GenomeNet

Database: RefSeq
Entry: NC_040194
LinkDB: NC_040194
Original site: NC_040194 
LOCUS       NC_040194            1303301 bp    DNA     linear   CON 11-JAN-2019
DEFINITION  Malassezia restricta chromosome II, complete sequence.
ACCESSION   NC_040194
VERSION     NC_040194.1
DBLINK      BioProject: PRJNA495494
            BioSample: SAMN09478194
            Assembly: GCF_003290485.1
KEYWORDS    RefSeq.
SOURCE      Malassezia restricta
  ORGANISM  Malassezia restricta
            Eukaryota; Fungi; Dikarya; Basidiomycota; Ustilaginomycotina;
            Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
REFERENCE   1  (bases 1 to 1303301)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Complete Genome Sequence of Malassezia restricta KCTC 27527
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1303301)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JAN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1303301)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2018) Division of Polar Life Science, Korea Polar
            Research Institute, 26, Songdomirae-ro, Yeonsu-gu, Incheon 21990,
            Korea, Republic of
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP030252.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 2018
            Assembly Method        :: canu v. 1.7
            Assembly Name          :: MRES_180501
            Expected Final Version :: yes
            Genome Coverage        :: 38.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1303301
                     /organism="Malassezia restricta"
                     /mol_type="genomic DNA"
                     /strain="KCTC 27527"
                     /isolation_source="skin environment"
                     /host="Homo sapiens"
                     /db_xref="taxon:76775"
                     /chromosome="II"
                     /country="South Korea: Konkuk University Hospital, Seoul"
                     /lat_lon="37.57 N 126.98 E"
                     /collection_date="2010-05-01"
     gene            <1274..>2530
                     /locus_tag="MRET_0836"
                     /db_xref="GeneID:38737602"
     mRNA            <1274..>2530
                     /locus_tag="MRET_0836"
                     /product="mRNA guanylyltransferase"
                     /transcript_id="XM_027627463.1"
                     /db_xref="GeneID:38737602"
     CDS             1274..2530
                     /locus_tag="MRET_0836"
                     /codon_start=1
                     /product="mRNA guanylyltransferase"
                     /protein_id="XP_027483758.1"
                     /db_xref="GeneID:38737602"
                     /translation="MQTIVPDIPGTPVTNPLQLQFLRDHVCHICNQRSPRYPGTQPVS
                     FTKSCLNRLLTEDFWVCEKSDGQRVLVLIVVRPVTGIQEVFLIDRKNMYYQVHGIFFP
                     PLSSSSQSPLTNTILDGELVVDTLAEGQTMLRLLLFDCLVMDGVNITQRPFSRRYASL
                     MLQLLPSLQNYLKFYPDARMMHPFEIQVKHMDLAHGIQMILEEKIPQLLHGNDGLIFT
                     SLESKYVYGSNTKILKWKPPQENTIDFQLQLRFPPDLKADASGATPDFRAKPTFQLWQ
                     HESGDTHVPFDYLDMDDEEWEKWKQSGEQLDDRIVECAWYPPSPDNSSLATWHIKRIR
                     DDKTTANHKTTVSRILQSIRDGVSEEELVQMVPSIRTAWKSPQRELHRNELFRSAPAN
                     NRPPRYKGTGGPPGPQHRGGFPRCKR"
     gene            complement(<2533..>3801)
                     /locus_tag="MRET_0837"
                     /note="MRES_03260"
                     /db_xref="GeneID:38737603"
     mRNA            complement(<2533..>3801)
                     /locus_tag="MRET_0837"
                     /product="tRNA-splicing endonuclease subunit Sen2"
                     /transcript_id="XM_027627464.1"
                     /db_xref="GeneID:38737603"
     CDS             complement(2533..3801)
                     /locus_tag="MRET_0837"
                     /codon_start=1
                     /product="tRNA-splicing endonuclease subunit Sen2"
                     /protein_id="XP_027483759.1"
                     /db_xref="GeneID:38737603"
                     /translation="MELARPPEIRGAGKKATQAKRKAFANPLPVGTTPIQISTQDASR
                     TWWDWFNESTKWMAENLFTSAPLYHGWYDPLTKSVWMYDKGDAMKLWTHGFFGKGSLS
                     RSEPTWSARKVAEREARERGVLTAEQMTQKRREERRLLKIERARAAVRAGIQLPDGIT
                     ALGGELREDDVQGPWQGDEDMPVVEAGVSRVKGLKYFSGDVQKTQVDRDIEDEEDPDM
                     SDLSNVEHFQLTLVEAFFLAGMLGCLQVHDNKNAVIPLATLYQLCMDSALPISSPSVP
                     SIRPDNPFLLSYIVYHHFRSLGWVVKNGTKFCVDYLLYKRGPVFSHAEFAVLVIPEYE
                     YGPDAEDTPFVQHHNGGEKSWVWFSMVNRVNTQVQKTLVLAHVKIPRITAQITNELTT
                     PDGLVKVLRRGAFRVKEISIRRWVPARMKP"
     gene            complement(<4002..>5579)
                     /locus_tag="MRET_0838"
                     /note="MRES_03265"
                     /db_xref="GeneID:38737604"
     mRNA            complement(join(<4002..4223,4275..>5579))
                     /locus_tag="MRET_0838"
                     /product="dentin sialophosphoprotein"
                     /transcript_id="XM_027627465.1"
                     /db_xref="GeneID:38737604"
     CDS             complement(join(4002..4223,4275..5579))
                     /locus_tag="MRET_0838"
                     /codon_start=1
                     /product="dentin sialophosphoprotein"
                     /protein_id="XP_027483760.1"
                     /db_xref="GeneID:38737604"
                     /translation="MRATVTMKLLNLVCVALLLAGSGHTAPVAAPNEGHREARSADAL
                     GAGRLAGSAAAAPTHDTRAVFLHERDTIHHAHHGGMRRAHRRAEPTWEPYSGTILLPH
                     SEEETETVTTTKKGKKVTTTKMRTTTDVVTKTKSVSPSQWTSTAVIAAQFTLHGQDGQ
                     SIDVVPDSDRNKGVVSIVTKTSPSEKSSTTSTTSSSHHHKHSTKSDKTTTTSTTKSSH
                     SSKSSPKSNSGSSSHSNSHSGSKSGSDSSSNSSSNAHSGSGSDSSSSSKSNSNSNSSA
                     NSGSNSNSNSNSSANSGSNSNSDSNSSANSGSNSNSDSNSSANSGSNSNSDSSANSGS
                     NSNSNSNSNSNASSGSDSGSNSKSGSSSNAHSGSGSDSNSSSNSNSSSKSGSGSGSSA
                     SSNSSSGSTSDNDDENDNDVLCDDDDDSSKLPPLLQPFPSASKASKSSSDSSSGRNAG
                     VKTSSTEKHHHTNSQKQPSAHSHKHHTKSNSHHSSKHASKASHSSKKDDDDEDCDEKE
                     "
     gene            <5973..>6454
                     /locus_tag="MRET_0839"
                     /note="MRES_03270"
                     /db_xref="GeneID:38737605"
     mRNA            join(<5973..6183,6212..6378,6404..>6454)
                     /locus_tag="MRET_0839"
                     /product="programmed cell death protein 5"
                     /transcript_id="XM_027627466.1"
                     /db_xref="GeneID:38737605"
     CDS             join(5973..6183,6212..6378,6404..6454)
                     /locus_tag="MRET_0839"
                     /codon_start=1
                     /product="programmed cell death protein 5"
                     /protein_id="XP_027483761.1"
                     /db_xref="GeneID:38737605"
                     /translation="MSDPELDAIRRARLAELRGNGMSMSSSGAMPVGQTPGMASGDDS
                     GEKAAQVDEMKRQMLSQILDSEARERLSRIALVKPQKADAISDILLRMAQSGQVRQRV
                     TEDQLILLLDQLDQASAHESGKITVTRKKTLDDEDDDWDL"
     gene            <6569..>7351
                     /locus_tag="MRET_0840"
                     /note="MRES_03275"
                     /db_xref="GeneID:38737606"
     mRNA            <6569..>7351
                     /locus_tag="MRET_0840"
                     /product="hypothetical protein"
                     /transcript_id="XM_027627467.1"
                     /db_xref="GeneID:38737606"
     CDS             6569..7351
                     /locus_tag="MRET_0840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027483818.1"
                     /db_xref="GeneID:38737606"
                     /translation="MPRLYLRMPKSMVTKYVTSFLGFMDIKVGCQIISLFSLFNKIAG
                     VYGIMAMFQGGSFSQLSLYIYSIATIPIFIWGLKVMSDEKHQAALKYAHLYFLDHLIS
                     TGWMVLFGFWWYGFAQHDGRPISNSSHQADIMSLIESLESHYRTPEQMAQFHHSTIDV
                     NTPEGASEAMLRAQRARQIWQAERGFAACVLILGWAVKIYFAVLLYAYALHLRHGTYW
                     MLPLSKSRRANAVHASAYQTVPNENDEVALPTEQGDESKTRS"
     gene            complement(<7732..>10218)
                     /locus_tag="MRET_0841"
                     /note="MRES_03280"
                     /db_xref="GeneID:38737607"
     mRNA            complement(<7732..>10218)
                     /locus_tag="MRET_0841"
                     /product="RanBD"
                     /transcript_id="XM_027627468.1"
                     /db_xref="GeneID:38737607"
     CDS             complement(7732..10218)
                     /locus_tag="MRET_0841"
                     /codon_start=1
                     /product="RanBD"
                     /protein_id="XP_027483817.1"
                     /db_xref="GeneID:38737607"
                     /translation="MSHRGEQGGEAPGLPRSQSLVQGLFGWMSPFRHGRGDTSMEEDD
                     DGEDTFAEASEGPTPEEVVPAPTPSPDVSLRSNPSPYARRPWTPKVPPSPSASMVFHP
                     GSFETPTKRTPVASVPFSSSPFSTTRNSPGRRHAPIYFGPGTSTRKAHSPLRSTIPAT
                     HSMSAIPREPMLTTPEKRRKTQESTEASSVAFEKPAEEPEVPVRRSTRAASAMRQVLD
                     SMQPVAPPAAPKPAVPEVVNPYQTRSKSTRPSRPTLSTRAKALEAARQRASKTASPPP
                     EKPSSLLDVVERTEPRRSSRLSTQDTPLWHVTNKPKRPSPLAMNTLEQADADVPASGS
                     MYDTIPPSMSDASLVPQLTSRLPKSATARDVSTVAKRPRDTVEDVAGPTPSEEPKGGT
                     ESQEPKQDPTPVPAPQPAPAPSPARVAAPAAAPVDVPSWCIVTPPTRREMPKGLSEDQ
                     IQALNVPYNDLAVFSFDVAPAKCDGTFAQVPSSTLKDTSKPLMDAETKSASFATEAPK
                     MSSEAQPSSLKAAGEVPKPAATPAFGSTETTPSFTFGTQAQPSSEAPKPSFTFGAPAK
                     PSSEASKPSFTFGAPAKPSSEASKPSFTFGAQATSSSEAPKPSFSFGASAKPSSEASK
                     PSFTFGAQATSSSSEAPKPSFSFGASAKPSFTFGASTKPSVESTETKSSGNAVKPSFS
                     FSSQAPVAPSVPSSVPAAETSSDAGAPDTNALTSQGQGEEDETTSHEVRAKIWRLDGG
                     QWQDMGVCILRIKTSKETSKSRVLARNAVNGNVVLNFALYEGLRVTCEKSVLLFLGFV
                     DAKPCNLRCKVKTNEAAESLKEALMSHVNH"
     gene            <10324..>12624
                     /locus_tag="MRET_0842"
                     /note="MRES_03285"
                     /db_xref="GeneID:38737608"
     mRNA            <10324..>12624
                     /locus_tag="MRET_0842"
                     /product="translation initiation factor eIF-2B subunit
                     epsilon"
                     /transcript_id="XM_027627469.1"
                     /db_xref="GeneID:38737608"
     CDS             10324..12624
                     /locus_tag="MRET_0842"
                     /codon_start=1
                     /product="translation initiation factor eIF-2B subunit
                     epsilon"
                     /protein_id="XP_027483820.1"
                     /db_xref="GeneID:38737608"
                     /translation="MAPDDVRQEDPLQAVVLCDVFTQRFAPLTLDQPRCLMPVCNVPL
                     IEWTLESLATAGVHEVFLLATWHIGQIRAYMEKHHPLLFRPQGSRSQGMTSTALTRIT
                     LIPVPEARSVGDTMRELDAHQVIKSDFVLVQSDALGNMDIASVVRAHKQRRTVDRDAI
                     MTICAMPVPPQSRARRPGDLSVFTIVPTTSQLVHYMSVPAIPRVPLLKLPFEVFEDTR
                     HLDVRNDLVDCGVDVCSIDVPPLFTENFDYQQLRREFVQGILSSDLLESKIFVHITPP
                     AGSSSTSSGEPFSAVSGGVLGTPPYGAGYMLRISDPSRYDAVSRDVLAGWTYPYTPRL
                     GMPDGTKYASLPGSRFYGDRVATASTAAIGHRTLLGAHTRVDEHTIVSESVLGHRVSV
                     GPSSAVRNSYLWDDVAIGRNCVIDGCILGRGVLILDHVHLTHGTMVGDGCVIGPDASL
                     PAFSRVSMHGYRACEDDSDTEAADADADTTLGKASRGCLWPPITTRSASADEDEDEDE
                     RDELERPCNAKLFMIRPDTSDVVLSDAMSDLSSIDADTEPDLNSESEDEDDSDTSSPN
                     SWSAYGSMSLTLPDGTNSLTYGEKRETQERLNEFRQEARASLERAFEEKHAPDNAAIE
                     LKTLRMASNVPPGEVRRMVVSFLLGRCAVDKAKETADLLDHWGPLLQEVAQDDQVEAL
                     ALIQSYCAVHVTHTRLFLPLLKKVYNDELVSDESILAWWKHPSSRRVVYEDHDTEDAH
                     QIVLELRKRAEPVVRHILEDDDDDDE"
     gene            complement(<12625..>13308)
                     /locus_tag="MRET_0843"
                     /db_xref="GeneID:38737609"
     mRNA            complement(<12625..>13308)
                     /locus_tag="MRET_0843"
                     /product="phosphopantothenoylcysteine decarboxylase"
                     /transcript_id="XM_027627470.1"
                     /db_xref="GeneID:38737609"
     CDS             complement(12625..13308)
                     /locus_tag="MRET_0843"
                     /codon_start=1
                     /product="phosphopantothenoylcysteine decarboxylase"
                     /protein_id="XP_027483819.1"
                     /db_xref="GeneID:38737609"
                     /translation="MTHVPRSLQGAYAPLSVPPTKERPLHVVLACTGSVASIKVPLMA
                     ERLVTQYAHVHVYVVATTSSRHFFSMPRSAFTVHDLAEMNRTGVQKDQAPRVHVWTDE
                     DEWQAWQQMGDPVLHIELRRWADLVLIAPCSANTLAKLSQGLCDNVLTSMMRAVSPAT
                     PVWVFPAMNTLMYLHPLTAQHIKTIESFGYKVYGPISKRLACGDMGEGAMYEWTAIVE
                     KVAHTFALT"
     gene            complement(<13311..>14624)
                     /locus_tag="MRET_0844"
                     /note="MRES_03290"
                     /db_xref="GeneID:38737610"
     mRNA            complement(<13311..>14624)
                     /locus_tag="MRET_0844"
                     /product="L-galactose dehydrogenase"
                     /transcript_id="XM_027627471.1"
                     /db_xref="GeneID:38737610"
     CDS             complement(13311..14624)
                     /locus_tag="MRET_0844"
                     /codon_start=1
                     /product="L-galactose dehydrogenase"
                     /protein_id="XP_027483814.1"
                     /db_xref="GeneID:38737610"
                     /translation="MPIHPEQDPPLEAFGPIVPLDALPDDQIEGPLPWDRPARPLTDF
                     ATQASPLLFGGGVFGQGMYNEDRVLYSDEAVRALRLAFRYGINALDSSPYYFPSEFVL
                     GRALRILAPEYPRSSYFLITKCGRYGPDKHMFDYTPERISSSIHQSLARLGTDYLDVA
                     LLHDIEFVSEQPVEAQTAPDAGWLEACAVQKSAHMPQEEALRRLGVLPQDAGRIRGPG
                     DEAVLEAARALFRLQDQGKVKHVGISGYPLGELLRIARLIASHPPYRCLDVVLSYSHH
                     TLHSDVLPAWQALFEQPVSESWRAPWILNASPFSMGLFSDRGPPAWHPAGADLQEATK
                     AAWQTVKADAALPGSCIDPQVVMGCTALFRGIHGAHTRTPAGIPHLRTLIGMSNVDEV
                     HAAIRVYRILCEPHSAIHQQLVRYERLVRTYIVEANAADRAWPSP"
     gene            <14759..>16009
                     /locus_tag="MRET_0845"
                     /note="MRES_03295"
                     /db_xref="GeneID:38737611"
     mRNA            <14759..>16009
                     /locus_tag="MRET_0845"
                     /product="phosphoglycerate kinase"
                     /transcript_id="XM_027627472.1"
                     /db_xref="GeneID:38737611"
     CDS             14759..16009
                     /locus_tag="MRET_0845"
                     /codon_start=1
                     /product="phosphoglycerate kinase"
                     /protein_id="XP_027483813.1"
                     /db_xref="GeneID:38737611"
                     /translation="MSLSTKLAITDVDLTDKRVLMRVDFNVPLDGDRITNNQRIVAAL
                     PTIKYALEHKAKAVVLMSHLGRPEGQKQDKFSLKPVVPELSRLLNKDVQFLPDCVGPE
                     VEKAVNAATGGAVILLENVRFYIEEEGKGKDANGEKVKADKDAVAKFRASLTKLGDVY
                     VNDAFGSAHRAHSSVVGVELPQRASGFLMKKELDFFAKALESPERPFLAILGGAKISD
                     KIQLIDNMLDKVNMLIIGGGMAFTFKKVLNNMNIGNSLYDEEGAKKVNDLVAKAQQNK
                     VELFLPVDFVTADKFDKDAQVGAATDESGIPDGWMGLDIGEKSREIFKGAVLKAKTIL
                     WNGPPGVFEFDNFAGGSQAVLQACVDAEKNGSTVIVGGGDTATVVAKYDAQEHISHVS
                     TGGGASLELLEGKELPGVAGLSQK"
     gene            complement(<15996..>18266)
                     /locus_tag="MRET_0846"
                     /note="MRES_03300"
                     /db_xref="GeneID:38737612"
     mRNA            complement(<15996..>18266)
                     /locus_tag="MRET_0846"
                     /product="AMP deaminase"
                     /transcript_id="XM_027627473.1"
                     /db_xref="GeneID:38737612"
     CDS             complement(15996..18266)
                     /locus_tag="MRET_0846"
                     /codon_start=1
                     /product="AMP deaminase"
                     /protein_id="XP_027483816.1"
                     /db_xref="GeneID:38737612"
                     /translation="MTHDGRYEENVDVYTSARNDMATATALAAQAGSTLPTIGMKNMS
                     LSDDAQAQPLMSLAPHMPPECEPLFSSLQTCLRMRDKYMNESLQGHLHDNPKNWDAEY
                     CADWAAEHRVPWTPPSPNVAPGSVRIDGCAMDAERERPKPWRIYPPPPRPHWEQFVPA
                     PASTFVREAETGVPLHTPLEPASQANVLAAQELLESCGGVPGEFRMEHIDLPPKHSIQ
                     GADVQFGLVDGVFQVWTDESRLTHVTPSDEWFHDLDVLRSITSDGPAKSFAWRRLKYL
                     EGKWNLYKLLNEYRESDFLKRVSHRDFYNVRKVDTHVHHSASMNQKHLLRFIKSKIKR
                     HSDDVVLHQGGKPMTLRDVFQLLGLTAYDLSIDTLDMHAHQDSFHRFDRFNLKYNPIG
                     ESKLREIFLKTDNYIKGRYLAEITREVTHDLEQSKYQMCEYRISIYGRHPHEWDKLAC
                     WVVDHHLFSPNVRWLIQVPRLYEVYKANGNVTHFEELLDNVFRPLFEVTRDPSSHPKL
                     HIMLQRVVGFDVVDDESKPEHRFVRHFPPPRQWNDSTSPPYSYWLYYLYANLATLNQW
                     RRIRCFNTLVLRPHAGEAGDPDHLAAAYLTSQSISHGILLRKVPVLQYLYYLKQIPLA
                     MSPLSNNALFLSYERNPFPEYFRKGLVVTLSTDDPLQFHLSKEPLLEEYSVATQIYKL
                     SSTDMCELARNSVLQSGWEMEIKRHWLGKYFYRPGATGNDVSKTNVPDLRLQYRSETL
                     RQELAFIWQEKASTSG"
     gene            <18351..>19697
                     /locus_tag="MRET_0847"
                     /note="MRES_03305"
                     /db_xref="GeneID:38737613"
     mRNA            <18351..>19697
                     /locus_tag="MRET_0847"
                     /product="merozoite surface protein msp-1"
                     /transcript_id="XM_027627474.1"
                     /db_xref="GeneID:38737613"
     CDS             18351..19697
                     /locus_tag="MRET_0847"
                     /codon_start=1
                     /product="merozoite surface protein msp-1"
                     /protein_id="XP_027483815.1"
                     /db_xref="GeneID:38737613"
                     /translation="MDASLASIRTALEQLHAQNVATISHAKRPAYFTNAVLNPQRLDI
                     LELIRDADAFEASLYVSAPPEPTPGPSTAPAEPKPHFRAVPVPTPLKQSHQADSDART
                     YLLAAEKLLQNYHNAPRARKHIRMLLKRDAELQRHISRYHATIDQAGKAQQFARTPPP
                     PPTRAKRSEALQAEIQREKMEILALESMLSEKETAPPTTPAARSPRPAPTPQRTPRRA
                     SPAKSPALSKSVAAPPTPRTPKNARPLAQSVSSPRTPTTRVSPPKTQPTASPSLVPLG
                     VVPTATPELERITTRIWDLFGEHVRYAAPGCKAASFPDTFAILRALEQGGPQAMEVDV
                     HGDAPNPSVPPSVGIMMMAHVLLLLMRTPPPYTLSLPLIKSYSDKWWKQEGQATIRAG
                     IQDMSTRNQLIQQLGIDAADLDQTGDALATRAVYGLVAKKLLRIQRTGGAANVRFA"
     gene            complement(<19608..>20810)
                     /locus_tag="MRET_0848"
                     /db_xref="GeneID:38737614"
     mRNA            complement(<19608..>20810)
                     /locus_tag="MRET_0848"
                     /product="zinc finger protein"
                     /transcript_id="XM_027627475.1"
                     /db_xref="GeneID:38737614"
     CDS             complement(19608..20810)
                     /locus_tag="MRET_0848"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_027483822.1"
                     /db_xref="GeneID:38737614"
                     /translation="MSVADLYHIRRAIRRDAGVGYVPASLSRQGRARLCGLCFTSEAS
                     YTCPRCHVPYCSLPCYRSHACSAALAERTARSLSQEDVRVDEAERAKTLELLWRLETG
                     EGVAEDDEPSDDDDTPEHLLRKLTVAERDQFAQLLQNPEKAAKMYFHDGAQVLWWQAD
                     TVVAPVSLPWNEGCARTPIDLRFHVLYVCLAYTYVLRHFGISSLACVGDEYQACRQML
                     MDLVPFFAPKHSRMTLHSAQEASLYFLQMVGLTRQEPLPLLLSLLRSVADLVQPRAVH
                     EVDQAPFAYTLWALADMHALLRNQVLPAKKLAFYAACVHPGGAADVASLHARIEAYIA
                     RLEREQDERVHAEHVANAHAYVERMDPRAQPKPRREGLSETHVGRATRALDPQELLGH
                     KAIDGARR"
     gene            complement(<20837..>21913)
                     /locus_tag="MRET_0849"
                     /note="MRES_03310"
                     /db_xref="GeneID:38737615"
     mRNA            complement(<20837..>21913)
                     /locus_tag="MRET_0849"
                     /product="pyridoxine kinase"
                     /transcript_id="XM_027627476.1"
                     /db_xref="GeneID:38737615"
     CDS             complement(20837..21913)
                     /locus_tag="MRET_0849"
                     /codon_start=1
                     /product="pyridoxine kinase"
                     /protein_id="XP_027483821.1"
                     /db_xref="GeneID:38737615"
                     /translation="MTTEAVPSHRLLTIQSHVVCGYVGNRSATFPSQLLGWDVDVVNT
                     VQFSNHTGYGRWGGQRIEAAALADVLEGMERNGLLRQNRVLTGYTPSSEALSVVEAFI
                     RRLRQEKPDMIYLLDPVMGDMDRGMYVNPDVLPVYRRLLPLSTIICPNQFEAQVLAGQ
                     DITSLASLHQVLDTLHMTYGVPHVVITSLELPADDMEKLGMKSTMPDGKPAMLLVGSS
                     RQERPWYLTFPSQGEYFSGVGDLFAALVLARFAEHASELPEPARASFEACVSRDASNI
                     KLSPIARAVTLAVASLQHVLDGTRAAMEAEGQRLGIDPFVPAHLASVDDRVRIMRLRE
                     LRVVQNPGAFLHPSILGRPRWLPL"
     gene            <21987..>22541
                     /locus_tag="MRET_0850"
                     /note="MRES_03315"
                     /db_xref="GeneID:38737616"
     mRNA            <21987..>22541
                     /locus_tag="MRET_0850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627477.1"
                     /db_xref="GeneID:38737616"
     CDS             21987..22541
                     /locus_tag="MRET_0850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483869.1"
                     /db_xref="GeneID:38737616"
                     /translation="MPDPGPRHDASLQMPPRQVFASQRHAHMLGKDAAAAGRAKGLDM
                     ALLAQQKRRIEDASADVDLDAARAEGQRAAQAKAEAVARAAEHRAKFRKLKQETPDIV
                     YIHGKRMRKKKKAPPPELPPPTQEMPLPSQAPAPALHEDPDIFGEVGVWDGLSETEPS
                     STVTTSTSHDWFGTPRRPSPAPPA"
     gene            <22729..>26811
                     /locus_tag="MRET_0851"
                     /note="MRES_03320"
                     /db_xref="GeneID:38737617"
     mRNA            <22729..>26811
                     /locus_tag="MRET_0851"
                     /product="DNA polymerase alpha subunit A"
                     /transcript_id="XM_027627478.1"
                     /db_xref="GeneID:38737617"
     CDS             22729..26811
                     /locus_tag="MRET_0851"
                     /codon_start=1
                     /product="DNA polymerase alpha subunit A"
                     /protein_id="XP_027483870.1"
                     /db_xref="GeneID:38737617"
                     /translation="MASRAQRLEALAALKAARQGGVVPSKVEEDDDGAIYDEVTEETY
                     QSLVRGRMMEDDFIEDDDGSGYVDHGQDEWAQAQSESDTEDERDYYERTGRKKPKKKG
                     ARRVARHALPHDYLGPRHEVRRAVPAPSKESEDAFMSKLFGGLEHMSTPARPMATLAL
                     DESHDSPSLAMARKRKQLHTPTTLPSLVPDLSSSTEPSSDALDDSWSDEASKKRKSDT
                     PPMDEDDDFGMVTARRQDPLEAATRTSKPVHAPETPTHLQTWRSVHDGLATESTPVAT
                     PYHAATKQVPCFEEDGSVHFYWFDYYDDLHGTFLLLGKVLDKATGRFVSASVAIDGME
                     RCLFLQPRPRIVVDGHETDRVPGEDEVMEEFESMRQRYGIQSWIGKWVSRKYAFELPD
                     VPREGSYLKVKYGFDEPALPADVSGSTFCRAFGAHTSAFELFVVKRRIMGPCWLRLER
                     ANVRQGAPQTWTKMELSVDEPKCVAPFADTDAHAPKDAPPLTIMSLALRSVVNFKENK
                     REIVAVSARVWRDMALEHPTPPEQCPSTAFTAVRPLGPSFPPRFEQQAQQSPTKIKAF
                     KYERMVLNHLLSQIQLHDADVILSHDLVGSTLDILLHRLRDLHCDQWTRLGRMRHESK
                     GKWHPVRALVGRLVADLSSDTAKGMIASTTWSLSEMCRTHLNTQREDIDPEDVPSFFD
                     CTAPTPERLLTFVKHCEVDAFFQMAIASKVQLLALTKQLTNLAGNAWSRTLNGGRAER
                     NEYILLHEFHKKKYLCPDKERKTPSDKKEKFKGGLVFEPKRGLWDKYVLVMDFNSLYP
                     SIIQEFNIDFTTVERHGDDVPPAPSSDVAQGVLPHLIATLVNRRRQVKALMKDKHAPA
                     LKQLQWNIKQQALKLTANSMYGCLGYENSRFYARPLAALTTFKGREILSTTRELAESM
                     SLDVIYGDTDSVMINTRCVDYDAAIKLGHEFRRAVNERYRLLEIDIDGVFQRMLLLQK
                     KKYAALLVNEGGDTSTEIKGLDMKRREYCALSKQASAYVLEQILSGDATETVVERIHE
                     YLQQLASDVREGRIPLDDYVIYKRLGKRPQDYPDAQNQPHVQVALRMLAKNESARSGD
                     VIPYVFCVGSDAKHQAERAFHPDDVRRHPDDPTYAIDYKHYLSLQILPPIERLADSLE
                     GSDRSRLAACLGLDVHTSHASEREFATLDSQVPSSVRFAHCDALHVRCPQCSHTSSVR
                     PLAHSARSEAAWLACEACHAPWPLASLVVQLQLAIRAHIAQYYQGIATCSEPSCRATS
                     DMTGVYSGRCVVAGCRGKVVAQYTDKALYTQLCFFAYLFDAAQAVAETRDTAQQTRLQ
                     SIVDAHRADIDALHGTVQSYLARNGRRFVGLGKLFSFMRM"
     gene            complement(<26794..>27369)
                     /locus_tag="MRET_0852"
                     /db_xref="GeneID:38737618"
     mRNA            complement(<26794..>27369)
                     /locus_tag="MRET_0852"
                     /product="centromere protein Scm3"
                     /transcript_id="XM_027627479.1"
                     /db_xref="GeneID:38737618"
     CDS             complement(26794..27369)
                     /locus_tag="MRET_0852"
                     /codon_start=1
                     /product="centromere protein Scm3"
                     /protein_id="XP_027483867.1"
                     /db_xref="GeneID:38737618"
                     /translation="MSQPCDNAFLQQSLGLGHESRPPRKPVFGSDRPLTFPSPPRAAP
                     GEEDSLAYARHESAERLRLKWESIYERFQHAHLEDQDEIYLGRADDKIRLIKDRGSLR
                     ALHKQLRFGSFMSEQEREALSMDWIEAEERPPPPPPPPALSDPDVAWELDIYRSVKRD
                     AIDSLLRTNTLGRAPLPYSIPGLASLLHTHE"
     gene            <27445..>27974
                     /locus_tag="MRET_0853"
                     /db_xref="GeneID:38737619"
     mRNA            join(<27445..27483,27513..>27974)
                     /locus_tag="MRET_0853"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627480.1"
                     /db_xref="GeneID:38737619"
     CDS             join(27445..27483,27513..27974)
                     /locus_tag="MRET_0853"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483868.1"
                     /db_xref="GeneID:38737619"
                     /translation="MSLSKERREVLCVLQRVLAICHVYTYFLDGLLLLLILRTLILFQ
                     FMRLYLWPRQRVPAHARFLTVFQAACAIAHVVCHTDPSRKRLLFDFVGQDHVASKGHL
                     LCIDAVIAGLHMLLMYIAAEEASSFQDAQHSNALDLTDTERATQSPGEEPTALPPTTM
                     PVAVVR"
     gene            complement(<28298..>28705)
                     /locus_tag="MRET_0854"
                     /note="MRES_03325"
                     /db_xref="GeneID:38737620"
     mRNA            complement(join(<28298..28302,28330..28507,28541..28669,
                     28703..>28705))
                     /locus_tag="MRET_0854"
                     /product="large subunit ribosomal protein L35Ae"
                     /transcript_id="XM_027627481.1"
                     /db_xref="GeneID:38737620"
     CDS             complement(join(28298..28302,28330..28507,28541..28669,
                     28703..28705))
                     /locus_tag="MRET_0854"
                     /codon_start=1
                     /product="large subunit ribosomal protein L35Ae"
                     /protein_id="XP_027483865.1"
                     /db_xref="GeneID:38737620"
                     /translation="MTRLYCKGRIMSHRRGKRTMHPNVTLLKIEGVETTKDAQFYLGK
                     RVAYIYKPATQVRGSKYRVIWGRVTRTHGNSGVVRSKFRSNIPPAAFGASVRVLLYPS
                     NI"
     gene            <28914..>29320
                     /locus_tag="MRET_0855"
                     /note="MRES_03330"
                     /db_xref="GeneID:38737621"
     mRNA            join(<28914..28959,28986..>29320)
                     /locus_tag="MRET_0855"
                     /product="bud site selection protein 20"
                     /transcript_id="XM_027627482.1"
                     /db_xref="GeneID:38737621"
     CDS             join(28914..28959,28986..29320)
                     /locus_tag="MRET_0855"
                     /codon_start=1
                     /product="bud site selection protein 20"
                     /protein_id="XP_027483866.1"
                     /db_xref="GeneID:38737621"
                     /translation="MGQVARRKRTHHARRDVSRAARTRARKLDYDQRYENATNASKRQ
                     LLEAPTELDPDKAGLGMFYCVECDRHFPNANDRNAHLSSKQHKRIAKKLLTEKPYTHE
                     EALLGAGIGIDNKQRNSDTIETEL"
     gene            <29417..>30535
                     /locus_tag="MRET_0856"
                     /note="MRES_03335"
                     /db_xref="GeneID:38737622"
     mRNA            <29417..>30535
                     /locus_tag="MRET_0856"
                     /product="FAD dependent oxidoreductase"
                     /transcript_id="XM_027627483.1"
                     /db_xref="GeneID:38737622"
     CDS             29417..30535
                     /locus_tag="MRET_0856"
                     /codon_start=1
                     /product="FAD dependent oxidoreductase"
                     /protein_id="XP_027483863.1"
                     /db_xref="GeneID:38737622"
                     /translation="MPPTQAVVVGAGVLGLTSALYLRKKGYAVTVLARELPEDAASQS
                     FASPWAGANWCSFARNNMAERRWDEYTYKQFQKLAKELPEDLLTFMPFTCYDVKPNDT
                     ETYWFGEVCGGIQEEYAPKHPAAAEAPYMYKFRSLTLDAPRYLRWLATQVTCPGGQGP
                     PGKIERVTKLRSLKTAVDLVPRASLVVNATGLGSQDIPEAAETQAYPIRGQTVLVHAP
                     RFRDANVAHCASKISSQGASYVIPRARSGYVILGGTFHKHVSNPLTPDQQVTERILKD
                     AVQLAPDLLPEHVRADDADAWKSLDVVGVNIGVRPARAGGARVALDEQPLEMHGRRVG
                     VIHAYGIGPAGYQASHGIAAEVCEWADRWEAQARRAHL"
     gene            complement(<31043..>31748)
                     /locus_tag="MRET_0857"
                     /note="MRES_03340"
                     /db_xref="GeneID:38737623"
     mRNA            complement(join(<31043..31710,31736..>31748))
                     /locus_tag="MRET_0857"
                     /product="DUF1014 domain protein"
                     /transcript_id="XM_027627484.1"
                     /db_xref="GeneID:38737623"
     CDS             complement(join(31043..31710,31736..31748))
                     /locus_tag="MRET_0857"
                     /codon_start=1
                     /product="DUF1014 domain protein"
                     /protein_id="XP_027483864.1"
                     /db_xref="GeneID:38737623"
                     /translation="MAPKLNPKAVAGRARKAEAAERKAEEAAAAAEAEEDRKWQQGAR
                     GKTAADSRNEKAAEKARKKAELDRLKQEDEANTPGKASSGKGGGKSGGGGKGVNRDAL
                     DDIDMQIAALNATNLDDALEAMELVNAKSDKASRGAAAGNIERHPERRFKAAFEAYKE
                     RELPKLREERPGLRLQQYNEAMYKSFQKSSENPFNQLHVSYDATKEEKLAILKAKREA
                     TALRLGTK"
     gene            <31844..>33562
                     /locus_tag="MRET_0858"
                     /note="MRES_03345"
                     /db_xref="GeneID:38737624"
     mRNA            <31844..>33562
                     /locus_tag="MRET_0858"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627485.1"
                     /db_xref="GeneID:38737624"
     CDS             31844..33562
                     /locus_tag="MRET_0858"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483871.1"
                     /db_xref="GeneID:38737624"
                     /translation="MTSDPVAEARSLLHRIRALGAVEVGKPETWHALEPEDRTALTGA
                     CNASDAERIVSQQTGALQQRISQLRAQFGDQMKKAWQVPTEVLNEEGLPFVDPLETLP
                     DSPPQSPHRLSDPPPPTGNVLGRVPGRIVPFDPTLHGDDRRAWMNSIMDQLEQEEQAE
                     EAQHAPAPLSLRRGFLQRESRPKKQAPPAEPERPVNVPPGMDPEDAGTYEEAARIVEL
                     LGPQVIQGHPNAERIFAEMEASQPHIVQKTEPAPAPSAKPPIGDVVVERAADAPTERT
                     SSSTRRPSAFKQRMRKDTLPSAPSVSQGVSAIERAGRADDEMAEQRRQQGLPPRVPHA
                     RPTKAYAAKLAHKAESTEMDVDEKPNRRVRFGGEEVYPPEEPEEHEEEEEHEEEEDGD
                     SDGAPWTSEDDMIWDSDEAYDSDDLEALKPSMDGHPDDAFWTEELAREYAEAKARLSL
                     PVSRSTHDQVDDTEDTYGLAPLSSQPRVSRFKAARMSGESVPDPNGQVAEMSANERTM
                     PMMVLPSLAPVRFPRPLAEDDRDLEGESDEDDERLHALMRARMSMQAAEEPSRAPQRP
                     PQVGRA"
     gene            complement(<33579..>34250)
                     /locus_tag="MRET_0859"
                     /note="MRES_03350"
                     /db_xref="GeneID:38737625"
     mRNA            complement(<33579..>34250)
                     /locus_tag="MRET_0859"
                     /product="large subunit ribosomal protein L27"
                     /transcript_id="XM_027627486.1"
                     /db_xref="GeneID:38737625"
     CDS             complement(33579..34250)
                     /locus_tag="MRET_0859"
                     /codon_start=1
                     /product="large subunit ribosomal protein L27"
                     /protein_id="XP_027483872.1"
                     /db_xref="GeneID:38737625"
                     /translation="MRPALFSGALGAAYNASLRIATPVPTALMPSAALARSSLRATDL
                     PAFTFGAAVQTRNSAKRGGGTTKNNRNSAGRRLGVKRAGSTAVIPGNIIVRQRGTEWH
                     PGEHVHMGRDHTLHAAVPGFVRFYKPLPRGPPKQAMPSMNGLPLRLSERRTVHAPSPE
                     SARPHPSSRKRERRYVGVVLHPHEQLPRDPSQPRSRLFDKIDLHALEREKELIRQGYE
                     PLAMM"
     gene            <34363..>35046
                     /locus_tag="MRET_0860"
                     /note="MRES_03355"
                     /db_xref="GeneID:38737626"
     mRNA            <34363..>35046
                     /locus_tag="MRET_0860"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM23"
                     /transcript_id="XM_027627487.1"
                     /db_xref="GeneID:38737626"
     CDS             34363..35046
                     /locus_tag="MRET_0860"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM23"
                     /protein_id="XP_027483926.1"
                     /db_xref="GeneID:38737626"
                     /translation="MWPFSSSSERAAPPATADVPASNDATEYLRTHSFEKSAPADAAT
                     HQEAPTAAGLLRNTALDPAKLHPFANIKDDLEYLDFDEGKPIEGGKTLIHTNNFTDAL
                     CYGTGTTYAGGLALGALVGLREGMTRPLGVDSPTFRLRMNAILNQVSRRASLLSNSGG
                     VLAMTYNIFDGTIDYYRGKHDIWGSVAAGALTGAMFRCTAGVRSMLVSSTIMMGVAAT
                     WTACKQSFL"
     gene            complement(<35048..>36502)
                     /locus_tag="MRET_0861"
                     /note="MRES_03360"
                     /db_xref="GeneID:38737627"
     mRNA            complement(<35048..>36502)
                     /locus_tag="MRET_0861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627488.1"
                     /db_xref="GeneID:38737627"
     CDS             complement(35048..36502)
                     /locus_tag="MRET_0861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483925.1"
                     /db_xref="GeneID:38737627"
                     /translation="MVPFLSAASSASMAPSTRSAEPKLASVSYVALDAIAAGICGTPF
                     YDTEFIVPHKGRDETLYAHSHVIKTSCPTLYRMIQKNSTLRLDSMEVQTALPSAAAST
                     AGGDTASLTPSCITEETFADAPSEEETEYADDDDTIEEESIMSVPASTQEPSSGRVPP
                     GVVPTRASMRGPEAPPKLSSPIHIQGSEASLPSIPKSLAPIANNAARRGPESFRGASF
                     FKSLRKKKDTIQDSEPIAELEQARLRHAEPNTPMTGTLAAPPALPRASAPPTESAEAG
                     PRRARHASAASVQHAGRTSSRASRTTRSAGRSRPSSHGRVPGVRRVVVRGVSPRTLQA
                     LLFYLYTNQVHFVTMPHIPPHGHLNEIHEEALAHLGDGSRQNAGVWPPAFSNKAAYCL
                     GQQLDLPDLKLRAFDSISQNMSVRSVLADLLSPFGDRFGDVQRVHLDFIMQHWDEVKT
                     RPDFVPIVENLAHGQYPKSSASLFQLFSKLSVQP"
     gene            <36681..>37421
                     /locus_tag="MRET_0862"
                     /note="MRES_03365"
                     /db_xref="GeneID:38737628"
     mRNA            join(<36681..36947,36972..>37421)
                     /locus_tag="MRET_0862"
                     /product="multi-transmembrane subunit of the DSC ubiquitin
                     ligase complex"
                     /transcript_id="XM_027627489.1"
                     /db_xref="GeneID:38737628"
     CDS             join(36681..36947,36972..37421)
                     /locus_tag="MRET_0862"
                     /codon_start=1
                     /product="multi-transmembrane subunit of the DSC ubiquitin
                     ligase complex"
                     /protein_id="XP_027483924.1"
                     /db_xref="GeneID:38737628"
                     /translation="MAVVGFAYAPLTKVVMAGLCLTSLLVSLLSLKLYIPFRLHPHIL
                     VYHQYWQAWAYHVAFTNSSELFLGIMILYYGARHVERACGSRKYGMLLLCMALMHSLF
                     SVAWGWVAIRLAPLGPSFWYEAFHTGYLPAGPFGVLGALVCLYYRITPPLWTISVYGT
                     ELTDRILVSVPLGLLALSQPPYSCISVVLGMLASHLYSLDAAFQVPARFASLLQRASA
                     PWIGSQPVPMRGSEAQYHRI"
     gene            <37466..>39265
                     /locus_tag="MRET_0863"
                     /note="MRES_03370"
                     /db_xref="GeneID:38737629"
     mRNA            <37466..>39265
                     /locus_tag="MRET_0863"
                     /product="fungal domain of unknown function (DUF1712)"
                     /transcript_id="XM_027627490.1"
                     /db_xref="GeneID:38737629"
     CDS             37466..39265
                     /locus_tag="MRET_0863"
                     /codon_start=1
                     /product="fungal domain of unknown function (DUF1712)"
                     /protein_id="XP_027483923.1"
                     /db_xref="GeneID:38737629"
                     /translation="MMVPDAWRFWQASSSGAYVPAQVQYVMLFSPVLTEHLGAEDPAR
                     LIGQLLTCTSRESAVSHVQTVRRIALANAFIDFGTSMQHHCRPEASDEMRTLAIHSSH
                     RRFYLVEVVPDMWLHACVTLAQKDGEALPYLVDAWMQRQMLDAWHGWRLQHGSPHELM
                     RTHGREALEHRLESYFSKWAWLWDVDAQYAPMLRASKPPGMPPGLLTETTPTLPLVPD
                     VVPDDLALPLSWFAEKGQSMDTPAPMDLLLLYDDKLLWPRTHPTGSALLSPQDRRHVA
                     RYVLERLVGLDAERAKAALVKPRQAPHDTALSDLPYVAAMLGEMPSSMEWPRPPSGQD
                     VPPTAFQALHEQLEALDAPTPADQAARQLEDITRAYARTSTMRARRRVGTVPQHDPPP
                     SSWYDAHDVPVVPHDFALDGWGPETPMLSRHATLHVKAHDAEPLGASSSSSRPVDVMY
                     MTRQLLTVVLVWDRGRLDADERRTWESPAWDLLRRVQRALHDVQRRTPSERVPFVCID
                     EAAAQCLNGLTPIPSGAEAQLLTAQSWMNGGASETLARADNHSFWVASRHAKDTSTRI
                     FVALHGNEQRRYGVSECDQQMRRLAAQHREWGL"
     gene            complement(<39262..>39864)
