQCLQARPKHAICSLARVYKTF
                     PLSHLTVFLGLESHEATFYHLQELSADETIQYEVTEWDLPNHLHSIPVPDGVLSMDAG
                     RELVHFTQPTSNAQAFHQSLALALVSETRSSTLLKNDLTNIVLSQDVMSRILSFSGGT
                     TFATDNREDDLMADT"
     gene            <641591..>644800
                     /locus_tag="MRET_0378"
                     /db_xref="GeneID:38737144"
     mRNA            <641591..>644800
                     /locus_tag="MRET_0378"
                     /product="sister chromatid cohesion protein PDS5"
                     /transcript_id="XM_027627005.1"
                     /db_xref="GeneID:38737144"
     CDS             641591..644800
                     /locus_tag="MRET_0378"
                     /codon_start=1
                     /product="sister chromatid cohesion protein PDS5"
                     /protein_id="XP_027482726.1"
                     /db_xref="GeneID:38737144"
                     /translation="MHRLRFKENLQANGISASALSDRLQRLHEELKEIGQGDLDTSQL
                     DPYCQELIKPSFIRHKDKGVQALVACNLADILRLYAPNAPFSQAEIKILFRFLLAQLV
                     SPSAGLANADHPLYKEAVYVLDSLSTVKSVVLICDLPSAGDLITEYFQKLWALITEKL
                     AKNVELAVIDVLVQLIDECATIPQPVVELLMSAYSQDPHSPTYMASTSICQATQDRLQ
                     KHVARYFSESFLETLESNDDDDEDDKVIALEQLHQQIVNVAEAAPSLLTSVVPNLESE
                     LHSDRVHVRLLATRALGTLFALSSNVSEGFATLHSHVWKAWLGRAIDKHAPIRICWTE
                     FAVKTLTQHSELVSAITPILAARAVDPDEHVRAKLAELIYNLDYDTMCHHIPLRIFQE
                     LAQRGKDRRATVRNRALDALGRSFSLAYAESGSASIFADKFAWIPGAVLNCNLTGSCD
                     VTRSVLHTWETYIVPPNDPSYAQRLHTVTSLLDDNERSVFFYLTNLRLSRPTALDVYV
                     ECCDGKDSSRLSACIQAIAAILNDPDVPNVLHSFANEPDEFLLNSMRVCFDPSTPLSK
                     STQTRHEAISYMQEKLPEMINVLSECLWTGSFPILNVSCIQPLLELQSTQLLRFIAQH
                     APYLLKDYSGILTQRALDEPVSSLALDLLASLAAFDPTSFSVSESFVAYLTKQATRSY
                     AAAKLISCISPDLVAQQVTYIKELLEHESNDASADVLEALAAFLDHSSVEHIPSLDTL
                     VEHILHRIVLAPWPNHEPELDTEWIDDDSMPLPLRTRLGSLRVLTQWCCVQKKADLVP
                     PVLKLLWILLGTGEVHRDQHIPLGVRSRLRLFAAQCILKLATCDAYASLILPRMGRLS
                     YALQDECFQVRMHLLHDLLLYLMRDELPTEFHAAIFLVAFDPEDEPRVQVASYTRRLQ
                     VLPPIVRHERLERIIVRFLHLLAHHPDLNAESPQTLCSFARYLEFYLACVACETNIGV
                     LARFSACVRTYIDLSLSEPSVENSRPLYAMAELAQFLIQRLADNHGWTIYPVDEEAPC
                     PKDILRSTGTIARSVLDGEVWELLQQQPRRHRDKKTKVA"
     gene            complement(<644825..>648391)
                     /locus_tag="MRET_0379"
                     /db_xref="GeneID:38737145"
     mRNA            complement(<644825..>648391)
                     /locus_tag="MRET_0379"
                     /product="PHD finger and SET domain protein"
                     /transcript_id="XM_027627006.1"
                     /db_xref="GeneID:38737145"
     CDS             complement(644825..648391)
                     /locus_tag="MRET_0379"
                     /codon_start=1
                     /product="PHD finger and SET domain protein"
                     /protein_id="XP_027482725.1"
                     /db_xref="GeneID:38737145"
                     /translation="MITASESAENIRPLPDAQSVIKQRQHAEEAISKPIPLAPMMGSF
                     MHSENGTTSIPSHQDMPSPPKQEADTNDQGTDEETGVIRCICLCDDDDGFTIQCDRCL
                     VWQHCACFGMSHSSVPDEYLCEQCDPRPVDSNYARAVQRRRLQEEARKSHRAKHTTSS
                     AASTLFESAANAAWESAVHGTKVPVPRKKRQSSRSPQTRPVPDHETVDDLDLNATSSS
                     RSKPRNKRSRSHTRKSVAGPSPSKGSDDEEIPMKFESWQIEFTNIDSNHIREPNILQV
                     IATHLFHWTGRSPLKATPDESGFFVAPLRCSTVLPPHEQQRKLLPSGLAAVGFETIPV
                     EIHCKSLTELSTHPLVRTISDQVTGSFFNNISHLQPLPSEPQNVWSASKAFCRPSMHG
                     LFSDTYIPAGAFIMEYLGELYSADTYRSNPINQYAQMGTTKPHVHLFPQPLNMVVDAR
                     MYGNSARFARSSCHPNAVLRSIFHYDGSSDIPRLSFGIFAISAIPKSQEITLGWEWDD
                     HHIVHILPSLARRPWAMDDATRLRKSLSPKEEMMLAAEEFSARGDFPYGSTILARKFN
                     AILSIILSYTTCGCVGPSLGGSSTNSLHTRRQNCAVTQMLRASQGMPLLYTSPSPRNP
                     RMKPIAFEPLVGVFRHWVPDLNMDPTTHLCAKISQNECFVQRVPYSDEPPNAWDSLHN
                     KPESEHESDTESESGASTATEIVSEDYPYASENEDALVKEALRHLEQQSRSILPLKKR
                     ADRIRTKDKMSGNDSRRISNLASRSDTISPPNEQKNRSLSKVTPASQSGLKRQKRHLD
                     KVDFSSSDEEGAPVSPSRHIRKKSMQSLAGKHTLKREHSDLTGSPQVRPVASPSPQLG
                     PVRPMSPTQSRSGSVTPPLLSSSASKRPSVDSQTAATPAVSVAASSPLETNTSIQRRE
                     SSVMSGNSSLPPAPPKRLSLAEYKKRLSSRRRPENQVQSEAADTPTAPSKIVSFDSQR
                     EKPVRNDGALDLPIHDPISLQAAPSSPVSSSLPSMERSGIRSVIIPRSPPQGTAYLPS
                     TTNLNEVSSGAVLDPLSKSSELNSGTMSRAPTLPVASSSSLLSNLEKDSVPTKGGSSL
                     VQSSLPRSLPVESPSARLHASAPLISSLQTHAPPPGPPPGPPPPMPPRLRAAQNRVDE
                     RNRQAHTNSSAQSTTPDAHDLRALQASRHGTGSNCSSWRPVH"
     gene            <648742..>655224
                     /locus_tag="MRET_0380"
                     /note="MRES_01890"
                     /db_xref="GeneID:38737146"
     mRNA            <648742..>655224
                     /locus_tag="MRET_0380"
                     /product="pre-mRNA-splicing helicase BRR2"
                     /transcript_id="XM_027627007.1"
                     /db_xref="GeneID:38737146"
     CDS             648742..655224
                     /locus_tag="MRET_0380"
                     /codon_start=1
                     /product="pre-mRNA-splicing helicase BRR2"
                     /protein_id="XP_027482947.1"
                     /db_xref="GeneID:38737146"
                     /translation="MAPKNQRDLSGYRYSALSSLVLSAGHRQDQNEPTGEAESLVGRI
                     DPKSMGSRVVKSQVQDVERKRKVAESDDYGMVKKRNWNPGTAQYANVLQASAELDGLR
                     YIPRTDETRSVYELVLTMIQSALGDQTTEVVRSAADTAIEILKDDSVRDLDKKREMET
                     FLGPLPEEKFSQYVNLSKQLTDYEEDTSAHAETSTGVDDEAGVAVLFDNEEEESNPDE
                     ETYVVREASDDEDDQNSERNEAAEEREIHDTSDLATNEEDLVLGGTAETTSSDLDVHD
                     IDAYWLQRILNDCYSDPVESGEKTDAALEILGAETDIRECENSLMALFDYDHFDVVQT
                     LTKNRDIVYWCTRLSRSNEDERMDVEVAMRERNAGWILKRLAGDAAKPALAADELEEA
                     KRQAHRLTSRATLAPGSTAAPRLTLDLESMAFSEGGHLNSNPKVRLPAGSFKRSKKGY
                     EEIHVPPPEKRSVLPEELVSVRQLPSWAHAAFPNTTTLNPVQSKCYPVAFGSDEPMLL
                     CAPTGAGKTNVAMLTILRELGKWRNEDTGAMDLTECKIVYVAPMKALVAEQANHFRSR
                     LEPFGVVVNELTGDSQLTKAQIAETHVIVTTPEKWDVISRKSSDTSYTNLVRLLIIDE
                     VHLLHDDRGPVLEAIVARTIRRMEQLNDPVRIVGLSATLPNYQDVAAFLRVNTASGLL
                     YFESNYRPCPLRQEFIGLTETKAIKRLQLMNEVTYDKVMEHAGKNQILIFTHSRKETA
                     KTAKFLRDSAEAREALDVFLPQTGTSRDVLREAAEDAQDANLRDLLQYGFGIHHAGMT
                     RADRELVEDLFAGRHIQVLVSTATLAWGVNLPAHTVIIKGTQIYNPEKSRWCELSPQD
                     MLQMLGRAGRPQFDTVGEGIIITQYSELQYYLSLLNQQLPIESQFVSRLADNLNAEIV
                     LGTIRNRDEAVTWLGYTYLYVRMLRSPALYSVSPDYTVDDPFLEQKRADIAHSAAVLL
                     EKAGLLRYDRRTGLFTTNELARIAAHYYLTHTSMGTYHKHLKSTSSAIELLRIFSYSD
                     EFKHQIVRQDEKLEIGKLRERVPIPIKEGIDEPSAKINALLQTWISQLSLEGYALSAD
                     MVYVTQSASRILRALVEICVVRGYARTMRYALDLAKMTERRQWGSMTPLRQFPGVAPD
                     LIRRLERKEFPWARLRDLEPNEMGELIGIPRAGRLLHRLVFQFPHLDLQAYFQPLTRS
                     LLQVHLTITPDFEWDDRIHGGAQSFWLLVEDVDGEVILFYDQFVLLRRYATDEHTVSF
                     TVELTDPLPPNYYISLLSDRWLHSEVRLPISFKHLILPDKFAPPTPLLDLQPQPLSVL
                     GAEAASLYAFDHMNKIQTQAFHALYETDESVLLGAPVGAGKTFCAELALWRLWNTGGG
                     RAVCILPYASMVQPRVLAWKARFPTKETVALASETSTNLRLLEQADVVVATPEQWDVL
                     SRRWRQRRNVQSVALYIFDDLHLLSDAYVGPTYEVVGSRARFVAAQTERPTRYIGLTA
                     PLANATDVAGWLGATQTLSFAPSARPVPMEVHIQPFNVPHFPSLMIAMAKPAYLAIME
                     YAPSQPVLLFVPTRKQTKLTVNDILAYALADSEYETGESPFLNMEREDLKPHLDRVQD
                     EELAEVLTYGIAFYHEGLSKGDRRVVERLFNAGAIQVMVASKDTVWSLPVQAHLVLLL
                     SLQTYEGREHRYVDYALTDMLEMVGKCTLPDEMGRSRCMLFCQANRKNYFKKFLAEGM
                     PLESRLGTYTQDFLNAEIVARTVQDKQGAVDMLTWTLMYRRLPKNPQAYGCQGRDMEH
                     IGDFLSELVENTLVDLEQSKCVAVENDMDLSPLNLGMIASFYNVSYATIDVFHLSLSG
                     TTKLRGMLEIVSSASEFETVPIRRHEDVLLRRIYDRMPLKLDKIQFENPFHKTFVLLQ
                     AHFSRLTLPADLAQDQRDILNRVLTLLNACVDVMSSGAMLNAIVAMEISHMCVQAVWD
                     RDSPLRQVPHFTAATIQRCQARGIHDVYALADVLPDMSQHERDELLQLNKRQLADVAT
                     LTNEFPYVDIEFDILDKEKLDSASTIILQAKLERDVDEEEEEPSDPTAIAPFYPSPKM
                     TAWWLVIGDPGTNSLLSIKRVTIAKTLDVRLEFMLPAGMHDKLKLYLMCDSYIGADRE
                     LEVPALHVAQGEEDEELDDEDNIEMPDA"
     gene            complement(<655241..>655828)
                     /locus_tag="MRET_0381"
                     /db_xref="GeneID:38737147"
     mRNA            complement(<655241..>655828)
                     /locus_tag="MRET_0381"
                     /product="protein DJ-1"
                     /transcript_id="XM_027627008.1"
                     /db_xref="GeneID:38737147"
     CDS             complement(655241..655828)
                     /locus_tag="MRET_0381"
                     /codon_start=1
                     /product="protein DJ-1"
                     /protein_id="XP_027482948.1"
                     /db_xref="GeneID:38737147"
                     /translation="MSKAVVFLTQGTEEMEFTITYDVLVRGGVNVTSVFVPESGKPAA
                     PINGLVVASRGVKLGADTTLQALLQNDNVDQYDAYVVPGGAGAIHTLSKDENVLKILH
                     HAHACGKVIGMICAGTLAALGAQIGLKGPITSHPSVKDQLDALYEYKDSPVVVSDNFV
                     TSRGPGTTFLFALTLVEKLVGLEKRNEISGPMMLV"
     gene            <656041..>658071
                     /locus_tag="MRET_0382"
                     /note="MRES_01885"
                     /db_xref="GeneID:38737148"
     mRNA            <656041..>658071
                     /locus_tag="MRET_0382"
                     /product="long-chain acyl-CoA synthetase"
                     /transcript_id="XM_027627009.1"
                     /db_xref="GeneID:38737148"
     CDS             656041..658071
                     /locus_tag="MRET_0382"
                     /codon_start=1
                     /product="long-chain acyl-CoA synthetase"
                     /protein_id="XP_027482945.1"
                     /db_xref="GeneID:38737148"
                     /translation="MSKQGHKASVQVSPGEGAFGPIYRSFLSPEQLVERPHEGIHTMY
                     ELMEEARKRFGDKKNIAWRDIVDEHQEQKVVTKKIGDEEVKETKTWTYYELSPYKYIT
                     INEFFKTVDEFASGMHQLGLNQKTVFNIFASTNVSWQVAAQSCFRQGITFCTSYDTLG
                     PEGLQVSLEEPEVQGIFTNAQHLKVLEKIIDQTPLLRVVIYDGEADENILNRIHSKIS
                     GRPNAVLIHYDEVIRNGKQNMVGPAPTQGKDVACIMYTSGSTGKPKGVILTNDNLIAT
                     IASVTMLLKPYLNQSDSYLAYLPLAHILEFVVECYMMYYGIAIGYGRVKTLTSNSVRK
                     CEGDLVAFRPTLLVGVPAVWELIRKGIVSKVQAASATKKKLFDMSMWAKSNNIPLFKQ
                     FAESVVFKSVRAQTGGRIRYALSGGAPIARETHQFLNTALTTIIQGYGMTESSAMCAL
                     MTPEFFCYGSVGCPMPSVEVRLVDVPEAGYFANKNPAQGEVWIRGPSVTQGYFKRPEI
                     TEEAITKDGWLRTGDIGQWDEQGTLSLIDRKKNLVKLSGGEYIALERLESTYKACNFV
                     SNLCLVASSDAKQPMAVVFPREDNLRAALEDNNKKDIAHLELSNLCHDKVVQNMMLKK
                     LNEVGKEAGFANMELLQCVVLIPEELPLTAAQKVQRKEVEKKYADLIKKVYP"
     gene            complement(<658162..>660351)
                     /locus_tag="MRET_0383"
                     /note="MRES_01880"
                     /db_xref="GeneID:38737149"
     mRNA            complement(<658162..>660351)
                     /locus_tag="MRET_0383"
                     /product="serine arginine repetitive matrix 2"
                     /transcript_id="XM_027627010.1"
                     /db_xref="GeneID:38737149"
     CDS             complement(658162..660351)
                     /locus_tag="MRET_0383"
                     /codon_start=1
                     /product="serine arginine repetitive matrix 2"
                     /protein_id="XP_027483004.1"
                     /db_xref="GeneID:38737149"
                     /translation="MQASGPSPEAQADALLLHFLSPLSDSDTPSWSDALSQAVKERRG
                     LAVGGQLLVDRLLQEAGVSSSLFPPSSPSDAFVLMVEVFTSAAPDLLKSELMYYLGLE
                     HNHIQATQHASAMAEYLHLPASNCTEVESYWAIDHGFFDRAVAGGRTSKFSSIMAESL
                     SSSPALLLEFYEVRGALPSIESSNDAASFHELSMIVAALARVEGLVSAWLMCRTILAA
                     QPTDYAPSVRLHLFGTLLRLCFSPPDATLIRDLLNLPLKTDEEAFIESFAIDSLDQSH
                     GALAMDTLLIKCVNQGRYIDAIHLDHRASRHERTLALSGQENEFYLRAKQRRSAFMDG
                     VWAVIPVIQRDALHAQDVKEDISSEATHTNDVNMDIASSPPLRPHTPMSASLNSKDMQ
                     RTHPFSPEVNLLRASIRVPTASSSETRSASPAQKLTDQSAELRSSSPFSGWKQPGVLR
                     QTHVSPKPAWSLPVPRIMRTSKSYDLNVDIPVSTIDSNVQDNAKSDDADTDILKDTPV
                     LESNATEENDAVLDSPREVPVRRRTGQRRSARQATKAIRKVMKPSDVKPEPTIPGGFP
                     MEEEEATVNPSPRRSTRRSRMNVASKTVNEMSTSLSMHPDTPSKSPSTTSRIPRSSTT
                     ADITMYPQNSLARLEALSDVQPIARRTRAQVAELESQGSQSSTDAISDTEAESNVLST
                     PSRRRTRSERASAAALSSPQRVTRSARRLRDGSAGTPRTPGRSSRRH"
     gene            complement(<660541..>664200)
                     /locus_tag="MRET_0384"
                     /note="MRES_01875"
                     /db_xref="GeneID:38737150"
     mRNA            complement(<660541..>664200)
                     /locus_tag="MRET_0384"
                     /product="hydroxymethylglutaryl-CoA reductase (NADPH)"
                     /transcript_id="XM_027627011.1"
                     /db_xref="GeneID:38737150"
     CDS             complement(660541..664200)
                     /locus_tag="MRET_0384"
                     /codon_start=1
                     /product="hydroxymethylglutaryl-CoA reductase (NADPH)"
                     /protein_id="XP_027482951.1"
                     /db_xref="GeneID:38737150"
                     /translation="MVKFDRSSRRLSTSPLQALLYLVSKVSRHPIEVIVSVFVLVTLA
                     YFVLLRAIANSTLFSSLSDVASLSVISTHVGHSSLPIFEYSPEHVWRSLRDSIESPDQ
                     VPDMGFADWLIVVDEHNGPATLQQERRESLLPAITKALQAESHGRCAWPVTRFTDAND
                     TVGDVVVCFEPKSYDASNTRHILSPKTLQRVLAHAMQTLPANTDSDLVERWKRGDILL
                     QSLTPTSHGPKALAGEGISFQWIASFVISALRRAWTLVHRSDTIDFTVLLAAYIMMHG
                     SLVHLYVSMRHFPRRFWLGTCILLSSCFACLVALVTADALQLPINPIVLSEGLPFLVI
                     TIGFEKPYLLTKAFFAHATPTLRPDQDTSTLKGSPEDDFVRALTQRVHEEQELGVLTA
                     PFAPVHDVAIRAVAQAGPGILRAYAVEICILMLGAFNGMHGLREFCSLSILILFFDGC
                     LLFTFFLAVLCVTLEVQRIREPNSARKCLLPENDKETPPSEAPAEPQHLDSSKRKRAT
                     TSLFRRVFGSLDHPLSRLKLLLLLTLVALHSLNLLSTLSLPTTIARHQSTRPLTLYDD
                     VVSSFDMFNATSSHPAVSAFFDAYTPPKTNAVAFMPPNIIVLADKALATPHSMTASMM
                     THKMPRNSALDSVMTTWTTVSSDPVIGKLLSVALIISLFLNTFLLKGIATRNPAVIEG
                     NAVYVTAQAAARLIGAHFVEDWKKKPKDEDKSSTPRVSFGPPESRAPPPPPSDPPRPF
                     EQVHEVFKSDGPGALNNEEVVLLVQRGVIAPYALEKVLQDLERAVVIRRAVLSRASEM
                     HTLEHSLLPYKDFDYASVFGACCENVVGYMPLPLGIAGPLIIDGLMTPIPMATTEGTL
                     VASTSRGCKVLNANGGVTTVLTQDAMTRGPVIEFPSLTSAARAKRWIDSAHGASSIKS
                     AFDSTSRFARLASLHTVLAGRTLFVRFATSTGDAMGMNMISKGVEAALGMMKEKHFPE
                     MELLSLSGNYCIDKKPAAINWIEGRGKSVVAEAVIRGDSVRKILKCTVEDLVNLNIKK
                     NLVGSAMAGSIGGFNAHAANILTAMYLATGQDPAQNVESSNCMTLMEAVNHGEDLLVS
                     VSMPSVEVGTVGGGTGLPPQRSMLELLGIQGPHKNTPGANAQRLARIIAAAVMAGELS
                     LMGALCAGHLIKAHMQHNRSAPPTPGHMSPMPKDVQYKPTMTPLIATPIPSTYQQQGL
                     SPVSNTPQEKEAHDT"
     gene            complement(<664340..>668128)
                     /locus_tag="MRET_0385"
                     /note="MRES_01870"
                     /db_xref="GeneID:38737151"
     mRNA            complement(<664340..>668128)
                     /locus_tag="MRET_0385"
                     /product="protein TIF31"
                     /transcript_id="XM_027627012.1"
                     /db_xref="GeneID:38737151"
     CDS             complement(664340..668128)
                     /locus_tag="MRET_0385"
                     /codon_start=1
                     /product="protein TIF31"
                     /protein_id="XP_027483005.1"
                     /db_xref="GeneID:38737151"
                     /translation="MASEPEQEAVATPTTFELELLLPKRPLLPKNVEALGLPETPSPL
                     RVAVSQHETLNDLRATLNDSPEGYWLGAFRFRRTDSHARPGELVNEWDELHDVFRDDA
                     PEQRVLQVSHEPYNDTEVRLHIQRLRDLLAGTHSDPASVSLDAGATVHDAVCHPAEWA
                     NEAHTAAPPKPTWRGWPADGTSQLFPSLTRRVRALPRCLHGLSLSAWNPPPKPLALRG
                     DILYLVADTLEGESLHITASVHGFYVNASSSQRFQPQPHPHKTLRSSSLFDLLAAASP
                     QFLQNFARLFNDPVSTRDYFSALPVMNSLPAAPWLAREPRHEPDAMRAQTAFLLSGAM
                     SADTLDGSRDWNEELQSSRELPRTSLAERLMRDRVLNRLHAEFTLAAARVVPRVAAGD
                     VPPMNPADAPAAHMFLFNNLFVTRGIDSVGMYDYLGGDAAAHVAVGKDVQGVRTLGVL
                     DVEGVGLLGTVVVDWLGERWVVQTVLPGLFRQVAAEAAASQTDGATASHVAYGGIEGP
                     DTIHSDPAFHELLRNVGKSLHVAPHRMRDAQGTEHELCLSVDCKGLRGTDGRMYVLDV
                     SRLCPMDVHWFERDLHGPVLEGSESPAYPHRLPLLRPELIQTYWETQLHDFARSKLSQ
                     TQQEGQTRVDVSDFDLHFHPDAFAEFRTGSGDEARVIRPATDESDPSIAAVRTVSTHL
                     RDTVIVRLVSDVAAGLASASDGMALTQQMHARGINVRYLGYIAHLCQPSQRSRWDETV
                     VSKLSSGHEALVSAYRRVALHEMIVRSAKHCLRAYLRGVERTDAPACIAHFANCLLGS
                     DLEPQPQPAPTESKAAWTSLTPAALFDELRADIRRRFRFELPPLYLETDLRKPQVLRA
                     LCLKMGIQLAVRDYAFEPTPASQTPASTGPAKKNKRTVPMPAPKLQRTTTFVPEDVVS
                     LCPIVKLSTPKSTLVEEAFDAGRVTFARGEREIGTELLLESIGFHEQVYGLVHPETAK
                     CYSLFATFVHHYWVEFARDAAKKKAEKKEGEADDEEPLPELVKETFQIENALRFQRQA
                     VTVSERTLGLDHPDTMVHYINLSALERSAGHFDVALRYQDRIMELWQLLYGRDHPDAV
                     HTLSSIALLLQSRQDFDTSLQAYQSSHDLALRLFGPDSIYTGNMAHELSQAYTLSGDL
                     KTAIQVEKDAWRIFQDRLGADDALTQESQSFLSALASSAVRVAKLESAAKQQHAHDIV
                     RAASSSRSAHTQRTSSHVHANPALANRSLDELVDYIQGAPGTGTSRAARKRAARTKKT
                     "
     gene            <668267..>669619
                     /locus_tag="MRET_0386"
                     /note="MRES_01865"
                     /db_xref="GeneID:38737152"
     mRNA            <668267..>669619
                     /locus_tag="MRET_0386"
                     /product="ESCRT-II complex subunit VPS36"
                     /transcript_id="XM_027627013.1"
                     /db_xref="GeneID:38737152"
     CDS             668267..669619
                     /locus_tag="MRET_0386"
                     /codon_start=1
                     /product="ESCRT-II complex subunit VPS36"
                     /protein_id="XP_027482949.1"
                     /db_xref="GeneID:38737152"
                     /translation="MEAWEPWAVEAASPALVRGERVLATQHGVGLYAGDTKVAERSAG
                     TAMLTTHRLAYVDDARPRERSAYVRLARIRQSEYYAGFLKSSPKIVLVCLREAHVPWT
                     CHVCGTFHDTMTLDRRCRLCGVMVRHAPTQRACPVCTYVNGENTLRCEMCTASLDATV
                     TTTCKLSFRHGGERPFYAALRDTLQSKPWIATETKSRPGLLAVEAASAVEAPPLDALA
                     DLDMLMRQARRMVDFAESLRTELERYERTAPTSGAASSLLQSALVRIGLPSPAVTPDM
                     VKNERAYHRELARELSGVLLGEHGLLGPCDQDTGRGLLPLDEVWGLWNRARGVALVSP
                     KLLRAAVTYLPDMTSPSVRLRTLRSGMPILYTPRFDDAAIEERVLRYLDEAPFLTTTQ
                     VAALEGLSAPLMRELLEGVEQQTGAVVRDECGTKETRWCRNRMATMAAGPRRSSCTVP
                     "
     gene            complement(<669573..>670586)
                     /locus_tag="MRET_0387"
                     /note="MRES_01860"
                     /db_xref="GeneID:38737153"
     mRNA            complement(<669573..>670586)
                     /locus_tag="MRET_0387"
                     /product="2-polyprenyl-6-hydroxyphenyl
                     methylase/3-demethylubiquinone-9 3-methyltransferase"
                     /transcript_id="XM_027627014.1"
                     /db_xref="GeneID:38737153"
     CDS             complement(669573..670586)
                     /locus_tag="MRET_0387"
                     /codon_start=1
                     /product="2-polyprenyl-6-hydroxyphenyl
                     methylase/3-demethylubiquinone-9 3-methyltransferase"
                     /protein_id="XP_027482950.1"
                     /db_xref="GeneID:38737153"
                     /translation="MLSVSRRLGVHGRLIGRAMHTASSVDPRDIAHFSRLADEWWNEQ
                     GEFAALHTMNRVRVQFMREKLQEVRGWDRAVAEALGRDVPLPLNSPDFLHGCSMLDIG
                     CGGGILAESATRLGACVTGVDASADNIRVASVHAARDPSLHVRERAEDHVPASLAYLA
                     ASAESLAGRTYDIVTAMEVVEHVNQPADFLRCLASLIKPGGHLFLSTMSRTVFSYFLT
                     IFLAEDMLRVVTPGTHRHSQYIHPFEMVDFFRSLGWIPGERDVLADRPLLPNGTPIAP
                     LPPRLQYETRGTMYVPGLGQWILVPPRAVPNGSSSWLPSCLGGGIRPTELCNYFFWVR
                     RPW"
     gene            complement(<670601..>672788)
                     /locus_tag="MRET_0388"
                     /note="MRES_01855"
                     /db_xref="GeneID:38737154"
     mRNA            complement(join(<670601..672584,672616..>672788))
                     /locus_tag="MRET_0388"
                     /product="glycosylphosphatidylinositol transamidase"
                     /transcript_id="XM_027627015.1"
                     /db_xref="GeneID:38737154"
     CDS             complement(join(670601..672584,672616..672788))
                     /locus_tag="MRET_0388"
                     /codon_start=1
                     /product="glycosylphosphatidylinositol transamidase"
                     /protein_id="XP_027482953.1"
                     /db_xref="GeneID:38737154"
                     /translation="MPSHTPPSLRQRNKEHVNSSREDEVYHAPTPDDRRTLLRLARRE
                     RLYNRIVGLSPMLRVLLIVAALVWLALLPVPRKPFTHRTYVDENALQPGYAEARWGAP
                     NVHEADRISAQLHEIARQDDKDARIAYLVQELRSYDLDVHTQTYAFYVPGQPEPIQGT
                     NVYARSYTPRTDGRVAMILAANWQSHWRQKPSDSSELPYVPDDGTYRAINVRGIALLL
                     AYAKHAASIPHWSKDYLFVISDGFLDGMQAWAAQYFGTGQPNLEAEAVHTTGAQVWNA
                     LALDYPADSFSSFNFYYEGRDGLLPNLDTINTVTDITRLTYMSPSLGLHGESADEMEL
                     GRFHVDALRSWLPVDWLERHWLGRHGVKSFVSGWVSILRQLRYQLAGRPSGIHGVLLP
                     FHVDAITLFARPAPGPFGFQQLGDITELTFRSFSNLIERLHHSQFFYLLPSPWYFVQI
                     GVFILVPLLLGAALTFTGLSVWVQLGARRQKQCEALRRPYTKGRAVLATPTYAEFAQL
                     CTHESLRALFRAHSRPVLPALLCMGVAHIVCAACWALWTQTPAGPQALVGTGMLCIAA
                     TITMVYVASRFASSRHALGMCLHAFALLHAGMVVSVLAPLNFAQATAMAMLLCLTLYS
                     VPTAPSRCRAVAHALCLMVVSPPSLVALLHEVCPRLLTHTPAFVPHIAPVIDRLLWDY
                     HVLRTSALPILCLVYAPIVLEGCAACLLYSAQDCST"
     gene            complement(<673019..>674416)
                     /locus_tag="MRET_0389"
                     /db_xref="GeneID:38737155"
     mRNA            complement(<673019..>674416)
                     /locus_tag="MRET_0389"
                     /product="polyadenylation factor subunit 2"
                     /transcript_id="XM_027627016.1"
                     /db_xref="GeneID:38737155"
     CDS             complement(673019..674416)
                     /locus_tag="MRET_0389"
                     /codon_start=1
                     /product="polyadenylation factor subunit 2"
                     /protein_id="XP_027482954.1"
                     /db_xref="GeneID:38737155"
                     /translation="MSTGVAYWQPSKYLDAPKPPPPDARDREEEAATATALAAGYEGR
                     RARRYVQRRTVDYWGTVPLWMRHRACRGVARHDAFLRPSPHQVIGLLPPSAYEESATS
                     VASVPVHISTNKVRCSVNIVRWLPEARRLLTGSTSGEFTLWNGLMFNFETILQAHDSA
                     VRAMEWSHSGSWLVSADQNGQIKYFQSNMNNLQAFPGHRDAIRGLSFAPDDQRFVTAS
                     DDSTLKIWSFDEAQEESTLKGHGWEVKCVQWHPTQALLVSGSKDNLVKFWDPRSGVDL
                     GTFHGHKNTVQSVRWNPDGHIVATASRDQSIKLYDIRAMAELYTLKGHSKEVCTVEWH
                     PIHHDLLVSGGSDGSILHWSLRSSIPESPIHVMPSAHESNVWSLQWHPLGHLLASGSN
                     DHTTRFWSRSRPGEQIEPEHGALSSTDRTDGDEDVIPGLSKHADDVPDVAPSLGASGA
                     WARPARRIRRGPGGW"
     gene            complement(<674630..>676312)
                     /locus_tag="MRET_0390"
                     /note="MRES_01850"
                     /db_xref="GeneID:38737156"
     mRNA            complement(join(<674630..676119,676168..>676312))
                     /locus_tag="MRET_0390"
                     /product="phosphoinositide PI4,5P"
                     /transcript_id="XM_027627017.1"
                     /db_xref="GeneID:38737156"
     CDS             complement(join(674630..676119,676168..676312))
                     /locus_tag="MRET_0390"
                     /codon_start=1
                     /product="phosphoinositide PI4,5P"
                     /protein_id="XP_027482871.1"
                     /db_xref="GeneID:38737156"
                     /translation="MTDAHSTLTRATTASRKSTIASRNASLIKKNTGPLELRPSDILI
                     ERFTGWKNIVKMLISYFEGISDIEYNTAKEMTKLGGVIQVPFREGNQFLGEDGLQDIF
                     YSIREKTRTISDHHANLAKTVEGSIVQHLHKLRQEIKAHIANVQQDTGKLANMVARER
                     EVSTKMISDLARSITLLKNTPMSVSPREDPYTANQAVSIQLQRQVNEENALQKSIIIM
                     QQNSAHFEEAVVRSIQSAWQTFDEWSGRMSAQVQDTWLGLGVHMRSLEPNAEWIAFAS
                     RSDHLLDPDTPLRNPETIDYPGKEDPSVIPVHQGMLERKKRFTNAYKESFYVLTPAGY
                     LHEHGSSDPIRHPVPELSLFLPECTLGAPSTAAASTHKFHIEGRTGQQANMFGTNVAY
                     TFRARSHDEMMEWWNDIKQLSKVYLTTSEQMDRSGPVPAAVRAAGYRDEDEEELEDDE
                     EEVEEEDEEYDEGEYITTHHHFGAAPAIPSTVTSAAPVTVLDDLRRHEQVPLYSGPAQ
                     GSNIEMGANGYALEKKPQPAEPSTADRAEEVAHISS"
     gene            <676734..>676991
                     /locus_tag="MRET_0391"
                     /db_xref="GeneID:38737157"
     mRNA            join(<676734..676775,676812..676851,676879..>676991)
                     /locus_tag="MRET_0391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627018.1"
                     /db_xref="GeneID:38737157"
     CDS             join(676734..676775,676812..676851,676879..676991)
                     /locus_tag="MRET_0391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482870.1"
                     /db_xref="GeneID:38737157"
                     /translation="MTRGTNTAFQQRLRVLTFTIPIMVVSSYMLYKRLYLGEQQRPLP
                     PDWFQLKAEKSPSKDTTESP"
     gene            <677205..>680036
                     /locus_tag="MRET_0392"
                     /note="MRES_01845"
                     /db_xref="GeneID:38737158"
     mRNA            <677205..>680036
                     /locus_tag="MRET_0392"
                     /product="ribonuclease Z"
                     /transcript_id="XM_027627019.1"
                     /db_xref="GeneID:38737158"
     CDS             677205..680036
                     /locus_tag="MRET_0392"
                     /codon_start=1
                     /product="ribonuclease Z"
                     /protein_id="XP_027482873.1"
                     /db_xref="GeneID:38737158"
                     /translation="MVPMSLRILAPPTSDTSEAPSLVLQCDARKYMFNVGEGTTRVSA
                     QHRASNMRVDHIFLTRVASETMGGIPGLLMTLADGGRGSIDIHAPPNLLYALAATRLY
                     ARRDTMALNAHEIEVREPHVCYQDEYVQIHSVPLVPAQHRSLYTDIAEKGPALDVKAQ
                     LSSPKALRGSQAKAWYECILRDAWTNSERTSPGPARSAYLLPPPPVPYAPDGPEPGRQ
                     AAVLAYICAGHTQRGKFDAEQAMALGVPPGKSFARLARGETITISRPVAWEQMDQDAR
                     QAWLRAQQRRDPGPAPMPVEDVQVASQEVVGASRAGPVFFYLHVPTPAHVEALVQSDA
                     FAPYTHGANQHLAPEQRRTPHVMLHAAPQSVWDDERYRSWRQRFGPDCHHLLANRDVC
                     ADQLTYTSNAVSLDRLSELDAQVFAVPGHAEARVQVADALPVWPNMHVSLQPRGEPSQ
                     WQSTAPALEARAALPSWDAYCDMAKQVRSKAPVPPRTAAAGLADHLVFTTLGTGSSAP
                     SKYRNVLSTLIEMPGDGYVVLDAGESTYFQLARRFGPGMHGWDGAGVDRILRDLRLLF
                     VSHIHGDHHMGVARLLLERRKLRPTEPLVLVANNYTRVCLAEYDALEDLGLRDMHVFD
                     SASLDWQRGDRTWEAGALARLERVCTAPVSHRMGHCYGIVLQHKHGWKVVFSGDTMPC
                     EALVQAGQGATVLIHEATMQDDEAALAAAKGHSTIGQACQVAQDMHAEHLLLTHFSQR
                     YPKLARIGAVAGVPMGIAFDMMRMTPAQLRRLVAGHGAMALLLDTEHESDDEEAKAPS
                     PKKARRVHTSSTQFAHQYVLVSFTGHGEAPPSELSVSQGVQEALQAAHGVVGGAIHVD
                     VLYAGPPRATTGIGEAVLRVDAAHVGVLTSALSSAHGSALATLTGRQPGLRVRLSNVS
                     HHLGALGTNQSRAWTMQQQNDLSIYTSTV"
     gene            complement(<680018..>681115)
                     /locus_tag="MRET_0393"
                     /note="MRES_01840"
                     /db_xref="GeneID:38737159"
     mRNA            complement(<680018..>681115)
                     /locus_tag="MRET_0393"
                     /product="4-hydroxysphinganine ceramide fatty acyl
                     2-hydroxylase"
                     /transcript_id="XM_027627020.1"
                     /db_xref="GeneID:38737159"
     CDS             complement(680018..681115)
                     /locus_tag="MRET_0393"
                     /codon_start=1
                     /product="4-hydroxysphinganine ceramide fatty acyl
                     2-hydroxylase"
                     /protein_id="XP_027482872.1"
                     /db_xref="GeneID:38737159"
                     /translation="MSWSKTFTRGDVAQHSSKEDCWVIFDNVVYDVTDFIADHPGGED
                     LIMEYAGQDVTAIMKNKDSHVHSRSAYTMLGDFAIGKVSLPETMSPEGMAPAFLPADA
                     HISDDFVPEETDVAKDYVHHQFLDLSKPLIPQMWYSSFSKEFYLEQVHIPRHCKEPAQ
                     LMPYAFLEVFTKTPWYVIPMMWLPIAAAFFHLSATQYKEFFYTGNATLSNMEGYAAAF
                     GCFVFGVVFWTFLEYLFHRFLFHMDRLLPRHQFFYLMHFLLHGIHHFLPMDRYRLVMP
                     PVLFATLSFPMLLLAHAVLPTAMANGVISGSYSMYVVYDTMHYALHHTKLPEYVREQK
                     RYHLEHHYKNYELGFGVTSKIWDYVFHTVLV"
     gene            complement(<681288..>681602)
                     /locus_tag="MRET_0394"
                     /db_xref="GeneID:38737160"
     mRNA            complement(join(<681288..681354,681382..681472,
                     681497..>681602))
                     /locus_tag="MRET_0394"
                     /product="COX assembly mitochondrial protein 1"
                     /transcript_id="XM_027627021.1"
                     /db_xref="GeneID:38737160"
     CDS             complement(join(681288..681354,681382..681472,
                     681497..681602))
                     /locus_tag="MRET_0394"
                     /codon_start=1
                     /product="COX assembly mitochondrial protein 1"
                     /protein_id="XP_027482875.1"
                     /db_xref="GeneID:38737160"
                     /translation="MASQNSTHVMSNREFETFMKNRKLEAYKACDPLVQEFVACSRNR
                     VFSVLWACSEQSKRMKDCIRSFAEEKSVMAAGEEYLRTHRRQV"
     gene            <681742..>683538
                     /locus_tag="MRET_0395"
                     /note="MRES_01835"
                     /db_xref="GeneID:38737161"
     mRNA            <681742..>683538
                     /locus_tag="MRET_0395"
                     /product="ATP-dependent RNA helicase DDX51/DBP6"
                     /transcript_id="XM_027627022.1"
                     /db_xref="GeneID:38737161"
     CDS             681742..683538
                     /locus_tag="MRET_0395"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX51/DBP6"
                     /protein_id="XP_027482874.1"
                     /db_xref="GeneID:38737161"
                     /translation="MSLAGKPKTKAKQRYLKAKKDRRKARKAAGPKPPGEASKKQRWE
                     QHEEQQSDEDDDVSVRDDAVTTEDAGALPDTSAASQNDRQEETTSEPAATTTYLYRFP
                     RPQQTASDDATDLLASQGIPDALLHPTEVAASKTQALDTPDDQLLHLCPETRRQLAEL
                     GITEWFAVQATVIPALLHDPRMRHTYLPYTPPHDLCISAPTGSGKTLAYIVPIMELLR
                     TRTIVQLRALILVPTRDLAVQVRDVFEAVAKGSGLRAATITGHHSFRHEQEQLLHVDV
                     VMATPGRLVDHIRGTPGFTLEHLRFLVIDEADRLLGQSFQEWVSTLLDALEPHGPSDR
                     LCAPPRLWTESDTWARDDIQVPQPSVQKLLFSATLSRDPAKISALRLRDPQFIRVRDG
                     AEQGQFALPSSLHQHMLICPTNEKVLHLLHMLHGDQHIRQALCFTKSVDAANRLVHLL
                     LFFEEAWAQATAQPPLHIHFYSSDLRTSERKQLLRAFERGEVDVLVCSDLIARGIDLP
                     DVRHVISYDVPVDMAKYVHRVGRTARAGRVGDAWSLVEEQEVYHFKRMLNEAGQLEHI
                     QRHKVHSGAFDPLLPHYKAALARLAQLYSQQR"
     gene            complement(<683547..>684339)
                     /locus_tag="MRET_0396"
                     /note="MRES_01830"
                     /db_xref="GeneID:38737162"
     mRNA            complement(join(<683547..683736,683762..684209,
                     684237..>684339))
                     /locus_tag="MRET_0396"
                     /product="DnaJ subfamily C member 8"
                     /transcript_id="XM_027627023.1"
                     /db_xref="GeneID:38737162"
     CDS             complement(join(683547..683736,683762..684209,
                     684237..684339))
                     /locus_tag="MRET_0396"
                     /codon_start=1
                     /product="DnaJ subfamily C member 8"
                     /protein_id="XP_027482877.1"
                     /db_xref="GeneID:38737162"
                     /translation="MTEGAPLAPGPPPGPPPRPPRVRRKLVVDESKLSPKERYTQSQR
                     REVDRVLTRAFRMNPYDILDLTQDADEKTIQKSYRKKSLLIHPDKMTEDQARAEEAFD
                     LLKKSLDHLLDENRRKALDETVTSARCLALRELGLPMTLTNEEIELEKVPGGRLDQIA
                     PSFEDRIKIYVKDIVLDEELKKRKAIQHKQEAEIEAAKLRMDAEEERKRRAELDTAWE
                     EAREDRVQGWRSFNKTTKRRKKGPAVLG"
     gene            <684474..>685703
                     /locus_tag="MRET_0397"
                     /note="MRES_01825"
                     /db_xref="GeneID:38737163"
     mRNA            <684474..>685703
                     /locus_tag="MRET_0397"
                     /product="acyl-CoA-dependent ceramide synthase"
                     /transcript_id="XM_027627024.1"
                     /db_xref="GeneID:38737163"
     CDS             684474..685703
                     /locus_tag="MRET_0397"
                     /codon_start=1
                     /product="acyl-CoA-dependent ceramide synthase"
                     /protein_id="XP_027482876.1"
                     /db_xref="GeneID:38737163"
                     /translation="MTAPADLAAEGRVHTTEKPAKKEHTFFDDIVSMKWLVYPSSAAK
                     FAMIFIVGYLLCEYVLPVGVNPFRPFLMLSYRIPEGEVIKRMAMEQAHGPRPTLSLDN
                     SVTTALRSFCHSLQATLFPHQPALLRYGKGWLDVCFMAFYIIVFSFLRQVITGHIFKP
                     LAAHWNIKLENKQIRFAEQGYALTYWGIMGAVGVYVMSFQDSWWYHLDHLWYQYPHWQ
                     MRPELKLYYLLQASYWLQQAFVMLLGLERPRKDYYELVAHHLVTLWLIGWSYFINLTM
                     IGTTVFVCMDIPDTWLALSKMLNYLDMNMCAAVVYSTFMVVWSYFRIYLSALTLYSVY
                     ADYTLIPAYARTFHPSQGHWLVWWMQCHVFAPLFLLLLLNLFWYVIMWRILFRAMRGV
                     CGDMREDGEDEAPTKEE"
     gene            complement(685824..685915)
                     /locus_tag="MRET_t0002"
                     /db_xref="GeneID:38741196"
     tRNA            complement(685824..685915)
                     /locus_tag="MRET_t0002"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:38741196"
     gene            complement(<686043..>687818)
                     /locus_tag="MRET_0398"
                     /note="MRES_01820"
                     /db_xref="GeneID:38737164"
     mRNA            complement(<686043..>687818)
                     /locus_tag="MRET_0398"
                     /product="acetyltransferase (GNAT) family"
                     /transcript_id="XM_027627025.1"
                     /db_xref="GeneID:38737164"
     CDS             complement(686043..687818)
                     /locus_tag="MRET_0398"
                     /codon_start=1
                     /product="acetyltransferase (GNAT) family"
                     /protein_id="XP_027482879.1"
                     /db_xref="GeneID:38737164"
                     /translation="MSRSETAPPALRPHRSNSMMHHKQSITIDTLRMDELRAAQHVLS
                     TYFPHEEVPSMAQLSTRFEQAPHLTLGAFVTLPPPMVSGPLSGTNDSRRKLVGVISAT
                     ASPANITQSMYGHSTSNLARVVCIQDFGVEQGQRHQGIGTNLLVAFIRRLQTMDFGDK
                     AHGQEYEIISVVCPRRRKSFFQRFEFQFHAYSYEQRAADVWAEMRRPINTSTSLSIDT
                     SFAQEDWADQHSALSSKGMLPLLETTTHQTSSRSYHANDTEGPSSSYEPSMFRYEPNS
                     PSVMTPVSATPNNDHTLALLLQKANMTEGAARDLGIIPSSAPNKPKKNPGKALEAIFG
                     EAFASKTFEEDIRQAVKSRIVDFKYYLNLHPLLCPNESCDCTLVARNSAEWSIRETGP
                     LMNTVPSVNGETSDSLGNLDNPIAPWMNSLFRTSSDAHATIGPLRGFWHVPNPMGFDN
                     VTFSRCIEWNVPNRTFQSSQNQESTSPSSSLPSHSGRSSSIGVRRKRSSRNSFSTLRQ
                     SLHLLESSPQEVPENATLDTSDESRLDVMPGEKRLVKHILCPDCGCGPLGFAILPRTS
                     THETQQKDIQNNDCYLAAFRVRYNV"
     gene            <688353..>688841
                     /locus_tag="MRET_0399"
                     /note="MRES_01815"
                     /db_xref="GeneID:38737165"
     mRNA            <688353..>688841
                     /locus_tag="MRET_0399"
                     /product="peptidyl-prolyl isomerase"
                     /transcript_id="XM_027627026.1"
                     /db_xref="GeneID:38737165"
     CDS             688353..688841
                     /locus_tag="MRET_0399"
                     /codon_start=1
                     /product="peptidyl-prolyl isomerase"
                     /protein_id="XP_027482878.1"
                     /db_xref="GeneID:38737165"
                     /translation="MSNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGF
                     GYAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHSKPGLLSMANAG
                     PNTNGSQFFITTVVTSWLDGKHVVFGEVVDGMDVVKAIEAEGTGSGKTRSRIEIAKSG
                     VC"
     gene            complement(<688852..>690300)
                     /locus_tag="MRET_0400"
                     /note="MRES_01810"
                     /db_xref="GeneID:38737166"
     mRNA            complement(<688852..>690300)
                     /locus_tag="MRET_0400"
                     /product="actin-related protein 6"
                     /transcript_id="XM_027627027.1"
                     /db_xref="GeneID:38737166"
     CDS             complement(688852..690300)
                     /locus_tag="MRET_0400"
                     /codon_start=1
                     /product="actin-related protein 6"
                     /protein_id="XP_027483220.1"
                     /db_xref="GeneID:38737166"
                     /translation="MRRARKEAAAAAVVLDTGAAHVHVACSEHPDMHTIPNAIARTRQ
                     GVRRQVLVGDLIESECQDYGGLQLRQPIDRGMIVDWAAQKSVWDRALIKALGCKTTTD
                     TFGLLRGRTVIVTEPYFALPEQQRAFDMLLFEWYEADAIWRTTTAQLIPWSLATPRPE
                     ALLVVDMGHSYTHAVPIIRDQVVWHAVRRLDLGGKVLTSLLKVLFSFRQWNMMDETYL
                     TDKMKCSSCFVAACARDEERRRFPPQDALPSSWSFEQLVEMFHADEDNPMVQQYVLPN
                     YATPEDVADPKTKYGHVLSGPAAYDTPMLPEDELDAFIAGSTTPSQHVASTEHQVLRL
                     GQERFQLFESFFAPKRIGLDQGSLPELIATCISHVHEEARDMLWTQIVLVGGSARVPG
                     LRRRLSQELRMWAPDDVPVHIHIPHDPIEASLHGARTLWQASPTSEAGRCLASHLVQR
                     SAWLNAGGSHAPPGERGGTTLGDTHFGGWNTT"
     gene            <690339..>690658
                     /locus_tag="MRET_0401"
                     /db_xref="GeneID:38737167"
     mRNA            join(<690339..690532,690556..>690658)
                     /locus_tag="MRET_0401"
                     /product="cytochrome c oxidase subunit 19"
                     /transcript_id="XM_027627028.1"
                     /db_xref="GeneID:38737167"
     CDS             join(690339..690532,690556..690658)
                     /locus_tag="MRET_0401"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 19"
                     /protein_id="XP_027483219.1"
                     /db_xref="GeneID:38737167"
                     /translation="MSFGRPPTFSSFQVLPPERGSFPLDHYGECKSFMQEYLACLRAN
                     KNNNGACRHQSKAYLACRMDHQLMERDDFDNLGFSDIDKPTSGAPPPDDSQRML"
     gene            complement(<690653..>692032)
                     /locus_tag="MRET_0402"
                     /note="MRES_01805"
                     /db_xref="GeneID:38737168"
     mRNA            complement(<690653..>692032)
                     /locus_tag="MRET_0402"
                     /product="SET and MYND domain protein"
                     /transcript_id="XM_027627029.1"
                     /db_xref="GeneID:38737168"
     CDS             complement(690653..692032)
                     /locus_tag="MRET_0402"
                     /codon_start=1
                     /product="SET and MYND domain protein"
                     /protein_id="XP_027483222.1"
                     /db_xref="GeneID:38737168"
                     /translation="MYALQDAPLTIAHGAWGRGLRATRAIQAGETLLIDDAYVRVLRT
                     TEAVHRCHFCLAKEPHLQVCASCDFARYCDDVCEASARPWHKRECAALQRHKDVPDAD
                     VRALAQLLWLKSERTPAWWAPLGAMASNRHAMQDHVREEAAMLAFRLGVFLGTEEREA
                     LGLTNADELMELVCQHMTNAFMLSDAYLDPLGVCVNPTLALVNHACDANAVMVFPTMQ
                     RGSPSRMHLVAIRPISAGDAVHMSYVDVATSRAERQAVLQERYGFTCACALCERTQWI
                     DPRTALWCTSCSEWSGSAACGHRRIEPRAVDMGEDTDPDILVHRTALAPPSHYRVWPL
                     LFAAHTRAIERQAWDDAVQCTMLLCAGMQARGARDARSALYPPGHPQRAVLLATLGRL
                     LCENVELHDTPSHLLARPLPCLSMLTDMTSRRFMAHTFLTQALEEACIAFGHDGGAMG
                     ALVRACLAL"
     gene            complement(<692118..>692461)
                     /locus_tag="MRET_0403"
                     /db_xref="GeneID:38737169"
     mRNA            complement(join(<692118..692174,692202..692309,
                     692336..>692461))
                     /locus_tag="MRET_0403"
                     /product="dolichyl-phosphate mannosyltransferase
                     polypeptide 3"
                     /transcript_id="XM_027627030.1"
                     /db_xref="GeneID:38737169"
     CDS             complement(join(692118..692174,692202..692309,
                     692336..692461))
                     /locus_tag="MRET_0403"
                     /codon_start=1
                     /product="dolichyl-phosphate mannosyltransferase
                     polypeptide 3"
                     /protein_id="XP_027483221.1"
                     /db_xref="GeneID:38737169"
                     /translation="MTRASRFAGVAGCVLVVYLLFLFEILRVPFIPQDVSRAILPTLP
                     WWVLVGTGAYLLFQVGWGLFTFNDTPKAHEELLMDIKTAKDYLSQRGVSIDS"
     gene            complement(<692589..>693172)
                     /locus_tag="MRET_0404"
                     /note="MRES_01800"
                     /db_xref="GeneID:38737170"
     mRNA            complement(join(<692589..693068,693095..>693172))
                     /locus_tag="MRET_0404"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627031.1"
                     /db_xref="GeneID:38737170"
     CDS             complement(join(692589..693068,693095..693172))
                     /locus_tag="MRET_0404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483216.1"
                     /db_xref="GeneID:38737170"
                     /translation="MSQGMSSSPSGKGKRQVHAERMKAVSLSHMLSTRLRYAVFKVEN
                     GWTRQSLSEVENLFYRRQMTLSKPAMERGVSPREKGPWQASPSSPTPSPRKQEVGPLE
                     LRHDTSSYADFWHRIDTNKARASPELKDTTTQDTHVPSSASGGDAKPVPSGGKHTLDT
                     SLSHDVTDDEPSSKRSKMHLDESVA"
     gene            <693471..>698039
                     /locus_tag="MRET_0405"
                     /note="MRES_01795"
                     /db_xref="GeneID:38737171"
     mRNA            <693471..>698039
                     /locus_tag="MRET_0405"
                     /product="myosin V"
                     /transcript_id="XM_027627032.1"
                     /db_xref="GeneID:38737171"
     CDS             693471..698039
                     /locus_tag="MRET_0405"
                     /codon_start=1
                     /product="myosin V"
                     /protein_id="XP_027483215.1"
                     /db_xref="GeneID:38737171"
                     /translation="MPTLSQPLAAYEAGTKAWFPDDVQGWVSGTLTKEPHISESGQVE
                     LLFTLDETGAERMVTTTMAKLEAPGGVDRELPPLRNPPLLEASDDLTSLSHLNEASVL
                     HTILNRYQQRTIYTYSGIVLIAVNPFFDLNLYSPEIIQAYAGRRRGELEPHLFAVAED
                     AYRCMIRDRKNQTIVVSGESGAGKTMSAKYIMRYFATVEDPESMSSRRPGSHVMSDTE
                     RAILATNPVMEAFGNAKTTRNDNSSRFGKYLEIVFDERHEIAGARMRTYLLERSRLVY
                     QPEVERNYHIFYQLCAGAPDELRAQFGIGKAADYHYLHQGSEEHLAIQGVDDAAEFQS
                     TVNAFTTIGVSQETQRQMFQVLAALLHLGNVAITATRNDANIAPEDPALAQAASFLGV
                     DAHELRKWMLKRQIQLRGEKIVSSLSQAQALAVRDSVAKYIYTCLFDWLVAQMNKSLA
                     PRDEKSAVSMIGVLDIYGFECFKVNSFEQFCINYANERLQHEFNLHVFKLEQEEYVAE
                     QIPWQFIHFADNQPCIDMIESKFGLLSLLDEESRLPSGQDASFLQKVYGQLQPKPEYQ
                     KFLSKPRFGAESAFTVKHYALDVTYNVDGFMDKNKDTVPDEQLALLDSTQSPFLKTVL
                     DARAAADAALPSPPARRASGQSAGHKKPTIGSQFKASLAALMDTMRSTEVHYIRCIKP
                     NDAKVAWEVEPQNVLGQLRACGVLETIRISCAGFPGRWTFADFVERYYMLVPSQHWTM
                     NSLEKVRELAQYILSETIEPDKYHFGLNKVFFRAGVLALFEQMRRNVLNERTRTIQTA
                     WRRYSVQSKFQSLKHGILTLQSHIRRHAAHARFVASRETRAAVLLQTMIRGSLQRQRR
                     SQAVQAAVRIQQAIRAHQARARLVQVREAHHATQLQTAARGLLARRAASSRIRQVIIL
                     QSLYRRRLARRALLQRRTEAKSATHYQEVSYKLENKVVDLTQSLQDRTRENKDLRASL
                     QELEAQLSSWQHRHVELDARARGLQAEVQKPSVPVEEHEAVRSERMDLERQLRQAQER
                     IRNLELEIATLHSQIRSIEAPESMVQSLRSEIAMLREQLSRATAENERNGTTVPLGPR
                     HQHHRSMASDVPAADVLEFHEDVLDERRGADVPPEEIIDLLEDEAQLDEDVLHGLIEY
                     LKIPLPSLQNPPGPKEVLFPSHLISLVTNEMWKYGLVRSSERFLANVMQTIQQHVMSF
                     HGEDAIMPGIFWLSNVHEILSFVCIAESDMLQGVGPGVDGSAREFEWGDYERLVTIVK
                     HDLDSLEYNIYHTWMQEVKKRLNKMVVPALVESQSLPGFVTNDSGGRLLNRLLASSNA
                     PSYTMDDILGILNKIWKCLKSYYVEPSVTQQVITDLLKMIGVTSFNDLLMRRHFCSWK
                     RAMQIQYNITRLEEWCKSHDMPEGSLQLEHLLQATKLLQLKKATMSDIDIIYDVCWML
                     TPTQIQKLISHYHVADYENPISPEILKAVASRVVPNDRNDHLLLPPEIDEAGPYELPL
                     PREVTGIETYCPAYLHVPLLRSLASKVA"
     gene            complement(<698065..>701511)
                     /locus_tag="MRET_0406"
                     /note="MRES_01790"
                     /db_xref="GeneID:38737172"
     mRNA            complement(<698065..>701511)
                     /locus_tag="MRET_0406"
                     /product="solute carrier family 12 (potassium/chloride
                     transporters), member 9"
                     /transcript_id="XM_027627033.1"
                     /db_xref="GeneID:38737172"
     CDS             complement(698065..701511)
                     /locus_tag="MRET_0406"
                     /codon_start=1
                     /product="solute carrier family 12 (potassium/chloride
                     transporters), member 9"
                     /protein_id="XP_027483218.1"
                     /db_xref="GeneID:38737172"
                     /translation="MSRFVSADEADYASLQEQLLHRSGNDDGADQMRASVSGPVDSRS
                     SSASLRSTRASSSQAASATASPSLVLTESSPLLRGTGMDSRSSAMHHASLSSQEVPVM
                     RKLGTWDGVFMPVTLNVLGIILFLRFGFILGQAGLIGALALLVGSYAIDTLTVLSLNA
                     ISTNGQVRGGGAYYLISRSLGPEFGGSIGLVFFFGQAFNTAMNTLGCVEILVNAFGES
                     RGYMTFMPEGSPFLYLYGTITLWLCTFVCLFGSSLFARATLMLAIILSLAILSIPLSS
                     FLVEPFEDSVRSVYYSGWNWITLAENMWPNFTSGAAGSSAAPGKENWRSVFGVLFPAV
                     CGILAGSSMSGDLRKPSKSIPKGTNWALIFTFGIYALCFVVLAATVPRESFYMNVMIV
                     EAISRWPSIVLMGELASCVFSALMGVMGCAKILQAIARDDLLPFLAPFAQGTAHADVP
                     TYAVLFTALLCQFVLLLDSINLIAQLVTMTTLLTFGVLSAATCALKAGGAPSFRPSFR
                     YWNIWTAGAGTIASLGTMLVTDSYTASVCIAVTVLLFILIQVFSPPKPWGDVSHNVTY
                     HFVRKYLLRLDERKGHVKYWRPQILLLANDPRKEWNLIIFCNSLKKGALYILGHVLQG
                     QFYDCLPELRQTHLEWLKLVDVSGVKGFVDVVIARDVREGARNLILSCGLGGMRPNII
                     VLGFPTALQRASEHHRGPVARVRPSEPPSVWSTYTQPIDGAKFVGILEDALALNKALA
                     VAYGFDAMDLPGPSKVARYEPALGEQYIDLWPIQMANHVRDEAPSWDTYTMVLQLGTI
                     LSFTGTWRQHKLRVNVFVEHDDEMASERLRVRTLLDNLRIPASLRVFCLSGHVPRYDA
                     IVLGKRALDSELTEVLQDDPWWRQVCDMRRREELQKQMKHKAEPIDAGARRHSPSLSS
                     VDGRRRARQSRQLGVSLPEEHLAYHYNNIRLGLSHPDAHDRQDDDADYASFQLDADNT
                     YDELESELASLAVDWDPAYLIRARRAKQQQRDTQSDGMYGVSYGTLSSSQQTVTPATV
                     HTQDARPRRGTEVRSPHTSPRSVPEAAPLMPAVARGGRALTFNDLPNHAQYLILNELI
                     RRYSTRSTSVVLTALPAPAPGTSTSERDSLAYLHQLQSLYSGGPPVLGVHATTLTMTM
                     TL"
     gene            <701666..>702487
                     /locus_tag="MRET_0407"
                     /note="MRES_01785"
                     /db_xref="GeneID:38737173"
     mRNA            <701666..>702487
                     /locus_tag="MRET_0407"
                     /product="pre-mRNA-splicing factor 38A"
                     /transcript_id="XM_027627034.1"
                     /db_xref="GeneID:38737173"
     CDS             701666..702487
                     /locus_tag="MRET_0407"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor 38A"
                     /protein_id="XP_027483217.1"
                     /db_xref="GeneID:38737173"
                     /translation="MSNTTAFGAQSIHGTNPQFLVERVIRARIYDSTYWKHDCFALTA
                     ATLVDKAVELSYVGGTFGMQRPSPFLCLVLKLLQIQPEREIILEYLAAEDFKYLRAVA
                     AMYVRLTFPAIDVYEILEPMLNDYRKLRWRDMAGNFSLSHMDEFVDLLLTEERVCDLI
                     LPRLTKRSVLEAKEGLRPRTSRLEDAMLRGDADGLEEGSGSDSDDSLAALRAEHRTRM
                     HQADTLRSQSRPHETPQDGAYESQQSESEEERLHERLARTPSPAFRSRSPSRSPD"
     gene            complement(<702500..>705112)
                     /locus_tag="MRET_0408"
                     /note="MRES_01780"
                     /db_xref="GeneID:38737174"
     mRNA            complement(<702500..>705112)
                     /locus_tag="MRET_0408"
                     /product="centromeric protein E"
                     /transcript_id="XM_027627035.1"
                     /db_xref="GeneID:38737174"
     CDS             complement(702500..705112)
                     /locus_tag="MRET_0408"
                     /codon_start=1
                     /product="centromeric protein E"
                     /protein_id="XP_027483224.1"
                     /db_xref="GeneID:38737174"
                     /translation="MDVDGANVGVGTAGRGAQERAAGFFSITEPGIDTPSQKKSRMPF
                     MPTPRKRPVRPVVPVSSPAWTKRPEDFHMKPLSDSTMTNVAGRMSPQKAPVHTPAAGP
                     RVVRAAVIPDGPPTTVTPAKVPGMRPTRPATSLSLSRPVPPRPATSLAASRTEGTVPQ
                     ERPASPALSPVPPIRSVVHPSHAMSPARKVRAKVTEGIIPNRNRNHEAQVTPKPKIER
                     RAGSPMRRIPRPPLPDSRMDILALQQQVSDSSFVLEQDDTQTIDAVQVHVRLRPTHPN
                     EECAWVTPPGSASLMLDPAISETKMQPNLGMPFYFDHVHTGSSNANVYATLARPLVHS
                     ALHGYNALIFAYGQTASGKTFTLSGDDDGREPGMIPRAVNDLFQGICQGSAQREYLIR
                     VSYLEIWNEIVRDLLEPTNQPHVRDDRRRGANAVLVAPLHEEVVTSPAGVFKLLARGE
                     ANRHMGATDWNERSSRSHTCFKITIESWDREPSTMRPYRVSELSLIDLAGSERHSTHT
                     SQRRTEGGNINKSLLSLGKVIFALSEKNVGHVPYRDSKLTRILQNSLSGRARIAVVCT
                     LNPSPVMVEESLGTLNFARRIKHVRVRASINEFEGDMSALDESHALLARYREEMGTLR
                     AQVARLEAHKSRESQPLTVEALQSRLDELGALILPGGQAPPESEVSHPISPTKQRGFT
                     FDDPLPVVQEKLHAALQKIQRLERQLAARLSLPMSASNEKDERIQYLLQRIQELETVC
                     EAQTVDAPQAIREDVELEWLERVEAAEAATRKREAFLAEISAECTRLRRANEALVRLA
                     HAQTSSMVTQLAERQDAPRAPPVLSIFAPRLRPATVLGTQRTQTAPEISIDDDESSGR
                     LSSSDIDDLLLDAE"
     gene            <705264..>706547
                     /locus_tag="MRET_0409"
                     /note="MRES_01775"
                     /db_xref="GeneID:38737175"
     mRNA            <705264..>706547
                     /locus_tag="MRET_0409"
                     /product="26S proteasome regulatory subunit T5"
                     /transcript_id="XM_027627036.1"
                     /db_xref="GeneID:38737175"
     CDS             705264..706547
                     /locus_tag="MRET_0409"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit T5"
                     /protein_id="XP_027483223.1"
                     /db_xref="GeneID:38737175"
                     /translation="MSHDGDTNMYENVPEEIRNAEVSEIQMRKRMLENEIRMMRSEFM
                     RLEHDDAVTRERITDNTEKISQNKVLPYLVGNVVEILDIDPDIDEDSEDAKAQAESVG
                     RPKPGKCAVIKTSTRQTIFLPLIGLVPADQLEPGDLIGVNKDSYLILDKLPSEYDSRV
                     KAMEVDERPTETYTDIGGLDKQIEELVEAIVLPMQQEQKFKNLGIKPPKGALMYGPPG
                     TGKTLLARACAAQTNACYLKLAGPSLVQMFIGDGAKLVRDAFELAKEKSPAIIFIDEI
                     DAIGTKRFDSDKSGDREVQRTMLELLNQLDGFSSEANIKVIAATNRIDILDPALLRSG
                     RLDRKIEFPLPNEESRARIMEIHSRKMAVGPNVNFAELARSTDEMNGAQLKAVCVEAG
                     MIALREGATELDHEHFLGGILEVQALKKSDHFYYA"
     gene            complement(<706566..>707267)
                     /locus_tag="MRET_0410"
                     /db_xref="GeneID:38737176"
     mRNA            complement(<706566..>707267)
                     /locus_tag="MRET_0410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627037.1"
                     /db_xref="GeneID:38737176"
     CDS             complement(706566..707267)
                     /locus_tag="MRET_0410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482456.1"
                     /db_xref="GeneID:38737176"
                     /translation="MEGWLESAEGTGISRQNLPICDPSLSPPEAHDESDSDDQVCLSF
                     VLQRFSGSQSIYAPGEMTRDFCMRERTYMSWSKFTALVTVLSVIFFLDLRIFNIDNYA
                     HQVSATLACIQNECLQVKPSYEQQVLGQGSESPGLDISQFQTKAMRNSEEPDSTPSRT
                     QGMVLGSIYLIVGILSWLISVFDYFERIGELERERTLMDECEGHTHPIVTILSMVICV
                     IVLATIVFLVVQHGA"
     gene            707447..707539
                     /locus_tag="MRET_t0003"
                     /db_xref="GeneID:38741197"
     tRNA            707447..707539
                     /locus_tag="MRET_t0003"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:38741197"
     gene            707697..707789
                     /locus_tag="MRET_t0004"
                     /db_xref="GeneID:38741198"
     tRNA            707697..707789
                     /locus_tag="MRET_t0004"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:38741198"
     gene            complement(<708273..>708866)
                     /locus_tag="MRET_0411"
                     /db_xref="GeneID:38737177"
     mRNA            complement(<708273..>708866)
                     /locus_tag="MRET_0411"
                     /product="G-patch domain protein"
                     /transcript_id="XM_027627038.1"
                     /db_xref="GeneID:38737177"
     CDS             complement(708273..708866)
                     /locus_tag="MRET_0411"
                     /codon_start=1
                     /product="G-patch domain protein"
                     /protein_id="XP_027482963.1"
                     /db_xref="GeneID:38737177"
                     /translation="MAREASPSEASQYHLTHSPSASLPARQSSIIRFVPSKKCDTVHD
                     APGRSLLGSTLRFSTPEMELDAQLALEAQEKLGDAIVCAPYNGPMPLDDTTIPTRTVN
                     YCTDYEPSKPNEYASFCRSLKEWRRMKQYDERESESEEEDSVPRRSQFAPPAFYTHTV
                     SRAHSFTRRVPPPGPPPRPPPSLKHLVPSVESHNKKV"
     gene            <708946..>709734
                     /locus_tag="MRET_0412"
                     /note="MRES_01770"
                     /db_xref="GeneID:38737178"
     mRNA            <708946..>709734
                     /locus_tag="MRET_0412"
                     /product="mediator of RNA polymerase II transcription
                     subunit 4"
                     /transcript_id="XM_027627039.1"
                     /db_xref="GeneID:38737178"
     CDS             708946..709734
                     /locus_tag="MRET_0412"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 4"
                     /protein_id="XP_027482454.1"
                     /db_xref="GeneID:38737178"
                     /translation="MMRPLRDEVHDYVHAIEDRTTKLFTRIAEEGSLERSGTVLDTIA
                     WDDVLSMTQAQTELVKLVEMTALHQENQSRIDALIESIKACEERQRRTISLVNELQTD
                     LLALLRHGEREAENIRRAEVMPISSKDILEYAQRLARYTSAPRGYTLESLTTPAAEPH
                     QPGQGSGQKGDYNDQAERAKFYYDPVMPTTPHELPFPSDRLMRQGILYADAASSTTEP
                     ARDTEHDTTNKDAVGAPAEEVKDIPVLDSFAMDEDDAFDLDLNP"
     gene            <709983..>713183
                     /locus_tag="MRET_0413"
                     /note="MRES_01765"
                     /db_xref="GeneID:38737179"
     mRNA            <709983..>713183
                     /locus_tag="MRET_0413"
                     /product="dual specificity
                     tyrosine-phosphorylation-regulated kinase 2/3/4"
                     /transcript_id="XM_027627040.1"
                     /db_xref="GeneID:38737179"
     CDS             709983..713183
                     /locus_tag="MRET_0413"
                     /codon_start=1
                     /product="dual specificity
                     tyrosine-phosphorylation-regulated kinase 2/3/4"
                     /protein_id="XP_027482455.1"
                     /db_xref="GeneID:38737179"
                     /translation="MNLGYLTADDTFGTSHHTYPTGGVGTENHILPVQTPPQIQRRAP
                     SGAVPASHQQTSAHLMQSLTPLGSPWSAASPSVTQASHDPASPTTVYDRRDQVGLGEL
                     TTPRWMLSQAHTESGLPQRVLPLDSPIHSQSSEERTTRERNARAISYSLGQSKHEQAT
                     LMPSFASMQLQDIGVGVSSPSLESTEDPVVDEFTTHRTGLRSQPSSSANIHTPPSLPV
                     RKPRVSQTVSAQNSCAKSSPFVQGMISDPHEDAHAQVSPLLTQHSQSGAHPDIFAETT
                     LSTTSPTINKTQEFSRFEPQVDSGSWAVDVNPSSPTRHIEPTQTKSLRQELSSKVQKS
                     PKSRPRNESRADDHDETSSLAGRLSRRSLGAFSHLFKTSPRRSNQEDEDAASIDGPLT
                     TSPSRSRLFFTRRRRQSLQNARNPMPRRPDATAQDRPEVSNIKAPAAPTIPPKSSRRE
                     GADVVHPLRSEPSPYYTAKAQGSRIPRSSSMVRILSRKSSEPDNARESKLPTSASMQS
                     ISSTKSSSFSTHNQTKSFMELPKEPSPVKFRSLRKSFASADAAEALRRHQASVTTATE
                     PDISSKVTTNSETRTSTVYESNIPVPRDARRRVPNTQSRRAGRTLIDDTQAADEEMER
                     HIQRVFRRKLAAGARHESLEKQLSFPQPEAPSKRLSPRQAAVIYGNQLCPYEQDEIHQ
                     YDSVYYVGSYARHKHYAVPEKNDRNYGYDDERGDYIVNLRDHLAYRYEIIKLLGRGSF
                     GQVLQCLDHKTGNYVAIKLIRNKRRFYHQAMIEVKIMEHLTRLDSDNQHHVVHMTESF
                     SFRNHLCVTMELLSINLYELIKANSFEGFSTTLIRRFTQQTLSCLALMRQARIVHCDL
                     KPENILLANPRRSDVRVIDFGSSCYADQRVYTYIQSRFYRSPEVILGIDYHMAIDMWS
                     LGCILAELYTGYPIFPGENENDQLACIMEVLGVPDRHLLEKSTRTKLFFDSTGAPRPV
                     VSSRGQRGRPNSKSLATVLRTNDEWFLDFVARCLIWDPERRMKPDAALHHPWFLQNAD
                     VAIPRVPRASRVARPETSRDTSGSMLPRATSASIRP"
     gene            complement(<713244..>716132)
                     /locus_tag="MRET_0414"
                     /note="MRES_01760"
                     /db_xref="GeneID:38737180"
     mRNA            complement(<713244..>716132)
                     /locus_tag="MRET_0414"
                     /product="importin-4"
                     /transcript_id="XM_027627041.1"
                     /db_xref="GeneID:38737180"
     CDS             complement(713244..716132)
                     /locus_tag="MRET_0414"
                     /codon_start=1
                     /product="importin-4"
                     /protein_id="XP_027482452.1"
                     /db_xref="GeneID:38737180"
                     /translation="MRNSLACVINEIACKELPHNMWPELLPWMFESAESPNAVQRQTA
                     MLVLFYVLETFVDSEELKSHLPRIMALFAKGIQDPESLEVRVTTVRALSKVAENIDSD
                     DQADLAALQSALPQMILVLQQCLDNTFSEGVRQILDVFENMCMLEAPILSAHLSELVA
                     CFVQNSANRDHEEDLRLMCLNSLVWTIQYKRSRIQSTGLAKPMIEKLMPVATEEDSDD
                     VEEDTPSRLALRVIDQLATELPPNHVFPVLFEQVQAYANNPDAMHRKAAMMAFGVSVE
                     GCSEYIRPHMNELLPFVEHGMKDESPVVRKASCITLGCLCEMLDDECAAKHAVFLPLI
                     MELINAPETQRPACTALDALLEVMGDDIAQYLPAIMERLTGLLETAPIAVKATITGAI
                     GSAAHAAKEGFAPYFPALMQRVQPFLALTEEGEEIDLRGITTDTIGTFAEAVGADMFR
                     PYLPDMMRVTVESLAMDEPRLRECAYIFFAVMSRVFKEDFGPYLEHVVPKMLASFSQS
                     EHEGMDDGAAALSYGGGDDEDDGFVDMEELTNSFLNVSTAVAIEKEVAADSLGELFQF
                     TRGAFLPYLEKATEELIGVTTHFYQGIRKSAVASLFTFISTLHSLCDSPAWVPGDTNG
                     VQLDPNVEKIAQVIMPAIMETWEAEDDRTAAIEICQSFASCLNKCGPGLISPQWIEPT
                     CQLTMQILEKKAPSQIDPEADEDEETEDSSEYESVLISAAMDLVGAMAYVLCDSFMTP
                     MRQFLPLLCKYYSPGRSVTDRATAIGSLGEITVNMKRAITPFTQDILAILSHAVGDED
                     ASVRSNAAFAAGVLIEHSDSDLSQHYMPLLTALQSYFHKSSGESDELKTARDNACGCL
                     ARMMIKDANAVPLDQALPVLFSALPLEKDYAEWTPILLCMIQLIQTNNPAAMQHVDTI
                     LQLFRHVLSSDEDMLGGQLRGQLVAFVSQLHSQAPEKISANGLDAFLV"
     gene            complement(<716751..>717774)
                     /locus_tag="MRET_0415"
                     /db_xref="GeneID:38737181"
     mRNA            complement(join(<716751..717576,717617..>717774))
                     /locus_tag="MRET_0415"
                     /product="DnaJ subfamily B member 6"
                     /transcript_id="XM_027627042.1"
                     /db_xref="GeneID:38737181"
     CDS             complement(join(716751..717576,717617..717774))
                     /locus_tag="MRET_0415"
                     /codon_start=1
                     /product="DnaJ subfamily B member 6"
                     /protein_id="XP_027482453.1"
                     /db_xref="GeneID:38737181"
                     /translation="MPNDWYAILEVEPSATSSDIRSAYRKQALRSHPDRAQTDDKDQA
                     TAQFKLVAEAYEVLSDERKRWEYDRFEYPLLSGAMPDGYEPHASMAPNGHTFVWESSF
                     DSARRAQGRNGPDAFSRAAFDPFELFNSMFSRDFHEMEASYGLDDSFNAMNDWHGMST
                     STFGRPTSFGAPPPGFMREPILGMPMHHDAPFGGVGMSPFGLMSGLSPMHTSAPGQSS
                     FSSSMSSLSFNGGNTGGTSETRRTTVVNGRRETTITKRDEHGNETVRRISPDGETVYV
                     NGQIQSSIEAPQPKAVEMASGNTESASKDSRSGESSGSSSSRRKMWKLFGR"
     gene            <717951..>718634
                     /locus_tag="MRET_0416"
                     /note="MRES_01755"
                     /db_xref="GeneID:38737182"
     mRNA            <717951..>718634
                     /locus_tag="MRET_0416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627043.1"
                     /db_xref="GeneID:38737182"
     CDS             717951..718634
                     /locus_tag="MRET_0416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482450.1"
                     /db_xref="GeneID:38737182"
                     /translation="MHTSSLRGRRRKNQTHSHSWDQAQAVRASLPRASRTPAAQAADL
                     KRPYYNIIFGREQDQDIADTLVDTLDVVVPRDLAAARYSQNHTFMDQLLGPTRLDLLK
                     APPSPYEGKDPQQLADSIASLERELRNMRAEFQDKKKAFASLSSDDTEEVTMDAEESW
                     AVAPSQGPVLGIGYVPTDMPVEVAQILEQQRLRRSEREAQQHTQVPAAAQPLPSHHDA
                     MDTTPMQTQ"
     gene            complement(<718628..>719836)
                     /locus_tag="MRET_0417"
                     /db_xref="GeneID:38737183"
     mRNA            complement(<718628..>719836)
                     /locus_tag="MRET_0417"
                     /product="TBC1 domain family member 5"
                     /transcript_id="XM_027627044.1"
                     /db_xref="GeneID:38737183"
     CDS             complement(718628..719836)
                     /locus_tag="MRET_0417"
                     /codon_start=1
                     /product="TBC1 domain family member 5"
                     /protein_id="XP_027482451.1"
                     /db_xref="GeneID:38737183"
                     /translation="MQRVPLAKERAAWTKYLYPDHTHDLSMFYSVVWRIHLGELRVGE
                     SDAWSTTTLLQRRAYRHLCTKYTKAWDEIRRFGDQNDIHPLQDTSKTLWEKHTGMEEL
                     HAVIDLDIQRLSVTLTKEDQQCVARILRVWSFTHVHIGYFQGMHELAALLWRIRASES
                     VPVPMDSVLHVLLSPGDVEPDTYFLFSALIQRLAPMYDHTQRAGSPTLIKAILHRVDP
                     SLNSHLQSLQLEWTPILLRWHRLLYMQEFTEATILELWDTLFAIDPTLQLVPYISAAI
                     LLSQRDKLVQSEYIDAMQFLMHLPDLNAPRQLVEHAMQLSQTPSASTGAFIARAYEQH
                     PPPEPAESKMESAKHLLRELTAGILTQDGHGQSDWSPRTEDRLYIESSNYTEQHKRAM
                     LSLDSVREFH"
     gene            <719922..>720500
                     /locus_tag="MRET_0418"
                     /note="MRES_01750"
                     /db_xref="GeneID:38737184"
     mRNA            <719922..>720500
                     /locus_tag="MRET_0418"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627045.1"
                     /db_xref="GeneID:38737184"
     CDS             719922..720500
                     /locus_tag="MRET_0418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482460.1"
                     /db_xref="GeneID:38737184"
                     /translation="MPSKGLSSRLQGLKFMQRASARDELKDTKPSPASSKANFPAEGM
                     SGDETEAKDVSRNAEHWVVPVNMRVKTKSVQRDTWNWDSWFQKATETDFVPARQQFGS
                     WKGRRNQGDDEFEEDVSDNDEESYDDGDDESFSSAPSSPADKGFLKPPSAQQSSQSAQ
                     KRRASSTWDEPSRSKLAAVADKSQGLRKKKLR"
     gene            <720771..>721991
                     /locus_tag="MRET_0419"
                     /note="MRES_01745"
                     /db_xref="GeneID:38737185"
     mRNA            <720771..>721991
                     /locus_tag="MRET_0419"
                     /product="amphiphysin"
                     /transcript_id="XM_027627046.1"
                     /db_xref="GeneID:38737185"
     CDS             720771..721991
                     /locus_tag="MRET_0419"
                     /codon_start=1
                     /product="amphiphysin"
                     /protein_id="XP_027482461.1"
                     /db_xref="GeneID:38737185"
                     /translation="MKGITKFLQRTPHMVSSRVGISAKSTDVEFDHFRHKFEAMEKLI
                     KQLARESKTYLDGVKKMLESCSAFAAEYSALFHPFGTEYDIERRHPETVQTLVNLSGY
                     VTYIDDLRETLRPELELIATRVVAPCQELEQVLKSINKAITKRDHKLIDFDRHTNSYT
                     KLREKQNRSAKDDQHMFKLEHDCEAAAGEYEHHNNILKAELPQFLAMATKFVTPIFYS
                     LYYMQLNVFYLSMEKLKSYSEGRFDMTNNNLISREHKFSMDMSKVIADLESFSIQKPG
                     PPTTRILQMAKAGTPLSSRPRGLPSAAGSAAPLPPQEEIKKAEQVTAEAAATTESSAP
                     PAYTPAPEEAAASDAEYVVALYDYAATADGDLSFKAGDRIEVLKRTPSAEDWWTGRLN
                     GVEGVFPGNYVRDA"
     gene            complement(<721992..>723344)
                     /locus_tag="MRET_0420"
                     /note="MRES_01740"
                     /db_xref="GeneID:38737186"
     mRNA            complement(<721992..>723344)
                     /locus_tag="MRET_0420"
                     /product="translation initiation factor eIF-2B subunit
                     delta"
                     /transcript_id="XM_027627047.1"
                     /db_xref="GeneID:38737186"
     CDS             complement(721992..723344)
                     /locus_tag="MRET_0420"
                     /codon_start=1
                     /product="translation initiation factor eIF-2B subunit
                     delta"
                     /protein_id="XP_027482547.1"
                     /db_xref="GeneID:38737186"
                     /translation="MSEAAAAPPPRSNEAPPVKKDKKAAKEAKRERRAAAKVDATAQQ
                     APSTAASKGASARPPASGPKVKDTAISTKAVTGSLDEDLSTVGVLGDASLFGNVTLPR
                     NARVNSASWSSALARGAIHPAVLDLCHQISTFAIRGANKRAISVLKALAAVIQDYKTP
                     SGAVLNRDLLTRVSQQVGFIVESRPLNTATGHAVRFLKYEISVVDAGLSEDEAKEHLI
                     GRIEHFIRDRIVYAGKVIQANAAAKIHHGDVVLTYSHSSVIEGTLLHAHNHGVKFEVI
                     VIDSRPLFEGRLMAERLLEAGIPTTYGVLTSLSTLMPRASLVLLGTSALLSNGAPYAQ
                     SGTAMCAMMAHGFDVPVIICCETYKFSDRIQLDSFVVNEAGQSSELLSHEDDNTETDS
                     VLLTRSECSTQSRLKVVQLLHDVTPPRYVSAIASEVGLSGTESVGVILRDYKSVLFGV
                     "
     gene            <723771..>724137
                     /locus_tag="MRET_0421"
                     /note="MRES_01735"
                     /db_xref="GeneID:38737187"
     mRNA            join(<723771..724020,724050..724073,724100..>724137)
                     /locus_tag="MRET_0421"
                     /product="dynein light chain LC8-type"
                     /transcript_id="XM_027627048.1"
                     /db_xref="GeneID:38737187"
     CDS             join(723771..724020,724050..724073,724100..724137)
                     /locus_tag="MRET_0421"
                     /codon_start=1
                     /product="dynein light chain LC8-type"
                     /protein_id="XP_027482546.1"
                     /db_xref="GeneID:38737187"
                     /translation="MSASRDDEVAVPPAPQDTPKAVVKNVDMEQEMQQAIIELAADAM
                     VRFAVEKDMAAHVKRTADERYGPTWHVIVGRSFGSFVTHESKYFIYFYLGTMAFLIWR
                     A"
     gene            complement(<724134..>725560)
                     /locus_tag="MRET_0422"
                     /db_xref="GeneID:38737188"
     mRNA            complement(join(<724134..724235,724262..>725560))
                     /locus_tag="MRET_0422"
                     /product="hypothetical protein"
                     /transcript_id="XM_027627049.1"
                     /db_xref="GeneID:38737188"
     CDS             complement(join(724134..724235,724262..725560))
                     /locus_tag="MRET_0422"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027482545.1"
                     /db_xref="GeneID:38737188"
                     /translation="MCSTHAWHAVVRASEALDALKDAIFLVEEQRQAHIGIWEARTEA
                     SPGRLLLALDDARDRLVKARDRAEEACNMQPASEETSKLSKMRADIYAEFVRIHAEAL
                     DLELTLESDRALLVLYDVCVQCERHMSNLEATFSRDSEDSEAMRVKKHHTIHACERLL
                     ATIRQSAQPNDYVKPRISRIEERWDRLRQQFGIMNDSDIDATAAVLDASLSLSTTKRR
                     ASESNDTRKRRWSFGTPSRIPRTPTSKTYSRIPSSTQRMRSIHFQMPADSPETPRWTD
                     AVARHEASPSVEHARARSALDHRPSSSQGRRLRRRESMLPRISRDVPAVPPLPASFAS
                     PQPDSHTRLRAHPSMPTLSPRTPSTTGRATPGATGRMTPSRSHRYMPDGKDPLDIAVA
                     RLCNVRGIRIERLDEMCHQDGDLIHRYAMFSKTVACRLLRMHKPEHPRDVDASYVQVR
                     VGGGWLELDTWLDARI"
     gene            complement(<725607..>728048)
                     /locus_tag="MRET_0423"
                     /note="MRES_01730"
                     /db_xref="GeneID:38737189"
     mRNA            complement(<725607..>728048)
                     /locus_tag="MRET_0423"
                     /product="ATP-binding protein required for mismatch
                     repair"
                     /transcript_id="XM_027627050.1"
                     /db_xref="GeneID:38737189"
     CDS             complement(725607..728048)
                     /locus_tag="MRET_0423"
                     /codon_start=1
                     /product="ATP-binding protein required for mismatch
                     repair"
                     /protein_id="XP_027482544.1"
                     /db_xref="GeneID:38737189"
                     /translation="MTRSIAPIAAADVRRIAGAQVVPDMRAAVKELVENALDAQATSI
                     ELRFKEYGLDSIEVVDNGAGITKENYAALCQRHHTSKLATFEDLARVETFGFRGEALA
                     SLCTVARVTIITATQTEAPMGTVLEFDHQGVLIAQDKRQARSRGTTVILRDLLSNLPV
                     RRRELEKHVKREYNKAHTMLQAYALITQNVRWSSCVQLENGRQVSQLVMRSASGPNAI
                     QTNMSALFGTKASAAVQPLDLDISLDEPARFQGVISKPTMGLGRSSGDRQYFYLNGRP
                     WDCTKLAHICNQVYRTFNATQYPTVIANLIIGPDKYDVNVSPDKRTLYVHDETALLER
                     IRELLEDTFSPSRGVFAVDEPKKRDAPPSSPEPAKMPRTQDNISTQGAPLASSPSSEP
                     IQSSFQDQFRRAVVNFARHTNTSLEYEEASDEEMDAVQQLEDFEPEHVSEDAVLAPDV
                     CPDYDLQHDEVQSGVAFQDDDEEHDRHSIDCRDREERHEYDEQTQERISQERILHEQA
                     CEHTHESEDTDNDRVPMEEPVPPQPDTQTYTRSLRQSESEEHSSAPLESISFDWSTLS
                     HRKAQAGVAPEPTAMTGADVGQPDAQAAAVMERVIPKSDFRTMSVVGQFNLGFIIARR
                     ETASMDDLFIIDQHAADEKHNFEDLQKNLRIYCQRLVVPQRVELAPSDELVAREHQDW
                     LRINGFDMALDESSPPGSRVRLLSKPISKGTVFDVHDFEELLHLLRDAPAGRINRVRC
                     SKVYDMLASRACRKSIMIGTALQMRKMQSVVHNMADTDQPWNCPHGRPTMRHLTTLRS
                     PRMPRPIAWSTIGLL"
     gene            <728161..>728943
                     /locus_tag="MRET_0424"
                     /note="MRES_01725"
                     /db_xref="GeneID:38737190"
     mRNA            <728161..>728943
                     /locus_tag="MRET_0424"
                     /product="dienelactone hydrolase"
                     /transcript_id="XM_027627051.1"
                     /db_xref="GeneID:38737190"
     CDS             728161..728943
                     /locus_tag="MRET_0424"
                     /codon_start=1
                     /product="dienelactone hydrolase"
                     /protein_id="XP_027482551.1"
                     /db_xref="GeneID:38737190"
                     /translation="MSQSACVISPVKAEYQPKGISGKVAGLDAYVVGPDSKHVLLSVY
                     DIFGFWDTTKQSADLLSEALHVKVIMPDFFRGKPWPMNAFPPRDEEEQKVFDEWFATV
                     ASVSDRKKDLDAIAQELKSQGVEKIGVYGFSWGAKIASLAGYEGTPFTGVVIVYPAMM
                     HGGGEKQVVPESIMVSGEDSKYLGVPAAFFPSKDEPRDESDKYWSTLKQSRPELVEKS
                     VYHYYDIFHGFAAAPANFHDEANRAAATELYQRLANFFHTIF"
     gene            <729049..>730653
                     /locus_tag="MRET_0425"
                     /note="MRES_01720"
                     /db_xref="GeneID:38737191"
     mRNA            <729049..>730653
                     /locus_tag="MRET_0425"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627052.1"
                     /db_xref="GeneID:38737191"
     CDS             729049..730653
                     /locus_tag="MRET_0425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482550.1"
                     /db_xref="GeneID:38737191"
                     /translation="MATALIAQSRALYRLPIEVWTLILLQLEPAEIVVVRNATRAMYA
                     AGTSYLLWNALLVHYEKRSIPIAWYDCKLHDNCAQALERSLLVARRVSLAWQTHGAQP
                     KRVVRFRAHANRITSIKMIPGCTSSDYWLITGSVDGFVRVWDVHRALSQNGAMDVTPE
                     LHQDMSLPEDAVPVDPATDIRRSSNAFLVAEVDTGGDVTSIDASMDRTTRTMRIAVGS
                     YYNAAACLLYELHLDTLPHIMDLCATLDPPEWCGTQCVSLLHDVVAVGTYTGRVYLVH
                     WHTGERCMLEHAEPGSIAALKLLPSYMISITRLGSMYVYERFGTTQARLVAQHTLSPH
                     PILSVSFGESCMERAGQLASGTITDPTPLAVMCADPVGVSHWVWRSAEELTKIRHLDM
                     PPERLIGASIGALGRCGLITTSLGGVPPVCSARAYTQGRTLCSIRPTPELTLPEWNQA
                     LPPTPPTPPLPQGDGGSPAPSQRRRARVDSFSSTSTTSSVAPAPSSRVDMLTESALDE
                     ARGLVCLASVRGAVWISDYGNSLDTM"
     gene            complement(<730661..>731076)
                     /locus_tag="MRET_0426"
                     /note="MRES_01715"
                     /db_xref="GeneID:38737192"
     mRNA            complement(join(<730661..730938,730964..731045,
                     731074..>731076))
                     /locus_tag="MRET_0426"
                     /product="V-type H+-transporting ATPase subunit G"
                     /transcript_id="XM_027627053.1"
                     /db_xref="GeneID:38737192"
     CDS             complement(join(730661..730938,730964..731045,
                     731074..731076))
                     /locus_tag="MRET_0426"
                     /codon_start=1
                     /product="V-type H+-transporting ATPase subunit G"
                     /protein_id="XP_027482549.1"
                     /db_xref="GeneID:38737192"
                     /translation="MVAQKSQGIQTLLEAEKEATKIVEQARAYRTQKLKEAQTEAEKD
                     IAELKAKKEKELDEYKQKYAGTQSSAQDKIDRDTKDRLSEIERAFQDKREELISKLLD
                     RVSQVDPQPHKNLQKMSA"
     gene            <731220..>734255
                     /locus_tag="MRET_0427"
                     /note="MRES_01710"
                     /db_xref="GeneID:38737193"
     mRNA            <731220..>734255
                     /locus_tag="MRET_0427"
                     /product="symplekin"
                     /transcript_id="XM_027627054.1"
                     /db_xref="GeneID:38737193"
     CDS             731220..734255
                     /locus_tag="MRET_0427"
                     /codon_start=1
                     /product="symplekin"
                     /protein_id="XP_027482548.1"
                     /db_xref="GeneID:38737193"
                     /translation="MASVDPIRSLCGALTQATGGVYHVDLRMPDGIHRLAEVVDLLFG
                     KRIVGADVRERLTLHVPAAIMVLLADPMGTYAKLACECFASVYPRVFLYASQDGSPAS
                     FQLWQVVTAIKERVLFTLDDGTLGARIGAVKACQRIIQAQTKPDGDPRLQNRAEINLN
                     AVPPEHPFLKTEQLEAEADQVFTRLVTLLFTCKAPSLVMGVTQVLTRLARLRTKLNKV
                     VIEAFVSWTPASLESLAPVHVRSAENTVRLAMVHFLQHGSVEPQTTQLTQALERQRQR
                     MDIAMREAMAARREGVSRKREVKDTDGSSKRTRASTPTDPRRPSGLSVNDIARLPLER
                     VVDAIIEGLQSVPEDRLKTAIASFVRTVTPAGATNEPVDPLKMDMGDDDEPTKAMPTE
                     DAVAPLASLEHFELPEPVRLEQREAQALIIDSVTRICESGTQLLPAQALEHASEGHAA
                     LWIKLVVRLATRGLDTRGQVAPPDLANQADKVRALLLDYVNQDFCVRRGIALQWLMEE
                     WTCDRERQKQGIESEHYHIWLDKLLDAQLSMPTVDSVALGNFLRDLPQIPLVILDRLY
                     ELCLDRGTIGEGFALLRDVSAARPPLRVPVCHKVLQLTRHSERLVRGRAIVTARTWVL
                     QKGPLADVVLAFARESLQLLVEEARAHDAPEAQDMSVEAEEADETAANPLGLNEQDVL
                     RLIELALVLSVKQPSFFAEVVRIYPLLPAPVQAAMQKHVTPVARSVGPNSTVLLDVLR
                     TYPHGADTLVMAILRILIDKGHTQALAELVRDLVDTRSLDVEYLLPLVPHLDRDAMLH
                     ALPRVVSVLADGSEEHKVAVHRLFQTLVAPAMQAAGAETASEHPTTTASLTPVELLVL
                     LHVHEKEIGLKAALVAVQLCFSMSEVFRSDVLTAVLNRLVEEDPLPVLFMRTAIMATK
                     SFRTLGSYVSTSLLSRLVQKEIWREPRLWDGFALCANLTAPTSFGAMLQLPPPQLLEL
                     VTKQPSLRDPLRDYLIYKAGGPVRHGALLQMLESVPTGT"
     gene            complement(<734242..>736338)
                     /locus_tag="MRET_0428"
                     /note="MRES_01705"
                     /db_xref="GeneID:38737194"
     mRNA            complement(<734242..>736338)
                     /locus_tag="MRET_0428"
                     /product="tryptophan synthase"
                     /transcript_id="XM_027627055.1"
                     /db_xref="GeneID:38737194"
     CDS             complement(734242..736338)
                     /locus_tag="MRET_0428"
                     /codon_start=1
                     /product="tryptophan synthase"
                     /protein_id="XP_027482543.1"
                     /db_xref="GeneID:38737194"
                     /translation="MAEQLKATFLRKKERNQAAFVAFLTAGFPTKDDTLDLLFALERG
                     GADIIEVGVPFSDPQADGPVIQESNNIALEQGIDYAQCLSIVKEARARGLQVPIILMG
                     YYNPLHAYGEERAVRDARAAGANGFIVVDLLPEEAGQFLHACRQEKMAFVPLVAPTTD
                     VERVRYLSTLADAFIYVVSRLGTTGASNTVSSSLGDLLAKIRSGTDVPLAVGFGVSNR
                     DHFVEVGALSDGVVIGSKLIQCIKNAAPTKEARVEAAYTFCDSITGKSQGGLPRAHPL
                     VTPAPIETGAVPESHVSKAAHFGEFGGQYIPEALVQCHRELEKAYDTARHDPTFWKEF
                     YDQFKYIGRPSELYEAERLSKWAGGARIWLKREDLNHTGSHKINNAVGQVLLAKRLGK
                     TRIIAETGAGQHGVATATACAKFGLECVIYMGAEDVRRQALNAVRIRMLGAKLIGVES
                     GSKTLKDAINEANRDWVTNIHNTHYLVGSAIGPHPFPTLVRDLQSVIGQEAKKQLQEQ
                     AGCLPDAVVACVGGGSNAIGMFYPFIDDASVRLVGVEAGGEGVDTAHHSATLSAGRPG
                     VLHGVRTYLLQNQDGQVTETHSISAGLDYPGVGPQHAYLKDSGRAEYCVATDKQALLG
                     FKWLMEHEGIIPALESSHAVYEAVNLAKTMRPDQHIIVSLSGRGDKDVEQVARGLSEQ
                     GWGQAIGWTLPPLTFQ"
     gene            <736479..>737231
                     /locus_tag="MRET_0429"
                     /note="MRES_01700"
                     /db_xref="GeneID:38737195"
     mRNA            <736479..>737231
                     /locus_tag="MRET_0429"
                     /product="dienelactone hydrolase"
                     /transcript_id="XM_027627056.1"
                     /db_xref="GeneID:38737195"
     CDS             736479..737231
                     /locus_tag="MRET_0429"
                     /codon_start=1
                     /product="dienelactone hydrolase"
                     /protein_id="XP_027482542.1"
                     /db_xref="GeneID:38737195"
                     /translation="MSQVSKACCSIPPVKTDYQPKGSMEKVAGFDSYVVGPADSKNVL
                     VCVYDIFGFWDTTKQCADLLSDSMKVKVVMPDFLRNKPWPLTSFPPSNEEESKKFQEW
                     FSTVASVPDAKKDVEAVAQELKKNGAEKLGLYGLCWGGKITSLAGYEGTLFSGVAIVH
                     PAMVNGEDSKGLTVPVAFFPSKDEPRDESDKYWENFQKSHPELVEKSTYHYYDNMFHG
                     FGAARANLKDEANRVAAEDLYNRLANFFCGVF"
     gene            complement(<737233..>737721)
                     /locus_tag="MRET_0430"
                     /db_xref="GeneID:38737196"
     mRNA            complement(<737233..>737721)
                     /locus_tag="MRET_0430"
                     /product="mitochondrial protein import protein ZIM17"
                     /transcript_id="XM_027627057.1"
                     /db_xref="GeneID:38737196"
     CDS             complement(737233..737721)
                     /locus_tag="MRET_0430"
                     /codon_start=1
                     /product="mitochondrial protein import protein ZIM17"
                     /protein_id="XP_027482592.1"
                     /db_xref="GeneID:38737196"
                     /translation="MTSRLVALAWRSFDSHVSRAARHTWASYIGVSRTSPHMRPFCSS
                     VWRSHASSQHTPEAIQPRLQLTFTCTVPQCGTRSTHEFTKHSYTKGIVLVQCPGCKNR
                     HLIADNLGWFAESRGEPRTVEEIVRAHGGRVRTGTVYSDVDNGETVEIESDSHDDTVR
                     TT"
     gene            <737851..>740133
                     /locus_tag="MRET_0431"
                     /db_xref="GeneID:38737197"
     mRNA            <737851..>740133
                     /locus_tag="MRET_0431"
                     /product="solute carrier family 30 (zinc transporter),
                     member 5/7"
                     /transcript_id="XM_027627058.1"
                     /db_xref="GeneID:38737197"
     CDS             737851..740133
                     /locus_tag="MRET_0431"
                     /codon_start=1
                     /product="solute carrier family 30 (zinc transporter),
                     member 5/7"
                     /protein_id="XP_027482593.1"
                     /db_xref="GeneID:38737197"
                     /translation="MADARAVPTQPDPRKRGHVKVDTLQGSSFFHASHRIRIHHLLAL
                     LVTKTLVASAAWLTRQWLLVPQMDVTLFHERYAESNDTEMSLEKVRDIIHEPASVWAV
                     AVMTTAVAAIFMLLALRVWRWDVVWSNHVVRHLLVLGSVTFLQLFTWLTALKFLGATN
                     TLLYTQFCEVWMRDIQVRHRWTTSGGFFVLLSMAFAFVIAALTHSIVSLRQPYADMLE
                     SVTFQTLSLTTKLQDHISLWDTFKGFLALIIYAILSVETGYLMSNTAKEVGGRRRAMV
                     LAISLAATILLPISMLGAILGVKMLPAPFVPGRSPTQQDALEINHLAAYLVLALGFLV
                     FDVLVTLTLESYVTLMVHIAHAWPMVVCAAMAIGFAVFNVNVSLVQVMSVISVGFALR
                     AILRRSPLYMTSWYRKATVEEQRVAMAGVESDTTLLTDFVIMTYRLVVQIRRMINVIL
                     SNNESRRIFLFLCLNLAFMFVQLVWGVWTNSLGLISDAIHMFFDCAAIFMGLMASVMA
                     SWKTNKDFPFGYKRVETLSGFANGVFLVLISVFILFEAVQRIIEPPVMNNMAQLLIVS
                     TLGLLVNLFGMFAMGHHHHGHSHGCSHSHDHHHGHSHNMLGLYLHVMADTLGSVGVII
                     STILIHYFHWTGFDPIASLLIGIMILGSVVPLVIDSGRILCLELDNNDQEALQLALEK
                     IAAHPIVSAYSSAHFWPLDSETIVGTIHIHYDTLLASDASSLVDPSTLTLEVKQILHS
                     YLHSLEAVHVQLHPGGQKNF"
     gene            <740610..>743081
                     /locus_tag="MRET_0432"
                     /db_xref="GeneID:38737198"
     mRNA            <740610..>743081
                     /locus_tag="MRET_0432"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627059.1"
                     /db_xref="GeneID:38737198"
     CDS             740610..743081
                     /locus_tag="MRET_0432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482594.1"
                     /db_xref="GeneID:38737198"
                     /translation="MKHDDYAGTYAPPDTQTSSLMSRPMSFYVRAKYDFRSNEANLLS