                     /locus_tag="MRET_0864"
                     /note="MRES_03375"
                     /db_xref="GeneID:38737630"
     mRNA            complement(<39262..>39864)
                     /locus_tag="MRET_0864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627491.1"
                     /db_xref="GeneID:38737630"
     CDS             complement(39262..39864)
                     /locus_tag="MRET_0864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483930.1"
                     /db_xref="GeneID:38737630"
                     /translation="MVAGGKAPSPPPSMWRVRLSPVWRAMRPLARAYTALRDPDGATG
                     LYYHRLPRGTWAVSLLERAPPCESSADVICELPTTGDAPSEYLRANPDAPRNNGAFWD
                     ALHRVLKEATADDDQLRTEAVLRTDGWAHLSDERTEAMPGRTTPPEDILGSVAFTDER
                     VVPSSYERNDMYRFCVAHQGPMKLKDTWRAKVRAYLQTLP"
     gene            <39863..>41227
                     /locus_tag="MRET_0865"
                     /note="MRES_03380"
                     /db_xref="GeneID:38737631"
     mRNA            <39863..>41227
                     /locus_tag="MRET_0865"
                     /product="prephenate dehydrogenase (NADP+)"
                     /transcript_id="XM_027627492.1"
                     /db_xref="GeneID:38737631"
     CDS             39863..41227
                     /locus_tag="MRET_0865"
                     /codon_start=1
                     /product="prephenate dehydrogenase (NADP+)"
                     /protein_id="XP_027483929.1"
                     /db_xref="GeneID:38737631"
                     /translation="MGDPATCQIGIIGMGDMGRLYALRLRDAGWQHVNVCDRPEKYEA
                     LQREWEGTGLTVLRDGHLVSRQSDFIVYSVEAGNIHSVVKEYGPSTKVGAIVAGQTSV
                     KAPEREAFETYLPRDVYIVSCHSLHGPHVDPRGQPLVLIQHRAPDEKMRLVERILACL
                     ESRYVYMSYDEHDTVTANTQAVTHAAFLTMGTAWAQLQAYPWATGKNPGGMETVKIYL
                     CLRIYGAKWHVYAGLALLNPQASVQVTQFAKSATALFQLMLEGRYDALAARVMAARRS
                     VFGWRDTEEGQDVPGHTRILVSDGMLDEFYVIAERVSKGERGAQEAVRAAREEPPPAN
                     SHLSLLAIVDCWHVLGIDPYRHLELAATPVFRMWIGVTQNLFRSPERVLAACRAGVYD
                     VSFRADDLEFVVAARGWAQAVQFGGFDVYRRRFEMTRAFFEPRLAEANKVGAEMLRVV
                     SMRN"
     gene            complement(<41224..>41721)
                     /locus_tag="MRET_0866"
                     /note="MRES_03385"
                     /db_xref="GeneID:38737632"
     mRNA            complement(<41224..>41721)
                     /locus_tag="MRET_0866"
                     /product="PX domain protein"
                     /transcript_id="XM_027627493.1"
                     /db_xref="GeneID:38737632"
     CDS             complement(41224..41721)
                     /locus_tag="MRET_0866"
                     /codon_start=1
                     /product="PX domain protein"
                     /protein_id="XP_027483928.1"
                     /db_xref="GeneID:38737632"
                     /translation="MSEPHHRPRRNPAFSTTSKLEVLRDDESIVSASSLRSLSPVNEQ
                     PASRAQTELFATDVRVRGWHRVGTVMRGWIVYVIYITTRSGTVIKISKRYSAFLSLYE
                     QLEHECGGCALPPLPPRHVGLWQRYHPLFLEDRRRALQQWLCATLLDERWGNADAYRR
                     WVLER"
     gene            <41783..>42418
                     /locus_tag="MRET_0867"
                     /note="MRES_03390"
                     /db_xref="GeneID:38737633"
     mRNA            <41783..>42418
                     /locus_tag="MRET_0867"
                     /product="beta-1,4-N-acetylglucosaminyltransferase"
                     /transcript_id="XM_027627494.1"
                     /db_xref="GeneID:38737633"
     CDS             41783..42418
                     /locus_tag="MRET_0867"
                     /codon_start=1
                     /product="beta-1,4-N-acetylglucosaminyltransferase"
                     /protein_id="XP_027483927.1"
                     /db_xref="GeneID:38737633"
                     /translation="MGPFLWAALVLGWCVWRIVASRRPCARPAGPLCVAAVLGSGGHT
                     TEMLSILRALPRDMYTPRIYVVSSGDALSLPKAREAEGGALAPHPLQGLVIPRARAVR
                     QSWLTTPYTVLTSLAYCLWHMGIAPWCRSRTPWADVVVMNGPATCVPVVATIWAMRVL
                     GAPTPRMLYIESYARVISLSLSARLLRHVVDQFVVQWPTADPSAPCWGALV"
     gene            complement(<42415..>42699)
                     /locus_tag="MRET_0868"
                     /db_xref="GeneID:38737634"
     mRNA            complement(<42415..>42699)
                     /locus_tag="MRET_0868"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627495.1"
                     /db_xref="GeneID:38737634"
     CDS             complement(42415..42699)
                     /locus_tag="MRET_0868"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483922.1"
                     /db_xref="GeneID:38737634"
                     /translation="MDGSLPIFAMCWPCCDLWFPCGQSCECLDCCGTVHCCNGAWQGK
                     RSQLPFDDYRLEAQERAAQEGARHDQPGGTSATYPSTPPMSIPSTPPPAY"
     gene            complement(<42756..>44126)
                     /locus_tag="MRET_0869"
                     /note="MRES_03395"
                     /db_xref="GeneID:38737635"
     mRNA            complement(<42756..>44126)
                     /locus_tag="MRET_0869"
                     /product="syntaxin 1B/2/3"
                     /transcript_id="XM_027627496.1"
                     /db_xref="GeneID:38737635"
     CDS             complement(42756..44126)
                     /locus_tag="MRET_0869"
                     /codon_start=1
                     /product="syntaxin 1B/2/3"
                     /protein_id="XP_027483921.1"
                     /db_xref="GeneID:38737635"
                     /translation="MARDRLAAMRAQQASAAGGYTSPGAGAGATNYEQEYGLGSGNNG
                     YGDHLFPTQQATGQPYVPPSSEPAAAYAAQPQGVTAAAQQPATYVPPTSNPSTAYAPA
                     THAAQHPDSYEMTSMQGVTGRSYVADQAATVGLPDGGAAPAAASTRAGAGAQSDSYAV
                     NMSSDPTMAASTATTTGSSSSFFGRISEIQDMIRQIDLNVNRISDLHSRSLNNVGEAA
                     QLAAESELSSVAQQTSMYTNFVKTSIKSLEAEAVKIPASGPAPEGVGRNVRLTQIGAA
                     KNRFKETIMRYQEVEKAYRTKYRQRTERQLRIVKPDATQAELQSALEGEASGQQIFSQ
                     ALMNSNRQGEARGALREVQERHTDIQRIERTITELAALFQEMSILVEQQDEQLNVIKD
                     HAQHTEHEVQAGRQQTDKAVVAARRARKRRWICFWLVVIIIAIIIAAVVGGVCGHGDT
                     CSSNKN"
     gene            complement(<44263..>45033)
                     /locus_tag="MRET_0870"
                     /note="MRES_03400"
                     /db_xref="GeneID:38737636"
     mRNA            complement(<44263..>45033)
                     /locus_tag="MRET_0870"
                     /product="large subunit ribosomal protein L15"
                     /transcript_id="XM_027627497.1"
                     /db_xref="GeneID:38737636"
     CDS             complement(44263..45033)
                     /locus_tag="MRET_0870"
                     /codon_start=1
                     /product="large subunit ribosomal protein L15"
                     /protein_id="XP_027483988.1"
                     /db_xref="GeneID:38737636"
                     /translation="MLVSRPAVLVPLVRALTGAARPIARTAFETVRPASPRIATYATS
                     AIRIGNLTPAVPKKNSKRLGRGDGSGRGGTSTRGHKGQKARAGNGKPKPGFEGGQTPL
                     TRLIPKRGFTNPHKQHYAPLNVDRLQYWIDQGRLDPTQPITARELYASRCVHNVKDGI
                     KLLGDGHAHLRTPVHLVVSRASRSAITAVEAAGGSIVCRYYNALSLRALVKPHKWLAK
                     NEPLPRFADPVSQKDLLWYSSPNHRGYLALRDRIASTA"
     gene            <45148..>46836
                     /locus_tag="MRET_0871"
                     /note="MRES_03405"
                     /db_xref="GeneID:38737637"
     mRNA            <45148..>46836
                     /locus_tag="MRET_0871"
                     /product="ATP-dependent RNA helicase DDX23/PRP28"
                     /transcript_id="XM_027627498.1"
                     /db_xref="GeneID:38737637"
     CDS             45148..46836
                     /locus_tag="MRET_0871"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX23/PRP28"
                     /protein_id="XP_027483989.1"
                     /db_xref="GeneID:38737637"
                     /translation="MAPPLSVDELLAQQAQQPVARPRFVSRKEREKHREAEQAAASEA
                     DAAKQAQVKRARIDWLHRGDAKPAPAPAADVRTRPVRRARDTMKRFHFEWSADDDTSE
                     AGVAGDVSAPVLRRRAGMDGSERSASGRSTMPSILAEKPWSDKTLEEMRPRDWRIFRE
                     DYQIQIKGGTDAPPPLRAWRESRCIPPALLDAIDALGYREPTPIQRQAIPVGLQCRDL
                     IGLAETGSGKTLSFVVPMLAHVLRTSRTHGGPYGLILAPTRELAQQIEVEAHKLARQL
                     GGVRVVSIVGGRDLGEQAHWLGEGADMVIATPGRLQDCLERHMLVLTECRFLVLDEAD
                     RMIDMNYEDALHAILDCLPAQRTTMLYSATMPPTVDRMARTYLQQPLTIVIGQAGQAV
                     GTVEQRVEMIHSEAERLQGTLQALDSGLAPPMMVFVNQKANADVVGRELRRAGWHVAI
                     LHSGLSQPQREAAIASVREGVNEILCCTDIGARGLDLPNVSLVVNYQFPTQFASYIHR
                     IGRTGRAGRRGCAVTMVGDDDAEHFYALRLELAKSPVSSVPAFLAQHPAAMAST"
     gene            complement(<46841..>53062)
                     /locus_tag="MRET_0872"
                     /note="MRES_03410"
                     /db_xref="GeneID:38737638"
     mRNA            complement(<46841..>53062)
                     /locus_tag="MRET_0872"
                     /product="acetyl-CoA carboxylase, biotin containing
                     enzyme"
                     /transcript_id="XM_027627499.1"
                     /db_xref="GeneID:38737638"
     CDS             complement(46841..53062)
                     /locus_tag="MRET_0872"
                     /codon_start=1
                     /product="acetyl-CoA carboxylase, biotin containing
                     enzyme"
                     /protein_id="XP_027483990.1"
                     /db_xref="GeneID:38737638"
                     /translation="MATPEDLSINAEYIRMADQYVLVPGGPNANNYANVELIVDMAER
                     VGAHAVWSGWGHASENPRLPEMLAQLQPRVLFIGPPGSSMRALGDKISSTIVAQHADV
                     PCLPWSGTGITETAKSDAGYLTVPDDVYQRACVHSATEGLQVAERIGFPVMIKASEGG
                     GGKGIRMCASADMFRQLYDAAVGEVPGSPIFVMKLAKAARHLEVQLLADQYGQVISLF
                     GRDCSVQRRHQKIIEEAPITIASPETRQRMEQAAVRLAKLVGYVSAGTVEWLYAPDSD
                     ELAFLELNPRLQVEHPTTEMVSGVNIPAVQLQISMGIPLHRIADIRALYGEVRDGTSA
                     IDFDARHASLATTPRPRGHVVACRITAENPDTGFKPGTGSLSELTFRSSPSTWGYFSV
                     SASGALHEYADSQFGHIFAMGADRDEARKSMVMALKELSIRSDFRTTIEYLVTLLEYD
                     AFVRNSITTAWLDGLIAEGVEAVRPPTELVVLCGAAVKAHAMATETRDEFKRILHRGQ
                     VPPRHTLRTQFPVDFIYDDVRYHFTAHQSAPTLWTLELRGQRTRVSLRELRDGGWLLG
                     LGGASHTVYALDEVGQTRLVIDGQTCMLEDERDPTQIRSPSPGKLVRLLVENGEHVRA
                     GQTIAEIEVMKMYLPLVAQEDAVVTFVKSPGVTLNPGDLLGILNVDDPSRIRRAQPFA
                     GTLREYGEPDMDGRRPAQRYAAALQVLHHILDGYDHSDRMHAALDTLIECLRTPSLPF
                     EQADEVLASLTGRLPARVEAALRDTMRPDAPFPAAQMRAILDAHVADVTDSAAHMALT
                     SAAAPLYAILDAYALGLWHHEMAVLCELCERYIRTEASFQHGGPEALLQLRTTMEGDL
                     DRVAELQMSHEGIERKNALLLTLLVHYVQSSDMASPHARAQRMVRLLQALTQLQGYAA
                     APVALKAREILLQAKMPSLAERRAQMEAVLRRSVSSETPLPALSVLRELSELPHNVSD
                     VLHTFFGAELGIAYAALVTYVIRVYRAYDIVTINFGQERRALITWHFQMSADVLTNRA
                     KDKERQASTTDLAEHMHRRTRPKLRLGALTSCATLAELDETLERSLKHFGTPTSTPVN
                     VLSIAVTEYDDSLYDRALNETSALIAAHTAGLDRAGLRRVSVMLCEPGMYPRFVTYRR
                     LDAGGWVEQRAIRNVEPALSYQLELDRLEPHFDITPLPMSSSSVHLYHARGLQTRADV
                     RFFVRALIRPGRPPQDMATYLYSESERVLSDVLNTLEVAQGRAEFANTDGSHIFMSWL
                     YPLDASLESVLDACRCFEAQYAEHFQRLRIDEAEIRVVLQDSQGGAPRPVRLFVSTVT
                     TYTVAFSAYDEVIDAHGAAVLQAIPHVSSDTSLHRTSAHRPYMNRGPLQIRRVHAERL
                     GTTFVYDLPDALRHALQTADAADPVLQVIELDLQDGRVVHTSRPPAKNTMGMVAWRLL
                     LRTPEYPAGRPLYLLANDVTFQAGSFGPKEDAFFAHVCRLACRDGVPLLYVSANSGAR
                     LGLAPDVMSLFRAKFVDDDPTRGFEYLYLADQDVALVEEGVVRCVRRALPDGRVHHVI
                     TDIVGDPRGGLGVECLSGSGLIAGEMSRACGDIFTATIVTGRSVGIGAYLARLGTRVI
                     QVASSPMILTGYKALNKLLGREVYTSNLQLGGPGIMHANGVSHLVVQDDLHAMREYLR
                     WLAYVPERRGLPPRILPPVDPVDRDVAFTPTSTPYDPRAMIAGAVVDGVYVPGLFDRD
                     SFQETLAGWATSVVVGRARLGGIPFGVIAVETRTLERVVPADPANPHSTEQRILEAGQ
                     VWYPNSAYKTAQAIVDFDREGLPLLMLANWRGFSGGQQDMYDEILKQGSKIVDGLSSY
                     RQPVFVHIPPAGELRGGSWVVLDSQINARGMIEMTADAHSARGGVLEAAGLVEIKFRA
                     DRQRATMLRLDPTYAQLARDASEASGPAQAEARQRLEEREKHMAPFFHAMAVEYADAH
                     DRAGRMLATGALRHAMPWAETRRYFYWRGRRRMMEVRYLHAFLAAQPTLPPPEAAARV
                     CRAASYVPHDDDAHAVAQLEAHTADLDAAVERARADAIVATLAQLSPETRDYVAAQL"
     gene            complement(<53507..>54522)
                     /locus_tag="MRET_0873"
                     /note="MRES_03415"
                     /db_xref="GeneID:38737639"
     mRNA            complement(join(<53507..54400,54448..>54522))
                     /locus_tag="MRET_0873"
                     /product="ubiquinol-cytochrome c reductase cytochrome c1
                     subunit"
                     /transcript_id="XM_027627500.1"
                     /db_xref="GeneID:38737639"
     CDS             complement(join(53507..54400,54448..54522))
                     /locus_tag="MRET_0873"
                     /codon_start=1
                     /product="ubiquinol-cytochrome c reductase cytochrome c1
                     subunit"
                     /protein_id="XP_027483991.1"
                     /db_xref="GeneID:38737639"
                     /translation="MAQLFSSCTRAVISRASAKQGFAQSIRFASTRAQANASSPLTSR
                     TSAIAATAVALGSVMWYQHMYGEWPFLESLSANLADEGLHPPAYPWEHFKWFKTFDHA
                     AIRRGFQVYQEVCSTCHSLDRIAWRNLVGVSHTVDEVKAMAADVEYEDGPNDDGEMFQ
                     RPGKLSDYLPSPYPNEEAARAANAGALPPDLSLIVKARHGGADYIFSLLTGYCDPPAG
                     VTVQEGLNYNPFFPGTQIAMARVLFDDLVEYEDGTPATTSQMAKDVVSFLHFTAEPEH
                     DDRKRAGFKAIILLSALFAMSVWTKRFKWAPIMTRKIVYDPPKGHH"
     gene            <54807..>55604
                     /locus_tag="MRET_0874"
                     /note="MRES_03420"
                     /db_xref="GeneID:38737640"
     mRNA            <54807..>55604
                     /locus_tag="MRET_0874"
                     /product="4-amino-4-deoxychorismate lyase"
                     /transcript_id="XM_027627501.1"
                     /db_xref="GeneID:38737640"
     CDS             54807..55604
                     /locus_tag="MRET_0874"
                     /codon_start=1
                     /product="4-amino-4-deoxychorismate lyase"
                     /protein_id="XP_027483984.1"
                     /db_xref="GeneID:38737640"
                     /translation="MVPHAPLEALTSARCYRDAGASLQQLVPDVHCADVQEDALNTHK
                     LAKHIPLFTAHIQRLVRATHALCRLYPDTWTRAWSAEDILASDAFKSVCEHLDAIQGS
                     ETEQLRVSVRIHAHGTTRAIVSPLRTSRAVPTVRLDPEPVRLSGPLVSYKTDARAAYD
                     AARQRVHGTLGAAPDGCFDVLLWHDTPEGRVVTESSIANLVLERGHGDLVTPVLSEGL
                     LPGLLIQELVRQNVVRQDVIRVDDMHRASRLWLCNAVRGMFRVELVS"
     gene            complement(<55601..>57427)
                     /locus_tag="MRET_0875"
                     /note="MRES_03425"
                     /db_xref="GeneID:38737641"
     mRNA            complement(<55601..>57427)
                     /locus_tag="MRET_0875"
                     /product="crossover junction endonuclease MUS81"
                     /transcript_id="XM_027627502.1"
                     /db_xref="GeneID:38737641"
     CDS             complement(55601..57427)
                     /locus_tag="MRET_0875"
                     /codon_start=1
                     /product="crossover junction endonuclease MUS81"
                     /protein_id="XP_027483985.1"
                     /db_xref="GeneID:38737641"
                     /translation="MTSPVAVWLSFLEAWADEARQRGTKAASAYLKAHQSLAACQDTL
                     VHPSETVRVRGIGASIAERIERAYAQWCAQHGRDMPPKPGSMIAPSRSHTTARPRKTK
                     TYIPEPRSGAHGLLVALYTRVLEDDDDEAQLGKSELIARAQPYCDSDYTMPGRSGAAP
                     SSLVRHSQSNKTFITAWNSIKTLIHKGYVYRRGNPALFSLSPQGLEVAELVALAEGIT
                     RQAPEPLPSAPSPASPAAHEQAPPSVPRLYLPPRSQVPVIDLDSDDVDDIQICTPAKP
                     LTISLMDSSPIVISSSPAPVPHVPYHILPASSYTIHMIVDHREVRAKTVDGRITFHDA
                     LRERGVPCEGRVLELGDILWIARAKPHLPSEQQQAWAHMQEVVLDVVVERKRLDDLTS
                     SLMDGRWHDQKQRLQQAGIGQVLYLVEDMHVSELVQRYGAQIQTALSSTQVIDGFFVH
                     RTAHGQGTVDFLVTMHDTVQHMYKDKPLYVLREEQIQRDTYAQMQRMMRAEHPGTRFH
                     TSFHTYQELHTKTSASGSLLDMWTRMLLCIRGVSPEKAQELTRRWPTPAHLLHAYAQC
                     ASVHDAQHLLSTTIDPATRLTRRRIGQALSKRVWHTLQSLTY"
     gene            complement(<57580..>57998)
                     /locus_tag="MRET_0876"
                     /note="MRES_03430"
                     /db_xref="GeneID:38737642"
     mRNA            complement(join(<57580..57604,57633..57742,57780..>57998))
                     /locus_tag="MRET_0876"
                     /product="small subunit ribosomal protein S15e"
                     /transcript_id="XM_027627503.1"
                     /db_xref="GeneID:38737642"
     CDS             complement(join(57580..57604,57633..57742,57780..57998))
                     /locus_tag="MRET_0876"
                     /codon_start=1
                     /product="small subunit ribosomal protein S15e"
                     /protein_id="XP_027483986.1"
                     /db_xref="GeneID:38737642"
                     /translation="MSNEDFVKLVHARARRRFSRGLKRKPMALIKKLRKAKKEAQPNE
                     KPAVVRTHMRDMIVVPEMIGSMIGVYNGKVFTTVEIKPEMTGHYLGEFAISYIPTRHG
                     KGSLGKNAGRFIPLY"
     gene            <58360..>58695
                     /locus_tag="MRET_0877"
                     /note="MRES_03435"
                     /db_xref="GeneID:38737643"
     mRNA            <58360..>58695
                     /locus_tag="MRET_0877"
                     /product="large subunit ribosomal protein LP2"
                     /transcript_id="XM_027627504.1"
                     /db_xref="GeneID:38737643"
     CDS             58360..58695
                     /locus_tag="MRET_0877"
                     /codon_start=1
                     /product="large subunit ribosomal protein LP2"
                     /protein_id="XP_027483987.1"
                     /db_xref="GeneID:38737643"
                     /translation="MKHIAAYMLLSLGKEEKPTADDVTKLLSTVGIEADGERLEKLVA
                     ELAEKDLAALISEGKEKLASVPSAGAVAAAPAAGGAAAGGAAEEAKEEKKEEPKEESD
                     DDMGFGLFD"
     gene            complement(<58773..>60506)
                     /locus_tag="MRET_0878"
                     /note="MRES_03440"
                     /db_xref="GeneID:38737644"
     mRNA            complement(<58773..>60506)
                     /locus_tag="MRET_0878"
                     /product="Rho GTPase-activating protein RGD1"
                     /transcript_id="XM_027627505.1"
                     /db_xref="GeneID:38737644"
     CDS             complement(58773..60506)
                     /locus_tag="MRET_0878"
                     /codon_start=1
                     /product="Rho GTPase-activating protein RGD1"
                     /protein_id="XP_027483982.1"
                     /db_xref="GeneID:38737644"
                     /translation="MDDAARPAANAPALGAEASQVVDEATMRALNSMDCSLHLMDERM
                     KQSIESARGASQMLKRRAALEEEYAQSLKKIARAAMSDYTGNDVRAGTYGTSWIHMIK
                     NQDILSENHFRFASKLTNISDDIAGLVHDAEQHRKQSRDLGFRLEKNLLEAESTADRA
                     RVRLDSAIDDLDRVLLLKHGDPRANDKRSIGMPFSKGSSLFKSKNPQQIARTEDECRA
                     KQGHAHDTLRSEAQTAQAKRQEYFQQQLPQILRAYKESLDELETGLQFQLMRYAFLYE
                     NIALSDGLCVNPLGDKSAPPGLRDAVASINNKSDFKDFMQNYELVFNNKEHRPTPHRA
                     NPYDEATLAQYRHQTTLKQAPSDVDGATPAARPVFGVDLETQMVRDGVQVPPILEICA
                     DAIERVGIRNTGIYRLSGTSSRVQKLKNRFDYDWSTVDVMANEAIQDINIVAGCLKQW
                     FRELPEPLFTYPLYPAFIEAAKISNDFLRQVRLHEQVNNLPDANYATLRFLMTHLDRV
                     RAHEADNQMSAHNLAIVFGPTLLRSPHEAQMASTGAGGAVFLPDMGLQCKAVETILLK
                     YRDIFVEADEA"
     gene            complement(<60581..>61984)
                     /locus_tag="MRET_0879"
                     /note="MRES_03445"
                     /db_xref="GeneID:38737645"
     mRNA            complement(<60581..>61984)
                     /locus_tag="MRET_0879"
                     /product="cryptococcal mannosyltransferase 1"
                     /transcript_id="XM_027627506.1"
                     /db_xref="GeneID:38737645"
     CDS             complement(60581..61984)
                     /locus_tag="MRET_0879"
                     /codon_start=1
                     /product="cryptococcal mannosyltransferase 1"
                     /protein_id="XP_027483983.1"
                     /db_xref="GeneID:38737645"
                     /translation="MASPADGVELDMLDHGEWGVPSPAPRGRAPWWRPAWLRDARGRI
                     GVVSVVLFLGLSWYFSMPSTLYAYAVVVCFTCPMLLCHLLYRRAWATTSLVRRTVLVV
                     VTAWVALSALRGWAPAHLPVPPAWRASNDTYFIASILYNAERILPQYTDSLVSFARDV
                     GVERVYVSVLENDSQDRTPAMLEALRRTLERAGVRHTIVSAPLPASIRSFERIQRLST
                     LRNMAMRPLYDDVRMPISKVVWINDVLFTPHMLHHLVHTLDGTYDQACALDYFWLGFY
                     DTWVLRDQYGETVRPLWPYFRRKDERRAVDAQQPIPVNACWNGVTVFDARWFTNATPP
                     VLRREPAVADLPPPPIERADGLDYPAKLPLQFRTCAPCNASESILTSVDMHRLASPHR
                     PRIFVNPAVKVAYDYPSYYLYNHMLTWYVMQPWRYVWETWIERRLFSWIANLGNRWDP
                     CAPLLQRQWATDAASWT"
     gene            complement(<62007..>62862)
                     /locus_tag="MRET_0880"
                     /db_xref="GeneID:38737646"
     mRNA            complement(join(<62007..62528,62557..>62862))
                     /locus_tag="MRET_0880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627507.1"
                     /db_xref="GeneID:38737646"
     CDS             complement(join(62007..62528,62557..62862))
                     /locus_tag="MRET_0880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484031.1"
                     /db_xref="GeneID:38737646"
                     /translation="MPNSAWPVARPRSSAWEEGVVYPLLLLAALYHVVQCIPAWWLPA
                     PLRQAGWGFPSDVFLLLHMPTSVPTRVLRDALPAQLSWLAPSAVLEALLARLSSVEGR
                     KVYLVLGAAPIVACTHCHDTQDYQAYRLYHVWRMYVAQALALSIATITPHGTLPRLVE
                     NVAQHAYPGLVATRTRAHWRTRAWLALLALLAVDVGAILYAEHLPLPPGLWEHWHAYA
                     HIARHTLLLCLVVLVARGVRWQPPFLPVLDALQAVAATHTRFETHLAARPPLASPRS"
     gene            complement(<62909..>63940)
                     /locus_tag="MRET_0881"
                     /db_xref="GeneID:38737647"
     mRNA            complement(<62909..>63940)
                     /locus_tag="MRET_0881"
                     /product="DUF803 domain membrane protein"
                     /transcript_id="XM_027627508.1"
                     /db_xref="GeneID:38737647"
     CDS             complement(62909..63940)
                     /locus_tag="MRET_0881"
                     /codon_start=1
                     /product="DUF803 domain membrane protein"
                     /protein_id="XP_027484030.1"
                     /db_xref="GeneID:38737647"
                     /translation="MTWRMQDKWIGLMLAISSSVAIGTSFIITKKGLMSAAAHSEGLA
                     SERLSYLGNPVWWAGMLTMVVGEVANFVAYMFAPPILVTPLGALSVLVGAVLASFLLH
                     ERLGRLGILGCALCLVGTVVIVVNAPEDRDIQTVDELLQYAMRAPFLIYCLCTACFSL
                     YMVWRVVPRYGHRTPLVYLSICSLVGSISVMSVKALGVALRLTFDGHNQLTHVSTYCF
                     GLMVVLCILVQMNYFNRALDQFSTNVVNPIYYVMFTTSTILASVLLFQGFDTTNAAAV
                     SLLGGFLVTFLGVYLLNANAQAPASSADYERIYPDRDAAASFVIDEPTQSFPLTPFHD
                     QPAEPARSP"
     gene            <63994..>64698
                     /locus_tag="MRET_0882"
                     /note="MRES_03450"
                     /db_xref="GeneID:38737648"
     mRNA            <63994..>64698
                     /locus_tag="MRET_0882"
                     /product="PPR repeat containing protein"
                     /transcript_id="XM_027627509.1"
                     /db_xref="GeneID:38737648"
     CDS             63994..64698
                     /locus_tag="MRET_0882"
                     /codon_start=1
                     /product="PPR repeat containing protein"
                     /protein_id="XP_027484033.1"
                     /db_xref="GeneID:38737648"
                     /translation="MGSWHDMAESAVLERYARGDASQDLVDAWPSLRPHLCQRLRDNV
                     RAFPVHTEPHLHKAAPLADLLRDDPTLIERPSAAIELLMTEHDITPDDTRGFVPARAP
                     PPSAAWPTWDAALDGSHVDRVCEHVCAMLDDFDAPPCTMQRVAELLLEPTKQYHTRSK
                     YLGALRRVLGVTGTLRQAPTSPPRPAQPGEAHDATVPCGRVDELDSSTAHGTVARTAQ
                     PLSAATLVDTPQRQRS"
     gene            complement(<64693..>66300)
                     /locus_tag="MRET_0883"
                     /note="MRES_03455"
                     /db_xref="GeneID:38737649"
     mRNA            complement(<64693..>66300)
                     /locus_tag="MRET_0883"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627510.1"
                     /db_xref="GeneID:38737649"
     CDS             complement(64693..66300)
                     /locus_tag="MRET_0883"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484032.1"
                     /db_xref="GeneID:38737649"
                     /translation="MSSSLLQAYPQMTLVPGAGLFGLGAYAFSTIAPLWAFAFFGPLI
                     RRYCPDGFTLAEFVRRRFGWPIGIFSALVFLGFMFCFMIVELNTYSVIVRTIQPDMNK
                     VVPPLVIALTTTIYTTYGGFKASLWTDNFNAIVVIVFIIIGSVMFSKKLSIDKDLMHE
                     SGMLGAHRLGGELWYILTISIVFSQMFNQGFWQRAFASRTNGGLYLSVALATLPLFAI
                     VFLVGMAGPLAYWSHAQPPINTSDADAYDDGSNALFRALLYMPKWVHGLVLVLTGVLS
                     SSAYDTFQSAMISVIESDLLLSRVNIWWCRLFLIALNVPCVALAVIDIDILQVFLVAD
                     LAGLAVIPSVFLGLSRRLAVLNGFDLVVGGCGGFLTVFVFGTIYYHGDAIEGGSLIGL
                     PNGLYGDPDDYSVIGAFLAAPLGSMGFTLGSCATRICLGWLYARATNQPFTMLDRQQI
                     DIQDCVTDADRTGAFMGKVSNPLDGHRLEDGPDKDFDMRMHAAEPHLISHVLHRVGFG
                     KDSSHSSDASDKHSDVDVEHTIEDRVS"
     misc_binding    66338..66521
                     /bound_moiety="thiamine/thiamin pyrophosphate"
     gene            complement(<66598..>66848)
                     /locus_tag="MRET_0884"
                     /db_xref="GeneID:38737650"
     mRNA            complement(join(<66598..66653,66686..>66848))
                     /locus_tag="MRET_0884"
                     /product="urea transporter"
                     /transcript_id="XM_027627511.1"
                     /db_xref="GeneID:38737650"
     CDS             complement(join(66598..66653,66686..66848))
                     /locus_tag="MRET_0884"
                     /codon_start=1
                     /product="urea transporter"
                     /protein_id="XP_027484035.1"
                     /db_xref="GeneID:38737650"
                     /translation="MDPSTFPAPNGRLTKAQGDALVYSTLCGFMLVGLWAGVNTRSKR
                     EFISGVRTQPALPLALNWIASGSCLMER"
     gene            <66990..>68621
                     /locus_tag="MRET_0885"
                     /note="MRES_03460"
                     /db_xref="GeneID:38737651"
     mRNA            <66990..>68621
                     /locus_tag="MRET_0885"
                     /product="transcriptional adapter 3"
                     /transcript_id="XM_027627512.1"
                     /db_xref="GeneID:38737651"
     CDS             66990..68621
                     /locus_tag="MRET_0885"
                     /codon_start=1
                     /product="transcriptional adapter 3"
                     /protein_id="XP_027484034.1"
                     /db_xref="GeneID:38737651"
                     /translation="MPAAGVPATFRSSTAPLYRRYASGLGTSATVVPSLEELHHLVHH
                     LQTLRQDWASRAQTLADERRAMGSSSVHVKQEDDTRAEESDSDADWAPNDRVQRTYSR
                     AHRKREEASGSESDVPLHAVQPKPKTLGVKLRVMDDAHKARPEAVPEKAPLVPSAGVI
                     DLRGDTFHDATTFSWDAPSDPQSSFLPKREPTREIRPYPTHPYDVHEDFANTDWHDRE
                     AMYTVPGHVPPSSAARPRPAKEAAQVPATTFFHYVDAYFKPVTEDDLAWLSSQADDPS
                     PYVFPELGVHYRKIWEKEDAELQSVLQAMEGHAPTQPPWRPAPPSAPEDSPFVPSNTT
                     LDALSDAQMYDPSTRGGPLMERLAASLMTGDAPEPNAEAPTDAPDALDPHVSLVDMET
                     HVRHACESIGLLETGAPIHWDEHGDSLIASTLRLAQARLRQQSRANELRKARLFHIAQ
                     DRMAYQDYQACLQAVDREIEANWAKRQRQIKASVGKKRKTDAEAGPNKPQLSESLPDA
                     LQRRKKLKAALEPLFAHIPHACAPPTESIYQGIDT"
     gene            complement(<68622..>69656)
                     /locus_tag="MRET_0886"
                     /note="MRES_03465"
                     /db_xref="GeneID:38737652"
     mRNA            complement(<68622..>69656)
                     /locus_tag="MRET_0886"
                     /product="nucleotide exchange factor for Gsp1p"
                     /transcript_id="XM_027627513.1"
                     /db_xref="GeneID:38737652"
     CDS             complement(68622..69656)
                     /locus_tag="MRET_0886"
                     /codon_start=1
                     /product="nucleotide exchange factor for Gsp1p"
                     /protein_id="XP_027484037.1"
                     /db_xref="GeneID:38737652"
                     /translation="MAASRRWRLAGRWGALVTQGRLVDVPARGTLAAASVSHAVVAEA
                     QTAYLAGHNTWGQLGQGRTSVWGTARIALPDRIVSAAAGLGFTCLATSDALYVSGTNV
                     RGQMGLDQERGSLSFQRLALPAVRSVCAGLDHMLVLAGAQVWACGLHTDRQLGVPSRA
                     PYLATLERVAIPLADGEGVTRLAAQGDTSVALTSRGRVFLWGNTEYGQHLRRDAVDRL
                     DTPTLLPIDEAVCDVQVGGSFLLVLTADGSVYTAGYGATGHAQAPYARLTRLPLPSRA
                     VSLSASLQYAAAVTDAGHVWTWGLDSPDGRLGLGVLADHRVHEPRRVPFSERATHVVC
                     GGQALLVRCA"
     gene            <69760..>70599
                     /locus_tag="MRET_0887"
                     /note="MRES_03470"
                     /db_xref="GeneID:38737653"
     mRNA            <69760..>70599
                     /locus_tag="MRET_0887"
                     /product="fatty acid elongase 3"
                     /transcript_id="XM_027627514.1"
                     /db_xref="GeneID:38737653"
     CDS             69760..70599
                     /locus_tag="MRET_0887"
                     /codon_start=1
                     /product="fatty acid elongase 3"
                     /protein_id="XP_027484036.1"
                     /db_xref="GeneID:38737653"
                     /translation="MALYEGIKSLLPPSVVRYTAPMHFWQPGVTPLSTVMSVVAMSVG
                     YITIVLGGQAVMRHLPAVPARVLKIPFFLHNVLLCLGSLLLLCLYLELEIPIIFKYGM
                     HNSICEYRLYFDAEMFHIINYYFKYWEFADTLFLVLKKKKLLFLHVYHHMATAALCYS
                     QIVNQTTLSWVIICLNLAVHVIMYGYYALASIGVRCPWKQLVTTGQIVQFVIDVVVCI
                     YGIYHHYIHLYAPWMPYVRYCHGEPAAAFSGLGILVSYLVLFIFFYRDTYKKAPKADK
                     KTQ"
     gene            complement(<70717..>71346)
                     /locus_tag="MRET_0888"
                     /note="MRES_03475"
                     /db_xref="GeneID:38737654"
     mRNA            complement(join(<70717..70729,70756..70852,70885..70914,
                     70942..71125,71153..71176,71216..71287,71323..>71346))
                     /locus_tag="MRET_0888"
                     /product="ubiquitin-conjugating enzyme E2 D"
                     /transcript_id="XM_027627515.1"
                     /db_xref="GeneID:38737654"
     CDS             complement(join(70717..70729,70756..70852,70885..70914,
                     70942..71125,71153..71176,71216..71287,71323..71346))
                     /locus_tag="MRET_0888"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 D"
                     /protein_id="XP_027484039.1"
                     /db_xref="GeneID:38737654"
                     /translation="MAMKRISKELADLGRDPPSSCSAGPTGDNMFQWQATIMGPSDSP
                     YSGGVFFLTITFPTDYPFKPPKVSFTTKIYHPNINANGSICLDILRDQWSPALTISKV
                     LLSICSMLTDPNPDDPLVPDIAHLYKTDRAAYENTAREWTRKYAM"
     gene            <71518..>74250
                     /locus_tag="MRET_0889"
                     /note="MRES_03480"
                     /db_xref="GeneID:38737655"
     mRNA            <71518..>74250
                     /locus_tag="MRET_0889"
                     /product="SANT domain protein"
                     /transcript_id="XM_027627516.1"
                     /db_xref="GeneID:38737655"
     CDS             71518..74250
                     /locus_tag="MRET_0889"
                     /codon_start=1
                     /product="SANT domain protein"
                     /protein_id="XP_027484038.1"
                     /db_xref="GeneID:38737655"
                     /translation="MPPPSPPEAVAERKDQARPSGWSREAPPARFRPWGAPRSHEWPR
                     DHERPRSKKHRGYRSSRGDHAYYDYDQAGLNQMQASRSYMQEQDANVTEDLYGEPEVD
                     VKRTTAKEPEGHMDERPNESRLGATEKEAPLAYDSAETHDAQDSTPVPKPAEQPIDSE
                     ARESLEALPPPTTDGPRVESEPAPPETSEENANVPAPSKEAPEERPPASQPEPAPQTD
                     VPKEQAPELPAESPPTHPEDPAAFSPTEDDETERMQRVVHALTQQLVLRYPWSDAHTH
                     TILEENHRVTASLRVPAMLGLQKPAQVQRPVEKSAVDEYLYRQIREQKETQRIKLVQL
                     RNEYRAKHQAWSQYCASLDRERERRASATSTTPQDETPGKAWMPTTRSFRRGGLGSSG
                     FGDAVRSEAEFQEILASLENAEMQDPVARAARTSATVPDMCLDPQPQLDVDNGYVADS
                     TRFYFGGFDPDVWSEEERNIFARRYVLYPKQFGRIAEKLPHKTPNQCVAFYYLHKHLA
                     GYKALLNARHRERRKKTKSKPKKSKGSALITDIAATEAEQKEGEADEERSGKRPSDEP
                     PPRAKKSRTKQRESSPPAETELERDLAAAEALEALATLATPAPEPKKRRSVGTDEPKS
                     RSRGPHWSMSERAEFLRLLAIYGKDWNALAAAFPAKTPAQTRNFFARHASESTYFQEA
                     AALAQRHATESWEEKSRAALAFVQAWYDALPEGASKASITSWPSPSMPPPPAPRELVP
                     KDEPAPTPPPQQQQQPAHAEAADDDETDDEGQSSTRIPMRMPDTHVARMSYTPPPPPP
                     TPPTPRTSVVPVPSAPPSMSYAAYGPPRPVHHPMHASPALNMYYRDAASSPTPGAVPR
                     AMPPPGMYGYPMPKYPPAPTPPSPYMPASVPRMPMRPGPNMGYFHHTRQDRWPT"
     gene            <74289..>75626
                     /locus_tag="MRET_0890"
                     /note="MRES_03485"
                     /db_xref="GeneID:38737656"
     mRNA            <74289..>75626
                     /locus_tag="MRET_0890"
                     /product="FMN binding oxidoreductase"
                     /transcript_id="XM_027627517.1"
                     /db_xref="GeneID:38737656"
     CDS             74289..75626
                     /locus_tag="MRET_0890"
                     /codon_start=1
                     /product="FMN binding oxidoreductase"
                     /protein_id="XP_027483298.1"
                     /db_xref="GeneID:38737656"
                     /translation="MDPVLSSRVTLPCGAVMPNRLAKAPLEEMLSTFGGGKPNADVFR
                     LYRAWADGGWGMIITGNVGVDRKHIGIMFDVVMPEEGNDARKAEYLAEFVKYARATKG
                     FDVDDARADAVPADGSRPLAVVQLVHCGRQSMRGSYRKPWEPSLAPSAVPVQLSQEKR
                     TWMDALTFGTPHALTVAEIHRIVEQFTRAAVFMEKAGFDGIELHGAHGYLLSSFLNPK
                     TNLRDDEYGGDAARRFRIIREIIESIRQRVSPSFVVGIKLNSSDFCHGGQTEEDALQN
                     VQWLAEMRMVDFVEVSGGSYEAPVFAQQASERTRRREGFFAGFAKQAHSRLPAGSTMR
                     IIVTGGFVSRAGTRDAIESGVADAVGMGRAACVNPQLPRLLMDTSVPDDEAKVDAAFT
                     PPPPPSFMPKIPLAGFGWGTVWHDMQLHLTAHGQPTDPRPNGWAFVRQLHWWN"
     gene            <75658..>77088
                     /locus_tag="MRET_0891"
                     /note="MRES_03490"
                     /db_xref="GeneID:38737657"
     mRNA            <75658..>77088
                     /locus_tag="MRET_0891"
                     /product="origin recognition complex subunit 5"
                     /transcript_id="XM_027627518.1"
                     /db_xref="GeneID:38737657"
     CDS             75658..77088
                     /locus_tag="MRET_0891"
                     /codon_start=1
                     /product="origin recognition complex subunit 5"
                     /protein_id="XP_027483299.1"
                     /db_xref="GeneID:38737657"
                     /translation="MAMARAWQAPIEMLGQLLAEQVSPPAVLVHAPNSPRSAKRLVRD
                     TLAAYEAQHHGDVRVSHVSPLVACTPRLLYTQVLRQLSEEADSCGDPSTFLRHAREYM
                     RPYTKWVVVVNDAERMRDIWPEHVWEMWPLLAESMACHGRVMVVYVSPLAWSAFRSTS
                     GRTISTSPLCIRVPRLPREDVLQLLMEHVGNDSSTSRIASQVFYDAVKDTVRDEFELC
                     VLYTRVWQALQAAIEERGSKTTATLVPYISEQCRDILVRVVPRHVGPTAWLLEKNNKP
                     STPPPSALNLTRTGFGAMPAFLLISAFLASYNPAITDVKYFVRELEASRKRRRGKAQR
                     AAKAALLELEGHTDKVFELPQFWGPRTFTLERVLAIYHALLTDFEQDLNEDALLVPAE
                     RAARMSENKAEMHLGHIAGEFWSRSSTVLAELNELVRQQLIVRMSPANKLSAMQYRVN
                     ASFAYVRQVAHSVGFPLTVWLWDTYT"
     gene            complement(<77068..>77679)
                     /locus_tag="MRET_0892"
                     /note="MRES_03495"
                     /db_xref="GeneID:38737658"
     mRNA            complement(<77068..>77679)
                     /locus_tag="MRET_0892"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627519.1"
                     /db_xref="GeneID:38737658"
     CDS             complement(77068..77679)
                     /locus_tag="MRET_0892"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483296.1"
                     /db_xref="GeneID:38737658"
                     /translation="MSFTALVVVLVEPQGATAQRRLSMLQHVRKAFDPAYRRWPPHIT
                     LVPPAVYTPDGQDDALDPPAWLVRHLQRLTAGVERVCAEHPAHILQLRHLAAFERREA
                     ILHLRPSASSAEPLLSLQADVAQAALPHMPGVRLRSTYVPHMTLGRVKTVEKRRELEQ
                     RVMEVLGDGLEVRVDRVHIMYKRGEAKQPYTTWRALPLGIRVP"
     gene            <77707..>78759
                     /locus_tag="MRET_0893"
                     /note="MRES_03500"
                     /db_xref="GeneID:38737659"
     mRNA            <77707..>78759
                     /locus_tag="MRET_0893"
                     /product="member of the NineTeen Complex"
                     /transcript_id="XM_027627520.1"
                     /db_xref="GeneID:38737659"
     CDS             77707..78759
                     /locus_tag="MRET_0893"
                     /codon_start=1
                     /product="member of the NineTeen Complex"
                     /protein_id="XP_027483297.1"