                     FQAGTLIEVLGQLESGWWDGLLDHNTRGWFPSNYVDIISHESGMIQFSHASICPKSPM
                     LSISSGSTESTGSSGCDPNSGNNAMFHVNAFVQELQQLIQASQVPLSEHWAQTSRQQA
                     VPTLKNGMTELAQTMHEIDEIVTQISKMDLEASSSHSGSSLSNVVLTNLPKNLSSQLP
                     VLGVRVHMLLKYLQESTQIHIAHSEYAKEQVHFEKLAMNFIESLELLGQELRDDQRFV
                     PYVRVESPELMEERSFEHAHNSDAADSSSLSASIPKIGALVKYPSFGRSSASEIMSAL
                     KRFSPANGSDGKSEYSMSSSSTTNSRVPLVGTLLSSTNSMTGSEISPGDIVFTDSGTV
                     KGGTLEALVIQLTRHDAFDTKYTSTFMITYRSFTTSSRLMELLIDRFHLEIPSDLEES
                     KFQQWEELKRTPVQLRAVNVMRLWLEYFCDTDDEKALDLVEAFANNALIYRHVNGMRG
                     MLMRLIRRCRQGSGNLNRKMMQPKMQPKPLLPPSLSQLCFLNISPIELARQLTLMESE
                     TFLRINVPECVNKAWASSDARHRASGVVNVISLHNHITGWVIETILNEENVTQRAAIT
                     SHFIAIANYCYQINNFSTMWAISSALNCASIYRLNATWALVSRKDLDIFSEINQIIQP
                     TRNYSRYRDLLDRVNPPCVPFFGLYTKDLTFIEDGNSDSLWSDSRLINFAKRSLAADV
                     LYEIRRFQFVPYNFVRVPSLFEFLDLHFKPRMSDEERYERSLKLEPRQSSSPYGGNYH
                     RHDFTFYDMIPDEYFMKRLQENGFT"
     gene            complement(743207..743287)
                     /locus_tag="MRET_t0005"
                     /db_xref="GeneID:38741199"
     tRNA            complement(743207..743287)
                     /locus_tag="MRET_t0005"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:38741199"
     gene            complement(<743321..>744652)
                     /locus_tag="MRET_0433"
                     /db_xref="GeneID:38737199"
     mRNA            complement(<743321..>744652)
                     /locus_tag="MRET_0433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627060.1"
                     /db_xref="GeneID:38737199"
     CDS             complement(743321..744652)
                     /locus_tag="MRET_0433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482595.1"
                     /db_xref="GeneID:38737199"
                     /translation="MTKPSAGALLAQLVDDYLDEEQYDTAVQLVAETYSCSLRPPASI
                     LRRLLCLSLCTEDCTSPQIRDSSLNLPRHAKKVYARPTSTSVGIARELLLDLAPLSDD
                     QDHWMPCNLTNEDGAKQWQEQKQHIETTTFYASTPLAFWADNATLYGFESIWDLLLRE
                     PTHAADRESPFPLRVHEFWMSPFDDTLHNSETDEHEGDGSARYMTQGAWRTLNVLLAV
                     WKDTGTTAFLGSDAKYLSKMLQAAFSFEHSAMSSQDSLSQLEERTSVTVQILGLLSQP
                     ICANHASTIRQSAAIQFQTLCFSSLSLLCNMAQHLPIYKDICFTYLYMLYVDARAPAQ
                     FLHVDSKQVDVKKLTAILNIPCPFLERCKCSTSPSITMFRMTHRCLWLKWWLIQALNQ
                     VHLIKQTSVFRDAHIFLQCLLEAPSFAQDPELREFSRRTKDLIESSNMSIR"
     gene            <744803..>746384
                     /locus_tag="MRET_0434"
                     /note="MRES_01695"
                     /db_xref="GeneID:38737200"
     mRNA            join(<744803..744830,744865..744919,744947..>746384)
                     /locus_tag="MRET_0434"
                     /product="WD repeat protein 68"
                     /transcript_id="XM_027627061.1"
                     /db_xref="GeneID:38737200"
     CDS             join(744803..744830,744865..744919,744947..746384)
                     /locus_tag="MRET_0434"
                     /codon_start=1
                     /product="WD repeat protein 68"
                     /protein_id="XP_027482588.1"
                     /db_xref="GeneID:38737200"
                     /translation="MSAITYEAPWPVYALAWSNSHSSTDSNGEPSRQLPPNARLAVGS
                     FQEEYNNRLQVLGMPHNLDGSSSMEVLADVLHPYPATKIGFQPTNDLQRTEAEEKSQD
                     VDWSGQADLTETSHNISSTFSTASNPDDTSDLIQVDPYPDSELLASSADCLHVWEMER
                     NEDVSDLYDAMSLRPSLSSKKRTSGHRFVLREKCALAHAKSSLSPPAPLTSFSWNAPS
                     PNLIVTSSIDTTCTIWDLPSRTALTQLIAHDREVYDVDWCPGSADVFASVGADGSVRV
                     FDLRNLEHSTIIYETNMQPPSSSDRQNSAYTSSSGMNVPLLRIAFNPWDANYLATFQL
                     ESNTVQILDVRAPGSPILELSGHSGPVNSVAWGPPSQSTLRNGPSKGMICTGGDDAQC
                     LVYDLTSSTLRTASAQGRRSRNSPYKQSHSPGIDGWRVGAEVPVLAYTAPSMVNNASW
                     LGMPAPSKRTSLQSKHRSLYRSLLSEWTEYTSSTSTSSGTDWLALCAGQAVKILRV"
     gene            <746476..>748662
                     /locus_tag="MRET_0435"
                     /note="MRES_01690"
                     /db_xref="GeneID:38737201"
     mRNA            <746476..>748662
                     /locus_tag="MRET_0435"
                     /product="DNA replication licensing factor MCM5"
                     /transcript_id="XM_027627062.1"
                     /db_xref="GeneID:38737201"
     CDS             746476..748662
                     /locus_tag="MRET_0435"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM5"
                     /protein_id="XP_027482589.1"
                     /db_xref="GeneID:38737201"
                     /translation="MSGFDAGRVYSTQAVAVSSTAQAPDAPVQNETALFEFVQNFRLG
                     AEYIYRDRLRSNLLVKQYVLDVQLEHIQMWSPHLAQALRETPAEILSLFEAAVKRSAR
                     LLLYPVSAGTERPEAPDCQVTLRSSANLMAMRDLHAENISRLVRIPGIVISTSVPSSR
                     VTHLHLMCRDCRAVKTILVSSGFGGFVLPRQCDAPKVDPSLKCSVDPFVILHERCLFV
                     DAQTIKLQEAPDMVPVGELPRHMLLSVDRALCGKVVPGANIIATGIFSTFSSSRGGST
                     PNAVALRTPYLRVVGLEVDAGGVSGRGVSRVFTAEEEEEFGRMSKSPDLYEKFSASIA
                     PSIFGSNDIKKAITCLLFGGSKRVLPDGMRLRGDINVLLLGDPGTAKSQLLKFAEKVA
                     PIAVYTSGKGSSAAGLTASVQRDANSREFFLEGGAMVLADGGVVCIDEFDKMRDEDRV
                     AIHEAMEQQTISIAKAGITTVLNCRTSVLAAANPVWGRYDDLKSPGENIDFQTTILSR
                     FDMIFIVKDEHNESRDRTIAKHVLGIHMHGSTDQTDAEGEIDLQRMKRYIAYCRARCA
                     PVLTNTAAEKLSSHFVAIRKQVAQMEHDHDERSAIAITVRQLEAIIRMSESIAKVTLS
                     PYATEEHVDEAIRLFRFSTLNAVESGNVEGMTRGELQEEVQKLEREIRRRIPIGWTTS
                     YARLRMEFVDAQGYSLHALERALYILEKRDVLRFSNQRKTMTRTGV"
     gene            complement(<748682..>749626)
                     /locus_tag="MRET_0436"
                     /note="MRES_01685"
                     /db_xref="GeneID:38737202"
     mRNA            complement(<748682..>749626)
                     /locus_tag="MRET_0436"
                     /product="prohibitin 2"
                     /transcript_id="XM_027627063.1"
                     /db_xref="GeneID:38737202"
     CDS             complement(748682..749626)
                     /locus_tag="MRET_0436"
                     /codon_start=1
                     /product="prohibitin 2"
                     /protein_id="XP_027482590.1"
                     /db_xref="GeneID:38737202"
                     /translation="MSNRSPQNVLKNMQRMFQQMQENARSSSRQGGPRGSGGGGGPVN
                     PAIGGAGLIALVGLAVGINASLFNVDGGHRAIKYSRVYGVGNTIFPEGTHLLIPWIET
                     PIDYDVRAKPRSIASLTGTKDLQMVSLTCRVLSRPSVEDLPTIYRELGTEYDERVLPS
                     IVNEVLKSVVAQFNASQLITQREMVSRLVRENLKVRARRFNIILDDVSITHISFSPEF
                     THAVEAKQITQQSALRAAFQVDQALQEKQAIIVRSAGEARAAELIGDAVRKNKGFLEL
                     KRLDAAREIANTLSNSGNRIMLDSKSLLLNVNEKAPQN"
     gene            <749794..>750480
                     /locus_tag="MRET_0437"
                     /db_xref="GeneID:38737203"
     mRNA            <749794..>750480
                     /locus_tag="MRET_0437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627064.1"
                     /db_xref="GeneID:38737203"
     CDS             749794..750480
                     /locus_tag="MRET_0437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482591.1"
                     /db_xref="GeneID:38737203"
                     /translation="MVLLYAWIACLLANLVVAYDSHGSMKKIHPTKTLAARDVPLSTL
                     SPTSIFIPSLPGDKDATAPTSIIYMGQGFISYTSVYALVMGEKGKGEEPKTNYMFQGP
                     TEINVNKVMRTDAVGDVSTSGLFNVACSLPKSGGPSWECEYAFQNQSEKTVYSTVTTR
                     PNPNTMITPVIGVLNQRRRSTASGPTGIPRFTGTNSAKSWSRAYTLSVAYALLHMLGT
                     IFCAIAIESI"
     gene            complement(<750488..>754036)
                     /locus_tag="MRET_0438"
                     /note="MRES_01680"
                     /db_xref="GeneID:38737204"
     mRNA            complement(<750488..>754036)
                     /locus_tag="MRET_0438"
                     /product="pyruvate carboxylase"
                     /transcript_id="XM_027627065.1"
                     /db_xref="GeneID:38737204"
     CDS             complement(750488..754036)
                     /locus_tag="MRET_0438"
                     /codon_start=1
                     /product="pyruvate carboxylase"
                     /protein_id="XP_027482587.1"
                     /db_xref="GeneID:38737204"
                     /translation="MVEVTAQSVESRDFPTIEHLRDELRELSGIKGRRLMVANRGEIA
                     IRIFRTAHELGLQTVAIYSAEDRMCAHRSKADFSFEVGKGLSPVAAYLDMDGIVQIAK
                     ENKVDMIHPGYGFLAENPEFARKVEEAGIAFVGPRPETIDGLGDKTKARDLAREAQVP
                     IVPGTPGPIASYDAAEPFIKEVGFPVIIKAAMGGGGRGMRVVWSMDEFHAAFDRAVSE
                     ARSAFGDPTVFIERFLHRPRHIEVQLLADGEGNTMHLFERDCSVQRRHQKVVEVAPAS
                     HLSESVRQAILQDAVKIAKTARYRNAGTAEFLVDQENRHYFIEINPRLQVEHTITEEV
                     TGVDIVASQIQIAAGATLRDLGLSQESLIARGSAIQCRITTEDPEASFQPDTGRIEVY
                     SAAGGTGVRLDAGSGFVGAQITPHFDSLLVKVTCRAATYEMARRKMIRALVEFRIRGV
                     KTNIPYLLRLLRHHYFVEGNTWTTMIDDTPELFIFGHSANRAQKLLQYIGNLLVNGSS
                     IKGQVGEPGLSTEAHRPSLYKDGQLVDTSKPMLQGWRNIIVQEGPEAFARAVRAYKGT
                     LIMDTTWRDAHQSLFATRLRTLDILNIARETSHALHNAYSLECWGGATFDVAMRFLYE
                     DPWERLRAMRKLVPNIPFQALIRGANAVGYTSYPDNAIYEFSKRAVENGLDIFRVFDS
                     LNSLDSLKLGMHAAKVAGGVVEGTICYTGDVANPERHPKYTLDYYMGLVDELVATGHL
                     HVLGIKDMAGLLKPQSARLLVGSIRAKYPDLPIHVHSHDTAGIAVASMLACAEAGADV
                     IDAAIDSMSGLTSQPSMGAIVSSLEQMELGTGISHDSIQRLNLYWSEVRQLYQCFEQN
                     VKASDSSVFDHEMPGGQYTNLMFQSQQLGLGSQWSEIKHAYMEANMLCGDIVKVTPSS
                     KVVGDLAQFMVANKLSARDVEEHASTLDFPVSVVEFFQGFLGTPPGGFPEPLRTHIIR
                     NKERVDTRRGASLPPLDFDKIKSDLTVKYRRPMSECDAVSWAMYPKVFEEFQAFIEEF
                     GDLSRMPTRFFLGKPKAGEEMHIPIEDGKLLIVKLLGLGPFHEATGMRDVLFELNSSP
                     RSISVKDLSASVEEVHHEKATSEPGSVGSPLAGVVVELKVKEGDAVKPGDAMFVMSAM
                     KMETIVSAQIAGKVTRVAVKQNDSLSQNDLLCEITP"
     gene            754388..754523
                     /locus_tag="MRET_nc0001"
                     /db_xref="GeneID:38741157"
     ncRNA           754388..754523
                     /ncRNA_class="snRNA"
                     /locus_tag="MRET_nc0001"
                     /product="U4 small nuclear RNA"
                     /transcript_id="XR_003525358.1"
                     /db_xref="GeneID:38741157"
     gene            <754726..>755348
                     /locus_tag="MRET_0439"
                     /note="MRES_01675"
                     /db_xref="GeneID:38737205"
     mRNA            join(<754726..754775,754829..754951,755057..>755348)
                     /locus_tag="MRET_0439"
                     /product="small subunit ribosomal protein S18e"
                     /transcript_id="XM_027627066.1"
                     /db_xref="GeneID:38737205"
     CDS             join(754726..754775,754829..754951,755057..755348)
                     /locus_tag="MRET_0439"
                     /codon_start=1
                     /product="small subunit ribosomal protein S18e"
                     /protein_id="XP_027482499.1"
                     /db_xref="GeneID:38737205"
                     /translation="MSLVPPDPSQNFAHILRLLNTNVDGKRKIQYALTEIKGVGRRYA
                     NIVCKKADIDLRKRAGELNSDELERIVNILQSPQEFKIPTWFLNRQKDFSTGKDSQVL
                     SNNVEAKLRDDLERLKKIRAHRGLRHYWDLRARGQHTRTTGRKGRTVANKKK"
     gene            <755854..>756813
                     /locus_tag="MRET_0440"
                     /note="MRES_01670"
                     /db_xref="GeneID:38737206"
     mRNA            <755854..>756813
                     /locus_tag="MRET_0440"
                     /product="solute carrier family 25 (mitochondrial iron
                     transporter), member 28/37"
                     /transcript_id="XM_027627067.1"
                     /db_xref="GeneID:38737206"
     CDS             755854..756813
                     /locus_tag="MRET_0440"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial iron
                     transporter), member 28/37"
                     /protein_id="XP_027482997.1"
                     /db_xref="GeneID:38737206"
                     /translation="MTVEKTPNVFIAPDMPIDEAVEPEIDYEGLGDNYPLHINMLAGS
                     LAGITEHAVMFPVDVVRTRMQVLTSSPTATYSGIFDAFSRISSLEGARTLWKGIASVI
                     LGAGPAHALYFGTYELVKDLTGGNKLGFQLWSTSVAGASATIISDAFMNPFDVVKQRM
                     QMYNNTYSSVWECARYVYRTEGLRAFFLSYPTTLTMTVPFTAIQFATYEWAKGILNPS
                     HSYSPFTHVVAGGFAGAMSAACTNPLDVAKTLLQTRGLSHDKEISSATSMTRAFQIIY
                     AREGLRGFARGLSPRIFTHMPSNALCWLSYESFRFALREKPVL"
     gene            complement(<757075..>758883)
                     /locus_tag="MRET_0441"
                     /note="MRES_01665"
                     /db_xref="GeneID:38737207"
     mRNA            complement(<757075..>758883)
                     /locus_tag="MRET_0441"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627068.1"
                     /db_xref="GeneID:38737207"
     CDS             complement(757075..758883)
                     /locus_tag="MRET_0441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482996.1"
                     /db_xref="GeneID:38737207"
                     /translation="MVAVKGDSGKEILNTAAQDSVSGFVDDDLSQSEESDSDYELPES
                     ASTPNLKEAVDRIKRSVSLSSLQNISSGPHSEVRRQIQKKLWRPQDDEAKIPTDWERL
                     MIHVIRGASRAFTLAYGLRGSINFLFVIVKALRSRKPINKSDLKIAFTSEATIRFALC
                     FGIWASIFKFTNNALRLVTPRHIKPRNANRRSAHNTPEPTMRIEKDGNLTLAARQNNE
                     RRKSEWKHISSLDPRSRKWHAYLAGAVSSMAFVVMKRDFVRSLGTHLFVRGLEGTCRM
                     ANRAGYLYVPYGSVLVFGLANVQIILSWLGAPEYLERSYKAWIDKASGLSPEILRSYT
                     LSLTLGGPSPWDLVHLMGGEIPKPISTNPLKFSDVPPNAVAPLGVSGEMIRRIYRWCD
                     DGNPPRFPTCGLHHMYTTNHFVSTVRNYWILWKFVIPVYLTLYFVPLVFLRPKLLLKT
                     PLLTSVRTLLAATRSSAFLATYGLIVKSAFCILYASADGITHSWLKNYAVMRRLSNLL
                     VDHRMMGLAGFLSCLSLFVEHRRRRNELTMYVLPKALESFWKSGRARGIFPRVPMGDY
                     ILAAAGLSMIMGTYAENPQNLSKIVSLVLYQFLGRN"
     gene            complement(<759452..>760330)
                     /locus_tag="MRET_0442"
                     /note="MRES_01660"
                     /db_xref="GeneID:38737208"
     mRNA            complement(<759452..>760330)
                     /locus_tag="MRET_0442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627069.1"
                     /db_xref="GeneID:38737208"
     CDS             complement(759452..760330)
                     /locus_tag="MRET_0442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482999.1"
                     /db_xref="GeneID:38737208"
                     /translation="MRLSTLRLRYAALAPARIIGCTRVCPVARPALVPHATKNNNVRS
                     FVSSLAQRSSKIDNVHDENTASSPIFSKTLDAALGTQLQPSDMLSYLNSEDFCVYRST
                     SDPSQPLFGKEERLVSNALTHESWMHGLQGHNRRLSFIGRRALKTYLTLFLFDIFEHA
                     NRINAQAPDLKYLQTVLSSQQDIDDILATHHLGDHVGRKLGLEKVMRWHPTTRVDPTN
                     GTRESGLFKVRGTCVEAIMGAIYHFRGALVAQQFFLSRILPILADSYMSQAPRMVKEK
                     VAEASRDAAEALTQSA"
     gene            <760525..>761463
                     /locus_tag="MRET_0443"
                     /note="MRES_01655"
                     /db_xref="GeneID:38737209"
     mRNA            <760525..>761463
                     /locus_tag="MRET_0443"
                     /product="translation initiation factor 3 subunit G"
                     /transcript_id="XM_027627070.1"
                     /db_xref="GeneID:38737209"
     CDS             760525..761463
                     /locus_tag="MRET_0443"
                     /codon_start=1
                     /product="translation initiation factor 3 subunit G"
                     /protein_id="XP_027482998.1"
                     /db_xref="GeneID:38737209"
                     /translation="MSAAATLPPENGNKVNWADDESEGNAGSRIEKHDEGDGVQTVVE
                     YRRNADGKQVKVTRRIKRTLISTKVNHFVAERKNWHKFGLEKNAAPGPNSGTTSIGAN
                     VQVKLTAGATKEPEPDPTEAMREKLANKRVQCRLCKGDHYTARCPYRDTLEAIPGAGG
                     DVPDSDTVAAAAAAGVSLTNEAATGKVGSVAAALGGAGGGSRYKPPSLRSGAVPSSGM
                     GGPTQRDETATLRVTNLSEDAEEEDLRDLFRYYGRVTRIFVGRDRETGLCKGFAYVNF
                     EDRASADLARQKLDGYPYNNLILSCQWSQPRGERPH"
     gene            complement(<761518..>762262)
                     /locus_tag="MRET_0444"
                     /note="MRES_01650"
                     /db_xref="GeneID:38737210"
     mRNA            complement(join(<761518..761530,761559..761608,
                     761645..>762262))
                     /locus_tag="MRET_0444"
                     /product="V-type H+-transporting ATPase subunit E"
                     /transcript_id="XM_027627071.1"
                     /db_xref="GeneID:38737210"
     CDS             complement(join(761518..761530,761559..761608,
                     761645..762262))
                     /locus_tag="MRET_0444"
                     /codon_start=1
                     /product="V-type H+-transporting ATPase subunit E"
                     /protein_id="XP_027483001.1"
                     /db_xref="GeneID:38737210"
                     /translation="MSHAMNDEEVITELKKMVAFIRQEAVEKAREIQVKADEEFAIEK
                     AKFVRQEGMSLDTQYDKKKKQFEVSQRIAKSNQSNKARLEILKSREENLQNLFTEAQE
                     RLTKVSENANSYKELLAKLLLESLLILHENKVQVITRSNDVQIVQGVVDEALKKYKDV
                     TGRESKVDVSEGLPKDSAGGIIVSARNNTIRLDNTLEQRLRLLEEKMLPEIRLNLFGP
                     NKQRKFFT"
     gene            complement(<762485..>763152)
                     /locus_tag="MRET_0445"
                     /note="MRES_01645"
                     /db_xref="GeneID:38737211"
     mRNA            complement(join(<762485..762948,762990..>763152))
                     /locus_tag="MRET_0445"
                     /product="large subunit ribosomal protein L54"
                     /transcript_id="XM_027627072.1"
                     /db_xref="GeneID:38737211"
     CDS             complement(join(762485..762948,762990..763152))
                     /locus_tag="MRET_0445"
                     /codon_start=1
                     /product="large subunit ribosomal protein L54"
                     /protein_id="XP_027483000.1"
                     /db_xref="GeneID:38737211"
                     /translation="MSMLVRALRATHAHMACNRASVAVLNSAQSHVFRFAHTEAIGKD
                     ASEHVEPAQQDLPSAAPAGTVLSGLSIYKDKPDPIAKPDHEYPSWLWDLLEDPAIKPK
                     KALVIGDVDTTGMSKGEARAALKRGAKIARAAVRKQAMMEAKEKARLERMTDTQRAAL
                     AAEAEAKAKAKAESMTITDTLEEERSQRRVLRKSRRDAIKSSNFVRAA"
     gene            complement(<763240..>765213)
                     /locus_tag="MRET_0446"
                     /note="MRES_01640"
                     /db_xref="GeneID:38737212"
     mRNA            complement(<763240..>765213)
                     /locus_tag="MRET_0446"
                     /product="small G protein signaling modulator 3"
                     /transcript_id="XM_027627073.1"
                     /db_xref="GeneID:38737212"
     CDS             complement(763240..765213)
                     /locus_tag="MRET_0446"
                     /codon_start=1
                     /product="small G protein signaling modulator 3"
                     /protein_id="XP_027483003.1"
                     /db_xref="GeneID:38737212"
                     /translation="MLPHKAHVYEERAPVDVHPLSVCTEDSPQITRVDSPPSPVPLPE
                     PPACIKAAFEDVEHAIWQDIAASLPNHSKMVHHWLDAQDNTARAVLYIMSRALERLVL
                     EPSDRVEATLRQAMDEELHDSQHVVSNEPFEIEKEPFRVLEWIVALAHATAPRSPSTG
                     SETGTASPNEEESHCSSEEPSGRDRLMELKPMVPLESCPPPLAPRHESASDLDRNNPI
                     FVDHYGFLYGVSVTDYWRQAQETPESTQDTPSPDPSPSPSATSPVMKLGLVESVPQTR
                     MTMSSSLTLPQPTPTLETSVISAMSDKHHGNAVSSTVPRLVRHVHDMYEEQEKERKAK
                     WDEFLAHVHASSSSAMDSEPETIWHNMFVALRSSPDTARGQSDAHRFQALCEGGIPMT
                     YRPAVWTECSHALSWAEPGRYADLHAQSNKESRQIALDVHRTMPTNLFFGGHGPGVPK
                     LKRLLTAYAHFNVDYGYCQGMNNLAAVLLLAFTNEEDAFWVLVGTIHTILPPGYYAPD
                     MLVPQADQKILTQLVRAGMPKLSTHMEQLGVELPAVTFSWFLSLFTACLPIQTVFRVW
                     DMLFLEGNVILFRVAFAILSLKSKALLDTPTAASFYQQLHMATAYWYDADELVSTCLS
                     MREKIRASDISARRAKLLKRLRDSFSQSVSTPP"
     gene            <765292..>767606
                     /locus_tag="MRET_0447"
                     /note="MRES_01635"
                     /db_xref="GeneID:38737213"
     mRNA            join(<765292..765406,765433..>767606)
                     /locus_tag="MRET_0447"
                     /product="cleavage and polyadenylation specificity factor
                     subunit 3"
                     /transcript_id="XM_027627074.1"
                     /db_xref="GeneID:38737213"
     CDS             join(765292..765406,765433..767606)
                     /locus_tag="MRET_0447"
                     /codon_start=1
                     /product="cleavage and polyadenylation specificity factor
                     subunit 3"
                     /protein_id="XP_027483002.1"
                     /db_xref="GeneID:38737213"
                     /translation="MADKVPDTESPMSEDKLCIEMLGAGQEVGRSCCVITFKGFTIVC
                     DAGVHPAHTGLTALPFIDNLDWSTVDALLITHFHLDHAAALTYIMEKTNFCDGKGKVY
                     MTHPTKAIYRFLMSDFVRISNAGSDRMLFDESEMLASWRQIEAVDYHQEVVLGGGFRF
                     TPYHAGHVLGACMFMIEMAGLRVLYTGDYSREEDRHLVQAEVPPVRPDVLICESTYGT
                     QSLEPRLDKEMRFTALIHSIINRGGRVLLPVFVLGRAQELLLLLDEYWEAHPELHSVP
                     IYYASSLARKCMSIYQTYIHTMNQHIRTRFHRRDNPFVFKHVSNLRSLDKFDDKGPCV
                     MMASPGFMQSGISRELLERWAPDKRNGVIVSGYSVEGTMARDILSDPDDIVAMNGQRI
                     PRRMSVDYISFSAHVDYTQNSRFIDQVKAKHVVLVHGELKNMTGLRAALQSRYSDREE
                     DVNIYMPRNCEPLYLSFRADRTAKVIGSLAKHPPKANETIDGLLVAKDFSYTVLAPED
                     LTEFTGLSTSTIVQRQRVALNVGWELARWHLEGMYGRVDEGVDEQGYRCMRIMSVVDI
                     KQVRQDMLVLEWESSVSNDMVADSVMALLLSIDSCPATVKMTMHDHVCQHAAPPPPSG
                     ESHINTLESLFAVLEAHFGDVEMLDIGNCAHEEVPNDASPTDRLCATIPSPVRPGVKV
                     ALDDEPAIVSLDDMVVYCETESLKHRVERLVAMVRSASTPIVDAFHLTPACSSMLFQG
                     KHNQVKLEQNDTKDIPRMQITQ"
     gene            complement(<767609..>770577)
                     /locus_tag="MRET_0448"
                     /note="MRES_01630"
                     /db_xref="GeneID:38737214"
     mRNA            complement(join(<767609..770403,770445..>770577))
                     /locus_tag="MRET_0448"
                     /product="DNA replication licensing factor MCM4"
                     /transcript_id="XM_027627075.1"
                     /db_xref="GeneID:38737214"
     CDS             complement(join(767609..770403,770445..770577))
                     /locus_tag="MRET_0448"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM4"
                     /protein_id="XP_027482995.1"
                     /db_xref="GeneID:38737214"
                     /translation="MSRRDDASPQSQHGRDASSSLGLPSSSPVHPSMHERAAPSDSSS
                     VVSGVGSPLHFPTSSPAVSQISQRTPLARRRHGPMSTTSSQSGDAEPLFFPPSTSSTP
                     HRSRRGDIQSFSVALSSPSVLPWRMHQGLTPAANGSESERAPRSSSHASDDLVFSHGT
                     SEDDAQYAQPQQNMLKVIWGTNVSVGETMQLFQTFLRGFRLKYRWAYVRSHGLPQAQL
                     PHMDGELLLYEDYMRQMRRTHIPNLNLSIRDLAAFPPSKKLALQVIRYPQEVVPIMDT
                     VLKEQMLVLAEEDLRSSLTNYEVDTLREQMDLIESMLYKVRPYGGKSTNMRDLNPSDI
                     DKLTVVRGLVIRVSSIIPDMKVAFFRCSVCHHTVQVEIDRGRITEPQRCPRDMCNQLG
                     SLSLIHNRCEFADRQIIRLQETPDVVPDGQTPHSISLCVYDEMANRCKPGDRIEVTGI
                     FRSMPVRLNPRQRTLKSLFKTYVDVVHVRLNSSRRLFMDGSTRELVDTHALGVGGEDE
                     GEMVDSDSHVAGDAPSSQLPASGRMSLFPSEEMQDQIQRLSERSDVYELLARSLAPSI
                     YEMEDMKKGVLLQLFGGTNKSITTGDGHDGPRYRGDINVLIVGDPGTSKSQMLQYVHK
                     IAPRGMYVSGKGSSAVGLTAYVTRDPDTKQLVLESGALVLSDGGVCCIDEFDKMPDAT
                     RSVLHEVMEQQTVSVAKAGIITTLNARTSVLAAANPIGSKYDPHLPITKNIDLPPTLL
                     SRFDLVYLVLDQIQEATDRRLARHLVGLYLDDAPESGGSDVIPIELLTSYISYARENV
                     APVLTAEASDLLARRYVELRKAGEDPRSTERRITATTRQLESMIRLSEAHARMRLSTV
                     VTAADVDEANRLIREAAKSSATDPTTGLIDLDLLATGRSLHQRRIAGDMKNELLSVIQ
                     TLAQGGGQSRPVRVTELLHSIREQSSVMVEPAELNEALQALEAEGTVQLAGDRERRTV
                     RLL"
     gene            <770712..>771383
                     /locus_tag="MRET_0449"
                     /note="MRES_01625"
                     /db_xref="GeneID:38737215"
     mRNA            <770712..>771383
                     /locus_tag="MRET_0449"
                     /product="mitotic spindle assembly checkpoint protein
                     MAD2"
                     /transcript_id="XM_027627076.1"
                     /db_xref="GeneID:38737215"
     CDS             770712..771383
                     /locus_tag="MRET_0449"
                     /codon_start=1
                     /product="mitotic spindle assembly checkpoint protein
                     MAD2"
                     /protein_id="XP_027482994.1"
                     /db_xref="GeneID:38737215"
                     /translation="MSVAQAVGQQAPTRTHLTLKGSTTLVHEFFNYSVQSILYQRSIY
                     PSDDFRTIKKFGLQMLATTDEDLADYLDRAMQQLKKWLEQGKVRRLVVAIVEKETQET
                     VERWQFDIEVLNEGMAESDVPKSDDAIPKSLRKTDAQVKAEMAAIIKQITASCTFLPV
                     LEEPCAFQILAYTDRDVEVPVEWSDSHARLIAEGKAEQVKLRSFSTHVHRVDAMVAYR
                     REDDI"
     gene            complement(<771402..>772265)
                     /locus_tag="MRET_0450"
                     /db_xref="GeneID:38737216"
     mRNA            complement(<771402..>772265)
                     /locus_tag="MRET_0450"
                     /product="tyrosine-protein phosphatase SIW14"
                     /transcript_id="XM_027627077.1"
                     /db_xref="GeneID:38737216"
     CDS             complement(771402..772265)
                     /locus_tag="MRET_0450"
                     /codon_start=1
                     /product="tyrosine-protein phosphatase SIW14"
                     /protein_id="XP_027483045.1"
                     /db_xref="GeneID:38737216"
                     /translation="MAGHVDPAMQFASEPTMDYTALLCRRPDDDVDVPKPPKHLEFLH
                     RILSENDAKTQSPRQGADVSNCDSDEKSDQDSKNMSPTKSAFVPSEELIPPDNFAMVN
                     SWVYRSSFPKKKHFPFLKTLGLRSVLTLILEDYPEQNIQFLDENGIRFFQYGIPGNKE
                     PFVQIPSQTITAALATILDRRNHPMLIHCNKGKHRTGCLIGCLRKLQQWSLTTIFDEY
                     RRFSYPKSRSMDQEFIELYSEQAVWPHIEPQWMPRWTVLGRREILSLITSATTDASHN
                     DHDNDDVVHGM"
     gene            <772495..>772994
                     /locus_tag="MRET_0451"
                     /note="MRES_01620"
                     /db_xref="GeneID:38737217"
     mRNA            join(<772495..772905,772935..>772994)
                     /locus_tag="MRET_0451"
                     /product="F-type H+-transporting ATPase subunit g"
                     /transcript_id="XM_027627078.1"
                     /db_xref="GeneID:38737217"
     CDS             join(772495..772905,772935..772994)
                     /locus_tag="MRET_0451"
                     /codon_start=1
                     /product="F-type H+-transporting ATPase subunit g"
                     /protein_id="XP_027483046.1"
                     /db_xref="GeneID:38737217"
                     /translation="MLSMFRQMVTSQSSRLARTSMTRGYASQSGNGAVQGLSERAQAI
                     GASVLKVAERALGSYAEPVMYNLKVAGSIAKQVYIAEKLAPPTSLSQIQAAYRQIWAC
                     VSKASWWTHSLPAGEWRKVAVYGVEAIGIFSIGEIIGKRKLVGYRIKEHGPAHH"
     gene            complement(<773061..>773659)
                     /locus_tag="MRET_0452"
                     /note="MRES_01615"
                     /db_xref="GeneID:38737218"
     mRNA            complement(join(<773061..773169,773198..773528,
                     773560..>773659))
                     /locus_tag="MRET_0452"
                     /product="protein of unknown function (DUF2781)"
                     /transcript_id="XM_027627079.1"
                     /db_xref="GeneID:38737218"
     CDS             complement(join(773061..773169,773198..773528,
                     773560..773659))
                     /locus_tag="MRET_0452"
                     /codon_start=1
                     /product="protein of unknown function (DUF2781)"
                     /protein_id="XP_027483043.1"
                     /db_xref="GeneID:38737218"
                     /translation="MTRTTHVPLWKRPIDSMYFTFFALHLIASLCVDIQGLVPAEYVP
                     TVLQRVLQDYLVKSRDPLVPNAWQPRYAWFRMSLLSEFVLQVPAFVVGLYVFWSNDPR
                     GYPLLIAYGAIACFTTLQCIAMVTMGEERVHLAPENLSFILQNYIPFMLFPGVIMLDM
                     LARTTRRMHATTPAHAKTQ"
     gene            complement(<773704..>774162)
                     /locus_tag="MRET_0453"
                     /db_xref="GeneID:38737219"
     mRNA            complement(<773704..>774162)
                     /locus_tag="MRET_0453"
                     /product="4a-hydroxytetrahydrobiopterin dehydratase"
                     /transcript_id="XM_027627080.1"
                     /db_xref="GeneID:38737219"
     CDS             complement(773704..774162)
                     /locus_tag="MRET_0453"
                     /codon_start=1
                     /product="4a-hydroxytetrahydrobiopterin dehydratase"
                     /protein_id="XP_027483044.1"
                     /db_xref="GeneID:38737219"
                     /translation="MISRSLLHIPSTLRSIRFMSTQWADAQCVPCSKKAIRELGLKAL
                     TAEETRTKIQQLEPGWTLAPQPQVGESSPVPLALQKVFRFRNFATASTFASQLGKVAD
                     AQGHHPAILLEWGSVAVWWWSHALQGLHENDFIMAARTDRVASSTEGRKS"
     gene            <774217..>774672
                     /locus_tag="MRET_0454"
                     /note="MRES_01610"
                     /db_xref="GeneID:38737220"
     mRNA            join(<774217..774247,774275..>774672)
                     /locus_tag="MRET_0454"
                     /product="U5 snRNP protein, DIM1 family"
                     /transcript_id="XM_027627081.1"
                     /db_xref="GeneID:38737220"
     CDS             join(774217..774247,774275..774672)
                     /locus_tag="MRET_0454"
                     /codon_start=1
                     /product="U5 snRNP protein, DIM1 family"
                     /protein_id="XP_027483049.1"
                     /db_xref="GeneID:38737220"
                     /translation="MSYFLTHLPTGWHVDQAILSEEDRVVVLRFGHDWDETCMVMDET
                     LFGVSERVKNFAVVYLVDTTQVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKI
                     NWAIDSKQEMIDLIETVYRGASKGRGLVVSPKDYSTRYSY"
     gene            complement(<774678..>776279)
                     /locus_tag="MRET_0455"
                     /note="MRES_01605"
                     /db_xref="GeneID:38737221"
     mRNA            complement(<774678..>776279)
                     /locus_tag="MRET_0455"
                     /product="protein DML1"
                     /transcript_id="XM_027627082.1"
                     /db_xref="GeneID:38737221"
     CDS             complement(774678..776279)
                     /locus_tag="MRET_0455"
                     /codon_start=1
                     /product="protein DML1"
                     /protein_id="XP_027483050.1"
                     /db_xref="GeneID:38737221"
                     /translation="MTRPKEIVSLSFGTPANYVAAHYWNAQQAYFDYGPDAPPPLVEH
                     DVSFKAGLGVDGLDTYSPRALLFDVREEFGHLSKIHELYDPGPDEAFDGEVIQTHQGE
                     TNRSYWTDLAQTLFHPKSLVTVSASSLYGSSFLSNMGTDTQNPTLETFAQGQAIARAM
                     DDEQRITEDTLRWWTEDTDLMQGFQLSASAYDAYGGIVCTYLDMLADEYPKTERHLTL
                     LSQRIDHANTRYTAMNQVLSLVRALEYAHLVTPVAMEEPTPWPHVRSDANDLHRSAVL
                     STLLETATLPQRLMHRTDSMHTLRMRLQWHGDTRFAQLGGCMPTPLLAEERPDPMDAL
                     LQAMLAQRGIAHSPPDRVPAAAKRLRDAWWDASMPWANASDPGATPYAEAVVARDADS
                     KAEQPTMDALAHEYPLSEPFVSRTFVPMAYPIEPTYPSILHGVTSDGRPWAGDEKVNV
                     TSMPCISSLRTSPEMRCIIKEARSFTLDVLQGHAPLSMYGMEKDDRDVLVDVRETLET
                     LYDVYGGVDDDQGPGTDEEWEVDAW"
     gene            <776309..>778897
                     /locus_tag="MRET_0456"
                     /note="MRES_01600"
                     /db_xref="GeneID:38737222"
     mRNA            <776309..>778897
                     /locus_tag="MRET_0456"
                     /product="vacuolar protein sorting-associated protein 16"
                     /transcript_id="XM_027627083.1"
                     /db_xref="GeneID:38737222"
     CDS             776309..778897
                     /locus_tag="MRET_0456"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 16"
                     /protein_id="XP_027483047.1"
                     /db_xref="GeneID:38737222"
                     /translation="MSEWHRLGEAYYRRTVLYDLAWSTSHLDGFMVAMSMDAGLIALT
                     RDPHQLVAVSDNAFDHNIQIFTGAGQLFEILRWDVTARIVAIGFTWHDELVVVSDDGQ
                     VRLYTWLVPTYQQDTPCLEATPTSYYHAFSLGDEAAEYGIARVLIQPRRLWALLRNGM
                     VVDASFSHTDVWPDEAPTLDVHVIPPLCTSKPHLCAWAPNHQQLLLCTDTGAWALEQE
                     HSYASLPVTQPILGASYSLQGKYVAWLDEHQQLHVDTADFSRQLRTYDLRTSQAYQAA
                     PMALRAGPLLDDDSLFGQKLDKGGLGGSGVYAMAWCKDNAVALAMYEHILLLGPYEEP
                     LVFHVRGIPHIYSSPDGLHVVHIDAHEHMALAEAPTLAALRPGSTHTAAILLDASRMA
                     QQHSPQAYEAVRAIQDSLEEAVQACIEAATLEWHASTQQALLQAALFGRTFLDTYDPA
                     RMLQVSSMLRILHAVRSPSIGIPAAYDESVSLILYRLASRNQHKLAVQICTFLGIRAD
                     PVLKHWLRAKVARARPIRGNEQLAHVIMDKFQAASAVNYADMARCAWQAGHPKIATLL
                     LEREVRAREQIPLLLHMREHRLALHKAVESGDTDLVFQVLFALQRTLARGALFRTVQS
                     LVWTESSPTPWAMGLCPPATPTYTDLAPHLLVSYARDQDPGMLHDFFYQDDRHADMAL
                     MCMDEAQRMDVSSRAEALRRAQRHFDEDRTCAWPARLTGEACSLLGLQAAIKSEGGGD
                     LEGASLYATILACLENPALEYRAEKLQHTFSVPSSRYYGLRVRAYIKTRNIHALTRLV
                     SSQKPPHGYVYIVRALLQAGLVDAACTFVAKGASDRSSKHRLLAYIERGPHPPSVREA
                     LQGALP"
     gene            complement(<778914..>780812)
                     /locus_tag="MRET_0457"
                     /note="MRES_01595"
                     /db_xref="GeneID:38737223"
     mRNA            complement(<778914..>780812)
                     /locus_tag="MRET_0457"
                     /product="glutamate--cysteine ligase catalytic subunit"
                     /transcript_id="XM_027627084.1"
                     /db_xref="GeneID:38737223"
     CDS             complement(778914..780812)
                     /locus_tag="MRET_0457"
                     /codon_start=1
                     /product="glutamate--cysteine ligase catalytic subunit"
                     /protein_id="XP_027483048.1"
                     /db_xref="GeneID:38737223"
                     /translation="MGLLSLGTPLAWEDALSLSEHVRTHGIEQFLSTWRKEQGRQDDA
                     LLWGDELEYMVVVLDHEHKTARLSLRQGEILECLNRCCSTELDDIRPDERPTFHPEYG
                     RFMLESTPGKPFGVSVAELLRVEPDMELRRKLARKHLQANEVPMAIVSYPRLGTHDTP
                     FTDPAHAPHGEASHSLFLPDELINKHVRFPTLTANIRKRRGSKVRINVPLFRDVHTPT
                     PFVDPSVPWDRHEFAEDQEAALGAAYTDHIYMDAMGFGMGCCCLQVTFQAPCIDDAKR
                     MYDQFIPLTPLLLAATAASPVYRGYLADVDCRWNVISAAVDDRTLIERGEAPLKEGEP
                     QHNSDSAGRRLRKSRYDSVDSYLTTREWNDVPLEMNERVRQRLLESGVDALLAEHMAH
                     LFVRDPLVIFSENINLDDTRSMDHFENIQSTNWQTMRFKPPPHGGHTGWRVEFRSMEI
                     QLTDFENAAFCIFLVLLSRVIMTMPVDFGMPISLVDVNMQRAQRRDAIHSQRFHFRSS
                     RHTSQTQEYTLADIFHGSPGDNTMPGLLPLVHSYLDSLNMSETERQRLNRYLDLVAMR
                     VDGRLMSTATYIRQFVQQHPAYRRDSVVSDEINYDLLCTLDRIERGECEVPDFMPAWF
                     AAYRRERK"
     gene            <780969..>782606
                     /locus_tag="MRET_0458"
                     /note="MRES_01590"
                     /db_xref="GeneID:38737224"
     mRNA            <780969..>782606
                     /locus_tag="MRET_0458"
                     /product="ubiquitin carboxyl-terminal hydrolase 1"
                     /transcript_id="XM_027627085.1"
                     /db_xref="GeneID:38737224"
     CDS             780969..782606
                     /locus_tag="MRET_0458"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 1"
                     /protein_id="XP_027483041.1"
                     /db_xref="GeneID:38737224"
                     /translation="MLLLAVAWLIVHSPVVQAADASDIVDIRILLFTLAAASLVLAAC
                     IIPILMPWIAPGFDPLRGLLPAHDSPPPLLDAHASVAAQKQRLSSEVPHYAGLVNPSV
                     DCYFNSVVQSLASLTHLARYLDDMAIMSRRWDVATPVTDALLALLVALNTPQARRTTL
                     TPRALRTALQSASPSHGIRTLLSAQQQQDAHEICVLLMETLDAELGAVQQGRSHALRS
                     QTTQGLGLLTAPSILVRGRLRTQLGFDGDHVSNPFRGTLAQRTSCAQCGYMEAVRHFS
                     FTDLDLVVPSSTCTLQQCLASWMELEHIEWVCHRCSLQATLMRIESARDAITEPCSRK
                     QSKQAALLDAQRTTLKRVLCSGAHDSELEATHELDGIELERILSTYATKQIMMARCPP
                     ILVLHLNRSSFSLGNFGASKNQARVVFPEYLDMLPFMTGATLSAHPLQPISPSEKAGN
                     AIYRLSAMVAHYGTHNYGHYVSYRRRPCPLDEGPDVWTRVSDDHVQLCSWDEVQVQNP
                     YLLMYERIDNAAPSPLIPARTVHRWDVYTFRRAISAP"
     gene            complement(<782581..>783036)
                     /locus_tag="MRET_0459"
                     /note="MRES_01585"
                     /db_xref="GeneID:38737225"
     mRNA            complement(<782581..>783036)
                     /locus_tag="MRET_0459"
                     /product="proteasome maturation protein"
                     /transcript_id="XM_027627086.1"
                     /db_xref="GeneID:38737225"
     CDS             complement(782581..783036)
                     /locus_tag="MRET_0459"
                     /codon_start=1
                     /product="proteasome maturation protein"
                     /protein_id="XP_027483042.1"
                     /db_xref="GeneID:38737225"
                     /translation="MTMSSAPSMAIVPPSHASCTKTDAHSTMHPELGVHDTMRHGLRS
                     MRDESAAATMHPIQHRLERWDETQRNWKMAMYRNTFGLGMPMRMMMERKNVAYTPHMP
                     AKHVSNIHLDVLDGRDEVLDPVDFLPSNVTGENRLGSDMHSAMEQKWRV"
     gene            <783158..>786285
                     /locus_tag="MRET_0460"
                     /note="MRES_01580"
                     /db_xref="GeneID:38737226"
     mRNA            join(<783158..786237,786270..>786285)
                     /locus_tag="MRET_0460"
                     /product="ATP-dependent RNA helicase DOB1"
                     /transcript_id="XM_027627087.1"
                     /db_xref="GeneID:38737226"
     CDS             join(783158..786237,786270..786285)
                     /locus_tag="MRET_0460"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DOB1"
                     /protein_id="XP_027483108.1"
                     /db_xref="GeneID:38737226"
                     /translation="MGKRGTDRTPSTAVSPQEPDGAKKSRIDDAPAVVTDEFTAESVR
                     QVPTAEDAQSTDHDSSSIQQSAATLKLSHSVRHQVAIPPGYDYVPLSKHVPRDPPSRS
                     WPFELDPFQRTSVHCIERNESVLVSAHTSAGKTIVAEYAIAQALRDRQRVVYTSPIKA
                     LSNQKYREFAAEFGDVGLMTGDVTLNPSASCLVMTTEILRSMLYRGSELMREVAWVVF
                     DEIHYMRDKERGVVWEETIILLPRKVHYVFLSATIPNAMQFAEWISQIHAQPCHVVYT
                     DFRPTPLQHYLFPQGGNGIHLVVDEKGVFREDNFQRAMGALAEARGDDPASTDSGKGR
                     KGQSKKGGANSSGTSDIYKIVKMIMLKKYNPVIVFAFSKRQCEALALQMTKLEFNTDE
                     EKDMVSTVFKNATACLNEEDQNLPQIQHILPLLRRGIGIHHGGLLPILKEVIELLFQE
                     GLLKVLFATETFSIGLNMPARTVVFTAVRKWDGNEFRNLSSGEFIQMSGRAGRRGLDD
                     RGIVIMMFDEKLEPSAAKVMVKGEADRLNSAFHLGYNMILNLMRVEGISPELMLQRCF
                     FQFQQAASVPMLEDKLAAAKQNHDAITVPDEDEVAAYYTMKKTLAQLDADRREVMRHP
                     SYALPFLQAGRLIKVQHDDTDYGWGVVVSYQKRMPPRGQEFDPRAPAHSLYVVDTLLH
                     CASGTVVPKQREFAPSFSGIEPASSSSGEWISVPILLSHVQEFSGIRVFLPKDVRLRD
                     ARAQVGKNLQEVHRRFPSGLPRLDAVKDMKIDDMSFKQLLGKMEILQTRMEQAPIAQD
                     QTSFQPKYDLYAKKRESADLVQTLESQISTAHNVLQLDELKCRKRVLRRLGFTSSEDI
                     VEKKGRVACEISTGDELLLTELIFTGTFNDMEPEHCAALLSCFVFGERSEHPVRLKEE
                     LAAPLRILQDTARRIAKVSVECRLPVVEQDYVQSFKVELMDAVLQWCQGARFVDICKM
                     TDVFEGSIIRAFRRLQELLRQMSQAAKAIGDEELSSKFEQSLAKLERPNSIIFSPSLY
                     L"
     gene            complement(<786299..>787966)
                     /locus_tag="MRET_0461"
                     /note="MRES_01575"
                     /db_xref="GeneID:38737227"
     mRNA            complement(<786299..>787966)
                     /locus_tag="MRET_0461"
                     /product="nonsense-mediated mRNA decay protein 3"
                     /transcript_id="XM_027627088.1"
                     /db_xref="GeneID:38737227"
     CDS             complement(786299..787966)
                     /locus_tag="MRET_0461"
                     /codon_start=1
                     /product="nonsense-mediated mRNA decay protein 3"
                     /protein_id="XP_027483107.1"
                     /db_xref="GeneID:38737227"
                     /translation="MEYHAPAPQRMVLCADCGIPIEPNNANRCVNCLRNSIDITELIP
                     KTATINFCKNCERYLNPPNTWVIAELESRELLAICLKKLRGLKSVRLIDANFVWTEPH
                     SKRLRVKLTVQKEVFTSTILERAFEVEIIVQYGQCPDCTRLAAKNMWRAAVQVRQKVP
                     HKRTFLYLEQLILKYNAHRETVSVQEKKDGLDFFYVQRAHAIRMCEFLASVVPVRSTK
                     SEQLISMDVHTSSSNYKFTYSVEIVPLCKDDLVCLPLHVARSLGNIGQFVLPFRISNV
                     IKLIDPVTLQMADLTAEKYWREPFPALCTIPEMVEFLVLDIEPLGTVAHGPHGQVMHK
                     FMAADAQVSPLHANTFGESDAVFYVRTHLGHILQPGDTVMGYYLATSNFNSAIYDAVP
                     EERRPDVVLVKKSYPERKRRSKRNWKLKSIAKEADDPTASEHYTGRGALGRRGGLDSQ
                     RVEQDYELFLRDLEEDDEMRANVNLYKDKVRMAQEEERRRRREVAYRDPQAMDDEDEP
                     AGEPMVDGDDGLTTDNESEYGSDSELPRVQLDELLDDMDEMAIEEQE"
     gene            <788141..>789388
                     /locus_tag="MRET_0462"
                     /db_xref="GeneID:38737228"
     mRNA            <788141..>789388
                     /locus_tag="MRET_0462"
                     /product="zinc finger protein (RING finger)"
                     /transcript_id="XM_027627089.1"
                     /db_xref="GeneID:38737228"
     CDS             788141..789388
                     /locus_tag="MRET_0462"
                     /codon_start=1
                     /product="zinc finger protein (RING finger)"
                     /protein_id="XP_027483106.1"
                     /db_xref="GeneID:38737228"
                     /translation="MWRHLTGLRAMRHRRNADVESQQGVTNIELNTAHRGSIVSPEQL
                     RPPQHGDFHLPEHPTDESIGQDSKRNDSLERIVGPNVGDFSGACADDDNVVMTDTLIR
                     WIDGVANHSSLTLLQLYVNLHHDFIHVGTDLSSCDVKLIPEVQSSLALPDPTHCITAM
                     CDCVAPRARLDLYLQASRHVGSDLVHPPLESQWSHGWRIASTIIETGYGVMVRLPLVL
                     DNAWNAADPKRLSIVLEALDEDELKLPQRNAIVTTWDIIGSGSYQARTLAQYAHLGST
                     RLQLHELFGLSPLTKKDEPTVRSNNNQPGDHATADRPHEPLVFNPALMENAAKLAETD
                     REDGPECPICMSNPAMTVLFPCTHSLCFECAVHLRDSVQKSRQHDRRNGREPRRQYVC
                     HICRCDIESMCSLSRQETPASTV"
     gene            complement(<789385..>790602)
                     /locus_tag="MRET_0463"
                     /note="MRES_01570"
                     /db_xref="GeneID:38737229"
     mRNA            complement(<789385..>790602)
                     /locus_tag="MRET_0463"
                     /product="transcription initiation factor TFIIE subunit
                     alpha"
                     /transcript_id="XM_027627090.1"
                     /db_xref="GeneID:38737229"
     CDS             complement(789385..790602)
                     /locus_tag="MRET_0463"
                     /codon_start=1
                     /product="transcription initiation factor TFIIE subunit
                     alpha"
                     /protein_id="XP_027483105.1"
                     /db_xref="GeneID:38737229"
                     /translation="MAPALAEPGPSSAKQNASGKNDALNQERQATPEQMAEIRRLVQV
                     IARLFYDDGYILLVDQLVSIALIPIEVLARRIGMQTRDLASLASKLVEDRVISVYRCQ
                     ETRDGPFQRSITRTYFYIDYKLFLDVTKWRMMAMRRHIDTKLRNGLDNKGYVCPRCGK
                     SYSTLEVAHLLNPFRNLFVCDVPGCGTELVDNEDAEDVRSSKDTLTRFNEQLSVVQKM
                     LRSVDGVALPPMDAHAWLAKNSAAPPWAHETARDEKALAPGSVPKTTPKAPAVRVEMA
                     HDTERERLELERQRALEEEQQRAQNTLPSWHLASTVSGDRTGLGNSESLRRGSEVDDI
                     KDVPQDTDIQSVEDVDYYARYASQVQEFTDAEATSTKRQAENAHDGQPEQKRVKPDEE
                     EEEEDMEDMEDVI"
     gene            <790771..>793074
                     /locus_tag="MRET_0464"
                     /db_xref="GeneID:38737230"
     mRNA            <790771..>793074
                     /locus_tag="MRET_0464"
                     /product="MFS family protein"
                     /transcript_id="XM_027627091.1"
                     /db_xref="GeneID:38737230"
     CDS             790771..793074
                     /locus_tag="MRET_0464"
                     /codon_start=1
                     /product="MFS family protein"
                     /protein_id="XP_027483104.1"
                     /db_xref="GeneID:38737230"
                     /translation="MTEDSVLGKHGLGSKNQPRSPLHTQERLQVSESTGLSQESGVPP
                     PLSFKRRSRDVSLGFSGMRRWIGQDSNRNSSVFSARHRANRASDGWEHPGRYVSASQV
                     SVPSILPLKPPSSHSNPIPTLPYTVLCMLIFGEFCSSGVAGPFLFFMLKDYDLGDESR
                     VGFWAGIVASLFFLAQFLTSLMWSSVAEKKGSRFVLRASMIGNSLSLIAFGFAPNLPL
                     AILFRLSQGFFNGAVGVAKGAVRSLTDETNEGRAYAQMGFWWGMGGIVGPILGGVLEH
                     PATKYAWLFGRSQFLHAHPYVLPCILAATSTIIGAFLSFFLEEDLKPSVGAIHLPEEP
                     QNIIRSPSQEDVERSGWSFTSSAWSRLRGRHSLQQPRWPLAFGPRTRQVSSGTAYGYH
                     EPRRLRCVSTASRISSDAGPGMRSPELLTTEDLREYDHEENKRKSLVERFVLSNDDAV
                     LSLTDLWVAAAANMEEDRHRESESDAIQEEDEWDYHDSEDDTSHPFHSTPSLIPTQTS
                     SSYVPPLHFARASKLHRTHEETSRQAINMSPSSPPSRTIPSASPIWMLPLVVIGHYSV
                     LSFHSSMFDQVFMAFLVTPEPSGGLGLTASHYAGLIATMTLCQLLFQFQLYPSLGPPN
                     GSLSHLSVLQTGVLLYLPCYVLFPFLRSFLLPNTDAAVMLGMIVFAALRWLANILSFT
                     SVMVLLNGWTPLHLVPLANGLAQTMSSFARCIGPITGGTIWAHSIQGGPYAHAWPFNF
                     HLGFWVVGLVAFTGAIHTRFIREVTFP"
     gene            complement(<793071..>794910)
                     /locus_tag="MRET_0465"
                     /note="MRES_01565"
                     /db_xref="GeneID:38737231"
     mRNA            complement(join(<793071..794705,794746..>794910))
                     /locus_tag="MRET_0465"
                     /product="ubiquitin-like 1-activating enzyme E1 B"
                     /transcript_id="XM_027627092.1"
                     /db_xref="GeneID:38737231"
     CDS             complement(join(793071..794705,794746..794910))
                     /locus_tag="MRET_0465"
                     /codon_start=1
                     /product="ubiquitin-like 1-activating enzyme E1 B"
                     /protein_id="XP_027483103.1"
                     /db_xref="GeneID:38737231"
                     /translation="MAGETSARYGAAVAALGGQEMERVRESRILIVGAGGIGCELLKN
                     LVLTGVGHIDIIDLDTIELSNLNRQFLFHKKHINQSKAIVARDAASAFNPDVRIVAHH
                     ANIKSHQFDVAYYASFDVVLSALDNLDTRRWVNRMCVMARVPLIESGTAGFLGQVQPI
                     RPSYTECYDCTEHPTPTTFPVCTIRSTPSTPVHCIVWAKSWLLPQLFGELDNSDEQEF
                     SEAAKRGEDAAELQRLRQEAQQMLTYREQLYASLNAPQVVCERIFDKLYSVDIQRLLS
                     MDDMWEHRTRPEPLTFASACRDTSSPTKSDAPTLRDRRQLTLAENAALFVETATALAK
                     RAASGTPVAFDKDDDETLGFVTAAANLRARVYHIPEQTRFDTKQIAGNIIPAIATTNA
                     IVAGLVVVEALHMLASRWSELRVVSLARRSTRLFTTFPCSLPNPKCGVCQDTYVRVFI
                     DPESATLQHVLDAAHSYLGYEDDADLSISAGARILYDADLDDNLPKLLRDLHVHPGNT
                     LSVVDENGVMSTAQFVLEGQSDTKTSPLYIEKAVQLGKRSCAEKEESDDEDDGVQVLE
                     SAPLKRARDADHENSTPKRIRAQNDTDDVIVLD"
     gene            <795036..>795809
                     /locus_tag="MRET_0466"
                     /db_xref="GeneID:38737232"
     mRNA            <795036..>795809
                     /locus_tag="MRET_0466"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627093.1"
                     /db_xref="GeneID:38737232"
     CDS             795036..795809
                     /locus_tag="MRET_0466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483102.1"
                     /db_xref="GeneID:38737232"
                     /translation="MRPTCLVSSRRFLAQNFYDRRILAFSSTSFVRKQSKHLPEHEYQ
                     VRLGAAIQVLRETLPTFMEQGLVDRMPSENSSSLLRVLKMGVPKRFSQPPDHLYHHNI
                     HFAFQPAHATIPFGMMSALAAPQSPDKQEGGKAWSPCFSFHGRNAYFLGASVLRHTLH
                     ACFSEALIHMEHMQFQRKAPPVMASPNSAQPGDELIMRIRFSGTNRFSHSQQTYTIVS
                     RYRFDRQTGTICEHIVDKMMPLPGEHVLRSASGLASRLA"
     gene            complement(<795806..>796708)
                     /locus_tag="MRET_0467"
                     /note="MRES_01560"
                     /db_xref="GeneID:38737233"
     mRNA            complement(<795806..>796708)
                     /locus_tag="MRET_0467"
                     /product="PAPA-1-like conserved region containing protein"
                     /transcript_id="XM_027627094.1"
                     /db_xref="GeneID:38737233"
     CDS             complement(795806..796708)
                     /locus_tag="MRET_0467"
                     /codon_start=1
                     /product="PAPA-1-like conserved region containing protein"
                     /protein_id="XP_027483101.1"
                     /db_xref="GeneID:38737233"
                     /translation="MSTDHAEDDADVMQQDDAYDESHMDEEVNYDEGEPEADDDGDAY
                     ESDSEVDELVDEIDESDKPPETNRRARRAPLRVKLMRRNTSSNSSPRRASIRTSQRST
                     RSRASRDDSYIDESEDDELMDAGDEEDPEDDEDDGNSETTSDMPMTARQIARANRARG
                     ITTEELEELPMEESSRKKKLSETELQLRRSETARRRRNQSEKKLEDDKIETINRLLKK
                     QAGKARGKDKTDGEPPEEDTKKPRDIPANHPQPFFRYVNRADKSVLAVPLGEPYSDDN
                     KTEGLYDYTLRTAFQMSREAWAHS"
     gene            complement(<796789..>800154)
                     /locus_tag="MRET_0468"
                     /note="MRES_01555"
                     /db_xref="GeneID:38737234"
     mRNA            complement(<796789..>800154)
                     /locus_tag="MRET_0468"
                     /product="ATP-dependent RNA helicase DHX8/PRP22"
                     /transcript_id="XM_027627095.1"
                     /db_xref="GeneID:38737234"
     CDS             complement(796789..800154)
                     /locus_tag="MRET_0468"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DHX8/PRP22"
                     /protein_id="XP_027483100.1"
                     /db_xref="GeneID:38737234"
                     /translation="MDDPLYKLEYLSLVSKIATELENHLGLNDRVLAEFIISLHEQSH
                     SSLPAFQAKLDESGAEFSSAFVENLDRLITMLHPKLKKLRQEQAQLKDNTAEQKAQML
                     PGLAIQNQAWSEPDYYKEQPQKRKRLHEEIERNRTDRHARRSPPLGQEPDTEPIVNKV
                     YDGRVSGVKDFGAFVTLEGVVGRRDGLVHISALSSGKGRVGHPSDVVSRGDRVKVKVV
                     KVEGQRISLTMRDIDQGTGRDLAAPPPRGRDPMPRFLTGSNGAPLGRPDPEPEEQRGQ
                     RLKRLTSPERWEIKQLIASGVAKATDYPELMEEEHSTPASRLAGDDADEEVEIEVNEK
                     EAPFLAGQTAASLELSPVRVVKAPDGSLNRAAQAGTALAKERRELKQQEMNEEADKKA
                     RDMSTGWLDPMAQASDKIFAQDVRGQTRNQHAYQQPEWKKHTFNKATTFGKITTLSIK
                     EQRESLPIFKLREPLLQAIRDNQVLVIVGETGSGKTTQVTQYLAEEGFADSSKIGCTQ
                     PRRVAAVSVAKRVAEEVGCRVGQEVGYTIRFEDCTSPDTRIKYMTDGMLQRECLVDPD
                     LKAYSVLMLDEAHERTIATDVLFGLLKKALQRRPDLKLIVTSATLDAEKFSSYFFGCP
                     IFTIPGRTYPVEILYTKEPEPDYLDASLITVMQIHLSEPPGDILVFLTGQEEIDTSCE
                     ILYERMRALGPSVPELIIMPVYSALPSEMQSRIFEPAPPGARKVVLATNIAETSITID
                     GIYYVVDPGFVKQNAYDARLGIDSLVVTPISQAQARQRAGRAGRTGPGKCYRLYTEAA
                     FRNEMLPNPIPDIQRQNLASTILALKAMGINDLLHFDFMDPPPAQTMLTALESLYALS
                     ALDDEGLLTRLGRKMADFPMDPPMAKMLITSVDMGCSEEMLSIVAMLSIPNVFYRPKD
                     KQAQADAKRAKFFQPEGDHLTLLTVYNAWVSSRFSMPWCMDNFIQGRALRRAQDVRKQ
                     LVGIMDRYHHDILSCGSNYSRVRRAICSGYFRNAAKRDPQEGYRTLAEGGGNVYLHPS
                     SSLFHRPPEYVVYHEVVMTSKEYMREVTAIEPKWLVEVAPRFFRMADPSHLSKRKRQE
                     KIQPLFNRYTKDQDDWRLSKQQRLARVLQSQTF"
     gene            <800438..>803047
                     /locus_tag="MRET_0469"
                     /note="MRES_01550"
                     /db_xref="GeneID:38737235"
     mRNA            join(<800438..800483,800523..>803047)
                     /locus_tag="MRET_0469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627096.1"
                     /db_xref="GeneID:38737235"
     CDS             join(800438..800483,800523..803047)
                     /locus_tag="MRET_0469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483099.1"
                     /db_xref="GeneID:38737235"
                     /translation="MSSSERRRSQRQTMDVKVLYTLDTSPHTMIARAGHRVSVRIARK
                     QGTNVLLGRVLLKTCLNAICLASPELLLDKNRDYIVYAVDPEESDASHASVASPQKYA
                     PVFVGKGFFSGGITEPGDGTSFVTGQVRLESRTSSAFSSDEEETPAKSTQFLEIVLRM
                     KEASHLGREQYQSRLRGLAAPPVPAPSTPVLSEPSIPPKPASTPSAQVLQVLQAMQAH
                     KGGLSQDQQSHLMGLLDMVAGAVQCGALPTSAGAETPRPPSNTRTEPKAAPRASRPGL
                     RDTRAEMPRICYNCGTTNATTWRILTLPSGVTINHPASERPPSDAVPLTWTPQYPNSG
                     PIQTHSEARWQACNPCGLYFAKYGVARPEYVRNFVARPSKDDKKRESTSLATGRSMDR
                     IKRERSQTSPGSTRVGFSRTLSTVANRDAERLQKRQRQHMHDENLPPTSPDAAMPVSY
                     PTVKSPAHSASMRHALQASPSSSAFGIPSSLMNSSPSTMLNTLMSAPGLPPTPRRTRP
                     EPASSPVRRSPRKQPPGTMADVNPYASAAQRSASSPAPKRAAGTARDALTSPADRTHV
                     LPTLNPFMGLSTLDDDMDPLGCPPSPTEGRTSRAKPAPKRDIRTPSRMPRDQTWPTSP
                     TLALSEPFRIHEPIKDLFPDNAQGHWMADWGSGSTHALSPHHAATEQPAPDAAVHDKT
                     ETSLVTHAPRRPMPTTVEDASSSQSGSPPATSPDLDDSLVDLIEDPYGLLSACGLGMM
                     QQPNQGTQGIVMNPSGVGGFSADAFNQIEIHNSPSFTQQLDAFTQSGHLGIAAHMNEP
                     QGVSVLPAAEVRSFGHANKSAPTALESFLDDPTVQSMLNNLNESTAPIKQGKRELSTG
                     "
     gene            complement(<803058..>804410)
                     /locus_tag="MRET_0470"
                     /db_xref="GeneID:38737236"
     mRNA            complement(<803058..>804410)
                     /locus_tag="MRET_0470"
                     /product="chitin synthase activator"
                     /transcript_id="XM_027627097.1"
                     /db_xref="GeneID:38737236"
     CDS             complement(803058..804410)
                     /locus_tag="MRET_0470"
                     /codon_start=1
                     /product="chitin synthase activator"
                     /protein_id="XP_027483166.1"
                     /db_xref="GeneID:38737236"
                     /translation="MTENTISPGGVAYMPTAYLQSSMPSSPVHSTYAPSIDAASSMPR
                     ASIAPSTPRIRSPPLSVLSSPRATDWRYSRDSQAATAVPYTKEYIENYRRRIKDEQDA
                     EALMVYALYLIEAAKRTLDPHDSEKQARKYREALLSESVKIIKKLATSGAAPGKPPYA
                     DAQFYLANCYGNGKLGMSIDHAKSYHLYVQASKQNHPAATYRTAVCNEVGAGTKRNPK
                     LGVLFYRKAASLGDTAGMYKLGMILLYGLLEQHPNPREAIVWLKRAADQADEDNPHAL
                     YELATHYAEPSNRFVPFDPSLARNLYTQAARLGHTPSQCKLGEGYANGSLGCPVDPRS
                     SIMWFNTAAMRGEGQAELALSGWYLTGAEGVLQQSDIEAYTWARRAASKGIANAEYAV
                     GHYAEIGIGTAVDMDEAVRWYTRAAAQQHPRAMQRLKDLKAHGGRIPLKVPDADCVVM
                     "
     gene            complement(<804694..>805488)
                     /locus_tag="MRET_0471"
                     /db_xref="GeneID:38737237"
     mRNA            complement(join(<804694..804696,804731..804745,
                     804780..804871,804903..804916,804951..805209,
                     805242..805274,805342..805353,805395..805401,
                     805474..>805488))
                     /locus_tag="MRET_0471"
                     /product="calmodulin"
                     /transcript_id="XM_027627098.1"
                     /db_xref="GeneID:38737237"
     CDS             complement(join(804694..804696,804731..804745,
                     804780..804871,804903..804916,804951..805209,
                     805242..805274,805342..805353,805395..805401,
                     805474..805488))
                     /locus_tag="MRET_0471"
                     /codon_start=1
                     /product="calmodulin"
                     /protein_id="XP_027483167.1"
                     /db_xref="GeneID:38737237"
                     /translation="MAEHLSEEQIAEFKEAFSLFDKDGDGSITTRELGTVMRSLGQNP
                     TEAELQDMVNEIDADGDGTIDFPEFLTMMARKMKDTDSEEEIKEAFRVFDKDGNGFIS
                     AAELRHVMTNLGEKLSDQEVEEMIREADTDGDGQINYDEFVRMMMSK"
     gene            complement(<805654..>808809)
                     /locus_tag="MRET_0472"
                     /note="MRES_01545"
                     /db_xref="GeneID:38737238"
     mRNA            complement(<805654..>808809)
                     /locus_tag="MRET_0472"
                     /product="hypothetical protein"
                     /transcript_id="XM_027627099.1"
                     /db_xref="GeneID:38737238"
     CDS             complement(805654..808809)
                     /locus_tag="MRET_0472"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027483168.1"
                     /db_xref="GeneID:38737238"
                     /translation="MVFRNKRMGSSDPKPPLPSLVVTPADAHGLDAARSIPTSPTTET
                     EPPLSPAAAITSPLVSDLERWAPAPEPEQPLKPQHERTHSRTGSSGAPQMRSRGPLPS
                     MPRPIGPQEDAKNKIASYESDVFKAQNWRRWMGINALNRAASSSTERRSLFSSSTSSQ
                     KHHGPVVSPNPAMDIDVGSSAALETVAVVNPDSDSSRSPSISHAYSSASSVPPSSLHT
                     QEPFSKKTATSVPALLKDATRPVDPKDTPSRSNSLQDSDAVLQHAKQIASDVHSKPSS
                     LQIVRPTPQTKVVKPQPQVPSALLDSRWSASDTTSPMMDDERRNTLSDWDGQGDESMQ
                     ILSLAHNNVFTNKDMHAQMRHMRKMPAELRDENTSSRSSKANQASPEDWPHSTPARTP
                     SPFSAAGLPRLSSLLRSSQRLDAQSIYELPASRRGTPDHRPCTPSTSPASASRPHVWR
                     RRKLRAWNKTLAEDDMESDDEDPHHARQGGARVYTTPADPDNPEYVYDMLHENQRGIV
                     LFGVSKRFSSNVLSAFDPSPWTDAQGMNTALTTLTMQLPDPTWEWVHPTWMIDMTGNT
                     DEDGWQYSGSFTGLQFWRRPIQVSSKAGPQQWWQAFHMFAHYVDANRTARRESKEATR
                     PDEGIEALMRSIRSRSARWTGKPGIWTFVRRRRWVRLRRRVAHVHLNKGASVMTADGA
                     TVILPDRNDSTSASFIQAREKEEEALEPVRKEIEEERASSLSETEQVIVALERLGLLL
                     PFFLIPQPQLSELFPSDGPPLHELDAWQHHFRIILEQETCIFNPFFSLGWIQRWLARD
                     DLRHLTRPLRAQEREYQKAHAHYREAGKTAGSATFLAPPAGKMYDACPTPPPNHPTDS
                     FLQFAHESSDVRPMIIRKAVVEHNFEMVIILMRLCMVDRLRVSLWLEWLHLSPGPKNM
                     LENDMSDSPLKFVQQEWYRRCASVHQIHQLGSTPAMFSPLVERILRTRIYNFTHSIPI
                     LLDVWDILVVHLDDILAMLDHDMSRRHLLQTIQHLASKRFNTCDPEESPNACPQPSDP
                     RWCPVEPNVMALPRIPNLPAP"
     gene            complement(<808974..>810408)
                     /locus_tag="MRET_0473"
                     /note="MRES_01540"
                     /db_xref="GeneID:38737239"
     mRNA            complement(join(<808974..810027,810056..>810408))
                     /locus_tag="MRET_0473"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627100.1"
                     /db_xref="GeneID:38737239"
     CDS             complement(join(808974..810027,810056..810408))
                     /locus_tag="MRET_0473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483169.1"
                     /db_xref="GeneID:38737239"
                     /translation="MPPRRSTPRKGRGESASHPSPAAESIASDSPAITPRRTTRSRRA
                     TAKTDSPATSTPAKSPSKSPSKSPSKSRTSKAAATKMQEPSSERVHELPKRTNPRLQE
                     VKSRQVKLQVIRREDKEIIIGRIKLPTVNGAEHGFLLKRFDTNAIAGSSMFRLAFPYA
                     DAEEESVEMTYLESRFDTEAANGGFVAASRSSSPRKTDTPSKKTGTMPPGSTGVRLQG
                     VWIPCQHASSIANDYGILELAQPLIEATALLLPNSNTPILNPDAATVASAAHALEKSE
                     EAESESTEGAQSEETNSRLTKRVRTAEVPSAPTKTEESSTPSQRTTRRSALSSSAALS
                     RSELSNSLTPAQIDAQIRESQLLAAKVQDEAMQDSNIRSRANKRRAEDDHDGSNVQVA
                     SQESSGRRRRPLARAAGMLTAAGAMGIGAMAWYTGSINFTANMPQVVQQLQNVDYASA
                     LHTIQQNIHNWGISSWFG"
     gene            <810625..>812139
                     /locus_tag="MRET_0474"
                     /note="MRES_01535"
                     /db_xref="GeneID:38737240"
     mRNA            <810625..>812139
                     /locus_tag="MRET_0474"
                     /product="transcription regulator Maf1"
                     /transcript_id="XM_027627101.1"
                     /db_xref="GeneID:38737240"
     CDS             810625..812139
                     /locus_tag="MRET_0474"
                     /codon_start=1
                     /product="transcription regulator Maf1"
                     /protein_id="XP_027483170.1"
                     /db_xref="GeneID:38737240"
                     /translation="MKYLEYPELEVLSRALTFEMSECKVFTRIEAYSCKAVNKEKRLF
                     KSLESSYLLSASSSPPAYLEEALASPFGRLDQPSARKTLFLLIATLNGAFPDHDFSEV
                     NPADFVRESSPTVVLNSLTSTLLSLRSGTGSPASLHASIDDSPLLSSLARSPLALDAR
                     STPSHVRAATPTAADGVSSGTAATHTPGPASGSGASPNLSSSRSAFASLPSVIDEIIH
                     TADCEVYTFHPDMDSDPHASAEPDEEGTGDMYETDPYDEGYTVDDDDQMAGTNAAHSG
                     GMHGNGAGDAYMDDASMADTPMFDEDMDVAPSLLGSAHGGAHASPSLTVDEDDLAGAG
                     AGLLWSTFAFFYNKRMKRILFVSVWSRKNSPLGTTPTMWSSPSLGAVQPLTATDDVPA
                     LGIAPSLYDRLAERATAAPSAPRPTRARRSAPYSVAQRRTRQTTRGRSASNSPAPSAL
                     SPFPHAQAPHAMHPPAARQASSTYTSLDAAALSVSAPDPRAVQPLAANPPSNGI"
     gene            complement(<812152..>813750)
                     /locus_tag="MRET_0475"
                     /note="MRES_01530"
                     /db_xref="GeneID:38737241"
     mRNA            complement(<812152..>813750)
                     /locus_tag="MRET_0475"
                     /product="serine carboxypeptidase"
                     /transcript_id="XM_027627102.1"
                     /db_xref="GeneID:38737241"
     CDS             complement(812152..813750)
                     /locus_tag="MRET_0475"
                     /codon_start=1
                     /product="serine carboxypeptidase"
                     /protein_id="XP_027483171.1"
                     /db_xref="GeneID:38737241"
                     /translation="MLSRWSILCLLGATIAVKAKQEPIHLEDAYKVLSHPSLPAHTLR
                     LRRVPGYVCGNRTSWSGYLDVDLDKLEEIEGGLGSTKEGYNHSGVVEHFYFWGFESRH
                     EPEKNPLTLWLTGGPGCSSMTGLLQELGPCLATKDSGHGKISTKANPYSWVQKSNLIF
                     LDQPIGVGFSYASWKNGTRTKKKSPATRVFSSQQSARDLSAFMHLLATHNDGPFGSYK
                     NDSSVHLRDFHVAGESYAGRYIPLMVDQILTDNALYEKNPEQGLKPLPVQSMLIGNGM
                     TSPKHLYQAYYDYACTKKSGHKPFLAKSTCREMKKHLPTCLAKVDKCNKKYNRQFCRE
                     TQFFCDEKLNDPWMGTDKSPFDYTHPDYYPEDEYIESFLNDKVTRRVLGIDDYDFGDK
                     DDGTFVGCSDRVYWDYYSTGDGVLDSTWAVKRALEEGVRVLAYSGRRDFQCNWLGNAA
                     WIEELQWSGHDGYAKAKMHDWYAKKGDKERAGQFRHYGGLTFATLDHAGHLVPFDDRE
                     ASLVMFDRWLNPMTESGRLDSSFT"
     gene            <813938..>816529
                     /locus_tag="MRET_0476"
                     /note="MRES_01525"
                     /db_xref="GeneID:38737242"
     mRNA            <813938..>816529
                     /locus_tag="MRET_0476"
                     /product="phosphoribosyl-ATP
                     pyrophosphohydrolase/phosphoribosyl-AMP
                     cyclohydrolase/histidinol dehydrogenase"
                     /transcript_id="XM_027627103.1"
                     /db_xref="GeneID:38737242"
     CDS             813938..816529
                     /locus_tag="MRET_0476"
                     /codon_start=1
                     /product="phosphoribosyl-ATP
                     pyrophosphohydrolase/phosphoribosyl-AMP
                     cyclohydrolase/histidinol dehydrogenase"
                     /protein_id="XP_027483172.1"
                     /db_xref="GeneID:38737242"
                     /translation="MLQQSTPFVPAWDSADTNVEAWSVKDELASAIQCTAPLLVPWGA
                     QVPAKLRPIVECDVSTSYDEAVDVLNGGAEAIAVRPDSALMEALGADVVSERVLVVLR
                     DGEELSAEVPPAGLLVEGERIPSSESLKRYVDRMNTSVSGRGVYVRAPVASLDDVRAI
                     AAHGATAIIGTSQLALEQPSAGQLDYVEAWMCTMASDRADGLLPTLVVSDTCSAALGL
                     VYSSAESVRASLKTGSAHYQSRKRGLWHKGATSGATQRVVQLRLDCDQDALEFRVEQH
                     MGDVSVGFCHLTDRASCFGNLQGLAKLEHTLRARKQSAPPGSYTSRLFNDATLLSAKI
                     REEAQELIDARDREHVAFEAADLLYFALARCISADVGLADIERSLDAKSKKVSRRKGD
                     AKPAYMPKNEPLDASAPIRLPVHRLSETSAAQQIELLRRPAIRTTQVMDRVRPILAAV
                     KERGDEAVLSFTAQLDRVQLDSTVRLPPFQTEADKQAMDARTREAIDVAYANVRSFHE
                     AQKAPAKTTPSKHAAWAPGEDVLEVTTMPGVVCTRFPRAIESVGLYVPGGSAVLPSTS
                     LMLGVPAQVAGCKTIVLATPPRSDGSIAPEVLYVADKIQATCIVCAGGAQAVGAMAYG
                     TQSVPKVDKIVGPGNQYVTAAKMLVQNEVDALVSIDMPAGPSEVLVVADASAEPVFVA
                     SDLLSQAEHGPDSQVVLVGIDLDDAKLRAIEDEVDKQARALPRVDVVRQAIDKSVTML
                     VKTREEAMAWSNRYAPEHLILHTTEPEALVPLVQHAGSVFVGAWSPESCGDYASGTNH
                     TLPTYGFARQYGGVSTSTFQKYITAQTLEADGLRQLGPHVVALAECEGLEAHANAVRV
                     RLQQLAP"
     gene            <816560..>817315
                     /locus_tag="MRET_0477"
                     /db_xref="GeneID:38737243"
     mRNA            <816560..>817315
                     /locus_tag="MRET_0477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627104.1"
                     /db_xref="GeneID:38737243"
     CDS             816560..817315
                     /locus_tag="MRET_0477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483173.1"
                     /db_xref="GeneID:38737243"
                     /translation="MAYPPSRPERDPRPGAPTHDETPLYEAATLYAQSPHVHADRRER
                     ARRERRSQYGPRHVFLFGRAKRVAEPMYLVLAVLLLGLLWIVTRTSPASTKLSSPPPA
                     ATAYFSTTPPSMPSQKTFTLASRGKGCHLVQSEVEREISDMIRGVQVGILTLFIQHTS
                     AALSLNENVDRDVRTDMDMALDHVVPESLPWRHTDEGPDDSVSHTKATLVGPSLTIPI
                     TRGQLNLGTWQGVYLCEFRRAKHARRIVATVLP"
     gene            complement(<817323..>819425)
                     /locus_tag="MRET_0478"
                     /note="MRES_01520"
                     /db_xref="GeneID:38737244"
     mRNA            complement(<817323..>819425)
                     /locus_tag="MRET_0478"
                     /product="carnitine O-acetyltransferase"
                     /transcript_id="XM_027627105.1"
                     /db_xref="GeneID:38737244"
     CDS             complement(817323..819425)
                     /locus_tag="MRET_0478"
                     /codon_start=1
                     /product="carnitine O-acetyltransferase"
                     /protein_id="XP_027483174.1"
                     /db_xref="GeneID:38737244"
                     /translation="MASRALARSPAVHIVHRRAFSTSGISRIMPTMLARISPSTFQLQ
                     ETLPRLPVPRLQDTLERYLRSLEPVLRQKEVLGELPSGTNAQSELQKRREWAQELISS
                     GVGPRLNERLVDLDQTTENNWFDDSFWLSKAYHEWRVPLLVNSNWWNMFMPDPSMPAE
                     LSERADAAAYTPDAIHRQNWDGSEYGLRRAAWITYRATLYKIAIDKQTIKPDRSRIGA
                     FCMYQYSRMFGVTRIPNIPADHNTSTDSTAASRHITVLVRDNVYELPVINEHGEIYPL
                     ATIEQALRDMVADAQKAEGDGIPVMTCDDRDTWTRAREHLLSVSPQNRLSLQSVQKSL
                     FVLSLDCNNLGAPEGAKPLVGSEPSYSSAMAINTAGAGRLGHNRWFDKAISFVVEPTG
                     RASLTGEHSPVDALIPSFLSETVLEDPMPPVGEPLPERAEGVSLLAESPKWSKLAWQL
                     DDRVRASIEHAENTAKAITSDSDIGMLWFSEYGADWIKKVARQAPDAYIQMALQLAYA
                     SVHGRQTATYETASTRLFRHGRTDVIRSFSNEAFNFVQGVQARKPAAELYKLLSEATS
                     SHTRQTRDHSFGKGIDRHMMGLRLVYRAEDDGEVPKLFSDPLLVESASWKLSTSGLSA
                     GDKFVGTGFGSGFPDGFGVNYLAGSQTLKFGIESKRSNPACSDGHPVHMYKQSIAHAL
                     RTMRTIVEQGAPPPEAKL"
     gene            <819554..>820564
                     /locus_tag="MRET_0479"
                     /note="MRES_01515"
                     /db_xref="GeneID:38737245"
     mRNA            <819554..>820564
                     /locus_tag="MRET_0479"
                     /product="SNF1-activating kinase 1"
                     /transcript_id="XM_027627106.1"
                     /db_xref="GeneID:38737245"
     CDS             819554..820564
                     /locus_tag="MRET_0479"
                     /codon_start=1
                     /product="SNF1-activating kinase 1"
                     /protein_id="XP_027483175.1"
                     /db_xref="GeneID:38737245"
                     /translation="MDHVRCTDTLTLDHDATTRRRMINQYVVDCELGRGVFGSVKLAH
                     DVATSALVAIKIVQREAPRRLGVSYVPRQTDERVLREIRAMSRCRHSNVVQLYEVIDD
                     PRSRKLFLVTEYLSGGALAWRDALTHTPVLTCSATRRVIRDVAHGLAALHRCGVIHRD
                     LKPANILCTEHGEAKISDFGSAYVRETLGSADALSSTTDPVLARTAGTPAFFAPELCY
                     GATDGPPITKAMDVWALGVTLYCLLFGRVPFDAETEYLLLESILHDDYTVPMHMGSDR
                     VLVGPRPARWPSPQGTPNVPLSGEAHAVRHLLDALLDKDPATRLTLDRVISHPWLVAE
                     SW"
     gene            complement(<820589..>822862)
                     /locus_tag="MRET_0480"
                     /note="MRES_01510"
                     /db_xref="GeneID:38737246"
     mRNA            complement(<820589..>822862)
                     /locus_tag="MRET_0480"
                     /product="XPG I-region protein"
                     /transcript_id="XM_027627107.1"
                     /db_xref="GeneID:38737246"
     CDS             complement(820589..822862)
                     /locus_tag="MRET_0480"
                     /codon_start=1
                     /product="XPG I-region protein"
                     /protein_id="XP_027482857.1"
                     /db_xref="GeneID:38737246"
                     /translation="MIRGLEGFLRDEKLMQEESLSALKYTRLGIDLSYYLRQVLSKPD
                     SAEPLVAAIGGLPLALMSRVESDMRVLEQHRIKPVFVLHGLSPAKRTRPFSYEDRRPA
                     QRQRAWDAYEQDDVSLATQQFAASNSMFFSDLYRSVLRMCRYHHIDYVVAPYQATGQL
                     VMMERHPKQYVHAMYGPSELLAFDDVDKVILHMDLRHGKFQYASKVALMSTLQCNEAE
                     FLDTVLLVGMEYCPTFPALQDESTGLVTSVGTPNLRVVSQHVRQYRSGFLLCSHFSEH
                     PMVAKAAYLDQFCHARAMIKYNIVLSPDDGAIVPLPLALCERGPKPEIPSDLHEIFSF
                     RLPEQVLLYLSRGLMSTSVLGSLLSGFVIEPAPLDNGETQEYRHFVRTYLTEDPTSPR
                     CVAIALICGAMHPFWRQRKVSAVYWFQPQVDVTVPHDAQPTQHLISRMSQWHVPAAML
                     DEELRRQNSSTIDIPLCLHTTADPARAKHTVGLTAVRLEKKDELVANSLWRFLELRGF
                     LTAEHTHTAYGRALFAAFQHVRVNDRLQEPLFMALELIRARVLHANAYSDTEYSGGPS
                     FGSADERKCMLLAMRTLSLLPMSFKAQAWDAPLSREMLVFNSFSRSLSRSLRSLVEMV
                     MVSLLLHTESRQQRDDYVDLSFSLPFQSDTNTGMGILIKCYMDALYTLHNGPITVGEA
                     HAPDVVEAKKTVVDMLIETFENVRDVTLELRRARRFWTALMAAVDVLAAEKVMEADLH
                     RQFCSTHAYLEPLWPSW"
     gene            complement(<823124..>823826)
                     /locus_tag="MRET_0481"
                     /note="MRES_01505"
                     /db_xref="GeneID:38737247"
     mRNA            complement(join(<823124..823615,823718..823730,
                     823804..>823826))
                     /locus_tag="MRET_0481"
                     /product="large subunit ribosomal protein L11e"
                     /transcript_id="XM_027627108.1"
                     /db_xref="GeneID:38737247"
     CDS             complement(join(823124..823615,823718..823730,
                     823804..823826))
                     /locus_tag="MRET_0481"
                     /codon_start=1
                     /product="large subunit ribosomal protein L11e"
                     /protein_id="XP_027482856.1"
                     /db_xref="GeneID:38737247"
                     /translation="MAESSKAINPMRELKVDKLVINISVGESGDRLTRATKVLEQLTG
                     QTPVTSKARYTLRGFGIRRNEKIACHVTVRGAKAEEILERGLKVKEYELQKRNFSETG
                     NFGFGITEHIDMGIKYDPGIGIFGMDFYVCMTRPGARVARRKQRVARVGASHRVRRDE
                     TAAWFKQRFDGIILQ"
     gene            <824338..>826068
                     /locus_tag="MRET_0482"
                     /note="MRES_01500"
                     /db_xref="GeneID:38737248"
     mRNA            <824338..>826068
                     /locus_tag="MRET_0482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627109.1"
                     /db_xref="GeneID:38737248"
     CDS             824338..826068
                     /locus_tag="MRET_0482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482859.1"
                     /db_xref="GeneID:38737248"
                     /translation="MTLTAESVANTATDEPPDAIAHLQGCLPLPGSQGLNFTRKSDAV
                     LHKFDKPLDSTYLLTSPMLSHPPSPAFDGVMPKLGYSPGHTESLSGSPSSVTSAISCA
                     SLRRGDTADTEDEPEMELEAVDEAEELDLNNHTLSSLNLDDKRVPTSVTESMDMYPVP
                     PNPVSVRSKKEDEKAALSSRESIQLRKGRVFELAANANEISRPAVDHDSPVTSSHEWE
                     GEIMEPPPPQPNLHPHETVPAIPSPLCVSYEPGENPSKSDSRRVLGVSDSEHRNDAGR
                     RESTPARRRSRRLSRGRQPLKSALSSSEDEKQGESRKKNGKKHSVRFCNGPPEERRTH
                     SPVDYDRKAHPVHSRLCSEDLRELRDLNMPIDLLQSRCQCTGEPDQQSMASPKDNTLS
                     SLPKYDLWHTVAMQGRSASTEPTPPACPTASNAWEYMDEAAKCNEATSFRQKDATQRT
                     SRSLDQHDPLDDLNAMHRERARTPSFYGTSAHPSSAAGSTLASSIAARFGLYKPPPPL
                     PGMERSVPALSEASKSTSNLVPRVSARSVSAQSTPQKRQSRSLSPHTDTKCPIGELGS
                     YGSEYDMMNI"
     gene            <826332..>828296
                     /locus_tag="MRET_0483"
                     /note="MRES_01495"
                     /db_xref="GeneID:38737249"
     mRNA            <826332..>828296
                     /locus_tag="MRET_0483"
                     /product="ATP-dependent RNA helicase DDX3X"
                     /transcript_id="XM_027627110.1"
                     /db_xref="GeneID:38737249"
     CDS             826332..828296
                     /locus_tag="MRET_0483"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX3X"
                     /protein_id="XP_027482858.1"
                     /db_xref="GeneID:38737249"
                     /translation="MSNDASTTGTGSTGLESSLSNMNVQSTPSSAPTDSGAAPAAAGA
                     PRKRYVPPHLRNQPEAATNSMGAGGRERGRGPSTLPPAFNSGRRGYGGGAGAPATGGR
                     WSGLSSGGGFSERGSRRGDGFGTWKDGKHVLGPVNERFEREMFGLPDDGMHQSTGINF
                     DKYGDIPVEATGRDVPEPITEFTNPPVDEHLITNIKLARYTTPTPVQKYSIPIVGAGR
                     DLMGCAQTGSGKTGGFLFPILSALFTHGPPPMPPQPPMYGRQKAFPSVLILAPTRELV
                     SQIHEEARKFTYRSWVRPAVVYGGAEMGAQLRQIERGCDLLSATPGRLVDMIERGRIS
                     LSNVRFLVLDEADRMLDMGFEPQIRRIVLGEDMPGVMDRQTLMFSATFPQNIQMLAKD
                     FLKEYVFLSVGRVGSTSENITQKIEFVEDRDKQSVLLDVLAAMPTTGLTLIFVETKRM
                     ADMLSDFLLYSNIPATSIHGDRTQREREYALDLFRSGRTPILVATAVAARGLDIPNVT
                     HVVNYDLPSDVDDYVHRIGRTGRAGNVGHATAFFNRNNRNIVRDLIKLLQEANQEVPP
                     WLEMIASESAFSSGGRGGGSRGGRFGGGRMGGGGSRFGSMASRDLRFSGGSNAFGPRG
                     AGYGGYNAGGSFYSGPPAPDYSSGGGQSWW"
     gene            <828533..>829378
                     /locus_tag="MRET_0484"
                     /note="MRES_01490"
                     /db_xref="GeneID:38737250"
     mRNA            <828533..>829378
                     /locus_tag="MRET_0484"
                     /product="deaminated glutathione amidase"
                     /transcript_id="XM_027627111.1"
                     /db_xref="GeneID:38737250"
     CDS             828533..829378
                     /locus_tag="MRET_0484"
                     /codon_start=1
                     /product="deaminated glutathione amidase"
                     /protein_id="XP_027482853.1"
                     /db_xref="GeneID:38737250"
                     /translation="MLVAVAQMTSGGVIRENLAIAQQLVRRAAMAGAKAVFLPEAADF
                     IAPPASVPTLTRSRDNGAFVSGLCASARDLGVWISVGVHEPPSSTLQEPTRCYNTQLL
                     INDQGSVCAQYRKLHLYDVNVQNGMSILESNTTIPGTELVPPVETPWGRVGLLTCYDM
                     RFPEVSLSLRRMGASILTYPSAFAVRTGGAHWSTLLQARAIDTQCWVLAAAQVGTHPG
                     TTRASWGHAMIVDPWGSIVAQCSDMPPFEPTFCLADITLPPLEKVRADMPLWSQRRND
                     VYPSL"
     gene            <829418..>830653
                     /locus_tag="MRET_0485"
                     /note="MRES_01485"
                     /db_xref="GeneID:38737251"
     mRNA            <829418..>830653
                     /locus_tag="MRET_0485"
                     /product="nucleoside hydrolase"
                     /transcript_id="XM_027627112.1"
                     /db_xref="GeneID:38737251"
     CDS             829418..830653
                     /locus_tag="MRET_0485"
                     /codon_start=1
                     /product="nucleoside hydrolase"
                     /protein_id="XP_027482852.1"
                     /db_xref="GeneID:38737251"
                     /translation="MTQVPLIIDTDPGVDDLLAILLAIASPEVSLEGITLTFGNTTLD
                     YAHGNILRLSHALNVAFKDGAITNETLRERIEHGMNGKPIPVALGAEKPMGGRLFTAS
                     YFHGRDGMSGVSFLEGNPYPMADSNPLFDAKPIATPADEFILDVIRRHPPHTVRIAAV
                     APLTNLANAYLKDPETFSRVGCISVMGGALDVPGNTSPTGEFNFFADPWAAKVLLEDA
                     TLDGRRLPIHLLPLDTTTKHTVPYSHIMMDESSELYKKNYLFRLITHFLRKPRSVTNS
                     FAPPNVPFDPAKYDLFEAHDPLAVAHAIFYTDAELWGDTERPFLVETDGRHTRGFCVV
                     DRRQQGEEYDGRNKAEVEAERGPKNEYGLSSSSTTPAKRKADDKPVTPPVPSTRVVTK
                     TPGSAWFEHLMLGRLGMQT"
     gene            complement(<830701..>831346)
                     /locus_tag="MRET_0486"
                     /note="MRES_01480"
                     /db_xref="GeneID:38737252"
     mRNA            complement(join(<830701..831149,831176..831311,
                     831344..>831346))
                     /locus_tag="MRET_0486"
                     /product="small nuclear ribonucleoprotein B and B'"
                     /transcript_id="XM_027627113.1"
                     /db_xref="GeneID:38737252"
     CDS             complement(join(830701..831149,831176..831311,
                     831344..831346))
                     /locus_tag="MRET_0486"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein B and B'"
                     /protein_id="XP_027482855.1"
                     /db_xref="GeneID:38737252"
                     /translation="MPPVKGKGGRMMSLIDYRLRVTLNDGRQMTGQLLAFDTHMNLVL
                     SNTEEFRRIKPKKKKTQKANKKQKVAHGDTPSGNAHVEDEEDEEDDSAPPPVQEQKRT
                     LGLIILRGETIISISVEAPPSESKRDVPVMAPGPGRGVPAGRGAAMGAVPMGRPPPFG
                     PPPGFAGPPPMGPPPGFGGPPPMGPPPGFRPPGMP"
     gene            <831506..>832921
                     /locus_tag="MRET_0487"
                     /note="MRES_01475"
                     /db_xref="GeneID:38737253"
     mRNA            <831506..>832921
                     /locus_tag="MRET_0487"
                     /product="tryptophan aminotransferase"
                     /transcript_id="XM_027627114.1"
                     /db_xref="GeneID:38737253"
     CDS             831506..832921
                     /locus_tag="MRET_0487"
                     /codon_start=1
                     /product="tryptophan aminotransferase"
                     /protein_id="XP_027482854.1"
                     /db_xref="GeneID:38737253"
                     /translation="MPLDYERMLSTEFHRRPSPAIRGLLAFESKPDMISFLAGKPNPS
                     GFPFQSISVTLKPDAIMSNDPETNTPTELVIEGDTLNRVLQYGSSSSDILFSEAIGAI
                     VTAVHGRTRNDGTPAGDFEMSVGTGSQDLLSKTSTVLFDPGDTVLLESPMYPGLLPDF
                     TSRGIHVVNIDTDDEGLSATSLASVLENWSTNANTAHLRFPKALYTVPTGGNPAGTTA
                     SADRKREILRLVRTHNVLILEDDPYFYLAFDGLGEDPVSRKRVPSYFALEREESETFG
                     CGYVLRFESFSKILSAGMRVGYVVGPTPIVRAIVAYTASSNIHPSSLDQVIIAQLLKH
                     WGVNGFLQHVDKVATMYKHRRDMFLQSLNATLRGDAPVATWVMPVAGMFFWLKLHLPP
                     TATAPGGDSFKTISENAIAHNVLVVPGSSFYADGRVTPYARASFSVTPDDQILEGLRR
                     LRKAIEATWKEAGYDTIPPMP"
     gene            complement(<832925..>833164)
                     /locus_tag="MRET_0488"
                     /db_xref="GeneID:38737254"
     mRNA            complement(<832925..>833164)
                     /locus_tag="MRET_0488"
                     /product="DASH complex subunit Hsk3 like protein"
                     /transcript_id="XM_027627115.1"
                     /db_xref="GeneID:38737254"
     CDS             complement(832925..833164)
                     /locus_tag="MRET_0488"
                     /codon_start=1
                     /product="DASH complex subunit Hsk3 like protein"
                     /protein_id="XP_027482851.1"
                     /db_xref="GeneID:38737254"
                     /translation="MSSSLPMSGTALTSAKERHYSYLASRLDALSSTMQHTQHHMSIA
                     SEQAAYMKDLGIGQAAIFMAALDQVDHENDQTSKD"
     gene            complement(<833238..>835877)
                     /locus_tag="MRET_0489"
                     /note="MRES_01470"
                     /db_xref="GeneID:38737255"
     mRNA            complement(<833238..>835877)
                     /locus_tag="MRET_0489"
                     /product="syntaxin-binding protein 1"
                     /transcript_id="XM_027627116.1"
                     /db_xref="GeneID:38737255"
     CDS             complement(833238..835877)
                     /locus_tag="MRET_0489"
                     /codon_start=1
                     /product="syntaxin-binding protein 1"
                     /protein_id="XP_027482850.1"
                     /db_xref="GeneID:38737255"
                     /translation="MPAKSLQTLVKQRYLNALHTVQPASRWKNLVIDAHTMEYMNAVM
                     RMFDILEQNVTKVDRIEKHRDPEPGIETAYILCPTTQNVNRIIQDMTPTHDRPALYDA
                     AHVFFVDAISDELVTKLTNSKAGIRLKQLVELFINLWPVESQAFLLKHPSSFFSVFQP
                     MDTKFCPSLDEALALMQDELDISTQAILNVCITLNENPLIRYLHVPGRVLGPLSPEAL
                     SDTVEGSFAVDDFSKSDIAGRVQIGVPFPQQLAHRVQAALDDYTKNQMLGDPGRPRGV
                     LFITDRTMDLVSPFLHEFTYQAMVYDLVPIQDNTYKHTYKNAEGITEELIAELNDSDE
                     IWTRIRHMHVAEAIQYLTREFKQHMGEASQFSGEMSINGMRDMLVALPHMQQTKEKLS
                     VHLSLAQLCMDKFEHSKLAAQAMVEQNAATGQTPDGSRPRSLVEDMVPILDDPSITNA
                     DKVRIIALYILSCDGVQEEDCRRLFQHARLTGGETATVTHLTNLGARVVREPSSSSLD
                     AIFRKRRKTLQPRLPAAGQAEYELSRWQPLLRTLLEDHLLGRLEQSMFPYVRDAPPEI
                     PLSEQISQRSMSFSASATGMATSVLHSAINATGGKDSPLARVGAGFGFDQSSSTRSNT
                     LRGGTTSLRSARPTWHQKGRSQSVASLSTSSANSGGAGAGGVTTATRNTSSALQEMSN
                     PSAQRMLVFMVGGITYSEMRTAYEVGKRNNTEVYLGSSHVFTPTSYMEALRVMGTPRQ
                     PIPPDLHVDVRRKAQQAEQEQLLAQQQGKKIKQPHILKKPKYPQDLPPQDRYDLRNST
                     AEEAPPPPPMPEKNSQRLVNKLHKGHDAQPNATPSQNNSSKKTSGTSTSDPNALPEMP
                     SVMGKHRFGRDMSKFKHALFHKK"
     gene            <836376..>838982
                     /locus_tag="MRET_0490"
                     /note="MRES_01465"
                     /db_xref="GeneID:38737256"
     mRNA            <836376..>838982
                     /locus_tag="MRET_0490"
                     /product="DNA topoisomerase 2-associated protein PAT1"
                     /transcript_id="XM_027627117.1"
                     /db_xref="GeneID:38737256"