                     /db_xref="GeneID:38737659"
                     /translation="MSHGHNERRARPARKQISYGELEEIRHHAEHMTGEGMIYNVWYN
                     KMSGGDTGHGPESKTRSMTRCDIARDAGYTRADMRIQASAGGVSDTTYVCLFFARGCC
                     PKGEECLYLHRLPRPYEVADQGRDIFGREKHGSYRDDMGGVGSMLRVNKTLYVGRINE
                     ETSLSFRRAAANPADNYDDTGSTPTSKIVRRHFSEWGDIEHVRVMVGRGIAFVTYKYE
                     ANAQFAKEAMMHQTLDHDEVLNVRWAAEDPRSDGEARDAAELRELAEKRIAEVERTKR
                     TSDDAEDERAKRQRMLLSQQQMAQLDEENRRGWEEIHGKAKTPILSAQALESLKALRP
                     TRPSSALENLAAYDSD"
     gene            complement(<78931..>79878)
                     /locus_tag="MRET_0894"
                     /note="MRES_03505"
                     /db_xref="GeneID:38737660"
     mRNA            complement(<78931..>79878)
                     /locus_tag="MRET_0894"
                     /product="glyoxylate/hydroxypyruvate reductase"
                     /transcript_id="XM_027627521.1"
                     /db_xref="GeneID:38737660"
     CDS             complement(78931..79878)
                     /locus_tag="MRET_0894"
                     /codon_start=1
                     /product="glyoxylate/hydroxypyruvate reductase"
                     /protein_id="XP_027483302.1"
                     /db_xref="GeneID:38737660"
                     /translation="MSKPIVVQTCWMPEAFIQKAAEAGKIELRLWKPQEGERRMTAPQ
                     EWIKEHIQGASALMCTPMNKVSEEIFEAAGPSLKVVSTMSVGFEHIDREAAKQRGIRV
                     GYTPDVLSPAVADVGLLLALNVMRHVLDGMNTVKTGTWLKKPWSPLSFCGPALEDKTV
                     GFIGFGSIAQALVLKLLPFKPGKIVYRTSKPRAFDIKDDYFRFLLQDDMLQCYHQCHQ
                     RLPVPVENEPDLKALAEQCDVILYVYTTYTQPHFYAKCVDAPPCGCSVFACDEAVGLP
                     GEHWPRSARRYAGSRGSTAQERDCWCRSRRAGRRAKHFR"
     gene            complement(<79972..>81320)
                     /locus_tag="MRET_0895"
                     /note="MRES_03510"
                     /db_xref="GeneID:38737661"
     mRNA            complement(join(<79972..81165,81204..>81320))
                     /locus_tag="MRET_0895"
                     /product="ubiquinol-cytochrome c reductase core subunit 2"
                     /transcript_id="XM_027627522.1"
                     /db_xref="GeneID:38737661"
     CDS             complement(join(79972..81165,81204..81320))
                     /locus_tag="MRET_0895"
                     /codon_start=1
                     /product="ubiquinol-cytochrome c reductase core subunit 2"
                     /protein_id="XP_027483303.1"
                     /db_xref="GeneID:38737661"
                     /translation="MYMPRSSSSVLRTAPAQIRAAAGTRSLSSGAPSIPLAALNESAP
                     VASLTVAVRAGSRFESEAGVAHAIKNFAFKSTKDRSALRIVREAELNGGVLSASLSRE
                     HLFLTAEFLKGDEAHFADLLAEVVGNHKYCRHEFNEEVVPSLAADAEQAAQDPVALGV
                     DALFSAAYRGRGVGSSLFASPSSPITVEAVRAFAAQAMNASNIAIVSSGLSQDKLRSL
                     ASTSFVRVPAGSALQAAPSKYFGGDYRAALTDAHGHALPNDHFFMAFEGASRANAAPL
                     SVLEALLGGGTSVKWSAGLSPLSQIRDAKAQAFHSALEDTGLFGIHIAAPSAKVADAA
                     KTAAQALKAAADSVSSEDVQRAVAKAKFVLAQEFEGSRVAGHESVAARLLGSSASSLE
                     SELDSLSSVKAADVSSAAQALLKGKPSSVALGNVKQLPYADELF"
     gene            complement(<81569..>82561)
                     /locus_tag="MRET_0896"
                     /note="MRES_03515"
                     /db_xref="GeneID:38737662"
     mRNA            complement(join(<81569..82250,82277..82510,82536..>82561))
                     /locus_tag="MRET_0896"
                     /product="DNA/RNA-binding protein KIN17"
                     /transcript_id="XM_027627523.1"
                     /db_xref="GeneID:38737662"
     CDS             complement(join(81569..82250,82277..82510,82536..82561))
                     /locus_tag="MRET_0896"
                     /codon_start=1
                     /product="DNA/RNA-binding protein KIN17"
                     /protein_id="XP_027483300.1"
                     /db_xref="GeneID:38737662"
                     /translation="MGRAEAGTPKAISNAMKARGLTRLRWYCQICSKACRDANGYKCH
                     IESEAHMRQLTAAMGEGGQRAGKVVHDYSSQFQHEFVALLRQRFGTRRVLANQVYQEY
                     IQDRHHVHMNATRWVSLSEFVKFLGRAGIAKVEGSELGWFISWVDNSSSARARQDAIK
                     KMDRAKMDDEQRSRRELDEQIRRAQEQCAAPQAPAPTPLPSNNATSGLPQSNNGGPVK
                     LSLSLSKPVSTSTTTTHTPAPSESAPAAPSVFSKRVNPLKAASKENAALSAITPTQNK
                     RPPPAHMGAAERIKMEEQSRKRTTGPTMQPGIKRTRF"
     gene            <82816..>84277
                     /locus_tag="MRET_0897"
                     /note="MRES_03520"
                     /db_xref="GeneID:38737663"
     mRNA            join(<82816..82851,82880..>84277)
                     /locus_tag="MRET_0897"
                     /product="glycine hydroxymethyltransferase"
                     /transcript_id="XM_027627524.1"
                     /db_xref="GeneID:38737663"
     CDS             join(82816..82851,82880..84277)
                     /locus_tag="MRET_0897"
                     /codon_start=1
                     /product="glycine hydroxymethyltransferase"
                     /protein_id="XP_027483301.1"
                     /db_xref="GeneID:38737663"
                     /translation="MSFPSIPVPNDFNNVLYKPLAEADPEVQQIIDNETYRQFTGLEL
                     IASENLTSLATMEANGSILTNKYSEGLPGARYYGGNEYIDQLEELCRKRALEAFDLDP
                     KVWGVNVQPYSGSTANFAAFTALIQPHDRIMGLGLPDGGHLTHGYYTAKKRITASSIY
                     FESFPYQVKRDDGYIDYERLRINANLYKPRLLVCGGSAYPRDWEYATLHEIAKEHGAY
                     LLCDMAHISGLVAGKEQNSPFEYCDVVTTTTHKTLRGPRAGLIFFRKDREADLEARVN
                     AAVFPACQGGPHNNTIAGIAVALKQAADPAFKQYAKQVRANSQAIAKKLVSYGYRLQT
                     EGTDNHLVLWDLRPIGLTGSKIEKLCDLVHITLNKNAVAGDTSAVVPGGIRIGTNALT
                     SRSMTEKDMETIGEFLHRVVEIAQTLQKEAGSKLLKDFIAKASSGEGEGRKQLLKLAD
                     DVKAFATSFPLPGVPDTSVIKQPAGAH"
     gene            <84420..>87512
                     /locus_tag="MRET_0898"
                     /note="MRES_03525"
                     /db_xref="GeneID:38737664"
     mRNA            <84420..>87512
                     /locus_tag="MRET_0898"
                     /product="mitochondrial exoribonuclease Cyt-4"
                     /transcript_id="XM_027627525.1"
                     /db_xref="GeneID:38737664"
     CDS             84420..87512
                     /locus_tag="MRET_0898"
                     /codon_start=1
                     /product="mitochondrial exoribonuclease Cyt-4"
                     /protein_id="XP_027483304.1"
                     /db_xref="GeneID:38737664"
                     /translation="MLRRVAQRTAWRALHSSVLAPREKKWELFNELLKQHVGDHTSPE
                     KPKYDRSVDRRNRGYPELSPAAKWHTPTKKDPDGVDMVYTHKDTMHTHDVRPGDLVEA
                     RKASGTYVGVVLPIPKDREVTGAGQGATLLIVVATGHLEQIRTTDITFQLPQFVDVTT
                     AEKAGPLKWDYVLATAAHTKSAPVSEDMLPESVLEEEPVDLPRFTIRVSICRKIRDMQ
                     RQMDGQIRRIFPAFRTLFLPDPSEDMSAYNASERLIRQRARDVLQTGVVSTMEATRLI
                     EQYLHKKDVPIRVSVMFATHTLLMSHPIQFLADANSHRRSQLFMYRPRHDQEILERVS
                     GWVRAAMSEKPHKNAEHATEVLDGFCMRARYVMAWHDKKPAKDYGPPQLDAFAPGMDG
                     KGEFTWTDTDLDILEFFKMCLGNRRELQENVTGSIAMAIIKRAGVNPKLYPLAFEGST
                     KSRELSEINDRSQAELHTDVLQANVDLQHSLMFEFLTRIGALTPWENPNALDIQFRNR
                     RTIHDAEKNAWELKEELKSRHSFGDMPVYVIDAASSHELDDGMSVEATDNPHQYWIHV
                     HIADPSAWIPKDHALAKSAQHKYSSIYLPELMAPMLPSDVTDNGMSLSDTSKDPMNVL
                     TFSALVDSVTGKVASFDVRRGKVQNIKILHYDQVNQLFLDSHRKHGVSDLRTQQDLRQ
                     IAALASVLNRRRVHVGNAVNATDADSSLSIHPRTLDFLAGHTRDRPHFYTGFPEIRVT
                     FADYENVERPGTYDQVPGGITSETMVSEMMILAGRVAASFGLMHNVPLPYRVQPEPNE
                     EEMATINQLKHPDTGTMAMSKLVSKAIFLPTGYSSIKPGIHFALGVRPIPEKDPNSDA
                     LFRGGYVRVTSPLRRFADLVCHWQLKAILDGQAPPFDTETMSQSLVRFDQMDIWIKQM
                     ERASQRFWMWTYVDRLLKKKKQYDTECRIDYEEYFTKEERELLSPIPAFQSIMDVRYN
                     SELLESNIRVSLLHFGGLPADCRWPNGKSPPKRDEIKKVKILKTISASTRRTIICSIA
                     "
     gene            complement(<87664..>88866)
                     /locus_tag="MRET_0899"
                     /note="MRES_03530"
                     /db_xref="GeneID:38737665"
     mRNA            complement(<87664..>88866)
                     /locus_tag="MRET_0899"
                     /product="DNA damage-inducible protein 1"
                     /transcript_id="XM_027627526.1"
                     /db_xref="GeneID:38737665"
     CDS             complement(87664..88866)
                     /locus_tag="MRET_0899"
                     /codon_start=1
                     /product="DNA damage-inducible protein 1"
                     /protein_id="XP_027483305.1"
                     /db_xref="GeneID:38737665"
                     /translation="MLTVLDKLGQSVPLDVDTSIELENVKAILEAEFAIAPENQQILF
                     LGRVLPDDKRTLASYGIKDGDLLVIHDTRAMITQNPEMSNLEELMRQQILQSPSMQQN
                     LRQHNPVLLDAALRSPQEFKQVITQQRAKVQEMQAAQEELLNADPFDVEAQKKIEESI
                     RQDRVTENLEHAIEYSPESFGNVSMLYVNLKVNGHPVKAFVDSGAQATIISPDCATRC
                     GIMRLLDTRFAGVALGVGTAKILGRIHSTQIQLGSDLFLPCSFTVLEGRSVDMLFGLD
                     MLKRYQASIDLKKNALIIQDREIPFLPEHEIPKNEHNLPLLGDAEPKETDGAEFQSRV
                     ANEKSSTDSTSRSSQQGGPTRDNTKIWDKEKIKELVNLGIPKNEADELLNAANGNIEI
                     AASIYFSK"
     gene            <88934..>91780
                     /locus_tag="MRET_0900"
                     /note="MRES_03535"
                     /db_xref="GeneID:38737666"
     mRNA            <88934..>91780
                     /locus_tag="MRET_0900"
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase DHX38/PRP16"
                     /transcript_id="XM_027627527.1"
                     /db_xref="GeneID:38737666"
     CDS             88934..91780
                     /locus_tag="MRET_0900"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase DHX38/PRP16"
                     /protein_id="XP_027483511.1"
                     /db_xref="GeneID:38737666"
                     /translation="MASRFPEYGDESARRPRRQEQDDLSDNEGWDEDEETDIDREWYL
                     QDDEGGVAGDADHNPFAQYEDMHGQVSNVLARRQQRMTARQAQYNVDLDAWEKSRLQS
                     GGVGGRQAVRDDLDDHDENRIHLLVHNLRPPFLDGKTTYTKQLAPVSPVRDPTSDLAV
                     FAMKGSRLVKEHREQAERAKAAGRVASLKGTQLGNIMGVKDDDDEDTTKSKIDPSRDQ
                     GDSKFATHIKKAQGASAFSRNKSLREQRQYLPAFACRDDLLRVIRENQVVVVIGETGS
                     GKTTQLCQFLHEDGYTQYGMVGCTQPRRVAAMSVAKRVSEEMECALGNTVGYSIRFED
                     CTSRDTKIKYMTDGVMLRESLTERDLDRYSAIILDEAHERSLSTDILMGLLKQVLMRR
                     RDLKLIVTSATMNAEGFSKFFGAVPIFTIPGRTFPVDVLYSKTPCEDYVESTVKQILT
                     IHLSQGQGDILAFMTGQEDIEVTCEVTIERLKQLEGAAPLLMLPIYSQMPADLQARIF
                     EPSEHGERKCVVATNIAETSLTVDGIMFVVDSGFSKLKLYNPKVGMDSLQITPISQAN
                     AAQRSGRAGRTGSGTAYRLYTEVAFHNEMFPSTIPEIQRTNLANTVLLLKTLGVKNLL
                     EFDFMDPPPQDNLLTSMYQLWVLGALDHVGNLTELGRKMSEFPMEPSMAKVLIMSTEY
                     GCSEEVLTIVSMLSVPTVFYRPKERQEESDTARERFYVAESDHLTLLHVYMQWKNNGF
                     KDNWCAKHFLHAKLLRKAREVRAQLEDILRSQKLPVVSCGTDWDIVRKCITSGYFHHA
                     ARVKGVGEYVNCRTGVPMHMHPTSALYGLGYTPDYVIYHELTLTSKEYMGIVTAVDPY
                     WLAELGAVFYSIRESNALASDSRRGRDTQLSRLVEIEAEFERDRQRTADEQETSLKRA
                     RRHGPGHGSTSHEGIAMPGIGPPRRGRRRLPLGK"
     gene            <91811..>92926
                     /locus_tag="MRET_0901"
                     /note="MRES_03540"
                     /db_xref="GeneID:38737667"
     mRNA            <91811..>92926
                     /locus_tag="MRET_0901"
                     /product="nuclear pore complex protein Nup37"
                     /transcript_id="XM_027627528.1"
                     /db_xref="GeneID:38737667"
     CDS             91811..92926
                     /locus_tag="MRET_0901"
                     /codon_start=1
                     /product="nuclear pore complex protein Nup37"
                     /protein_id="XP_027483512.1"
                     /db_xref="GeneID:38737667"
                     /translation="MSIPLQARSGAWQPALELLEPISLVRCCTSPLGRNLCMIVTETA
                     VHVYATSDESPNLSFEPVTSFFLGCRATGASWSPSTQHASTAWRIEILVATETNELRL
                     LESVRQGSEASTSNKKLADTYARVTDLAWCASPGYESYAAAACSDGTVRLWDLEGGCR
                     THYLNSAVLSVAFHPKVPKLLLAMESSGVGYLLDWLASDGEVRTAASFHEPITLGAHA
                     TQHYEAQGAAAWQAQDADMVGALLGTRWCVWNVHEASVPVASGQLHQPSVHGGLRFCP
                     TNSRLFAVFAHGSMTPAVHIFDSAFPASPRGIDVHAQTPFRPGPVSLDTTGVAGTGAT
                     LPSAYGAQSIDWMPRRMAAYDVLLVGVGRHLVPIPVA"
     gene            complement(<92927..>96727)
                     /locus_tag="MRET_0902"
                     /note="MRES_03545"
                     /db_xref="GeneID:38737668"
     mRNA            complement(<92927..>96727)
                     /locus_tag="MRET_0902"
                     /product="E3 ubiquitin-protein ligase TRIP12"
                     /transcript_id="XM_027627529.1"
                     /db_xref="GeneID:38737668"
     CDS             complement(92927..96727)
                     /locus_tag="MRET_0902"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase TRIP12"
                     /protein_id="XP_027483513.1"
                     /db_xref="GeneID:38737668"
                     /translation="MEQRPPDPSEKLVSNRQTISDTSGTRKRKSSGTPRARKAPAASP
                     MTSSRHKGSSSPDESDANWLDDEDALQELYDHVADEEEEEEEEEVDEEGVDPMMMAEH
                     LGRLFGGGRMMSKRYRDFLEALQNAAYDPVRRLVVLQDLAEQLSIATEDVFLGGFPMH
                     GLLVELLWTLGSDEPRTHPVHASDDSGDAELYACRCITYILEAAPPVVPHVASIVCQH
                     GTIPLLITKLQEISYIDLAEQVLQTFEKLSHTNAAEIVRAGGMLAMLQYLDFFGIHVQ
                     RTAMAAVAHCAKVRPTHTRHVTDVVPIVRQVLGYSDARLVESACECVCHWLTNLPDED
                     ALDEFLPTVCALLARGLGQATDGLPTLAPDTYARLLQALAHAARARVSAAHLLYEHHL
                     LETVHTFLSSSVSDGVPSALAVLRDMLPPLPCTGIFDAKMYTAKAYEQQCRLAEREHC
                     ELGALDVPSRRLSTSSEREQRAIDARAQTQRTWPSFFHRYAAHLLPVLLRVYAASRAL
                     RATPTVLEIVLRTLWHTSTETLVPALEHVPLASFFAGVLTSGDTEQALQGVELLVTRL
                     SYLPYLVREGVVHQVTHLADEGDIRAKLVGARLAVIPDDAHIQAARDIPKTLRAIASR
                     IEAASHADALRDALAALVEWIPRMTGFEMQVSGVLDALRQPGLVSGERRHALRDVLLP
                     VHAPLLSCLHDVVSRSEDECVLSAGGVESLKKRVQLRLTPDPATAGKLPATFHSLVVS
                     VHAVVRIQSLHDFLRPKMDFMLRKQGPWHLVLEANGRPMPRSATLYKCVGLPDDAYPV
                     QYRMAEREEEETPEPLDEDVPSYAPALDLIRELHDLWESAVPEALYVNGPLSAKLAQQ
                     LDEPLVLASECLPTWARTLPVRYPCIFPFETRLKYMQHTALDFARLMHQYRHVCARDD
                     TLMLHANMPRQKVRIARNQLLESAIRVLELYAHTPSLLEVEYFDEPGSGLGPTLEFYT
                     LVSQAFQAMPDLWRGEPSMPLFPKPSGDASLFRVLGQFVAKSIVDLRMIDVPFHPLFW
                     RAVLGRRVPHTLETLEALDAVQARSLRALQTMPADELERLELDGTLPGTERELVQGPL
                     TSANINAYIQAVVDVSLHDGIAPQLDAFRAGFESVLSLDALRVFASHELSALFGQATE
                     DWSEATLLRTIVPDHGFSSDSEPFRALLSILVEFDASERRTFLQWLTGAPRLPIGGFA
                     ALQPPFTVVRRQPEPPLQPDDYLPSVMTCVNYLKLPCYSSRDVMRQKLCLAMHEGLAS
                     FYLS"
     gene            complement(<96862..>99381)
                     /locus_tag="MRET_0903"
                     /db_xref="GeneID:38737669"
     mRNA            complement(<96862..>99381)
                     /locus_tag="MRET_0903"
                     /product="CLIP-associating protein 1/2"
                     /transcript_id="XM_027627530.1"
                     /db_xref="GeneID:38737669"
     CDS             complement(96862..99381)
                     /locus_tag="MRET_0903"
                     /codon_start=1
                     /product="CLIP-associating protein 1/2"
                     /protein_id="XP_027483514.1"
                     /db_xref="GeneID:38737669"
                     /translation="MEPTELTLVHAIDTAPDADACVDAIDALTARWQSAHEVHDVDVC
                     VMSLHTHMLSAHIGVTRAVYAALATLLETAAPQLSTARHVQTIVKMGVPPALERMPDV
                     PAARAWLEQVRHVVYADVVGAARMRESDMPRTLWEHTIRDAGLCATSPRVRAGTLRML
                     SEAPAEAALATYMPYLLERLHDADGDVRAAATAAVHALSAHATPTQLSELREALPDHA
                     GLETRGSQTPAQAPESLPFWADVACDDIRPVAIWSRHDVDAALQHASHVLEGKETETN
                     WQAREKAVVHLRGMLKAGVPDEHIAAFAAQMRHIQEGLLKTLASLRTTLSMHTIALIR
                     QLALSLGAHLEHSIMDAWFTALLRMAGITKKLVASASQVAVDTILACFPVRHMHWQSL
                     YAGLQDKSVATRVYMCKHVHLVLQVHGHKRTEMEAHHGLDMTRQCLERALSDPSAEVR
                     SAARDVFGTLYRLHRTDAESLLAALPPATHKQVAASLETPSSPAVTPRRPSSRAGPSR
                     AIVAAKRAAMQQQRDTVAERPRMPRDSVWHPSLVENGPDASTDLVGSDVPWHEREDGD
                     DMSMMLQGLQIHTPRATRHDVIPSTPTTPVTPKPPRPTAPAQMPSTASAWFLDQSARV
                     LQDVCKEAPPASDEGMTHWAEAPATALGRLAQHLDTQAPEDLAPVLDGMHAQLDQARD
                     DTTWLLILTVLHRLAPYVCRDEALERAWLAQVLHVPSTRPEHITLAMGASRAMLNVWG
                     THSHSSAALMSQVGDDAEQRILALHALEVRRITDLEELRATAPLVQVALRDPHTPVRR
                     ACVSFLAQVPREALTLYAPLAAGEERLIQYYRDRLGGGGRT"
     gene            <99485..>100519
                     /locus_tag="MRET_0904"
                     /note="MRES_03550"
                     /db_xref="GeneID:38737670"
     mRNA            <99485..>100519
                     /locus_tag="MRET_0904"
                     /product="replication factor C subunit 3/5"
                     /transcript_id="XM_027627531.1"
                     /db_xref="GeneID:38737670"
     CDS             99485..100519
                     /locus_tag="MRET_0904"
                     /codon_start=1
                     /product="replication factor C subunit 3/5"
                     /protein_id="XP_027483515.1"
                     /db_xref="GeneID:38737670"
                     /translation="MADKGKGRDVGDAPRSSDALPWVEKYRPATLDEVLSHQHITSTL
                     ERFIDAHQLPHLLFYGPPGTGKTSTIMALAARLYGTSYRSHVLELNASDDRGIDVVRG
                     QIKAFASTRNMFSTQTDTFKLVILDEADAMTQAAQAALRRVMEQYTRNVRFCIICNYV
                     NKIIPAIQSRCTRFRFSPLDRAQVERRIDSVIAAEHCRIDDRAKAAILQLSHGDMRRA
                     LNILQACDAACEPGSLIDEDSVYTCTGHPHPHDIETAFHAMLEQEFTTAFHTVQALRI
                     DKGMALPDLLTGMHDLVMSLELPPHARVYILDQMAQIEYRLSTNASERIQLSALLASV
                     KTTVDMATAS"
     gene            complement(<100514..>100978)
                     /locus_tag="MRET_0905"
                     /note="MRES_03555"
                     /db_xref="GeneID:38737671"
     mRNA            complement(<100514..>100978)
                     /locus_tag="MRET_0905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627532.1"
                     /db_xref="GeneID:38737671"
     CDS             complement(100514..100978)
                     /locus_tag="MRET_0905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483516.1"
                     /db_xref="GeneID:38737671"
                     /translation="MDDESWDGAFGPPMGGSTLADELGASDAACEVAMVDELGPSDAL
                     LDAWAAQCAEMDVYVQLAAVPRESVRAVDGDAELVRLLMHVGDEAQECGALLQECHRQ
                     TRQLVSLCEHRHRELASYAEAAERRVRVPRGDDAVWDEAPIYACLESVSSGL"
     gene            <101063..>102600
                     /locus_tag="MRET_0906"
                     /note="MRES_03560"
                     /db_xref="GeneID:38737672"
     mRNA            join(<101063..102310,102337..>102600)
                     /locus_tag="MRET_0906"
                     /product="sorting nexin-41/42"
                     /transcript_id="XM_027627533.1"
                     /db_xref="GeneID:38737672"
     CDS             join(101063..102310,102337..102600)
                     /locus_tag="MRET_0906"
                     /codon_start=1
                     /product="sorting nexin-41/42"
                     /protein_id="XP_027483517.1"
                     /db_xref="GeneID:38737672"
                     /translation="MHSQIRITDALSSTEFSKSSYIVYVISSPGHEAKRRYSDFEALR
                     EALEKLHPTLIIPPIPSKHSLLDYATNPVRAKNDPALIARRKRMLERFLQRLDTHPVL
                     SIDVVFRRFLEARYSWHEIAHTPPLSTLPKSNLNAPPQHPSHPDAPACYAFLPTPTAP
                     SKLHTPDAHFLDAEGFTHRFESFMASTMEPSNRRLVHRWRDIAADYADLGALLNAQSL
                     AEQTQLAPAIESTGKAADTTYVALSDMLHDWDAHVSEPIHEYTQYASILSRLLRWRHL
                     KHQQYEMAQDMLESKSQHLAECEREEAQAARLSKALETGGTSLLDKRRTQAPMSSVYG
                     RAAESDAEDEVPSPAEATEPSTDDDLTSMWARKAASPHTPPAAPPQRGFLGSLTNRFA
                     HVVDLDPNRTRQNAISRLREEVLHLQEAIEYTAQDLAYTNKTIQASLDRFQRIKVQDI
                     KQLMLDLARMQRAYCSKSLDAWREARDQIEHIDDATWEHMPAARLSASTHDRT"
     gene            <102731..>103189
                     /locus_tag="MRET_0907"
                     /note="MRES_03565"
                     /db_xref="GeneID:38737673"
     mRNA            <102731..>103189
                     /locus_tag="MRET_0907"
                     /product="ubiquitin"
                     /transcript_id="XM_027627534.1"
                     /db_xref="GeneID:38737673"
     CDS             102731..103189
                     /locus_tag="MRET_0907"
                     /codon_start=1
                     /product="ubiquitin"
                     /protein_id="XP_027483518.1"
                     /db_xref="GeneID:38737673"
                     /translation="MQIFVKTLSGSSITLDVEESDTVDHVKAQIQRKQGIPPDEQRLL
                     FAGKQLEDGRTLSDYQIQKESTLHLELRLRGGAKKRCQNGAGTDQQCRDAAIQLVGEC
                     PHCHLKFCGRHRLPETHNCAQQEQLRSAAFAANKEKLESERTVGTRGLVH"
     gene            <103357..>104604
                     /locus_tag="MRET_0908"
                     /note="MRES_03570"
                     /db_xref="GeneID:38737674"
     mRNA            <103357..>104604
                     /locus_tag="MRET_0908"
                     /product="aspartate aminotransferase, cytoplasmic"
                     /transcript_id="XM_027627535.1"
                     /db_xref="GeneID:38737674"
     CDS             103357..104604
                     /locus_tag="MRET_0908"
                     /codon_start=1
                     /product="aspartate aminotransferase, cytoplasmic"
                     /protein_id="XP_027483519.1"
                     /db_xref="GeneID:38737674"
                     /translation="MSAFSSNEALWSQVPKAPSDAILALTVNYKNDPSETKANLGVGA
                     YRDENGEPWVLPAVRRATEELLRDPKLNHEYLPITGYAPFTAAAAKLMFGDDAPVVKE
                     ARIATNQTISGSGAVHLGAVFLHDFYPFPKDKTVYVSDPTWPNHFAILKAAGLSTQTY
                     TYYDSSSRSLHFEGMYRDLASLEDGSVVLLHACAHNPTGVDPTEEQWKKLADLFAEKK
                     LFAFFDSAYQGFASGDPAKDAFSVRLFAERGISLLVAESFAKNAGLYGERIGALHIAT
                     ASSAQAEAVLSQLNTIVRRENSTMPAFGARIVTKILTEPELRAEWDRDIKTMSRRIIS
                     MREQLYDLLTNKFHTPGSWEHIKTQTGMFSYLGLDEAQCDRLIREGHIYLMRTGRVSM
                     SGFNSRNVEYIASWIDKVVRERS"
     gene            complement(<104621..>105322)
                     /locus_tag="MRET_0909"
                     /note="MRES_03575"
                     /db_xref="GeneID:38737675"
     mRNA            complement(<104621..>105322)
                     /locus_tag="MRET_0909"
                     /product="non-structural maintenance of chromosomes
                     element 1"
                     /transcript_id="XM_027627536.1"
                     /db_xref="GeneID:38737675"
     CDS             complement(104621..105322)
                     /locus_tag="MRET_0909"
                     /codon_start=1
                     /product="non-structural maintenance of chromosomes
                     element 1"
                     /protein_id="XP_027483520.1"
                     /db_xref="GeneID:38737675"
                     /translation="MDRATLRQALVQCLLQRRMTKRADAYAAYQRLATHMGVDEAFDA
                     DLDAIHASLAPLGWDVRACHDQERAEPYLLVVNAKSDELAQVATPYSAAELQYIKALV
                     HAIFHAPQYALPSIQALQLATHTQPVPLTKQTATQLLANLERRQWLHHLPSGAYTLTL
                     RALHELDTYIRHEMDEACVLECMACYAIVTRGVRCASCRGAVHTSCQSAYEAGHATCT
                     LCGVAWQPVPVGESL"
     gene            <105438..>107216
                     /locus_tag="MRET_0910"
                     /note="MRES_03580"
                     /db_xref="GeneID:38737676"
     mRNA            <105438..>107216
                     /locus_tag="MRET_0910"
                     /product="methylenetetrahydrofolate reductase (NADPH)"
                     /transcript_id="XM_027627537.1"
                     /db_xref="GeneID:38737676"
     CDS             105438..107216
                     /locus_tag="MRET_0910"
                     /codon_start=1
                     /product="methylenetetrahydrofolate reductase (NADPH)"
                     /protein_id="XP_027483469.1"
                     /db_xref="GeneID:38737676"
                     /translation="MKGDDSSKITHKIARAKREGRVWWSFEYFPPRTPQGMQNLYDRI
                     ERMSQLGPEFVDITWNAGGRTSDMTTQLVKTVHAYFGVETCMHLTCTNMPRSKIEVAL
                     REAKEFGCRNVLALRGDPPACGSPWEPHAAGFSHAYELVQYIREHYGDYFTIAVAGFP
                     EGHPEATGGPDVEMQHLKQKIDAGADFIFTQMFYDLDAFVGWSRRVRATGITVPIVPG
                     VMPIQNYGQFTRAVARFQAFVPPHFHEALDPVKDDDEQVRVVGTRLVGDMCRQMLAHP
                     DLDVHGLHIYTMNLERGSRMLLEYLGLTPSVNQLNPLPWRPSLTPKRRDENIRPIFWA
                     NRAKSYVNRTDGWDEYPNGRWGDARSPAFGDLGTMEPNLPVTQDEARALWGTPTSVED
                     LQRLFVRFCAGELASLPWSDAPIAKETKTIDQLLVQLNERGFLTINSQPAVDGAPSTD
                     PVHGWGPPHGYVYQKAYLEFFVSTHKLDELIARIEAHPQITYHAVNAQGDMRTNTTSD
                     APNAVTWGCFPHCEILQPTIVESMSFLAWKDEAFQIGRCWAAQYEPDSPTRRLLEHVF
                     DTYFLVNVVHNDFKRPHAIFEPFLTA"
     gene            complement(<107267..>109369)
                     /locus_tag="MRET_0911"
                     /note="MRES_03585"
                     /db_xref="GeneID:38737677"
     mRNA            complement(<107267..>109369)
                     /locus_tag="MRET_0911"
                     /product="actin-related protein 8"
                     /transcript_id="XM_027627538.1"
                     /db_xref="GeneID:38737677"
     CDS             complement(107267..109369)
                     /locus_tag="MRET_0911"
                     /codon_start=1
                     /product="actin-related protein 8"
                     /protein_id="XP_027483468.1"
                     /db_xref="GeneID:38737677"
                     /translation="MAPKAAKQVLPPNPPADETRTLPLAYTSFHPPPFVNAKNVSSSY
                     LKTEAQTWVSRSHRPTKRPKTGADGDDGDDDPASRRLVIHIGSEAIRLGRATDLYPTV
                     VPHVLARQLPHPRAQPARPHATEAQLEMLRAELRSIMRQYKLRPVSNGWQSANSYNSS
                     VEPEPVAAHNDVYHVGFVDEGDASVVVGHEALRLASLSRPSAWRLFSPWTRGMLNVTG
                     YAAEYGDACIEALLGDVQRILTHAISSAPSKASGPADAADDAGLGIPTSEYGDYAVLL
                     LVPDSFSRSDLRALGHVLLRYMGFSALHVQTEGLCATFGAGLSAACVVDVGATSIGIS
                     CVEEGLVLPETRVALSYGGQDMSRFFGDVLRGSSFPYTDLQEARLADVQLLQDLKERF
                     VTLQPSQVGLNLYDFMVRLPGETARKYALRLYDEPILAGLMLFHPDVAAPPPMPRRPL
                     TCAQPAPAEEADEPEPTAVLAAANASLGGDEAVELCASAVLDMAPTLAMLGCVSRRLS
                     PQVAALVDMRADEASEEAPRAAPTIPQTSAMATQAAKCASAAAQAAQDGIDVVQAASV
                     TPLDHAVFRSLLASTGTVDGSFAHGGEERLRRLANNIVCTGGAARIPGLSEALEARVS
                     MLLAEHYAPADGAPGAPTTAPQAVVIPPPRNLDPASLAWKGLAVMAHLDAMQELWIQA
                     SDWDTLGYRALKEKSLFL"
     gene            <109525..>110622
                     /locus_tag="MRET_0912"
                     /note="MRES_03590"
                     /db_xref="GeneID:38737678"
     mRNA            <109525..>110622
                     /locus_tag="MRET_0912"
                     /product="SAP domain protein"
                     /transcript_id="XM_027627539.1"
                     /db_xref="GeneID:38737678"
     CDS             109525..110622
                     /locus_tag="MRET_0912"
                     /codon_start=1
                     /product="SAP domain protein"
                     /protein_id="XP_027483467.1"
                     /db_xref="GeneID:38737678"
                     /translation="MWRVKHTISTPSLRALSRSTAAPSRSLVSTVLLTNEGYDTKQVT
                     ELRALLRQRGLTTSGRKAELVQRLKQSDMTRAGSTLASADKAPQSRAKKGRQAVQDLE
                     EKQPSLPMEPGTVVSATAVRQGQGAGTSSSSPQAAQPQTGAVRGQPALTPEASTPTFD
                     VQIPSEPLAEPEAQYIPSIKPLTDPTSHNYTDPTRESDLILPHVPRMYRVAQDADVAH
                     IGGLAWSEKHGGPSSSRNVVLDVLSDALPTQAHKKLEHTWHTASHASSRALSSMASEV
                     TRVVPIDPSVAPSTSHARPSARRPLNESESRGLWVLGGIVATGMAVGSWMSRDRPPRA
                     AAAAAAAPHPAAQPPVYAHGGGIVGGGARRV"
     gene            complement(<110627..>111252)
                     /locus_tag="MRET_0913"
                     /note="MRES_03595"
                     /db_xref="GeneID:38737679"
     mRNA            complement(join(<110627..110637,110661..>111252))
                     /locus_tag="MRET_0913"
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /transcript_id="XM_027627540.1"
                     /db_xref="GeneID:38737679"
     CDS             complement(join(110627..110637,110661..111252))
                     /locus_tag="MRET_0913"
                     /codon_start=1
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="XP_027483466.1"
                     /db_xref="GeneID:38737679"
                     /translation="MSLRVATLERRTNETQIHVSIALDTHPVDAPPKIQVSTGIGFLD
                     HMLHALAKHGGLALELQCRGDLYIDDHHTAEDCAIALGQAFKQALGEIRGVKRFGTGF
                     APLDESLSRAVVDLSSRPYCHTHLQLRREKIGDLSCEMIPHIFHSFATEAGITLHVDV
                     LHGENDHHKAESAFKATALALKEAITRTGSQDVPSTKGVL"
     gene            <111303..>113126
                     /locus_tag="MRET_0914"
                     /note="MRES_03600"
                     /db_xref="GeneID:38737680"
     mRNA            <111303..>113126
                     /locus_tag="MRET_0914"
                     /product="dynein intermediate chain, cytosolic"
                     /transcript_id="XM_027627541.1"
                     /db_xref="GeneID:38737680"
     CDS             111303..113126
                     /locus_tag="MRET_0914"
                     /codon_start=1
                     /product="dynein intermediate chain, cytosolic"
                     /protein_id="XP_027483465.1"
                     /db_xref="GeneID:38737680"
                     /translation="MAGRRAEIEAKRAKLAELRRAREEREEKARQRPAPPPPSVDELV
                     ASLLASSRPEAPTAAAVPAAPVQAPTPAPAAAAPTSPPAPAPSSTPADAPVGAPPPAR
                     DTPIPERLLYTKQVQTDALDEPIAAPAVATEAPVAAAAAPIAVETRARQPVQPDFVDF
                     VHAKTMVMERMLDEPYNVLTDYTHVPTDAPERPSMHLVRTFFDDTLLATRAVTDVDWS
                     THHPELVVASYNRKRVLRHEDDHDGLVAVWNLHVRDRPEMVFTAPNDVVSVLASPFHP
                     HLFVGGTFGGQVLLWDARQRGLPVQRTPWAFSSGGTHAAPVYALRIAGSAHAHHLWSA
                     STDGLVCTWSLDMLARPQETIPLTNPMHPRSARMHVTSIDAASHDPSRFFVATDEGNV
                     FDAQRVDRAGLQAGLDTARVYVGHSAPVTRLETHPTHMLDERLPASIADLFLTASMDA
                     TTAVWQPAQTPAEPRVFYPHAHPRIATNTRTNPLAFRHAAWAPITPLARFEHAHDYVM
                     DARWHPHHPAVFCQADAGGHVDVYHLTQHTERPVLSARVPGDRGVHRVAWERRRPTAT
                     RLAAGGMDGRLHVYQVPEAAVHVRGDADVAEMERLLSRWHG"
     gene            complement(<113240..>113696)
                     /locus_tag="MRET_0915"
                     /note="MRES_03605"
                     /db_xref="GeneID:38737681"
     mRNA            complement(join(<113240..113264,113308..>113696))
                     /locus_tag="MRET_0915"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627542.1"
                     /db_xref="GeneID:38737681"
     CDS             complement(join(113240..113264,113308..113696))
                     /locus_tag="MRET_0915"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483464.1"
                     /db_xref="GeneID:38737681"
                     /translation="MEDVDASARPVHLVVLGGRVGSGKSSLARAAVATWPGTWRRCSQ
                     DALGSRRAVERAAREALWRGEHVLIDRTNLDRAQRAHWLRLAHEVRAVRPVVVSLLWL
                     DVDARVCRERLAVRQGHPTLRTPAQAHAARRAAVR"
     gene            complement(<113728..>114906)
                     /locus_tag="MRET_0916"
                     /note="MRES_03610"
                     /db_xref="GeneID:38737682"
     mRNA            complement(<113728..>114906)
                     /locus_tag="MRET_0916"
                     /product="SAC3 GANP domain protein"
                     /transcript_id="XM_027627543.1"
                     /db_xref="GeneID:38737682"
     CDS             complement(113728..114906)
                     /locus_tag="MRET_0916"
                     /codon_start=1
                     /product="SAC3 GANP domain protein"
                     /protein_id="XP_027483463.1"
                     /db_xref="GeneID:38737682"
                     /translation="MAPDADWPQALRELVGRAFGQCADAQRGAVSAELKRLIFEAVQD
                     GSLHTRDWARVRLASLGETRKRRAPDTPTKAGRYREDPTRRELRQRRFEAEQAAFERE
                     QQADRVAAAVPVRDAAPDPNVVDWDAYTVVGTSTKLEKPYLRLTSAPDPKTVRPLATL
                     RRTLALLTQKWASERNYDYMCDQLKSVRQDLTVQRITNEFTVRVYEMHARLALDMGDL
                     GEYNQCQSQLRVLYAYDLPGSRLEFLAYRILYLLHTRQQRDVHTLMAELSDEAQADVA
                     VRHALDVRAAMRCGNYHRFFELYAHAPNRNACLMRHFVDRERVQALWILARAFRPACA
                     LPFLTSELGWSTEEEARAFLAKHGVACFVGAAWDTKRAEAPLVAALASYRHVDLQGPR
                     "
     gene            <114984..>116033
                     /locus_tag="MRET_0917"
                     /note="MRES_03615"
                     /db_xref="GeneID:38737683"
     mRNA            <114984..>116033
                     /locus_tag="MRET_0917"
                     /product="homoserine kinase"
                     /transcript_id="XM_027627544.1"
                     /db_xref="GeneID:38737683"
     CDS             114984..116033
                     /locus_tag="MRET_0917"
                     /codon_start=1
                     /product="homoserine kinase"
                     /protein_id="XP_027483462.1"
                     /db_xref="GeneID:38737683"
                     /translation="MSRSFHIRVPCTSANIGPGFDVVGLSLSLYLFLDVTIEADAPHK
                     DPVLTYSGQGAADAPLNPYQNLITRVALYVMRVNDIKSFPRGVRIHVRNDIPFGRGLG
                     SSGAAVIAGLLLGNELGQLHIDRDRLLDYALMIERHPDNVAAALIGGFVGSYLRELSG
                     EAAATTQVPLSEVLPAYPDNASESWGYHPPTPPQGIGHYIRFGWAKEIKVIAIIPHFE
                     VLTAEARRVLPDTYTKEDLVFNLQRLAVLTTSLARSPPDVHLIFQAMQDRVHQPYRQH
                     LIPGLPRILASVTPMTHPGLLGICLSGAGPTILALATDHLDHIAETLCHEFAKEHITC
                     DTKFLQVTEDGAQVY"
     gene            complement(<116030..>117361)
                     /locus_tag="MRET_0918"
                     /note="MRES_03620"
                     /db_xref="GeneID:38737684"
     mRNA            complement(<116030..>117361)
                     /locus_tag="MRET_0918"
                     /product="kinetochore protein Nuf2"
                     /transcript_id="XM_027627545.1"
                     /db_xref="GeneID:38737684"
     CDS             complement(116030..117361)
                     /locus_tag="MRET_0918"
                     /codon_start=1
                     /product="kinetochore protein Nuf2"
                     /protein_id="XP_027483461.1"
                     /db_xref="GeneID:38737684"
                     /translation="MATTDQNYTSFPAVTTDELLSVLHELNLSVTAEDVAKPQGGMVQ
                     KVYLAFLDTLAGTMPDMLEKQRDALCEGMEHKEIYEDGVAWLLFFREVRAMMEAATVH
                     DFHLQDLTRPTPKRFKRHMSALVNFFRFRSDRLAEFDELVLETEDLETRRLEWEESMD
                     RTRQAIAEIVARRKHDEPRVKQLQEENLSHSDKLLEMKKEQGRLLAEVDALKSDKAEA
                     IQKQTDIQYQLQIVATELHKLQTRIVTRPEEIKQQVQDMQVQVHGERAALGESERKVR
                     EWRAKMDVLVRLDDEIATSIRAMEQVAADMERTAQEARVLQDMKATMASRTQEQSTQL
                     HRMEQLDRQVKSATERLERARHDLEAARAHRQAKLQALGARLSDVSRLRKERHAMAEI
                     KHHEAVDMERQLATVMQEHEEHYGQMQLEKDALSRTATAYMDAIARALSLG"
     gene            complement(<117433..>118188)
                     /locus_tag="MRET_0919"
                     /note="MRES_03625"
                     /db_xref="GeneID:38737685"
     mRNA            complement(<117433..>118188)
                     /locus_tag="MRET_0919"
                     /product="glutathione-dependent oxidoreductase"
                     /transcript_id="XM_027627546.1"
                     /db_xref="GeneID:38737685"
     CDS             complement(117433..118188)
                     /locus_tag="MRET_0919"
                     /codon_start=1
                     /product="glutathione-dependent oxidoreductase"
                     /protein_id="XP_027483460.1"
                     /db_xref="GeneID:38737685"
                     /translation="MTTSSLSNVVAITSPDMFTSLMQQDLNRVTLLNFWAPWAQPCEP
                     MMAAVRDLAVKYPHVLFMNIEAEEQPDVSESFDVEAVPTVVLLRGHTLLSKLTGGQPQ
                     AVEQVLAAHAKVPSASALSGGEPAQGVDADVGKPHALPTHIDVSQESAEETERRCREL
                     MSRSRVMLFMKGQPDMPRCGFSQKTITLLRDQNVEFDYYDILSDEPVRQTLKVLNDWP
                     TFPQIMVQGELIGGLDILTEMVASGEFQHMISA"
     gene            <118654..>121608
                     /locus_tag="MRET_0920"
                     /note="MRES_03630"
                     /db_xref="GeneID:38737686"
     mRNA            <118654..>121608
                     /locus_tag="MRET_0920"
                     /product="ubiquitin carboxyl-terminal hydrolase 4/11"
                     /transcript_id="XM_027627547.1"
                     /db_xref="GeneID:38737686"
     CDS             118654..121608
                     /locus_tag="MRET_0920"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 4/11"
                     /protein_id="XP_027483405.1"
                     /db_xref="GeneID:38737686"
                     /translation="MSFSPPAPHSAEPHSVHTTPAALAKRARTSSPIDTDDSSDTEST
                     LELDADMPSFSRTDDSVDALMDESLKLDEAPHATIVREMEAWRETKPRIGDTWYVVPA
                     AWYEQWKTKPHAPAMDLQALCAPNGTLRELAPEEYVLVPTPVWDFLSSRYRIVGASLG
                     CPVVPGSDGPVVQLVGKTVELALCTPYAPLVDAFEPFVRHGTLPTAQNDTRQALEERV
                     RAMGAPQQVRFFRLPMTLRAVALANRGMVSLSALAKYPIELVDEHTTPLELVGIDVRP
                     SPDEPWHVPHGDQRHSTRSSSTPALGLRGLANLGNTCFMNSALQCLSNTPELQQYFAR
                     NAHQDELNTDNPLGMGGALAMAYGRLVQSIWAAQQGAVVPREFKMALARYAPQFMGYA
                     QQDSQELLAFLLDGLHEDLNRIHRKPYIEAPDWTGGSDADMVRFAQQQWDLYKARNDS