     CDS             836376..838982
                     /locus_tag="MRET_0490"
                     /codon_start=1
                     /product="DNA topoisomerase 2-associated protein PAT1"
                     /protein_id="XP_027482925.1"
                     /db_xref="GeneID:38737256"
                     /translation="MSFFGFDTSLPADDKAAVLSSKDEERALNDKIERALAASAQEDV
                     EVYTWGQDGYDGLGEQLDEANDDVNEDTFGTFAEEVGTDFDFGHAAAAPPRSDRNASA
                     FAASLDDFWDTPALSRTTASVQPPMRHAPPPATLEQVEAELKSKKASAAPSADAPPPR
                     PLTLGEVEAQLLQKRTSVNAHPPVRPSQPPTIPPPGIVPPMVRPVPGAAGPHPGSVPM
                     VPPMLMPPGIRPGASDVASTPLPPPPGIRPTVPVSAPRAPQQSAAEAQAAHLARMRMM
                     LEACPSNVQSAILSLPPPIQFDSLEDIVRQYPSLLRGDTSDAEQASQVLTSQASERLE
                     NWKKAEDKRRAKAAKLAHMTRYNGVMSGADKDFITRIQISQLVTSDPYTDDFYAHVFF
                     AVRGGARKVVVPDGSVEAIQQHKNAETSGKGAPRKLTRHENAMLRMQQQVERLVDNRK
                     KREAKGAVSSQSGTLGRVSLVTANKPRQMLQLINQPGEAPGSHAAPAAHNQEDAVRMA
                     LQDAALGDAARAPQSATRKALTRRESLAALERLYHLVLQLEQLRREPSTPENTAAQKQ
                     LTEALWKELRVLEPLGVSDPHPFVSLLNHVKGKKLIPRVFRLLSAEQALAMLTMLIAS
                     FESLDAVKEFAQWEKYRVLEPMRHVRPPISAHQATDLGRSIDAFSNSVLFQMMALINT
                     LSLRIISGMLALLMERNHVLACARTRPGISLLSALLSRAEALRQAANAPPAADELEQW
                     YSVLGVLFNRLSSDGQLPSLFYSTRAASYMPFGVDMFSLGTVPGHAPDSNAEDEPVWN
                     FMALLAIHANLSQQQVLVQELREKILSNILAAKEAKASSLPMPPGAEDARIRNVNLLL
                     HALNLDAAQITL"
     gene            complement(<838985..>841328)
                     /locus_tag="MRET_0491"
                     /note="MRES_01460"
                     /db_xref="GeneID:38737257"
     mRNA            complement(join(<838985..841243,841272..>841328))
                     /locus_tag="MRET_0491"
                     /product="BRCA1 C terminus (BRCT) domain protein"
                     /transcript_id="XM_027627118.1"
                     /db_xref="GeneID:38737257"
     CDS             complement(join(838985..841243,841272..841328))
                     /locus_tag="MRET_0491"
                     /codon_start=1
                     /product="BRCA1 C terminus (BRCT) domain protein"
                     /protein_id="XP_027482926.1"
                     /db_xref="GeneID:38737257"
                     /translation="MDGVRFVIAENVDPFRGEKISNDLLKHGATAVDSAQFDSASNRA
                     ATFRELVTHFITETIHCEYATWCRHMEYDDVTVSEEASPVAVTPAWAERSMALRHPQP
                     VKLYSPDPRDIFSGIVICCAHLTPHDVDLMATSVTSMGGGVKQTLCEEVTHVVAIDRD
                     NSKMRALEQHKTDLPIIAVAPHWINDSYSVQRLLPLDKYVFPMDTPQGLPPCLCAPNT
                     ATQVAAVPSPPQPLSLHTEHSILQGKTVLFARDIHGGTLEAHPELHSIRDRVVQVGGQ
                     CAPTIPATASADEVAAAIESADLIVARHRESDECAHALGQNKTVGTLPWLAKVLSTGH
                     MTSPRDRLLHFPYPYEHVQGFPKLSITITNYKGQARAYLKELIVKMGGVFTPELSTMN
                     DVCVALDLHGDKVKRAREWNIPIVNHIWLEQCFATWTNQHLAQRSFITFPGAAQLSAV
                     LGQIGVTDESVTPYIQAGPKIPPAVEMSQPTPTPPPEDVSPVASPPAVIRDHQQTEAP
                     QPVPEQPEPEHAEAQPSEFVGPKKQGNDEPSSPTASRRKREAPAASHTPKRARNELLV
                     ATTSVTLTKTEQHALEALGIQYTERISEAHVLVAKALTRTEKMLCAIARGLDIVNVSW
                     IKTMVRKRERIDPKAHVLRDRNREHQWSMSLPDVLSRSQDNPSSLLRGHTFYIFKHTE
                     PSRDVLTRVIEAAGGSVEHATGKTDARVLASDQAHVIGSAADETAIHALQSHYTKAHG
                     SPLAVYTAEVVLAGVLRQQMDWTSTYQLSAT"
     gene            <841617..>844118
                     /locus_tag="MRET_0492"
                     /note="MRES_01455"
                     /db_xref="GeneID:38737258"
     mRNA            <841617..>844118
                     /locus_tag="MRET_0492"
                     /product="solute carrier family 26 (sodium-independent
                     sulfate anion transporter), member 11"
                     /transcript_id="XM_027627119.1"
                     /db_xref="GeneID:38737258"
     CDS             841617..844118
                     /locus_tag="MRET_0492"
                     /codon_start=1
                     /product="solute carrier family 26 (sodium-independent
                     sulfate anion transporter), member 11"
                     /protein_id="XP_027482923.1"
                     /db_xref="GeneID:38737258"
                     /translation="MEARKASRTLWDRTKSIAKRVVRYDDTEANRLGVPMVGVQDYMG
                     EMVDHPWEKAVHYLDSLFPFRHWILSYNLTWLFGDLIAGITVALVLVPQSMSYANIAG
                     LAPQFGLYSSFVGVVIYALFATSKDVTIGPVAVMSLQTATVIKKINETYPDRHYEAHM
                     IASALAFLCGIITLGVGLLRLGWLVEFIPAPAVSGFMTGSALTILVGQLPSLFGESNV
                     PSHGAMYLTVIRFFRELPTTKLDAAFGIPALVFLYFIRSACNYIAKRYPKYARVAFFV
                     SVLRSAFVIIVLTIASRVWLGPEQKSDYPITIINHVPRGFRNMGQPSLPQDVTSAIGP
                     NLPASVILLLLEHIAISKSFGRLNNYKINPNQELIAIGVTNLIGPCFGGYAATGSFSR
                     SAVKSKSGVRTPLAGWITAIVVLIAIYALSGVFFWIPKAALSAVIIHAVGDLIAPPSL
                     LYKFWLMNPLELLIWVASVVVTIFTSVDYGVYTSVAASAALLLIRIARPRGHWLGVVR
                     VEHNDPSIAGGAQQRNVFMPMDVQDGLRDPSVHVEPPPPGVFVYRVEESFTYPNASHM
                     AEVITDKIKRHTRPGRAAVSKTGDRPWNDPGPPNVRLVRAFRACTWYYHRHKDAPALQ
                     EELEERMRIEKEDPRPYLHALVLDFGSVANVDSTSVQVLVDLRNALERYRGGPVQFHF
                     AHILSPWIRRALLAGGFGTGRIHRHVTEIASVVQQGDARAVGERRSPSPEKPPLPEAG
                     EDDDYLHRPPHDDLESQVPAQVTAEMDKLDFEIRHLDAMYAQESKQESSMSSPSITVP
                     IMWNNELTPYFHLDLAAAVSAATDSLSPLQEPSAA"
     gene            <844254..>847508
                     /locus_tag="MRET_0493"
                     /note="MRES_01450"
                     /db_xref="GeneID:38737259"
     mRNA            <844254..>847508
                     /locus_tag="MRET_0493"
                     /product="nucleotide exchange factor"
                     /transcript_id="XM_027627120.1"
                     /db_xref="GeneID:38737259"
     CDS             844254..847508
                     /locus_tag="MRET_0493"
                     /codon_start=1
                     /product="nucleotide exchange factor"
                     /protein_id="XP_027482924.1"
                     /db_xref="GeneID:38737259"
                     /translation="MSGPADAARRESASSVSIDALVDEIDQVMDDMRDAPPSMSDASR
                     SSSICSGAGRRRRPLPQTPPLPPAWQSHSMQTGSSTVMSPAPMRRDAERPWPSVSRQS
                     SIDSVLPAYTQRTEAEPHAHVSSLIGTSVDLSRLSQVSQLLSCILERKPLIKGSVVYP
                     LSFTGRTLIETLTSMITQYAKVSPCFELDPTALEGTAHQLALSMAHSLKTQLYVHEAD
                     WEEQDITNDLGGVYMLSTDSLSTKKDVPGQDAVHGIHTQLFVVSQDIHVALSATAAAA
                     CMTAAEGERPTGIISPLTHCYSPTCALTHGQGCYSPSCPRQNAALAQVHVSQEMEPGE
                     SLSAAKAWVEIFPQSVVSSLPREEVKRQNAIHEFIQKEEAFLRDLQLLTLFCSKLQAL
                     AAPTPTLALPPDAPLTGEALTSFVEDVFGPVFTLLPRIAQFVDHMHERQREQGPVIQC
                     MGDVVTRAALDWRTEYVSYVTHYPAALAHLKAECESNARMQRFVDDCRRYPAAGRHPL
                     DNFLFRPPARLQRYHLHLESILKHTSEYSDDRDALQLAIEVLDEQCLVAQSGVEATEA
                     RLDMRALANQLTAKRLDDYIDMNLLDARHQLLHRSRVFRRPDNFEFEWTRLEAILTNQ
                     FLVLVKPRAHDDPEAGAPSSRRKLVLSRKPIPVVCLGSGGFDLAPTGRGSISRHWMPT
                     NVSEMYPFQVWHKLHTNQSPITLYVCTRDEREEWRRALETLPPTSPHTFVRTDLSGDV
                     FSARAEPSETYALVKDAPWARPDVTCATTWLWRDRVLLVAIGTTEGIWMGRYGDPPTL
                     RKVLHMKGVTQCAVLQEYRRFLVLADKSLIAYDLEALVPSGQGTLSAAPMRIGSGRDV
                     HFFSYGHVHATPMLVYAKRKTTETSVRLLTPQTSLDAAGQMMLTGFQLVHKFYVYPEA
                     LQIQCVRDGVLVSTPRTVYTYRFTSHMLVPLLSLRQNDERAHALVRQWEAGVVLGVFH
                     DAERGWLMCYDRGAFFVDEHGTMVHMECTFQWEKAVDRVVLADQHVFACSTTHVEVHE
                     ARTGRLVQLHEGQDIQMLVHNDTEHALGTPPILVERVPFGTTQVQRVVAYQQRS"
     gene            complement(<847533..>848840)
                     /locus_tag="MRET_0494"
                     /note="MRES_01445"
                     /db_xref="GeneID:38737260"
     mRNA            complement(<847533..>848840)
                     /locus_tag="MRET_0494"
                     /product="ethanolaminephosphotransferase"
                     /transcript_id="XM_027627121.1"
                     /db_xref="GeneID:38737260"
     CDS             complement(847533..848840)
                     /locus_tag="MRET_0494"
                     /codon_start=1
                     /product="ethanolaminephosphotransferase"
                     /protein_id="XP_027482921.1"
                     /db_xref="GeneID:38737260"
                     /translation="MYHFLGAEHRARLKEYRYASQGSSLVSTYVLGPYWNWLVTLFPL
                     SIAPNTLTLSGLLLVVANYFSLLFLDGELEKATQLRAHTSVQDGALPTVLLLPGGGLP
                     DALRATQPTTESPIPSWMLFVWAICLFLYQSMDAIDGKQARRTGMAGPLGELFDHGCD
                     ALNTMLEVVLAASALGFGRSYWTLICLICSLTSFFLTTWEEYHTHVLFLSSFSGPVEG
                     ILIICALYTCAGAFGSGVFVQGVLNVLRVSHIDWVRTHIAWANVPLGDLVMLLACLGL
                     LVNAWQAYRNVRGHCRSQHMSTLAPLAGLVPFVIQIVSHMAWASGRDAQVMVHGHLFM
                     AFLMTWGLSFAYLVGLVILAHVCRTPYPYWNVFMLPSMVLGLDAWLPQPILQATLPQT
                     VQRVYYVLGLTIAGYAYFVYDVIRTITTETGKPCFRVVKAHEQ"
     gene            complement(<848922..>851084)
                     /locus_tag="MRET_0495"
                     /note="MRES_01440"
                     /db_xref="GeneID:38737261"
     mRNA            complement(<848922..>851084)
                     /locus_tag="MRET_0495"
                     /product="condensin complex subunit 2"
                     /transcript_id="XM_027627122.1"
                     /db_xref="GeneID:38737261"
     CDS             complement(848922..851084)
                     /locus_tag="MRET_0495"
                     /codon_start=1
                     /product="condensin complex subunit 2"
                     /protein_id="XP_027482922.1"
                     /db_xref="GeneID:38737261"
                     /translation="MQPFRAPSTSAAAARRDASGRRGGIGGEKRMPSSSLMPGVGRRI
                     VSQGLARTQQRTGELEGAPSAALQVDNTSFEEWMKMATDNKINATNTWSFALIDYFHD
                     MSLLRSDSGDGSINFQKASCTLDGCVKVWTSRVDSVMAETGRLLSGLQDEDASSAQAD
                     TSQDMGDHSRVDEVEEGDERPRAKRRQRAQEVTLAKSFSQLQVKRFDLEFSVDPLFKK
                     TSADFDEDGAGGLLMNHLHVDDQMKVVFDASDVAATMEEDVDAHDSSDHATTEELASW
                     DLEKLRARLYAAAAQLDPSVLSIQSEPLSALLENRMICPSTSTFTFADDNEAALPSMQ
                     LDLEEEAMDIQDVDQDGLDFFDGQVGEIDEDDEEERGAFDVALTHDTKTTTSDHDRLF
                     DYFDNTKNWAGPEHWKMTRLHMSLATPVPEKPAEAAPDKAVKARRTKESQVIDFLSAD
                     PPPSAKELFAPGTAPSAISLSKTAQTATDRHLLPEDHHFNSKRLLRLFLKPKAQILLQ
                     RKRQPANTPGALGGAWDDDDLAWGADNAPSADDGAVFDTGLFEEHDPYEDVLAAPSLE
                     AETGMADAFDVDSDIDEEAWGAEALRRVRPEFVDHARRAKQVDVKKLKDNIWQSLSLD
                     GHEPKSFSQALEELQSMYAPSKFSEISTSFCFICLLHLANEEGLEIQVPTGEEPASAG
                     AILSATRTGQMEHDDDDGHVGHLERLRIRRDPAVPIVA"
     gene            <851253..>852293
                     /locus_tag="MRET_0496"
                     /note="MRES_01435"
                     /db_xref="GeneID:38737262"
     mRNA            <851253..>852293
                     /locus_tag="MRET_0496"
                     /product="2-acylglycerol O-acyltransferase 2"
                     /transcript_id="XM_027627123.1"
                     /db_xref="GeneID:38737262"
     CDS             851253..852293
                     /locus_tag="MRET_0496"
                     /codon_start=1
                     /product="2-acylglycerol O-acyltransferase 2"
                     /protein_id="XP_027482919.1"
                     /db_xref="GeneID:38737262"
                     /translation="MATMEKMSSEEFSAQVDKLTHFHEQKPIRDIRVVGVMQWGLMPF
                     IAFFLTFWILSYPILWPVSILYLIYMFADPSPERAGKQPSWTRKSTLFRWFADYFPFK
                     VHKTADLDPSGNYLFGYHPHGIFGFGTVCAFSTRAAGFDEKFPGLKPHVLTLHQNFLL
                     PFYREYLMLFGLRSVSRKSCDTILQSGPGESIVIVVGGAQESLAAHSGYMDLTLKRRK
                     GFVKVALSTGASLVPVISFGENELFYQLKNDRQSTLYKVQQKLKSLFGFTVPILIGRG
                     FSHFYYGWVPYCRPVNVVIGAPIPVQKTPNATPEQVDALHEQYVQALVKLWDEHKDTY
                     APHRIADIRLVD"
     gene            <852399..>853268
                     /locus_tag="MRET_0497"
                     /db_xref="GeneID:38737263"
     mRNA            <852399..>853268
                     /locus_tag="MRET_0497"
                     /product="histidine phosphatase"
                     /transcript_id="XM_027627124.1"
                     /db_xref="GeneID:38737263"
     CDS             852399..853268
                     /locus_tag="MRET_0497"
                     /codon_start=1
                     /product="histidine phosphatase"
                     /protein_id="XP_027482920.1"
                     /db_xref="GeneID:38737263"
                     /translation="MQESRPAALLTLVRHAESMANVDRVLQGVCDAPLSPRGLKQLQQ
                     LEDAWRPTSASLNLFDLPKPTLIVTSPIGRAKRTSCAIARGCGINTLPESDTTIFRSA
                     HCEAPQHVAHDTVRADAGLSERHFGTAECTRKMQPVQGYERPPSKELGRAESVTAFYK
                     RAADVGVKWMDWLETYARHNLQDRGSPDSDDQNKAPDTIPHLVLVSHGQWINAFLQQH
                     LPDTWEKADLYYIQSANTSLFTIGLHVTPTSRRLELLRRNDTRHLDETTRPSKRGRRA
                     KPPQRTTLTALWS"
     gene            <853338..>855476
                     /locus_tag="MRET_0498"
                     /note="MRES_01430"
                     /db_xref="GeneID:38737264"
     mRNA            <853338..>855476
                     /locus_tag="MRET_0498"
                     /product="lysophospholipase"
                     /transcript_id="XM_027627125.1"
                     /db_xref="GeneID:38737264"
     CDS             853338..855476
                     /locus_tag="MRET_0498"
                     /codon_start=1
                     /product="lysophospholipase"
                     /protein_id="XP_027482917.1"
                     /db_xref="GeneID:38737264"
                     /translation="MKLSVVLFVAASCLLAGTQVQATYKDGKGTTHWEQHELDTAISP
                     DERERLVETMVKAHQIVDKERSKQRRYSPKDTYAPVNVPCPPMPEGDNYVGFVRNATN
                     QSLNPNEAAYVKRHRQNNKRRWADWLKRAGMDDNGVPGGVDSFLSDERNQPRVGFAAS
                     GGGYRAMLVALGVAQGFDERNKTAMDRGVGGLLQLADYFAGLSGGSWATGSMAINDWP
                     TMQSLVDDIMDLSSNLIKPSHDKLSFYKDLFNDVSDKKDAGFPVSISDYWSRALSYQL
                     LNKTDHSPMFVHHGQRTTYSDIVNTTSFKDASYPLPIVLSIGRPPNEIMINPNATYFE
                     FTPFEFGTWQPYLQAFFPVGYLGSDMRNGKQNAKDKSCVANYDNFGYVVGTSSTLFNG
                     AYTAFLEGNKTGVLNDILKKILEDTDKGYNDVAPVPNPFKGYRTDSNVFWQEKYIDLV
                     DGGEANQNIPFEPLLQPARELDMIIGIDVGSDHAGWPNGTDLWETQRRMQLDEFSYMA
                     FPKVPEMKTFVNRGYNTRPTFFGCNPKNATNADKASRPAPLVVYLPNYPYTYMTNAST
                     FELAYNVEHQHRMLDNSVDIATMGGNMSNWHECLACASVLRSLQRSNTKVPSKCQKCL
                     DMYCWDGTEDESEPGMYTPPTGAPAFVASHGKKNVKPPVTGSNDTSESTIGEIMGSKD
                     DTGNSAPKAAMMPLAMSAAMVCATVLTMLM"
     gene            complement(<855469..>857415)
                     /locus_tag="MRET_0499"
                     /note="MRES_01425"
                     /db_xref="GeneID:38737265"
     mRNA            complement(<855469..>857415)
                     /locus_tag="MRET_0499"
                     /product="translation factor GUF1, mitochondrial"
                     /transcript_id="XM_027627126.1"
                     /db_xref="GeneID:38737265"
     CDS             complement(855469..857415)
                     /locus_tag="MRET_0499"
                     /codon_start=1
                     /product="translation factor GUF1, mitochondrial"
                     /protein_id="XP_027482918.1"
                     /db_xref="GeneID:38737265"
                     /translation="MILRALRRASCVLRVRALHHSCVSLKQATIPYDELETRTFSIIA
                     HIDHGKSTLADRLLECTNTIPSHASNKQVLDKLKVERDRGITVKSQAVSMLYQTPERA
                     KPLLLNLIDTPGHVDFAYEVRRSLSVCQSALLVVDATQGIQAQTISVYRIAEQCGLTV
                     IPVLNKVDLPASNPEQCAEQLRDILGMDTTVHTPLHVSAKTGQGVDRVLEALVERTPP
                     LPGMQRQDREPPGLRALVFDSWYDKYRGVIALISVMDGAVRKGDMIEAYHSGKRYEVL
                     DLGLNHPEPVSVPILRKGQVGWLITTMKDTEEASIGDTFHRAHETVEPLPGFRPALPT
                     VFAGIFPTDKSEFLKLEDAIQRLCINDRSISIQKETMTALGQGYRLGFLGTLHLDVFR
                     QRLEDEYDHEILVTTPTVPFRITYNDETQVLCSNPADFPDEGTKKLHVACLEEPSVKG
                     SLVCPEEYTGAMMELCAEHRGEQLDIEFSRAAQAQSQVYMQYRLPLAEIVTDFFDKLK
                     SRSSGFASFDYEEDEYISSDLVKLTFLVAGAPVDALDMVLHRSKASLVGRTFAQRLKD
                     AIPRQQFEIKVQACVGGKVVASETVRAYRKDVTAGLYGGHYERKLKHLNKQKEGKKRL
                     KAMSLGRVQVPHKAFMDILDTRST"
     gene            complement(<857480..>858361)
                     /locus_tag="MRET_0500"
                     /note="MRES_01420"
                     /db_xref="GeneID:38737266"
     mRNA            complement(<857480..>858361)
                     /locus_tag="MRET_0500"
                     /product="mRNA export factor"
                     /transcript_id="XM_027627127.1"
                     /db_xref="GeneID:38737266"
     CDS             complement(857480..858361)
                     /locus_tag="MRET_0500"
                     /codon_start=1
                     /product="mRNA export factor"
                     /protein_id="XP_027483194.1"
                     /db_xref="GeneID:38737266"
                     /translation="MGTKVISVGADKVARCFDLNTNQAGVVAQHNDTIRCVRWTRVFG
                     GALVTGGWDKSVKIWKIEPQPTLITSMDLPERVYAMDVIGFIIIVAMAERKIMAFQCN
                     EATGTAQQVVDQFSPLKFQTRSLAALPEGDGFALGGTEGRVAVHYFHDPPDPKDGKVK
                     KFAFRCHRRTNADHPDVPRNETQLYPVNAIAFNAQGTFATGGGDGSISFWCKASRTRL
                     KTFETKGSAMAPKELFKTNPNRLPVTAIAFNMDASIFAYALGYDWHKGYQGATTEAHV
                     FIHPVNPEDIKKRPPKA"
     gene            <859042..>859697
                     /locus_tag="MRET_0501"
                     /note="MRES_01415"
                     /db_xref="GeneID:38737267"
     mRNA            join(<859042..859085,859163..859199,859317..>859697)
                     /locus_tag="MRET_0501"
                     /product="large subunit ribosomal protein L24e"
                     /transcript_id="XM_027627128.1"
                     /db_xref="GeneID:38737267"
     CDS             join(859042..859085,859163..859199,859317..859697)
                     /locus_tag="MRET_0501"
                     /codon_start=1
                     /product="large subunit ribosomal protein L24e"
                     /protein_id="XP_027483195.1"
                     /db_xref="GeneID:38737267"
                     /translation="MKVEICSFSNRKVYPAKGRLFVRGDSRVFRFQGSKPESLFHQRK
                     NPRKIAWTVLYRRMHKKGVTEEVAKKRSRRTIKSQRGVVGASIDQINTHRNQRPEVRE
                     AARKEHIAKTKEAKKARQAERKANRQAAGANTAVARQQAKSTARSGGGLKA"
     gene            <859945..>861792
                     /locus_tag="MRET_0502"
                     /note="MRES_01410"
                     /db_xref="GeneID:38737268"
     mRNA            <859945..>861792
                     /locus_tag="MRET_0502"
                     /product="serine palmitoyltransferase"
                     /transcript_id="XM_027627129.1"
                     /db_xref="GeneID:38737268"
     CDS             859945..861792
                     /locus_tag="MRET_0502"
                     /codon_start=1
                     /product="serine palmitoyltransferase"
                     /protein_id="XP_027483196.1"
                     /db_xref="GeneID:38737268"
                     /translation="MGMPDALHAPATGGLTQKTGLQHSEFGECKEDAFRWTSRYDAGQ
                     LESSEEDTPSYLTVLSTYLVYIVLILFGHARDFIGRRFYPQEFAHLRENNGYAALNSD
                     FDSFFTRRLKTRIDDCFERPVTGVCGRTVMTLERISHDYNRSFHLTGRKRRALNISAY
                     NYLGFAQSHGECADNVDTGIDMYGLSSGGTRLGAGMLDLQTQVEKMVAKYLGHEDAML
                     ISMGFATNSTTIPAIAGPGTLIVSDELNHTSLRSGVRMSGASIRPFKHGSMDALEALL
                     RECISQGQPRTHRPWKKIIVIVEGLYSMEGTIFDLPRVLELKKRYKFYLYIDEAHSIG
                     ALGPNGGGVCDYFGIDPMQIDILMGTFTKSFGAVGGYVAGKKSTIDAIRRRNYSNVYG
                     ETMAPPVLVQIMSSLATIMSIGRSPENRALLPSWTHFSEQFLMGVEGRHRLERLAFNS
                     RYLNHGLRKLGFIVWGNRDSPVVPLLLFQPGKMVLFSNLMLHRGLALPPSQRWQTEDD
                     VWNSATLETAQVASTGPQGVRRRPPIVVVVVAYPATPLISSRVRFCVSAAHTKQDIDD
                     VLVACDEIGSLLALKYANGGPGGRWHIDKVLSHSAELVAWNGVNPLPEP"
     gene            complement(<861826..>863586)
                     /locus_tag="MRET_0503"
                     /note="MRES_01405"
                     /db_xref="GeneID:38737269"
     mRNA            complement(<861826..>863586)
                     /locus_tag="MRET_0503"
                     /product="aldehyde dehydrogenase"
                     /transcript_id="XM_027627130.1"
                     /db_xref="GeneID:38737269"
     CDS             complement(861826..863586)
                     /locus_tag="MRET_0503"
                     /codon_start=1
                     /product="aldehyde dehydrogenase"
                     /protein_id="XP_027483197.1"
                     /db_xref="GeneID:38737269"
                     /translation="MWWYVLWAVVTLALARLVRARPRRVRAIERVYPEEAQPGWSGEV
                     RSPHTPLIDEDQCITCYDPATGYVLARVPGDTPDTIRDKVRRAKEAQEVWRTSSFTQR
                     REVLRTMQAWIQRDAEAVARIACRDTGKTAIDAAFGELLTTCAKLAWTIQHGERILRP
                     ERRSGNLLLAHKRCTVYHEPLGVVAACVSWNYPVHNMLGPIISSVFAGNAVVIKCSEH
                     VVWSSRHVLEGVYRCLDACGAPRDIVQLVACGPMAVEALTRDARLAHITFIGSDAVGR
                     RVAEAAAPQLTPTTLELGGKDPALILPGTDLSFFASMFMRACFQAMGQNCIGIERFLV
                     PDSMQDDLAALVEPRIAALRCGSTLDETRFGLASDKGEDVVDAGAMISDARFDALEAL
                     IADAVAQGARLVLGGKRVVHEKWPMGHYFAPTLLTHVQPTMRIAQEEVFGPVFLVMPY
                     SDVEQGIQLANNTPYGLGASVFGRDHAECKRVASKLACGMVNINDFGISYLNQGLPFG
                     GCKHSGYGRFAGPEGLLGLTAPKAVTEDVLFGIIQTSIPPHVDYPLRDTRRSWRFLQS
                     LVRLAFGSLWDRIQALPGLL"
     gene            <863631..>864611
                     /locus_tag="MRET_0504"
                     /note="MRES_01400"
                     /db_xref="GeneID:38737270"
     mRNA            <863631..>864611
                     /locus_tag="MRET_0504"
                     /product="COP9 signalosome complex subunit 5"
                     /transcript_id="XM_027627131.1"
                     /db_xref="GeneID:38737270"
     CDS             863631..864611
                     /locus_tag="MRET_0504"
                     /codon_start=1
                     /product="COP9 signalosome complex subunit 5"
                     /protein_id="XP_027483190.1"
                     /db_xref="GeneID:38737270"
                     /translation="MSEAAMYAQDPSAYQALLHKAPWRQDPRYFQRVCISVMALLKMV
                     LHAQSGGDLEVMGLMQGHVRGDTIYVLDAFPLPVHGTETRVNAQNEAYEYMVMYLEAC
                     RSVHRPEHAIGWYHSHPGYGCWLSGIDVQTQRTNQQQDPFVAVVIDPWRTMSTGHVDI
                     GAFRTWPLDQPSTAPDTTAPPPRLPAHKIDDYGAHASQYYELDVQFIKIAADRPLYDQ
                     LWQQYWAQVLCSPPNASLQPLHELGTRLGEIAATIESTSTMPGGTSYAQAARAVPRSD
                     GVDVQALAQQLDRRADGQPLEQASQDAYSVAADMRYAIERARRKTMLFGL"
     gene            complement(<864716..>866224)
                     /locus_tag="MRET_0505"
                     /note="MRES_01395"
                     /db_xref="GeneID:38737271"
     mRNA            complement(<864716..>866224)
                     /locus_tag="MRET_0505"
                     /product="G2/mitotic-specific cyclin 1/2"
                     /transcript_id="XM_027627132.1"
                     /db_xref="GeneID:38737271"
     CDS             complement(864716..866224)
                     /locus_tag="MRET_0505"
                     /codon_start=1
                     /product="G2/mitotic-specific cyclin 1/2"
                     /protein_id="XP_027483191.1"
                     /db_xref="GeneID:38737271"
                     /translation="MSSNLPVRRAPARARSTTKTDENAYALRGTSAAPAPAKGKAPVA
                     ADKGPAATTSALGASGVLGTRKRAALGDLTNAARTRLANDEKAEEKKPALRVRPPPAA
                     QRTAAHLPAARAAVATQRRVARPREPEAMAIDDVSGSDKENRDLATDQAREAKRVRMT
                     HEAAPAAPTQRAKDEGWEDLDKDDADDPLMVAEYVEEIFAYMRQVEMQCMPNGSYMDL
                     QRDLNWHLRGVLADWLIETHAKFRLLPETLFLALNIVDRFLSMRTISLSKLQLVGVTA
                     LFIAAKYEEVLCPSIQNFMYVADGGYTDEEILRAERYMLKVLNFDLSYASPMNFLRRI
                     SKADNYDIQTRTVAKYFMEISLVDHRLLDHPPSLVAAAAVWLAREVLERGEWTPTLVH
                     YSTYAEPELLGTAEIMLDYCLRPPAHLHFHKKYSSKKFMRASAYVLEWAKNTFPHAVI
                     TQDDVTLGKWTDENGEKHSLDMLRVDLYERHGHPRPTVLPLGPATPVTNIDA"
     gene            <867237..>868307
                     /locus_tag="MRET_0506"
                     /note="MRES_01390"
                     /db_xref="GeneID:38737272"
     mRNA            <867237..>868307
                     /locus_tag="MRET_0506"
                     /product="MIS18 kinetochore protein A"
                     /transcript_id="XM_027627133.1"
                     /db_xref="GeneID:38737272"
     CDS             867237..868307
                     /locus_tag="MRET_0506"
                     /codon_start=1
                     /product="MIS18 kinetochore protein A"
                     /protein_id="XP_027483192.1"
                     /db_xref="GeneID:38737272"
                     /translation="MEDAKRSGAHLDTSPITSMQKSVSSATPAVRPAEDVPSAAPPKA
                     RRRGRPPKSTSTSRAPATASVPPPPATRVIASDTPPPMVFQCFQCLSIVGDSTSWIMA
                     QRQLGFIVLRDVTDKVVALEFHTMSDDIGWERYKFAPLACAHCDQVLGRMYKDTPPEW
                     STLRAAYCLSHSALLVYQLGSTRSSQSGSDIDFGGLSAHDGDDDKVSRSPSPHIPSKL
                     PPIVSVNASAEAEHDKDLGKIRTLLMAMGERLLRLEQQIPSLQASSQAPLIPSMNDGV
                     THRATPSSWDGITRSPSFHGPVQPGRSFLLDDLSSRRLPPLAPVDDARWISTPHQHRS
                     PTSTDALSRAPSVWARHASTGL"
     gene            complement(<868314..>869192)
                     /locus_tag="MRET_0507"
                     /note="MRES_01385"
                     /db_xref="GeneID:38737273"
     mRNA            complement(<868314..>869192)
                     /locus_tag="MRET_0507"
                     /product="mRNA-decapping enzyme 1B"
                     /transcript_id="XM_027627134.1"
                     /db_xref="GeneID:38737273"
     CDS             complement(868314..869192)
                     /locus_tag="MRET_0507"
                     /codon_start=1
                     /product="mRNA-decapping enzyme 1B"
                     /protein_id="XP_027483193.1"
                     /db_xref="GeneID:38737273"
                     /translation="MDLDARLQLNTRVLQRIDPCALHILASASFVVYYTYENEWTKTS
                     VEGPLFLYQRSEAPYYGLQILNRNDPEPFYVGFTPSDDVEISEAFLIYRAHQPDDGNA
                     GDHTIYGFWIFEPSQLEQLAKTITSLQKAPYPPPAPPPLRVDHAPTSISMDALFGQPE
                     APTFTEQERTGASILNALFREASDKNQDTAPEPKAPEPASQIQSTPIDLDTLFGTASV
                     QESSDPMAMEPVDELRAPKSPPTSIGDTLPASQVVVGLEGHLSRADFVQKLIVQLCTD
                     QAYVEKLYAEYQRGHR"
     gene            <869333..>872068
                     /locus_tag="MRET_0508"
                     /note="MRES_01380"
                     /db_xref="GeneID:38737274"
     mRNA            <869333..>872068
                     /locus_tag="MRET_0508"
                     /product="replication fork protection complex subunit
                     Tof1/Swi1"
                     /transcript_id="XM_027627135.1"
                     /db_xref="GeneID:38737274"
     CDS             869333..872068
                     /locus_tag="MRET_0508"
                     /codon_start=1
                     /product="replication fork protection complex subunit
                     Tof1/Swi1"
                     /protein_id="XP_027483186.1"
                     /db_xref="GeneID:38737274"
                     /translation="MVASDTDDVWRQVWSDEGDSVSTVSEEEPEVEAGDVDMDERVEM
                     LRAPVLSICTALGGYEHVQQLGRTELVYRVGDDCLECLRDLRRLWRQDDTDASRAIAR
                     VFAELGTLHNDLIPILLHCAGGGDKADKIALACTDLITALTWPIDWDAELHDMTTRME
                     EDENEQVLAKLLELQSAQVQYKSSILRERAKEPRLGDRTVLSCVLRHVLAPSLKPRSE
                     RTERDVGVTSMCLHLFRNLLAIRDPPLQSFSTGNIANMSLQSVLVQQMDTFHILDALR
                     MLASQADTKEFEMWTPIVAESVYHMVSGTPPAWLAGAIETSPLSASLSAEASERRLSR
                     RNASARHSRFGTTIQFPAHDGSLRIARTPAALTERVDRLEQRVIDRTKRRVSRRRPAF
                     DRGAPPTQVHWTPSAQRVLRTWADRFVLDGLFGVLVPAYLRDIHAERERVGGLEAARC
                     KAIQLASFFLEYAMARRMPMAHVSLWLEPWAFRLVRARTAMALESRQWLEFTLSVRLW
                     TTQLRLLEALSRSALDAEREAAESLQHTLYYDGEYLDTALHAMHAYSTQSFACLEAII
                     DFSYMMPRLLERHASTSTYMFVKTSKDERIFRFESFQRSMASTRLVHACTQYLARYRD
                     SSCASTMLPRLAAVVHRTIVRASHVALFFSAKIRHVWDRVMADGAHMQRVHPQAARDL
                     ARLYHIIRKTFLRLSDASRQAYEVGRRPPKPTAELYVRSELSHSEQIGVAVGLLAEAH
                     KLTSVSWVRTALERASMERMSHQPEAHVPEAHMPLYPEHELPDGGPDAAHLAPLRLLC
                     RLVELEEKAEGTWYVPPDCAPNTLARYGQIIDQYLTEPLVIEGQSLKDLVRAKRPRPP
                     ATDRPAQRPRIEDEVPSLSDAESSPPTSSSPQIAAPEPMEAKGVPDLFLLSDTEA"
     gene            complement(<872065..>872718)
                     /locus_tag="MRET_0509"
                     /note="MRES_01375"
                     /db_xref="GeneID:38737275"
     mRNA            complement(<872065..>872718)
                     /locus_tag="MRET_0509"
                     /product="DNA polymerase subunit cdc27"
                     /transcript_id="XM_027627136.1"
                     /db_xref="GeneID:38737275"
     CDS             complement(872065..872718)
                     /locus_tag="MRET_0509"
                     /codon_start=1
                     /product="DNA polymerase subunit cdc27"
                     /protein_id="XP_027483187.1"
                     /db_xref="GeneID:38737275"
                     /translation="MDDTHAFLTARILHDKQAVTYRLLSREMGMHVDEAKAALGRFAE
                     AEDVSVIYAVHDVHHVFVVPASELESTLARLSNGKKQVYALQPVGTSYDPAMLASVNR
                     ALVYDEAYAAQRHAGLGAFGAIQKDEEVRAPPPPSSTNKRRKVIKRIRTKNEKGYTVF
                     QDIETYESGDEAAPSAQPASTAPAAPAPSKSPTKASPKGPSKAAPKQHSLLSFFGKR"
     gene            <872806..>874188
                     /locus_tag="MRET_0510"
                     /note="MRES_01370"
                     /db_xref="GeneID:38737276"
     mRNA            <872806..>874188
                     /locus_tag="MRET_0510"
                     /product="ATP-dependent RNA helicase DDX19/DBP5"
                     /transcript_id="XM_027627137.1"
                     /db_xref="GeneID:38737276"
     CDS             872806..874188
                     /locus_tag="MRET_0510"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX19/DBP5"
                     /protein_id="XP_027483228.1"
                     /db_xref="GeneID:38737276"
                     /translation="MSDPKVESLSERLGDILADVSRTSDWAEEGDDASKNEGPLHESK
                     YDVQVTLADQQADPNSPLYSVKSFDDLGLHEDLLKGIYAMKYTKPSKIQERALPLLLQ
                     NPPRNMIGQSQSGTGKTAAFVLTMLSRIDFSEEKTQALALAPSRELARQIMDVVQEMG
                     KFTPVKTAFAIPDSIKRGQKVSAHLVVGTPGTVYEFLRTRMLDPAGIKVFVLDEADNM
                     LDQQGLGEQSFRVRLLMPKTCQLVLFSATFPESVHKYATKIAPNANEIRLKQEELSVE
                     SIRQFYMNCKSEEHKYEVLVELYNLLTIGQSIIFCAKRHTADKIAQRMTAEGHRVDSL
                     HGKLDTSARDRTIDDFRSGKCKVLIATNVIARGIDIQQVTLVINYDMPLTQSGEPDAD
                     TYLHRVGRTGRFGRKGVSINFVHDEKSKQQMEAIERALHCRIVPVQTDDLEEMESTIK
                     EALKSSQGSQ"
     gene            <874252..>876129
                     /locus_tag="MRET_0511"
                     /note="MRES_01365"
                     /db_xref="GeneID:38737277"
     mRNA            <874252..>876129
                     /locus_tag="MRET_0511"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627138.1"
                     /db_xref="GeneID:38737277"
     CDS             874252..876129
                     /locus_tag="MRET_0511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483227.1"
                     /db_xref="GeneID:38737277"
                     /translation="MSSAPRDEADMTQLTLSEDSVQPEPLSDEALGALQRWMLSIACV
                     HFDLELGPDVECMYPPLGISKEEKDNIAFSSFPDTHVFNDGDLVFSWRVREVPLDASN
                     ASPPASSKPAPPRRSPSVRESMTRSVSWLRRSRNEAVVDASPRLHSRSTSYLYGYTYF
                     LQRRDTSRRRGYFQKSLVILSHLPYVGLFHQVIARLGPAFFEHGMVVLESFVHDVIRW
                     PSPEPGLTLSVSVLGTLLHASLPHGLEAQNGDGMQSGTSASLPILASVPSTPLIQVFY
                     ELLPDLWRLWECMLTAEPILIVGRDPRTTSDAVWHLVDLIRPVPVAGDFRPFFHIHDY
                     DFRAFVTRATPPTGVVLGATNPFFLQTCATWPHIVQLGRGDKPAHQGRDTPTARIVSS
                     SKRRVNKDTTLLKQLLQWRDSPSQLEHANAVLRRYFSDLTERFLAPLHQHMATLIPAS
                     FDLTSPAEVPPIKSFHRETFLQWLKSHPGPLRMRQRSLSPASVLRHSLYSDFLQSPNF
                     AVWLQGRVEAAQYEQRQRRIAALAMGDVVTFGRTRSDIESIDLYLRLREELRALETAL
                     QAPRAAPGPGARWRASMEPSGTGMSLIESRAMIAQRTRLAAQMERLLQTMPPDLRVGL
                     P"
     gene            complement(<876136..>876462)
                     /locus_tag="MRET_0512"
                     /db_xref="GeneID:38737278"
     mRNA            complement(<876136..>876462)
                     /locus_tag="MRET_0512"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627139.1"
                     /db_xref="GeneID:38737278"
     CDS             complement(876136..876462)
                     /locus_tag="MRET_0512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483226.1"
                     /db_xref="GeneID:38737278"
                     /translation="MLLSALRQSVRLAAPPMSRVLSTTSMSLAAPRPKAHLYKLKTHS
                     ATKKRFFPIQGSSRGTPKIKRAHSNKQHLNSGMSRTHLSRLRRPQIVATGAVSRMLRR
                     LLAPIV"
     gene            <876597..>878450
                     /locus_tag="MRET_0513"
                     /note="MRES_01360"
                     /db_xref="GeneID:38737279"
     mRNA            <876597..>878450
                     /locus_tag="MRET_0513"
                     /product="CRAL/TRIO domain protein"
                     /transcript_id="XM_027627140.1"
                     /db_xref="GeneID:38737279"
     CDS             876597..878450
                     /locus_tag="MRET_0513"
                     /codon_start=1
                     /product="CRAL/TRIO domain protein"
                     /protein_id="XP_027483225.1"
                     /db_xref="GeneID:38737279"
                     /translation="MAGSRASGRRKSTQSVLDAYCAVQTLFRDHESVVDALHADLMEH
                     AMQALSAERTYTEEERQRVLEFLDDRIMIFRFLRRAGFDKDTARSMLIKTVAWRMEGA
                     IDALPQDLLQSPYMNATSNGIPLFWQHSRFRDKLGRPALYVRLQHVERTPEGLHELKK
                     TIIASFDVMRRYLLRVNRRTRRGDPVIQCVVLVDVMDAGLANVELDILPFFTDLLKNH
                     YPSLCGAVYILRYSWFHAGLWRMLRPILPPKLLERLFFVDRPELLAHFEHHMPRSLGG
                     PLSIPIAPDTSDVFNYFVRAAAWSHPSSSSSGPTPKATDPSPPALRIRQHDFDTIYDV
                     MSCMGSPYTPARTPLTPHTSMPTTPRQHAQTGSPIPLHDLPTSPKAYRRQRASGDARS
                     VVSWFLSWLSPPQRSDDDEAPAEPIRTSRGGDADAAPAPTPPATATAPPTAYGTAESN
                     TVTRYLSWRAHKYAEMDGHVSPYNIENPYFGYPASYVTHDPASVDMTASDPAAAAAVA
                     ASGGARPAGFSREIHVKRRKRDLVRTLSYLFVLRLIRLYHTIRRGILVVVWNVLGPHR
                     AWASLGRTSPGHRPSRYTQCRVLVLLALLLYLQLPRARFLSLLIPHFHAIV"
     gene            complement(<878454..>878732)
                     /locus_tag="MRET_0514"
                     /db_xref="GeneID:38737280"
     mRNA            complement(join(<878454..878514,878545..878683,
                     878714..>878732))
                     /locus_tag="MRET_0514"
                     /product="F-type H+-transporting ATPase subunit k"
                     /transcript_id="XM_027627141.1"
                     /db_xref="GeneID:38737280"
     CDS             complement(join(878454..878514,878545..878683,
                     878714..878732))
                     /locus_tag="MRET_0514"
                     /codon_start=1
                     /product="F-type H+-transporting ATPase subunit k"
                     /protein_id="XP_027483240.1"
                     /db_xref="GeneID:38737280"
                     /translation="MSYTIAGMKIPSEHLVLGVFGAIGAAAYAGMSGGSSKKEKPSVD
                     KVPLNAESADEEAFIKQFLAEAAKEDSK"
     gene            <878947..>879996
                     /locus_tag="MRET_0515"
                     /note="MRES_01350"
                     /db_xref="GeneID:38737281"
     mRNA            <878947..>879996
                     /locus_tag="MRET_0515"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627142.1"
                     /db_xref="GeneID:38737281"
     CDS             878947..879996
                     /locus_tag="MRET_0515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483236.1"
                     /db_xref="GeneID:38737281"
                     /translation="MASTSASPTQRVQSHPLDTLSAEDMTTLPWTPRLGTSRSMHSLP
                     SPPSSTQSARSVPTPGKTRRVRYVKTLQDASPRNVSRSEDVDHILAMCYNVSIGRIQR
                     MAPVHKETLHAIAAKERICMELREELAREEAQLEELRSAWKRMTMRIGTHPPAHVPHR
                     RPPPASPTAQSTRETSRIADHAKAAETWPDWRRIPSQLSNQFHAMMDQFQTADHDTGP
                     SSSPTQDRAVRKGKARRFAASRTHTQDMLSITDELHPDILREKLSSGWHVLSQRLRDT
                     TASFADLSTWAPDDPPPTSSQSSRASLPFSMEDTAFGTVSGLDAMHRAATAPSVLPLA
                     EKRHAPAPEAHLRIV"
     gene            complement(<880115..>880548)
                     /locus_tag="MRET_0516"
                     /note="MRES_01345"
                     /db_xref="GeneID:38737282"
     mRNA            complement(join(<880115..880178,880220..>880548))
                     /locus_tag="MRET_0516"
                     /product="large subunit ribosomal protein L32e"
                     /transcript_id="XM_027627143.1"
                     /db_xref="GeneID:38737282"
     CDS             complement(join(880115..880178,880220..880548))
                     /locus_tag="MRET_0516"
                     /codon_start=1
                     /product="large subunit ribosomal protein L32e"
                     /protein_id="XP_027483230.1"
                     /db_xref="GeneID:38737282"
                     /translation="MPAATIPIVKKRTKKFARHQSDRFKRVSPNWRKPTGIDNCVRRR
                     FKGTISMPKIGYGSNKKTRHIMPNGYRRFVVANVNDMDLLLMHNNTFAAEIAHNVSSK
                     KRIQILEKAKVLGVRVTNANARVRAQEA"
     gene            <880796..>881445
                     /locus_tag="MRET_0517"
                     /note="MRES_01340"
                     /db_xref="GeneID:38737283"
     mRNA            join(<880796..880954,880990..>881445)
                     /locus_tag="MRET_0517"
                     /product="large subunit ribosomal protein L13Ae"
                     /transcript_id="XM_027627144.1"
                     /db_xref="GeneID:38737283"
     CDS             join(880796..880954,880990..881445)
                     /locus_tag="MRET_0517"
                     /codon_start=1
                     /product="large subunit ribosomal protein L13Ae"
                     /protein_id="XP_027483229.1"
                     /db_xref="GeneID:38737283"
                     /translation="MSLMQSTPFIVDGKGHLLGRLASIVAKQILLGQKVVVVRSELIN
                     VSGSFFRNKLKYHAFMHKRHLVNPRKSGPFHHRAPSRILHRAVRGMIPHKTARGAAAL
                     QRLKVYEGVPPPYDRKKKVVIPDALRVLRLKPGRKYATLKRISSEVGWKYQDIVDKLE
                     AKRVVKQQAFHERKSAATKQRAAAATAAASQLEPINKQLEAYGY"
     gene            <881831..>882133
                     /locus_tag="MRET_0518"
                     /note="MRES_01335"
                     /db_xref="GeneID:38737284"
     mRNA            <881831..>882133
                     /locus_tag="MRET_0518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627145.1"
                     /db_xref="GeneID:38737284"
     CDS             881831..882133
                     /locus_tag="MRET_0518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483120.1"
                     /db_xref="GeneID:38737284"
                     /translation="MHFWSLAQQLASLLLTLFILLMRAIALFFGLTPVLVISISELRG
                     AYLTYVRASQGESPKQAASHARPLRPTGQESHATVASSVYTNDASQLQQRVTTNAP"
     gene            complement(<882189..>883667)
                     /locus_tag="MRET_0519"
                     /note="MRES_01330"
                     /db_xref="GeneID:38737285"
     mRNA            complement(<882189..>883667)
                     /locus_tag="MRET_0519"
                     /product="DUF803 domain protein"
                     /transcript_id="XM_027627146.1"
                     /db_xref="GeneID:38737285"
     CDS             complement(882189..883667)
                     /locus_tag="MRET_0519"
                     /codon_start=1
                     /product="DUF803 domain protein"
                     /protein_id="XP_027483119.1"
                     /db_xref="GeneID:38737285"
                     /translation="MDVPLAVGIGLVASLIQSLGLTMQRRSHVQNQRLPETERQSAWR
                     RPMWIAGFVVFLSANISGTLFQIGTLPVVILAPLGAVSLLYNALLARVMLDVIFSWHM
                     LTGTCLIALGAIMVGYFGAVPHAPLTLAELMELYKRPPFVAIALVYTLVLATILAIAH
                     FTEYQLTWQPLLTLRRRRRTRFGWRRYLPVPSLATVAEVSENSSGVATPTHKHLDSEE
                     RLLPDHSQHAKRMHGTLPQNPHIPDYGAVPSQSSLFDMPNARSTVLALAVAYSAASGL
                     LSGACLVMAKSGVDLLILSLQGRNQFSSGFSWCLILVLFAAAMLQLWYLHKGLQLADP
                     MLIAPLAFCFYNVSSITLGLVYFNDAAYLSWLSVAMIVVGTVLLLAGVWTLSLHRQSD
                     TLTSLQPGPIEVNEPSSHVSGHALSSPRMPSALSGPKANRLPSSISLDYSLQRGIEQT
                     DAAPTQHRTSWLTMLAERGLSVGLSASSPGFHVQSQHQRHSM"
     gene            <883858..>886455
                     /locus_tag="MRET_0520"
                     /note="MRES_01325"
                     /db_xref="GeneID:38737286"
     mRNA            <883858..>886455
                     /locus_tag="MRET_0520"
                     /product="phosphatidylinositol phospholipase C, delta"
                     /transcript_id="XM_027627147.1"
                     /db_xref="GeneID:38737286"
     CDS             883858..886455