                     VIVDLFQGQYRSTLVCPVCHKVSIKFDPFMYLTLPIPNTRKWRGRVYFMRPSSPTVQV
                     DVQLPATATIADLRTKVSALVQAEHLVIGEVWSHHVYRWIHDYEPVCDINAGDHIYLW
                     DVGTPFSLPAPRKPPSRFSLFARPERSVEEVENAYSPPPMPDLVCVPVFSCKADGVGR
                     FGSFRRSLGEPLGVPFFVTLPRTLLHQVEGIQDAVERHYLPLSQQDSLEAMKQRAHAM
                     GKDELFQLRVAVPSADEAMHRGDDASEQTTEDLAARASRGGPWPVLFPGAALYALWDS
                     EVAEAVLKPMDRATWGPVSLIQDTDFQQGTAMLAEGRRRAPNLRLEDCLDEFTKEEKL
                     GQDDLWYCPSCRAFQQATKKFDLWKTPDILVVHLKRFSAGRGARDKLDNLIDFPLTSL
                     DLRDRVVGSRLWADLDMKPAPPETRLGDHVLAHDEHDDKVLADTPIYDLYAVDNHYGG
                     LGGGHYTAYAKNPLNGQWYHFDDSSVRPVSDPESTVTSSAAYLLFYRRRTTRPIGGTS
                     YQRLARLHSDTE"
     gene            <121674..>123068
                     /locus_tag="MRET_0921"
                     /note="MRES_03635"
                     /db_xref="GeneID:38737687"
     mRNA            <121674..>123068
                     /locus_tag="MRET_0921"
                     /product="peptidase inhibitor activity protein"
                     /transcript_id="XM_027627548.1"
                     /db_xref="GeneID:38737687"
     CDS             121674..123068
                     /locus_tag="MRET_0921"
                     /codon_start=1
                     /product="peptidase inhibitor activity protein"
                     /protein_id="XP_027483406.1"
                     /db_xref="GeneID:38737687"
                     /translation="MDDAEPHTVCLTFQEQDFCVFPSASDQGPTVYVEETNDDDERIL
                     VGVPAPALPIDRSLFWEPLDAVFGALRVAHVLGEFLEEGTELCIAFPDLDLVLREDNV
                     YARDISLQDISQLALGFECHGSLRLVVTEEPRFISRYNELATALGSEESEEDAQDEEA
                     GEEDEGADKEDEVAGEDDEEEDKEDEEVERGIEEAGKEDEEADEDDDEEDIEVEEVER
                     GIEEADKEDEEAGQEGEEAEEGEEAGDEGEEAGDEGEEAGDKGEEADDDVPGKETDHD
                     TRESNEQAHNAAPMRDDALDAMHALDEEAPKDVPSQDGDETVPSKEPNDAMHALVEEA
                     DHAAHVSSQVQDVVHALDEEVDHDAHDTQADDAPDADPDTIADQDIVQPHDEDAGTEH
                     ADYDEPVDPEVAPTTRIPRGNEASDTEQATETAFDAETASYEQADIATYEDEPLKRSA
                     EPSVLSSPKRPKTS"
     gene            complement(<123137..>124072)
                     /locus_tag="MRET_0922"
                     /note="MRES_03640"
                     /db_xref="GeneID:38737688"
     mRNA            complement(<123137..>124072)
                     /locus_tag="MRET_0922"
                     /product="glycosyl transferase family protein"
                     /transcript_id="XM_027627549.1"
                     /db_xref="GeneID:38737688"
     CDS             complement(123137..124072)
                     /locus_tag="MRET_0922"
                     /codon_start=1
                     /product="glycosyl transferase family protein"
                     /protein_id="XP_027483403.1"
                     /db_xref="GeneID:38737688"
                     /translation="MTDRVVAHQGAACWATLFTHAHYLPCLAVLLQNMRACQTRYPLV
                     VMVTETVDARTRERLTRMGCVLRDVDAWRVPHADGSLAFERFQNVWTKLRAFELYEYE
                     RVVMIDSDMLMCHNMDELFDLPLERGMIAAALACTCNPKQIPTYPAEWTPRNCGYALR
                     PHPPNDTRQLTKPTHRLINSGVVVLEPSQEQHDKIHTFILQHPERVAQYRFPDQDLLA
                     DVYSERVQMLPWHYNALKTLRQCHPDLWNDDEVRMIHYILDKPWLLGPAPCGEHTHLH
                     SLWWNAYASLAAHPATLGMTRDEWAKEVALHVRGI"
     gene            complement(<124103..>125140)
                     /locus_tag="MRET_0923"
                     /note="MRES_03645"
                     /db_xref="GeneID:38737689"
     mRNA            complement(<124103..>125140)
                     /locus_tag="MRET_0923"
                     /product="acylglycerol lipase"
                     /transcript_id="XM_027627550.1"
                     /db_xref="GeneID:38737689"
     CDS             complement(124103..125140)
                     /locus_tag="MRET_0923"
                     /codon_start=1
                     /product="acylglycerol lipase"
                     /protein_id="XP_027483404.1"
                     /db_xref="GeneID:38737689"
                     /translation="MAQPFQVSIDVAHPGTTQEEWYDLRGDGSTQYYLKHWYPTDPST
                     KEVAQPKAAVVFVHGFADYCDRYTGVFRVFPDRGIQVSGFDQLGFGRTWHESPNRATT
                     HGWTSWPDQFRDVSCMLRLTRARLDERWGKDTVPLYLMGHSMGGGITAAFFTRDPASP
                     PEEEVKQLVSGAILMSPWLDIHFPIPTAVGIPVMRSVLRWFPTIKLPLGPPSKDLCRE
                     SAVVQDARVNPLSSCYVHVRCLYGPLSGGPQIVAEDYRRWPERLPLLICHGTGDKVTR
                     WDCSKKLYDHLKGLGRSVQLVSFTGFYHEAIFEPGQDKVLFAQTLVDWVEKQVEARGR
                     PLPPANERSVP"
     gene            complement(<125290..>125700)
                     /locus_tag="MRET_0924"
                     /note="MRES_03650"
                     /db_xref="GeneID:38737690"
     mRNA            complement(<125290..>125700)
                     /locus_tag="MRET_0924"
                     /product="histone H3"
                     /transcript_id="XM_027627551.1"
                     /db_xref="GeneID:38737690"
     CDS             complement(125290..125700)
                     /locus_tag="MRET_0924"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_027483409.1"
                     /db_xref="GeneID:38737690"
                     /translation="MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRP
                     GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQESAEAYLV
                     SLFEDTNLAAIHAKRVTIQPKDIALARRLRGERS"
     gene            <126124..>126435
                     /locus_tag="MRET_0925"
                     /note="MRES_03655"
                     /db_xref="GeneID:38737691"
     mRNA            <126124..>126435
                     /locus_tag="MRET_0925"
                     /product="histone H4"
                     /transcript_id="XM_027627552.1"
                     /db_xref="GeneID:38737691"
     CDS             126124..126435
                     /locus_tag="MRET_0925"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_027483410.1"
                     /db_xref="GeneID:38737691"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYDETRGVLKLFLESVIRDSVTYTEHAKRKTVTSLDVIYALKRQGRTLYGFG
                     A"
     gene            <126739..>127947
                     /locus_tag="MRET_0926"
                     /note="MRES_03660"
                     /db_xref="GeneID:38737692"
     mRNA            <126739..>127947
                     /locus_tag="MRET_0926"
                     /product="acetyl-CoA acyltransferase 1"
                     /transcript_id="XM_027627553.1"
                     /db_xref="GeneID:38737692"
     CDS             126739..127947
                     /locus_tag="MRET_0926"
                     /codon_start=1
                     /product="acetyl-CoA acyltransferase 1"
                     /protein_id="XP_027483407.1"
                     /db_xref="GeneID:38737692"
                     /translation="MSFATYTGKSQIIEKHNDDVVICGAYRSPLTRARKGGLAQCTPE
                     EMLGNVLKGLIAKTGVDPKLIEDVSVGNVLPPGGGATGARQAALWAGIPNTAAVNTVN
                     RQCSSGLASVTQIANEIITGQIDLGIGAGTESMTLNYGAGVMPVKMSDEIMSNEEAAD
                     CMLPMGITSENVAKKYNVTREKQDAFAAESYKRAAAAKAAGKFKDEIIPIKYIDDDGN
                     ERYIAEDDGIRQGVTKESLSKLKPAFEKDGCTHAGNASQVTDGAAAVLLARRSVAQKL
                     GLPIVGKFAGAVVVGVPPNLMGIGPAFAIPKLFEKAHITKDDVDIYEINEAFASQALF
                     SVEHVGLPLAKVNPVGGAIAMGHPLGATGSRQIATALAEAKRTGAKLIVTSMCIGTGM
                     GMASLIVNEQ"
     gene            <128352..>129419
                     /locus_tag="MRET_0927"
                     /note="MRES_03665"
                     /db_xref="GeneID:38737693"
     mRNA            <128352..>129419
                     /locus_tag="MRET_0927"
                     /product="cyclin-dependent protein kinase complex
                     component"
                     /transcript_id="XM_027627554.1"
                     /db_xref="GeneID:38737693"
     CDS             128352..129419
                     /locus_tag="MRET_0927"
                     /codon_start=1
                     /product="cyclin-dependent protein kinase complex
                     component"
                     /protein_id="XP_027483408.1"
                     /db_xref="GeneID:38737693"
                     /translation="MSLSTPSTDQLHRASQDVSMLEDTEGRAYKTRRTSVTSPEHRHK
                     ESSTSPALSASTSPGSRGSSSSRGPRVPQLDIVNFPSTELLRMLAVLLQHIASSNDQL
                     RPLHQRHQAQDSFAQTTRDMSSSMHLPLADPKRPNITTAALATLNTSNSTLCFHARHI
                     PSISIEAYLFRILKYCPMTNDIFLSLLVYFDRLSRVGALGQFPGEGTTSAPSHASAPP
                     SPVSTPWADKESGDHARQEAANSGGFPGISGFAIDSYNVHRLVIAGVTVASKFFSDVF
                     YTNARYAKVGGLAVHELNQLELHFLLLTDFRLTVPMAEIQQYGNQLLAYAHDHSATHN
                     IARPLSQAENIADSESTSRPH"
     gene            complement(<129416..>129775)
                     /locus_tag="MRET_0928"
                     /db_xref="GeneID:38737694"
     mRNA            complement(<129416..>129775)
                     /locus_tag="MRET_0928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627555.1"
                     /db_xref="GeneID:38737694"
     CDS             complement(129416..129775)
                     /locus_tag="MRET_0928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483401.1"
                     /db_xref="GeneID:38737694"
                     /translation="MCCMAAYAFFSHMRMVCLGCQPQQNLIGSLALSSAYLPPKATTS
                     TSCNEWSRTSVGQQNGPRPMVVCGVENKMRKCDTLRVKQRLQGRGIHYGHNYVQNAIE
                     RTRAERDGIIRDNIPRT"
     gene            <130059..>131561
                     /locus_tag="MRET_0929"
                     /db_xref="GeneID:38737695"
     mRNA            <130059..>131561
                     /locus_tag="MRET_0929"
                     /product="HMG (high mobility group) box protein"
                     /transcript_id="XM_027627556.1"
                     /db_xref="GeneID:38737695"
     CDS             130059..131561
                     /locus_tag="MRET_0929"
                     /codon_start=1
                     /product="HMG (high mobility group) box protein"
                     /protein_id="XP_027483402.1"
                     /db_xref="GeneID:38737695"
                     /translation="MSAATETPSTPTQVQTPSPTSTQSTSAQQPPPAEQQDLIDFLSS
                     HRPAASHALSPLQQAESPAQPEPPAQPEAQTSHPRRQSAHHIKRPCNAFILFRSHAVT
                     TNLVPKEVERDHRNISRIISHMWHNLNADERKMWEMQADIEKQRHRQQHPNYKYRPSS
                     RRHVTNRRNIRRLSSTERQCERIADAILKSCGREGVTRHRPPKRSPRRPAALERVESN
                     DSAFTSSPSLPPSPAWAIQSNASSPFRPNMTMSPQRPAGLRRSSSAPPCHTTLLKAPC
                     PDTREMNEAFRWLFDASTVSSHQSQVSTPSDLVASSAATTPHFDPCWHSSVSPAGSAP
                     PPLRDRQVESPASTPSQTPSSSTTFAPSAVEQLEHFSLGPSALLLTSGIEDTPFSMAP
                     TPPQATAPTPGSVVVSETPAIPPLFLPPVSPKTRLPADGHLLPTSIMPSMAEFDHPPS
                     SPWAEMDTAALSAPWNPESDQERWLSVVPETRDWMLPPPLLMEGDFFHMT"
     gene            <132209..>133747
                     /locus_tag="MRET_0930"
                     /note="MRES_03670"
                     /db_xref="GeneID:38737696"
     mRNA            <132209..>133747
                     /locus_tag="MRET_0930"
                     /product="secretory lipase"
                     /transcript_id="XM_027627557.1"
                     /db_xref="GeneID:38737696"
     CDS             132209..133747
                     /locus_tag="MRET_0930"
                     /codon_start=1
                     /product="secretory lipase"
                     /protein_id="XP_027483347.1"
                     /db_xref="GeneID:38737696"
                     /translation="MMYVSLVHWLALAVALAVPFVTALGNVPYPQDDPFYYPSENGWQ
                     NEAPGTILRERKIQAASLGIFEWKLDAWQVLYRTAGARPDKPSYTVTTFLVPSHAHRD
                     RVVTISSPENSNFIQCAPSYAFRKTGVLEIANFEPRWEQMLYTLFLAEGWIVNAPDHE
                     GPESAFSAGRFGGHMVLDSMRAANNFKPLQLSSNPMHIGHGYSGGSTPNGWAASLHES
                     YANELNVVGWSLGGSMTDPLYTLNSLDGKPTSSLVVAGAIGLMDAYRDEVGNLLDDEV
                     WTEEGKIAEKVMRNSCVYESVIRYFGATFQSERYIKGGRNLSSWPQMRKISNMNTMGH
                     NPRFTPRKPIFMFHALYDEEINWHQANKTAVEWCNNGANVRFLTYSSTSLVHVTTYLL
                     NLPYIVQYMRDRFNGKDWYGGACQFDVESQNPALDVNVLGERFRGILEAALDMLGKEI
                     GPNDSILKNRLKAGQNPNTHHKTKLHVLKKGDISPGEGGDHTKESKKAAAKFKAEKKH
                     GKHH"
     gene            complement(<133881..>134246)
                     /locus_tag="MRET_0931"
                     /note="MRES_03675"
                     /db_xref="GeneID:38737697"
     mRNA            complement(<133881..>134246)
                     /locus_tag="MRET_0931"
                     /product="annexin A7"
                     /transcript_id="XM_027627558.1"
                     /db_xref="GeneID:38737697"
     CDS             complement(133881..134246)
                     /locus_tag="MRET_0931"
                     /codon_start=1
                     /product="annexin A7"
                     /protein_id="XP_027483346.1"
                     /db_xref="GeneID:38737697"
                     /translation="MSAKDYYNGTSGGAGGGAYKPPAGPPPGQGGGYPMGGAPGGGYP
                     PQGGYPPQGGYYPPPPQQAYGGMPPGGGGYYGNAPPQPVYIQRPQQGGGDAAQGCCAC
                     LAAMLACCCLEELCMAFLY"
     gene            <134383..>135249
                     /locus_tag="MRET_0932"
                     /note="MRES_03680"
                     /db_xref="GeneID:38737698"
     mRNA            <134383..>135249
                     /locus_tag="MRET_0932"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627559.1"
                     /db_xref="GeneID:38737698"
     CDS             134383..135249
                     /locus_tag="MRET_0932"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483349.1"
                     /db_xref="GeneID:38737698"
                     /translation="MASLRARNVAFDLQDTHASGSAAAAPHAAPKSVLKQKQNATLPP
                     PARYRHPDPLLRRLRMIDGHGQGVDLKQAFRDTKLVVFYFGSHWNATDGRGCQQLVSN
                     LCRQYPHEVKVVYVSVDTDARHYKAATRNRPWLSLEWHDGSSIDPDKEEEEEDALPEQ
                     FLLADDADPDDSVVQSDAAGTSYVRPFSRVHMAYKFDVLMTPTLVVYHVPTRRILDKN
                     VRLQRLRSERLHQSVSVWLRGETSPPINWIDVMYMTPWTFISAALLLLYLGLRLVLGN
                     QISLSHIWKQFT"
     gene            complement(<135252..>136694)
                     /locus_tag="MRET_0933"
                     /note="MRES_03685"
                     /db_xref="GeneID:38737699"
     mRNA            complement(<135252..>136694)
                     /locus_tag="MRET_0933"
                     /product="glutamate N-acetyltransferase/amino-acid
                     N-acetyltransferase"
                     /transcript_id="XM_027627560.1"
                     /db_xref="GeneID:38737699"
     CDS             complement(135252..136694)
                     /locus_tag="MRET_0933"
                     /codon_start=1
                     /product="glutamate N-acetyltransferase/amino-acid
                     N-acetyltransferase"
                     /protein_id="XP_027483348.1"
                     /db_xref="GeneID:38737699"
                     /translation="MTRSPGLVVRWCRTYASKAERFVQPISPETLPRGYLVASTYAGV
                     KKAISPGTSSVPMSKPDMALVVSSVPASVAGVFTTNAFRAAPVVHATTALQQAGPDAR
                     VRAVLTNSGCANAVTGEAGLDDTRALVEQVRASLAPSSDCTPTDVLMMSTGVIGVRLP
                     VLPMQRAIEDLVSGRLLQNHPEAWLDVARAFMTTDTFPKLRTRSFSLGGRQCRIAGID
                     KGAGMIHPRMASASSALHATMLGLFATDAPIATPDLQRCLNEAVRVSFNCVSVDGDMS
                     TNDTVVALANGQATAEDGSVPDEWWTEKSHPDLVRAFQAELTALCTEMAQLLVRDGEG
                     AEKFVQVRVRHAGTYEQAHAIAASISTSALVKCAMHGEDANWGRILCAAGYAALPAPA
                     WAVDPSKVHVTFEPPPGVQEAPLPTLIDGVPQVVDEAHAARLLQHEDIYVDVDLQGGT
                     WRREEAVAEAVYWTCDFSKEYITINGDYRT"
     gene            complement(<136798..>137877)
                     /locus_tag="MRET_0934"
                     /note="MRES_03690"
                     /db_xref="GeneID:38737700"
     mRNA            complement(<136798..>137877)
                     /locus_tag="MRET_0934"
                     /product="solute carrier family 39 (zinc transporter),
                     member 1/2/3"
                     /transcript_id="XM_027627561.1"
                     /db_xref="GeneID:38737700"
     CDS             complement(136798..137877)
                     /locus_tag="MRET_0934"
                     /codon_start=1
                     /product="solute carrier family 39 (zinc transporter),
                     member 1/2/3"
                     /protein_id="XP_027483351.1"
                     /db_xref="GeneID:38737700"
                     /translation="MGECKGERTDISNDHMGTRIGALFVILVTSAIFTIFPILTRRIP
                     NLRIPGVIYDFAKYFGSGVIIATAFVHLLEPATDELGQECLTESFQNYPMAYAFALIS
                     MMLMFIGEFFAYRYGSHILESRGMGDFAHNHHQHGMVANAVHTSEQLPQNEVEHNLVN
                     PNEVEHNLANPKEADLESDSFGGEMVLQKNTSGTAEVIGVFVLELGVVFHSVIIGLTL
                     ATTEWEGDDDKFYVLFPVIVFHQLFEGLGLGSRLAYMPEFFSMWFLCLLALLYALCTP
                     VGMAIGLGIRNTFSADTPTYYYTTGVFDSVSAGILIYTGLVELMAHDFIFNKEMHAAP
                     TWKVLLNIFELCAGVGVMALLGRWA"
     gene            complement(<138303..>139388)
                     /locus_tag="MRET_0935"
                     /note="MRES_03695"
                     /db_xref="GeneID:38737701"
     mRNA            complement(<138303..>139388)
                     /locus_tag="MRET_0935"
                     /product="solute carrier family 39 (zinc transporter),
                     member 1/2/3"
                     /transcript_id="XM_027627562.1"
                     /db_xref="GeneID:38737701"
     CDS             complement(138303..139388)
                     /locus_tag="MRET_0935"
                     /codon_start=1
                     /product="solute carrier family 39 (zinc transporter),
                     member 1/2/3"
                     /protein_id="XP_027483350.1"
                     /db_xref="GeneID:38737701"
                     /translation="MSSETSCTGRVPDNDDHMGVRISAVFVVLVTSAGATLFPIVTRR
                     LARVKISENFYDFAKYFGSGVIIATAFVHLLQPAQEELGQTCLLKSFQDYPMAYAFAL
                     ISMMIMFLGEFYAYRFGAEILERHGLGRVSEQHTCGPPDARAFNEDIASEQPSATHDV
                     ASPTSEEARLEAKDVDPESGPMGTEDVVIKKQSSGTVEVIGVFVLELGILFHSVIIGI
                     TLSTTEWNSGAESFFVLYPAIIFHQLFEGLGLGARLALMPSTYSVWFLCFLGMLYALC
                     TPIGMALGLGIRRTYSPDTPTFYYVSGVFDAVSAGILIYSSLVELMAHDFIFNKDMYQ
                     KPLWKATLNILELWAGTGVMALIGRWA"
     gene            <139701..>141459
                     /locus_tag="MRET_0936"
                     /note="MRES_03700"
                     /db_xref="GeneID:38737702"
     mRNA            join(<139701..141289,141315..>141459)
                     /locus_tag="MRET_0936"
                     /product="cell cycle control protein"
                     /transcript_id="XM_027627563.1"
                     /db_xref="GeneID:38737702"
     CDS             join(139701..141289,141315..141459)
                     /locus_tag="MRET_0936"
                     /codon_start=1
                     /product="cell cycle control protein"
                     /protein_id="XP_027483353.1"
                     /db_xref="GeneID:38737702"
                     /translation="MPSSSYDGTRPPRRERSPPAQRDTDHTYASHPHRAVRNDWMLSP
                     GDGGRDVMDRRPEPQPRVSSRELNPYLVGSAPSAPAPAAKGAPGYKWRMMKLERTYDM
                     AKQRGVPVEEVAVERYGSMDAFHEACAERQFLHPQHHEPTKKAASRPSSSGFQRPATV
                     QQPPPRAPPASTSSPLPRVPPSMDVSQLNQLEAQVLRAELLQKPEAASLREKWEAARQ
                     GTSEDRVEIVPVMDGHGRLYDLGSSSSDQDTSLAELVRQERYGAGRADERDADAMLAQ
                     QIAGDRAFVNDTEYMDDEAQRFARKRMRDDAMKRQFAMEDFARTKRALDQCPFCWQND
                     GRTPPQATIVSSGSCVYLALPDREPLADGHCWIVPMHHHVSSLDVDEDGWTEIRNFMK
                     CLLRMAISRNQSMVFFETVMSVRDQKHTYIEAVPIPNDIFAQVPAYFYSGLSEVESEW
                     SDHKQVITFTEQRPFQHSMVSRLPYFMVQWDYKGQRGYGHVIEERYGDRHRTRRHRQY
                     ASDYEAPTYDDGDHVGGTGFPANFAHEILGTMLDLEPHRWRRPKRVAGSSQRVEAFRV
                     AWEPFDWTRAL"
     gene            <141526..>142650
                     /locus_tag="MRET_0937"
                     /note="MRES_03705"
                     /db_xref="GeneID:38737703"
     mRNA            join(<141526..141684,141724..141792,141997..>142650)
                     /locus_tag="MRET_0937"
                     /product="small subunit ribosomal protein S4e"
                     /transcript_id="XM_027627564.1"
                     /db_xref="GeneID:38737703"
     CDS             join(141526..141684,141724..141792,141997..142650)
                     /locus_tag="MRET_0937"
                     /codon_start=1
                     /product="small subunit ribosomal protein S4e"
                     /protein_id="XP_027483352.1"
                     /db_xref="GeneID:38737703"
                     /translation="MSAESKRATALRRFLRCGQRRLQSFHLFPVAMVRGPKHHLKHLA
                     APSSWMLDKLSGTYAPRPSTGPHKLREALPLVILLRNRLKYALTGREVLSITMQRIIK
                     VDNKVRTDPTYPTGFQDVVSIEKSGEHFRILYDVKGRFVVHRITPEEAKYKLLKVKRV
                     QLGAKGVPLIVTHDGRTLRYPDPLVRVNDTVKFDLENNKMVDFIKFDTGAHVMITGGR
                     NVGRAGQIIHVERHHGGFDIVHVRDAAGREFSTRLNNVFVIGDSEKRWISMPRGGGVK
                     LTITEERDLRLRKQSEA"
     gene            <142903..>144204
                     /locus_tag="MRET_0938"
                     /note="MRES_03710"
                     /db_xref="GeneID:38737704"
     mRNA            <142903..>144204
                     /locus_tag="MRET_0938"
                     /product="DnaJ domain protein"
                     /transcript_id="XM_027627565.1"
                     /db_xref="GeneID:38737704"
     CDS             142903..144204
                     /locus_tag="MRET_0938"
                     /codon_start=1
                     /product="DnaJ domain protein"
                     /protein_id="XP_027483344.1"
                     /db_xref="GeneID:38737704"
                     /translation="MSSEAGEASRPANISRDGEKIVDMEYYELLGVRGDATELELKKA
                     YRKAAIKNHPDKGGDEETFKVIGEAYRVLSDSNERATYDKYGKKKPTDEVGLKEATEM
                     FGNLFGGERFVDLIGEISLIRDFGRASEIMMTDEEREEMERQMNEHLKKSPETVTGAA
                     APEDESAAAAATTSTKHERHKHKLTAEQREKLEAFEHEKAEKEQKRIADLTEKLKDRI
                     RPYVDARHPGADDDSETQLFIKRMSEEAEDLKLESFGVELLHTIGSVYLTKSHTWLKT
                     KRGNFLGVPGFWSRLKERGGMIKETWNVMGSAVNVQIGMEELARRQEKGDLSEAELQQ
                     LEQDVNGKMLLATWRGTRWEVTGVLRRVCDNVLNEKGVSDKVLIQRARAVALLGSIYS
                     RVEPDESDDERRELEHLVAQAAQKKKKKSKRSVSGGGIHRS"
     gene            complement(<144201..>145895)
                     /locus_tag="MRET_0939"
                     /note="MRES_03715"
                     /db_xref="GeneID:38737705"
     mRNA            complement(<144201..>145895)
                     /locus_tag="MRET_0939"
                     /product="nucleus protein"
                     /transcript_id="XM_027627566.1"
                     /db_xref="GeneID:38737705"
     CDS             complement(144201..145895)
                     /locus_tag="MRET_0939"
                     /codon_start=1
                     /product="nucleus protein"
                     /protein_id="XP_027483343.1"
                     /db_xref="GeneID:38737705"
                     /translation="MPRIVASQTLATGRACAPSACVQWSDDGQVVVATKEALHILTPR
                     VGAALEHEVLDAPRERECAGACAPEPVHEDPTASVVPSMVLGGPAWYAAAWSPSSAAR
                     SCLLATIDTRRSVRLYAGPTCLGDVDMPRLRDDDDMARHCTCLAWQPHAAAPAWLLVG
                     TRSGHVVLFRVQDTWEYVAHSVVPGCVRAISWGTHVMVHAGEHLVQLHMPRMSVVATR
                     RVGAAHISGLVQLRGRWLWATPHACWAWDADGQVRSADTRASHAAGHDATRLILSDGT
                     AWDGDSLEACAPPRLWGYATDASGWCAMLQEADEDAPWRYVITHKLAFTLHMPPTPPP
                     VPTDGAPASAWRAWALWRQERGQEACEALWTELRTRVTELDARVDALLTTRPAAAAWL
                     EELRHAHRWAWWIHLTSADEAAAHGLQGLPWTVTWLGGVCRAAALLESDAKDEAYARR
                     VAAALFCMAQQAGVRERTCLEHYSHRLLPPDTYADWVRAGAPQLDEACPACGASMAFE
                     LAPYARCTAQHVLDRCVATWALLDGTDTLTCTGCERQASAHTSWSSCPACGNRWRS"
     gene            complement(<145955..>146689)
                     /locus_tag="MRET_0940"
                     /db_xref="GeneID:38737706"
     mRNA            complement(<145955..>146689)
                     /locus_tag="MRET_0940"
                     /product="SAC3 GANP domain protein"
                     /transcript_id="XM_027627567.1"
                     /db_xref="GeneID:38737706"
     CDS             complement(145955..146689)
                     /locus_tag="MRET_0940"
                     /codon_start=1
                     /product="SAC3 GANP domain protein"
                     /protein_id="XP_027483754.1"
                     /db_xref="GeneID:38737706"
                     /translation="MSWFSQQWHRWNPAAQTTDVEWVDVVWGQQRYQVALPSLDEPLT
                     LRHLRQELASVFSIPAERVVVVWQGMRLRDDRVSLQDYGITTGSRIHVLARDAPSSQP
                     ATHPPHEAAAPPTPGASEEAQHWQTIEQVAHTCRAELVPELARFEDTIRALPDAPPGT
                     HQSAPPEDTMTTPDAIPCQRIPYAQRKLSELLLRELLRLDGIPTDKDDIRTARKATVK
                     EIQAYLDRVDAAWDTAQHDKGIVSDV"
     gene            complement(<146746..>147894)
                     /locus_tag="MRET_0941"
                     /db_xref="GeneID:38737707"
     mRNA            complement(<146746..>147894)
                     /locus_tag="MRET_0941"
                     /product="solute carrier family 35, member E1"
                     /transcript_id="XM_027627568.1"
                     /db_xref="GeneID:38737707"
     CDS             complement(146746..147894)
                     /locus_tag="MRET_0941"
                     /codon_start=1
                     /product="solute carrier family 35, member E1"
                     /protein_id="XP_027483755.1"
                     /db_xref="GeneID:38737707"
                     /translation="MPSARPQEGGTSVQFDARQRASSLALLLLLCVLWYTSSALTSNT
                     SKDLLSRRRAPGQEVRGPPVFPYPVTLTLVQFAFVHLYCYLGTRRALLGEWVLAKRLV
                     RVTWPQLRDILQISVFNVVGHALGTLAVSRVEVSLVHTIKALSPLFTVLSYAVLFRVP
                     YSSRTYIALVPLMLGVILACSSLSKSRRDDMVGFIAALGSTLIIVAQNIYSKKLLKPA
                     DTVSTSAPEKLDKVHILFYSSACSVVLMLPMCLYYDARPMISPTAPTVGLHALYLLFL
                     NGTVHFAQNMLALQVLAHVSPVTYSIANLFKRVFVILVAIAWFGQSVTAPQWLGIVLT
                     FVGLYLYNSAKNDAPPPRDAEPESLPMHMRSPPLSTTLPPRPPPIENT"
     gene            complement(<147955..>149667)
                     /locus_tag="MRET_0942"
                     /note="MRES_03720"
                     /db_xref="GeneID:38737708"
     mRNA            complement(<147955..>149667)
                     /locus_tag="MRET_0942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627569.1"
                     /db_xref="GeneID:38737708"
     CDS             complement(147955..149667)
                     /locus_tag="MRET_0942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483756.1"
                     /db_xref="GeneID:38737708"
                     /translation="MLRASDVCRHGTRRMGMASARGASTSTGMLRVRPRRHDGVWRCV
                     AFVRQVQSWAGHEPRGVAEALVRAGHARHLTREMAREICENSMAHLDVKAFVHMTMEA
                     RMSWHRRDMLLCEMVRALLATDKMRVSTLLYILRASHAKYVPRTRDVLHAFLQDQGDT
                     SAHTRQLWRAVLRSHRVASEWHKVDDGLRTSVAKEDASELDVYHYTLHRLRFESQDND
                     KYVKADDVLVHMRQSGTKLDDRTLVQLLHILMIPVYRAYRTHQRPRVVMDAVRPARRA
                     MQATFRWLRGDGASPTRLGRYRLSAAEILEFELFFAYVQHMCQRRYLFAPPAERCGMV
                     PAEHLAPLHAKLDVLCRAWGERDVRVKRLRIMLHASGGAWARACRDLEAWLADDASQD
                     AAFEQRRLIVTMFGYACKHTRYERLESMAELLRISARCHLWRDGASPAPGATLVRLWL
                     RFVVAWTKCVGVNCGHARRAHMARSRYGWELMSRALPHLTAMARCIQIPCARVWDHPE
                     RCRSLVRAGRLAGGDLSVVDACLDAIEAPPRIRRWAHRAACRYEAEAPSSWARRVGRR
                     RPID"
     gene            <149761..>151953
                     /locus_tag="MRET_0943"
                     /note="MRES_03725"
                     /db_xref="GeneID:38737709"
     mRNA            <149761..>151953
                     /locus_tag="MRET_0943"
                     /product="ATP-dependent RNA helicase DDX10/DBP4"
                     /transcript_id="XM_027627570.1"
                     /db_xref="GeneID:38737709"
     CDS             149761..151953
                     /locus_tag="MRET_0943"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX10/DBP4"
                     /protein_id="XP_027483757.1"
                     /db_xref="GeneID:38737709"
                     /translation="MVGRRPMQARTRASRERKRQADQREISDLQRACETLELGPEDRA
                     FSLLPLSPRTRQGLKRAGFLDMTPIQKEAVPIALRGRDVLGAARTGSGKTLAFLIPVL
                     EQLYKQRWSNADGLGALVISPTRELAMQIFDVLRSIGGQHTFSAGLVIGGKDLKHEQD
                     RLRKMNILIATPGRLLQHLDQTVGFDVSNLQVLVLDEADRILDMGFARTLNAILEHLP
                     STRQSLLFSATQTRRVKDLARLSLRDPAYVAGEADSLMPQHLEQFYMVVELPRKLDVL
                     FSFLRTHTQCKILVFMSSCRQVQFVHEVFCKLRPGLSLMALHGKQKQIRRLKIFDDFR
                     RSQHAALFATDIAARGLDFPAVDWVVQVDAPESRDTYIHRVGRTARYHAHGKALLFVL
                     PSEEQGMLSALRDADVPITDIKARDTKIQHTAPQLQAFLFQDAELKHLAQKAFISYVR
                     SVHLHKDKATFNAVALPLPEFAASLGLPNAPKIKVVQEARARAAAAAAATAAPESSSE
                     DESPRVRTKHDRLFGRTNQTVLSDHYAALLDQPEPEDDDGDLLTLARADHELDEAPEP
                     EPPSSHLSRRQLQRGTSKKAMASAGLRGSGDRVVFDDEGMPRSMYEIQDEAAFRAQGD
                     VQTQIHEHEQAERQRMAEADVLDKDRAKQKRQEKRRRMKEMERLLAEKHGVGARTEDD
                     YGNEAEVLDLVLPGEEDEEEEEEEEAPRKRAKTDLASQEDMALRLLGA"
     gene            complement(<152122..>153039)
                     /locus_tag="MRET_0944"
                     /note="MRES_03730"
                     /db_xref="GeneID:38737710"
     mRNA            complement(join(<152122..152130,152158..>153039))
                     /locus_tag="MRET_0944"
                     /product="mitochondrial carrier protein"
                     /transcript_id="XM_027627571.1"
                     /db_xref="GeneID:38737710"
     CDS             complement(join(152122..152130,152158..153039))
                     /locus_tag="MRET_0944"
                     /codon_start=1
                     /product="mitochondrial carrier protein"
                     /protein_id="XP_027483750.1"
                     /db_xref="GeneID:38737710"
                     /translation="MSPPVGKSKESAKARLLGSATSGIAELLVFHPVDTVAKRLMSNT
                     DPHASMIKVLFKDKASAPAMTRFLSLFPGLGYAAGYKVLQRIYKYGGQPYFNDYLSKH
                     HKHQFDSVFGERTGKFMMNATAGSLTGIGEIVLLPLDVLKIKRQTNPESFRSRGFVRI
                     LLDENVNLYRGWGWTAARNAPGSFALFGGSAFTKEYLFGLKNYSDATWGQNFVASIAG
                     SIASITVAAPLDVVKTRIQNANFESKVGGVTIIRDMIKHEGFTAFFKGLTPKVLVTAP
                     KLVFSFTLAQSLIPWFGKYV"
     gene            <153146..>154699
                     /locus_tag="MRET_0945"
                     /note="MRES_03735"
                     /db_xref="GeneID:38737711"
     mRNA            <153146..>154699
                     /locus_tag="MRET_0945"
                     /product="multidrug resistance protein, MATE family"
                     /transcript_id="XM_027627572.1"
                     /db_xref="GeneID:38737711"
     CDS             153146..154699
                     /locus_tag="MRET_0945"
                     /codon_start=1
                     /product="multidrug resistance protein, MATE family"
                     /protein_id="XP_027483751.1"
                     /db_xref="GeneID:38737711"
                     /translation="MTEEAGSARSNLSGFLTGEFLREHGEETPLLTGDAAFQPHISSM
                     GNASGYGAVRPAPSVPVDASPHVWPEMCTLAKFTVPICATHLLELSLSVVSVLSLGHL
                     GTVELASASLAGITANVTGFSVISGLVSALDTLLPASYTRQPHLMGLWTQRVGLMVFA
                     VLPLIFVLWLNAERGLILLGQDPDIAYNARQFLMVLSFGLPGVAIFELCRRFLQAQGM
                     MHAPTVVLIIVSPLNAIANFFLVWGPERYRIGFLGAPMASALSMWLMAGLCAVQCAVA
                     CRDTWGGFSRDVWDPAALRTCVSLGFAGLISLASEWWAWEIVGLVTAALGTRALASQS
                     VLLVLSSVTYQIPFAAAVAASVRVGNLLGAMHASSARTASYAAVVLSIVVGVFNSSVV
                     FGTRNYLGYLFSSDKDVVRMVASVLPIMALFQCADCVSGIVGGILRGCGRQSLSAMIN
                     VTAYYVIGLPVSLLLAFGPWHLGLAGLWWGLTTALAYSTVLSLWYVYNMDWDSVMQKV
                     HRTMRASVM"
     gene            complement(<154708..>155763)
                     /locus_tag="MRET_0946"
                     /note="MRES_03740"
                     /db_xref="GeneID:38737712"
     mRNA            complement(<154708..>155763)
                     /locus_tag="MRET_0946"
                     /product="CTD kinase subunit beta"
                     /transcript_id="XM_027627573.1"
                     /db_xref="GeneID:38737712"
     CDS             complement(154708..155763)
                     /locus_tag="MRET_0946"
                     /codon_start=1
                     /product="CTD kinase subunit beta"
                     /protein_id="XP_027483752.1"
                     /db_xref="GeneID:38737712"
                     /translation="MADRKAQVATVTDTLYFTPSQWDGCMARMRGDKISALKWNQMQM
                     AACSFIAAVGAKLGCPQRTIGTAQLLYQRFHLFHAPTDFSLHEVALTCLFTSAKLNDT
                     QKRVHEVVLASYVFRYPELISTPDRGDWIAHAHVSDVDQEMLHREQTAIVSLERLLLP
                     CVCYNFQLRSPQILSWTIKLARHWRLSKSDADVAWRMACDSHRTNVAWLYTPLTVALG
                     CLYAQEAMARGAPYPWHETASWGVALSDVTDVALKLLELYVQHTPALYMSARSERRVV
                     PPHAVYPPPLGLLAWRAPTASEMEARLTQAQIYLRQKPLDERAPPPPPRSLDALLPPK
                     ATHDGARIIATRYILPI"
     gene            <155826..>156695
                     /locus_tag="MRET_0947"
                     /note="MRES_03745"
                     /db_xref="GeneID:38737713"
     mRNA            <155826..>156695
                     /locus_tag="MRET_0947"
                     /product="DnaJ subfamily C member 9"
                     /transcript_id="XM_027627574.1"
                     /db_xref="GeneID:38737713"
     CDS             155826..156695
                     /locus_tag="MRET_0947"
                     /codon_start=1
                     /product="DnaJ subfamily C member 9"
                     /protein_id="XP_027483753.1"
                     /db_xref="GeneID:38737713"
                     /translation="MSHDPAAEDPMRLFFSEDVDLYEVLDVAHDASADSIRKAYRRLA
                     LTYHPDKAAQHGHDAEAVARKFQQVGFAYSILADEKRRKRYDATGSTSDSIWDSDEPV
                     DWNEYFKTLWTGEVNAKTLDEFKASYQHSEEERNDILQAYRDHEGSLEGIFAAVPCSN
                     ILDDEKRFIRVVHDALRHHDLEPTPAWSDLFSDRGKKKRKALRQKAHSEAHEAEAYAK
                     ELGVWDNLFGKKRDTPTKPEPTEEEDVDLEGLRAAMRAKASKRADAFDDMLTQLEAKH
                     APPTKSRKKRRAQ"
     gene            <156805..>157266
                     /locus_tag="MRET_0948"
                     /note="MRES_03750"
                     /db_xref="GeneID:38737714"
     mRNA            <156805..>157266
                     /locus_tag="MRET_0948"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627575.1"
                     /db_xref="GeneID:38737714"
     CDS             156805..157266
                     /locus_tag="MRET_0948"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483748.1"
                     /db_xref="GeneID:38737714"
                     /translation="MRIHLAAILVLVLATAVLARIPASLASSGVGGPMERSSFAKNLD
                     HSQHHSKSHHSTSSGHHAKGRHSKVSTVTSPSTDSDAIDGAQRSSSEASSLLESASSK
                     HPASDTPSPTSEEIKSADDAAASIELGFWGMQSGSYLIALSAVVVAGALFA"
     gene            <157433..>161011
                     /locus_tag="MRET_0949"
                     /note="MRES_03755"
                     /db_xref="GeneID:38737715"
     mRNA            join(<157433..157501,157538..157573,157614..158600,
                     158699..>161011)
                     /locus_tag="MRET_0949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627576.1"
                     /db_xref="GeneID:38737715"
     CDS             join(157433..157501,157538..157573,157614..158600,
                     158699..161011)
                     /locus_tag="MRET_0949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483749.1"
                     /db_xref="GeneID:38737715"
                     /translation="MARKARQSMPLPMTQKTPPIRFAEDEPRKTSRSAKTSHQSASSC
                     FFTRWIVRLSIFYLIYAALYRCSSTPFSFSYNPHHELLVCREMASMQAHVSPVLHEYA
                     GKTHALLEPYAGKYMNAAHNAWKKASPVLHKTAKQAHSLYWTHVEPGARALYKQVHQW
                     SLPHQRTVHNHYKKHVHPHVKKMGRILDPYVRTYHKDVHPHVLKGLNQLSDAQKASSE
                     FYVDKLHPRIKQNLYNAYAYVRHTLFPFAHHHYVHHAHPHVKKMHDSVSTAVANTLRK
                     YGIRDGSLTNKITESVQGTYHQAVDTVDEQLSKSGLKDGSVVNKVQDAAKQVYEKVDN
                     AVDSAMKEHGMRDKTVADGIKEAYQHGKEADTKSDVIHNRTDDDSIAEALAEADVEAR
                     AAATTSGGVDPKSGERLDVMQARLDAELLEADDVLSEQERAISMLAASLMQELLKEIA
                     ESRRMAFTQIPSRLEQVFSMTIDHGISGSFLRTVRAAKTLAANASMPLDEWKEMMQTR
                     LTDEVDMMIDVYDELRQGISQVLHASQKSEEEIIQRGVSQIRQRSREALKKFNEVMEK
                     AEFQRTIYENEGWDMVMKRRGQIFREEVHNKTMQVLSLSGEPLDSPTAPDLQTEQKTL
                     LTSVVELFKRAEAAFSQLTAELREHPSTVQDKAQYASLLVLMHNNLDGLAEFCRETLV
                     NSTLRLRDDIVRTRLALGMPSLPDDGLLRDVASLPSPLERRDTSTTATPAPTFSNEDG
                     QNMATILPVGDIPPAVVDGHAFLSSAIHAERVNATSKATSNDLSASMAPTSSESLDAT
                     PSISSLLSSTLVSSSIDTDTLPTPPTPLTTSVVSAPSTTEPSRSSNSIESTPTTTESI
                     SSTLSTSLLISKSTERNNLTTASTDSLTPSSVANLSKTLDVSSKSQTTLAAPSLEPSQ
                     ATSEAASTQSSKSAIEAVSMASNNATTVTPASESTPSIPVTPESSHTTTAVPTPESAQ
                     SISVTSASSAVTSDTSTPESVHSIPASFDAMHVTGNTTTRTSPKLSPATSSESHRTTL
                     AISSSIPLTATTLSSSVANSTLSSSSSSSSTSSETTSSLMTSLPPTTLPVVVTSDSPR
                     PESSSMASETAQSQSSGLKNTMVRGVRPGPRASRSNTTTHLTHDEL"
     gene            complement(<161063..>162046)
                     /locus_tag="MRET_0950"
                     /db_xref="GeneID:38737716"
     mRNA            complement(<161063..>162046)
                     /locus_tag="MRET_0950"
                     /product="AHA1 family protein"
                     /transcript_id="XM_027627577.1"
                     /db_xref="GeneID:38737716"
     CDS             complement(161063..162046)
                     /locus_tag="MRET_0950"
                     /codon_start=1
                     /product="AHA1 family protein"
                     /protein_id="XP_027483685.1"
                     /db_xref="GeneID:38737716"
                     /translation="MSTWNKHYHWKTKGCTPWAKEWFTSHLVGQKVPLSKDPDACVKV
                     DKLTGFEGDVELGNRKGKLITIYECAITLAWSGQTEDGTSANGTIKFPEVSHENEDND
                     EAYLFETELLSESSSAALSMYEVVRKKLVPALEEVFHGFRKDLIESHAKDLGHDDEGQ
                     NAAKTSAQAAPSAAASTPSVVGASRSDKTGGSVSTSAAEVRVASHLAISQADLWDLLT
                     NPLRIPMWSKAPAQFSPNVGANFSLFGGNISGSIVQVTAPTRLTQTWRIPQWPAGHHG
                     TLTTELTQGDDSTKLELVLSGVPLGEEDHAQTGLETYYIRGLKSIGLGTIL"
     gene            complement(<162171..>163513)
                     /locus_tag="MRET_0951"
                     /note="MRES_03760"
                     /db_xref="GeneID:38737717"
     mRNA            complement(join(<162171..162188,162222..162381,
                     162414..>163513))
                     /locus_tag="MRET_0951"
                     /product="26S proteasome regulatory subunit N6"
                     /transcript_id="XM_027627578.1"
                     /db_xref="GeneID:38737717"
     CDS             complement(join(162171..162188,162222..162381,
                     162414..163513))
                     /locus_tag="MRET_0951"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit N6"
                     /protein_id="XP_027483684.1"
                     /db_xref="GeneID:38737717"
                     /translation="MSATHAVAASVAEADHVIESGNYENGKDMLMQILHRVASPADEA
                     LLAEQEQALLRLGQLHRDHKDAHGLAGTVIESRQFMASIAKAKTAKLVRILIDYFNDI
                     PNSRDVQIQVTKENAEWAKQEKRIFLKQNLETKLIGQLYEAKAYREALPLIAQLLREL
                     KTLDDKMILTEVHLLESKVNHAISNFPKSKAALTSARTSANSIYCPPLMQAQLDMQSG
                     VLHADDKDFKTAASYFYETMEGFDSVDDARAIPALKYMLLCKIMLNQPEEVYSILEGK
                     IASKYAKHREIEVMKAVAEAQSHRSLEDFERALQQYKSELSSDLIVRNHLSALYDKLL
                     EQNILRVIEPYSRIELAQIAKLVRQPVREVEQKLSQMILDKEFKGVLDQGAGCLVVFE
                     ETDDDETYETALSTLKQISHVVDSLYQQANELT"
     gene            <163643..>164812
                     /locus_tag="MRET_0952"
                     /note="MRES_03765"
                     /db_xref="GeneID:38737718"
     mRNA            <163643..>164812
                     /locus_tag="MRET_0952"
                     /product="26S proteasome regulatory subunit N7"
                     /transcript_id="XM_027627579.1"
                     /db_xref="GeneID:38737718"
     CDS             163643..164812
                     /locus_tag="MRET_0952"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit N7"
                     /protein_id="XP_027483683.1"
                     /db_xref="GeneID:38737718"
                     /translation="MEDDSVAPIPNPVVQQQVFLLLHTGSNEQVRKSALEKLWRNIEQ
                     DEMAPYYEFLLADANVAQYVPRREEILRALREKNSQEIARLDSEQKRAEENEGDIELH
                     TVLKQRAMYLARIGDKEAALPAIDEAFAKATGTGSKIDFMLLKIRLGLFYGDPELTEK
                     SMASAAALIEEGGDWDRRNRLTAYRGVYAASIRDFGESSKRCTEALSTFTATELIEYH
                     DFVLLTILTSMVSRNRRELKQLMESPEILQSIDELPYMREFTSSLYNSEYALFFRTLA
                     EVEQRYLLPSRILSRHTQYYVREMRLISFAQLLESYRSVALDSMAAAFGVTTDYMDRE
                     LSRFISAGRLPAVIDKVDGIIENRRPDQKNAQYNRIIKEGDVLLNSLQKLSRTAL"
     gene            complement(<164816..>166861)
                     /locus_tag="MRET_0953"
                     /note="MRES_03770"
                     /db_xref="GeneID:38737719"
     mRNA            complement(<164816..>166861)
                     /locus_tag="MRET_0953"
                     /product="UBA TS-N domain protein"
                     /transcript_id="XM_027627580.1"
                     /db_xref="GeneID:38737719"
     CDS             complement(164816..166861)
                     /locus_tag="MRET_0953"
                     /codon_start=1
                     /product="UBA TS-N domain protein"
                     /protein_id="XP_027483682.1"
                     /db_xref="GeneID:38737719"
                     /translation="MDDLADLDWHAKPTATTGLSKPASSGYQFDALLRSMPSTQPEKR
                     PTAQPSKPAPPQEDAFASLLPSFGEKQHLQAAKQEPSTPSDGLWKLDALESKIVQAPR
                     DEDDLLEDFRTPSQPAAAQPADHDTLDLLGDLGKPVSQRASQPIQAPAVETRSTSPPP
                     HVVGQLVEMGFAPQDARRALAQTDANVEQAVQVLVASIPKMQAPSSPESEPKPLRSDT
                     PSLQKHADHFYTQANVFGTSMLKNANALWDSTKAHARKTLNDARRDAQDASAMGIASE
                     LGKHMWRRWNAMPKRPVDYNATPRWMMKEEEPKAPQNENSRQERFNVPATSANLLEEP
                     APVPSQPVAKPVVAAPTPKPNPSISAPPSRHIRSLPAEDAGAIARATELKDQGNAHFY
                     RGAYAEAEAEYTKALDVLLPTSLWRIPLLNNRANVRLKNGDSEGTLSDCTASIELIVL
                     PSMQDGMYRPSQDALPASHASLTLREAYAKSISQRARAYEANEKWALAKQDWERLAHY
                     ERVEGSGVKSGQAHRRAACEGLARCARILEPPPSKSIPVPSGSAASAAAAAASDAGVN
                     RVRALRKAQDDEEAERLSLKDSVDARLAAWTRGRETNIRALLASIDDPKYGLVWDELR
                     WSKINLHNLLTDAQVKRAYTKAIARLHPDKLSSSNTTIEQRMLAAGMFHTLNDAFHT"
     gene            <166972..>168321
                     /locus_tag="MRET_0954"
                     /note="MRES_03775"
                     /db_xref="GeneID:38737720"
     mRNA            <166972..>168321
                     /locus_tag="MRET_0954"
                     /product="signal transducing adaptor molecule"
                     /transcript_id="XM_027627581.1"
                     /db_xref="GeneID:38737720"
     CDS             166972..168321
                     /locus_tag="MRET_0954"
                     /codon_start=1
                     /product="signal transducing adaptor molecule"
                     /protein_id="XP_027483689.1"
                     /db_xref="GeneID:38737720"
                     /translation="MFRAPNPFEELVNKATDENLTTENWELNLELCDRLASNDESDAR
                     KCMAAIQKRVVHRNANVQLYAITLTDTLSKNCGDAIHHEIASRAFMHTLSKVVRDTST
                     HNLVKQRILRTLLSWRDEYKHDDTLGLVADTVNDLREDFYELDEEPAPVRRDESEDDE
                     LQRVLALSIQDQGGRSSYREEATSAAGPSTRRPAEPTSPDCDSLPNPFSEPLSNEAPQ
                     PIAPEPRSARPSRVRALYDFEPDEPGELAFHRGDVIRVLDSVYEQWWRGELRHQVGIF
                     PVNYVEALPDETPDMIQQEQELERSVFTHASDIHVLHARLQHLKPSDNFVDDDELQEL
                     YQRSLALRPKIVRLMDTYHTKVQELRSLNDKFVRARTMLDDLIQQHVSMQPTHPTVDA
                     PQQSAPSPPSDAMPIPQEEEKRRLFERARAEVEEFQRQRQQVSQASDLEGLLFAPPP"
     gene            complement(<168318..>169499)
                     /locus_tag="MRET_0955"
                     /note="MRES_03780"
                     /db_xref="GeneID:38737721"
     mRNA            complement(<168318..>169499)
                     /locus_tag="MRET_0955"
                     /product="queuosine salvage protein"
                     /transcript_id="XM_027627582.1"
                     /db_xref="GeneID:38737721"
     CDS             complement(168318..169499)
                     /locus_tag="MRET_0955"
                     /codon_start=1
                     /product="queuosine salvage protein"
                     /protein_id="XP_027483688.1"
                     /db_xref="GeneID:38737721"
                     /translation="MAPLDLIAAFFLRGAMSGGQEATPMLRRIRSHCAEAAERAHIGL
                     NEDAVDAFLDTLDESEFSALKTQHGLRFPLRFSSFMDQLNFVAVLAMLNAFSGYRAAF
                     HQATGHGAFDCIRKIVLGMYLSADEGDSALDTLALERVTPSTFAQLLGVPTHSETPHP
                     SLPGVVVGTIGGPLREPFEMAAKMSVETAAFLKARQHKNLASYVWEVCEQASRHEHVE
                     SCIVEGLAEVPAFYDALDSPYPIPIMKKALFLVRALQGLVLDAEPHTLPQLMQILSER
                     WRHGLGEPLPMFVDNVIPTMLIYLGMLQLEHSSILSTWHPAPQDSDTSGPLVNRSDAY
                     HVRAAALVAGARIVERARTSSTWISSITEEQLDAYLWSMAKRPEFRCISRLAEQHTGM
                     Y"
     gene            <169453..>173799
                     /locus_tag="MRET_0956"
                     /note="MRES_03785"
                     /db_xref="GeneID:38737722"
     mRNA            <169453..>173799
                     /locus_tag="MRET_0956"
                     /product="DEAD/DEAH box helicase"
                     /transcript_id="XM_027627583.1"
                     /db_xref="GeneID:38737722"
     CDS             169453..173799
                     /locus_tag="MRET_0956"
                     /codon_start=1
                     /product="DEAD/DEAH box helicase"
                     /protein_id="XP_027483687.1"
                     /db_xref="GeneID:38737722"
                     /translation="MAPRKKNAAIKSSGAMSSKAAPLPDWVKGGGAKPPPPTGTNRDG
                     TAQLFPPRYKTPLNILYERIQKMPGWLKPEVEPIHRKDGYTCAVTLRKENKQEKSNPF
                     TVRMEPKEPGARLTCESSLHAKHWGATYALFRLFNHLGLHRVLPPGPREYWLQLEEVK
                     AQSMEHDNWKWAADPFDAIMKRDAEREAREKERAAREAAKNDPSKRPMSKVWQRAMEV
                     RMAPELRELVESTIRARMSDVSNTLTEELSSNNHAQVDSAALERELTALGVRPGYVRR
                     IVSWLQDARSTYASSAAMQQLQQAHPLLASILALPDKEAAVEYLVLYTPEQDLPPKLR
                     PTAASESFVTSAASGGGSESLVDRWTVDKFTRCAGFPRENVERAIRDVRAAGLHASQT
                     EKEGAVLDLLLHALMGEPVPVHAPPAYDEAVAQKRSDERMMLAACLGDEALRPVPERD
                     AIDKSDFDVDLGTYGGDQVYLRVSMHPASSYLVQGTAWPSVYVTSPSLPTFLRLALTR
                     HALRCLRGDREDMREALDMCEGGVLFLLCEELKDRLPTYVHDPPPLDEVMESLVLQAP
                     RTVARVTRPTPSSAPRRALSSGSAAPRKARKLARDERLDASLSEAHTAWRASLKYTES
                     VGCVRESLPAYAARSTILETLQKHRVVLIAGETGCGKTTQVPQFLLDDAIERGCGSLC
                     SLVVTQPRRVSAMGVAARVAAERGESLDVSQVPDAAQVGYAIRGERRAGKQCRLLFTT
                     TGVLLRRLATGTDPDLQSVSHVIVDEVHERSTDSDFLLLLLRDILARNPSLHIVLMSA
                     TIQAETFTSYFDGAPYLHIPGRTFPVQEHYLEDIVHLLSYRSPMSLSKEDERIDKLFD
                     ASRLSEADVPTVRALCASQRTDYDLLSQAVALAAQRAEKVDFTGSLTSRAAILVFCPG
                     VGEIRQAMDAIDALRLDGAVLLPLHANLAAHEQRRVFQRVQKHERKIIVATNVAETSI
                     TIPEVCFVVDTGRVREAQYDAQAGVSRLLEQWASRAACKQRAGRAGRTMPGECFRLYT
                     RYVEAHVQKPQSVPEIQRTPLEGVMLQVKAIQPHGDIKAFLQKAIDPPPLEALDAAHR
                     HLVITGAVHRDGGFAATLTPLGRHLAQLPLEVRQAKLLVLSCLFGCVEPVLHIVSLLS
                     CRSIVAGSAQRDADKAKARAAYLWGQSDLLSDAHIFATWLAMRAERRPMKDVRAFCES
                     LGLSMPALQDVDMTRMTLLRQLDEVGLLDRDYVAAYRRQGPMWPRASSLGMDAHSHHV
                     NVVRALLVASLWPSLARVDQPTAKYNASTSGAVLKEAHAKELHYIDEQEGRVFLHPSS
                     MLFHATKFKSNYVAVFAKSASGVAGQARTYLRDATEAPLYALLLFGGPLYVDHEVGGM
                     TISTGTEASPDAWVRVRANTRIGVLCRQLRQLLDRVLADGVQDPHALLSAPNQVVVEA
                     MIALLAHDGLTG"
     gene            complement(<173789..>176860)
                     /locus_tag="MRET_0957"
                     /note="MRES_03790"
                     /db_xref="GeneID:38737723"
     mRNA            complement(<173789..>176860)
                     /locus_tag="MRET_0957"
                     /product="trafficking protein particle complex subunit 11"
                     /transcript_id="XM_027627584.1"
                     /db_xref="GeneID:38737723"
     CDS             complement(173789..176860)
                     /locus_tag="MRET_0957"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 11"
                     /protein_id="XP_027483686.1"
                     /db_xref="GeneID:38737723"
                     /translation="MNAYPSELVVQLRPCVHVSGLVPEQKAWHDVLPHPTQVHPELCQ
                     ALVAQLTRHAQPQAWYPPTRPDYVRMVFVAYAHKIPPARMRAGLRLQDEQARRVLGAL
                     PPRSPLSPLYPGGPLFPDGIISPSWIRKHTEYVPGVHVAFFCMPPHDTASLAMDAALI
                     EVVASMRAAYAQRGIKLMMVLLCDPLLFAQGIEARVAHLRRASGLEARGAVFVLNTGA
                     KEDMAPFAQSLMQAARLVAQDHYREHARHVRRNRARYPPPPSVTQPIMHAAVSAGVAR
                     ADRVPSMLSAEGWHIRMHYKLGALTELQGETREAHQLYMEAYRLLMHTYLPNAALVEP
                     RTRRWAEAKVLADTLSLKLVKLSLYDAQRSLAHKQCQYHMSHMSQLCQRWGMTQHEYW
                     AWLAKQYVLVTDLVDALPMRMHGFDVPLWRYQAALCHMQRACCGRPADAARREAHVDY
                     TTPIVRELHAAYEAWNQARRGRLAHLAGTRLALAYEDAQPRKTLEYLLRTLQWYRRDA
                     WRELTVVLVARAIDCAVRAQESSHLAALVWDMQQTVPSSLRGLQQQALAQAPAVETHE
                     SVHVVDQPPCTLCVHAVFARGTSACDEAMPFQVVVAIADDAPMDTLDVRQCDLYVSGQ
                     EAPLLTLAGIPTGPPGVVDVGDVVAGQAHTREVRPLVLSKREPLAWYGRLQGRVPGTV
                     AWRSVVCHVQRPTHTLKLETRIPTPSSTWLLPSGARLALPPRHRPHTLHVRAPTTEIH
                     VPATVYAGQVVPLTVDGQGTLSVSDQAALLDEDGTAHASIAIPPHTLRLHAPSVTTPC
                     DLELRCTTRARQTRRMIRVEPSFTVRAQDVPGARILHVTYHGAMPVCVERAHLNEAVL
                     HGMDPQHVWTTHDQAVWAGVGAMTGPPTLVIEWRPCQEKAPLCVTHLALAVASPSPPL
                     PVTCTVAVSTTHATVFEPIHVDVRVHNTSEAVADLVLTVDETDDFGIDGFQGRLAVSM
                     LLPQEHRTFPLTLWPKRPGPLVLPRVRAWDREASEVRVDLTAPAIVHVASQ"
     gene            <176974..>191502
                     /locus_tag="MRET_0958"
                     /note="MRES_03795"
                     /db_xref="GeneID:38737724"
     mRNA            <176974..>191502
                     /locus_tag="MRET_0958"
                     /product="midasin"
                     /transcript_id="XM_027627585.1"
                     /db_xref="GeneID:38737724"
     CDS             176974..191502
                     /locus_tag="MRET_0958"
                     /codon_start=1
                     /product="midasin"
                     /protein_id="XP_027483681.1"
                     /db_xref="GeneID:38737724"
                     /translation="MPLDVRACAVACGPSVHAIAPVIAGCAQGAVSDAGCVLEEAASL
                     LLRSDAEAWARVAVAFRPCLLELVARTWEHAHAVHALAYLIGAFEEIYTLLEAFLRRH
                     YAHGLPMDEAHLVSLWRMLRAAPHLAHTLQWPSSTLYCVFASREHATATRCLAIECYA
                     AQEHLSNAARDALRDAWIGDAPALLTHMDVRTMPVHEQQRIDAIWRACEACPLTPTDA
                     PVPLESVSSSLSLLGDMIVDAPPCTDDGSDPFICTSGALDAIQRVLLHVTLRLPVLLS
                     GPPASGKTHLLTYLATRLARTEHGMPPYLSIPLGDQSGVDAKALIGSYVSSTTRPGTF
                     EFVEGALTRAVRAGMWVILEDLDKASTDVLSVIAPLAEALGPTKAMGTRPVLDLGARG
                     RIEAAPGFALLATRSTRTGAARPMFLSSEHWGEVRLAPPRTEDVLAILRGRCPSLRAL
                     PSHECACLVQAWYDAIEASQRAPSSVRQPTLRELVQWCARLDAMHAASLLNNPVVQDA
                     LFLDACDVFLASFADTSTPVAQSMASALSKALHMSSERASYAMRERVPDLALGHAGHV
                     RVGRVSLDRLVPGAPTLQRYALTRSTLASMERVAACIAHAEPALLVGETGTGKTTMVQ
                     TLASLVGQPITVINLSQQTESGDLLGAFKPLDPKRQAADIHNAWTRLFERTFSLKRNG
                     AYLDAERKAFFAGKWSRLAKLWSESCRLAQRELAAQSDARKKRRTDGTLDASWRDLLE
                     RVTSFTAMFASGQRRHFAFSFVEGPLVRAVRQGHWILLDEINLASPETLDCLAPLLQS
                     RHGSIVLTERGDLTPVPRHAQFRLFACMNPATDVGKRDLPPSVRARFTEVYVPSPDAD
                     RDALTSIVSQYIGQEAVSDKSAILDVAEWYTAVRHAAMRHELADGANQRPHYSVRTLA
                     RALTFAATLAPSYGLRRALAEGVQMSFGMLLDAPSALAFSNLVQRHLLSHTKDRRIHA
                     SFVPPAPHSHAIQVGAFWLETGPVPSDDAPDYVLTPSVEAKIGALARALVTRQSPVLI
                     QGPTSAGKTSAVEYLARRTGHRFVRINNHEHTDVQEYLGAYASNAEGQLVFTEGLLVT
                     ALRRGDWLVLDELNLAPTDVLEALNRLLDDNRELLIPETGEIVKPHPHFMLFATQNPP
                     GAYAGRKMLSRAFRNRFVELHFDDVPQSELASILTTRCAIPPSWADKIVAVFAELQRR
                     RESGRVFEKHAFATLRDLFRWGMRGADGYQQLAETGYMLLAERTRHARDAETVRDVLQ
                     QVMRVHIDPEALYDRADTLAAQLGPERLAALQSAAQHHRIVWTSAMRRLVCLTAAALQ
                     QNEPVLLVGETGAGKTSVCDIVATAFGRPLHSFNCHQNTDSADLLGGQRPLRNRAALA
                     SEARVTATPLLGAPLDDVPLEQVAAQLRSLEPSEARDHALALTQQALALFTWCDGPLV
                     EAMRHGDMLLLDEISLADDSVLERLNSVLERERTLVLAEKAGTDVVMTASEGFQILAT
                     MNPGGDYGKKELSPALRNRFTEIYVPPVERTEDQAAIINAILPASLHAWTPPMLSYVQ
                     WFAHRLGGHDHTGLGVRDLVGWAMFVRDVCERGILPPPLAFAHGAALTIIDALGTLPA
                     TAAMTQAGLHALRMQCYQQVNAMIEPAHLDPLDPAYRAVQDTPEALYVGPFAMPKGPA
                     AVTRPPFLLQAATTADNALRVLRACTIRGRSVLLEGSPGAGKTSLITSLAAMTGHELV
                     RINLSEQTELVDLFGGELPVEHGRPGEFAWRPAAFLDAMQRGAWVLLDEMNLASQTVL
                     EGLNSCLDHRGSVYVPDIGRTFTKHPDFRLFAAQNPQHQGGARKGLPKSLLNRFIKVY
                     VAELQDADIRVICEQLYPDAAPYLDAMVSFHAALHKATQDGTVGRHGAPWELNLRDQL
                     RWLQVMHADLGLSMAEPLDALRCLYLARFRTPQDRQAVAELFATHFGDAGHALRMPHA
                     LVSPTDALLGHVHLSRAGPVASASTQLLLPSQLACLEGMAVSVRLGLLTIITGHAGTG
                     KSSVVRTMAALAGMHLDEVRLSSASDTMDVLGSFEQYDPAYAQRHAAQALDQCRRAIQ
                     ARSHLSDGAALEALDACRRCLPHDLAQAAQYLAPFATTDEAASLHAMIEQLQGPPPSG
                     GQFAWIDGPLVRAAKQGHWVLLDHANLCAASVLDRLNSLFEPGGSLVLSERGMVDGGV
                     PHIVPHPAFRVFMTVDPRHGELSRAMRNRGMELWLDALDLDRLTPFARSLCAHGTLVE
                     RAVQAHAARRGVPTESAPLSSEPSVRAASAHAVLKEAGMPGAAFVAACLQDETLAEAA
                     HIYAAQALTPAERALVQHVNVDLPSGASKGSLLPLDARRHPDMRTCDDIEPRAVELLV
                     RCHMRTASLAAPPPGSLLWQVQDDVHQVPMLIQSMPAFLEACIHVAQTAASSTNGGVL
                     AQAGTLLDLVSFLESALHHTDLDYSLVHVMLRSIRTAVSELAQRQVAVPASLVSLMRT
                     MQQAPRATHTGVAMQALWMRTLPHVPPPMLPHITALEATYMTQTLSPSQARTVLQVLA
                     TLYVCNASWTEEQCRDLARLAQELCALPSPTHTTSWPYVARVLPVLLWTLASCRDARL
                     SQLVSLWSAYPSVPAPLVVGTQLCAWSPTTTVSPMLQMRWPRAFWYAPDGSFSVDAPG
                     AHALHRAVILPAVLDAVHVDRIALSAWPSYDAHLHDLATSIATACVPAQAHRLTLLRD
                     MLHTFTMFLSEALVEALQSSLSPDMHADVDGLHEAVQAHDYVRIAHMVRTLCRRCEAD
                     ASWHSALQAWLQHLAHAHDCLSAHKGITELGRAWVQLALWTLHIYIPDVPLDPVAEAH
                     AKHSFGMSIHARLSRQAHVEEAAETFRSGGCVNAVVQQLQTAMSDVLARLESSRHTRV
                     TRPPATALLHRLHGELSGFASQVLAPARVERLVSRMSASDSTAIAEEASLQSSLHAFE
                     HRLWRHYVDLHDLTAPVLVALEQMRLGLRLCLPTSPVPGRTERLASAATRFPSSNAAQ
                     TLLIDAAEPRAVSTAVPELLLVLACAAYEVQTTHSRAAIQAVYTAYEQLYILWAQQRE
                     SDREKAEAEAQLFTFKDEDASEEQARLDAEIRALFPVYDDVLETQARMPSSSDTPRLD
                     EHVMLRVLDLHMALFPSAMARSTQRSMPSVPDMLVQATDSLLRTSAPLVSSMPMEMDR
                     TAAFQLARIARRRAPPTRSTNFYHDAQPLEIARLMPILERLRARATELLHAIPEQVQL
                     QQLVERCDRIAMLDVASPVAKGLAAVELLLTHVDDWQTYASRDTSLQAHATELTNLVV
                     EWRRLELHSWKTLLDDEAAREEASVAPWFFSLYEALTRASHGPSAPELVELLDTFVRG
                     STAGQLSTRLALLDSFSMFRGPSHLQSILHNTAAYYAQFVPAIEAHLSQQRDMLDREV
                     ADFVKLATWRDVNVYALKQSAQKTHAYLHKSLRKFRDILRQPADPLLASKADVRPAIA
                     VRPLLGPAYVPCDVVPETASDTYTPSAFHATRPPHLQDMKRTILHLSELSTHTLLPQL
                     ESQRYLDVVDMGTTILETADALAQQTPSVANEGNMKLIKSLATQKRRAWTDLIKALRF
                     MGLSPFVTAELLAHNRDPMHVYGVAPLSSSHTALGLDAVSQYYAAMLAQAERLRLASQ
                     SPKGDVPDLVRGIAIVEHIVQLCLRVRQRLSNMLQGARDVWALAQRLGQLQGNLVSMD
                     QTFVLHVQGRAHDFARLLRGLDEYMASLPMHQQVSPLPTSPDLAPVQSLQTRVRELHA
                     QLEALASALSDSGITLCTEQEFDMVATSTHVLQDAQKVFEQLADTPSLTLLAVPMRDW
                     LETISTPIACHTREEDAASVQSLSDKVCSSMLVIAQELHKQPTPVQGGDALPERWFVD
                     EVSKLHDIDRILRPQAVAGAIRDAMATAGTGPVTMTCVQDMNKFLAPYTQWLWTHMSC
                     VSLWNRSMMRLTLVLSVLMTSLATQGFCQPPEESQGEDDQDAEGGDQLEGGTGLGDGT
                     GAKDVSDTLQDDENMEELEKEDQAEDDEPEATKGEDKAREMDDMDGDVHSVDGEQGEE
                     ADDDGEEQEQDVEDEVGDIDPLDPDAVDEKMWGDEPENEKQGESEAQGGAEDDREQAG
                     DRNEAQQREEGDAQDQAEEEEQQDEHSGDNDADEEAEVEDMPELNEGLGRELDQEAKE
                     QDMQLGDLDLGEQDEDEEDNDMQDDENLSLPEGDIDEKEDETANFDEHDTQETRMDTD
                     EHDVHEGEEQNRDEQASEKDREEGSEEQASDPPDPEPKTREDEEKIDEVKSSGDKPQN
                     ARAPPPMPMDQHQHETLGEKDSDPMDFDATHEGGGEDTGGAAGQQDRAKGEAGQADGS
                     SATQDQGAHQDANEQAAQGTGDEEKSEAQPNPTQSIADSLDQFRRDVESIREATQHDQ
                     DAAMKDGGVPESSDMEHVAHDDDADAQALGTADEQQAQAMKQLSMDDDNAAGETLAMP
                     EQDQDMDMPDSSAPPDLPEPEGSGSQPRGAREGAMMASDVLNNHGTEGDNDLPKEEED
                     EEHMEPIADEQRVEADQHVAEELEEFRTFDADANRASELWRSYSALTSDLAFGLCEQL
                     RLILAPTLATRLNGDYRTGKRLNMRKIIPFIASDFAKDKIWLRRTKPSAREYQVLLAM
                     DDSKSMAESRNIHLAYQTLALVSGALTRLEIGDIGICRFGSQMDMLHDFGSTTFTDRH
                     GGQILQRLRFQQTRTDMFALLEQSMRVLRRAREQHASASAADLWQLEIIISDGVCQDH
                     AKLKALLRRAAEERIMIVFVIVDACDESAPADTHQAQRSSILAMNQVNYHMDAAGKLQ
                     LEMKHYIDTFPFDYYVIVRDVQSLPQVLATTLCQWAERIRDA"
     gene            complement(<191518..>194406)
                     /locus_tag="MRET_0959"
                     /note="MRES_03800"
                     /db_xref="GeneID:38737725"
     mRNA            complement(<191518..>194406)
                     /locus_tag="MRET_0959"
                     /product="U3 small nucleolar RNA-associated protein 21"
                     /transcript_id="XM_027627586.1"
                     /db_xref="GeneID:38737725"
     CDS             complement(191518..194406)
                     /locus_tag="MRET_0959"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 21"
                     /protein_id="XP_027483680.1"
                     /db_xref="GeneID:38737725"
                     /translation="MPPQEKRVRAQEEPNSEVKQSGTVHRDALYAPFRALGYITNGVP
                     FVLQVRFGGKDAQVPDVNIVTCIGDTWTMWNAERMTLLFVGPVLSDGISAMAHATSPD
                     SLLVAAGSSVYRYVRGHEVAKYNTSVADEGIEGHVLSSMLVFGDYVCSLAAHGSTMYV
                     WSLLTTELLQAIALPSSSQASCFVHPATYLNKVVLGMTDGSLQLWNVRTASLIHTFDA
                     LDVRGGKKSTNVTGVVHMTQSPAVDVLAVAYTDGLVSLFDVRVGEALFSVRVEGGLAS
                     GCLAFRTDHVAHLLAVATRAGSIVLFDLNAVTDTDHVSGGVPRLLHSIQHAHDGAIGS
                     IEFVPGQPLLISTGADNALKQWFFESPTLPPRVLKSRSGHAMPPHLIRYYGDDGRAML
                     SASRDRSLRCLSIVRDSRSFELSQGSIESKSHKLAVEASSLKLTPTTSLSYSTLRSRD
                     WDDVLTTHANDKHAHTWTVRNKHMNPNTLNVARSKRSSAVATTSCVSACGNFALVGTS
                     DGRVEMYNMQSHIHRRTFHTESSVPVSDICCDALNQVCLVSTQDGVLHYFDFFSAQKV
                     ATESMPAGCSGLRLHRESNLVAVLTDDLVLSILDLETRRVARRFTGFRGRILDATFSA
                     DGRWIVACSTDNVVRTFDIATAQLIDAFHTPSMATSVSFSPAGDFLATAHVDSLGVHL
                     WVNRAQFMSVALRALDMGNVQEEREATLPTVQGNTIDACGPTELDVGEPELQRTYTSP
                     PQLGDVEKPLVTLSTMPRARWMTLLHLDTIRRRNKPTEAPKKPEKMPFFLDAAPTSSS
                     LDGPQQDREPLESARQIDLVFESDMERRLRVAVDACDVGPLFTYLHTLSAPQLDLEIR
                     SLVSVQQQTLFLQALALRMRSKLDFEAVQAMLQGFLACHAEELQAQGVHPEHPDEDAM
                     TDEAGAQLALALRDVLVEQRKEGARLIDELDYCLGTLSFLRHVPLTSI"
     gene            <194557..>196176
                     /locus_tag="MRET_0960"
                     /note="MRES_03805"
                     /db_xref="GeneID:38737726"
     mRNA            <194557..>196176
                     /locus_tag="MRET_0960"
                     /product="ATP-dependent RNA helicase DDX18/HAS1"
                     /transcript_id="XM_027627587.1"
                     /db_xref="GeneID:38737726"
     CDS             194557..196176
                     /locus_tag="MRET_0960"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX18/HAS1"
                     /protein_id="XP_027483628.1"
                     /db_xref="GeneID:38737726"
                     /translation="MVSKHSASDAEEAKLERQLQQDALNAHQSNSNSSERRPFSDLDL
                     TPATSKALDAMGFKTMTEVQERCIPPLLAGKDVLGAAQTGSGKTLAFLVPAIEMLQRL
                     KFKPRNGTGAIVISPTRELALQIFGVAKEIMAHQSQTMGIVMGGANRKAEADKLQKGV
                     NLIIATPGRLLDHLQNTKGFVFSNLKTLIIDEADRILEIGFEDEMRQIVKILPSERQS
                     MLFSATQTTKVQDLARISLRPGPLYINVHEQMASSTVSKLEQGYVVCDSDKRFLLLFT
                     FLKRNAGKKIIVFMNSCNSVKYHGELLNYIDVPVLDLHGKQKQQKRSNTFFEFCNAQH
                     GILLCTDVAARGLDIPAVDWIIQYDPPDDPRDYIHRVGRTARGGKHGRSLLFLLPSEL
                     GFLRFLKVAKVPLNEYTFPPNKIANVQNQLEKLISKNYYLHQSAKEGYRSYIQAYGSY
                     SLKRIYDINQLDLAKVAKAFGFAVPPKVNVTIGTSLKARKDRDHNNDEDEDAPQGKRQ
                     RVDRRSYGSRDDKAAMYRKHQTSSNGTQWSR"
     gene            complement(<196204..>198825)
                     /locus_tag="MRET_0961"
                     /note="MRES_03810"
                     /db_xref="GeneID:38737727"
     mRNA            complement(<196204..>198825)
                     /locus_tag="MRET_0961"
                     /product="periodic tryptophan protein 2"
                     /transcript_id="XM_027627588.1"
                     /db_xref="GeneID:38737727"
     CDS             complement(196204..198825)
                     /locus_tag="MRET_0961"
                     /codon_start=1
                     /product="periodic tryptophan protein 2"
                     /protein_id="XP_027483629.1"
                     /db_xref="GeneID:38737727"
                     /translation="MKSSFRFANVCGTVYQQGNIQFAGDGDMLYSPVGNRLSVFDLVR
                     NMSFTLPFETRKPIARVAVSPANTSLVLVADEDGHAILINVSRRALLAHMNFKLPVRD
                     AQFSPNGQYLAVTHGAQVQVWRTPSVLVREFAPFVLHRTYVGHFDDVLSITWSRTGRF
                     FLTTSKDMSGRLFSLDPVPGFRPKTFSGHRDSVVRAFFSLDEKTIYTVSRDGACLVWQ
                     GKDDDIQDMEEDALPPSEEAFTDPENAVGLTRWGVAARHYFYQTQTHITCAEFHPGTS
                     RLVVGFSSGLFTLRDMPDFTEVHALSISQEKITSVAINKTGEWLAFGAQRLGQLLVWE
                     WASESYILKQQGHFFDMNTVAYAQDGQMAVTGGDDGKVKVWNTVSGFCTVTFSDHSAP
                     VSCVEFAKQGQVLFSASLDGTVRAYDLVRYRNFRTFASPTPVQFVSLAVEPSGEIVCA
                     GSSDAFDTYMWSVQTGKLLEILSGHEAPVTGLAFDPSGSGLLASTSWDRSVRLWEVFQ
                     RSQSTETMPISSEGLALAFRPDGQQVCVASLNGQLNFFDTKTGTHTGVIDGRRDIASG
                     RRLDDKVQQRNNAAGSAFTSVCYSADGSCVLAGGNANYVCLYDVRERVLLKRWTLSMN
                     LALDGTQDRLDSRQVTEAGNVALIHDLSDEDELTLAERADQSLPGVQRGDLSRRSTRL
                     QARAKCVRFSPTGRSWAAASTSGLLVYSLDEQATFDPTDLDMDLTPQAVRAASHQGHA
                     LVALLGALRLNDPMLEAEVYERIKPQEILLVARQLPTIYLDRVLGLVAARMNPSCQSP
                     HVEFHLKWLTALFRSHGEEIRANSTTTLAPVLRAVQMALNELRSNVKSTTDTNTASIL
                     YIWNSFSHQSRQAHGIP"
     gene            <199034..>201199
                     /locus_tag="MRET_0962"
                     /db_xref="GeneID:38737728"
     mRNA            <199034..>201199
                     /locus_tag="MRET_0962"
                     /product="Sec7 domain protein"
                     /transcript_id="XM_027627589.1"
                     /db_xref="GeneID:38737728"
     CDS             199034..201199
                     /locus_tag="MRET_0962"
                     /codon_start=1
                     /product="Sec7 domain protein"
                     /protein_id="XP_027483626.1"
                     /db_xref="GeneID:38737728"
                     /translation="MEKEKYSSFECALAKNGTHRISLTPVPMTMQHHQDIPTLTTATI
                     SCQQPEMNNSSFKKRSSASIPGPSQANCSPRRSVPMHEKTPRPYSITSLCSDISSVPT
                     ITSNFSTSNSCSPLLATSMTSLKPTSSEFVPSESHTRSQTRYDTNILSSTLPIVNNVP
                     DCLTNLTSSSSQPSNNKLIPCVTQSHQSWIPLVDPPVPVELEPPLKKKLRDESPYIPQ
                     DCWKSEFMRMNSKETSPLLSESDHLPMKAPEQFFEHFDWRGKSLLEALRSLCSQLYLQ
                     GETDKIDRILESLSIRYVVCNPSSHFRAKECVHSVVYSLFLLNTDLHLANMNKHMTLH
                     QFLNNTCDALKELDFFDDVPVSVKQELEEMYISIREQPLGVPQEIRTLIEPEPEPFLR
                     RTLSRGRGTISSLYRRQSKKQMERTSLALGLHSEPRDPLSLSSKKRDSTCLSFDMDSV
                     VALDPKQNWTGRKSREQFRVVLCDGAVMLYAKKSLLNFQDIPARCLSLNQAWPKLCEN
                     KQETYLALTLADESVHLFYAPLPILKSCKKACIFMSACVSSIPLKEGSSNVDYGWLNV
                     CTKDVQPRAHEPLQVKSGFWWKLFSRKEEKSAEASIQNWLIPEMSLSPSTLSRGDQET
                     KMAEYLVYIEQTLSMLERIKEPMLQYWHKDRRARSKALANWDRKHAFLQAQFAKFGEY
                     QEALKCCDDTPTSCEQSQQRKGAHNARTSLLMEGSRDVL"
     gene            <201739..>203052
                     /locus_tag="MRET_0963"
                     /note="MRES_03815"
                     /db_xref="GeneID:38737729"
     mRNA            <201739..>203052
                     /locus_tag="MRET_0963"
                     /product="cyclin (Pcl1)"
                     /transcript_id="XM_027627590.1"
                     /db_xref="GeneID:38737729"
     CDS             201739..203052
                     /locus_tag="MRET_0963"
                     /codon_start=1
                     /product="cyclin (Pcl1)"
                     /protein_id="XP_027483627.1"
                     /db_xref="GeneID:38737729"
                     /translation="MASSSTMLSSSALRRHPASLLPRIVHNPSLTDLIRYPVTRDMVA
                     YIAKQATNVIQCSSDACDSASMQRSQNIPSLETFIMMLVEKSNVQVPTLLSTLVYLDR
                     LKNRLPRIAKGMPCTRHRVFLASLIVAAKNLNDSSPKNKHWTRYCVFFSQAEVNLMEK
                     QLLYLLDYDLRIEEDELVYHFSPFFRRFETRADAGRREMFLRGCDAGRECERYVRATE
                     RRLALRNSSASQITSNNATTPKTTPSTPKRVSPPTAQVQSSLSTTSIPRLSSKGLLTP
                     TATLKATSLHARNSETTRSGSSISEADLTDDNGSATSSPDEAHDYEDERGFSSIRVLD
                     QSRTLSSVPRSQSAAVLASMEHRHIHTMRSQIPPGAYAPQHANEKGHYSFSESKSLES
                     TPVRNGKPRTAQMVTDGMQRYLTSVIPNGIRRSNSRVTLRSNTYA"
     gene            <203403..>204142
                     /locus_tag="MRET_0964"
                     /db_xref="GeneID:38737730"
     mRNA            join(<203403..203593,203619..203688,203722..203760,
                     203789..203896,203924..>204142)
                     /locus_tag="MRET_0964"
                     /product="VanZ domain protein"
                     /transcript_id="XM_027627591.1"
                     /db_xref="GeneID:38737730"
     CDS             join(203403..203593,203619..203688,203722..203760,
                     203789..203896,203924..204142)
                     /locus_tag="MRET_0964"
                     /codon_start=1
                     /product="VanZ domain protein"
                     /protein_id="XP_027483624.1"
                     /db_xref="GeneID:38737730"
                     /translation="MNTESHGILSRISWLRRADQYFLWSIPIKIMGLQTGSQWDLPLR
                     LRPCLLGVLVLVLVLMGILGFHPNVQNYIYLNDKVMHFLAFMTTTYLCYRMWEVDQDS
                     MHVPIWKYTPLILTIFTSIIAGGIGSEFIQSLLPYKTFQLGDILANLMGSCTGLYAAY
                     YMEQRYRARCELQQLYAPLDLENVSEPEDDAERDPIALISPFRIGEST"
     gene            <204486..>205301
                     /locus_tag="MRET_0965"
                     /note="MRES_03820"
                     /db_xref="GeneID:38737731"
     mRNA            <204486..>205301
                     /locus_tag="MRET_0965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627592.1"
                     /db_xref="GeneID:38737731"
     CDS             204486..205301
                     /locus_tag="MRET_0965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483625.1"
                     /db_xref="GeneID:38737731"
                     /translation="MRDDVFNNRPMIKSQTVDFIVQIPLVAQAIQVGHRFLKDHPLLL
                     RLFDLAECLFIEFLLLILPLAKRFNKTLISVDNYAVRTLQYAKDKVPYPFEVTWNDLY
                     ANGKVQAHQLSQDVYENRIKAPAKSVYDQGVKVVEQLQQNENEYIKKVGASISSMHEK
                     VLSVAKEISQKSSQDVSEGEKQASSLVKSVVGEIEGLQKFAATLPSEAQKRLDPYIHV
                     LNTTYKDLSAEALDGKVPILDRLNKVVSYLQNKTVPELQKAVTAAPKSNKKKD"
     gene            <205511..>206533
                     /locus_tag="MRET_0966"
                     /note="MRES_03825"
                     /db_xref="GeneID:38737732"
     mRNA            <205511..>206533
                     /locus_tag="MRET_0966"
                     /product="fructose-1,6-bisphosphatase I"
                     /transcript_id="XM_027627593.1"
                     /db_xref="GeneID:38737732"
     CDS             205511..206533
                     /locus_tag="MRET_0966"
                     /codon_start=1
                     /product="fructose-1,6-bisphosphatase I"
                     /protein_id="XP_027483622.1"
                     /db_xref="GeneID:38737732"
                     /translation="METQQHQTDIITLTRHVLSEGARARSQDATVTGEMTLLLSSLQT
                     ICKVIENLVRKARVNDLIGIAGNQNVQGEEQKKLDVLSNEVMIKLLSSSGQCSVLVSE
                     EEDNIIIVREHGGHPGKYCVVFDPLDGSSNIDAGVNIGTIFGIYRIQDGSEGSVKDVL
                     RPGREMVAAGYCMYGSSANIVLSTGNGVNGFTLDSSFGEFVLTHPNIEIPSRGKIYSF
                     NEGNSMYFHEPVIKYLESVKFPGEGKKPYTARYIGSMVADVHRTLLYGGIFGYPSDKK
                     TKDGKLRLLYEGFPMAFLIEQAGGLATTGEKRVLDVEPKSIHERVPIFLGSKEDVQDL
                     LSFYHK"
     gene            complement(<206548..>208125)
                     /locus_tag="MRET_0967"
                     /note="MRES_03830"
                     /db_xref="GeneID:38737733"
     mRNA            complement(<206548..>208125)
                     /locus_tag="MRET_0967"
                     /product="protoporphyrinogen/coproporphyrinogen III
                     oxidase"
                     /transcript_id="XM_027627594.1"
                     /db_xref="GeneID:38737733"
     CDS             complement(206548..208125)
                     /locus_tag="MRET_0967"
                     /codon_start=1
                     /product="protoporphyrinogen/coproporphyrinogen III
                     oxidase"
                     /protein_id="XP_027483623.1"
                     /db_xref="GeneID:38737733"
                     /translation="MPGSGGKTIAVLGGGITGLTSAFTLARSLPQDAYRIVLIESQSR
                     LGGHVHSNREPSTSALYEWGPRSIRPVGYRGLRTIELLHQLSLQDRMVLVPRSSASAQ
                     NRFLYHDGQLLRLPSSFWSAIQATVRQPTLRRIFAEVRNEWRIPRSEHLGTAAGDESV
                     HAFFNRRFGPCLADTMASALMHGIYAGDSRELSIKAVMPSLVLTEQMHGSLLRALLPR
                     FLNSRYKASTYENSDQARKEAVESRLDPGLVRKLRSTSIYSFPQGLAELTRALEAELL
                     AMPHVSIWKGDACKRIVPGQRIEIETNHSKLYADRVVATVPSSHLAPLLPDLPHLAYN
                     PSAHLAIVDIVLGVADVLPIRGFGYLVPRNATNNSDEILGVIFDSDAVPNQSQRLTKL
                     TVMMGGPYWRHRSSFPNEDDVKERALRALHSQLGLSLLTLTSHLENIYARVMTDTIPQ
                     YLVGHPQRMAELKAAIKMHPQWRNRLSLLGYSYGGVGVNDCIANAMDTCDAICNYEQN
                     RSPLSDISGLQPALFPG"
     gene            <208300..>208852
                     /locus_tag="MRET_0968"
                     /note="MRES_03835"
                     /db_xref="GeneID:38737734"
     mRNA            join(<208300..208308,208362..208517,208595..208714,
                     208751..>208852)
                     /locus_tag="MRET_0968"
                     /product="ubiquinol-cytochrome c reductase subunit 7"
                     /transcript_id="XM_027627595.1"
                     /db_xref="GeneID:38737734"
     CDS             join(208300..208308,208362..208517,208595..208714,
                     208751..208852)
                     /locus_tag="MRET_0968"
                     /codon_start=1
                     /product="ubiquinol-cytochrome c reductase subunit 7"
                     /protein_id="XP_027483630.1"
                     /db_xref="GeneID:38737734"
                     /translation="MASKSISLASFIKSSPTLHKLVKPVANAYAHIAGYRQMGLRYDD
                     LIQEENMQMQKALSRLPENETYDRVYRMRRAVQCSIVQRDLPKDQWTTPENDKRYVTP
                     LLKEVQAADDERLAWDTMKVEQLRHH"
     gene            <209100..>210419
                     /locus_tag="MRET_0969"
                     /db_xref="GeneID:38737735"
     mRNA            <209100..>210419
                     /locus_tag="MRET_0969"
                     /product="DUF300 domain protein"
                     /transcript_id="XM_027627596.1"
                     /db_xref="GeneID:38737735"
     CDS             209100..210419
                     /locus_tag="MRET_0969"
                     /codon_start=1
                     /product="DUF300 domain protein"
                     /protein_id="XP_027483631.1"
                     /db_xref="GeneID:38737735"
                     /translation="MAGASSPLFTIMAPPVDGGSGRSLPRSLLALCTLATIFTTIVSL
                     YSILLQLKNYYKPSLQRYVVRILIMPLLYAVASTISLFSLQLAEMIDLMRDLYEAFVI
                     YCFFSLLVEYLSGEGAMLVHLRGRPPKPHLFPLNLILYPMDLSDPYTFLSLKRGILQY
                     VQIKPVLAVTTVLLKMYGKYEDGHLHLGNGYTWTAIIYNFSVFVALYYLTMFWICLSK
                     ELAPFRVASKFICVKGVIFFSFWQGLFISVLVAMGLVTHIGGVYDDTYLSTALQDILI
                     CLEMPIFAIAHIYAFSHLDYMTESPRLVGRMPFLYAVRDSFGTGDIAADMMSTMYGTE
                     YTYRSWEPSDDIRHHSYAFYRRSRAGLRYSEDGRTKYWVGENTHRFDERTPLVRHAPK
                     REYQATRGYDELSELRFPDATEEEDHLYNISRKLPFGDYKYPCVQTS"
     gene            complement(210554..210638)
                     /locus_tag="MRET_t0012"
                     /db_xref="GeneID:38741206"
     tRNA            complement(210554..210638)
                     /locus_tag="MRET_t0012"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:38741206"
     gene            210944..211026
                     /locus_tag="MRET_t0013"
                     /db_xref="GeneID:38741207"
     tRNA            210944..211026
                     /locus_tag="MRET_t0013"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:38741207"
     gene            complement(<211038..>213734)
                     /locus_tag="MRET_0970"
                     /note="MRES_03840"
                     /db_xref="GeneID:38737736"
     mRNA            complement(<211038..>213734)
                     /locus_tag="MRET_0970"
                     /product="RAD50-interacting protein 1"
                     /transcript_id="XM_027627597.1"
                     /db_xref="GeneID:38737736"
     CDS             complement(211038..213734)
                     /locus_tag="MRET_0970"
                     /codon_start=1
                     /product="RAD50-interacting protein 1"
                     /protein_id="XP_027483567.1"
                     /db_xref="GeneID:38737736"
                     /translation="MAGVVHTCPGYTRDELEQDARRILEYVQPALHPDAQRMAGTDAD
                     MRLLPVLLQHDRLTAEHLDTLLQTAHMDKDAAMSRLQDAESQLRECVNDVLRLHGAPT
                     SEDDDDDDLLTSSIEPLMALLEDKHPKHTQDIPKTDESGASEQLASLYAARACTQLLA
                     DAEETQRLASSSPINALVQLSALVEDAPQRGPRDCPMLMRTMSCLTQSRDALCEQIKL
                     ERTEALRTAFKQAAWPPPAYQSPETMTRDTPAYHLLGHPAVELAWADVCEWQFTAATI
                     GLIPSPSCITAPATVTGTSDCLNASCRDAAPGSDTYVPLLAVQVMMEQILLRFRYHFD
                     GARSTNRLDKPEWFLAHILGLIQVLGNLFEASPDPWTPGGDVAELTRRRRDTSLAEAP
                     LRQRYVAVNAPSELLHALLYPARRKIQASMHRLVCERALLAHNIYQFITFDADLRDTY
                     APARVSAISLADEILAHETWFQSWLDGERAFTEQRFVSLMEKPGAWNLVQADTMDDEG
                     VASTTLSDEEIDVDTATTTRCACSLVHMLTGVTEQYKPLHSLPQRCAFIIKVQRPLLD
                     MMHHRLVRHLDAFENMSTAFSRALPGDIASFSSGPGNELVRGEHGVTRVAKALLSADY
                     IKKQLQEWSESTFFLGMAQDIAELDTSSPLYRLMALKSSKDDLDSASLMSVLQRGIQR
                     GASAAAQLRPLSSAAKEEPAPQPNQTEETDMLGIWDYYITKFEIIATRSAHALERLTV
                     AEVLDLLKPYILRRWDHDEPVDDQETASQDQADQHQDIPTRELIPALSKLTTMLQHMV
                     QVLPPNLLLPVYRHIAASLSHAIVERVLMPNARFSQQFTASQAQRFCLDVKQGWLHVA
                     QEIAIHPKVSARQAKGMPTGLGRDPATAWRVLMDASKQLELS"