                     /locus_tag="MRET_0520"
                     /codon_start=1
                     /product="phosphatidylinositol phospholipase C, delta"
                     /protein_id="XP_027483027.1"
                     /db_xref="GeneID:38737286"
                     /translation="MGPSPPPPTASASSAEARPIPFKAPRRSSSMTQSDPGVLSASLP
                     SSSLRSLPARYAAWKQSTRAFRAMRHEGSMQVTPPSSPMSMQPQPQPAFEPLDAMIPA
                     ALQHGEPLLKVTQNKVAQRMFRVSPESASILWASKRGNSVHLYAIRDVRVGASARSYR
                     QSLQISDEHEARWISIIYQNDRAYKAVHMIALSDESLARWRDTLLRVLAQWQALVSGR
                     VTASRAQCEWLHASWDLDRALDERSLMQLCERMGLQISRPELRALFVEADKERRGTLH
                     FEAFQQFVAALKRRPDLEEVYHRLQSHGQLTLATFMAFVRLEQGEWASTDEHIAHIFQ
                     RFHVDTPDGFCAYMTSRQHGAYHAAYSEPTLDAPLSSYFISSSHNTYLEGGQWKGDST
                     VEGYVRALLRGARCVELDCWDGPSGQPQVTHGHTLTSRVPLDDVVAAIAQYAFVSSPY
                     PLILSLEVHNDLAQQEVLASILRTQLGDMLVTAPLEDDVPGVLPSPEQLRYRILVKCK
                     DYEWIHSQTPNEEDESMGSSENADWDSDSLLEQARHLVRLARPKRTGKVARPLSGELV
                     RLLVYTIGVPCRGLNKKEHYAVEHMFSLSERSAARLMRQSYMDLVKHNLTHLTRVYPS
                     MTKLSRLTSSANFRPVDMWASGCQLVALNWQTHDQGMAQNLAMFANSVGYVRKPDALR
                     LRSHVKNDGTLCVSCVLTIVSAQQLPNVRATDEALCPFATVALDVPHEWGRDAVRLSV
                     PLDASPVRQVRTPTVRSNGLIPLFQTPVGVEIRMPAGVDTAAVLAQRTRKEHILRQAT
                     RGLLDLCFVHVQLWDEQVNGAVPLATNTFSLGRVGHGYRHLPLYDMQLSPLVYSTLFI
                     HTAYTHITI"
     gene            complement(<886523..>887419)
                     /locus_tag="MRET_0521"
                     /note="MRES_01320"
                     /db_xref="GeneID:38737287"
     mRNA            complement(<886523..>887419)
                     /locus_tag="MRET_0521"
                     /product="plasminogen activator inhibitor 1 RNA-binding
                     protein"
                     /transcript_id="XM_027627148.1"
                     /db_xref="GeneID:38737287"
     CDS             complement(886523..887419)
                     /locus_tag="MRET_0521"
                     /codon_start=1
                     /product="plasminogen activator inhibitor 1 RNA-binding
                     protein"
                     /protein_id="XP_027482754.1"
                     /db_xref="GeneID:38737287"
                     /translation="MSVASNNPFQLLGVDGAEDVPSQQASSQAAAKKPQQPQQQRYVP
                     GAPRQSAPKSAPAPMDEEPPLSEQRDSRAERRSRGDRGRGGRGGRGSQRGRGRQFDRH
                     SGTGREETAKSQRQGWGGTDGASAVKLEKDSKEDAKEDAEEFAKEDAADVKAEKEAQQ
                     PVQDNTLTLDEYLKSQAEKRPQLAASAPRTVQEDESYGQRLERGEGESYFAGQEKKSQ
                     APRPRKEKQLVEIDLPSYASESTPSTRGSGRGGRGGARGGRGGRGAGRGGNRGERSNR
                     SRGGRQGPVVNLADEQAFPSLS"
     gene            complement(<887895..>888680)
                     /locus_tag="MRET_0522"
                     /note="MRES_01315"
                     /db_xref="GeneID:38737288"
     mRNA            complement(<887895..>888680)
                     /locus_tag="MRET_0522"
                     /product="small subunit ribosomal protein S3e"
                     /transcript_id="XM_027627149.1"
                     /db_xref="GeneID:38737288"
     CDS             complement(887895..888680)
                     /locus_tag="MRET_0522"
                     /codon_start=1
                     /product="small subunit ribosomal protein S3e"
                     /protein_id="XP_027483025.1"
                     /db_xref="GeneID:38737288"
                     /translation="MASAIISKKRKFVADGVFSAELNEFFTRELAAEGYSGCLVRVNH
                     VRTEIIIRATHTQEVLGDKGRRLRELTSLVRQRFRFPEGSLELYAEKVANRGLHAVAQ
                     CESLRNKLLGGLPVRRAAYGVLRYVMESGAKGCEVVISGKVRGARAKAMKFKDGFMIH
                     TGQPAKDFVDEAIRHVLMKQGVLGLRVKIMHGWDPEGRSGRPFPLPDAVTILEPKDDE
                     PISAPMSESRNQPVAAAPAAEPAAPVQPQETTAYTQAPHAAAF"
     gene            complement(<889376..>892123)
                     /locus_tag="MRET_0523"
                     /note="MRES_01310"
                     /db_xref="GeneID:38737289"
     mRNA            complement(<889376..>892123)
                     /locus_tag="MRET_0523"
                     /product="dynamin-like GTPase MGM1, mitochondrial"
                     /transcript_id="XM_027627150.1"
                     /db_xref="GeneID:38737289"
     CDS             complement(889376..892123)
                     /locus_tag="MRET_0523"
                     /codon_start=1
                     /product="dynamin-like GTPase MGM1, mitochondrial"
                     /protein_id="XP_027483026.1"
                     /db_xref="GeneID:38737289"
                     /translation="MYRMPGRGGSSLRGTAIRPSVTPTITRRQIQTRALSTRSGMPRA
                     MLKLLRLPLAGVATAGGAYAYAHSKMDELKNTFHGFISSASDTATDLYDSMSEYSSSM
                     FESARGGLRSFMGRLEDIKKAEFWDQQPVGGNEEPPEEPDPQNDENGGGGLAAAAAAF
                     AASLSGSSEEEEEGEKQEEKQENTDDLMVLTRKLIEVRNILKTIDHDSDELVLPSIVV
                     IGSQSSGKSSVLEAIVGHEFLPKGNNMVTRRPIELTLVHVPKDHPPADGIYEYGEFPG
                     SGGGKITDFSRIQKVLYDMNMSVPQEECVSDKPIELHIHSPHVPDLSLIDLPGYVQLS
                     SMDQPEELREKIQNLCNKYIKEPNVILAVCAANVDLANSPALRASRKVDPLGMRTIGV
                     ITKMDLIDPTVGAAILNNNKYPLSLGYIGVVCKAPQQMSQSMFAYSRSRTLVQLTQEY
                     ERRFFDEHREAFEAPKRGRNAGIAPLVGTDQLRRRLMVVLEEHMGSSLSGVSNVVRSE
                     LDDAAYQFKVQYNDRSITPETYVAEVMDIMKQRFKLFANSFGKPEVRLLLKNALDDRV
                     MDILAQVYWSDTELPALTELGSHRKITQQDVDPAWLNKLDLSVSSLTKSGIGRMSTQL
                     VANTIRSQLEQLATAEPFNHHSETAERIITFGSALLRDRFAVTADQVENCIKPFKYEV
                     EMEPREWERGREQSVRLMQNELEMCNEAQDRLRKVIGSRRLRGAMEYIHQLEERERKR
                     VAERMEHANETGELDLEADDQADPTRPGFNAALLMKAREARFLQERSDILRLRIAALK
                     SRRCKAGPESQVFCPETFLNVVADKLTYMSVMFINIELLAEFFYQFPREIDARLGFDM
                     SHEDMVNFARENPAIRKHIDLQERKFKLEEVMIKLEELTRLYSEKQLPHRPASSKWFF
                     F"
     gene            complement(<892269..>893594)
                     /locus_tag="MRET_0524"
                     /note="MRES_01305"
                     /db_xref="GeneID:38737290"
     mRNA            complement(<892269..>893594)
                     /locus_tag="MRET_0524"
                     /product="3-keto steroid reductase"
                     /transcript_id="XM_027627151.1"
                     /db_xref="GeneID:38737290"
     CDS             complement(892269..893594)
                     /locus_tag="MRET_0524"
                     /codon_start=1
                     /product="3-keto steroid reductase"
                     /protein_id="XP_027483023.1"
                     /db_xref="GeneID:38737290"
                     /translation="MPRPILLVTGANAGLGLGVCERLLIQMASTVPPDSAMLDKPAHA
                     AASTPFHAGEGCTMLLACRNQAKARDAVLHLQAVLQRLYYTDDAYLEKHGVPKPASAL
                     DTSPGAEVATTSAVENASALLRRRDKTDERRSMPLDDRTRNARTLYRQSFCKGTHIEA
                     VPLDLASLASTKACVEAVKAKVPYLTHIILNAGGAAWLGIDWLGATWEILTNLHKAVT
                     IPSYKLQRSGDKSQDGFGWVWQINAGGHYVLTKQLEPLLIASPYTEPSRVIWTGSLEA
                     NEADFHANDLQCIDPHTSPRPYESTKYQCELLALGMDQRYASSQQTHMPRAYTAHPGI
                     VATSIFSGVIPAFMLIMMKLVFYLARWTLSPHHPIDVYKGAVAASYVAVAPGSYLDST
                     VRYGAQSTITGREYVHAGRVDGWDHDASRIMKRASDLVDAFDHWLQTCA"
     gene            <893626..>895176
                     /locus_tag="MRET_0525"
                     /note="MRES_01300"
                     /db_xref="GeneID:38737291"
     mRNA            <893626..>895176
                     /locus_tag="MRET_0525"
                     /product="RNA exonuclease 1"
                     /transcript_id="XM_027627152.1"
                     /db_xref="GeneID:38737291"
     CDS             893626..895176
                     /locus_tag="MRET_0525"
                     /codon_start=1
                     /product="RNA exonuclease 1"
                     /protein_id="XP_027483024.1"
                     /db_xref="GeneID:38737291"
                     /translation="MLPVRGLLHDVVCPSFRDGECEKKRIGCVFSHDTSLLPVRPHQP
                     EPEKRPVKKPRVGMTEPPRITSAHHSSTSKLTLAQRQDGLKKMYTSLRRFYAPLFDHS
                     EPALQHLGADMATNDALRMEQDVFQHANEFSYKSSSIVGAASVTKRSSEVLAASVAEA
                     AQALSINKNATDEAARILEACTETGTETDVRLKRESQQQRKKGRLTRERLVKAGFLCP
                     KGDLEQLGYLMDVPSEWGPGGEAADASGEKQTCVRCGVVFKVGPLGAVQSAEACHFHP
                     GRPRRERLGETTRSRKVFRWTCCGRTADSNALGEDRCATGPHVFKEETPQAMHRRAGY
                     VRWSDIPSAAQEASEVLPVAALDCEMSYTTAGMSVTRVTLVDETGDVLFDEMIRCPEG
                     VSMIDLNTQFSGIQAEAYEAEAVFDLDSARKTLAQYIGPHTILIGHGLENDLHALRLL
                     HTNVVDTCQLFPHPRGLPFRLALRDLVSQHLGKLIQTGGASVGHSSAEDAQMTLELVR
                     WKWMNRYT"
     gene            complement(<895173..>895748)
                     /locus_tag="MRET_0526"
                     /note="MRES_01295"
                     /db_xref="GeneID:38737292"
     mRNA            complement(<895173..>895748)
                     /locus_tag="MRET_0526"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627153.1"
                     /db_xref="GeneID:38737292"
     CDS             complement(895173..895748)
                     /locus_tag="MRET_0526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483021.1"
                     /db_xref="GeneID:38737292"
                     /translation="MFKRLSKASAHREQVDNDEEYVPLDAALDDDSQSEEEQADSEEE
                     EDDSDEEEEDETALTVAHAMESPIYMDDEQPESPYRFRCVACPIVLLKSEKSIDVHLE
                     SKNHKRRHARFVAFAKTEMEREGAHVMRIDPRTLVDLLEDQRAMEAKQARQEVPTKRK
                     RDTSHVPRVERRKMRRAVRRERRELERKTSA"
     gene            <895829..>896764
                     /locus_tag="MRET_0527"
                     /note="MRES_01290"
                     /db_xref="GeneID:38737293"
     mRNA            <895829..>896764
                     /locus_tag="MRET_0527"
                     /product="MAGE family protein"
                     /transcript_id="XM_027627154.1"
                     /db_xref="GeneID:38737293"
     CDS             895829..896764
                     /locus_tag="MRET_0527"
                     /codon_start=1
                     /product="MAGE family protein"
                     /protein_id="XP_027483022.1"
                     /db_xref="GeneID:38737293"
                     /translation="MSQHDAWIDALTQGTQEFGASARKAAQHVGETNITKKAQDLVRL
                     ALFHEYERTPIRRDHIIKHIIGKEASRAFPIIFCQAQNILRTTFAFELVEARGRGTEN
                     PLLTQQEAALDERVGSKRRRTDETVRKASTSTHTYILRSTLPPDILKVMASDESGDPV
                     LDWDTSEGELGTMGLLFVVLGIILVSGRQAPDTRIRACLAQVSLSIDRVMPMSLQPLE
                     AGTSDHASRHTLDMFFQRAMRQGYLERVRAADTSQQTSALEWRWGPRSEVEMGEHAVA
                     SFMAELYGQIKSESSEPSVSILKRIERAAGTSLVG"
     gene            complement(<896768..>897532)
                     /locus_tag="MRET_0528"
                     /db_xref="GeneID:38737294"
     mRNA            complement(<896768..>897532)
                     /locus_tag="MRET_0528"
                     /product="phospholipase carboxylesterase"
                     /transcript_id="XM_027627155.1"
                     /db_xref="GeneID:38737294"
     CDS             complement(896768..897532)
                     /locus_tag="MRET_0528"
                     /codon_start=1
                     /product="phospholipase carboxylesterase"
                     /protein_id="XP_027482776.1"
                     /db_xref="GeneID:38737294"
                     /translation="MEPKFKRPVASSRALAAFTKGTQLEIQYAGAPSGVDANLLVLLH
                     GLGDTSKPFFRLGEQLQRTLPQTAILSVQAPIRVPLLDEDAWMWWDSFDSLGEVNMRP
                     DPRHALRDMRNLFAYLTEPDTTGGCGWSMQHIHAFGFAQGGTVLLESLAAMRAQTLGS
                     ATSVCGPLLSLPTYTPPLPIPVCFVTRSLGASSATREDIRAVERGFRNVTHVHYNAPN
                     MGMIQGKEWGDIMRFWSPRWRNLTMWELEGEVHEVS"
     gene            <897779..>899168
                     /locus_tag="MRET_0529"
                     /note="MRES_01285"
                     /db_xref="GeneID:38737295"
     mRNA            join(<897779..897814,897936..>899168)
                     /locus_tag="MRET_0529"
                     /product="HMG (high mobility group) box protein"
                     /transcript_id="XM_027627156.1"
                     /db_xref="GeneID:38737295"
     CDS             join(897779..897814,897936..899168)
                     /locus_tag="MRET_0529"
                     /codon_start=1
                     /product="HMG (high mobility group) box protein"
                     /protein_id="XP_027482777.1"
                     /db_xref="GeneID:38737295"
                     /translation="MEHAGNTLISCMPSQKDSLDTHRWKGTSPKAPMSLSPMTPGHTA
                     SSLLRQEDVNMKTQLENMSIQAASHPICAPGDISYMVTPSLPVPCLLPSFMPRATCTS
                     VPTLPPTIMSSTITPTFGPLQMSNAQGMPGPIPLDTSPLCPSITPVTPMMQPPFSVGL
                     VSPFDFVHMGPESTSLKHSGAPPASSFKRRRGRPRKESLPDHEAAIKRAIKAGEPLQE
                     ALQMTKGPPLKSRLRPPKQPLTSWQLYFMDEFDKLKTCSHRESINVAKLSSEAGQRYA
                     NLPDDVKQVYVQRGQEAREKYEKDLAAWHAQLTPEDIRLENQFRAAQRRLGKSRRGNM
                     RDPNAPKRPPPAYFLFLRAVRTNPDMRSDVFHDERDSLKQSALASAKWRSMSLEEKRP
                     FYEQAEREKAEYVRQRREYEESHSKSKDVI"
     gene            complement(<899196..>900032)
                     /locus_tag="MRET_0530"
                     /note="MRES_01280"
                     /db_xref="GeneID:38737296"
     mRNA            complement(<899196..>900032)
                     /locus_tag="MRET_0530"
                     /product="26S proteasome regulatory subunit N12"
                     /transcript_id="XM_027627157.1"
                     /db_xref="GeneID:38737296"
     CDS             complement(899196..900032)
                     /locus_tag="MRET_0530"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit N12"
                     /protein_id="XP_027482979.1"
                     /db_xref="GeneID:38737296"
                     /translation="MTIDPELQSAHAALVQQFDAVNGAQSNDNNVLASIGSQLAMLKV
                     MLTERDILYPQQSDVQQHKDALVLTREVLEIGALWSIRVQDTSSFDRYWSQLKPFYFD
                     LVHALPLSKNYEPIVGLSLLRSLSSNSIASFHIALESLPMELVRDSPYIQHPVLLERW
                     LMEGSYSNVWRERENVPLEEYRFFVNILMVTIRHEIASCEEKAYDTLPLNDVATLLFL
                     DSLPEVLEFAKERGWHVNPTNQTIEFANKAVEPTSDNERIPTRSTITTNLHFARELES
                     IV"
     gene            <900144..>901022
                     /locus_tag="MRET_0531"
                     /db_xref="GeneID:38737297"
     mRNA            join(<900144..900267,900293..900352,900378..900548,
                     900577..>901022)
                     /locus_tag="MRET_0531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627158.1"
                     /db_xref="GeneID:38737297"
     CDS             join(900144..900267,900293..900352,900378..900548,
                     900577..901022)
                     /locus_tag="MRET_0531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482978.1"
                     /db_xref="GeneID:38737297"
                     /translation="MRGVSRHGVDALPIIRRSKTHGGRSKKLICELEASLLTNPFVHM
                     LATPLRRCFVTTATLPNALLIKLKPVFMPSADGTSLEETIVPEGLLHPRFESQRTSPG
                     MYITADRFVFQHLVKKRLYRAMAPNATISPHLESLITHQLMQRVNQEAELLCKRAQTG
                     ALVRTVDAQPVALLQETEGTLCRQWTPGLRHVPTYALPRLMQDARLRDTLLDHLTRAS
                     RTNRGWVLTSTDGIRTWHLQRHQHTTSMAVALWRLAAWNDSGAKLSPV"
     gene            complement(<901067..>901508)
                     /locus_tag="MRET_0532"
                     /note="MRES_01275"
                     /db_xref="GeneID:38737298"
     mRNA            complement(join(<901067..901330,901368..901396,
                     901430..>901508))
                     /locus_tag="MRET_0532"
                     /product="cytochrome b5"
                     /transcript_id="XM_027627159.1"
                     /db_xref="GeneID:38737298"
     CDS             complement(join(901067..901330,901368..901396,
                     901430..901508))
                     /locus_tag="MRET_0532"
                     /codon_start=1
                     /product="cytochrome b5"
                     /protein_id="XP_027482981.1"
                     /db_xref="GeneID:38737298"
                     /translation="MTRQITYAELCQHKSEEDLWLAINGKVYDVTKFLSEHPGGDEVL
                     LTEAGNDATEPFEDVGHSEDARSQLDKLFIGTLADPENLPKRAGKASDMASEGSSSAL
                     YIALIAGLVAVAGYFLLNKSK"
     gene            complement(<901714..>903825)
                     /locus_tag="MRET_0533"
                     /note="MRES_01270"
                     /db_xref="GeneID:38737299"
     mRNA            complement(<901714..>903825)
                     /locus_tag="MRET_0533"
                     /product="pyruvate dehydrogenase phosphatase"
                     /transcript_id="XM_027627160.1"
                     /db_xref="GeneID:38737299"
     CDS             complement(901714..903825)
                     /locus_tag="MRET_0533"
                     /codon_start=1
                     /product="pyruvate dehydrogenase phosphatase"
                     /protein_id="XP_027482980.1"
                     /db_xref="GeneID:38737299"
                     /translation="MHMHGALRHRACAPASVRAFSSISCSARQSTPRIAATAGRSPAS
                     STNDAYHRQRRAEWIIVGVAGSAAAFGTWYYWNRRESRQMNETRSKFSLSSSTPTSFT
                     IPVRSKQTGQPHFRVITPLTEEQVNARLRENENSTLVDRPAGACLVARYDTNSVASNA
                     SNEDRHAEVIVERDRGINDPPQHGLRETTDAQTAAPVRGDLCFFTVMDGHGGDFTSQV
                     LSRKLVAFVALELDKVFKETGEYAHMARSKVSTMSTLWNSLLGSNHHHVAALDGDPDI
                     VKRALIKGFRGLDKEITNTPLELLKQYELSLASVSKHHNTSDDAHSLSSLAHSIWPSS
                     LGQPKNTSFSTMSQGSAYESILPAISGSCALMVYVDSARRDLYVASTGDSRAVAGYWD
                     ERAGRWEVEALSVDQTGRNLAEVRRIQREHPPDEAAFVIQRGRVLGGLEPTRAFGDAR
                     YKWDRQTQKRIAEAFLPEKYRRMTPAALKTPPYVTAEPLVQWRRIAPFQDALTPAYAS
                     ASKSGASLSPAATTPVSASSSRELRFIIMATDGLWDLMSNEEAVGLVAGHLAGMRGSV
                     RADKLQRLCFQPQSKSNTAAMPASSSNETLEQVQHGPSHPLLKSPNHQQTFTFEDDNL
                     STHLVRNALGGAARERVAGLLAIPSPESRRFRDDITVNVILFHAATTSTPNERSTEKG
                     TTTPTSPTSLPPSPSPMTAKL"
     gene            <903971..>906403
                     /locus_tag="MRET_0534"
                     /note="MRES_01265"
                     /db_xref="GeneID:38737300"
     mRNA            <903971..>906403
                     /locus_tag="MRET_0534"
                     /product="vesicle-fusing ATPase"
                     /transcript_id="XM_027627161.1"
                     /db_xref="GeneID:38737300"
     CDS             903971..906403
                     /locus_tag="MRET_0534"
                     /codon_start=1
                     /product="vesicle-fusing ATPase"
                     /protein_id="XP_027482975.1"
                     /db_xref="GeneID:38737300"
                     /translation="MAGFFRSDKSTSGDLRSIYGGGAGVGDSVRNRPTPSYSTPLASQ
                     ARVPVPSLGATAGGGASVSAPRAPPVPQRATPAMHSAELRQPHMFRIVKSPPTLNTTN
                     CVILNPQEWGSTRYVLLSGRFAFTAIPDNTNTIAPGTIGTALLQRQWARLSAEGHDVV
                     VEAFEPSVLGKGVYLGSLDIELDFLSRSQMPMAPFSADEMQAIFVRVFEAHVLSTDQM
                     LVFEFHGQNLKATVRGVYSVDTSAPHHMGVVIPQTQVNFFVANGSALEIKASGKRARP
                     NAILQPNFKFEDMGIGGLDTEFSAIFRRAFASRIFPPDLVDKLGIQHVKGIVLYGPPG
                     TGKTLMARQIGKMLNAREPKVVNGPEVLSKYVGASEENIRKLFAEAEAEFKSKGDESS
                     LHIIIFDELDAICRQRGSTGGGTGVGDTVVNQLLSKMDGVDQLNNILIIGMTNRLDML
                     DEALLRPGRLEVHMEISLPDEHGRLQIINIQTSKMRSNGVMDDDVQLSELAALTKNFS
                     GAEIAGLVKSATSFAFNRHVKVGTMAGISDDVANMRVNREDFLCALEEVKPAFGVAEE
                     ELQQVVRNGIMHFAPHIDAILRDGRLRVEQVRTSERTSLVTALLHGPAGSGKTALAAT
                     IAMQSEFPFIKLIAPETMVGMNEHAKIAYLNKVFNDSYRSPLSIIVVDSIEKIIEWVP
                     IGPRFSNPVLQALSVLLGKQPPKDRRLLVLATTSNKAMLNDMDMADAFLADIRVPDIT
                     SLRSVDHVLRETQLFATQEEHARCLELLTKAGLGTQGRIQIGIKKLLSEIEMARLDDD
                     PADKLTAALNFM"
     gene            complement(<906408..>908716)
                     /locus_tag="MRET_0535"
                     /note="MRES_01260"
                     /db_xref="GeneID:38737301"
     mRNA            complement(join(<906408..908629,908654..908671,
                     908698..>908716))
                     /locus_tag="MRET_0535"
                     /product="vacuolar import and degradation protein"
                     /transcript_id="XM_027627162.1"
                     /db_xref="GeneID:38737301"
     CDS             complement(join(906408..908629,908654..908671,
                     908698..908716))
                     /locus_tag="MRET_0535"
                     /codon_start=1
                     /product="vacuolar import and degradation protein"
                     /protein_id="XP_027482974.1"
                     /db_xref="GeneID:38737301"
                     /translation="MFMLKSLFGKMWSDKDNIELVQLPSGSLFVMREDRRECVYERAV
                     ATIRRSSVPFQYVLAITPHMEDKEEEDAAIEETTFLIDEALAFRTSVRDQTPSFVWRD
                     VQGESFEFVVDTAMCNSVMRSVFEVTYLQCAWERKTGQSHELATDEDLERLKPGETSM
                     PTANAGAPTRAPPAESLQSVTGTQEPTVVLTATADLYLYDQASGLFMRQEKHVTAKVA
                     EVGRFLYWMVVDGAESPWLSQGVDSRMNMNFSLENLSAVWNYYDEQRHVYSWLLRFGE
                     KAAYHAFQETFSHLLWETLHEEKWGKASGAEQQYLEQAYEQDVAMTDDEGESHQRTLL
                     SPRHTAALSEDESDVDAIEAQLDPMDEEEEESVEAATQVDDVAPVMPDMGRQERNSAL
                     AVGYKSDRAFVVRGDKIGVFKHTDDDTLEFSTAINRISTPQGRSFVPQRVMLHDQDTD
                     MVLMDPSNKHTLYRMDLEYGKVVDEWHVHDDVPVNNILPTSKYAPMTAEKTFLGTSRN
                     GIFRIDPRLRDQTLVDSQFKLYATKHDFSAAATDASGRLAVASNKGDLRLFDNQIGKN
                     AKTALPSLGDPIIGVDVSADGRWVIATCRTYLLLIDTLIGEGRYQGHLGFDRAFPADS
                     RPLPRRLQLRPHHVAYMDSEVRFTPAHFNTGSDAETSIVTSTGNYVVSWSFEAVKHGN
                     PYAYVLKRYGGTVVRDDYTYGSDQSIVVAFEDDVQLAKRAQLRKPTRASLAPAATQPR
                     TSAGRLRRQTQA"
     gene            <908800..>910584
                     /locus_tag="MRET_0536"
                     /note="MRES_01255"
                     /db_xref="GeneID:38737302"
     mRNA            <908800..>910584
                     /locus_tag="MRET_0536"
                     /product="translation initiation factor 3 subunit D"
                     /transcript_id="XM_027627163.1"
                     /db_xref="GeneID:38737302"
     CDS             908800..910584
                     /locus_tag="MRET_0536"
                     /codon_start=1
                     /product="translation initiation factor 3 subunit D"
                     /protein_id="XP_027482977.1"
                     /db_xref="GeneID:38737302"
                     /translation="MTSFSLPVMAADSEFWGPPAGPSAASVLPKEFQQIPYTPFSKSD
                     RIGRIADWNSFGTNAEDRSGASANPGRAARSARSAAAPSYPAGAPVNTFAYFHGEDES
                     SFSVVDHARSAPPRRSAVSAAARGGRGAATGGRTGGFGRGQSAAGGRGVRGSAGRAGA
                     ADSRNRRPGWRDWERSQRKTREASITVGPDWEQLGELDFVRMVKLRMEVDAPEDVASY
                     GTLYQYDRSYDRVSVRFEKPLQPRDRVHYNPTTSEDPVFHELATQSSKPQVFITDSIL
                     ALLMCAPRSVYPWDVVVTKTDDGQLFFDKRANSAIDFLTVNENATEPPMELNDPANGP
                     TPETNTRARINTPGTLSLEATFVNENFGYQVCDESKTYSFEHANPFHALDGEEGKLAS
                     CGYRYRHFNLSTDENDPVDMVVRTELNAYVAGASDKKPPSQLITIRTLNEFDSRAPGA
                     GGAPDWRARLDQSRGAVVATEMKNNSFKLARFAVQSILAGADNMKLGFISRMNPLDPY
                     RHTILGTAWFKPRELAAQMAYNLSNGWGIVRTIIDVVRAQPAGRFVLAKDPNKQVVRF
                     FKVPWDFDQQDEEEEPEEEEEEEAQEEE"
     gene            complement(<910597..>911184)
                     /locus_tag="MRET_0537"
                     /note="MRES_01250"
                     /db_xref="GeneID:38737303"
     mRNA            complement(<910597..>911184)
                     /locus_tag="MRET_0537"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627164.1"
                     /db_xref="GeneID:38737303"
     CDS             complement(910597..911184)
                     /locus_tag="MRET_0537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482976.1"
                     /db_xref="GeneID:38737303"
                     /translation="MPRKRAKHSVRVANRDAMEHNLPPDNKRRGEWGDMPRRAIELFR
                     GPPPKKEAAPANATNTSIPPMHIRPGERLSDFNQRVEQEFAHDIYSSMRTNQRSESNQ
                     KKRQRRRDILKAKKRAASGSDDEDDEAAAQREFARAPSSRSLHDVALAPPTITARPKE
                     RRPTSTRPKPSPARQRILDEERQRVIELYRAQKRA"
     gene            complement(<911238..>913088)
                     /locus_tag="MRET_0538"
                     /note="MRES_01245"
                     /db_xref="GeneID:38737304"
     mRNA            complement(<911238..>913088)
                     /locus_tag="MRET_0538"
                     /product="CDP-diacylglycerol---glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /transcript_id="XM_027627165.1"
                     /db_xref="GeneID:38737304"
     CDS             complement(911238..913088)
                     /locus_tag="MRET_0538"
                     /codon_start=1
                     /product="CDP-diacylglycerol---glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /protein_id="XP_027483199.1"
                     /db_xref="GeneID:38737304"
                     /translation="MLCARVALPYVACFASPRPTYPTVLARNAGLRPLLPVRRSMATA
                     SRTPHSPPASQHVPESVPHDQPFLLPEIVSEALHVPMFSASAHSMVRVPSPRQFYSTL
                     RHHIMKAQHRIFIATLYVGKEERELAMFLTKALARRPQLQLTILMDAMRATRESPQSA
                     SSASLLSHLASMFPDQVDLRLYATPVLRPNSIASRIIGKRFNEGFGLQHMKVYGFDDD
                     VIITGANLSRDYFTRRMDRYLLIREHKPLANYLHALILLLSRFSYALLYDGDPSLLSH
                     VKGHIEDMDDSSSDYVQLTRSAFRLHWDGGSDLLLAEDTDGTIATAGLCPSTRACLET
                     NWRSSATQALQDFTMRWYERAKAQRPASGDTRIVPLLQLGQLAITQETDMIPILTQYL
                     SALSPRALGPTAARPYTTVDLTSGYFTLSGLYKSLVLSDAIHRHSQAPVFFRLVAASP
                     EANGFFGSRGLSGRIPAAYTLLEKLFWNRVVDKQLHAPVHPYVDVSDPISEGPLAPVE
                     LREWSKYGWTYHEKGLWITGPSLAQPVLSPATTLIGSSNYGARSEKFDVECSLLITTQ
                     SPQLQDTLAKEVQEMRESARTRMDTATFRSKERRVDAVTQVLTRLLRPLL"
     gene            complement(<913215..>914024)
                     /locus_tag="MRET_0539"
                     /note="MRES_01240"
                     /db_xref="GeneID:38737305"
     mRNA            complement(<913215..>914024)
                     /locus_tag="MRET_0539"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627166.1"
                     /db_xref="GeneID:38737305"
     CDS             complement(913215..914024)
                     /locus_tag="MRET_0539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483198.1"
                     /db_xref="GeneID:38737305"
                     /translation="MYKDKRIHLIKLAADGVLNSHAQVESGPMPPSGHAQAPTQVALT
                     ADNLEQIPEAEQLAPGIRLGEPILGDRVEELYASPSLSSTAMHMDARSDSMDQTSVPP
                     ELDPRTSQFRPGIPSAGSVFSVAVQPGSPKSVTFDDRVHDTSHVPSHGSESVFSSRST
                     TPAHSTGLPSGSNSRADSISVTHSDMSNMPSDTHAMNTDTREKNSATELQHPRERVGD
                     ELNNPPLSRRQGSVNQPHRTLSTCTTVGSSPAASVMDGDKEVPSSPIPKSS"
     gene            complement(<914173..>914985)
                     /locus_tag="MRET_0540"
                     /db_xref="GeneID:38737306"
     mRNA            complement(<914173..>914985)
                     /locus_tag="MRET_0540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627167.1"
                     /db_xref="GeneID:38737306"
     CDS             complement(914173..914985)
                     /locus_tag="MRET_0540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483260.1"
                     /db_xref="GeneID:38737306"
                     /translation="MMDSLAPPAHPLRLYPPDMVLGRIFAPSPILGEHGAQFAPLDHG
                     MSSQGATMHMEPSVLQEKLHSDLSPVEQMSSGHNAKSSLMNGRWSKSLLRVTRLGEIK
                     MSTVKPIHPIGRKHGSIRVKTQSVQAPGEAAVSNEDFSVMPGGIPLRAETPLCTRIAR
                     SASRKSQRPRRKPAPQVDEFACTPLPAEPLQTKTFDPSTVPPPRPPKHPLRHLHLATV
                     EPGPSLPNQLAGLKPLRHPSPTIYEAMHASDNDMPALMSDGDTDSLSSLDAP"
     gene            complement(<915150..>916545)
                     /locus_tag="MRET_0541"
                     /note="MRES_01235"
                     /db_xref="GeneID:38737307"
     mRNA            complement(join(<915150..915362,915397..915499,
                     915527..>916545))
                     /locus_tag="MRET_0541"
                     /product="tRNA (adenine-N(1)-)-methyltransferase
                     non-catalytic subunit"
                     /transcript_id="XM_027627168.1"
                     /db_xref="GeneID:38737307"
     CDS             complement(join(915150..915362,915397..915499,
                     915527..916545))
                     /locus_tag="MRET_0541"
                     /codon_start=1
                     /product="tRNA (adenine-N(1)-)-methyltransferase
                     non-catalytic subunit"
                     /protein_id="XP_027482938.1"
                     /db_xref="GeneID:38737307"
                     /translation="MDESTKPEHDAHTERHDDEQARKRPRYAAPFVPTNAQLRERTTI
                     LLPGMNVYLRLPSGMMKLVTLEKGSTISIGKFGSFEADHIIGKPFGPTYEIKPDGSLD
                     IMHQAVAEALVESEATNENIFDDGESQSLTYEDIKALKEAGATGREIIQKQLEGNKSY
                     EMRTVYSQTKIMKRKESKHLKYFTPLTPDMFHVALYNFDRNPDKIRNMRADSLAQCLS
                     FSHVQPGGKYLVIDGIGGLLVGAVLERLGGFGSVHLIHDSDSPPALELMPQYNLMPFQ
                     THNVLKTLHWAATEKRWTLPSHMSEELSRVYTSDRERNRARKKRANIEDFIATRQQFF
                     EGEFDAVIIACPYEPYSIIHRLTPYLAGSANVVVHSPHLQPLVEAQARLRASHSFINV
                     SVTEPWLRRYQVLPARTHPDMSTSASGGYILHAIRILDDVESDSTSANGPIL"
     gene            <916648..>917056
                     /locus_tag="MRET_0542"
                     /note="MRES_01230"
                     /db_xref="GeneID:38737308"
     mRNA            join(<916648..916704,916730..916833,916858..>917056)
                     /locus_tag="MRET_0542"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627169.1"
                     /db_xref="GeneID:38737308"
     CDS             join(916648..916704,916730..916833,916858..917056)
                     /locus_tag="MRET_0542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482939.1"
                     /db_xref="GeneID:38737308"
                     /translation="MASAPGASAHAIDHDPEFQSGIQVILEQLRAQGASDEEIERTME
                     QAKQFYLQQKDARASEMKQTSESEQYPPSFHAIVELIATGQESQIPGIRDIPLKINPA
                     PPSESKMECPKKPWESC"
     gene            <917194..>919461
                     /locus_tag="MRET_0543"
                     /note="MRES_01225"
                     /db_xref="GeneID:38737309"
     mRNA            <917194..>919461
                     /locus_tag="MRET_0543"
                     /product="U3 small nucleolar RNA-associated protein MPP10"
                     /transcript_id="XM_027627170.1"
                     /db_xref="GeneID:38737309"
     CDS             917194..919461
                     /locus_tag="MRET_0543"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein MPP10"
                     /protein_id="XP_027482940.1"
                     /db_xref="GeneID:38737309"
                     /translation="MPAIEETLSQRLSTEPHLLAKGDSLLNQLARDTTKSLYDKGVQE
                     EKASLPYISALLDACVPRGQQSGKRKRANDGIISQHPLFPPTELNELVLEGMGNDQIW
                     HQLELRSAKLARVLDHVISSGPEDADEEESEEENEKDADDLPDDDEAWDEEDDEEEES
                     DEGFAGASDLSDVDPNEVYYEPLHTEEMQHMRKEEKERQEMMQMYGVSDPALYDALTS
                     ASSDDDEEEEEDKEKPRHPTLDDDFFSIDEFNRLTEAQERQEHSSRAHLSGEEEEEDM
                     DGIDLFAPVDEDEGEDEMDVSEIRYADFFDPIKKTRPAKSVDASPPRTPQVRFHDQVR
                     VRPIKKAKSQSLAGLLTDGDDEEDEDGEEEGEDDNDEEEEEEDDDDEDEEGEEEDDDE
                     EDEEGEEDDDDDDEEEEDEGEEDEEEEADEGMDGDAAEATAGRVAQDLFAEEEQEAPS
                     SMSRYEQHQAELAEEIARYEDENVREKDWVLMGEASTRQRPVNSLLEEDLEFERTAKA
                     APVQTHEHGEGIEAMIKRRILDRHYDDVVRQRELEALPFAASSMLELSDTKSAKSLAE
                     LYEEEYQAARGEEAGDGAPRSEADVKLDNDHAALAADMDTLFSKLDALSNAHYTPKAP
                     KAAIQTVSNTPSMAIESALPTTMSAGSMLAPEEVYERPIHSAALEGDKSEMSHAEKQR
                     LHNKLRHEKRRRNDRIKRTEEAIQRQRGDGPRSKSETKADKDKALKSLVGHKGVTVVG
                     KEKREKKKAPASWKL"
     gene            complement(<919462..>921789)
                     /locus_tag="MRET_0544"
                     /note="MRES_01220"
                     /db_xref="GeneID:38737310"
     mRNA            complement(<919462..>921789)
                     /locus_tag="MRET_0544"
                     /product="bifunctional dethiobiotin
                     synthetase/adenosylmethionine---8-amino-7-oxononanoate
                     aminotransferase"
                     /transcript_id="XM_027627171.1"
                     /db_xref="GeneID:38737310"
     CDS             complement(919462..921789)
                     /locus_tag="MRET_0544"
                     /codon_start=1
                     /product="bifunctional dethiobiotin
                     synthetase/adenosylmethionine---8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="XP_027482941.1"
                     /db_xref="GeneID:38737310"
                     /translation="MASVARRVHQVFGADTDVGKTIFSTALLLASAARGSKVAYVKPV
                     STGAQQDMDARHVRTFAPQVPTRTLVQFSEPVSPHMAAAMQASPDEHVRDAQIVERLR
                     TWLHECGMEAAIVETAGGVHSPSPSGSSQADLLRPLRLPTILVGSSVLGGISSTRASF
                     ESLRMRGYDIDVVLMFTSPYYGNDTYLAQYFVEHGIPLFTIEKPPARVADTPTDVARM
                     QTYYQHTLTTMAEVVQYLADQHARRYASLDTLGMRAHQHMWWPFTQHTRVAPQDVTIV
                     DSAHSDFFEAHAPGQGTSPMMDGSASWWTQAVGHGHPRLALAAAYAAGRYGHVLSPSV
                     AHEPAVRLAERLLGHDSSATLAPGRGWASRAFFTDDGSTGMEVALKMAMQASVRRYTP
                     TVMSSATLARTAPGRRAGSLGGRQQREWHVLGLQGSYHGDTIGAMDACEPSVFSEHVA
                     WYRGRGYWLAPPALRMKEGKVRIEVPASDEWGESQCLGILPSIEAAYRMPARLQSELA
                     QRYVRMLNKRLEELVLVEGHRFGALVLEPLVMGAGGMIFVDPLFQRCLVDVVRSREDL
                     FSLSDPPLRDACVNRDADGWRGLPVVYDEVFTGLHRLGFAMGADVLGTPPDINCLAKI
                     LTGGVVPMSVTLASDSIFRAFAMSDQKTHALLHGHSYTAHPVGCQVTLETLDMLDEMP
                     TKASWDPAWLERMSHAKRLRGIMSLGTVLKLELESSTGGYASDAADDLLRTLRAGSFP
                     IHLRSLGQVVYIMTSLTTPADTLARIQTLLEHEFL"
     gene            <921916..>925257
                     /locus_tag="MRET_0545"
                     /note="MRES_01215"
                     /db_xref="GeneID:38737311"
     mRNA            <921916..>925257
                     /locus_tag="MRET_0545"
                     /product="AHNAK nucleoprotein"
                     /transcript_id="XM_027627172.1"
                     /db_xref="GeneID:38737311"
     CDS             921916..925257
                     /locus_tag="MRET_0545"
                     /codon_start=1
                     /product="AHNAK nucleoprotein"
                     /protein_id="XP_027482942.1"
                     /db_xref="GeneID:38737311"
                     /translation="MSAADQATDETSSAARPPLSESSVRKDTSRDKPAKPIMGAWSCA
                     SMTGPADTTRDSQPRDMYSEALLPWLHASHAFAGTDAGSKSLDEAAARPLPPLSMAMP
                     LGLGRPTTSSTADVLLHPASSGHSGLRRARTTADRPTASPPMRMSQDMSMLGAALNAP
                     ETSFRVPSIHELRINKAAAPSHDARFVSGASFVMSPDTAKHFDTATPPPPIMRPRFPS
                     AQGPIVYETHTWTVDRPRTVTSPLSTEADFSPPESWASANMDSADPSKFPHAAALWAR
                     LPDTYTFSPPLQPIHIVRGSPPTWASTSPHTTTSSTLQSPDLPTTTPGRRVEPHVPTT
                     DGPVPYSNEERPVYMSAAPRSEWPGDVSSPSDGGHDTTLIDWSDQQKISSVDQLLLKQ
                     SWSQLPVSDTHTTSWTAPLDLGEHASNEPRNTPPQPVRRRSSRKAPPLSLPLPPKVRT
                     ADVSDAASRQHEFDSSGVGDDSNASPDDAPPYVPSHDSEADALRAPHTGSVEAPPSEV
                     DAPPLMPALQYTLPFKLSSRRRYQPRNTWPSRPPTSPPGAARVPRPTVSDERDEDVVD
                     VGTARPSAPSIPLAPPSTTGYGVVQPALAPELCGPVHSIEGRRVEDDVGHTSHLSMLG
                     AVADQSQDFHFETYFEASLQRIREEMGRTATAPLAGAVPLQRTTENDFFHNAPPINVR
                     SLGSPVMALDEFSYVVDNDGAALLRTSTRPPSDVSKQVPELPPVDMYLPEEHEVMGDA
                     PRSSYDQRWTFPYMESPLIGERSEPMPTDAKLPLDFITKPNSVLSRGRPVKKTHPSMF
                     YASLPQSRRHRYRVAETGPASVLQDDEPAQDEEDVDDDPFSQSMMAPHTPAKPAIPSK
                     ATSPPAAPKATLLGDYAAPRPKPAARPKEAPRQAPPRTMPPPRSMSPPPTSSLGSATV
                     RTARDAPPPAPPPSAPLPPSPSLAARESEEKKAPAKDADKKFSAWLKRMVHAQGKESP
                     PERAASSSPPAAAAGPASERGSAPGGASPRTSTSTTQTHKYGRRIKRPGFEPTQPGKY
                     HLAGTVSLPTLNVARTAEQRARDETGLPETEPALIQSLLAAPSSSTVRARAGIINSIP
                     FVEEAVPPGQVLVAEERKVLVRPVM"
     gene            complement(<925271..>927241)
                     /locus_tag="MRET_0546"
                     /note="MRES_01210"
                     /db_xref="GeneID:38737312"
     mRNA            complement(<925271..>927241)
                     /locus_tag="MRET_0546"
                     /product="anaphase-promoting complex subunit 8"
                     /transcript_id="XM_027627173.1"
                     /db_xref="GeneID:38737312"
     CDS             complement(925271..927241)
                     /locus_tag="MRET_0546"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit 8"
                     /protein_id="XP_027482943.1"
                     /db_xref="GeneID:38737312"
                     /translation="MAHRFATLDGLDDLAPDRARCVLTHASKDLIDHGLLDAAQWCLE
                     LLTCVPDSHVHPTSTPRLGAGDDSHRFPVHSTPALNLESPSWNAHKMPEEGAPSWTSW
                     EHASPSGPSSRIIPSPARSMDPPTSPEASLHVKINEPIPTSFEEHFDATYMLAKTFFD
                     RDNYHACVSLLESQPHLTDKARFLMLYARLLIFDTHPSHPNALLPPLAYADKHDREGA
                     HPTLVSLLQELVSPTDPFLLFLKGVIFRMLHKRIDAMDCLISSVRAFPYNWSAWKELS
                     RTLNLKNAEREQILDLLPASFMSVFFLEYTQRQSTQIDDGHFERIDALLSHFPGSAYL
                     LTCRAQSLYLHQDLEEAADTFQHALELQPYRLDGISEYSNTLYVLDREDTLAQLVQQF
                     AHVSNSAEVWCMRGNFYNQRSEHFRAVESFKQALRMDRGCVAAWILLGHEYLEVKNSH
                     AAAEMYRRAIEMNPHDYRPWHGLGHVYELNEAWSAAIDYYQQCAMIRPYDARMWASLG
                     VCYDRLGQRAQAIECFKRHLACPLTHLESIEAIARIIELYEQDGDSVHATMYHCLLVQ
                     VVDRNMAQMDPALLARFVFSYIIAARWEMGELHGRLYYSRQDKQRGRVADTAAPAGDL
                     QRAHDYLQKVLLAGTDMTPVAEELLARLQKQI"
     gene            <927479..>929158
                     /locus_tag="MRET_0547"
                     /note="MRES_01205"
                     /db_xref="GeneID:38737313"
     mRNA            <927479..>929158
                     /locus_tag="MRET_0547"
                     /product="cytoplasm to vacuole targeting protein"
                     /transcript_id="XM_027627174.1"
                     /db_xref="GeneID:38737313"
     CDS             927479..929158
                     /locus_tag="MRET_0547"
                     /codon_start=1
                     /product="cytoplasm to vacuole targeting protein"
                     /protein_id="XP_027482944.1"
                     /db_xref="GeneID:38737313"
                     /translation="MSQKPNEKAQDATSHNFSSVLAASKQPVSSQDALNYPALHLYPL
                     NDTFVSKQINLAPTNSREHIKIGRYSNNKTVPSPVNGYFDSKVLSRAHAEVWYENDKV
                     YIKDIKSSNGTFINGTRLSPESQESEPFELHNEDVVDFGIDILTDDNKDILHRRVACR
                     VFLVMTPEDALKLRSDFTSLYRGGVHGGSLGNAGLCPGAEGGFRRNKSNVNVDQVIMR
                     LQSELQKSSMVGSDLHALGTSIQKIHDTLEGGAVPVQDAPYQELVPASAPHDHSSDST
                     KQVQLNPASAASLETQLANTHNVLASHVEKIKHLEETLASYERVKDEFSSLKCEVEEM
                     RLELQNQRRQEDSPKQTLDTLSGVRILEDGFDDATSVGSVETVVADASHSAMPDDTMT
                     DHSMDASDVTITKDEECVVPPSASTGSQDSAVMPALLSRIERLEKALQQQPQRLDPDA
                     SSEKTDFSFQEWKNNFERRWEEQTLGWKNAQQKINDAFESRSLSRTPKSSSFTSLLIW
                     LSKHDSEMSIMKVSIEFLCKLLFLVVSTIVGVVISLGMAKLLLPLIDVLYG"
     gene            complement(<929445..>929795)
                     /locus_tag="MRET_0548"
                     /db_xref="GeneID:38737314"
     mRNA            complement(join(<929445..929485,929528..929726,
                     929793..>929795))
                     /locus_tag="MRET_0548"
                     /product="large subunit ribosomal protein L38e"
                     /transcript_id="XM_027627175.1"
                     /db_xref="GeneID:38737314"
     CDS             complement(join(929445..929485,929528..929726,
                     929793..929795))
                     /locus_tag="MRET_0548"
                     /codon_start=1
                     /product="large subunit ribosomal protein L38e"
                     /protein_id="XP_027482946.1"
                     /db_xref="GeneID:38737314"
                     /translation="MPKQVQDIKKFLEIASRDDVKVARIKKTVLADRTVQTKFKLRAS
                     RFLYTLVVNDVEKAEKLKQSLPPTTKVEEIGAKRLK"
     gene            <930058..>930584
                     /locus_tag="MRET_0549"
                     /db_xref="GeneID:38737315"
     mRNA            join(<930058..930128,930224..>930584)
                     /locus_tag="MRET_0549"
                     /product="small subunit ribosomal protein S14e"
                     /transcript_id="XM_027627176.1"
                     /db_xref="GeneID:38737315"
     CDS             join(930058..930128,930224..930584)
                     /locus_tag="MRET_0549"
                     /codon_start=1
                     /product="small subunit ribosomal protein S14e"
                     /protein_id="XP_027482952.1"
                     /db_xref="GeneID:38737315"
                     /translation="MAPNQEVSLGPNVDDGKIVFGVAHIYASFNDTFVHVTDLTGKET
                     IVRVTGGMKVKADRDESSPYAAMLAAQDCAARCKEVGINAVHIRLRATGGVGPKTPGP
                     GGQSALRALARAGMRIGRIEDVTPVPSDSTRRKGGRRGRRL"
     gene            complement(<930886..>931496)
                     /locus_tag="MRET_0550"
                     /note="MRES_01200"
                     /db_xref="GeneID:38737316"
     mRNA            complement(join(<930886..930918,930950..930971,
                     931000..931141,931183..931231,931257..>931496))
                     /locus_tag="MRET_0550"
                     /product="nuclear movement protein NUDC"
                     /transcript_id="XM_027627177.1"
                     /db_xref="GeneID:38737316"
     CDS             complement(join(930886..930918,930950..930971,
                     931000..931141,931183..931231,931257..931496))
                     /locus_tag="MRET_0550"
                     /codon_start=1
                     /product="nuclear movement protein NUDC"
                     /protein_id="XP_027482849.1"
                     /db_xref="GeneID:38737316"
                     /translation="MTLDADEYSKLSLDEQNEYDTKQRKQEHAEQAALPYRWSQKLDH
                     VEVNVPVPSGTRARQVQVTFKSKALSVKVNETVFVEGALPKPVKVDECTWTIDGDILS
                     VHLEKANQNEWWPHVVTHHPKIDTSKIAPEDSKLSDLDGETRAMVEKMMMENRQKVCS
                     S"
     gene            complement(<931624..>934434)
                     /locus_tag="MRET_0551"
                     /db_xref="GeneID:38737317"
     mRNA            complement(<931624..>934434)
                     /locus_tag="MRET_0551"
                     /product="DNA repair and recombination protein RAD54B"
                     /transcript_id="XM_027627178.1"
                     /db_xref="GeneID:38737317"
     CDS             complement(931624..934434)
                     /locus_tag="MRET_0551"
                     /codon_start=1
                     /product="DNA repair and recombination protein RAD54B"
                     /protein_id="XP_027482848.1"
                     /db_xref="GeneID:38737317"
                     /translation="MATFSSEQAEEKLLSKFHTPVKRKHDDTRSSDVNTTQTGSSATP
                     ITPVPLLPSAQEPSYLCQWRAPQTRKHKTWEGDAILILHGNKTTCSLRSAHDGSMLVT
                     NAAFRRQHVHEGDEFYVAGKEIMVERPLTENRMDIVQPQNNGKSTAPIYRNKLSKSGL
                     AARQRPIPASQFYSTPNSSSFSPHNASSGGSILLQEPHPRYNPDVPGSVVFKRPNAKH
                     QELFGRKQPVVDVVLDPDLARILRPHQIEGVKFMYEAVTGISSLEQGHTTPGQGAILA
                     DEMGLGKTLQTIALIATLLRQNCYFSNIRPGTVEKVLIVCPLTLVVNWKREFRKWIGR
                     SSIGVLAVEGDGRKEVDRFVSHRQYQVLILGYERLRNCVQELSRAMPGVGLVVCDEGH
                     RLKSKDTKTTKCFDLLPTRRRILLTGTPIQNDLREFYTMVDFVYPGLFDQYSVFKRIF
                     EDPIMRSRQQYCTEETLELGKKRNKALMVITKGIILRRTADILKQYLPPRQEMALFCT
                     MTPIQKVMYGIFSEYVNHQLLLGESQTYLPYITLLRQLCNSPELILPDAEDLARNPGA
                     NDQALVKVTETILQTYTASIDPCLLSGKFLVLHRILSSIRKHTQDRVIIVSNFTSTLN
                     LLQRYCVRQKFPFLRLDGRTKADVRSKMVNEFNSDSGSDHLGKQPFVFLLSSKSGGVG
                     LNLIGANRLILFDSDWNPATDRQAMARIHRDGQLKPCFIYRLLLVGSMDEKIYQRQIT
                     KIGLSDSLMSNEAAKDHDVASSSDTFSQEELRDVFGYHPNTTCLTHDLLGCACGGNGK
                     EVQTPAEEPSKVENFTLPGFVSASKLPTENMLNEMHRKRLERQFVGYLHYDFQNHAQS
                     FEFDDILQHVAERQRLSTRTFTSNQDAMLNDMSIDLSQSDHGILQSLVNKHVGYLKTK
                     GVNEANGELSYVFIKPSDIQTQ"
     gene            complement(<934542..>936089)
                     /locus_tag="MRET_0552"
                     /note="MRES_01195"
                     /db_xref="GeneID:38737318"
     mRNA            complement(<934542..>936089)
                     /locus_tag="MRET_0552"
                     /product="outer membrane protein insertion porin family"
                     /transcript_id="XM_027627179.1"
                     /db_xref="GeneID:38737318"
     CDS             complement(934542..936089)
                     /locus_tag="MRET_0552"
                     /codon_start=1
                     /product="outer membrane protein insertion porin family"
                     /protein_id="XP_027482847.1"
                     /db_xref="GeneID:38737318"
                     /translation="MSAKDVMSDAAHALAPDPEEVNGPNAQKLENGGPNERDNEPPPP
                     PPQIHNLEKAMKQIQLPIIDPTDVPILRLHDILLYGVKDTRHDFLMALCRPYMDPAVA
                     TEPLAHMRYGHRLHFSKPGDTTTMPSILQLITSLSSDISRMELAKDISVQFEPLRSDK
                     HPTEDVDVILKIKPVSRFFLRTSTSVGNSEGTASVQGKLRNVFGGAETLEGSATLGTR
                     TKHSYNFVFSSPVLACPDFWANVSAISQHRDLTAFIRAHEGQHLLRSSLIYAKGDGAR
                     HELAYEASHRHFHHILPDASLSIRRLAKPSFKSAISYTFEQDTRDNTFATMVGSYFRS
                     FTEYAGLGGDTSYFKTDTQASVSDTFANGLTWSLAAKTGLLIPLNGCVPCLNDRFMLG
                     GPTCIRMFRLNSLGPKFRHDSLGGDAFWAVGASLLSPIPMRSHWPLKLHAFTNLGQLA
                     QVQPNAARKHHHWTELAQPSVSAGFGVLFQQGPVRLELNFGLPLVARVGDGIRKGLQF
                     GIGIDFL"
     gene            <936289..>937054
                     /locus_tag="MRET_0553"
                     /note="MRES_01190"
                     /db_xref="GeneID:38737319"
     mRNA            join(<936289..936312,936342..936428,936467..>937054)
                     /locus_tag="MRET_0553"
                     /product="DNA-directed RNA polymerase III subunit RPC8"
                     /transcript_id="XM_027627180.1"
                     /db_xref="GeneID:38737319"
     CDS             join(936289..936312,936342..936428,936467..937054)
                     /locus_tag="MRET_0553"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC8"
                     /protein_id="XP_027482846.1"
                     /db_xref="GeneID:38737319"
                     /translation="MFVLSEIEDIIKVEPRQFYKPSAKAILDQINIKYSNKILQDVGL
                     CICVHDILDSSEGRIRWGDGCLYYTVVFRLVVFRPFANEVLVGRISSSSSDSIRVTMG
                     FFDDIYIPPHLLPSPSAFDYQEQAWFWLLDPASDAHVADPLLSAPEERMYLDVGEIIR
                     FAIESDTFYDLEPGPAVGEGKLGDAPSGVGNIPGDSSSKRGNFASYKIIGSIAGQGLG
                     LVSWWAGAEQVSVE"
     gene            complement(<937121..>939043)
                     /locus_tag="MRET_0554"
                     /db_xref="GeneID:38737320"
     mRNA            complement(join(<937121..938551,938580..938660,
                     938693..>939043))
                     /locus_tag="MRET_0554"
                     /product="GTPase-activating protein SAC7"
                     /transcript_id="XM_027627181.1"
                     /db_xref="GeneID:38737320"
     CDS             complement(join(937121..938551,938580..938660,
                     938693..939043))
                     /locus_tag="MRET_0554"
                     /codon_start=1
                     /product="GTPase-activating protein SAC7"
                     /protein_id="XP_027482845.1"
                     /db_xref="GeneID:38737320"
                     /translation="MTSPREESFPPTAPRSWLSLFGSRTSLQSPREDQSTEQQPTVIF
                     GAPLRTALQYTTVPISLAKENGEQYVWGYVPALVAKTGLFLKQNGVEVEGVFRVGGSE
                     KRMRELQDIFNTPPNYGKDIDWTPFTVHDVAGVLRRYLILMPEPIIPHNLFKNFCRVL
                     ERGDLDLDTKLGRYRTLIKSCPQANQYVLLYILDLLALFKHHQAKNKMTAQNLAIVFQ
                     PSILNIQNLTSKSEHTLAVSVIEFLINYQDSFVLGLTPPPPSDKRPEELTTPSATHDL
                     EDYMIIPSDSDEEVGEYHVHIGGGAHLARSGTNLNAQSSALFARRERKQRMEQQRYMS
                     EHSKPPTLGSSDGDHASRQSPRLLRSFSQRRRANSHTDGKVDEVPMPSFKDQERNVSE
                     LNVTQPSHKSRDMNQGQLQQQHLERPSLSQRSISAHNVSHRESLRPTVTDDQVSRIND
                     DKRAQPSYTPTISAARLPSPKSEERPPLSPSIALFPPNELNPMSYLQTTSIRHAHPYV
                     ASARSLAEAPSQVPTNHGSFVYSDGTAQTQPLVRSVSADAAPPTQPAPIPFLGQSRAR
                     DTISLNGSDAIPVPHTSPQPPPTILPTSTTSAISDSTLQHAKVVLTISAQPESH"
     gene            complement(<939434..>943105)
                     /locus_tag="MRET_0555"
                     /note="MRES_01185"
                     /db_xref="GeneID:38737321"
     mRNA            complement(<939434..>943105)
                     /locus_tag="MRET_0555"
                     /product="vacuolar protein sorting-associated protein 8"
                     /transcript_id="XM_027627182.1"
                     /db_xref="GeneID:38737321"
     CDS             complement(939434..943105)
                     /locus_tag="MRET_0555"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 8"
                     /protein_id="XP_027482844.1"
                     /db_xref="GeneID:38737321"
                     /translation="MEAEASSSKWPFYATHRLRAPWNATGSTYSQLSDTVSIQSRDSR
                     PLSTSATTEDTLPPLDKEPIARPLFHFHALQKITRACREYGELTCLHVSGGLMAVGCA
                     TGVTVVFDMSQRQRCVCGVISNDAVTALSMNRDATYLGVGHSSGHLYLYDMYQPEEPA
                     RHVAPIDPALVELGKGEGHLENVPITHLDFVGARKTALMSADARGLCFYHSLGRMLGM
                     ASNDTLRLYGQYNAAASSPIYAAASLPLGTTRHVSDDHQFTALLLPHKLLLIGLQPSA
                     RTWYRVIAPTPCDTAALAWLPATHTDAEVHNPMLAYAFGDALHILHLGAVRVKPRTED
                     ERPTTGLRVQEDTLGVAPQPVVQLQWIHRQLLLVITTQTWHLYDMRYHCFTEWQPHDP
                     LVFMPSKPWPTMTVWRSKAFVLAQGTVYVGDFVAWDARLSQLEADHEFVQALAHALSL
                     YDGSALGSGIGLPPEPDQQKAVVARRIERLQREAVRHFGSFDADRFVRLCARAAVATQ
                     QFHVLFGDVYHVYEAHGQEALLVQHVEEYILHGQMRAPAPTIMQHLLSYRDRMQDYAH
                     IEELILHVDPLCLDLDRTLPLCTKHGLWRALAYVYDYVLQDRITVLALVLTHLDKHGE
                     ALFPILGAWLRGLRYPTLDACDDPAKVVLDVQSVLFSQHAYSAPDGTLIPVNDADPWP
                     YVRQLLAFDAASFLGVLDLALESDSDDHGTHQHVIQILLAVGDVVPTSARLFTAVFVA
                     RNAAKFPQFITLQDAEVAWLFDVLTQEKGDTDCEFALECLLSAHPISWDAAHIDRLER
                     AAFWRVYETSLRKTRRWDALLAFYARDQDGQHHAPGQLFHRVAELFTLPGLRRPAQRE
                     ALGPVWMACIHDVPDSLLGDVAHVVMQYWEHGQEQVLRELQKSDSPTRAYLYLKPFFP
                     LEHMTPHPPFLCTAWIDLVAQLSPALLVPLLDAYDPAYFDLEHVIRAAKEHRVYDACL
                     WCLDRLGRTHEAMEALDALISHVAQDTQRALDAPIDATTDSEAECIHEQTRQEFEYLH
                     MAVLMSVRLCVEHTTEPNATVDDARELWFRVLRALMQLEHSLVPLYASKHGPLQTYVL
                     KQSRALTQEALTTLITTVPSDMIALAHLFRRLIDSVSHTQEHRYSEVRVVVESMLAAY
                     RLRCDVLQLGVQLNEADTSRLFQQLAKERGWGWLVPSSLCSQCHDALYLTARHHNSVT
                     LHAQGYAYHTLCRCHDDPK"
     gene            complement(<943243..>945711)
                     /locus_tag="MRET_0556"
                     /note="MRES_01180"
                     /db_xref="GeneID:38737322"
     mRNA            complement(<943243..>945711)
                     /locus_tag="MRET_0556"
                     /product="AFG3 family protein"
                     /transcript_id="XM_027627183.1"
                     /db_xref="GeneID:38737322"
     CDS             complement(943243..945711)
                     /locus_tag="MRET_0556"
                     /codon_start=1
                     /product="AFG3 family protein"
                     /protein_id="XP_027482599.1"
                     /db_xref="GeneID:38737322"
                     /translation="MLTATLSRATARAASSSSAGLASVALGTRSPLRSIRHNAASTFM
                     ERSQMRKPYFMAARWFATPSGQPGPEHDRKNDKEFQESIERGLREAKAGQKIDDVPED
                     IKHFFGKHERGPTPTHDEKPRSNEESKKTSSSGPNNNKNNKNNKNNNNNDMRANMNMI
                     IATIISTYILYRFTSPEASSREVTWQEFRSAFLDKGLVDRLVVVNRSKVNVYLHNNAA
                     ENMYALQPGTQMLGSPQYWFSVGSVEAFERHLEEAQRELGIPSNERIPVAYHESISMA
                     STLLHFAPTIILAGLLFYFTRRATGSAGSGGGGGIFGIGKSRAKLFNQETDVKVKFEN
                     VAGMDEAKQEIMEFVSFLKNPERYERLGAKIPRGAILSGPPGTGKTLVAKATAGEAGV
                     PFLSVSGSEFVEMFVGVGASRVRDMFATAKKMAPCIIFVDEIDAIGKSRGKGGNFGGN
                     DERESTLNELLVQMDGFSTNEHVVVLAGTNRPDVLDQALLRPGRFDRHIAIDRPDISG
                     RCAIFHVHLKPLKLASDVNTDLLAEKLSTLTPGFSGADLANVCNEAALIAARLEAPAI
                     DESHFELAIERVIAGLERKSRVLSPEEKTTVAYHEAGHAVCGWFLEYADPLLKVSIIP
                     RGVGALGYAQYLPKERYLFSTEQLHDRMCMTLGGRVSEELFFGRITTGAQDDLSKITR
                     LAFEICASYGMNDKLGPVSYRTEQESMHKPYSERTGELLDEQVRALVMEVHARTTKLL
                     TEHKADVEKVAKLLLEREVITREDMTNLLGKRPFKQADEADEYLDKKGRLARKGESSA
                     PPPPQDELQQDPHLASSQSEIPPP"
     gene            <946195..>949617
                     /locus_tag="MRET_0557"
                     /note="MRES_01175"
                     /db_xref="GeneID:38737323"
     mRNA            <946195..>949617
                     /locus_tag="MRET_0557"
                     /product="SWI/SNF chromatin-remodeling complex subunit
                     SWI1"
                     /transcript_id="XM_027627184.1"
                     /db_xref="GeneID:38737323"
     CDS             946195..949617
                     /locus_tag="MRET_0557"
                     /codon_start=1
                     /product="SWI/SNF chromatin-remodeling complex subunit
                     SWI1"
                     /protein_id="XP_027482598.1"
                     /db_xref="GeneID:38737323"
                     /translation="MDISSWFRIHNEMQQQQQAQVPNLAYQLSQQQQNQEQQQQQLQQ
                     QQQLQQQQQLQQQQQQQLQQQQQQQQQQLQQQQLQQQQLQQQQLQQQQLQQQQLQQQQ
                     QLQQYTQIPQSPFPLSQQQPQQHAQQVQQQAQLQQLQRLQQAQNQAQPAPNVIGQPSA
                     AIINPVQPMQSQSAMAPEMSAQQRRSTPSAPSISPVQMLQSIQANMNMVQRQWAMVNA
                     QQDTPNKTSALQYLTTQMQRLMSMHESVLNASRNSVTPDSNASGSSMNAPPLNQTANP
                     LTPTHPPGEPRSWDPATTAPHSYPLSVNQIAQPEQKHTADSVALAQPSDPSFVAPSNV
                     QTKPMVSPVVSTPAVPSTQSPPQPSNAVPRDFLSAVYLFYSQRGMILAPDFASPFVGP
                     ATTPNETRSIDLQRLFTKVLSMGGSDHIFSVQNGWALVAQQLDLAVGPPTSSTPPSAI
                     PTPGEVPARLAAYYVRRLLPFEKSWIATQRAHSEASKPAIPTPPTSVPAPTELPTAPV
                     QTSAPVPVPTPTPTAATASNPFINMEPTQVQMVVGQHLNQLQNLVAAGQLSPQLAMAR
                     YAATQQALQAYNNERAASLQRPTEPGPVAPTPAAAPKVAKPTANLAPPVPVPPPAQVP
                     APEAPSTVERPPETDSPKPIDSPKPSQPPREVLTRYEIEYIPTNIRLSTFGGRDLNRL
                     DEELAPRLAQCAGTRGVHELGVVDVHALIMSLKSGLAVEISYALNALLIVSAGADAPS
                     DFQLSLAQCDDLLDVLLDVLASHAPCDSDTSLDHLLQDSLLTYCDAIDLALAEEAEIC
                     VRRRQSKTQSEEHEADRRVAVAQVVLTILRNLSVMPENCTYLATHKRFIPMMASLLRT
                     IQRDQRWDTAHGTALAAFSLRELLHIRKDVLTMMLGVAGEALELRRFAVDTIAALVDL
                     LRFFVLDAVEFEQRHGTSSDALERASSSALVFHAPHHIFLALQALSLLTLPDANRDVL
                     AYCIPLSVQIQLVSRLITLLPISVSDFRRFASLTRLEYTETAAICLYNLIYLAPLAVK
                     TAIRDTLGVPGILFRAVKHLIMSTRDYAQNPYDVLCRRLIETAHLLIDDKDSLDESPL
                     LGMYWPPTDEKDHTKSSEQTTILTGHDETVIDMLIRTSNVDAGMTSELLALV"
     gene            complement(<949641..>952400)
                     /locus_tag="MRET_0558"
                     /note="MRES_01170"
                     /db_xref="GeneID:38737324"
     mRNA            complement(<949641..>952400)
                     /locus_tag="MRET_0558"
                     /product="26S proteasome regulatory subunit N1"
                     /transcript_id="XM_027627185.1"
                     /db_xref="GeneID:38737324"
     CDS             complement(949641..952400)
                     /locus_tag="MRET_0558"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit N1"
                     /protein_id="XP_027482597.1"
                     /db_xref="GeneID:38737324"
                     /translation="MGRDESQAQKIPVLSRDPEVKEDDKPQHSKELRPSESKVNDELS
                     EEDQQLKTELEMLVERLSEDNTQMHRPALEALRNLIRSSTTSMTSVPKPLKFLRPHYD
                     QLKSVYEKWMTANNEKVLFAEILSVLAMTYSNNGKHETLMFRLRADDMRSSPTTAENL
                     GDWGHEYVRQLCSEVGEEYNTRLEKEQDTSELLRLALLVVEFSLKHHAEIDAVDLLLE
                     IEAVDQLPQYVDKDTFERVCLYLVSCVNLLVPPDDIMFLRTARTIYRNHQRYYEALVI
                     SVRLMDADLIREDFWSPKNPTMQKQMAFLLARQQIPLEWIQNESEPITDQALLDCLFH
                     TNLSSHFINFAKELSVYEPKTPEDVCKTELETSRPAGADSARANLANAFVNAFVNAGF
                     GNDPLVVGAEEGDSYVYKTKDHGKLSAAASAGLSLMWDTELGLSHIDKFTYSSNEFVK
                     AGALLAYGILHNGVRTEMDAPLALLSEHVESKSAPLQHSSVVGLGLAYAGAHREEVMA
                     LLLPYVQDESTSMSTAALCALALGFVFIGSAHDEIVPSILQTMMERDPSQLDDKWMRF
                     MSLGLALLFLGKQDASDATIEALKAIDHPVSRETQILVDACSYAGTGNVLKIQTLLHY
                     CAEHVTNEAKKEGDDSQMAEDATEESRDLYQAFSVLAIALVAMGEDVGAEMTLRHMSH
                     LMHYGDPVIRRTVPLALALLNPSNPVISVLDTLSKYSHDSDLDVAVLSIFSMGLVGAG
                     TNNARLAQRLRQLASYYAKEPDCLFAVRVAQGLVHMGKGTLGIDPYHTDRQLFSYTAV
                     AGLLSTLISLTDVRNFVLDRSHWMLFFLTAAMRPRFLITLDESLEPLPVSVRVGKAVD
                     VVGQAGKPRTISGFQTHTTPVRLGSHERGVLGTEEYLSYTPIMEHFVILHKNPGSSSD
                     DATNM"
     gene            complement(<952501..>953535)
                     /locus_tag="MRET_0559"
                     /db_xref="GeneID:38737325"
     mRNA            complement(<952501..>953535)
                     /locus_tag="MRET_0559"
                     /product="DNA-3-methyladenine glycosylase II"
                     /transcript_id="XM_027627186.1"
                     /db_xref="GeneID:38737325"
     CDS             complement(952501..953535)
                     /locus_tag="MRET_0559"
                     /codon_start=1
                     /product="DNA-3-methyladenine glycosylase II"
                     /protein_id="XP_027482840.1"
                     /db_xref="GeneID:38737325"
                     /translation="MSQVVETSKSSASISTMRRSARLQQKPSIEDTLRDDVESPAPKK
                     VKRAATHEAELPLLSEDQVALCTTLAQPRLSFSLEDARDHLCKVDARFSSLFAQMDLK
                     AYKDLESSKELNLFRVLTTSILGQQISWMAARSIVYKFCRLFSPHLPKDPDMNHVNRD
                     ELPFPTPLQLLQATDEQLRSAGLSMSKIKYVRDVAQRFGDGRLDVRRIVHLDPETCIQ
                     ELTEIKGVGRWTAEMLLMFALRSPDILPVGDLGVQRGIVRFYLSNAASLTVSERKRKA
                     DYASQKREDQPGPLPPGPISHAELKNRSNGNKTKKKMYLDDHEMVALAAPWAPYRSVA
                     CMFMWSIEDH"
     gene            complement(<953617..>955659)
                     /locus_tag="MRET_0560"
                     /note="MRES_01165"
                     /db_xref="GeneID:38737326"
     mRNA            complement(<953617..>955659)
                     /locus_tag="MRET_0560"
                     /product="AHNAK nucleoprotein"
                     /transcript_id="XM_027627187.1"
                     /db_xref="GeneID:38737326"
     CDS             complement(953617..955659)
                     /locus_tag="MRET_0560"
                     /codon_start=1
                     /product="AHNAK nucleoprotein"
                     /protein_id="XP_027482770.1"
                     /db_xref="GeneID:38737326"
                     /translation="MLSTTTLIVALTVGLCGGVLVISAISFVSAYLVRRHWLAQRKEC
                     EERVRIHASSSILPSSTGAHLASPPFRPYINPEKVEEDSSPASLAHVDNPAPLLPIHS
                     PSPTKSLKCTQPRPSLDTENLLVQDRGSMPTTQSPTSNSIFRSQTLSSKYKLNLSRAS
                     VRNASLRCSRMSQNVLSRLPSQFRSNRSSRQISLESGESLGMPEDQIPMARRIQRKEQ
                     RFQYDSSSYSSSVATPEGCLPESEAMMPPPPAMLKSDSPRNKEALFDRIMAWQETSAV
                     NVSPDSDEAHSDIADLPSPSKWRHDKPRLQRQVTQSSMYSMGSESMCSHTTISDVINP
                     YMQSQSHTPILRIPSIRPQFMAETSLESWLGPEDPRRTAKSGQGVAPSPTTLFREVPM
                     AAPEVNAHESVSAHTAPSVHGTQLEHPRTSVHLLAPPETPSPKRVSLTSTDTKETPTT
                     DVPIFLSPADKAALPQPTSYTPSNSSRSSYRSSARFSGYSPQHWKHLSNETAGTEITW
                     VEEAEEEEEAECKAKAVEPSSPPSPRHSPDRPQNIQIDMEAEVKHAAHPPAPRRDVSA
                     ATMVEAIGYAYDPTDLGSDVYAQTPRIPSARYPAAPSPPSATLPLRNVHSSTPDSADS
                     ESVATERDSHSAPSTLSQNAIVGSPMQTMQAWFQMAGEKTPLAKETVSLRGPRAMV"
     gene            complement(<955950..>957908)
                     /locus_tag="MRET_0561"
                     /note="MRES_01160"
                     /db_xref="GeneID:38737327"
     mRNA            complement(<955950..>957908)
                     /locus_tag="MRET_0561"
                     /product="solute carrier family 32 (vesicular inhibitory
                     amino acid transporter)"
                     /transcript_id="XM_027627188.1"
                     /db_xref="GeneID:38737327"
     CDS             complement(955950..957908)
                     /locus_tag="MRET_0561"
                     /codon_start=1
                     /product="solute carrier family 32 (vesicular inhibitory
                     amino acid transporter)"
                     /protein_id="XP_027482771.1"
                     /db_xref="GeneID:38737327"
                     /translation="MPPRHAIPMRPSGVSSRRDAVQGKYANTAGQDGSAHHPWRSSLD
                     LVWSYSRSQAYFGDNLMSSPSFVERHWGEDSQADTESDIMAGSDSCHTSTHHPEDHEP
                     SLEPTALSDEESLHGARVRDRGPASVESRNYYSMLDRDMDTTLHHSRRPSSRSKTPLR
                     ASPFAHSDSDYDEGVSDVTPECMAADCQQGEHPDLARTLSQGTSSAAHKVNPHAPLRA
                     WAPYLHDPYHVDERSHLLCVTGGSEYQQELITSTGPKSTFWQSWFNAVNALIGVGILS
                     MPFVFAQCGWLGGCVLLVLCALLTNWSGKLLTQIMVRDPSLQTYADIGTYAFGPGARV
                     WVGLLLSLEMFMVAVALIILFSDSLAALVFGQGQEPSASWLLLFKVLGFAVSVPTLFL
                     PLSFLSPVSLMGLVSIVVLSVVLAIDGLIKSSAPGSLWDPSPTTWAPQWSGFGLGFGL
                     LMSGFSAHPIIPSLYRDMQQPALFGQMIDLAYLTAVGLYMAVATMGYLMFGSLVSDEV
                     SKDLARTPHMPVVLTCICVGLLTFNPVTKFALALRPIQALFESALLKHDDPRPAVSQG
                     KQHFLSIALSGAVLLTAVTFPNIVRVMGFLGAFLACSTCIFGPCLAGMVIFRKERTWL
                     RLLLDVVILGVSLLLCLHGTLASLRYTS"
     gene            <958055..>960067
                     /locus_tag="MRET_0562"
                     /db_xref="GeneID:38737328"
     mRNA            join(<958055..958130,958164..>960067)
                     /locus_tag="MRET_0562"
                     /product="nuclear pore complex protein Nup62"
                     /transcript_id="XM_027627189.1"
                     /db_xref="GeneID:38737328"
     CDS             join(958055..958130,958164..960067)
                     /locus_tag="MRET_0562"
                     /codon_start=1
                     /product="nuclear pore complex protein Nup62"
                     /protein_id="XP_027482768.1"
                     /db_xref="GeneID:38737328"
                     /translation="MSFGGGSGFSFGSSSNKPTFSFGTQNQSQGSAPAATNTTPAPGA
                     AFGGTSTTESKPPAFSFGGSTTPAAQPPANLFGSKPAATGSSGLFGQGNPGSQGATTT
                     PTQAPATGGLFGAAKPAAATGFSFGKPAENAEAPKTGGFSFGKPAEAPKPSGFSFGKP
                     AESTEAPKAGGFSFGKPAENTEAPKPSGFSFGKPAESTEAPKTGGFSFGKPAENAEAP
                     KAGGFSFGKPAEAPKEAPKPSGFSFGKPAESTEAPKAGGFSFGKPAENTEAPKTGGFS
                     FGKPAEAPKEAPKPSGFSFGKPAENAEAPKAGGFSFGKPAENTEAPKTGGLSFGKPAE
                     APKEAPKPGGFSFGKPAEKKDEPATEAKPAEAGNLFSKPPASTSGTQTDTKPTNVAVS
                     APSLLRGKSMEDIVKMWQGELDASIKEFSQQAGEVAAYDRVLLKGGDEISRLVAQIAQ
                     AEERQSGIDQTLDYVEQQQTELNALLDTYESQRSELLQASGAHGRMDMGVADVEREKA
                     YALAENLNTQLDDMSRNLVSMIDEVNQMSAPTTNGRRAVRDATDASSEALGSLQVSRD
                     VPGYEDPITQISAILNAHFSSLKWIDEHTSSLRDRLEALRRGQTDKAHAANDTLRLSV
                     GPDAPRSSTPSRTLLDHRGSPATFRSSTSARYLGA"
     gene            <960137..>960937
                     /locus_tag="MRET_0563"
                     /db_xref="GeneID:38737329"
     mRNA            <960137..>960937
                     /locus_tag="MRET_0563"
                     /product="20S proteasome subunit beta 7"
                     /transcript_id="XM_027627190.1"
                     /db_xref="GeneID:38737329"
     CDS             960137..960937
                     /locus_tag="MRET_0563"
                     /codon_start=1
                     /product="20S proteasome subunit beta 7"
                     /protein_id="XP_027482769.1"
                     /db_xref="GeneID:38737329"
                     /translation="MHAYPGQTWRSTPQVDCIASQSSLFHADRPVDAFDDARQRTQQP
                     IVTGTSVLGLTYQDGVMLATDTLASYGSLARFMDNQRLTPFGSHVVVGASGDMSDWQN
                     IQHTLTKLMEKEDIQGDGHSLTPEQVYAYLSHTMYERRSKLDPYWNALVLGGYDARAN
                     APFLGYVDLLGTTYQSSTIATGFGLHLAQPMLRKAVEGRESQLTEEEARAILEQCMRV
                     LFYRDARSLNRFQIAKITKHGVHITEPYSVSTSWSFGEGLRGYGPQTQ"
     gene            <961039..>963168
                     /locus_tag="MRET_0564"
                     /note="MRES_01155"
                     /db_xref="GeneID:38737330"
     mRNA            <961039..>963168
                     /locus_tag="MRET_0564"
                     /product="dipeptidylpeptidase"
                     /transcript_id="XM_027627191.1"
                     /db_xref="GeneID:38737330"
     CDS             961039..963168
                     /locus_tag="MRET_0564"
                     /codon_start=1
                     /product="dipeptidylpeptidase"
                     /protein_id="XP_027482774.1"
                     /db_xref="GeneID:38737330"
                     /translation="MGRCLGAAWSIVGVLALVLQTYARPLTPKLLLEAPRPASHVAVN
                     APGTAALLGVEMPSTTTGDVSKALYYIPLDPPASWEHKQASLLQNGTNDAVFLDEDTF
                     VFVKDQQLHCRSLREDKSELLLHLPKGIQHMQSVRTAKDTATLAFSAMVFDDGDIYAQ
                     HPEQEAAWQRAKVYDQLFIRHWDQWQHPQQRTQLFALDLYRHQSGWTVRDKIRNLLQA
                     TRLESPVGPLGDASDFSLSRHYVAFTAKDPDAPPAWHTRQHIYLVPLDGHAPPKRISL
                     AENRGWAGTPVISPNEDMVLFLQQYKDGFESDRKVLQAYLMEGGQQVEIFPDWDVSPD
                     TLSFSSDGRTLYAVVPEDEQRKVYAISVQGASFSDKHALVVDGSASSPTQLPDGRLIY
                     VLSTLQSPNDVYLYDRGQTTRLTHFWQWSDAHRDVDMGPVPERFTYQGADGVTMHGWL
                     IKPPSYEADVKAGKKLPLAVLLHGGPEGDWSNGWSTRWNPVAFAAAGFVVTTLDPSGS
                     IGFGQALTDRVLEHWGDRVKEDVLRGVHHVLDTHTYLDRDRVVAAGASFGGYMVNWLQ
                     GHNQGKLFKAFVTHDGIFHLESMYYSTEELYFPESELGGLPWTSPHLYEAFSPHRHVA
                     AWSTPHLIVHGGRDFRLSPAQGISAFTALQRRHVPSRLLFFPDEGHWVLDPRNSLQWH
                     EQVLGWLQYWSRPPATALTDHQAVFST"
     gene            <963228..>964312
                     /locus_tag="MRET_0565"
                     /note="MRES_01150"
                     /db_xref="GeneID:38737331"
     mRNA            join(<963228..964178,964205..>964312)
                     /locus_tag="MRET_0565"
                     /product="replication factor C subunit 3/5"
                     /transcript_id="XM_027627192.1"
                     /db_xref="GeneID:38737331"
     CDS             join(963228..964178,964205..964312)
                     /locus_tag="MRET_0565"
                     /codon_start=1
                     /product="replication factor C subunit 3/5"
                     /protein_id="XP_027482775.1"
                     /db_xref="GeneID:38737331"
                     /translation="MLYVDKYRPKDLSELNYHLHLTEQLESLVASADVPHLLFYGPSG
                     AGKKTRITCLLKALYGPGAHKLKVDQRVFLNPSKRKIEVNLISSNYHTEITPSDAGIY
                     DRLVIQDILKEIAQTQQVDQNAARRFKTVVINEADSLSRDAQAALRRTMEKYMRNMRL
                     ILCANSTSRIIAPIRSRCLLLRVGAPKDEDVMRVLRHVAKREKFHLPDNISSDIARNA
                     DGNVRKAILVLETLRVQSPDLSGPVAIAQPDWQVYCERTADMIVSEQSPARLLEVRGR
                     LYELLVHAIPASLIFKTLAHDIVRRVDESLRASIIEKAAFYELRCVSGNKPIFHLEAF
                     VAQVMFLQKSLLLGMDLE"
     gene            <964413..>965963
                     /locus_tag="MRET_0566"
                     /note="MRES_01145"
                     /db_xref="GeneID:38737332"
     mRNA            <964413..>965963
                     /locus_tag="MRET_0566"
                     /product="alanine transaminase"
                     /transcript_id="XM_027627193.1"
                     /db_xref="GeneID:38737332"
     CDS             964413..965963
                     /locus_tag="MRET_0566"
                     /codon_start=1
                     /product="alanine transaminase"
                     /protein_id="XP_027482772.1"
                     /db_xref="GeneID:38737332"
                     /translation="MSSFLSRKLLWRRSFVTATLPRHVFRKDTINPSVQYVAYAVRGE
                     IPLKAAEYEKRLRLGDKLPFDSIVWTNIGNPQQQPMLGQEPITFWRQVAALTEYPQLL
                     DMPAAVRDSMFPSDVQERAQELLKAFGSVGAYTASKGVPLVRQHVSDFLQQRDGYAEN
                     IENIYLTAGASSGISALLQILMRPNRDGLLIPIPQYPLYSASASLLNLAALTYRLDAQ
                     QHWEPSLTDIKAKIDEARSQGIEPRVIVVINPGNPTGACMTRAEVEDMIKLAHRESLA
                     IFADEVYQDNVYNKDRPFVPFRRVLMELQNSQDASEREIGSSVELVSFHSTSKGMVGE
                     CGRRGGFFVLNNMDAEVEAQINKVVSMSLCPPTQGQIGVDLLVRPPKPDEPSYELWRH
                     QMDSIYHTLRSRSQLIADSLNRLPGIFAEPAMGALYVLPRVHLPKSVSDRARQLGKKV
                     DELYCLELLDETGICVVPGSGFSYEPEVLEDGSTLSCFRITVLAKETQAMVDRFTRFH
                     RAFMDKYP"
     gene            <966215..>967222
                     /locus_tag="MRET_0567"
                     /note="MRES_01140"
                     /db_xref="GeneID:38737333"
     mRNA            <966215..>967222
                     /locus_tag="MRET_0567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627194.1"
                     /db_xref="GeneID:38737333"
     CDS             966215..967222
                     /locus_tag="MRET_0567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482773.1"
                     /db_xref="GeneID:38737333"
                     /translation="MPSALASQSVVDRSWEKLPTPPSSGGADDVTVPQKHTSRRVHLC
                     SEAATLDDSLDEYTHSAKKRACLRPPDVLTPPSTRGRRMTDKLGLHAAAERHQERRTR
                     HIRQCSDVSEDPSSLFDGMDLFSPSRLGRRAEKARDTTPPPFLSAYESRPVRDTPHNP
                     FVEGGPADVGFTGVNASNALLRAMARPARQPDTTVFVFRGQRVMYRDAESRHPAPLYE
                     NVPSPPRPRTLFPTKQRTGMPTYAARRHALSDDEAPPMNSTRRRNLFADELANPHRRA
                     QPLPAAGDDVDARWLASDAPADGTSRSQYEIPAKNRELLARLERVDWDEDEDEEEEED
                     R"
     gene            <967344..>967946
                     /locus_tag="MRET_0568"
                     /note="MRES_01135"
                     /db_xref="GeneID:38737334"
     mRNA            <967344..>967946
                     /locus_tag="MRET_0568"
                     /product="small subunit ribosomal protein S11"
                     /transcript_id="XM_027627195.1"
                     /db_xref="GeneID:38737334"
     CDS             967344..967946
                     /locus_tag="MRET_0568"
                     /codon_start=1
                     /product="small subunit ribosomal protein S11"
                     /protein_id="XP_027482766.1"
                     /db_xref="GeneID:38737334"
                     /translation="MLQRGMWGLRGAVRRSAVRSMPWRAYSQSALGSDALPAPREQKV
                     SLDSAVEFTPVPEMSAPTPPPKPVSDVLGLPSASRPHRLHIKSSRNNTIVTFTMPTGE
                     PLVGESGGTVGFKKAQRSGYEAGYRAAVRVFQHIVAHRAQWGVKDIEVLWNGFGQGRE
                     AVFRALQASEGESVRQMVLAMTDKTPIKIGGVRPKKRRML"
     gene            complement(<967956..>969005)
                     /locus_tag="MRET_0569"
                     /note="MRES_01130"
                     /db_xref="GeneID:38737335"
     mRNA            complement(join(<967956..968047,968075..>969005))
                     /locus_tag="MRET_0569"
                     /product="small subunit ribosomal protein S9"
                     /transcript_id="XM_027627196.1"
                     /db_xref="GeneID:38737335"
     CDS             complement(join(967956..968047,968075..969005))
                     /locus_tag="MRET_0569"
                     /codon_start=1
                     /product="small subunit ribosomal protein S9"
                     /protein_id="XP_027482767.1"
                     /db_xref="GeneID:38737335"
                     /translation="MWSWAGTLGARVPRAAAVAPRSHTLRLAHTWQAHHRLPRPHPPA
                     PERLKPLSPTYYTAKPSFMDTLHMIDQLTREVKRELEKACVLAPNAPPPAASGKPMTW
                     MSRDRLGSRLGLTLRASQHRSVTSRLSLLHRYKKVAADAFLGTSSFAAGASTHQRDLV
                     HQIMEVLDSYADMRSTDDSASSFVHTGTPSRGLIDERGVAYARGRRKVSHARVWLVRA
                     QPSRLGEMLINNAPLHQYFSRTAHREIVTWPLRLSGMLGMYNIFAIVRGGGASGQAGA
                     LAHGVANALVAALGTAEGENATNIQLHVQHLLAQDGVLIRDPRMVERKKPGLAKARKA
                     YTWVKR"
     gene            <969113..>969575
                     /locus_tag="MRET_0570"
                     /db_xref="GeneID:38737336"
     mRNA            join(<969113..969383,969412..>969575)
                     /locus_tag="MRET_0570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627197.1"
                     /db_xref="GeneID:38737336"
     CDS             join(969113..969383,969412..969575)
                     /locus_tag="MRET_0570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482716.1"
                     /db_xref="GeneID:38737336"
                     /translation="MHSRAFVVRVPHAACPVMGLQVVVMQDTLLVWCGAVPSDIEDEA
                     RDGAYAGALSRDWSVAMHVPSSTTMTTSLYRAAYHDDVSRRMSERLATKLGLRQLYLS
                     LDLPDVLVPRGAAALAPEDARALQALERGLREGLQRASEASS"
     gene            <969644..>975241
                     /locus_tag="MRET_0571"
                     /note="MRES_01125"
                     /db_xref="GeneID:38737337"
     mRNA            <969644..>975241
                     /locus_tag="MRET_0571"
                     /product="phosphatidylinositol 4-kinase A"
                     /transcript_id="XM_027627198.1"
                     /db_xref="GeneID:38737337"
     CDS             969644..975241
                     /locus_tag="MRET_0571"
                     /codon_start=1
                     /product="phosphatidylinositol 4-kinase A"
                     /protein_id="XP_027482715.1"
                     /db_xref="GeneID:38737337"
                     /translation="MDVLDQPTHALILSDLAACLAQEAADGTLDSSDFAAFQSSDASS
                     STLALGYFSVSDVRAVLAQARFASALADAMSQAPARDATSASHVYMEHVSRTLCATAE
                     HMPRADFDESLQVRGQWPMADELAYAVVEGLLKIGACVASMRAPTQAALLQLVRGLCA
                     QLRASGAWDEQRRWACRCVPQLHGVARAMQAVAFVWDEASIAPMAEELGALALEAQTV
                     YRLDALLLTLPSQSAALQQSRAWAERRGCTPLVPATPSKHALDAGDVLLEQYVRLGVP
                     LSGQLVASCSLRALASIVAQAAVPQAASAQRASAWACLVRGTLPVRLPMPSVVHAAYE
                     ARTSDGAEHAELYASEQLCASLQLLIVGAATRTDDVTYAWDALCDVLSERAPSHDVAS
                     QCAALEGAAVLAHVRPTLSLKLLHHIRRWVQAPTSVATLDAHADLAAACMAACIRASG
                     QDEAAASTMYTMLNHVSREAHAIIVHTTLAVLTRLAREMRVPSYTALVVSLLLQRTQA
                     PGQLPIGIVFSHLVPLAAASPRSGFVNMYTALGDAMRHALQHGDSAQWERLQHASLQL
                     ARALTPAAEAQGRDADAAAGEATPCLRKELMLPDVLALVIEAGTRRAGGRAAVQGLVH
                     IVAALLAHADMHVHWQPPAELVYLFRNAWIVMVLVGGVSSLTAPMPHGDPLNTIALKT
                     PTLVPATARNYLDDDIDTYNVLRHDALATSADALRHALSPVLGHRALETRALSLARLA
                     FVYAVLHVEWRRAACGRPSMALCYLVHPGIATSSVHAPLRAVIERTFAAFLVHVSERC
                     HTHTADACLASEARNMLVALCHTRAAVRDEAHSYLERLVPACPWLFARAEVVATMLEL
                     VTLVSRGCDGELTSAFMPQYTFTSALAGVSIDLSDVYADRRALLESVSRRVRDILTRV
                     QIDVPGALHGALLRYLQADTAADGLGATLALDVARGRTQRVGFSQVRCDDAGHVTHAL
                     LVQSASLGWTAATPEATLRAQIQALAASALHSHDALDGFVYRCAALLVQQATPDADVL
                     SALVRVPMQVCTKTALRAATRAWSWLLAERPAAMAALVCAIAEHWADAARQRRGLYTT
                     QLPAQAPLSRKTDMSATDPARIARETSLADELLAGHLLVLQLLSDCLERARSSDATLV
                     AVLCRLVLHMADAAPALCLHPLARLAHTALVQFSLRVLEAARLDVFIEARLRDAVCRL
                     ALAWFAQPPVWSYGGDLRRGAEELLHVRAVMALLRHATLRADTFVSSSTAHTTQHTML
                     HSTQRLVPHCPLARAVEHVQQCLHLLQALYASEEARLLVWLHPTQHAKGAPPSVQVQR
                     GDLLTAWRLDPRVAVHMIERFPQPELRTELAQLISAEPHRVTHCSAALRLFLTQQPTP
                     RALRWLLAWAPVAPVDAIDMLTPDGGGRHPMVLQYAMRTLAEHPVDLVFFYVPQLVQT
                     LREDVYGYIAQFILHTSLVSQLFCHQIIWNMEANKYKDDLAEVEDPLKPTLDAMIQRI
                     VGQLTGEAQAYYEREFAFFKKVTGISGSLRPYVKCSKPEKKAKIDEEMAKIAVEEGVY
                     LPSNPDGAVVDIDRTSGRPLQSAAKTPFMATFKVRRAVAERTNPDDPPHVDVWQSAIF
                     KVGDDCRQDMLALQVIAQFKNIFMAIGLDVYLDPYRVTATAPGCGVIDVVPNATSRDE
                     MGRAKINDLSDFYKNRYGDEHSVAFQQARLNFIQSMAAYSVVCHILQIRDRHNGNIMF
                     DGEGHVVHIDFGFLFDIGPGGMRFEPYSFKLSHEMVDVMGGHESPGFAMFEQLVVKAY
                     LACRPFAHEIVATCGLMLGTDLPSFKGKATLDRLHERFKPNMTEREAALHAQWLVKDA
                     YGNMRGTLYDLIQEKQNHIPYRR"
     gene            complement(<975242..>975679)
                     /locus_tag="MRET_0572"
                     /note="MRES_01120"
                     /db_xref="GeneID:38737338"
     mRNA            complement(<975242..>975679)
                     /locus_tag="MRET_0572"
                     /product="coiled-coil domain protein 12"
                     /transcript_id="XM_027627199.1"
                     /db_xref="GeneID:38737338"
     CDS             complement(975242..975679)
                     /locus_tag="MRET_0572"
                     /codon_start=1
                     /product="coiled-coil domain protein 12"
                     /protein_id="XP_027482718.1"
                     /db_xref="GeneID:38737338"
                     /translation="MEAAAAVRKARIVALRELKQAEEAGDEAAISANVFGQRVKRHFR
                     SSVPPAALLPQRDEAAASTVENDVRDMQESVMAEDTRRQAEELDLANIAPRRPNWDLR
                     RDLDARLALLEPRTEEAIHTLIVRRLGASRDRQEDVANVLANE"
     gene            <975807..>977420
                     /locus_tag="MRET_0573"
                     /note="MRES_01115"
                     /db_xref="GeneID:38737339"
     mRNA            <975807..>977420
                     /locus_tag="MRET_0573"
                     /product="mitochondrial splicing suppressor protein 51"
                     /transcript_id="XM_027627200.1"
                     /db_xref="GeneID:38737339"
     CDS             975807..977420
                     /locus_tag="MRET_0573"
                     /codon_start=1
                     /product="mitochondrial splicing suppressor protein 51"
                     /protein_id="XP_027482717.1"
                     /db_xref="GeneID:38737339"
                     /translation="MMRRSLPGVPMVPRHHRVPQHANMYALRMHGQARSIFGLFKRKP
                     KAEAPVAPPPVLGPDNLFHKLSESPIPSMRARGERIRSLAPCPVSMSKYGVRRLVNFE
                     CPDCGWPTHFSEKEWKEDTEHGRYVARLREANEDEHDLRSGRPMTEFQLPRDQTAEAA
                     INLSGWDQFFYTRDFPSIESERSKRHVSKLLTFPLTIVGALHEFSPYTRRNSRLTHEG
                     LRSLTPLRQTLHPELGSKPQLDAVRVFVVGARAEATLPPDVWNQISYVFPNVPIHVIL
                     IGPEAAIPPKHVPNPWNHPAYKERAASFPFPSRSIAVSEGLTLTVIQTTYEKVHALFE
                     PFDPYTDVFFAFAPGFGFPSVIAVEEQARLRAEEREDERKMQEARDTYYAKNAPSEEA
                     PQVAFRPTEVAKNPAGGDVPSDEPAPAVVAMRPSKNNFTALQTAPVVQAQREWAQAIG
                     QLLSTRCALFVSGFSPADVERDVLAFESVEGVSGEFDWLLTPGENVFASQQWAIADFD
                     PRVAVKANWGLWAVRGKRYDILGPQWDPL"
     gene            <977501..>978298
                     /locus_tag="MRET_0574"
                     /note="MRES_01110"
                     /db_xref="GeneID:38737340"
     mRNA            <977501..>978298
                     /locus_tag="MRET_0574"
                     /product="urease accessory protein"
                     /transcript_id="XM_027627201.1"
                     /db_xref="GeneID:38737340"
     CDS             977501..978298
                     /locus_tag="MRET_0574"
                     /codon_start=1
                     /product="urease accessory protein"
                     /protein_id="XP_027482720.1"
                     /db_xref="GeneID:38737340"
                     /translation="MTVVCDMKGTPSAQSDAMHSHGHSHEHGHTHEVMDHPGKFGERD
                     LPNYASRNWTERAFTVGIGGPVGSGKTALLLALCRRLRDTYNVGVVTNDIFTREDQEF
                     LVKNAALQDANRIRAVETGGCPHAAIREDISANLEVLEQLQAEYETQLLFVESGGDNL
                     AAAFSVELSDFHVYVIDVSGGDKIPRKGGPGISQSDLLVINKIDLAEHVGASLDVMRR
                     DADKMRDGGPTIFTSVRQDQGVDAVVDMILAARRAAGADKAGKPPSP"
     gene            complement(<978295..>978969)
                     /locus_tag="MRET_0575"
                     /note="MRES_01105"
                     /db_xref="GeneID:38737341"
     mRNA            complement(<978295..>978969)
                     /locus_tag="MRET_0575"
                     /product="endoplasmic reticulum-based factor for assembly
                     of V-ATPase"
                     /transcript_id="XM_027627202.1"
                     /db_xref="GeneID:38737341"
     CDS             complement(978295..978969)
                     /locus_tag="MRET_0575"
                     /codon_start=1
                     /product="endoplasmic reticulum-based factor for assembly
                     of V-ATPase"
                     /protein_id="XP_027482719.1"
                     /db_xref="GeneID:38737341"
                     /translation="MPVMLVMPEATVAQLLSLTEAPPSLHKDIRDCMQSMPLNHDTPA
                     DPSIARQHTTVPHDLLIRVARWASSHDRPDLCLDRLLRGARIYTPPPPKYERPRELDE
                     SLEAIRLEQERRTYDAMIHHTAPTDRGATHEERLAWRETRLHISAILNVLLSMAAIAA
                     AVWWGAGSASPLWKVSVALTLSVLIGTAEVVLYTQYGRTVKHSRTKRIVRQQRRRQRR
                     AQLPPS"
     gene            <979136..>980449
                     /locus_tag="MRET_0576"
                     /note="MRES_01100"
                     /db_xref="GeneID:38737342"
     mRNA            <979136..>980449
                     /locus_tag="MRET_0576"
                     /product="peroxisome-assembly ATPase"
                     /transcript_id="XM_027627203.1"
                     /db_xref="GeneID:38737342"
     CDS             979136..980449
                     /locus_tag="MRET_0576"
                     /codon_start=1
                     /product="peroxisome-assembly ATPase"
                     /protein_id="XP_027482722.1"
                     /db_xref="GeneID:38737342"
                     /translation="MYERKVREGTIQRDDFQRQIVSILDRLHYDLRTYKQPPVPDVEA
                     CLDATTSTSWGLWGSLTSWFSQNTHGEASCPSFRPAGTPQGLYLYGDVGTGKSMLMDL
                     FYHTLPTNITRKRRVHFHQFMIDVQKSSHTFKARYRDKGHDDVDPIEPVIRDIAQKAE
                     VLCFDEFQVVDIADAMILRRLLEGLLRYGVVIVTTSNRHPTELYKNGIQRSSFIPCIE
                     LIESQYHVVSLNSGTDYRKVPQKRYQTYFTLSDSQGAAEYEQLWQELTQSEPVMENRS
                     LSVWGRSLQVPKSTSRVARFTFLQLCGEPRSAADYIALCKEFHAFFIDDIPHMNLDMR
                     DWARRFITFVDAAYESKARLFCTSEVEIMKVFSNTTTWDEMSSSQMRVLMDDLNMDMS
                     DVGNSSIFSGHEELFAFARLLSRLSEMQTKPYADMSAQLYHLNAS"
     gene            complement(<980435..>983527)
                     /locus_tag="MRET_0577"
                     /note="MRES_01095"
                     /db_xref="GeneID:38737343"
     mRNA            complement(<980435..>983527)
                     /locus_tag="MRET_0577"
                     /product="checkpoint serine/threonine-protein kinase"