     gene            <213846..>214105
                     /locus_tag="MRET_0971"
                     /db_xref="GeneID:38737737"
     mRNA            join(<213846..213871,213901..>214105)
                     /locus_tag="MRET_0971"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627598.1"
                     /db_xref="GeneID:38737737"
     CDS             join(213846..213871,213901..214105)
                     /locus_tag="MRET_0971"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483566.1"
                     /db_xref="GeneID:38737737"
                     /translation="MSSKGGSYLSAQPGFLNSSVSRHAPIQPSWLQRFWAEEIMHPAK
                     FWGNMSVAWSVGFFALGVLFFRRAGAILLPMF"
     gene            complement(<214114..>214953)
                     /locus_tag="MRET_0972"
                     /note="MRES_03845"
                     /db_xref="GeneID:38737738"
     mRNA            complement(join(<214114..214229,214255..214338,
                     214368..>214953))
                     /locus_tag="MRET_0972"
                     /product="translin family protein"
                     /transcript_id="XM_027627599.1"
                     /db_xref="GeneID:38737738"
     CDS             complement(join(214114..214229,214255..214338,
                     214368..214953))
                     /locus_tag="MRET_0972"
                     /codon_start=1
                     /product="translin family protein"
                     /protein_id="XP_027483569.1"
                     /db_xref="GeneID:38737738"
                     /translation="MPDPVAELRGSFERFRDEIDSHNDKRERLIKASRDITALSKKLI
                     FHLHRFSLERGDAATSSQAALLGEAHTKLQGIYAQLSQLAQEEGLVSDHDRPSVAMLR
                     YERYVGDSIEEMVEAASFLHFLEHRTILPYEQMQRHFCAPDGRIVVHISPLRYILGLC
                     DLNGELMRFAIDASASPDPMRIIHQVLHVQRTIYYTIEPMSPLLPDIRKKQSVTLSSI
                     RKVENAAYTISVRSFEYGHDPQFIRDFVRRDLDTVRTDDYDTM"
     gene            <215009..>215872
                     /locus_tag="MRET_0973"
                     /note="MRES_03850"
                     /db_xref="GeneID:38737739"
     mRNA            <215009..>215872
                     /locus_tag="MRET_0973"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627600.1"
                     /db_xref="GeneID:38737739"
     CDS             215009..215872
                     /locus_tag="MRET_0973"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483568.1"
                     /db_xref="GeneID:38737739"
                     /translation="MTRRSSSAAARPPSQAPGAWEDEPGDPDVYAEPAHAEIESDDDS
                     DDAVEEVSMSTARAKAREEDAARSAQRHAERAARSAAQKRREATKTKPSRRARTHVDQ
                     DEHLDPAVFAEALAQDEIRDAPLPATSSSRRPRAPKDHVTLRGERTIVRTFDDEDALA
                     DDWEDAPLKHSPLDPRRSLPSARERAYKKQKLALRAKDVRASTIAKPSRPTTTRTPSV
                     DDPLGLQDPAFLPGGELYHLTGRHKRRARGRPTRADWTLRDRGAGGRVAVPLSRASMG
                     PAAVFARSRRV"
     gene            complement(<215873..>217750)
                     /locus_tag="MRET_0974"
                     /note="MRES_03855"
                     /db_xref="GeneID:38737740"
     mRNA            complement(<215873..>217750)
                     /locus_tag="MRET_0974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627601.1"
                     /db_xref="GeneID:38737740"
     CDS             complement(215873..217750)
                     /locus_tag="MRET_0974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483563.1"
                     /db_xref="GeneID:38737740"
                     /translation="MTESGHARPHEEVHAAPHAKHRFSSLNINQRFLQQVNTVTAPKA
                     APTPASTATSTATSASPDHARAACPRLVTAMPGRASASTPATEAGRSKEPGARDATTT
                     TSSSATPASTAPRMPWNARHRTAPKPVVSSHDFPTAKEAMEAERKAEERAAEEHARHQ
                     AAKEELERFRGTEIHSHDHWDEIDEESEDELDDVVEFGDGTQYKISEVEEEQSKRAPP
                     PPRVPAWGPLHRPAALLRRSEPPVSMPAAPAPASSQAPPPAPVSSWGPLAQRHSALTG
                     KPPPKIEPPAPKVDAAEIEAEQQTEMLSAAERARRRREDDERQREAERERARQKAARL
                     EEMMHKKEEDTEPATWRRTTPLPKSLCTPKRVEVRERAEPRKPAPKEAPPTKPATHEA
                     DPPTPPDACVVRTETTRFEQLHDEVPPVWHKYAVHLPRRRHRRHGPSRAAQQGQVPCG
                     AYEPAPSLHTLFTAHPARVRLPKGRIARSATPVPASAFARVERVDEAAFLRRYDELAH
                     PVDALFDDEPPRVRLPSRRASPTMPTMPLAPLLSHNLDAAAWGSSLTLPPLSVPKQSW
                     HASLKQVWTQNDTTTPSARNSLREIPDDAETSGLSAWMAPNGSTLFPSDYSEFVLSDA
                     W"
     gene            <217868..>218733
                     /locus_tag="MRET_0975"
                     /note="MRES_03860"
                     /db_xref="GeneID:38737741"
     mRNA            join(<217868..218623,218647..>218733)
                     /locus_tag="MRET_0975"
                     /product="COP9 signalosome complex subunit 6"
                     /transcript_id="XM_027627602.1"
                     /db_xref="GeneID:38737741"
     CDS             join(217868..218623,218647..218733)
                     /locus_tag="MRET_0975"
                     /codon_start=1
                     /product="COP9 signalosome complex subunit 6"
                     /protein_id="XP_027483562.1"
                     /db_xref="GeneID:38737741"
                     /translation="MAVHVELHALPALSIAEHRTRALKYASTSNVAGVLVGHVMDGTR
                     YEVVDSLAAPLRDDAQVDTEALRLAWALHQQVWPGRQVVGWYALGTEPAPHHAHMHAT
                     FLRCLSPDTPLTLVLLSEAAWHAFSHNDTWSPATVSLPSSATERIVLNDAHQRARFTD
                     DAPSDAPRTHHILASMQSERRALQMLCDRLTVACDYVDGVCQGTQPHDPAILRDLATA
                     VVNRRPAPQTHDETDALRSTYLATLLNNLHTLHEITEVHAFASSTAPAATSGGGRLVP
                     DRLP"
     gene            <218811..>221285
                     /locus_tag="MRET_0976"
                     /note="MRES_03865"
                     /db_xref="GeneID:38737742"
     mRNA            join(<218811..221238,221266..>221285)
                     /locus_tag="MRET_0976"
                     /product="DNA replication licensing factor MCM3"
                     /transcript_id="XM_027627603.1"
                     /db_xref="GeneID:38737742"
     CDS             join(218811..221238,221266..221285)
                     /locus_tag="MRET_0976"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM3"
                     /protein_id="XP_027483565.1"
                     /db_xref="GeneID:38737742"
                     /translation="MTDALDLDIPVLDDDLYKDRARTFVEFLDDQSGAVDYRTAVRQM
                     LASEACRLIVSIDDVRVYNRDYADGLLNEPNGYLPPFEHALQVLVEQLHDPLKDDIQG
                     KQFHIGLRGSFGDNHVNTRMLRSMHLGKMMSLEGIVTRCSLVRPKIVRSVHYCDTTSR
                     FHMREYRDATMYGTGPPTTSTYPTTDESGNRLTTEYGLCTFRDHQMISIQEMPERAPP
                     GQLPRSIDVVMDDDLVDQVKPGDRIQLVGMYKSLGNRVGQSTTSTFRTLMIGNYVYVL
                     SNKAGGGISQLPLTDLDIRNINKISRREDVFDLLAQSLAPSIFGHDYLKRAVLLMLLG
                     GQEKNLANGTHIRGDINILMVGDPSTAKSQMLRFVLNTASLAIATTGRGSSGVGLTAA
                     VTTDRETGERRLEAGAMVLADRGVVCIDEFDKMSDVDRVTIHEVMEQQTVTIAKAGIH
                     TTLNARCSVIAAANPIYGQYDVHKEPGRNIALPDSLLSRFDLLFVITDDIDEKRDRMI
                     SEHVLRMHRYVQPGQPAGVPAKDSLDQVLDVGGGPDDEAADQTQEDESPFEKYNPLLH
                     MGIQGDQRQQVLSITFVKKYLQYAKSRIAPVLSPGAAAWISNVYANLRNDEQGGNMRR
                     TAPLTARTLETLIRLATAYAKARLSQVVEEQDAEAAEAILRYALFKEVMHTKTTKRRK
                     TRPVDDEEDEDEADDGFDSDDMDQDEADRQLGGQPTRQTPYVTRASTRAEAKAPAPPS
                     ASRATSSALREFRVRAAEALSTTFAEEEYIPLTTLLEAVNAAGPTPIPEEDARNALEA
                     MSEDNQIMIAEDMVYKI"
     gene            <221420..>222061
                     /locus_tag="MRET_0977"
                     /note="MRES_03870"
                     /db_xref="GeneID:38737743"
     mRNA            <221420..>222061
                     /locus_tag="MRET_0977"
                     /product="Ras-related protein Rab-11A"
                     /transcript_id="XM_027627604.1"
                     /db_xref="GeneID:38737743"
     CDS             221420..222061
                     /locus_tag="MRET_0977"
                     /codon_start=1
                     /product="Ras-related protein Rab-11A"
                     /protein_id="XP_027483564.1"
                     /db_xref="GeneID:38737743"
                     /translation="MAAESNYDYLFKVVLIGDSGTGKSNLLSRFTRNEFSLDSRSTIG
                     VEFATRSINLDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHSTYINVS
                     RWLKELRDHADSNIVVMLVGNKSDLKHLRAVPTDEAKAFAAENNLSFIETSALDASNV
                     EQAFQNILTEIYHIVSNKALQSSDDVIKPSGGETISVQPSTDDGGQPKKGGCC"
     gene            complement(<222103..>222579)
                     /locus_tag="MRET_0978"
                     /note="MRES_03875"
                     /db_xref="GeneID:38737744"
     mRNA            complement(<222103..>222579)
                     /locus_tag="MRET_0978"
                     /product="peroxin-4"
                     /transcript_id="XM_027627605.1"
                     /db_xref="GeneID:38737744"
     CDS             complement(222103..222579)
                     /locus_tag="MRET_0978"
                     /codon_start=1
                     /product="peroxin-4"
                     /protein_id="XP_027483571.1"
                     /db_xref="GeneID:38737744"
                     /translation="MHRDGHSASIRRLAHERRGAEHAQDEHIHGLRPVSDANLFAWSA
                     VIHAPADGAYDGGRFEIDIQVPDTYPIKPPTMRFRTRIFHPNVHWKSGEICLDVLKTQ
                     WSPAWTLHSACTAVVALLDAPEPDSPLNVDAANLLRTGDLIAYRSMCAMFTRFYAT"
     gene            <222721..>225780
                     /locus_tag="MRET_0979"
                     /note="MRES_03880"
                     /db_xref="GeneID:38737745"
     mRNA            <222721..>225780
                     /locus_tag="MRET_0979"
                     /product="mitogen-activated protein kinase kinase kinase"
                     /transcript_id="XM_027627606.1"
                     /db_xref="GeneID:38737745"
     CDS             222721..225780
                     /locus_tag="MRET_0979"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase kinase"
                     /protein_id="XP_027483570.1"
                     /db_xref="GeneID:38737745"
                     /translation="MHLWSEQRAASHAPYAHTIQGVPRASAMVTYQQPGAHHDEYGRR
                     PVLPPGHVSGLSSHSRGHSHTSSDEMVWPQATSPRRTPMAMTGPAPLPPTNAYMSRPY
                     SASSIHSQGSTPSSTDSGDRVIIQATLDNESFSVVNVTGIDSAPTIREMILRKLKLPW
                     KDLSQWGLIRTEIGESDVGNSPLIDDDTLLSLCLQFGDDKGTVKFRVLQRRAVSDEPH
                     EAPVVYASPILVPQHTAPANLAWPGDSLYASHQPPPVPYAPPNVARNVVPRRQPWIPT
                     APAGAPQHIKDTFLPPLTNRHMSPAVVLPPSQAPSFPYLQPGMLVPSSSLDDKALRKS
                     SRPLSVHGMSSSRPAPSPHHAPVAAPNGRPASFQLDAPYKRDPDEAVPRRVLKPSKSP
                     ALSSSSDVGSPQDENVYPNSTPPVLYRGESSLGPRPLPVPSPISSASPASAQMSPWRQ
                     DIHSEWTDHIPSDRSTQSDHSGDSSMQRLMAHLRVSQERKNVSTSDAPAFDSFADDTL
                     GGTFAQPLDASTLTTRPHDADTLRPSPSTLTPRDASRPVLTLSISPPPEPKAPSQASA
                     TTVASKSSQDSYRQSWAFRPPPEELYEQLDNLFPRHDLDQPLSDMALSPQTSSETPLS
                     AQKEDRIVAGGTPSTKHRRAPRGLSRHQHHSIRIIAQNRRQLLEKTKQEERRNKLKNE
                     EVLSRRKSTKLWGGRMVEMRTNGANSVGIVPDGNTHNSMDPDTQPVFKWVKGDLIGKG
                     TYGRVYLALNATTGEMIAVKQVELPRTAADRDSSRQRSIVSALKSEIETLKDLDHPNV
                     VTCLGFEETLDTLSIFLEYVPGGSIGSCLRRYGKFEEDMTSSFLNQTLQGLAYLHKQG
                     ILHRDLKADNLLVDYQGTCKISDFGTVRRSEDIYANVENMSLQGSIFWMAPEVVSLSR
                     KGYSAKVDIWSLGCVVLEMLAGRRPWSDEEAVQAMFKIGAERRAPPVPKDVKISKPAA
                     HFLRNCFEIDPDRRPTAARLLEHVFAWPSPNWCFEDSGLYKLLCPPK"
     gene            <225918..>228725
                     /locus_tag="MRET_0980"
                     /note="MRES_03885"
                     /db_xref="GeneID:38737746"
     mRNA            <225918..>228725
                     /locus_tag="MRET_0980"
                     /product="transportin-3"
                     /transcript_id="XM_027627607.1"
                     /db_xref="GeneID:38737746"
     CDS             225918..228725
                     /locus_tag="MRET_0980"
                     /codon_start=1
                     /product="transportin-3"
                     /protein_id="XP_027483974.1"
                     /db_xref="GeneID:38737746"
                     /translation="MSEAAATSPDVSSVLAALQALYHNPDAQAKQQANQALLQFQKTP
                     QAWSTANALLLAQDVPLESRLFSAQTFRSKVTFDLEQLEGASQEQLRDTLLHALDMYA
                     TGPRVIQTQLCLALAALALQMSEARWGNVVPGMIERFGGAPSTVGVLLEFLTVLPEEV
                     SMNHRIPMDNTTYHDRVSQLLTQHAMSALQVLVMYIQADGVTSTIQAMIFACLRSWLK
                     TGEVTAMQLAETPLLSCTFDALQDEELFDTAVDVLCDLINETQELEENQGVIEWLLPR
                     IESLRPALMAAGDDEDRVRGLCRIFVQAGETYHALALQHPQALLPIVQAALDCASYHD
                     LDIVQITFRFWYLLATDVHRALEQGNPAALPFRDVFEQLFAVILRHLRFPDDDTDLTG
                     QERDDFRSFRHYMGDTLKDCCYVLGAEACLARSLEVIESALAQASPELRWQDMEAPLF
                     SMRSMGGQVDVTTSEVVPRVFALVPRLPPHPRLRYAGLLVMSRYTEWVADHPEHLSGI
                     LTFITTGFDGSDRDIAAAAAQAMDFLCQDCREHLVPYFDQLMHFFRSVHATLAVDDLL
                     SVSEALAHVVTAMPPAAATEALVQLAQPLLENVHEVCELPSATKPDLMRAADRMEQLA
                     RILQIMGVSLASTLPEACAATCTQAYAILDRLLERYGDVFFISERTSALIRRALIFFD
                     QRAVPTMPALLDRFASCFESTGFSGYVWIVGKSIDQYGQRADSTLGMQLGQAFERVTH
                     KVGSMLRSAPSPDAMSDVLDDYLHSCLVTIQAAPTLLLGMPPLLTQAYAMALQALAAL
                     SPGVVGIAADVVRAIVEYAHEVPVPDRTHADTVHAVVGEHGAETCRALMHGLVTHFPP
                     ENMPVVVSTMRTLATDFAAQMPVWASAAAQALPTEAVPEADKMHWIEQMHAVPLDERI
                     KPSLVRLYGASRKSRERAQLE"
     gene            complement(<228742..>230088)
                     /locus_tag="MRET_0981"
                     /note="MRES_03890"
                     /db_xref="GeneID:38737747"
     mRNA            complement(join(<228742..230010,230037..230058,
                     230087..>230088))
                     /locus_tag="MRET_0981"
                     /product="vacuolar protein-sorting-associated protein 4"
                     /transcript_id="XM_027627608.1"
                     /db_xref="GeneID:38737747"
     CDS             complement(join(228742..230010,230037..230058,
                     230087..230088))
                     /locus_tag="MRET_0981"
                     /codon_start=1
                     /product="vacuolar protein-sorting-associated protein 4"
                     /protein_id="XP_027483975.1"
                     /db_xref="GeneID:38737747"
                     /translation="MAPTDFLQRGIDIVQRAIDEDVKHHYQEAYMQYQNSLDYFMMAL
                     KYEKNDKLKQLIRSKFVEYLDRAEKLKEHLGKVAQAETSDGGKGVAGSKSDSEDMDAE
                     TRKLRSGLSNVILTERPNVSWDDVAGLSSAKDALKEAVILPIKFPQLFTGKRKPWSGI
                     LLYGPPGTGKSYLAKAVATQSNSTFFSVSSSDLVSKWMGESERLVKQLFAMAREARPS
                     IIFIDEVDSLCGTRGEGESEASRRIKTEFLVQMNGVHNDHETEVLVLGATNIPWALDS
                     AIKRRFEKRVYIPLPELDARRRMFELNIGSTPCTLTPRDIRTLAAQTEGYSGADVAVV
                     VREALMQPVRRVMNATHFKQVREVDDDGTERTRYMPCSPGDPDAREMTWMDVESDELR
                     EPHLVMNDFLKALHAVRPSVSAADIQKHLDFMRESGAE"
     gene            <230180..>233362
                     /locus_tag="MRET_0982"
                     /note="MRES_03895"
                     /db_xref="GeneID:38737748"
     mRNA            <230180..>233362
                     /locus_tag="MRET_0982"
                     /product="phospholipase D1/2"
                     /transcript_id="XM_027627609.1"
                     /db_xref="GeneID:38737748"
     CDS             230180..233362
                     /locus_tag="MRET_0982"
                     /codon_start=1
                     /product="phospholipase D1/2"
                     /protein_id="XP_027483976.1"
                     /db_xref="GeneID:38737748"
                     /translation="MSTAPLRIPSDASRPSTEAVSESDQEPRQQACREAPDTHASPTV
                     QDLPPNSARISLRSLWRRQHASTPQREPRSNSISMVSDLQTGLTSAALLKMRLERDEN
                     NAPRIPVLLQYLRVQVTDTFNSHSSGHHVYRIELSYGYGMVSWVIYREVRDFFNLHAY
                     YRTHSVANTLYKSFSSEADSEGDLPSFPKGSFTNRFTRQRQQQDGKTAQEHQDAQERT
                     YRQALTDYLQKLIKFAMFRSEANRLCRFLEISAMGLQVASLDGYLGKQGYLQIKSKSS
                     WRDTQSLVQRPKRRIPKWFIVRESYIIIVEEAHSLRLYDVFLMDQEFKVVQKHTLRPA
                     SLKHAPKNEVEEDKEGKLAWPETHHTSTGTIGDYVRRHRFNLYNAERKLKLTAKNERE
                     LEQFLLSIQWAAHHNPFGKQTRFGSFAPIRRCAAVQWLVDGRDYYWNLSEALLHARDC
                     IYIHDWWLSPEMYLRRPGTPEWRLDHLLQKKASEGVLVYVILYNEVSNQFTPTDSAYA
                     KSRLMELHPNIVVQRSPSHLKTGTFYWAHHEKLCVVDQMVAFMGGFDLCFGRYDTPSH
                     PLVDDAAMGPSTTTDPSLLGPALDGAEAHIWPGQDYANERKVEWQILTKPEMDLLPRD
                     KVPRMPWHDVGVQILGQPARDLCRHFCQRWNMLLRSKKHTRRMDFLLPPSDLTEDEVR
                     RFGVQGTCDVQICRSGGPWSLSTPKTVEHSIQNAYLKAIEQSEHFVYVENQFFVTSTV
                     MESTEIENSIGLALVERIVRAHRERTPWRAIILIPATPGFPMEYDHPESGSVRIISAL
                     QYLSIARGPHSIFARLASVGIDPHAYIGFYSLRQWGRMRHGQLVTEQVYPHDKVMIVD
                     DRLAIIGSANINERSQRGDRDSELACVVQDHDMLMSRMAGEAFQVGRFPHTLRMRLMH
                     EHVGWDLDAMERGENVQITQDPQPQVVPKCLLDPVAQYDVWKAVATHNTVIYRQVFRC
                     VPDDEIKAWASYKVAMQHHDRVGRSVTDGSAPNGTDLFPPEQVENMAAQLQRCCGTLI
                     QHPTEFLEHDAMRGNYLFAKDHINPLIVFD"
     gene            complement(<233415..>234833)
                     /locus_tag="MRET_0983"
                     /note="MRES_03900"
                     /db_xref="GeneID:38737749"
     mRNA            complement(<233415..>234833)
                     /locus_tag="MRET_0983"
                     /product="citrate synthase"
                     /transcript_id="XM_027627610.1"
                     /db_xref="GeneID:38737749"
     CDS             complement(233415..234833)
                     /locus_tag="MRET_0983"
                     /codon_start=1
                     /product="citrate synthase"
                     /protein_id="XP_027483977.1"
                     /db_xref="GeneID:38737749"
                     /translation="MLSLTIPRAALRSATAPRQFAAAATSVRYSSTKSLAEAVGEIVP
                     AKREQLARIKSQYAEAPLGQSNVGHLIGGMRGLKCMLWEGSVLDAESGITFHGKSIPQ
                     CQKELPTAKDIGRPGDEMLPESMLWLLLTGKVPTAEEAKGLSQDLMSRAKLPSFVEKV
                     IDTFPKSLHPMTQFSAAVSTLNHDSKFAAAYNAGVKKTEFWQPTLEDTLDLIARLPAI
                     AARIYFNVFGKGDGKQHVDPSMDFAENFSHMLGYGDKEGLTDYLRLYLSVHGDHEGGN
                     VSAHTCHLVGSALSDPYLAYAASLNGLAGPLHGLANQEVLNWILEVQREVGDSPTDQQ
                     VTDALWATLKSGRVVPGYGHAVLRQPDPRFTALYGYCDKRAELQSSPTVKLVQRISQL
                     APPVLKEHGKTKNPFPNVDAASGAPLYTYGLDEFKFYTVLFGVSRAFGALPQLVFDRI
                     LGLPIERPKSLSMDALEQLVKK"
     gene            <235153..>236364
                     /locus_tag="MRET_0984"
                     /note="MRES_03905"
                     /db_xref="GeneID:38737750"
     mRNA            <235153..>236364
                     /locus_tag="MRET_0984"
                     /product="uroporphyrinogen-III synthase"
                     /transcript_id="XM_027627611.1"
                     /db_xref="GeneID:38737750"
     CDS             235153..236364
                     /locus_tag="MRET_0984"
                     /codon_start=1
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="XP_027483978.1"
                     /db_xref="GeneID:38737750"
                     /translation="MPLGRSEPVRVLLLRQPVPVHQGTDPYHHAFGTLRTSFRDPASP
                     DTSGAASCAPKNDNSLTSPAHTTNESRPDPDLFANDDLYLVTHHMRPHELKDVEFRVV
                     SFPILTHVTVHADELDQALLGMYHHTTHYDGVIMTSQKAVQAWQQACVRVNQKLYVQQ
                     DIHPERMRVLGQVPFYVVGPATAKALRHIEVATPFQPTTIHGAEAGNAESLALHMMRD
                     MNQSRHPRRFLYLVGDKRSPALINTLQAHNAPVTLDELVVYATDKNPGFEDNCALLAR
                     DIPRHTSDEALSGSRPSSTQRQREHHGIVGHTQEEHLDAHTPPASAPTEVRPDWIVFF
                     SPSGGNYALQELVQRRWIVSQEAHQGCKVACIGRTTAQWVHETLGFEPHAIAAHPTPD
                     ALQEAIFRDLI"
     gene            complement(<236394..>237641)
                     /locus_tag="MRET_0985"
                     /note="MRES_03910"
                     /db_xref="GeneID:38737751"
     mRNA            complement(<236394..>237641)
                     /locus_tag="MRET_0985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627612.1"
                     /db_xref="GeneID:38737751"
     CDS             complement(236394..237641)
                     /locus_tag="MRET_0985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483979.1"
                     /db_xref="GeneID:38737751"
                     /translation="MIPVLPRITREAVSGASGTASLFVWIFAQTPQIYQNFRTKSVEG
                     LSFVFLLQWTLGDLTNLVGAFLTNQLPIQMVIAAYMLLVDVTLCTQYALYYREPLPPR
                     ISPAFPTERSPLIGALYRPAHTSTTGTTAMASTSRSRHVLPSMSRQTLRARSLDPWMV
                     YRVRPHRPSRRTRAPRKSESTDDVTSKPAASVERGRRSKAHTSLAPASMDQDVSSSAR
                     GRARGRKAAIRRGATVALLGIGFFVSVGPSSRPDALASVDPVAQPHVLAHTSTTTPIP
                     PAVRHPILLYIPDMELWNAPRRGRKDPAPPFSVIIGRIFAWFCTVLYMTSRLPQIWTN
                     FQRRSVRGLSMLLFLLAFFANLLYSISILSNPKAVGPDRYEYLSESLPFLLGSSGTLV
                     FDLVILVQYAMWHDKHTPAPSSP"
     gene            <237786..>238310
                     /locus_tag="MRET_0986"
                     /note="MRES_03915"
                     /db_xref="GeneID:38737752"
     mRNA            <237786..>238310
                     /locus_tag="MRET_0986"
                     /product="golgi vesicular membrane trafficking protein"
                     /transcript_id="XM_027627613.1"
                     /db_xref="GeneID:38737752"
     CDS             237786..238310
                     /locus_tag="MRET_0986"
                     /codon_start=1
                     /product="golgi vesicular membrane trafficking protein"
                     /protein_id="XP_027483980.1"
                     /db_xref="GeneID:38737752"
                     /translation="MNRRNAPMPERYAVLTDHAYPSSTSAKMGPRNAVFEKPWRSDSP
                     FENPYEMSAQEPGAPKKDAQNSFVSLFSGTSAQQSSAADLEEQNDARLSGLSERIKLL
                     KDISTGIGKEARESTAEMNSLNDLFSNASSLLGNTFHKMTVMARRQRGWFCNMMLFIM
                     LVIWIFVFLWWWRK"
     gene            complement(<238355..>239896)
                     /locus_tag="MRET_0987"
                     /note="MRES_03920"
                     /db_xref="GeneID:38737753"
     mRNA            complement(<238355..>239896)
                     /locus_tag="MRET_0987"
                     /product="rhomboid family membrane protein"
                     /transcript_id="XM_027627614.1"
                     /db_xref="GeneID:38737753"
     CDS             complement(238355..239896)
                     /locus_tag="MRET_0987"
                     /codon_start=1
                     /product="rhomboid family membrane protein"
                     /protein_id="XP_027483981.1"
                     /db_xref="GeneID:38737753"
                     /translation="MTSEPDLYAKIQQHLQHGSSSHGDFPPTVFRAENGRPMSVARTR
                     PYQDVDDLVVSHPSSDEAFDRNRFYCLKNASDYASSISLHEPAHLLPVNSSHRDTVAV
                     PMYEDTRKPYDWGMSETDLPLKYAENDLDESHHWQTQHPIYPDHLTASRTHLMGSADE
                     SLEMPSQKEGKFTWSNQDKLKQKIDERERGVGRQRYPFVTWLISFGVVVVFIAELILS
                     KQRTGEAVQVHPSVQPMIGPPAEFLISFGARFAPCMRNVPGLPPTNMIPCLNHTATRE
                     TRFQRDELCSLADICGLKDATDPNQGYRFVSAIFVHAGIVHILFNLIVLLTLCGQIEK
                     LIGSLAYAIVFMAGGIGGNLLGGNFGLIGQPALGASGAVYTCISFEMIDLIYNWKFEM
                     KPKTRLTVSIIFAIIGLALGLLPGLDNFSHIGGFCIGILGGLVFAPSIHPSRSHMIIN
                     WVCRLVGVILLIAFLVALVLNFYRSDDPSKACTWCRYLSCLPAFDACRGGGIYTTTPD
                     GEVTQ"
     gene            <240046..>240954
                     /locus_tag="MRET_0988"
                     /note="MRES_03925"
                     /db_xref="GeneID:38737754"
     mRNA            <240046..>240954
                     /locus_tag="MRET_0988"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627615.1"
                     /db_xref="GeneID:38737754"
     CDS             240046..240954
                     /locus_tag="MRET_0988"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483972.1"
                     /db_xref="GeneID:38737754"
                     /translation="MTTAGDGAVLRVKRKRADDPVDAFLFQFHTQSHLAKRRGTQPHH
                     PPDQPGHGMFRRRETVNIGEQMAKDAQVIEAEWDSFSKRMRLKRKHEQDTETTSVRRK
                     HLPSHLQEEDKAQDMNCFSDMLSEYLRLNQVSLESHDTSAEAANEYVFDIYYQDTTPM
                     TAWRHRDAKNVNCVPTVGHARTKSNKPHSSVPISGKGYDTGPSTTTAPGFEHLQDPEE
                     DVDWMHEASFYPVHLRTTMDENGHTLVTAVPIGAQGLAENDLMLEEIESGADLCDDDE
                     DSNDEDFYRNDYPDQDEWDADSDTEW"
     gene            complement(<241603..>243027)
                     /locus_tag="MRET_0989"
                     /note="MRES_03930"
                     /db_xref="GeneID:38737755"
     mRNA            complement(<241603..>243027)
                     /locus_tag="MRET_0989"
                     /product="LIM domain protein"
                     /transcript_id="XM_027627616.1"
                     /db_xref="GeneID:38737755"
     CDS             complement(241603..243027)
                     /locus_tag="MRET_0989"
                     /codon_start=1
                     /product="LIM domain protein"
                     /protein_id="XP_027483973.1"
                     /db_xref="GeneID:38737755"
                     /translation="MTESGAPILESLDKRNFAGIGVASRRRLQQQFLQNQRQNVSPIL
                     LSHKDHRDISIPQSQFLPKCDQDTSMYGTQSRLSCGRFPRFAKAVHDTFPTQTMTPTS
                     IIPVRTGSTPLPTLPTMVPMNTPSSSETSSPVVQSSAPTSVHISPITPKLRLNTSGAL
                     RQQSSASLMSMSSTNTSNFSLPLTPAPSSMSYQAQDMLAARASPALSIEPSLKPYRQS
                     GLDALDMAFWSGDGFYSDDEDDPMPHASQTMLAQKRQPQCAKPLPDVREAENHLHLNI
                     IDEYLSDAAEPMTEHQREDNAALLHEECESQLRSLRCKSQLVMCNNPSVVQVQDTAHS
                     VSEPTDSSCCTRCHQFVEGRKICGKDNSILGIYHPDCVRCSDCDDKLAKTDIFMYQGK
                     LLCLWHYQVRSGTVCHACGRGITGIFRKTSKGECYHPTCMVCAYSDAASGPCLLQLTD
                     YFSMNQKMYCEKHARQVAQSLSSR"
     gene            complement(<243362..>245407)
                     /locus_tag="MRET_0990"
                     /note="MRES_03935"
                     /db_xref="GeneID:38737756"
     mRNA            complement(<243362..>245407)
                     /locus_tag="MRET_0990"
                     /product="enhanced filamentous growth protein 1"
                     /transcript_id="XM_027627617.1"
                     /db_xref="GeneID:38737756"
     CDS             complement(243362..245407)
                     /locus_tag="MRET_0990"
                     /codon_start=1
                     /product="enhanced filamentous growth protein 1"
                     /protein_id="XP_027483918.1"
                     /db_xref="GeneID:38737756"
                     /translation="MSTASPSVSTTTAATAAAASAAASPYGGISSMHAAPQQPAPPAP
                     QPQAPTASHSGAPALHGHASTALACSDPHVGGHASSAGLYQQQPDSVNQSSHHMASSF
                     PSTQLSPMTSPYAATYAAAQHPMYSASYPGHAYAPYPNYFGHISHYGTHPPHYPAAAT
                     SGPAYHAPFMSSMMPHAGYNPHTPAHIPSHHAPSAAAMPLSMTTTSANATSPAAPGGM
                     TSGAMMAASSYGSAPQYTTPVPWMGRHRVTTTLWEDEGTLCFQVDVKGVCVARRHDNN
                     MVNGTKLLNVCGMSRGKRDGILKNEKERIVVKVGAMHLKGVWIAFNRAKQLAEQHGII
                     DILYPLFEPNIQSFLYHPDNYPRTAAVMAAAQERQVHRHYGGMPANGVNTPVKDVSSS
                     DISTASLPLHSSLPHSHWGSPGQTTAHDTSATSNSADTSLSYSYPQHHSHYHHPATVL
                     PTAHAACQQTPNSTAASVTSPTPAPTTPGMFHSPNTPYSAHAAAMPPPTVRSTNAPAA
                     PGMMVDRRLEHAATPAATPNGHAASTSSVPATLSHELQQQPTSHMSHSSNEARRFSME
                     KRPSEPAVSLDVSPHHEFPHHVGPPSGVPVPQSTANSFATSPMPSTSSFSMDEKRPKM
                     ENATSTTTAPPTPSTSTVEVRSAASSTAPPAHQPLDMVYSGDGRPTETGVPTQKHEN"
     gene            <245889..>247454
                     /locus_tag="MRET_0991"
                     /note="MRES_03940"
                     /db_xref="GeneID:38737757"
     mRNA            <245889..>247454
                     /locus_tag="MRET_0991"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627618.1"
                     /db_xref="GeneID:38737757"
     CDS             245889..247454
                     /locus_tag="MRET_0991"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483917.1"
                     /db_xref="GeneID:38737757"
                     /translation="MEDAAAAHEPPSKIEVVEHRGVPSQEPVHRPDLEEVPNEPQAQL
                     TEPVEHEHTRTVMPESHAPQGEESSHPEQNVEALPPAGSGRVVPFAPKDVDPGTVDAA
                     EQAQAQGAIAQERAHQLEMDRLLWISLPKNDQLDYHIEHDNSDEWPELNEPGPSGFSN
                     RGQKLHAHNGVRWMHRGKLGTWTERRSDYELREREERRIDAFQHASVDAMLEAEATGP
                     GGMGGIWRTQVLPKRRGRHSDHYASKRAKTQLWDPQAKYDLVEDAWEEDDKNARHAST
                     LAFSLLVPVLTARGLLESKLLKQSFRNPHLTSLNRAALNLIENEHVMYRALGRCFDTM
                     EHLTGKEGPVPVKHDQHHTDVTVPMDYVPPLAHMNDLFITNEGFTVPVSSSEHENETN
                     STYTLSADEQREIVYSSLQCLNDLHADSREYMERLGEVRMMLAEVRRDRNHMWGIIRK
                     WALERESLDYQASLRQRRHRAGMDDMVDASSSHEAAHEKVHHMNDNAPESESRRTEWS
                     TSNRNRGKRRSGR"
     gene            complement(247550..247633)
                     /locus_tag="MRET_t0014"
                     /db_xref="GeneID:38741208"
     tRNA            complement(247550..247633)
                     /locus_tag="MRET_t0014"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:38741208"
     gene            complement(247705..247787)
                     /locus_tag="MRET_t0015"
                     /db_xref="GeneID:38741209"
     tRNA            complement(247705..247787)
                     /locus_tag="MRET_t0015"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:38741209"
     gene            complement(247896..247991)
                     /locus_tag="MRET_t0016"
                     /db_xref="GeneID:38741210"
     tRNA            complement(247896..247991)
                     /locus_tag="MRET_t0016"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:38741210"
     gene            <248112..>248816
                     /locus_tag="MRET_0992"
                     /db_xref="GeneID:38737758"
     mRNA            <248112..>248816
                     /locus_tag="MRET_0992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627619.1"
                     /db_xref="GeneID:38737758"
     CDS             248112..248816
                     /locus_tag="MRET_0992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483916.1"
                     /db_xref="GeneID:38737758"
                     /translation="MEQKTRHTYALPSSRRVRLSTPESSSGEAKTTPPSPRGRGILLP
                     PAQYGRAASPTPLSQSLPNDLALNTRNYTPKEWALIGIDRKDSSSKFAVVLLHWPSMT
                     LYTWPLDPKSPEKQSNCFITPLGQKENMQHDTKLVHQSLSVLEHAVRAWMRYVRTKSA
                     SQTGSVSVTHAEIVQICQILGLEPASQEQRLQYLQVQQLPLLPRSRPSSRSSSPLKSP
                     SFGMASATDKAPDNSP"
     gene            complement(<248965..>254211)
                     /locus_tag="MRET_0993"
                     /note="MRES_03945"
                     /db_xref="GeneID:38737759"
     mRNA            complement(<248965..>254211)
                     /locus_tag="MRET_0993"
                     /product="1,3-beta-glucan synthase"
                     /transcript_id="XM_027627620.1"
                     /db_xref="GeneID:38737759"
     CDS             complement(248965..254211)
                     /locus_tag="MRET_0993"
                     /codon_start=1
                     /product="1,3-beta-glucan synthase"
                     /protein_id="XP_027483915.1"
                     /db_xref="GeneID:38737759"
                     /translation="MNPQYQGGFAESPAQQNPYYAGGGTAPYSTTSLDANDTQQGDMY
                     GGQTGMYQHPPAQASALAYHEVAASGVRQREPYPAWTVDMQIPLSKEEIEDIFIDLAN
                     KFGFQRDNMRNMFDHLMILLDSRASRMSPQQALLTLHADYIGGEHANYRKWYFAAQLD
                     LDDAIGKIQNPGLARAASMAQRGNASKRGSTLFGTKSLENARARWRDAMYRMSDYDRV
                     RQLALYLMCWGEGSQVRFVPECLCFIFKCADDYYRSPECQGRMDPVPEGLYLHSVVKP
                     LYRFLRDQVFEVIDGKFVKKERDHDRIIGYDDVNQLFWYSEGIQRIKLKDGTRLVDVP
                     PQQRFMKFDKIDWDRAFFKTYKESRSFLHLLVNFNRIWIFHVSLYWYFMAYNAPKAYE
                     PDKVPSDAEKLSASALGGAVSTFFMICGTLVEVMYIPTTWNNTNHLFGRLVFLGICMA
                     LMIAPAVYVFGFNKDGHVGYVISVVQMAVASVLTAFFSIVPSGYLFGDRVAWRRRKYM
                     ANQTFTASYAPLPLSRRFFSILLWVLVFGCKLTESYYFLALSFKDPFGVLVTMRVQEC
                     HDRYFGTHLCSLQPTFALSAMMLMDLCLFFLDTFLWYVVWSTVFSLGWAFYLGLSVWT
                     PWSDIYQRLPKRIYSKILATADMEVKYKPKVLVSQVWNAIIISMYREHLLSIDHVQRL
                     LYHQVPADNSPHKRTLRAPPFFLNQLDSGPRPEFFPKGSEAERRISFFAQSLMTSIPE
                     PLPVDAMPTFSVLTPHYGEKILLSLREIIREEDQNTRVTLLEYLKQLHPVEWDNFVKD
                     TKILAEESGNFAGDAPFGFEDEKSNLKGGKTDDLPFYCIGFKSAAPEYTLRTRIWSSL
                     RAQTLYRTVSGFMNYNKAIKLLYRVENPEIVQLFGGNTERLEQELERMSHRKFKFVIS
                     MQRYSRFNKEEIENTEFLLRAYPDLLIAYLDEEPSPKEGGESRWYSALVDGYCEMLPT
                     GRRRPKFRIELPGNPILGDGKSDNQNHAVIFHRGEFLQLIDANQDNYLEECLKIRNVL
                     AEFETIDMPAENPYGPAYNVFSKAPVAIVGSKEYIFSENIGILGDVAAGKEQTFGTMA
                     ARGMAQIGGKFHYGHPDFLNSVYMTTRGGVSKAQKGLHLNEDIYAGMMVFQRGGRIKH
                     SEYYQCGKGRDLGFGTILNFITKLGNGMGEQILSREYYYFGTQLPVDRFLTFYYGHPG
                     FHINNIMVILAVHLFMFALMFIGSLYSTLEVCPDTQGIPFVLGQGECYYLNPIVYWVQ
                     RTVISILLVFMIAFLPLFLQELSERGAVFALVRLMKQFVSMSPLFEIFTTQIYSHSLI
                     TNLTFGGARYIATGRGFATTRLSFALLYSRFAGPSIYSGLQYLLMLFYATLTVWMPHL
                     IYFWVSLVALCVAPFLFNPHQFSFSDFIIDYREFLRWMGRGNSRSHANSWIGYCRLSR
                     TRITGYKRKRLGHPSEKLVADLPRASWKTILIHELLMPTMVAVIFAVTYAYVKSFPAP
                     GLTFEDGEFQGGIARLAIIVLVPIAWNAVVLLVLFFVSLFFGPALQSCCAKFGSVMAS
                     LAHGLAILGLFAVLEFFWYIEYWNSANTVLGIVAMIAIQRAIFKFLTGIVISREFKHD
                     ETNRAWWTGRWYGRGLGGSAFSQPLREYIVKIIEMSQFSADFINAHLLMFALSIPLAV
                     PFIDRIHSTALFWLRPSKQIHAPIYSLRQRAQRRSIVMRYSIVFLFAWLVFLALILVP
                     AIVQAVMSDEDKADACHFCRTL"
     gene            complement(<254708..>256339)
                     /locus_tag="MRET_0994"
                     /note="MRES_03950"
                     /db_xref="GeneID:38737760"
     mRNA            complement(<254708..>256339)
                     /locus_tag="MRET_0994"
                     /product="sterol 22-desaturase"
                     /transcript_id="XM_027627621.1"
                     /db_xref="GeneID:38737760"
     CDS             complement(254708..256339)
                     /locus_tag="MRET_0994"
                     /codon_start=1
                     /product="sterol 22-desaturase"
                     /protein_id="XP_027483914.1"
                     /db_xref="GeneID:38737760"
                     /translation="MATDATQQVWDSVVALNSTITDHVASVVPKSLHDISGMQVVFTV
                     LALAVSLLAMEQVVYRVKKGGLPGPAWTIPLIGKFADSLHPSLEKYQEAWNSGSLSAT
                     SVFNIFIVIASSTEYTRKILNSPMHAEPCLVASAKKVLCHDNWVFLNGKAHVDYRKGL
                     NTLFTSRALGIYLPIQEAIYKKHFQLWTASPKSEAEPFMLPLRHLNLETSLRVFCGNY
                     ISEQGAKQISDEYWLITMALELVNFPFALPGTKVYRAIQARKNAMKWFEHTAAESKKR
                     MALGEEVTCLTDAWIRAMIDAREDRNNEDLGAEQRRVLVRDFSNREIGMVLLSFLFAS
                     QDAMSSGLTYLFQHLADHPEILRKVREEQYAIRNNDVEAPVTMDTVEKMTYTRAVVKE
                     SLRLKPPVLMVPYLARQAFPISKDYTAPKGSMVIPSFWNSLHDPAAYPSPDEFLPERW
                     LEGPDSPAAKNPKNYLVFGNGPHNCIGKEYAMQHLVTVIGAASVLMNWEHKRTDLSEK
                     VMIIATIYPTDGACLKFSRRPAPPMDAPAAVAAAM"
     gene            complement(<256512..>258509)
                     /locus_tag="MRET_0995"
                     /note="MRES_03955"
                     /db_xref="GeneID:38737761"
     mRNA            complement(<256512..>258509)
                     /locus_tag="MRET_0995"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027627622.1"
                     /db_xref="GeneID:38737761"
     CDS             complement(256512..258509)
                     /locus_tag="MRET_0995"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027483913.1"
                     /db_xref="GeneID:38737761"
                     /translation="MDPEHRDVPSPLVTPPLLCDPHDGCDSGADRHSYAMPSTSHLTD
                     ARSSLQRINSTPQIKHCGRASLRHAAHDRSAHEWPMVAATLRSDPTRARRLHGRATLA
                     QAREPKKRPSLWLRELDDGAAYSSDGVPSLPSSPVWAHAEQLAPQPTPQHGVAEMRLF
                     PSHTGPPSVPPRAHSLSMEYADRLRHPCKQSMSSFTMSAISSRRSSHSHDVADMNVPD
                     IEPCHQSYLLRDASVSESGRILPADVLHVGDRIGPGMHHDGEFVHVAQSSEGFSEQDL
                     HPFLKCLEVVKLLGRGSYAVVYLAREVGVDGGEYALKCLSKRDLSPDQLADQRLEATI
                     HQLLPPHKNIVTLHNTYETRDWLFLVLEYCPGKDMFYWLEEASESIGITSATHIGGDS
                     VDTASARCENGHAAAFEMASKLRLSHLLLATPRLQLISHIFGQMCDAVQFCHDHGVSH
                     RDIKPENLIVQDQWQTDGHDSVVVKLTDFGLATTSEFSNEFNCGSNPYMAFECRHDLA
                     STYDPKQADTWSLGIVLLNLLFLRSPFSQPSAQHCASFLAFSLRPVAFLMQAFQGLTV
                     EVTRFLCEHVFCNVTHGERRRITPREFGQWAQHLPQMLGCHVPLAGASVTRPPAQPLR
                     SATFVCSSDPAPVKPAPLVSNRSHPILPPGHGSEHPSPPPR"
     gene            <258822..>259898
                     /locus_tag="MRET_0996"
                     /note="MRES_03960"
                     /db_xref="GeneID:38737762"
     mRNA            <258822..>259898
                     /locus_tag="MRET_0996"
                     /product="transcription initiation factor TFIIH subunit 3"
                     /transcript_id="XM_027627623.1"
                     /db_xref="GeneID:38737762"
     CDS             258822..259898
                     /locus_tag="MRET_0996"
                     /codon_start=1
                     /product="transcription initiation factor TFIIH subunit 3"
                     /protein_id="XP_027483912.1"
                     /db_xref="GeneID:38737762"
                     /translation="MAVGANETVRAYAETRAPANRGGHAPGYVSTRSMSVSASLALSD
                     CLVVILDLDAYAWQHVSPPTGDSTERADAAFETLQHVISAVLVFLNAYTAMQHGNGLV
                     VYGAAAGTAHLLYSSLQAGDSSDASSHDTHASACLPFKRMNDAVFHGMRAMLEAAHHG
                     AGGSVGIVRALALALCHINRITTAMSEHATERRGAGATSFQHRILVLSATPDVSAQYV
                     PMMNCIFSAQKQGIQVDVCKLLGDETVFLRQACHLTGGHYYHVPRLDGLLQVLMTTFL
                     PSRSIQASLMFPALDDVDFRAACFCHRRNVDIGYVCSVCLSIFCEPRDTCLICHAAFM
                     PSTLERLKDERIIAAQLRSSHTSA"
     gene            complement(<259858..>260598)
                     /locus_tag="MRET_0997"
                     /note="MRES_03965"
                     /db_xref="GeneID:38737763"
     mRNA            complement(<259858..>260598)
                     /locus_tag="MRET_0997"
                     /product="cyclin"
                     /transcript_id="XM_027627624.1"
                     /db_xref="GeneID:38737763"
     CDS             complement(259858..260598)
                     /locus_tag="MRET_0997"
                     /codon_start=1
                     /product="cyclin"
                     /protein_id="XP_027483911.1"
                     /db_xref="GeneID:38737763"
                     /translation="MLNPLASDEQVRCTPSRRDGVSVEAEDAICAHACQRIQQAGVIL
                     RLPQAAMATAQVLFRRFWFVASIQRFDVRIVSEGALLLACKLVEVPHSFREMHLVFDY
                     LHGRRADDARDAVLTAEMQVLKRLGFHVHVELPYALMINYLQTMGILHATVASKQAPI
                     RVQCVQVAWNYLSDALQTPVYCLFPVHTIACASIYLLTLENAWYEALALPMEPRPWWE
                     LFDTTRPELRAVGSHVMHLYATSEAVPQ"
     gene            <260672..>261337
                     /locus_tag="MRET_0998"
                     /note="MRES_03970"
                     /db_xref="GeneID:38737764"
     mRNA            <260672..>261337
                     /locus_tag="MRET_0998"
                     /product="charged multivesicular body protein 3"
                     /transcript_id="XM_027627625.1"
                     /db_xref="GeneID:38737764"
     CDS             260672..261337
                     /locus_tag="MRET_0998"
                     /codon_start=1
                     /product="charged multivesicular body protein 3"
                     /protein_id="XP_027483920.1"
                     /db_xref="GeneID:38737764"
                     /translation="MLASLSRLVYGPTKEERVQEVQRRLRQEQRALDREIRQMDQAMS
                     RVKQDIKRLARKGDDRNAIVLAKEVVRTTKHRTRLVTSKAQLNSISLQLQQQLSMYKV
                     TGHLQRSTEIMKLSNALIRIPQMTQSMREMSQELTKAGILEEMMQDTLESSVLADDDP
                     IELEAEADAEVHQVLYELTDGKLGEAGTTAHLPQPAVAETASREQDDLDQIQAALHGL
                     LHG"
     gene            complement(<261411..>261836)
                     /locus_tag="MRET_0999"
                     /note="MRES_03975"
                     /db_xref="GeneID:38737765"
     mRNA            complement(<261411..>261836)
                     /locus_tag="MRET_0999"
                     /product="histone H2B"
                     /transcript_id="XM_027627626.1"
                     /db_xref="GeneID:38737765"
     CDS             complement(261411..261836)
                     /locus_tag="MRET_0999"
                     /codon_start=1
                     /product="histone H2B"
                     /protein_id="XP_027483919.1"
                     /db_xref="GeneID:38737765"
                     /translation="MAPKPAEKKPPSTAGKAPASAGKAPSEGAKKTSKAPTKSAEKRK
                     AGSKIRKETYSTYIYRVLKQVHPDTGISNKAMAILNSFVQDIFERIASEASKLASYNK
                     KSTISSREIQTSVRLILPGELSKHAIAEATRSVTKFSST"
     gene            <262365..>262775
                     /locus_tag="MRET_1000"
                     /note="MRES_03980"
                     /db_xref="GeneID:38737766"
     mRNA            <262365..>262775
                     /locus_tag="MRET_1000"
                     /product="histone H2A"
                     /transcript_id="XM_027627627.1"
                     /db_xref="GeneID:38737766"
     CDS             262365..262775
                     /locus_tag="MRET_1000"
                     /codon_start=1
                     /product="histone H2A"
                     /protein_id="XP_027483795.1"
                     /db_xref="GeneID:38737766"
                     /translation="MSGGKSGGKAGDASSAKTQSRSAKAGLQFPVGRIHRLLRKGNYA
                     QRIGAGAPVYLAAVLEYLTAEILELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLG
                     GVTISQGGVLPFIQSELLPAKSGKSKKAMGSQEI"
     gene            <262886..>264091
                     /locus_tag="MRET_1001"
                     /note="MRES_03985"
                     /db_xref="GeneID:38737767"
     mRNA            <262886..>264091
                     /locus_tag="MRET_1001"
                     /product="lysine-specific demethylase 8"
                     /transcript_id="XM_027627628.1"
                     /db_xref="GeneID:38737767"
     CDS             262886..264091
                     /locus_tag="MRET_1001"
                     /codon_start=1
                     /product="lysine-specific demethylase 8"
                     /protein_id="XP_027483796.1"
                     /db_xref="GeneID:38737767"
                     /translation="MDDHVLHVIASQEIWHPLVYTIQRCARQVQERGDLSYVVRTCAD
                     VIRVQCEQRFLVYHYADVPVAWRALHTDAILLSGVATLAMQEPTEVEARIRDLDVALI
                     VSGAPDREADVHMLLRALQAYMPRDDTVHPRLVPDHIPLTQTNAARTVDEYAEAPSLR
                     AFLDRCPHPRCPYGAPFVVRGFARDWPAMSRWRDPSDLCRRAGPGRVVPVEKGLSYTD
                     EAWGQGIVPWSDFLARIGWSSSACEPLYLAQHTLHTQFPWLAHDIILPDYVYACPPHP
                     GYVAYHEGMDPIQSVWIGPRGTDSPAHTDPYYNCYVQVVGHKHVWLAPPPLTLPAMSP
                     DVAFGSMLQNTTQLSVWEAAQPPAFVQEVVPHAQHTELHPGDMLFLPPMWWHAMKSTS
                     QSFSVSFWF"
     gene            complement(<264098..>265247)
                     /locus_tag="MRET_1002"
                     /note="MRES_03990"
                     /db_xref="GeneID:38737768"
     mRNA            complement(join(<264098..265120,265149..>265247))
                     /locus_tag="MRET_1002"
                     /product="isocitrate dehydrogenase (NAD+) IDH1"
                     /transcript_id="XM_027627629.1"
                     /db_xref="GeneID:38737768"
     CDS             complement(join(264098..265120,265149..265247))
                     /locus_tag="MRET_1002"
                     /codon_start=1
                     /product="isocitrate dehydrogenase (NAD+) IDH1"
                     /protein_id="XP_027483793.1"
                     /db_xref="GeneID:38737768"
                     /translation="MSVLSIVPRAVRTSSQMTRPMSTLMAQTPRLTKGPTKYGGVYTA
                     TLIPGDGVGKEITDSVKEIFDRLNVPIEWEQFDLSGEMQGSDSEFQQAMDSLRRTKVG
                     LKGTLVTPSGAGSHNSWNVAMRQELDIFASMVFCRSLEGLKTRHSNIDFTIIRENTEG
                     EYSGLEHSPAPGIVESLKVMTRHKAERIARFAFDFALKNDRKQVTCVHKANIMKLGDG
                     LFLNTFRRIAEEYKSSGIKANDMIVDNTSMQLVGRPNQFDVVVTPNLYGNIVSNIGAA
                     LVGGPGIVPGANIGREYALYEPGCRHAAMDIKGSNKANPTAMILSATMMLRHLGLDYH
                     ANQIAASVYRVIAAGKVRTPDMGGSSTTQQFTQAVLDNL"
     gene            <265455..>266600
                     /locus_tag="MRET_1003"
                     /note="MRES_03995"
                     /db_xref="GeneID:38737769"
     mRNA            <265455..>266600
                     /locus_tag="MRET_1003"
                     /product="isocitrate dehydrogenase (NAD+) IDH2"
                     /transcript_id="XM_027627630.1"
                     /db_xref="GeneID:38737769"
     CDS             265455..266600
                     /locus_tag="MRET_1003"
                     /codon_start=1
                     /product="isocitrate dehydrogenase (NAD+) IDH2"
                     /protein_id="XP_027483794.1"
                     /db_xref="GeneID:38737769"
                     /translation="MFFAAAAASTRVARPVSAARPLASMLSRGLATQTDAPTSAYNKQ
                     KDADGKYTVTLFPGDGIGPEVSGAVREIYRAANVPIKWEEADVTPSINHEGKQVIPEE
                     TVQSVRRNTVALKGPLATPVGKGHVSLNLTLRRTFNLFANVRPCVSVKGCETPYENVN
                     TVLIRENTEGEYSGIEHEVVDGVVQSIKLITYDASERVARYAFHHARQNNRSRVTAVH
                     KAPIMKMTDGMFLNACRNVAKEYQDIEYDEDLLDRACLRIVRDPEPFADTVMVMPNLY
                     GDILSDMCAGLIGGLGLTPSGNIGRDASIFEAVHGSAPDIAGQDKANPTALLLSSIMM
                     LRHMSLFEHADKIERAIFETIAAGERTGDLGGKLGTRAFTESIISRL"
     gene            complement(<266641..>267634)
                     /locus_tag="MRET_1004"
                     /note="MRES_04000"
                     /db_xref="GeneID:38737770"
     mRNA            complement(join(<266641..267518,267544..267595,
                     267632..>267634))
                     /locus_tag="MRET_1004"
                     /product="component of the cleavage and polyadenylation
                     factor I"
                     /transcript_id="XM_027627631.1"
                     /db_xref="GeneID:38737770"
     CDS             complement(join(266641..267518,267544..267595,
                     267632..267634))
                     /locus_tag="MRET_1004"
                     /codon_start=1
                     /product="component of the cleavage and polyadenylation
                     factor I"
                     /protein_id="XP_027483799.1"
                     /db_xref="GeneID:38737770"
                     /translation="MSDMDPLSSPVASGREELAEPMDAPAEREWQNAENDDFDRRDAR
                     ESDGARDDRRRQRDAYDDRYPGPPPSRSRDPPPSRPSPAPSHIIGVFGLSIRTTERDL
                     EDEFARVGDVDKVVIVYDARTGRSRGFGFITMRDVETASRAIEQMNGVELHGRKIRVD
                     YSSTSRAHDPTPGEYRGNPRPVDDRHQRYRGRGREGPERPASWRDRDSYRDRDSWRDR
                     GSWRERDAWRERDSWRERDSWRSSRRYDEEPPRRWSSRRDDRRGPESDDWRRRSSPPR
                     YRDYDDDASARRQRDSAQDERAHRYADEPPRRDE"
     gene            <267896..>268474
                     /locus_tag="MRET_1005"
                     /note="MRES_04005"
                     /db_xref="GeneID:38737771"
     mRNA            <267896..>268474
                     /locus_tag="MRET_1005"
                     /product="large subunit ribosomal protein L18e"
                     /transcript_id="XM_027627632.1"
                     /db_xref="GeneID:38737771"
     CDS             267896..268474
                     /locus_tag="MRET_1005"
                     /codon_start=1
                     /product="large subunit ribosomal protein L18e"
                     /protein_id="XP_027483800.1"
                     /db_xref="GeneID:38737771"
                     /translation="MGVDIERHHVKKGHRQAPKSEDPYLLLLVKLYRFLARRTDSRFN
                     KVVLRRLFMSKINRPPVSVSRVIYLSRNQGGVAKEASQTPKTVVVVGTITDDNRVLEL
                     PKLSIAALRFTNTARARIEAAGGECLTLDQLAMRAPTGSNTILLRGPKNAREAVRHFG
                     MGPHQHKKPYVRSKGPKFEKARGRRKSRAFHV"
     gene            complement(<268603..>271125)
                     /locus_tag="MRET_1006"
                     /note="MRES_04010"
                     /db_xref="GeneID:38737772"
     mRNA            complement(<268603..>271125)
                     /locus_tag="MRET_1006"
                     /product="LisH domain protein"
                     /transcript_id="XM_027627633.1"
                     /db_xref="GeneID:38737772"
     CDS             complement(268603..271125)
                     /locus_tag="MRET_1006"
                     /codon_start=1
                     /product="LisH domain protein"
                     /protein_id="XP_027483797.1"
                     /db_xref="GeneID:38737772"
                     /translation="MVDEKHDTATSQDESTVARMADTISSRADLPDPTTSEVPAPAAE
                     SGPSASSGTGISVSHVDNQKESKDPSLEETRKRARSPTHEAEPKRPRNEAEADEAPKA
                     TKPLPTHYTGLSGSVLAAQMYEQISQNENSHKLDLYVWEYLYRRKLYKTAATLIEETD
                     LPENPEVPVRLPGGLLYEYWSVFWELFSSRVGYNTRQSNVFSELLEARKRQSLQDAMK
                     AKPTPPAETAHPTLGAEEATDPARLVQESPVPMFLPQQQAQPQQQPAPRPVIPNQPPG
                     PSSGMSFPVQPSVLGQPLPLSNASQQPAQGRAPTFPSSNVAAPMRHGQTNMSMQPMFK
                     LAQNSSPVATPQSTNQPQPPTPSQQQPHQAVQMQQAMARAHMSQSLNVAALSQQQQQQ
                     LLMAAALRQGISLDALKSMTPQSRMALIQSVAQNMLGQNAAAQRTDPQMQARLFMQQQ
                     QNLLYMQQMQNAGKNAPPGGANAQQALFQRPQTAGTPMQGPKNGEMPNSAGAMDTSGM
                     QGALAAQQAIAARSVMPFGRNEMQNGTPPPFASSNGIGPSSEQLSPQQRQMLVMQYQS
                     LQNAIKNEWMKAQSMSVPSMAQQCLAMAQQMQLKAQSIASLLQANPASEHPPQHAAQG
                     GLNTAAMLSQSSPLAQKMNLPQNAATPRPEMDMGMPFFPQAQQQAVVNGLMARGNNAS
                     TPSTPVTSQTAPQTTANKGRMNRPAPPTGHDALPPSPWQPATPHMTDSPSAAKKDKPP
                     RRHARSTSGKTPVKPEEAPPTTKEDEVPRQSFDATGLGMPSVMDDATFGAITSSTGAN
                     APTDDFAAMFGVSDIFDFDFDGGDAGSFAASAAPSDKKGHGE"
     gene            <271734..>273053
                     /locus_tag="MRET_1007"
                     /note="MRES_04015"
                     /db_xref="GeneID:38737773"
     mRNA            <271734..>273053
                     /locus_tag="MRET_1007"
                     /product="AP-1 complex subunit mu"
                     /transcript_id="XM_027627634.1"
                     /db_xref="GeneID:38737773"
     CDS             271734..273053
                     /locus_tag="MRET_1007"
                     /codon_start=1
                     /product="AP-1 complex subunit mu"
                     /protein_id="XP_027483798.1"
                     /db_xref="GeneID:38737773"
                     /translation="MASIVAILDLKGKPLIQRSYRDDVDPSALERFLPLLTEIEEERG
                     AGAIQPCLSAQGVNYMHVRHTNLYLLALSRRNTNAAEILLFLHKLASVLEEYFKQLEE
                     ESIRDNFVILYELLDEMMDFGYPQTTESKILQEYITQESHKLEVQVRPPMAVTNAVSW
                     RSEGIRYRKNEVFLDVIESVNLLVNANGHVVRSEIVGTIKMKCYLSGMPELRLGLNDK
                     VMFETMGRTTRGKSIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTQIK
                     PLIWAEAVVERHEGSRIEFMVKVKAQFKRRSTANNVEILINVPDDADSPKFRAAIGSV
                     SYAPELSAMVWKIKQLGGGKEYLMRAHFGLPSVQDEESMVRRTPINVKFEIPYFTVSG
                     IQVRYLKIVEKSGYQALPWVRYITQNGEYDLRTQSEKNASHLSHFAT"
     gene            <273465..>275735
                     /locus_tag="MRET_1008"
                     /note="MRES_04020"
                     /db_xref="GeneID:38737774"
     mRNA            <273465..>275735
                     /locus_tag="MRET_1008"
                     /product="RhoGEF domain protein"
                     /transcript_id="XM_027627635.1"
                     /db_xref="GeneID:38737774"
     CDS             273465..275735
                     /locus_tag="MRET_1008"
                     /codon_start=1
                     /product="RhoGEF domain protein"
                     /protein_id="XP_027484028.1"
                     /db_xref="GeneID:38737774"
                     /translation="MAPLRGDSAPLAPSAPSEGKSVAPIPTLSHVSMLHSFDEHRIPA
                     SAVESPSPWLLDMTVPRVSSPELETDISRTSSTSTKHSLSDSMTSNQSVHTAHSGDDV
                     SEPPPVPSKTDSRPDHPESGSQMRTHVKRLHALLELAETEANYVKDLDVLIHVFFKLL
                     PTVPYLAEDASRLRTVVRNGPQLLELHRDLDARLQRIIQMQRLNDASLSELVRAQSPG
                     HQEAIALFAEAFIDFAPRFQIYCEFCSKHKEALELIDAVEHRPEWETYQARASDAVGS
                     RDAASRKRLQFRDFFIKPIQRVCLYPILMQTIQRYTAPDAAVRLGEAMACMRRITSDV
                     NAASAERHARLLSDMIVSRMEPSLELSPSFLPSLGNCRMTGNLGVLYHHSTWAPLTWP
                     LTTKYYGCVLYADFVMMFKVRKTHTYEPRYWFPLAEAKLKRSDERSVRLPHLFRISVR
                     GHHFELMASTAKEHNLWLDAFAKAIADGPSPMRRVHGMDVPFPCNLADKGPAAPTSSD
                     QDDDPLARYLDDVGDAAPSLRGQVLVRHKSPPRRAAMDRGMVFSDACISARSSIDGHD
                     WAARSHSARVGLHRLSGSETVSLRISPSSATDAPLPSPTTRLMHANSTESLPGPRRMD
                     ASQRRLSVSSSPGGPLAPASPAGLLPRSQSMIGRTLQGWLTPSTTQLPIKAEELSRAL
                     LEACTPEPAAPMRLHRGRCSSMDMRAEAAPTRTIMRRRSSTSMSRRPDTSAPPSPHRR
                     LAQRFLQRHRLSTMDV"
     gene            complement(<275719..>276585)
                     /locus_tag="MRET_1009"
                     /db_xref="GeneID:38737775"
     mRNA            complement(<275719..>276585)
                     /locus_tag="MRET_1009"
                     /product="BadF/BadG/BcrA/BcrD ATPase family"
                     /transcript_id="XM_027627636.1"
                     /db_xref="GeneID:38737775"
     CDS             complement(275719..276585)
                     /locus_tag="MRET_1009"
                     /codon_start=1
                     /product="BadF/BadG/BcrA/BcrD ATPase family"
                     /protein_id="XP_027484029.1"
                     /db_xref="GeneID:38737775"
                     /translation="MTGVVAVVDAGGTSTRAAIADARGRIVARSCVGAGSFSVLSLRA
                     WTRRMCEALEACANEAPITRAWIGSAGIDADESARIATEALRCAMPHVHEWTVTNDAA
                     LLCASVPRNRPCVVCIAGTGSVVLAYDAQRTRTKRVGGLGWLLGDEGSAVGVGRAALR
                     HVLSEPSPLLDVILAATGAASADDLLSYVYTDDSRTRIAALAQVVTRAAHDGHAVAQH
                     IVELEAQAMAACIDRAAPPIPAACRLGGALFGDAGYLARVLHHIQTPFIDTQVVHDIC
                     GTAAQSKATRPW"
     gene            complement(<276596..>277717)
                     /locus_tag="MRET_1010"
                     /note="MRES_04025"
                     /db_xref="GeneID:38737776"
     mRNA            complement(<276596..>277717)
                     /locus_tag="MRET_1010"
                     /product="tRNA (cytosine34-C5)-methyltransferase"
                     /transcript_id="XM_027627637.1"
                     /db_xref="GeneID:38737776"
     CDS             complement(276596..277717)
                     /locus_tag="MRET_1010"
                     /codon_start=1
                     /product="tRNA (cytosine34-C5)-methyltransferase"
                     /protein_id="XP_027483731.1"
                     /db_xref="GeneID:38737776"
                     /translation="MAISKAQRKQQQSAADAFDAFFVHEYGAERWHRLRERLLQPTEY
                     AALINAYVPSIEVDRAILSDEAAAAGQYTLLRLPPPPDTTPCDTPTRLLCLLRTDPHG
                     SRPFPPPHPAADARHRLHTHWNLDAASVLAAQCLDIQPGQAVLDMCAAPGGKSITLAQ
                     RLWPALYVDHPSGEQQHRQRPSILHANEVDVARHRRLHANLTSYLPPTLFEQGLVDVL
                     RIDATSPRAVHLFPLGEEGYDRILIDAPCSSERHILHAFMRAQQSGSIAPEMLAWKPT
                     MTRNLSKTQSALLRTAWSALRPGGRLVYATCSLSQQENDQVVRAFVASQPARVVRSDH
                     LWRFCERTEYGYLALPDHVARGASDPSPWGPLYFCILAK"
     gene            <277753..>278961
                     /locus_tag="MRET_1011"
                     /note="MRES_04030"
                     /db_xref="GeneID:38737777"
     mRNA            <277753..>278961
                     /locus_tag="MRET_1011"
                     /product="2-dehydropantoate 2-reductase"
                     /transcript_id="XM_027627638.1"
                     /db_xref="GeneID:38737777"
     CDS             277753..278961
                     /locus_tag="MRET_1011"
                     /codon_start=1
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="XP_027483730.1"
                     /db_xref="GeneID:38737777"
                     /translation="MPDEVLLLGLGAVGTLYAYILQSGGANVTAVCRSNYQVVRDHGI
                     DIVSDKFGEHPKWRPTRVIQRPEDVDAVGVTFDYIVCCSKHVPDLQPVSDVLRPYLTQ
                     NFAKKPQRLPVILLLQNGIDIEHDSYEAFVHTPEPLAACVMSANSWVPVMLLNGGARI
                     EHGSLERLSMGVFPPPLRAPLPDSTRETVHHLLTLMLRGGSDAHLTNDITSERWRKVL
                     WNMSWGGVSLLARRPVFEMLQVDMLPYTVGSVRGIMLEILTVARASGMGEDRLPASVI
                     DHTLHATLLNTPAKLRMLRSPDIICDKPSAPNFRRDFKPSILIDLELQRPMELEPIFG
                     NIIRRARQVGVDTPRLDLIVTSIKPSQLEYVRRSKGIDHETLVQQEGVHDLLPSLNAT
                     GSAPTGPVTL"
     gene            <279007..>279312
                     /locus_tag="MRET_1012"
                     /note="MRES_04035"
                     /db_xref="GeneID:38737778"
     mRNA            join(<279007..279069,279100..279159,279184..>279312)
                     /locus_tag="MRET_1012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627639.1"
                     /db_xref="GeneID:38737778"
     CDS             join(279007..279069,279100..279159,279184..279312)
                     /locus_tag="MRET_1012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483747.1"
                     /db_xref="GeneID:38737778"
                     /translation="MRRPFIDYVHRATVLSILGLAGWGLWLTGAVYVSRIGNTDRYPY
                     GGRNRDTMTEVVGRIVERWQEVSEKKAQEKIAAERSSTS"
     gene            complement(<279324..>279899)
                     /locus_tag="MRET_1013"
                     /db_xref="GeneID:38737779"
     mRNA            complement(<279324..>279899)
                     /locus_tag="MRET_1013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627640.1"
                     /db_xref="GeneID:38737779"
     CDS             complement(279324..279899)
                     /locus_tag="MRET_1013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483746.1"
                     /db_xref="GeneID:38737779"
                     /translation="MLERAQSLLMRERYRRQRSAPSSYKHEDSQRSTHPKSLRHFIGV
                     EQENVPPGVLPRRSASVKQPVQHRVPFAAQENGVRLMRSQSARVPPGPVRRTAQAADV
                     IALDRPLPPLPTRRHRLDQHPPLPAPKKQRPVFSKKAPFSSASTYPSLQLHEVNAERR
                     PELRHTDEIYRAETLRSQRATVYIVTGTYGT"
     gene            <280003..>281970
                     /locus_tag="MRET_1014"
                     /note="MRES_04040"
                     /db_xref="GeneID:38737780"
     mRNA            <280003..>281970
                     /locus_tag="MRET_1014"
                     /product="hypothetical protein"
                     /transcript_id="XM_027627641.1"
                     /db_xref="GeneID:38737780"
     CDS             280003..281970
                     /locus_tag="MRET_1014"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027483733.1"
                     /db_xref="GeneID:38737780"
                     /translation="MATGVTVTLVRYAANTATSLGRAFSHMSFMAISCTPEADAVLTA
                     DKIAEQTRGDVRPFILPAFQDEDGLDETRIMKMVQSLIMPYLHSPPTYVAVVSNERII
                     DTVLKGLLCMDGASVHHPEPSSVKRSMSIYTKPLLPGAYHQVHVSAHDEQIHARICTL
                     SESAHLQHQTPSMISIDKPSSTLPSPVSISFPSEMSAEAAVSPGRDPLLLSRPDPHRS
                     TPLSISPLRLRPVDTFMHSREGTPRILSQTAKNAQSYDMLTMMRSIEKWDPMVDPLSS
                     TPSDMLDSATTAGFSPLGLGARFSDASAPRGALSVRSMPASAVPLRSSNTPTPHATPQ
                     GHSGSASSVTNTSTLSGNVSAFAQSLFNYLPSPVAAIGGLNSGPTSAAPDSQSLLQLW
                     QRICICILPIFAQEPHNLLIEPLHDSVDLYVRLVHERDQMHARATLLSHFEKLVSTGL
                     HGVTFQLQQNDGSRLLYDFLRAWQHYYGTVMPFLHACFSPLESRLWSMDLLLARWLHR
                     HDPLTHIDPSHAPARIDLRHALLILFRDLIVLPICDWLYMTTVQMQYTIHTDLSNALN
                     TSVRGRLMQLVNIMNSLGTDDAAQQRIERLRRGLLSHGLSLHSHAPPTSTSTLDVMSP
                     SNASTQPSPISPIPSCPIFSTPNSPTIRSSH"
     gene            complement(<281967..>282257)
                     /locus_tag="MRET_1015"
                     /db_xref="GeneID:38737781"
     mRNA            complement(join(<281967..282193,282221..>282257))
                     /locus_tag="MRET_1015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627642.1"
                     /db_xref="GeneID:38737781"
     CDS             complement(join(281967..282193,282221..282257))
                     /locus_tag="MRET_1015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483732.1"
                     /db_xref="GeneID:38737781"
                     /translation="MVVHKPVVGTGLASCCTVVSAAGVIVLSIFGWGFSHNWETFMGS
                     TDDPADGSAVGMTCYGAAFVYLLFILFCTCQMGVNRRYQRIQI"
     gene            complement(<282380..>282953)
                     /locus_tag="MRET_1016"
                     /note="MRES_04045"
                     /db_xref="GeneID:38737782"
     mRNA            complement(join(<282380..282464,282489..282721,
                     282747..>282953))
                     /locus_tag="MRET_1016"
                     /product="peptide-methionine (S)-S-oxide reductase"
                     /transcript_id="XM_027627643.1"
                     /db_xref="GeneID:38737782"
     CDS             complement(join(282380..282464,282489..282721,
                     282747..282953))
                     /locus_tag="MRET_1016"
                     /codon_start=1
                     /product="peptide-methionine (S)-S-oxide reductase"
                     /protein_id="XP_027483735.1"
                     /db_xref="GeneID:38737782"
                     /translation="MSTATSEVATFANGCFWGTEHMFRKHYGGKGLIDAKVGFIGGTK
                     ADPTYMEVCSGQTGHAEASQLTFEPSKVSYEELVEFFYRTHDPTQQDGQGPDIGSQYR
                     SALFPHTPEQEAIARKVTEEVQKKHFDPHGTRIVTTIHRVPASDFFVAEQYHQEYLLN
                     NPSGYHCPTHRLWW"
     gene            <283074..>283480
                     /locus_tag="MRET_1017"
                     /db_xref="GeneID:38737783"
     mRNA            join(<283074..283093,283125..283252,283278..>283480)
                     /locus_tag="MRET_1017"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627644.1"
                     /db_xref="GeneID:38737783"
     CDS             join(283074..283093,283125..283252,283278..283480)
                     /locus_tag="MRET_1017"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483734.1"
                     /db_xref="GeneID:38737783"
                     /translation="METQQAVSYGAIACAVLAIVTWVFWPRPASKKSSDYDPKTGLGR
                     GAPGFQTNVKRVALPAELVARIRAGEQVSAEEITAAQSHVSKGLPSAPVENDWLGPTT
                     TSRSKKTTRRKNKK"
     gene            complement(<283483..>284313)
                     /locus_tag="MRET_1018"
                     /db_xref="GeneID:38737784"
     mRNA            complement(<283483..>284313)
                     /locus_tag="MRET_1018"
                     /product="ubiquitin-conjugating enzyme E2 J1"
                     /transcript_id="XM_027627645.1"
                     /db_xref="GeneID:38737784"
     CDS             complement(283483..284313)
                     /locus_tag="MRET_1018"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 J1"
                     /protein_id="XP_027483292.1"
                     /db_xref="GeneID:38737784"
                     /translation="MVTGMSDAMKSRSSAIKRIMSEVRELQNDDTPDFSAAPTEDNLF
                     EWHFTLRGPRDTVFEKGLYHGKLTLPSEYPFKAPHVIFLTPNGRWSVDTKVCVTFTGF
                     HEESWQPAWGIRTALLGIQALMTSKEDEAGYGAASMNDEGRKLLAEKSWTWTCPLCQK
                     SNAELLPGEPSRAPNTAPPTALPASVVSERIEEPATSPSHSIPPVREEPFSKESMPAS
                     NPQASTPSIAPSAMEEATPSMAELLHARAESYRRTISMIDSLMGLICVMLFLLVLKNM
                     "
     gene            <284730..>285953
                     /locus_tag="MRET_1019"
                     /db_xref="GeneID:38737785"
     mRNA            <284730..>285953
                     /locus_tag="MRET_1019"
                     /product="ER membrane protein"
                     /transcript_id="XM_027627646.1"
                     /db_xref="GeneID:38737785"
     CDS             284730..285953
                     /locus_tag="MRET_1019"
                     /codon_start=1
                     /product="ER membrane protein"
                     /protein_id="XP_027483729.1"
                     /db_xref="GeneID:38737785"
                     /translation="MRRFAPWAVVYILVCGVLWVRSQYTATYVPGNTTLPETSEEGQA
                     GTNRCGEGSNDLSMCQNLYLNSATDFCLWGPQGPEPVGIGNSEREVVSYCTKAGRGTR
                     LIPPGTLRSVHFVRTPHYVQVSGTGIFENIHISKEGGGGELDPHGEDGLGNPIGGLVF
                     TNAFGKLAQAHEWTSFIDENQFCLRVCKDGDKAADYCKHIYDEMGCEFNMPTAPDQLG
                     VFESCEGPDADIVGVYTNHGVVSTFYQDQTKHGQKLPPPKSPQSLSNCSAFPSGLLQG
                     SVKHPYAKAAITGASRKSMKSQSVSTSSSSSTTSSMLTSTSSSTDSSSQNLYPPISSN
                     FSNMSPTSSISSSSPSATSSFTSETTSTLSSESNSEQVSPFGPVDDDAGVGIHLTASI
                     PTFTVLLLSLIVSIL"
     gene            <286124..>287110
                     /locus_tag="MRET_1020"
                     /note="MRES_04050"
                     /db_xref="GeneID:38737786"
     mRNA            <286124..>287110
                     /locus_tag="MRET_1020"
                     /product="fatty acid hydroxylase"
                     /transcript_id="XM_027627647.1"
                     /db_xref="GeneID:38737786"
     CDS             286124..287110
                     /locus_tag="MRET_1020"
                     /codon_start=1
                     /product="fatty acid hydroxylase"
                     /protein_id="XP_027483903.1"
                     /db_xref="GeneID:38737786"
                     /translation="MHPRPHADDWVRDKNLPIVHKVIKVLNLLPLASEDVRRTELTDP
                     VPWFSELNQALFLLPFAVLPYAIRTLYYNYVSHELPGRCAMWGCLFVYTMTFGVYWIH
                     FLRHLSKKYGYFHGARGRDTIPFSEVNKIAKEILGAVLLRSALVVYSSYDPHAAPSLS
                     IWTPLQLFFFTVVDDFYYYWLHRVCHETESAWKLHRLHHTTKAPTLLLLGYADDIQEC
                     FDLFLVPLATWLTFPIPFDAFVIWMLIHVSIQVVGHSGIRLHHGTLLTGPYLTPFGAE
                     IVTEDHDLHHRHGWRESYNYGKQSRLWDGLFGTKGERIEGHSGNIDRTRFIY"
     gene            complement(<287265..>288653)
                     /locus_tag="MRET_1021"
                     /note="MRES_04055"
                     /db_xref="GeneID:38737787"
     mRNA            complement(<287265..>288653)
                     /locus_tag="MRET_1021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627648.1"
                     /db_xref="GeneID:38737787"
     CDS             complement(287265..288653)
                     /locus_tag="MRET_1021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483904.1"
                     /db_xref="GeneID:38737787"
                     /translation="MSRWVNVADMETLYPHIWEALTHPYIRQFLKSFFLVQGVYQLFA
                     CTLVAGKSDEQQRKRSWIITTFAAFCSSMMSIPFVFDLFWCHLDWRRVTEHRETIADP
                     LTLFFMAYLSCDLVTGVFCYRKFVNLSSGWIHHIVYFLFCMYWIQKGWSHCFAINLCM
                     ELPTWIMGIGTLKPRFRSYWAFTTSFLSTRILLHLIIIYSLSVPSGNHVNKEVPSKMP
                     LLFAVLAFPMHVIWAYKSVRGLRRRMKKLAEEAKAREKARLAAIDEATRLLDSADELE
                     LGHDDTRLAGAPSTRVTHRSMHAKARAMQLVSNAAYVLWHSAPEAWRQAYREELDFNK
                     KQGIDPKDLRRSALVRRALARHLLHGNKRGHNVPLVKEDDEDDDLEDWMSITSLDSFD
                     HDKPRKGLQVSIGKGIRINMPRELDPILHGQKYVVSEYPVDREASGSRRQRIVGQMRR
                     RFEVARRDMVVF"
     gene            <288753..>289934
                     /locus_tag="MRET_1022"
                     /note="MRES_04060"
                     /db_xref="GeneID:38737788"
     mRNA            join(<288753..288921,288946..>289934)
                     /locus_tag="MRET_1022"
                     /product="adenylyltransferase and sulfurtransferase"
                     /transcript_id="XM_027627649.1"
                     /db_xref="GeneID:38737788"
     CDS             join(288753..288921,288946..289934)
                     /locus_tag="MRET_1022"
                     /codon_start=1
                     /product="adenylyltransferase and sulfurtransferase"
                     /protein_id="XP_027483905.1"
                     /db_xref="GeneID:38737788"
                     /translation="MSSALGPDDLARYSRQLILPGFGADAQRALKKARVLVVGAGGLG
                     CPAVQYLAAAGVGHITIVDNDCVERSNLARQVLHTDARIGMNKAASIAQAVSLLTPHT
                     HVDAVQAPFTPANAYELCQAHDVVLDCTDRVMMRYLVSDAGVLAGIPIVSGAAQGYDG
                     QLVVLHRDLGEGRRGPCYRCLFPQSPRPEHTQSCDDGGVLGCVTGLIGTWQALETIQL
                     LTGLGDRTPSMLFLSPLSLPSVRCVRVRGSQTQCRACGRAPDRITSLEQEDYETFCGL
                     HHRERHVPSVDVDDVHRPDVLVVDVRPLHEYGITALPHSLHMAWDTIRRDVQGARTAI
                     AQAAQGRDVLVVCRRGNDSRAAVHLLDMPRCQNVRGGLRAYADKHPDFPMY"
     gene            complement(<289931..>293080)
                     /locus_tag="MRET_1023"
                     /note="MRES_04065"
                     /db_xref="GeneID:38737789"
     mRNA            complement(<289931..>293080)
                     /locus_tag="MRET_1023"
                     /product="Importin-11"
                     /transcript_id="XM_027627650.1"
                     /db_xref="GeneID:38737789"
     CDS             complement(289931..293080)
                     /locus_tag="MRET_1023"
                     /codon_start=1
                     /product="Importin-11"
                     /protein_id="XP_027483572.1"
                     /db_xref="GeneID:38737789"
                     /translation="MSFTAEALQQVLIAAVQPADPSVLQRVDEQLAAWETESSFWEAL
                     VHAALAREAGYPSALRQLAMIRFKNGITKYWRPRIVNRKSVVIEHDAKERIRQRLLDV
                     LTEPDRVVATQGALSVARIMRHDYPDEWPTIVPALQAAFESSSTALHEAAVQGRLAES
                     TTDTVVLLRAADTLRYCVKELESVRIMAGRLRMASLADYLIPVLQPVMERVFAIAFDT
                     NDTAAWAQTPGTAERVRASHLLLKSLHRLSLHEKGLISSKVQQIESNVAYTFFASTPR
                     QLACVAQRRTEFVGTGHELLPVLTKHMVAYAKLHYAFVSNFRSHIAMWPSWTEVVEWY
                     WGVLCDAAKDGASVALHHDDDDDMVMYPYRWIVLSLRLLHATLDRWQRNRPAGTMFAG
                     ASGAQFELQMVDVLLKTYLRLTPTDLERWLAHPEQFAIEEDQGDDELDIRPAATELMR
                     ALSRHSFRSGKGAAPEVPNVSDYMWMQFEASAQWPLTLEGVLAREVVYHATGLCRDQL
                     NPVWWYDSDANPDVRMSGAIRDRLIPEAAMDADAIWIVVRRRIVWMVFEWSEYVYEPT
                     RPMTYALLVQLLRQAPGYTDATVQLLAARSLAAIADTITFERHTFQPYLQDAVVALAH
                     LLQSGLEEPDSVRSITHALCVIMDRVDTDMVPYGPALADMVPKMWARDDPQMRLKPSL
                     LEFVSKLVEKYLPHIEAQAQMQALVARLLRDSFEPAARPLLGHDALLLWYHTLASSYA
                     LSAPLVELLSCAPELLAQPEYAPLMCRVWEETVLLAPEDVLHAFGMSVYGAMAPMVGH
                     PNSPVIMEPIFAIDMHVRALSTASLSAMADIMRATHLDEAIFASLCRESDMYHVLQRC
                     AILVSRMALTMPPPMFHDMVRATASWPDLCRRLISTSATLSHARSRKLVALGLAHMLR
                     HASAQDKGLLSAVPDMIGMWTEVVGEVVEDEAGSADRYERELSPTRALEIGEDGIPFL
                     DEFGLIEAAPTPSSARTDAVRSRDPSFNVPLRAYVADTLNAVLQNGSYKTQLQSLLAT
                     IDPLVLDTLQRGLSERPVA"
     gene            complement(<293118..>294716)
                     /locus_tag="MRET_1024"
                     /note="MRES_04070"
                     /db_xref="GeneID:38737790"
     mRNA            complement(<293118..>294716)
                     /locus_tag="MRET_1024"
                     /product="vacuolar carboxypeptidase"
                     /transcript_id="XM_027627651.1"
                     /db_xref="GeneID:38737790"
     CDS             complement(293118..294716)
                     /locus_tag="MRET_1024"
                     /codon_start=1
                     /product="vacuolar carboxypeptidase"
                     /protein_id="XP_027483906.1"
                     /db_xref="GeneID:38737790"
                     /translation="MARISILVALLAICACVSAQFAFLDSAMSRIVSATQEVFKALGE
                     SRVSMPRHDEMAAWMHAGIESMGGVLYQKLEHPSFPDYRLRIAMEDEEPTTPFCDPGV
                     QQIKGYLDIRDDAHLWFILFESRSDPSNDPLVLWLNGGPGCSSSTGMLFELGPCWVSD
                     QGESTTYNVHSWNTKANLLFLDQPLQVGYSYSDSGETVDNSKDSAKDVYAFLQLFFAR
                     FPKYADLPFTIAAESYGGHYAPHIGAEIHRQNKALEPEMTDRIKINLDSLMIGNGLTD
                     PAVQFPSVVEYSCSPSNKYHLFEPESDTCQKLEASSAMCSKLMEVCDKLDSRLACVPA
                     SLFCWGSLYGPAQQTGVNLYDVRRQCDHEKDGELCYPEMTHIETLLNKPTVKSQLGVP
                     DSIQFESCNMQVNGQFMLQGDSIQNSAKLLEPLLADGVRVLAYAGEADFMCNAIGIQE
                     WMLQFPNVYHEALNNATQTPLFARGPTGAKPRQAGYVIKAGEGAGNLAFAWIQRAGHM
                     VPHDQPGVSLAMLNRWLANEDLTQ"
     gene            <294826..>297942
                     /locus_tag="MRET_1025"
                     /note="MRES_04075"
                     /db_xref="GeneID:38737791"
     mRNA            <294826..>297942
                     /locus_tag="MRET_1025"
                     /product="SNF2 family helicase ATPase"
                     /transcript_id="XM_027627652.1"
                     /db_xref="GeneID:38737791"
     CDS             294826..297942
                     /locus_tag="MRET_1025"
                     /codon_start=1
                     /product="SNF2 family helicase ATPase"
                     /protein_id="XP_027483907.1"
                     /db_xref="GeneID:38737791"
                     /translation="MAYAAESDEPVKEEGFHAQTPIDLTLDDSDDVQLQVVTPSTKRP
                     RSVSPEDDDSWAMYTPRPKVENTMEWICLGMVQQDVLCMYGAPPELHWDRMDLLPPVD
                     PAWTHLGFWGQPGYRPVSIHESASSSGSSRANELCVSTLCAPRDGRGHPTIINEYGKL
                     SARASKSLHPLLQFHAIQCVSRAPLISSRRAPNFTHQIETLIFTRAGNKVKVEQALFQ
                     AGLVLETPSTYQASDYPNAPILDIPDTHAPSLTLDQPVVMPQATAHVVEESTQSHIDA
                     IYAALGDTDSLEETEAGPLVSTPLFPHQKQALSFLLERERERHFEELLEEGAPQHISL
                     WTVYRRKGAQIEQYRNIVTGTVRRKRPTICRGAILADDMGLGKTLTIISLIAYTHENA
                     CIFQQSALDQGDDDDEPLIIGDSRNRRTAEQARKEELRCKSRATLLVCPLTVVYNWLS
                     QIRQHWRSDQQPDVYVYHGPGRTSHPQVLADHDIVITTYSTLGNEFSNQTVWTAAAGR
                     TDDDVQANGPRLEAPNPCQRIEWYRVVLDEAHIVKEARTWQSKAVCNLSSACRICLTG
                     TPIQNRISDLYALLVFLRLDPFTDRAIWNRFCGDRDHIRLNSQSTGVRIDPSSLERLQ
                     AIMKFLTLRRMKSDTKPDGQPLLALPPKTTRIVTLHFDEAERAKYQRLHSEFREEFMG
                     YVDQGTVGLHYATILHEILILRMMCDHADLVKGSIEARRLDVEETEDLARAVKWFEAL
                     LVNAMASCALCGHEFEQGDADALRRPVVTKCQHIMCSVCFGQRAGQVLCPVCAQALHV
                     GTDTIQPHTDVVETMFDTPDDTCTGPFVPEEPSTWPASWSTKLRALISDLIPFSRCNA
                     ASQLYDPKAPVLDHVVENGTVSVGVSKHSAPIKSVVFSQWTRMLSKVQHALIHAGIGF
                     RQLDGSMSREARESAMAEFHDDPRVEVFLVSLRAGGFGLNLIAGCRAYLLDPYWNPAV
                     EQQGLDRIHRMGQQRAIIMTKYIMHQSIEEKLLVLQQRKLELANQVGRRRDRQEATRT
                     EDLQLLFS"
     gene            complement(<297943..>298620)
                     /locus_tag="MRET_1026"
                     /db_xref="GeneID:38737792"
     mRNA            complement(<297943..>298620)
                     /locus_tag="MRET_1026"
                     /product="alkylated DNA repair protein alkB 6"
                     /transcript_id="XM_027627653.1"
                     /db_xref="GeneID:38737792"
     CDS             complement(297943..298620)
                     /locus_tag="MRET_1026"
                     /codon_start=1
                     /product="alkylated DNA repair protein alkB 6"
                     /protein_id="XP_027483908.1"
                     /db_xref="GeneID:38737792"
                     /translation="MAHQLDLPDACDGGFTYIQDFVTEDEEAFLLAKIDAAPRWKALA
                     HRRLQMWGGECVGKTLVSKPLPPHVTQFPALITRLEQTGAFVASKHGQPNHCLVNEYL
                     PGQGIMPHTDGPAYFPVVATISLGASTLLDWYRTKPEGGYDPTPAFSILLEPRSLLIT
                     RGQAYTRYLHGIDARMHDSPEHVARVINAHVLAHPTRAAYSSVVARRRRVSLTFRDVE
                     RVQKGLG"
     gene            complement(<298640..>301387)
                     /locus_tag="MRET_1027"
                     /note="MRES_04080"
                     /db_xref="GeneID:38737793"
     mRNA            complement(<298640..>301387)
                     /locus_tag="MRET_1027"
                     /product="mitosis inhibitor protein kinase SWE1"
                     /transcript_id="XM_027627654.1"