                     /transcript_id="XM_027627204.1"
                     /db_xref="GeneID:38737343"
     CDS             complement(980435..983527)
                     /locus_tag="MRET_0577"
                     /codon_start=1
                     /product="checkpoint serine/threonine-protein kinase"
                     /protein_id="XP_027482721.1"
                     /db_xref="GeneID:38737343"
                     /translation="MDSRPEVLRSTQTPLKRGTDQKTPLRTPLRTPLSAVSEQTSSTP
                     ITPFEAIESQKENVQPRSRGRSAHALSHTLSMHHKERQEVLATQRQEWEERVLGPENQ
                     DSDDPLEAWCAYVKWCIDNYPDGKSSDSGIVPLLERATREFRSSEQYQNDSRYLRLWI
                     LYAQHTDVPRDVFHFLMANEIGTKLASLYEELAHVLESYEMYDEADEMYRLGMARRAS
                     PLDRLKRRYHEYQKRILEMPTSTNDGEPMTYAKALAAAMARAGRSVLGVKTGRGAESV
                     PTNVLGSHQPLSSAAVRPNARTMHVYCDNDENGVAPASGGSWASVGTSAERHKENASG
                     RRGLQPLGVQTPRTQTRALEVFCDSDEDASPRRTPRPDDVFQRHARSESDKLRQNPFM
                     HYDQAALRPAPTEPARPRTKKHAPSKPVHERHVVPLDAMYPDADLTAAVRDKAQPIPP
                     TRELCIEELMARRRQMPEASSTDPWSHLDAWHGRWLPELTRRPPSPTLVTKAAMEEVE
                     HMFNGEESSSEEDDSETDDDDVRYPLPAHRMPVHDDENIGLQPKQPQSDRRPLGATPQ
                     RVTSGSDEADEARAPFQPLTPITERTERTDSSRWTLDVPSEDAMPYGGLRAPPTSLAI
                     PNPCSPADPDIVSTLLSNLARPVTQLPGYVDEAHESQYLSTLRARLDARSRRSSVGNG
                     CDVQVADMQLSVYSRLGEGGFGSVFLAQDMNESVPLAGQVTASYADVDQDDIDELERR
                     QLLALKIESPPNPWEFYILDQLRHRLPDQLQASIVGARRFVSCANESLLLLEYASMGT
                     LLELVNHAAEAGVSSVLGQGGGVEEVLAMFFVNELCRIVQGMHEAGLIHGDLKIDNCM
                     IRADDVDEWTSTYAADGSGGWAAKGVTLIDFGRAIDMCCYPPDQRFLADWQPGAQDCV
                     EMREMRPWTYQADYYGLASIAHCLLFGKYMDTTCYVNDDGLKTYKIQQSLRRYWQTDL
                     WTRFFHLMLNSTHYPAVGPQLTELRAEMDAWLTAHSFHAGKNLKGLLKKVEIWALRRV
                     "
     gene            <983663..>985144
                     /locus_tag="MRET_0578"
                     /note="MRES_01090"
                     /db_xref="GeneID:38737344"
     mRNA            join(<983663..983677,983713..983742,983771..>985144)
                     /locus_tag="MRET_0578"
                     /product="ribosome biogenesis protein SSF1/2"
                     /transcript_id="XM_027627205.1"
                     /db_xref="GeneID:38737344"
     CDS             join(983663..983677,983713..983742,983771..985144)
                     /locus_tag="MRET_0578"
                     /codon_start=1
                     /product="ribosome biogenesis protein SSF1/2"
                     /protein_id="XP_027482714.1"
                     /db_xref="GeneID:38737344"
                     /translation="MVGKKRRKTRTHLKGPISNSQTDSRAPKSFVIRGGRVGKSVTTL
                     VRDVRRIMEPNTATRLQEREKNKLRDYLTMAGPLGVSHMLIFNQSDAGINMRVLRCPR
                     GPTVTFRVNKYSLASDIMHSSRRPIAPGTEFTTPPLLVLNNFSGEERHLKLLVSVFQN
                     MFPPLHVHSMRLSQVRRVVLLNYNADTKTIDWRHYLISVRPVGVSRSVRRVIEGSTRP
                     SSASSGSVTGHGSEHKRHGRALVNLGNATDIAEYVIRGSQAAGGEDTDTSEAESELED
                     MADPQNAVQLSQNYVGRGNAANAQRAVRLREIGPRMELRLVKVEEGLNGSSVLYHDYV
                     HMSASDVAKQTRDITAKRQLAAERRAEQERNVERKKQAKAKKREPHPAENEPEEEEDE
                     ADDQDDFEYEDAAAGAPANDTAIAQDILGSDEELFDEGDEEEEDAAQSDQEDSDLEPI
                     PLGEVEHDAPVRRRQAPSKRRR"
     gene            <985255..>986931
                     /locus_tag="MRET_0579"
                     /note="MRES_01085"
                     /db_xref="GeneID:38737345"
     mRNA            <985255..>986931
                     /locus_tag="MRET_0579"
                     /product="T-complex protein 1 subunit alpha"
                     /transcript_id="XM_027627206.1"
                     /db_xref="GeneID:38737345"
     CDS             985255..986931
                     /locus_tag="MRET_0579"
                     /codon_start=1
                     /product="T-complex protein 1 subunit alpha"
                     /protein_id="XP_027482713.1"
                     /db_xref="GeneID:38737345"
                     /translation="MAQIFQKDPRNAGLFIGGQRLSGSDIRDQNVLAVQSIANVVKSS
                     LGPVGLDKMLVDDIGDVLISNDGATILQLLEVDHPAGRILVELAQQQDKEVGDGTTSV
                     VILAAELLRRANELVKNKIHPTTIITGYRLACREAIKYIQDVLAVKIDARAQECLINV
                     AKTSMASKIIGADDDFFAQMAVDAMLSVKTVNGRGETKYPVKAVNVLKAHGKSARESM
                     FVNGYALNCTVASQAMKTRITGAKIACIDVNLVKQRMHMGVHITIDDPDQLESIRARE
                     SEMVLERVRKILATGANVILTTKGIDDLCLKEFVQAGAMAVRRCKKEDLRRIAKATGG
                     QFVSSLANLDGEESFDASALGHADEVSQERVGDNELILVRGSKVHSSSSIVLRGANEY
                     MLDEMERALHDSLSVVKRTLESGSVVPGGGAVETALDIYLENFATTLGSREQLAIAEF
                     AQALLVIPKTLAVNAAKDSTDLVATLRAYHTAAQNAGATDPKKTLRFFGLDLLNGTVR
                     DNLRAGVFEPTMSKLRSLKSAVEAATSLLRIDDAITIPPEPPREDPHDHM"
     gene            complement(<986937..>988091)
                     /locus_tag="MRET_0580"
                     /note="MRES_01080"
                     /db_xref="GeneID:38737346"
     mRNA            complement(<986937..>988091)
                     /locus_tag="MRET_0580"
                     /product="calcium/calmodulin-dependent protein kinase I"
                     /transcript_id="XM_027627207.1"
                     /db_xref="GeneID:38737346"
     CDS             complement(986937..988091)
                     /locus_tag="MRET_0580"
                     /codon_start=1
                     /product="calcium/calmodulin-dependent protein kinase I"
                     /protein_id="XP_027482751.1"
                     /db_xref="GeneID:38737346"
                     /translation="MASVADTSLYEQPASYVKKQEYTFGKTIGKGTYGVVRSAIRTLP
                     DHTTQPVAVKIIKKSSLKRQEHIIMQEIEMVRSLNHPHIIKLIDWFESKDKFYLVFEE
                     AHGGELFYRLMQGRFTERAACRIIYVVLEAIAYMHRNEIVHRDIKPENILYRSEAQDA
                     DIVLVDFGIATHLYEHTDTELHGMCGSVGYAAPEVMARKGYGKPVDMWGLGIVTYCML
                     CGFAPFSSVDPKLFLEQVESATISFEGKYWDSVSAEGIDFVQQCLNRDPEQRITSEDA
                     LHHAWFRLISDETHESDDDGNDISTGVRENYRSKWKSVMATVRATKRIQALSHTHVEP
                     LHEDLCPSSPLYSDEDNDHDNHSFGAPQRTTSNSWLEWLRSYFPVYNYSE"
     gene            complement(988253..988332)
                     /locus_tag="MRET_t0006"
                     /db_xref="GeneID:38741200"
     tRNA            complement(988253..988332)
                     /locus_tag="MRET_t0006"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:38741200"
     gene            <988463..>988810
                     /locus_tag="MRET_0581"
                     /note="MRES_01075"
                     /db_xref="GeneID:38737347"
     mRNA            <988463..>988810
                     /locus_tag="MRET_0581"
                     /product="protein of unknown function (DUF2423)"
                     /transcript_id="XM_027627208.1"
                     /db_xref="GeneID:38737347"
     CDS             988463..988810
                     /locus_tag="MRET_0581"
                     /codon_start=1
                     /product="protein of unknown function (DUF2423)"
                     /protein_id="XP_027483028.1"
                     /db_xref="GeneID:38737347"
                     /translation="MAKSLRSHSKLAARNAKRYTEGTDYAVTAAARLQQVSDRLKQRL
                     QAPKLSETNKDEEEKMDDAHDNDKEADMQVEAPAKISTSHPHDSSKDRWRRKMRKKGA
                     RHGSGKKRRQAAW"
     gene            complement(<988888..>992163)
                     /locus_tag="MRET_0582"
                     /note="MRES_01070"
                     /db_xref="GeneID:38737348"
     mRNA            complement(join(<988888..992130,992158..>992163))
                     /locus_tag="MRET_0582"
                     /product="CDK inhibitor PHO81"
                     /transcript_id="XM_027627209.1"
                     /db_xref="GeneID:38737348"
     CDS             complement(join(988888..992130,992158..992163))
                     /locus_tag="MRET_0582"
                     /codon_start=1
                     /product="CDK inhibitor PHO81"
                     /protein_id="XP_027482752.1"
                     /db_xref="GeneID:38737348"
                     /translation="MKFGKQILSQQISGWGSYYLDYKFLKKIINSLEKGRIADAALFA
                     TSVRPEETSDGPQPLLPIDSPGSELQVHKAAFFFRLERELEKINAFYLQKESELRTRL
                     TTLITKKRHLIALANRPVGHNVITRDTPSLVTLLEGFRYFEKDLSKLQQFIEINATGF
                     RKILKKWDKRFKSQTKELYLARQVEVQPCFNREFMTEMSDIASASILQLESLADGHEL
                     PSTPFKNEVALLRGAAPLTGPVLVSDDDPVDDLEFASERPLDFDSADKHNNVIVELEG
                     QLTQAVHESRVDDAKQLIEQIQQQTSGGGDLDPPIHAGMAHLVWRALVTSTPDAMDAA
                     IQGHLPNYAFVDDINARTALHISAHAGKLPLCRACVEHGVDPRASDVYGREALAYAAI
                     GGFEDVCTYLLSLPPLRSPDDCVVHQVDLDGFSPLVHAIVRGRTGVVRILLDHVASIG
                     APAQTKSEHSDLSPMAIAAQCGLVDITRLLLEHGAEVGTNTEGLLPQTLAARAGHTEC
                     LRLLIDAQVDVNAVEKGTQCTPLFYAAEFGHAACVEMLLQSGASIEQVDEKGRHALFY
                     AAWHGWRECTRMLLEAHAKAPKTSQPAPPAPVAETADMDLEGDGIPSLHLPPPIIPFR
                     TYGHNYLDKRSLLCLSLSNQSIELHRQSFSDRPDIFPGLTSSFKLVLTPRNTSAGEQA
                     GIPHTMIFPIAEEREEVSFQVADMEHFYLECEMYPTFGSARIAKTVLLPQVLQGLQNR
                     THMSLPLFDWHMNLMGHMNIVLECVRPYGSVQLQIGGHVETYWKSTLPSQNQPLTISP
                     LPHPNTHDGQDTALYVTASSLSGDYLHVSVQFTQDLVPVVYALDRLPVDVWAPTVAQV
                     TATEFDHIAQRTGHAWHVSDDDAGLAMPAWSQRLATTLVSLETLLKTLPQHVGVALDI
                     RLDAAAAQPLNACIDATLQVVYDVAHRDKHRRRLFFSSTVPSACVALNWKQPNYAVFF
                     MNNATLHSDAAVPTLPKDADPRQSSIAEAVRFAKGNNLLGLMLDTSILELVPELLTAV
                     KAAGLVLITRSRPTTLSSTSTFAEPSLLGPPAIACPDAIDGFFEDHVIKCTK"
     gene            <992510..>995776
                     /locus_tag="MRET_0583"
                     /note="MRES_01065"
                     /db_xref="GeneID:38737349"
     mRNA            join(<992510..992524,992555..>995776)
                     /locus_tag="MRET_0583"
                     /product="exportin-1"
                     /transcript_id="XM_027627210.1"
                     /db_xref="GeneID:38737349"
     CDS             join(992510..992524,992555..995776)
                     /locus_tag="MRET_0583"
                     /codon_start=1
                     /product="exportin-1"
                     /protein_id="XP_027482753.1"
                     /db_xref="GeneID:38737349"
                     /translation="MASMESILDFSQDLDLVLLDNIVAAMYTGAGADQRMAQQVLAQF
                     QEHPDAWQRVPVIMQQSTNSQTKYIALQILDKLIATRWKVLPVDQQQGIRNFIVELIV
                     VMSSEESNLRSERTLLGKLDTTLIQILKQEWPHNWPNFIPEIVSSSRGSLAICENNMA
                     ILRLLSEEVFDFSAEQMTQAKARNLKNQFCGEFGEVFQLCTEVLEKANKPSLIKATLE
                     TMLRFLNWIPLGFIFETNVVDSLITRFLEVPDFRNVTLKCLSEIVNLNVGAEYDPKFV
                     ILFNMVMTSINRMIPPSTDIAGVYETSTDEDQELVLNLALFLSNFLISHVRLLENAEN
                     QEVLLNAHLYLIKVSQVPEREVFKICLEYWSKLVSELYEEYQQFPMGDAGSVWGLNLG
                     GAQAMQRSAMGRKAFYVKILSNLRLVMIERMVKPEEVLVVENDEGEIVREFLKESDTI
                     VLYKAMREVLVYLTHLDVLDTENIMTEKLARQVDGTEWSWANLNTLCWAIGSISGAMN
                     EETEKRFLVTVIKDLLGLCEMKRGKDNKAVVASNIMYIVGQYPRFLKAHWKFLKTVVN
                     KNFEFMHETHEGVQDMACDTFSKIAQKCRRHFVMQQAGEQEPFIDEILRNLLQITVDL
                     SPQQVHTFYEAVGYMIAAQPHRATQERLVAKLMELPSNAWDNLMKQAHSNVDVLSNPD
                     NIKVLSNVLKTNVSACSSIGPFFLPQIARIYLDMLALYRSVSGIISAKVEAEGLIATK
                     TPMVRGLRAIKKDILRLVDTYIRRADDLEGVNANLIPSLLDAILGDYHNNIPAARDAE
                     VLNVMATITTRLGALLTDKIAPILDAVFEPTLNMINQDFAEYPEHRVGFFKLLRAINL
                     HCFSALLELPPAKFKLTVDSIIWAIKHTMRDIADTGLHICLELLNNIANTDPMIAGAF
                     FQQYLLNILQDIFYVLTDTDHKSGFKTQCLLLARIFELIETDKVVVPLWDPAQVPDPA
                     MNNRLFIRQYTANLLRVAFPHVQPQYIDQFVSGLCALSSDLVQYKVHLRDFLITSREV
                     AGGSDNSDLFLEDKEAEARNRLALERENAAKIPGMLKPSQIVEEDEEL"
     gene            complement(<995811..>996521)
                     /locus_tag="MRET_0584"
                     /note="MRES_01060"
                     /db_xref="GeneID:38737350"
     mRNA            complement(<995811..>996521)
                     /locus_tag="MRET_0584"
                     /product="golgi SNAP receptor complex member 1"
                     /transcript_id="XM_027627211.1"
                     /db_xref="GeneID:38737350"
     CDS             complement(995811..996521)
                     /locus_tag="MRET_0584"
                     /codon_start=1
                     /product="golgi SNAP receptor complex member 1"
                     /protein_id="XP_027482747.1"
                     /db_xref="GeneID:38737350"
                     /translation="MTWEVQSRRVRQTQSRLDAKLTAYSQYVSDLARKNAAPSDAVSV
                     DMSGSTPSVQDRAAMEAEIQALLVQYSDELDELGTTLNDPLLPPNNTQKHAIQRHREL
                     LLDFEREFFRSKTHVRQVLDRHQLLGHVKQDIHDYRTQHASEVQSYLDERSHLERSHL
                     MMDETLDQAYATQQEFRGQREQLGHTLTRLTRIAAQMPGVQSIISLISRRRRRDTIVL
                     AVVIGVCLVILLLVGVRR"
     gene            <996999..>998594
                     /locus_tag="MRET_0585"
                     /note="MRES_01055"
                     /db_xref="GeneID:38737351"
     mRNA            <996999..>998594
                     /locus_tag="MRET_0585"
                     /product="DNA binding regulatory protein AmdX"
                     /transcript_id="XM_027627212.1"
                     /db_xref="GeneID:38737351"
     CDS             996999..998594
                     /locus_tag="MRET_0585"
                     /codon_start=1
                     /product="DNA binding regulatory protein AmdX"
                     /protein_id="XP_027482748.1"
                     /db_xref="GeneID:38737351"
                     /translation="MDASGPPPPPSFQESRAKAEDRRPSPTQDQAAQPPAKAPKHDAS
                     SYPGKSEPSSSSMGQYNTIDFLGNVSGGPHAAAAEALATFSSSVGSDAANNNSLFMQV
                     PSGPPPASAAPLHSTSSSSLPPPTTSTLPSSGTQHGPPFLCPTCNTSYSRLEYLRRHE
                     RRHADIRPFACPCGKSFSRSDVLARHKTKCRVVLSDESGAAANSSDGRKSDRLQRVSS
                     SMRSTRGRPAGTTRAGRPQDRETSAHDPSVDPALAGTAAVDPSMQPPPPLEGASDSPY
                     ASYTNAPPPTYAPHGHPESSDYAHDKAPYAHPGPSGSGAPPAASVAGAYGGMRMGVPH
                     DPKMYAHGNMPRPGNAPAPYLSGAPAIHPELSSRGAPGMYSGAPATSTTGSPGTASAA
                     PGSMYYPPSQHSEHAGSYATQPATVTHYDGSAAAAAAAAAAAAAVATPNGTQQGGSGI
                     YAPNKELARFSVPSSGPLSPFSNTALNSNISPYLSAFSCARDMPPRGGSSPRMSNSTA
                     SGTAPTQPPAPPSTDEAPPPSDS"
     gene            <999771..>1001006
                     /locus_tag="MRET_0586"
                     /note="MRES_01050"
                     /db_xref="GeneID:38737352"
     mRNA            <999771..>1001006
                     /locus_tag="MRET_0586"
                     /product="bZIP transcription factor"
                     /transcript_id="XM_027627213.1"
                     /db_xref="GeneID:38737352"
     CDS             999771..1001006
                     /locus_tag="MRET_0586"
                     /codon_start=1
                     /product="bZIP transcription factor"
                     /protein_id="XP_027482749.1"
                     /db_xref="GeneID:38737352"
                     /translation="MNHYIKLTSRFTTFPIVLDMTRECMNPANDISRGSAVEDPSATC
                     LDTLSPLLPLFPLSGPEHHGSMQSEWSESTSPSLADSLLSLGFDSADTMGTTLYNSDL
                     LSDSSVSPVTTPKETTASRLFAPVDAVMFPHQDTELDVPSPKRMRMDAEMPAPGMFQS
                     LLSVLRHDFTLFPGDDELHVPSKQDLDMTNPKAEKVMSLLDTLNGSPTQQPSVSTQLR
                     SGSLDSTLSEPKTAPPALMEKTPTSMPASVLPSPPITGLAVTPASISAPALSTTSMGG
                     TKSFRGTRRRRRDVDELLPLDAPIQPRMYHTESATSRRDSKDHSSSGEVSPKNGNPLA
                     TPTLPSAENQDVDARALKRLSNTIAARRSRHRKAEELKRLYDMIEQLEKEVGVWKGRC
                     EAAEQERDRLRTDSVALRM"
     gene            complement(<1001039..>1001537)
                     /locus_tag="MRET_0587"
                     /note="MRES_01045"
                     /db_xref="GeneID:38737353"
     mRNA            complement(join(<1001039..1001458,1001499..>1001537))
                     /locus_tag="MRET_0587"
                     /product="monothiol glutaredoxin"
                     /transcript_id="XM_027627214.1"
                     /db_xref="GeneID:38737353"
     CDS             complement(join(1001039..1001458,1001499..1001537))
                     /locus_tag="MRET_0587"
                     /codon_start=1
                     /product="monothiol glutaredoxin"
                     /protein_id="XP_027482750.1"
                     /db_xref="GeneID:38737353"
                     /translation="MAGIFAKQAASLLRPSLRISQAMRVNASPSMMRWLSNDTRVKIQ
                     NAVKEDPLVVFMKGSPSMPQCGFSRAVLQILQVQGVNTDKVATYNCLEDQELRDGIKE
                     FSDWPTIPQVYINGEFVGGCDILLNLHQTGELETMLREAGLLLEATEHQQ"
     gene            <1001796..>1003338
                     /locus_tag="MRET_0588"
                     /note="MRES_01040"
                     /db_xref="GeneID:38737354"
     mRNA            join(<1001796..1002196,1002330..>1003338)
                     /locus_tag="MRET_0588"
                     /product="pre-rRNA-processing protein TSR4"
                     /transcript_id="XM_027627215.1"
                     /db_xref="GeneID:38737354"
     CDS             join(1001796..1002196,1002330..1003338)
                     /locus_tag="MRET_0588"
                     /codon_start=1
                     /product="pre-rRNA-processing protein TSR4"
                     /protein_id="XP_027482755.1"
                     /db_xref="GeneID:38737354"
                     /translation="MLRTLATKPETSHAARDYEAGDTDVPQYMPPYDDDDSDFEEDVY
                     SNVQLGLADGPLEEDDESNPLVSRIGGRPAWLPLQPSKLPPASEVQCAYCKEPMQLLI
                     QIFAPLEDSAYDRNLFVWGCARPQCQRKGNGCIKAVRMLKHNARWAAKLAKREAQKRA
                     REERVRAEKEAEEERLRKERETNPFSMKNSGGSNLFGASLFDEPAAPEKQDADAVQDE
                     DDDDDDDDDYNEEERLAEEMTIKASLDEQHKQLQDHWAHSASHYTAPLYLNTIPEPEP
                     EPKAVPAAPQKLPSHVSSLGSGDTEEYEKMVIEGMDHVFERFTRRLGSEARQVVRYEY
                     GGAPLAFTGAGALFQQLWPNGVHGDYDASAVPPCPQCGAPRVFELQLMPNLANLLRVE
                     HLSDLTHDDGRQDAEARRQAEVASVLGLKNNASLSDMRTGIAWSTAMIFVCSRDCCLD
                     ATEGYAVEWVGLQHESTDL"
     gene            <1003406..>1005178
                     /locus_tag="MRET_0589"
                     /note="MRES_01035"
                     /db_xref="GeneID:38737355"
     mRNA            <1003406..>1005178
                     /locus_tag="MRET_0589"
                     /product="methylenetetrahydrofolate reductase (NADPH)"
                     /transcript_id="XM_027627216.1"
                     /db_xref="GeneID:38737355"
     CDS             1003406..1005178
                     /locus_tag="MRET_0589"
                     /codon_start=1
                     /product="methylenetetrahydrofolate reductase (NADPH)"
                     /protein_id="XP_027482756.1"
                     /db_xref="GeneID:38737355"
                     /translation="MCEEGQRRMAARVDEKLAGNDAYLWSLEFFPPRTALGLANLLAR
                     IWRMSTALQPGWVHVTWGTGGSTCHASLELAARVQNGVYDPAEDYTKVTEPRSGACDV
                     CLHLTCTNVERSCLDATLDEAKRFGIRNILALRGDSPRNEEYWVATDQRLQNATDLVK
                     YIRERHGDYFCIGVAGHPEGLKQGIDCDIPHDLRVLKAKQDAGARFILTQFFYDVDKF
                     VRWVQACRDAGITIPIIPGVMPIQNYTIFRRMSNLCGVHAPEHVLAQLESIKLDDAKV
                     KDEGIQLSIDMIRAVRKQTGLKTFHIYTLNLEKSATCVIKELSEVAQAGQAAQSLSNS
                     MTWDEFPNGRYTDTRSPAYGEIDGYGASLKVPPEEAVRLWGVPVDEDDIASIFTRFIE
                     GQLPCMPWCDIPVWNETMEVLPSLVRLNAPRSKGGKNWWTVGSQPAVDGCDSTDPTYG
                     FGPQGGYIFQKAFVELFLTPEDKDALVRHIEANPSPVTYFAGKWDPDSFQTNLERDGL
                     NTVTWGVFPGKEVAQSTIIEEPSFRAWCDEAFAIWREWELLFPPKSATRSLLRKIHDE
                     RWLVTVVHHDYKHPDALWKLLDQV"
     gene            <1005246..>1005737
                     /locus_tag="MRET_0590"
                     /note="MRES_01030"
                     /db_xref="GeneID:38737356"
     mRNA            join(<1005246..1005664,1005692..>1005737)
                     /locus_tag="MRET_0590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627217.1"
                     /db_xref="GeneID:38737356"
     CDS             join(1005246..1005664,1005692..1005737)
                     /locus_tag="MRET_0590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482697.1"
                     /db_xref="GeneID:38737356"
                     /translation="MHQAVSRALAHVKAAQTALEEAVPSEEPESLQHDELVSAYRALQ
                     REHEELRAQYEADKQTWREFKRWWKQKLQAKREARRTPWSPRKARERIQAHRRQVRSL
                     MSEQPGLFKGTGRYAPRPTANEQAQRETAPEPTPPDYWQLGFPSSSQDEPLM"
     gene            <1005774..>1007138
                     /locus_tag="MRET_0591"
                     /note="MRES_01025"
                     /db_xref="GeneID:38737357"
     mRNA            <1005774..>1007138
                     /locus_tag="MRET_0591"
                     /product="origin recognition complex subunit 1"
                     /transcript_id="XM_027627218.1"
                     /db_xref="GeneID:38737357"
     CDS             1005774..1007138
                     /locus_tag="MRET_0591"
                     /codon_start=1
                     /product="origin recognition complex subunit 1"
                     /protein_id="XP_027482696.1"
                     /db_xref="GeneID:38737357"
                     /translation="MATRKRKSTQDVPDGKRHHASTSLPDWPHSLHAMPAAVLARMTP
                     HGRARRLLHVGATPESLPCRHEQFQAVLDCTCDALRAGVGACAYICGVPGTGKTATVR
                     EAVRTLQRMQVRNEVPAFTFVEINGMKLATPMQAYTELWCGISDGKSRLQPRAALTKL
                     SAHFEGRQRSRPTVVLMDELDMFVTSRQDVIYNMFHWPDMPHSRLIVLAVANTMDLPE
                     RTLQPKVASRLGMTRIPFMPYTNKQLFDIVRARLDVNEDGTPAATSPATQGCETVFRM
                     DALIFASKRVANVSGDARRMLDVCRRAVEAADEHASARHQDPVPITIHDIRDVMDRMA
                     RSGRAAHMAGLSLHAKLLLASMYACMRRTGITEVVWSDVVVHHQALCAAQTHDACHEH
                     ELLRPLATLCQLGLVIAVGSGAGHARGGAFARFLLAVQEDEVYAALADDPVCQPLFAL
                     RAST"
     gene            complement(<1007121..>1008842)
                     /locus_tag="MRET_0592"
                     /note="MRES_01020"
                     /db_xref="GeneID:38737358"
     mRNA            complement(<1007121..>1008842)
                     /locus_tag="MRET_0592"
                     /product="alpha-1,2-mannosyltransferase"
                     /transcript_id="XM_027627219.1"
                     /db_xref="GeneID:38737358"
     CDS             complement(1007121..1008842)
                     /locus_tag="MRET_0592"
                     /codon_start=1
                     /product="alpha-1,2-mannosyltransferase"
                     /protein_id="XP_027482695.1"
                     /db_xref="GeneID:38737358"
                     /translation="MLIHDPPKLATQARPSWRTALGILVCVRVLIACVMIISDCDEVY
                     NYWEPVHLLSASTTPKAFETWEYAPQYAIRSWAYITLHAIVPGSLAHLPSYVSFYALR
                     VVLAIASSFADAFLYERVAQFVHVRIARYMLVFLVACAGMHSASVALLPSSMVMYTTS
                     VGMAYAMQPASMAASRRTYRATAAFAFGALCSGWPYALVLAVPFVLEELCGAPLGCRL
                     ARGCSAALLSALCVGVPTVLIDSLAYGRPTLVALQTILYNVASRARGIGPELYGVEPT
                     SYYFVALALGFSVAAPMALVSLPMLALAARYLPSRIAGSAVQLGLRLAPLYLWLAVLF
                     VQPHKEERFLYAAYPLVCFAAAVTLYLVRAFLESAYLRFTRSPYRASRTMLFSAVTLV
                     PLLAAAVLGVLRTSALILYYRAPIDVMHALPNEAGTLCYAGEWHRFPSHFFVPPQVRV
                     EFVESAFRGILPHHFRRGNASDPLWPWAAYTRTSPTHVNDRNAHEPDRYVALSQCSWL
                     VDTHADDTWEPLMCRPFVDNEASRLAAQTGPLPAKIRATVARALYVPGWDDSLVWRSY
                     CLLRRRA"
     gene            <1008886..>1010097
                     /locus_tag="MRET_0593"
                     /note="MRES_01015"
                     /db_xref="GeneID:38737359"
     mRNA            <1008886..>1010097
                     /locus_tag="MRET_0593"
                     /product="phospholipase C"
                     /transcript_id="XM_027627220.1"
                     /db_xref="GeneID:38737359"
     CDS             1008886..1010097
                     /locus_tag="MRET_0593"
                     /codon_start=1
                     /product="phospholipase C"
                     /protein_id="XP_027482694.1"
                     /db_xref="GeneID:38737359"
                     /translation="MEVLTLNCWGLKYLSKAREQRLRAIADRIADTHHDIVTLQEIWV
                     ESQDWQYMRAVCADRYPHGRFFLTGAFGSGLAVLSRHPIVSMDTHMFRLTGTPVFVHQ
                     GDWIAGKGCGRVTIAHPALGLVDVHTAHFTALGSQMGPEIQRAFRTTEAYELAQRCAA
                     SAHAGRHVLCTGDFNSLPTSLCMSLLYSVGGMHDALTHLRSGDGQADITCDSPRNTWT
                     HGKKLEPWAVQQGGKRLDYILYRGPSSLPNRLTCTSHKVTFTELMPDLHVSYSDHFGI
                     VATFDIQAEGSAPRGAKCESRIDVLQRALLPLREALRGAVTMQKRHLAVFLTLLGLDA
                     ILVAALACVDARHRSTASTVFVSLLMVAATWAGTTALYSGVVWGEWHKRALRAFIDEI
                     ETEAGIDKWYH"
     gene            complement(<1010717..>1012174)
                     /locus_tag="MRET_0594"
                     /db_xref="GeneID:38737360"
     mRNA            complement(<1010717..>1012174)
                     /locus_tag="MRET_0594"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627221.1"
                     /db_xref="GeneID:38737360"
     CDS             complement(1010717..1012174)
                     /locus_tag="MRET_0594"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482701.1"
                     /db_xref="GeneID:38737360"
                     /translation="MMNNCACPPSKTNCCKSEQSCDCRPVPASCVCPSDKIDCCQDDN
                     ECYCVPSTSKCPYPAQMNACCKDKDGKSCRLVVCCQDEDGKSCRPEDCCKDKNGKSCR
                     LVVCCQGEDGKSCLPSDCCKDKNGKSCRLVVCCQDESGKSCRPEDCCKDKNGKSCRLV
                     VCCQDEDGKSCRPEDCCKDKDGKSCRLVVCCQDEDGKSCLPSDCCKDKDGKSCRLVVC
                     CQDEDGKICRPEDCCKDKDGKSCRLVVCCQDEDGKSCRPEDCCKDKNGKSCRLVVCCQ
                     DESGKSCLPADCCKDKDGKSCRLVVCCQDESGKSCRPEDCCKDKNGKSCRLVVCCQDE
                     DGKSCRPEDCCKDKDGKSCRLVVCCQGEDGKSCRPEDCCKDKDGKSCRLVVCCQDEDG
                     KICRPEDCCKDKNGKSCRLVVCCQGEDGKSCLPSDCCKDKNGKSCRLVVCCQDESGKS
                     CRPEDCCKDKDGKSCRLVVCCQDESGKSCDPAGCC"
     gene            complement(<1012385..>1015762)
                     /locus_tag="MRET_0595"
                     /note="MRES_01010"
                     /db_xref="GeneID:38737361"
     mRNA            complement(<1012385..>1015762)
                     /locus_tag="MRET_0595"
                     /product="IPT/TIG domain protein"
                     /transcript_id="XM_027627222.1"
                     /db_xref="GeneID:38737361"
     CDS             complement(1012385..1015762)
                     /locus_tag="MRET_0595"
                     /codon_start=1
                     /product="IPT/TIG domain protein"
                     /protein_id="XP_027482700.1"
                     /db_xref="GeneID:38737361"
                     /translation="MEDLGHSGNYGTVFPTFTAPQDRASARFTDSSSITTPPSLTSES
                     SPESYLDNEDPACLSAIEQVHDFRSKSINAAVGGTANDALYCDWPANTPCAAFVPKVS
                     DELKMTGVAQHLSAPHPNHKEAYDAEQFPPSQIREHVTALPMETALSTTHTEVHDEKL
                     MSPDHSSLQPMTSSDAPFSNHATAMKPMSSFSSSPHHTSDTNSIAPAMIEKNDKRLLV
                     QSPPHMPSSATDTTSLSLMSTRAIWPDRENLPSDMKILVNGLPAAGAKSRVETQIRMR
                     IELVHPVQQTDGHVEYERIGSFTHIKVPPLSGTKRKSRKHQKTCVPPESTLMLEADVI
                     NATPPHARVYVCDSCRERERKRAHRKKSRAAVLNAYPTEEEMTAMGINPHAPDALSLA
                     VTRLEEEERKHAVLFNCGDYIDFHDGEVILSTRITCYCRHHREKVGFHIVFTLRNHKG
                     DFIATGSTPPIMIMDDHKSMSNSVSMSRMAEARLRSGIQDETFSPPRLRERAKPYDER
                     LRRSSVRETPQPSAFLPSPSPVMHMDSASSHLSFPLNDHISMSWVNSMSPPSADEPVS
                     SIPLMHDTTVPSPLQVTAPSNLFPPLTLPSDDLDMSGPVPRITKLVPVEGPTTGGVEI
                     TILGANFREGLQCVFGDMPSTSTRVWSPTTLVCILPPSFRPGPVIVRIQDSATSSLIE
                     LQSGHPIQIFTYIDTTDRALMELALQVVGMQMTGQVASARDIAMRIVSTCQGGSDAAG
                     SASTVPTQSSKTQHPIDLLSSCLRLTPDSRIPSVQDSLLGLLKLLDVDLNDLPDQQRP
                     PCNPIHACNRNGHTLLHLAVIHNFHRLVLDLLRRGCPIHARDANGYTALHFAALHGWM
                     EVTKLLLQHGADIYDANNEGLIPIEVAHRSEKIDVECMLADSAGEDHDPSYADYGDET
                     SDEDDDSETEEEWITFADVARTAGPVNHIHHTEESEEDKRVLDSAPSFQPKSPTSTPK
                     APWDSEVKSPGPIHSPPPTYDEATTQHGEPGSSKYIDGEKLISFPSALENAQTQNSSV
                     MDGNLERELKLLRRGRRNARLARQRRWDSMDEPKDQQGAGAETVLRTRQGVYDDRMLV
                     WFWIPAMLLAILVPILAQTGWFSSAVSTWIHGIVRDT"
     gene            <1016532..>1016903
                     /locus_tag="MRET_0596"
                     /note="MRES_01005"
                     /db_xref="GeneID:38737362"
     mRNA            <1016532..>1016903
                     /locus_tag="MRET_0596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627223.1"
                     /db_xref="GeneID:38737362"
     CDS             1016532..1016903
                     /locus_tag="MRET_0596"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027482699.1"
                     /db_xref="GeneID:38737362"
                     /translation="MRSAFIASIFALAASTVLAAPAKREFHNRAAKLSWYAGYMMDEP
                     YCGGAPPSDDDMVVATSFDMPYKCGDKLTFEYYGNHATVTVRDRCETCHGEWFDLSKG
                     AFAALTDLEVGVLENVDYWSH"
     gene            <1017201..>1019672
                     /locus_tag="MRET_0597"
                     /note="MRES_01000"
                     /db_xref="GeneID:38737363"
     mRNA            <1017201..>1019672
                     /locus_tag="MRET_0597"
                     /product="protein SEY1"
                     /transcript_id="XM_027627224.1"
                     /db_xref="GeneID:38737363"
     CDS             1017201..1019672
                     /locus_tag="MRET_0597"
                     /codon_start=1
                     /product="protein SEY1"
                     /protein_id="XP_027482698.1"
                     /db_xref="GeneID:38737363"
                     /translation="MERDEEAVHRMPVATGPSIVTGAHEVPVMASGIPSTDASEPEVP
                     PETLARTASVSADAGHDVAIGLAQPNRLQLIDEDQHFSGALFHDHLSQWGMLEAGFGY
                     DICAVLGSQSTGKSTLLNRLFGTNFDVMDDRARQQTTKGIWLCRGMDRNVLVMDVEGT
                     DGRERGEDQDFERKSALFSLATAECVIVNMWENQVGLFQGANMGLLKTVLDVNLTLFQ
                     VGRARAGAPKEKTLLLFVIRDYIGTTPLANLESTIRADLQRIWASLTKPEALAGAELG
                     DFFDVSFSALPHKVLQAKEFDEGIAQLQRRFIDRSDPQYVFQTEYHKRIPIDGLPHYL
                     ESVWEQILQNKDLDLPTQQELLAQFRCDEIAAAAAAAFAAAMTALRSALDAGQVLATL
                     GVDMASHRAEALAVFDKDASRYHRGVYARKRADLLLQLNAVLLPFFLAQLKNLHTKLA
                     SAFQQAMQEGTRGASYDFGRLVEEHVAHALAAFDAETQRLVLPDTDWSVSEERMHLEE
                     DLRAVARTLRADETQKLAVRLEKDIRRHLAEPIEAALSEPDAGMWDRVLGVWRDACDR
                     AAALYRERAAHLNTTPDEDAATVGRLHMVAWRALLDRVQESTSETVLASRLRAFFEDR
                     FRYDASGVPRVWKPSDDMDDAFVQARDATLALIPLYATMQPETPPTVAGDEDTPSWDE
                     ARRVLSERRCAELGRRFRRDADAAYVEAKRGTVSSMTQVPWWMYVVLIVLGWNEAMAV
                     LHSPVYFTLLCMVLASAYVVWRMNLAGPMLTVTTHMARELRALGEQQLRVYLDAPSAA
                     HPAAPATEARPAVSESAEPRLPASF"
     gene            complement(<1019718..>1020818)
                     /locus_tag="MRET_0598"
                     /note="MRES_00990"
                     /db_xref="GeneID:38737364"
     mRNA            complement(<1019718..>1020818)
                     /locus_tag="MRET_0598"
                     /product="NTF2 and RRM domain protein"
                     /transcript_id="XM_027627225.1"
                     /db_xref="GeneID:38737364"
     CDS             complement(1019718..1020818)
                     /locus_tag="MRET_0598"
                     /codon_start=1
                     /product="NTF2 and RRM domain protein"
                     /protein_id="XP_027482704.1"
                     /db_xref="GeneID:38737364"
                     /translation="MSQSTSTQANGTPVPNKASEVGWLFVPQYYTFMNKDPSRLHCFY
                     TKKSTMVHGTENEDITPSVGQQAIHERVNTIGFEDTKVYVSNVDSQSSADGGIVIQVL
                     GEMSNKGGKWRKFAQTFFLAQQPNGFYVLNDIFRYLKDDDDEKDEAREDEPQADEAAP
                     VSVADTPAAREATEASQHAAPAKDEAKPAAPAPAEPAAHAEPKEAPAAPPKTWANLAA
                     RGANRWGHTASEARGSSEAGAQATSTAAAAPEAKPASAPAKPAAPPARGQQGHVFIKN
                     AAGVAQDELRQSLEAQFGALKECQLNAAKGFAFAEFVDADKARRAIQTSSSQNGVRVG
                     AATVLIEKRRPGHAAGGGHRGGRGGHRGASRS"
     gene            complement(<1020946..>1023069)
                     /locus_tag="MRET_0599"
                     /note="MRES_00985"
                     /db_xref="GeneID:38737365"
     mRNA            complement(join(<1020946..1022967,1022996..1023009,
                     1023051..>1023069))
                     /locus_tag="MRET_0599"
                     /product="dynamin 1-like protein"
                     /transcript_id="XM_027627226.1"
                     /db_xref="GeneID:38737365"
     CDS             complement(join(1020946..1022967,1022996..1023009,
                     1023051..1023069))
                     /locus_tag="MRET_0599"
                     /codon_start=1
                     /product="dynamin 1-like protein"
                     /protein_id="XP_027482703.1"
                     /db_xref="GeneID:38737365"
                     /translation="MDQSLIKLVNKLQDAFNDVGIQNPIDLPQITVLGSQSSGKSSVL
                     ENIVGRDFLPRGTGIVTRRPLILQLINRMPESGEVGEPTGQTNPHEWGEFLHLPGEKF
                     HDFQRIRDEIVRDTELKTGKNAGISAQPINLRIYSPHVLTLTLVDLPGLTKNPVGDQP
                     KDIERQIRDMLLKYISKPNAIILAVTAANTDLANSDGLKLASEVDIDGSRTVGVLTKV
                     DLMDEGTDVVDILAGRVIPLRLGYVPVVNRGQRDIDTKKTVAAALDAEHEFFANHPSY
                     SSKAQFCGTPFLARKLSTILMHHIRNTLPDIKTRIQAQLKKFELELASLGGAMGDANA
                     SNAVLTIITDFCNDFRQVIDGNSNDLSVNELAGGARISFVFHELFSSGVKSIDPFDSV
                     KDTDIRTILYNSSGSSPALFVTTSAFEVIVKQQIRRLEEPSLKCCSLVYDELVRILSQ
                     LIAKNTQFRRFPALRERFNSVVIHFFKRCMAPTTKLVADIVAAEACYLNTGHPDFLSG
                     HRAVSIVTERHMAAQSHSTATSGTEIRGGKTVPSSVLNNNKDLDVDIKESTGFFGSFF
                     PNKNKAKKSMMEPPPPSLKATGSLTDREAIETDVIKLLISSYYNITKRTIIDMVPKAI
                     MLNLVNFAKESMQRELLQSLYQQDILKELMKESDHVVARRRECVKMIGALEKAAEICA
                     TV"
     gene            <1023201..>1024142
                     /locus_tag="MRET_0600"
                     /note="MRES_00980"
                     /db_xref="GeneID:38737366"
     mRNA            <1023201..>1024142
                     /locus_tag="MRET_0600"
                     /product="Cut9 interacting protein Scn1"
                     /transcript_id="XM_027627227.1"
                     /db_xref="GeneID:38737366"
     CDS             1023201..1024142
                     /locus_tag="MRET_0600"
                     /codon_start=1
                     /product="Cut9 interacting protein Scn1"
                     /protein_id="XP_027483096.1"
                     /db_xref="GeneID:38737366"
                     /translation="MPALLDAHCHPAEEVRGAGAEAVDAWVRAAGDVPLQQVWAMSTD
                     VHDQPLVARLADAWPDKVVPCFGFHPWVAHTISLGDVQDARSHYAALFGSDDDVFSQF
                     PPPLPLREAIARLEAYLVAYPQALVGEVGVDRSFRIREPGRGLTRWQTPLEHQIAVLD
                     AQVQLACRYQRSVSMHSVRAAGVTVAWLERMKASVAGFGEINIDLHSCTLSPETIRLV
                     QQGHPNIFVSFSTAVNLRAGRERLCEQIRACDPERLLCESDWHAWDELASRTNDMVQC
                     VVEMHGHDMPERMLRCSYAFTKRRYVSHYDMRTPYRV"
     gene            complement(<1024153..>1025799)
                     /locus_tag="MRET_0601"
                     /note="MRES_00975"
                     /db_xref="GeneID:38737367"
     mRNA            complement(<1024153..>1025799)
                     /locus_tag="MRET_0601"
                     /product="G2 mitotic-specific protein"
                     /transcript_id="XM_027627228.1"
                     /db_xref="GeneID:38737367"
     CDS             complement(1024153..1025799)
                     /locus_tag="MRET_0601"
                     /codon_start=1
                     /product="G2 mitotic-specific protein"
                     /protein_id="XP_027483095.1"
                     /db_xref="GeneID:38737367"
                     /translation="MDHSCQFGARPLHLIGQPPSLKLPPTKVQQHGGQRAPRPALVDV
                     SNREPYRPSHVPGQHVMHPHFRPPLTKPASTAPLAARPATQPPAPAPRPAPPVARAAP
                     PVALVPPVSTTLSAPLPAPVALPLAPPIALPVRATSSDVSMSTDTSTYAPGAASVADT
                     SRSPDELVSPSRLSSRSGQSEDSELLAELEMDLDPAGIVTLTLEHDIVEQRRMLDMCD
                     RFEIQVLVPQALAAQAERQDLVRHGQLSAQAAAHDDEMMRLGLDTEEARDISMVAEYA
                     QDIFDYMACMERESMANPSYMDFQDEVQWHMRATLIDWLLQVHMRYHMLPETLWIAVN
                     LIDRFLSARIVSLAKLQLVGVTAMFIAAKYEEIIAPSVEEFVYMTDGGYSREEILKGE
                     RIVLSTLDFNISTYCSPYSWVRRISKADDYDIQTRTLCKCLMEVTLLNHLFLRLRPSM
                     IAAIGMFLAKRMLGGIWDDAFVYYSRFTEAQLLPGANLLLEKLMEPGFEEQFVYKKYA
                     SKKFLKASIYARNWALRHRGPLGPAVPAAVPVASESESSH"
     gene            <1026370..>1026918
                     /locus_tag="MRET_0602"
                     /note="MRES_00970"
                     /db_xref="GeneID:38737368"
     mRNA            <1026370..>1026918
                     /locus_tag="MRET_0602"
                     /product="zinc finger HIT domain protein 1"
                     /transcript_id="XM_027627229.1"
                     /db_xref="GeneID:38737368"
     CDS             1026370..1026918
                     /locus_tag="MRET_0602"
                     /codon_start=1
                     /product="zinc finger HIT domain protein 1"
                     /protein_id="XP_027483094.1"
                     /db_xref="GeneID:38737368"
                     /translation="MAVTQGHAAPPRLRARKPGSRTDVDHAAQHDRRAWIAQQRKNRR
                     LLAWGAALFPTDRSEALATRVTAGPTKESDIERVMLQSVSDAQAPHVAAERDLSRTSP
                     GVRRLLSQRRGANALLDEAASLGQLATMPSFALGPSRYPCRPLCDVCGYWGQVTCMVC
                     GEALCSRSCRQTHLETRCEKHA"
     gene            complement(<1026915..>1028975)
                     /locus_tag="MRET_0603"
                     /note="MRES_00965"
                     /db_xref="GeneID:38737369"
     mRNA            complement(<1026915..>1028975)
                     /locus_tag="MRET_0603"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627230.1"
                     /db_xref="GeneID:38737369"
     CDS             complement(1026915..1028975)
                     /locus_tag="MRET_0603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483093.1"
                     /db_xref="GeneID:38737369"
                     /translation="MASDAAYQTLRRLLAAPPANRAHVDLLDRHALYGAVGHYLAVMS
                     LLNVSEFASVLVASPALWAPQPGAPHTRAAVERATGMTQALSFALSERVTVITKAIGK
                     TAPRSAPSELGAWLQALLHGVHTHTDDAPHTRLARLALITGLVQGLANEKRHRTHFSL
                     WFHLRRHAHTLETAWSTALARALELEHVPTRTATLTLAASVVDMVPDHCMRTVSDKAW
                     IEAALPLVLGVFDVSSQLFGDAMRDDRGVVSLPASGPTCAWQQRVSTHALYTHAGPLA
                     RLVAAALRRLGASLSPADYMDALWGTHGIFRPWLDASAALDTAWTSSCLAGVDAKHFP
                     SETRQRTTGVWHIFKTFLFTLTVVFDAVVHVVVEQCPSPSEAYPAANERHGAWPAMST
                     SNVPAPYLAILAQILRVFERVYFITSTFGLDGFESYRVVLYSALDVLSRDAEACTQLV
                     SAMAHDLLERHGVSAPDAQPAAHVRMGQRMHVTYLLLVVEQWVSELPDTMINQLILPL
                     CRPYLQDTRFQDTFESAHSVVLALYTCGAACTRELTPFYVDMLLHTCVPRKQLSASQL
                     QVACTTIVESLSHHSDSLAWWCIEQLDDQISVMQLQGRDDDAMSLALCLAAILPHVNL
                     VLLRSLLTRISARILERPAPSAERTQLVERVHESLRDMDASTRLEAMQWWLSHSDTFT
                     QGMS"
     gene            <1029048..>1029830
                     /locus_tag="MRET_0604"
                     /note="MRES_00960"
                     /db_xref="GeneID:38737370"
     mRNA            <1029048..>1029830
                     /locus_tag="MRET_0604"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627231.1"
                     /db_xref="GeneID:38737370"
     CDS             1029048..1029830
                     /locus_tag="MRET_0604"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483092.1"
                     /db_xref="GeneID:38737370"
                     /translation="MPATPAKRGGSAASSPFSKLAQNVSASPKSPRSEPRDPFDAFLV
                     PRALEGTHHRKLRAILQDFLKEATAWEEEHTIDGIRWATQASQAWDDIHAALGTAEDT
                     HLDRSERIIPLLLQLEEARASLGKTLSRLERHAQRMQMLVDTAHALLHDTASAHASKA
                     FQEPMWGTWSMARFVRAMSCLSTQYDLATTHTRMLLPDLCEVSEGAPHRAALATWVRL
                     PCVHTSGIGANAPAFGSDAETITGTSRHFFEHICETEVRGWT"
     gene            <1029930..>1031366
                     /locus_tag="MRET_0605"
                     /note="MRES_00955"
                     /db_xref="GeneID:38737371"
     mRNA            <1029930..>1031366
                     /locus_tag="MRET_0605"
                     /product="protein farnesyltransferase subunit beta"
                     /transcript_id="XM_027627232.1"
                     /db_xref="GeneID:38737371"
     CDS             1029930..1031366
                     /locus_tag="MRET_0605"
                     /codon_start=1
                     /product="protein farnesyltransferase subunit beta"
                     /protein_id="XP_027483091.1"
                     /db_xref="GeneID:38737371"
                     /translation="MWPAPDDACQTRTSVEQRCTEEAIYERMKPFVGENAQPLPPLYG
                     DEHIAYLRRLLQPLPAPYVTFDSNRAWMLYWIAHSLDLLRAPLRGALQARAISTLLHF
                     QSPHGGFGGGPAQMGHLMSTYAAVCALAILGGPGGAPTGDDVLLGVHEERGGWDAIDR
                     AAMYDWMMRLKQPDGSFLVHEQGEIDVRATYCVVAISMLLGIATDELLHNTGAFVRSC
                     QTYEGGFAAQSAPSYTLQEHGIVPAAPVASQAAQGEAHGGYSYCALATHAFLSFVGRA
                     DAGVDIPMLVRWATSLQGSLPYEGGGMRGRTNKLVDGCYGWFCGGGLMTLLEMLTDDE
                     PTDAATSDSWSTVSDVRSSFWDRSALRTYILAVAQIPRGGLCDKPGKRPDAYHTCYNL
                     SGLSLCEHRVHRSAAAAVRAEEAYDRHMHRDALHRACYVQCMAWAADDDGAATYVEAT