                     /db_xref="GeneID:38737793"
     CDS             complement(298640..301387)
                     /locus_tag="MRET_1027"
                     /codon_start=1
                     /product="mitosis inhibitor protein kinase SWE1"
                     /protein_id="XP_027483909.1"
                     /db_xref="GeneID:38737793"
                     /translation="MDNARASSPHVGDTCSDANASMTPNMSATYRNVRPLQTAFVSSG
                     LVSKRRRDLLPELRSSDNLRADAATYQGMESTRSVPSIASLSADASQSARPLREVVEA
                     AMADRSFNVSRRPPAAVMPDTPVKPMMGMSEAVRSARMHRRGCSMGGAFPSKSPLFQT
                     ATTPKSPSGPFSGFSSTFASKKAMPSTVLRRSGHIRSASERIPGTRHMFLNEIPVRPP
                     NVDPDDVFEAPSESPLRPVAAQREAPDMLLPERRREPLSPRPSGRPSGVLPVCPISVP
                     NERTSELPVPASPLDHDVTYGGRSSSMDSPNNMFAHPPSQQLTPRDDESSDPDWLEAP
                     GSSSMSSLGWVESTPTIMRKSVTRMNEPGISSPHFKLDFSPDAPFDGPKWYEATHSPM
                     VLQKGKSAVRPRHSQPAHMLTPPNPHDQTAAVTQSAPAGRFRSSLSSQFEDHFVVEGV
                     LGTGEFSEVVKVREKATGLLSAVKRMKRPFHGPKDRVRRLEEVDVMRVLKEQHAAWQD
                     PWFGAEGVVELLDAWEEEGHLYLQTELCSLGSLAFVLAEYGRQVGALDEARLWKILAE
                     LSAAVYFIHQCGVLHLDLKPANILITEVGTLKITDFGMATRWPRCTAQEILAGSHLTT
                     HGSTRDSDLSDTSFSPAHMTPEQASLPTAAVHATVQRPRRRPARLQRRPSPILALERE
                     GDREYIAPEVIFESKYGKPADIFSLGLILLEAACSVEIPDNGAPWHKLRCNDFSDVSF
                     DAISATLQSVITSMLSAEPSMRPTASDLVDMPVLERVRQLMRRGLSADELDQLPLHGG
                     KPAPAAPYPVPPVKYYEAPHTGMLDAHRTVVKIRGALIQEDEQAFLAEVLQSADTRDT
                     SSPDTSTSLMTEDSLQQDASCTRVAPVVHTYTPALMSPSAYLHDQVSSGMDIDKTFPV
                     G"
     gene            <301620..>303383
                     /locus_tag="MRET_1028"
                     /note="MRES_04085"
                     /db_xref="GeneID:38737794"
     mRNA            <301620..>303383
                     /locus_tag="MRET_1028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627655.1"
                     /db_xref="GeneID:38737794"
     CDS             301620..303383
                     /locus_tag="MRET_1028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483953.1"
                     /db_xref="GeneID:38737794"
                     /translation="MQAITSPFSESWGEYRLRKEDFSWHKANEGRLQGKWLRGLWSNE
                     LYQERRSSTTGRADDMMTVATLSLPPTLEIQKFVELFKLAYMHMRFVHPMLGVTIETN
                     VFSIPLLPCFVYEQVTSFDEVQAWADRTVHVHTCESEQDRALSMSDRIQCVRNTVGTR
                     PLPISQHTREWHIICFGREEDAHHVALMSYCAHSVSDARAELFLLQQLLDEMARLEGA
                     WPVSASHPSHPAAHEWGSEIKRLTPSLMEMIGVPIDAFEEEAARELVRSVTSEPSLRL
                     DEGRPIAEPELSETLHARVVFSKEETDALHQAAKAHGWSLTHLVDAARHMAYMQVRRP
                     YLEAWHWSPIPEKLHTDFLIPMDARYAILETFRDGASGHVCNATEGFTTTIPLMDPYY
                     IPIERELASSEKELHELSQVRTLAYMAQSLCVQYNAQKKRAKQRMMSSIPTLVLAGVF
                     LPTYPFQSLSPEGFSSVGVVDRLLTTRISLPGHTQPIDIIDWTVGLLMSKHRGSLQFS
                     LHIWTFQEQLNLSVVHTPHITKERTALFLDTMRSTLKLFLMAYEQHGKPIDIPAAPPT
                     PFKEPTLFQYVGRWLQSLLSH"
     gene            <304533..>304795
                     /locus_tag="MRET_1029"
                     /note="MRES_04095"
                     /db_xref="GeneID:38737795"
     mRNA            join(<304533..304629,304665..>304795)
                     /locus_tag="MRET_1029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627656.1"
                     /db_xref="GeneID:38737795"
     CDS             join(304533..304629,304665..304795)
                     /locus_tag="MRET_1029"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483910.1"
                     /db_xref="GeneID:38737795"
                     /translation="MATAALSALGYAGFGFLARCYALGIQKRNIFDNFAGHVMFASGF
                     GLIGYWLHGVRESQERLLQQKKEQLEEKRQA"
     gene            complement(<305154..>305762)
                     /locus_tag="MRET_1030"
                     /note="MRES_04100"
                     /db_xref="GeneID:38737796"
     mRNA            complement(<305154..>305762)
                     /locus_tag="MRET_1030"
                     /product="small subunit ribosomal protein S6e"
                     /transcript_id="XM_027627657.1"
                     /db_xref="GeneID:38737796"
     CDS             complement(305154..305762)
                     /locus_tag="MRET_1030"
                     /codon_start=1
                     /product="small subunit ribosomal protein S6e"
                     /protein_id="XP_027483857.1"
                     /db_xref="GeneID:38737796"
                     /translation="MSQDVEVDSLGDEWKGYILRIGGGNDKQGFPMKQGVLLPSRVRL
                     LLGEGDSCYRPRRDGQRRRKSVRGCIVGPDIQALHCIVVKQGEQEIPGLTDAESAVPK
                     RLGPKRANHIRKFFNLTKDDDVRQYVIRRTVQPKKEGAKPYTKAPKIQRLITPQRLQR
                     KRDHRRMKKQFISKKEAERAAYEALVAQRLAEKKQRLASHKA"
     gene            <306265..>306759
                     /locus_tag="MRET_1031"
                     /note="MRES_04105"
                     /db_xref="GeneID:38737797"
     mRNA            join(<306265..306540,306580..>306759)
                     /locus_tag="MRET_1031"
                     /product="small subunit ribosomal protein S13e"
                     /transcript_id="XM_027627658.1"
                     /db_xref="GeneID:38737797"
     CDS             join(306265..306540,306580..306759)
                     /locus_tag="MRET_1031"
                     /codon_start=1
                     /product="small subunit ribosomal protein S13e"
                     /protein_id="XP_027483856.1"
                     /db_xref="GeneID:38737797"
                     /translation="MGRMHSKGKGISKSALPYSRTPPSWLKTSPEEVVQQIVKLARKG
                     VTPSQIGAQLRDSQGIAQVRYVTGNKILRILRSEGLAPEIPEDLYHLIKRAVSVRKHL
                     ERNRKDADSKFRLILIESRIHRLTRYYKTTGAVPPSFKYESSTASTLVA"
     gene            <307011..>310259
                     /locus_tag="MRET_1032"
                     /note="MRES_04110"
                     /db_xref="GeneID:38737798"
     mRNA            <307011..>310259
                     /locus_tag="MRET_1032"
                     /product="lipase"
                     /transcript_id="XM_027627659.1"
                     /db_xref="GeneID:38737798"
     CDS             307011..310259
                     /locus_tag="MRET_1032"
                     /codon_start=1
                     /product="lipase"
                     /protein_id="XP_027483855.1"
                     /db_xref="GeneID:38737798"
                     /translation="MENPPLSPFPKAHGMAACHVQLQRALQQDAADFDTSDVEPLELP
                     GASDHDTNHDTPPSKPSIVTPSTLLGPKITKPSHIDMPPPPFAPVSALTVSALLSRSG
                     QVHPISTHMRRSEDDLRLLRRRMPKQNTIEEEERNDDMEPTHADALMSMMPSLLRDFW
                     SQEPSSRNKKGYRAGRYHTGSALEAIGALFLRQDSAGRLDQLSLNESRHRVSSWRWRL
                     PLWIRHMEIGPLILLLENIRRRVGSWIISKELPPSPERPRSFHGTDDLPETPLLMPGG
                     FIPEDSDVLMLPPPLLDNHGRDAWSFEGLLGVRRMREQLERQQRVDKMLKYHRPAHRV
                     DAFTAFMNFVRSAKASESRHYARHALVGPSQVQRRTPHGLWKQPLVLSQAKAHVMDDQ
                     MLPSPKSTKRSSLEFLDLATSSRKRLKPKSVLTEQVALMPSSQDKTQEATTLGVMWIV
                     LSYVFVSVAFVPDFVVFFLAHSLDLLMDAFEFLSYIFWFVRWVWRNVTGQTILGRIII
                     EAYVLFKREWEYVIREDHEESADRMQRFLGIPLFCRPRGLSTFQVLRGFIELACVQAV
                     TREQYQREGAGLICLGVRQEVASNSDVDNDDLVVTSQGNDILELSRTLGAETQPCERT
                     LWEEEDKAALVHNIKWASQLAISAYGLRVLIVDLPPVFTPSGKQLPRQTFAHLSRLKT
                     DDVLHADIQTLDMEATYMPTFYVVRDMRRKVVCVAVRGTQSFADIVVDLDMKTEDITA
                     SLAEWRGIPIDEGTERYAYHAGIWRAAKSLVAPGSTLFNKLQETLTEHEDFGLVFVGH
                     SLGGAIASAAAILLSEYHMDAPDIDPRKGMWRTTSQGGFPGGRPIRAITFAHPSTLSH
                     TLNRRTSYGVVPLVISVILGSDIIPRFGHGQLRELRRVLGALTRVRRRRGLVPTTISS
                     HLDHMSEDQELSVHIVRRFWDWLSICRTRHPDAVMLDKKKRLEALFWRLRCEVENDLY
                     AQAKRRFDDAASSQTLASTEPISPWVQAQRRNAPLHALSARRQRLDYATLKSEFAQGG
                     VLVPAGRVLWLSDEELYEITNPMAFFSLPDLHPSMFADHFPAAYEEAILALS"
     gene            <310439..>312112
                     /locus_tag="MRET_1033"
                     /note="MRES_04115"
                     /db_xref="GeneID:38737799"
     mRNA            <310439..>312112
                     /locus_tag="MRET_1033"
                     /product="NADPH-dependent medium chain alcohol
                     dehydrogenase"
                     /transcript_id="XM_027627660.1"
                     /db_xref="GeneID:38737799"
     CDS             310439..312112
                     /locus_tag="MRET_1033"
                     /codon_start=1
                     /product="NADPH-dependent medium chain alcohol
                     dehydrogenase"
                     /protein_id="XP_027483854.1"
                     /db_xref="GeneID:38737799"
                     /translation="MQKPILDLRCTPCCDDHAPMCNECDEAAHCPDAAESIICYDPHC
                     AEPPCEQDHMSQALSFGILPCCPVPSVSGRCCTTPTDTSFHDPAAAAMTAPCSLPSTC
                     TYDMCARGLDLICHEADIHHTQPCEQDANSGNCVSVCDGYVRPWHACSTFGLNNDMEF
                     AYPQGAFDPCCAPCTDPVSCHAPCFDVPPSFVSMTPRRSAPSIWRSSEEPSVSGTSCS
                     TPTSHPYPNTPDQTDQALDMLSCRWNGCGFQVPSMQELSLHMHKTHVPDMDVQSIQNY
                     FNAPIPLDTQMSMPDAWALKAPKPLAPSPTDTGTGVALESQGLLDNVVTACLCPLDEQ
                     GKKQHACGWIHCTESFDTHAELTAHIAEVHVGSGKTEYECGWVGCERAKHGRKFQQKQ
                     KVLRHIQTHTGDRPYVCSVCHKRFSETSTLTQHMRTHTNERPYKCDFPGCNKSFSVIG
                     SLTIHKRTHTGDRPFKCPYPNCHRQFSESSNLNKHLRVHSGDKPFECPECKRRFSRPD
                     QRARHRKIHAKQVASTHAASTSSSLAPSVSMPRAPEAGPIIESVAVVGL"
     gene            <312138..>312938
                     /locus_tag="MRET_1034"
                     /db_xref="GeneID:38737800"
     mRNA            <312138..>312938
                     /locus_tag="MRET_1034"
                     /product="inositol-polyphosphate multikinase"
                     /transcript_id="XM_027627661.1"
                     /db_xref="GeneID:38737800"
     CDS             312138..312938
                     /locus_tag="MRET_1034"
                     /codon_start=1
                     /product="inositol-polyphosphate multikinase"
                     /protein_id="XP_027483853.1"
                     /db_xref="GeneID:38737800"
                     /translation="MLLQVGGHPDTVHEQNGYIVKECTDAEALFYHETHAMHHPHASA
                     LRAWMPRCYGIADERGQWLEGWPRVPLKAMRGTYSVTLENLVRPFCRANVCDIKIGTV
                     LYNEANPRLSAEKRERMQRKAQETTSGSHGLRVTGYCSWDAHAQSFYTSGKVPGRAAR
                     TTDDLQRLLAAAWQVPPEVLRAHLVPRIKHLCDCLAPVPVSLCSASVLVVMEGDDAAR
                     QERLAHGEPIFDVRLIDFAHSRWCDQPDQGVLRGLSTLYELVLRLAAE"
     gene            complement(<312912..>314729)
                     /locus_tag="MRET_1035"
                     /note="MRES_04120"
                     /db_xref="GeneID:38737801"
     mRNA            complement(<312912..>314729)
                     /locus_tag="MRET_1035"
                     /product="vacuolar protein sorting-associated protein 52"
                     /transcript_id="XM_027627662.1"
                     /db_xref="GeneID:38737801"
     CDS             complement(312912..314729)
                     /locus_tag="MRET_1035"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 52"
                     /protein_id="XP_027483852.1"
                     /db_xref="GeneID:38737801"
                     /translation="MEAEAAALAPALAELTRASSATISVVCSDALQRMDHDQDRVVEA
                     RLPELQALAEQVQQSRGSLTQIRNELERFYEKLHTASEHIGKLQDRSNALSEHLSAQE
                     TRASTLTDWIEASMVPPSVVRLLRDTNVDQELNAWIRAICRIERTLRALNEYEATQKD
                     APSAGSARAQARTVAEQCKNLAISKVFPYLTRLFEPIRTSVTTSLPILQSSVLLPHHQ
                     PLYQFLALHAPRVAIEVQLSYINAARLYYETAFRRYVRELRKILQRWTEPATLIAWAY
                     KQSSPATAQYEPERQQYAHPITDAAAVLACQSEDVNFKASPEHLFHTLALVFLDTACS
                     EYAFLARFFSGAFDMQEPTYDASAVLSCNMLSLSADEEQRHESIVTRESWRQVMEPAM
                     AFLAEFYTAVLAMPGAPVQQLLTMANLMHELLQVARSRRCLIPELESVLMRHLLETWP
                     LVAKSLDTEVDTLKTLTIGPRMGPVPRSAGGGGLLERWTGGLMTTDLMRGGQAADALQ
                     KILSAYTQFFSQVVSLTSTEQHQGMLLGGLGRIHTELARLVREYATNVYAAHQDGPSP
                     RDMCVSMHAVLSATPDDTHAHEAAKWAELADSFSSETQN"
     gene            complement(<314832..>316832)
                     /locus_tag="MRET_1036"
                     /note="MRES_04125"
                     /db_xref="GeneID:38737802"
     mRNA            complement(<314832..>316832)
                     /locus_tag="MRET_1036"
                     /product="protein regulator of cytokinesis 1"
                     /transcript_id="XM_027627663.1"
                     /db_xref="GeneID:38737802"
     CDS             complement(314832..316832)
                     /locus_tag="MRET_1036"
                     /codon_start=1
                     /product="protein regulator of cytokinesis 1"
                     /protein_id="XP_027483851.1"
                     /db_xref="GeneID:38737802"
                     /translation="MDASTLSALIDTSSKELEELHRQLGCPNDEMDKAMSALKACIYD
                     AIHAQVRQVETRVAEVKVSCEAHERRIQQLCSATGAQPPTITPSQPLLAQRAALQAEE
                     ARLESIYAAQCDQCDLVLNQIHTLNMCMSEAGGAPSLPTRTDALRDVTPDTLCHLESH
                     LLHVQQVYKDRKIQMESDLSEILQLWSELHVMPDVAINAGHVSVHDERPEESQFHMSI
                     LQYTQQMPTLELDGEFRGQFEPIRTAEESTMDATPSRIQGTPTLAADTSAVPELLQPT
                     DAVMAKSIKLRESLEREKTERESSIQSYYDELCELWMRFDVPETEMDAFVLDHRGSTL
                     QVVEAYRTELDKMRALKSQHMALFISKTREQIWEQWDALYMSEAERRNTFPAYFLALP
                     GEDETISATFDWDELLAEHESMYAKLAEMLEQRAPILSLIGRYHTICHEARALEESAQ
                     DGSRLLGRGNRGDPGRLLREEKMRKRVKVQKPKLEQELLKVLPAWEAEHHMPFMMDGT
                     RFVDYLRDQLGGAKENPRTQRRTVPQKTGAELSSSRAANGVPETPRQGPLKRPGTASM
                     NRAPTSQARRGGAHGTSRPRMASQSRMTPYGAVATNKPGAKRLDSTSSTDTVVPHAAT
                     LSSSITSPAPDDDDVFSAGQRTPSSYLASSFARSQTPAMSRF"
     gene            <316999..>319416
                     /locus_tag="MRET_1037"
                     /note="MRES_04130"
                     /db_xref="GeneID:38737803"
     mRNA            <316999..>319416
                     /locus_tag="MRET_1037"
                     /product="protein NUD1"
                     /transcript_id="XM_027627664.1"
                     /db_xref="GeneID:38737803"
     CDS             316999..319416
                     /locus_tag="MRET_1037"
                     /codon_start=1
                     /product="protein NUD1"
                     /protein_id="XP_027483850.1"
                     /db_xref="GeneID:38737803"
                     /translation="MSQAASECGTVVHHSDASTVPPMFQPAWKATPARGRDRLNAIGG
                     DMFSPMKLQQMFLTPNVSSEKENAEGPSMEAAPPTKTEFTFRARNVPSSTPMPSRSSS
                     KGAMTRTTPSTPGGPHMPLRLINVPFDANIRSGLEQLAEECSREASRDEEESLSASAS
                     HSSLQDLRQNKRMRMASQETSNGGRMARFPLSYKNDNHQATPARPVSGSFPRSILKGG
                     SLGETPRVQASRSISFMDQKHPRSTASNATAQTARMDRMLQELEQMNLSRSQPAPEDR
                     SQMTNASFRITRDKLVEVLTDAVPWEPDWRTLKKIDLRARQLESCIALSEHLPHVQEV
                     WLDHNQVSFAMGIPSSVRLLTASHNVMSELTSFEHLKRLRVLDVCHNEFASLMPFVHL
                     TELRELRADHNRITDLRGLEQCTSLRRLSLAHNELGGCVDVSGMCWPALESLSLAHNR
                     IHTIAGLESVAALQELDADDNQLTTLPLTRTMPQLRVLRLCDNTALDTLDVSCMPHLR
                     VLYADRCRLASIEALSTARDLRHLSLRQQGTRVRLPLPVPRSLQRLYFSGNAVRANQL
                     FLSPMPSLVYLELAGCQLTSVSSELQDQTPALRSLNMDHSLFTSLPSLRPWRRLKRLS
                     IVGCRVDTLESIVRSIHGMTELCVLDLRTNPCTLGLYPPMILPLNAPDGTSGPPVPHP
                     AIVQPDAARAAEQAAQTRLRAVQSFAERSQFHKRTMLVPPEPTVEAPVASEHVKDSAR
                     TASLFHAADKHFQSTLPGHLLQKRRVYRGLCGMACNTLTWLDGLEIDEQDILRAEQQL
                     RRLDRDT"
     gene            complement(<319419..>320234)
                     /locus_tag="MRET_1038"
                     /note="MRES_04135"
                     /db_xref="GeneID:38737804"
     mRNA            complement(<319419..>320234)
                     /locus_tag="MRET_1038"
                     /product="riboflavin synthase"
                     /transcript_id="XM_027627665.1"
                     /db_xref="GeneID:38737804"
     CDS             complement(319419..320234)
                     /locus_tag="MRET_1038"
                     /codon_start=1
                     /product="riboflavin synthase"
                     /protein_id="XP_027483849.1"
                     /db_xref="GeneID:38737804"
                     /translation="MFTGLVECMARVVDVVPTDEHSGSYAITIGESALLLGDCHVGDS
                     IAVNGVCLTVTQFSTDTHGGCFRVDLAPETLFRSNLGRLQVGDKVNCERAMAPTTRFG
                     GHIVQGHVDTVATLQSIERNQSALTLTLRLFHDTRKEVDAHLPLPSTLAPYLVPKGYV
                     TLDGTSLTLIDVSPPAGGALNGDATENKKETIEFTVMLIPHTQEHITLPSKPLGSFVN
                     VEFDMVGKYVYRSLEGQLGRLDQAPGTDASTLSMPMLERVVERAVERVMHRQQ"
     gene            <320339..>320850
                     /locus_tag="MRET_1039"
                     /db_xref="GeneID:38737805"
     mRNA            join(<320339..320668,320701..320788,320822..>320850)
                     /locus_tag="MRET_1039"
                     /product="bud site selection protein 31"
                     /transcript_id="XM_027627666.1"
                     /db_xref="GeneID:38737805"
     CDS             join(320339..320668,320701..320788,320822..320850)
                     /locus_tag="MRET_1039"
                     /codon_start=1
                     /product="bud site selection protein 31"
                     /protein_id="XP_027483614.1"
                     /db_xref="GeneID:38737805"
                     /translation="MPRIRTSRTRPPPEGFEDIEPILEDYETKMRDAENDPQEGKRKA
                     EGVWGIMRITHIRSRYIYDLYYKREAISRELYDWLLEQGYADAALIAKWKRTGYEKLC
                     CVRCIQARDMNYEGATCICRVPRAQLRPGTFVECAHCGCRGCSSSD"
     gene            <320971..>322845
                     /locus_tag="MRET_1040"
                     /note="MRES_04140"
                     /db_xref="GeneID:38737806"
     mRNA            <320971..>322845
                     /locus_tag="MRET_1040"
                     /product="GTPase-activating protein SST2"
                     /transcript_id="XM_027627667.1"
                     /db_xref="GeneID:38737806"
     CDS             320971..322845
                     /locus_tag="MRET_1040"
                     /codon_start=1
                     /product="GTPase-activating protein SST2"
                     /protein_id="XP_027483825.1"
                     /db_xref="GeneID:38737806"
                     /translation="MPRLKRPQSPSPDSTKGARTANGQASATSSRPTSPWNRYPDPQA
                     PSAHDGTDTRPQSPMGGIPKPVALQSNEQWLMRVNREGLPICRDLHGLFTTVIISLCD
                     RWPDWRFPLAFVLPALIQRMQALQFVQIVRDSANGIQNMLSLSQTKTSFTMSSQTAAR
                     ICQAFIRAHLLERVPGQEDEVYAPSPKGVHLVDRFVVRHGIATRSVSNLLNVHPICDK
                     LLFLERDEQDDVLLSDAVVRILFNRMVGTSPRRTEPSALGIVLETKQVRDKEGQMYET
                     ARFSSTDALNWLVDYTTMVSIDEAIVLAAHMVRLGWLESEQTMDVSQSNNVATVCVDE
                     ALRAEHAAREGTFVEGEMYYLTELGVTMAWKVDWVDQPASKPADERPPTSFFYGDRLN
                     EMRSVSPRLDAFDLYGTYMNAHPSAQASPEIPGAPSPRARDVASPTSVPRQPLEEVLR
                     SANMRRSLYTFLQMRQDEKPLQFWCQVEWFRSDCRLATAGLLTDTFSADAVDVLPSEV
                     LRESAEKRPEGMTGPQMRASQQPILSLSAQRRIGSLLQSSALNLRLSSETSASLEGAL
                     EAFARGASGTDSTRQIEKALGHLLIQCGSAQKEVKAQLNEESLPKYYEALDCGLWERP
                     "
     gene            <322911..>324839
                     /locus_tag="MRET_1041"
                     /note="MRES_04145"
                     /db_xref="GeneID:38737807"
     mRNA            <322911..>324839
                     /locus_tag="MRET_1041"
                     /product="histone deacetylase 6"
                     /transcript_id="XM_027627668.1"
                     /db_xref="GeneID:38737807"
     CDS             322911..324839
                     /locus_tag="MRET_1041"
                     /codon_start=1
                     /product="histone deacetylase 6"
                     /protein_id="XP_027484024.1"
                     /db_xref="GeneID:38737807"
                     /translation="MTEAHPLSAPAAPVSDEPLIPPDVRKTGYVYDPSMTLHSTLAAE
                     PHPERPERITSIFTMLQMHGCIHRMHRILSREASLAEVSLVHTEELWHSLEETVQLPE
                     DKLRELIAFYEAKSLYLNRSSTLCARLSCGSAIELCKAVASGRVQNGFAIVRPPGHHA
                     EPDGSQGFCLYNNVAIATRTLLHHAARRIMILDWDVHHGNGTQRIFWNDSNVLYISLH
                     RYENGTFYPGTTFGNYDQVGGPDALGTSVNVPWPCTGMGDADYLHAFQQCILPIAYEF
                     APDLVIVSAGFDAADGDVLGGCRVSPTGYAHMTHQLMALAHGRLAVVLEGGYTLDAIS
                     RSALAVVRTLLGDALPPLPPGTAASTAAVHTVQQVIRAQAPHWQCMRTAMSMAPMSSG
                     TGACHSFSLPSLFLEARAARLWSSYQLLPLPMYSDGLAPHQVLCSSSFVLPTTDTFVV
                     FVHDLGTLHQDASGAPYVSDAADALVAWATSRHYAILDLCTLTPLPREAVCSPTHERV
                     PDTTPTHLYAHIESLWDHVCALSAAKRFVLVGLGTGCHVLMHLIAARALHHRVAGVVQ
                     VLGTNPIPLVPKSHPELKSWYLEHAHVVCPPNHPHLAWSDQASSGKRLGRVQRATSAC
                     PMDTLAQTIPLLEDMLRS"
     gene            complement(<324813..>325760)
                     /locus_tag="MRET_1042"
                     /note="MRES_04150"
                     /db_xref="GeneID:38737808"
     mRNA            complement(<324813..>325760)
                     /locus_tag="MRET_1042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627669.1"
                     /db_xref="GeneID:38737808"
     CDS             complement(324813..325760)
                     /locus_tag="MRET_1042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484022.1"
                     /db_xref="GeneID:38737808"
                     /translation="MAKRKAPSEPLPALDGADEVPVPLPRMIHALHTVAGVSVVDAIG
                     IVRVLAQKKRHTPSRLRRLSAPELEELGAPCAGPTRDRVVEALREVASSGVMSEAERS
                     SKQQRLREDVRLRRDWGDPGTGREDKSCAFDVVLTESTLRGRSVMVNRAAVLLAWAVV
                     VLECMGFARNEALSLAQCYTSLAAEAHGPAPPTKRVMSENQPHVEFLRVKIPIIRLRH
                     DGEYRGLKDGQVVPPTRAYDYLRRTMFQMLPYVMGALTLLANSYVAADGSAHALHDAA
                     YGLYLDFRPETHGERGKRAVLALDTILDLRASRAQHVLE"
     gene            <325785..>326708
                     /locus_tag="MRET_1043"
                     /note="MRES_04155"
                     /db_xref="GeneID:38737809"
     mRNA            <325785..>326708
                     /locus_tag="MRET_1043"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627670.1"
                     /db_xref="GeneID:38737809"
     CDS             325785..326708
                     /locus_tag="MRET_1043"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484023.1"
                     /db_xref="GeneID:38737809"
                     /translation="MVAGTVRIPALPQHAIAAVSAHLQTHHDAQPAGMWRIQFRPYHS
                     TLAPSTGPRHRRMMWEVTDAAYPHHVFVVFEDTSHPTRAEMHGTRTEGVPLRRWHAHV
                     LSAEFHTMLRQSTLPGPLGSSAGTLGPGAWAQRGAQTLLDGVSFRVRLGSSSPARQDA
                     SKTAGEQEECILSIGHVIVGAGRVAGGMVEIQYLPLSHLPPDSTLLGSLLASLLPPDI
                     VPLLVPISTMNPMALPTMIPPIQLAEIVPASGSAKAVPVPGAPGFGPWDDDDDGQHAE
                     TTLDPIGWTGIEMRRRMAYVHLIVLRAEGLA"
     gene            <326887..>328260
                     /locus_tag="MRET_1044"
                     /note="MRES_04160"
                     /db_xref="GeneID:38737810"
     mRNA            <326887..>328260
                     /locus_tag="MRET_1044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627671.1"
                     /db_xref="GeneID:38737810"
     CDS             326887..328260
                     /locus_tag="MRET_1044"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484021.1"
                     /db_xref="GeneID:38737810"
                     /translation="MATPPPRAVLLKGPTLNSKVFMTALPERHEDLLAKACELFKVPS
                     DHTPHLYVSCQASVGTPHSEQRGALLLSDAMPFLRDREMITLRWVPTTDPPRREKDVR
                     NVRWDTKLDEPAPLSHMRPTAVPAWRGPQARAMHVARVLERERIQSAQDELVPRKPTQ
                     ALYTAKPSVTPDPPFHTAPMSPPPSSPTTIPAARDENPSPPSSPTPNPMSSPARTLDW
                     GASGDSDDDHPSSATSSPSKSDRHHESRKSSFGAWCARLNPFARSEDHKDEEPEDKSD
                     GPSPSAPADKALPDLHVTGSAAYDVMTQVLMAVREHARNVHCKVPHEFCARQAGLSMS
                     LGTCVAKRAMSEDKPLRHFADALDEYLDTCVSTKGPMIEPEVSALRAFAYKLMDELQR
                     TSAPVAPPPSKEVPPPEASPEEPPAPTRTTRRRGAPRKRQAAALPPVPDEPLAKRTRR
                     STRHTKA"
     gene            complement(<328295..>329221)
                     /locus_tag="MRET_1045"
                     /note="MRES_04165"
                     /db_xref="GeneID:38737811"
     mRNA            complement(<328295..>329221)
                     /locus_tag="MRET_1045"
                     /product="26S proteasome regulatory subunit N11"
                     /transcript_id="XM_027627672.1"
                     /db_xref="GeneID:38737811"
     CDS             complement(328295..329221)
                     /locus_tag="MRET_1045"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit N11"
                     /protein_id="XP_027483824.1"
                     /db_xref="GeneID:38737811"
                     /translation="MDLQALFQQARFGSTSAPPTDVPQQDNAETVHISSLALLKMLKH
                     GRAGVPMEVMGLLLGTIVDDYTVSVVDVFAMPQSGTGVSVEAVDPVFQTKMLDMLKQT
                     GRSEVVVGWYHSHPGFGCWLSSVDINTQQSFEQLNPRAVAIVVDPIESVKGKVVIDAF
                     RLINPSTVMLGQEPRQTTSNIGHLNKPSIQSLIHGLNRHYYSIAIGYRKTQLEQAMLG
                     NLHKRNWTDGLKLADFQEHQHTNQGAVKRMLSLAEEYQKSVKEEAKLTPEQIKTHYVG
                     KQDPKRHLEDAVESSMSNQIVQSLGTMILAEL"
     gene            complement(<329307..>333197)
                     /locus_tag="MRET_1046"
                     /note="MRES_04170"
                     /db_xref="GeneID:38737812"
     mRNA            complement(<329307..>333197)
                     /locus_tag="MRET_1046"
                     /product="nuclear pore complex protein Nup160"
                     /transcript_id="XM_027627673.1"
                     /db_xref="GeneID:38737812"
     CDS             complement(329307..333197)
                     /locus_tag="MRET_1046"
                     /codon_start=1
                     /product="nuclear pore complex protein Nup160"
                     /protein_id="XP_027484020.1"
                     /db_xref="GeneID:38737812"
                     /translation="MLLPHGIASVPLDVLNTSASKARSYAVPCASAAKAPVPATHAPH
                     LAAHASHAATCRVSVLGPRVVALARFLDSTREIEVRILGQAGAPAPVRFVFPAPVLPN
                     VGMVEDGASSDLYVLAVTATGYLYRLRVPLTSLLHGHPLPTRWAHEHRMAHFASHETH
                     TEATSVHVVDQALLLVSCADGALVQLAYASEDLAWRESVLRPSAFSFSRLFGRSAAEP
                     VSPVQTLAIATHVSGADTPLALCVCRDRKLRVWNMATETLVRTLDLPGPSEAVWDSSA
                     QPHIQLFYPDDGAYSFYALVYVPTHGACLAAYGIELEESTSWSGGVGDMGLVWTRPCE
                     SLALAPDMELRDMAVVRARRAWRVWLLWHAGGAPLLQTTLVDGLRASEEQHVVRGPTE
                     DPWIHVQPFDPYTPLHGPALDAALATHTGSAVTALFLERLCEPARFSATTLTAALQAE
                     GVHVAGESLPRIMAAIAATIGAASTDAWLRFMRRVEQIDRAARWPLRLCMLDDVPCVV
                     ARHTLGVACARGAGAWLAGLATRLAAAAPHRDRPSARLAGEAASAEYALVLHQLTHVP
                     SEAYAPVVDGGASLLPVATLAIEAYDALGARAPRLVDAYALQGAPLPIPSRMHERVAA
                     LTERIGGDGLVHAAERLAALYADDAWLAPAWLDAVTACAHMAHVHAQWQGTRSLLVLL
                     SLVTHVPALQSVRAATLRAWRSARAMYTLASTSDHEPTLGLVHRALLRGVPPGARVDA
                     FCAAILPDAPDAVRVCLQGDEDPVCVYLVARADALRGRFDDACAALVRVHAALPTHAP
                     KLRPVLPFQDITDFAFWTHAASLVEASVSASYMCYRHAMHALEAGADVAEADARQVWT
                     QVFQAQLALHMYEAASSTVLSMPFDDLRTTCITTLVTTLCHAHETHTLLRLDLLDWQP
                     HVERTLSFHARHASPLAHPSYFHILYAYHISRGDYKSAAASMYQHARRMCVLAQSAQP
                     DTMRTYAVRQAQSYLVAINALTLLPPTHAWFAHDHADGLDVGRGKHRALRGRVTQYVP
                     TAQGASPPLAIVQLADVRREYDELMTRLELLHTYPELAHAATPWRAEDALSLFIANDD
                     FDAAWSCAQHLDLPLNGFFEALTHTAVTLERTFHQRKAQYEHLDPALQALYMADEEEA
                     DANATFLRHSACTASWPGHAHERAWKYLRLHLEAAKHDDAAAYRRTIAETLVASHAWD
                     LAPDWLSAWFQQHAPDVLVRVWMRHGMLEQALVYCTQLVDASMSALRTGHAQPPSCLP
                     YTLMDSLLAAATTQGVDAHALRTSLEARMKALHK"
     gene            complement(<333296..>335686)
                     /locus_tag="MRET_1047"
                     /note="MRES_04175"
                     /db_xref="GeneID:38737813"
     mRNA            complement(<333296..>335686)
                     /locus_tag="MRET_1047"
                     /product="kinesin family member 18/19"
                     /transcript_id="XM_027627674.1"
                     /db_xref="GeneID:38737813"
     CDS             complement(333296..335686)
                     /locus_tag="MRET_1047"
                     /codon_start=1
                     /product="kinesin family member 18/19"
                     /protein_id="XP_027483823.1"
                     /db_xref="GeneID:38737813"
                     /translation="MADSSIQVVVRVRPLNEKEVLLLAPTDTSHAFQGDGGLAASPSK
                     APNAIAAMRSNYIRNIIAPVDDRVLVFDPVEPDMMRGGESSRTRSSLSHMQFHGNGRR
                     PRDVRYAFDRVFPSSTQQREVYRDTVEPMLSGVLSGFNASVFAYGATGCGKTHTISGT
                     PTDPGLIFLTMQGLYERIEAESSDFETNVRLSYLEIYNETIRDLLSETPTPAGRGLAL
                     REDAASKMSVVGITEHIPESPEQVLEMITEGNKRRTQSPTEANAVSSRSHAVLQVNVM
                     RRPRTADTVEEMYSASLNIIDLAGSERASATSNQGIRMKEGANINRSLLALGSCINAL
                     CQSGTRGARSRHIPYRNSKLTRLLKFSLGGNCKTVMIACVSPSSAHYDETHNTLKYAN
                     QAKNIQTKVSRNLLHIDRHVAQYVQAIASLRAEVAELKDKLAHAPTESHAERDTQLEQ
                     ARARLATSAAQAKEHVGSSTYAASFLAHATQQATQARLSAGPPEAEERILQGLWQKCE
                     AAPEAGPWRVPTVPHHAPPLVAQHGPSAALYDAYHAKYAADVRAHANATAKEALEHLL
                     LDVLSPRMVTLVQYAARAASALQQVCASDPVPTDVEKTLADGVAMLKDLTGADVPTTV
                     RRGPRPGALASPARFHRKSPRRRALRPPPKPAMDKAARAPRASLVPRPSIPRRSDRPA
                     EAASKPRASLQPPLRMPVQAVPRASRDSGPPSDPAPRQPASSSSPPTAAKPPAGKPPA
                     APHAPSARRGLFQRQFLARRQEQEEEEDDDDDDDDDDDDLLGDTPRSYPPLAHSTW"
     gene            complement(<335741..>336484)
                     /locus_tag="MRET_1048"
                     /db_xref="GeneID:38737814"
     mRNA            complement(<335741..>336484)
                     /locus_tag="MRET_1048"
                     /product="protein-S-isoprenylcysteine O-methyltransferase"
                     /transcript_id="XM_027627675.1"
                     /db_xref="GeneID:38737814"
     CDS             complement(335741..336484)
                     /locus_tag="MRET_1048"
                     /codon_start=1
                     /product="protein-S-isoprenylcysteine O-methyltransferase"
                     /protein_id="XP_027484025.1"
                     /db_xref="GeneID:38737814"
                     /translation="MPWFFAAHPALIPKALAHPVGTIAATAFALGALAGVCAPGLWAL
                     VCGMLTYTPQRLAPLQVYLFAWSCFHVLEFVVTAYWNPTHLQSDSFLLQNGFEYVAAH
                     AMGVLEYVLESAWAPTWKYVWCVQAFGAVLIVSGQLLRSFAMIHASTNFSHALAQTKR
                     EDHVLVTTGVYAVARHPSYAGFFWWAVGTQIMLGNPVSLILFTVLLTRFFAQRIRVEE
                     ATLRAFFGDAYRSYAARTPRGVPLVGWVT"
     gene            complement(<336594..>337706)
                     /locus_tag="MRET_1049"
                     /db_xref="GeneID:38737815"
     mRNA            complement(<336594..>337706)
                     /locus_tag="MRET_1049"
                     /product="dihydroorotase"
                     /transcript_id="XM_027627676.1"
                     /db_xref="GeneID:38737815"
     CDS             complement(336594..337706)
                     /locus_tag="MRET_1049"
                     /codon_start=1
                     /product="dihydroorotase"
                     /protein_id="XP_027484026.1"
                     /db_xref="GeneID:38737815"
                     /translation="MVETLEIPSPADFHVHLRQGPMSELVTPHVALGGIDLAYVMPNL
                     TPPLTSAQQTVDYMAQLRAIAPHTRFLGTMYLSPSITPDEIRRASAAGIRGVKSYPRG
                     VTTNSDGGIEDYEVYFPVFEAMQECGMVLNLHGEIPSDTDKGVCVLNAEPLFLAHLEK
                     IHTHFPQLRIVLEHATTRAAVECVKRCGDTVACTITAHHLQLTVDDWAGKPLHFCKPV
                     AKMPDDRAALREVIREGHPRFFLGSDSAPHPLAAKYPSPASRNDSTDELMLNCGCAAG
                     VYTSPILLPLCATLLESFGALDQLAAFVSEHGRRFYNEPAEPGRVVRLRRATPQDAPV
                     PAAYVHSSSTDKRDGDPSKLQVSPFFAGQHLGWVLA"
     gene            <337809..>338696
                     /locus_tag="MRET_1050"
                     /note="MRES_04180"
                     /db_xref="GeneID:38737816"
     mRNA            <337809..>338696
                     /locus_tag="MRET_1050"
                     /product="zinc finger protein HUA1"
                     /transcript_id="XM_027627677.1"
                     /db_xref="GeneID:38737816"
     CDS             337809..338696
                     /locus_tag="MRET_1050"
                     /codon_start=1
                     /product="zinc finger protein HUA1"
                     /protein_id="XP_027483479.1"
                     /db_xref="GeneID:38737816"
                     /translation="MPPPLEPSEPPPSYEDVLASTWGDASSHHEAAAPSLPPRPRPPS
                     PSSTAPAPPRPVGPLPTASPANGYPLLYKGKILLYPATVPTCTKCYETGYVNRNPLKP
                     CKSCWHRYGKAYTGAVKNAYEQGGAHGYLADQRIQQPLRFYTPMQSHAFHPPAPRPPQ
                     PFSPSIGTQPPSGPSSRPDVYPEDQHSSVPPRYDVVSHTSSEKPLMQQDYPLYAPPPP
                     PRPMPCYAPPPPGAAPLVDWYGYQPPPGAVAVMPGDPRIGGTLCYKCGGTGNANDLFS
                     LFGLDDECNTCGGAGRIMR"
     gene            complement(<338697..>340306)
                     /locus_tag="MRET_1051"
                     /note="MRES_04185"
                     /db_xref="GeneID:38737817"
     mRNA            complement(join(<338697..338728,338752..>340306))
                     /locus_tag="MRET_1051"
                     /product="cactin protein"
                     /transcript_id="XM_027627678.1"
                     /db_xref="GeneID:38737817"
     CDS             complement(join(338697..338728,338752..340306))
                     /locus_tag="MRET_1051"
                     /codon_start=1
                     /product="cactin protein"
                     /protein_id="XP_027483478.1"
                     /db_xref="GeneID:38737817"
                     /translation="MAGMARREEGQAAWYPDAKRLRTDDDEGGVFRWKKKEVEEQRAG
                     LSRHDVERRDAARRAEAEREAERLRARRVQRENARREREEEEARRARQAESAVMADWV
                     AKEDEFMLQQSKARAAIRVRDHRARPIDWLVMPLLDDTEYDDEVDVPLKEPTAYMDTL
                     APSELQELHADIQTFVRLDADRAAYWKDALIVCDDRCRRVRHQDQTHVDPSILADADA
                     LLADKSADELLELQTSIRSKMRSGEPLDVEYWDMMLQRIVVWRSVAKLRAVHEKTVQE
                     KIAKRRHEQRCDAERHCAELAEQLDTPRKYDVVWDAAEMEPPGRPVHDLTPEERPLPM
                     YTPASLRAKLREARRDVLSRSYIPRQQTEWHRSCQTADDFVRQEAARAMGVNEEAFHD
                     DVRLTQQAHHGESKYRIRKPRYFNRVHTGYEWNRYNQVHYDAEHPPPKQVQGYKFHLF
                     YPDLLDPMQAPTYRVLPDPEGPGDTVLLRFSAGPPYEDVAFRIVQREWDYSYKRGFRS
                     SFDRGILQLHFNFKRFKYRK"
     gene            <340424..>341268
                     /locus_tag="MRET_1052"
                     /note="MRES_04190"
                     /db_xref="GeneID:38737818"
     mRNA            join(<340424..340911,340937..340991,341018..341170,
                     341206..>341268)
                     /locus_tag="MRET_1052"
                     /product="anticodon-binding domain protein"
                     /transcript_id="XM_027627679.1"
                     /db_xref="GeneID:38737818"
     CDS             join(340424..340911,340937..340991,341018..341170,
                     341206..341268)
                     /locus_tag="MRET_1052"
                     /codon_start=1
                     /product="anticodon-binding domain protein"
                     /protein_id="XP_027483969.1"
                     /db_xref="GeneID:38737818"
                     /translation="MSRTDAIHETLQSNVSAIVQLTVSYPSFHAPEYAVPTESLVGRL
                     WAYDAASNVVVIETGHTSALAPSMRRAAASAVCETSPRVLSNSGALAGFKMVRASKIQ
                     RVDVLQDDQSIPLTTVHPVPVAAIEARDAAAKKKCQERVAQLAPSNVSDVGQVVFDAV
                     NKTLPCRWHDSHIIVLDEVVISGPTYDISTTYVPGLPDDQLQQLLHDEDANISSQIER
                     ANDKARTWQRVTRVLDSVHAQQAARRPSLVERAS"
     gene            <341356..>341706
                     /locus_tag="MRET_1053"
                     /db_xref="GeneID:38737819"
     mRNA            join(<341356..341447,341490..341596,341624..>341706)
                     /locus_tag="MRET_1053"
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 2"
                     /transcript_id="XM_027627680.1"
                     /db_xref="GeneID:38737819"
     CDS             join(341356..341447,341490..341596,341624..341706)
                     /locus_tag="MRET_1053"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 2"
                     /protein_id="XP_027483968.1"
                     /db_xref="GeneID:38737819"
                     /translation="MASTLSKAFPAAVKEIRMHFSPTSASSSGARKFVAQHYKEVKAS
                     NPYIPFLVREAQGGPARLFVRLERGAEKNAEISNLEPSAIIKALEDLIK"
     gene            <341859..>343196
                     /locus_tag="MRET_1054"
                     /note="MRES_04195"
                     /db_xref="GeneID:38737820"
     mRNA            <341859..>343196
                     /locus_tag="MRET_1054"
                     /product="protein pelota"
                     /transcript_id="XM_027627681.1"
                     /db_xref="GeneID:38737820"
     CDS             341859..343196
                     /locus_tag="MRET_1054"
                     /codon_start=1
                     /product="protein pelota"
                     /protein_id="XP_027483965.1"
                     /db_xref="GeneID:38737820"
                     /translation="MRILSKVLERDGSGTVSVIPDCDEDLYHLYNLIQPEDLVSASTV
                     RRIQSESSTGSIESHRMRLQLTLSVTKIDFEMAAGSGMSSAVSTSNEPLSESDASSPA
                     STPMSSLVLGEAGSTPSLSGASQGQPTLHISGRVAVENNHVRTGSFHTLDIELNRKVS
                     ITKEQWDQHHLDILEESGNAGSTAEVGAIILGEGRAIVCLLTNTMTIIKQRIQVSLPR
                     KRAGAGYGVAQQSTGTTKLTDRFYTQVYDAVIKLLSLPEMRVVLLASPGFWRDNMYDY
                     LLSEATKRSDKILMGNEGKRKLLKVHCATPHVHSLMEVLKSPEVAAQLQNTKFTRENQ
                     LMDQFLRKLATSEQFAWYGERQILMAADRGAIGTLLLSDAFLRNVHPTIRKRWLELCD
                     QVKSFGGSVVIFSSLHESGRQLNGLGGVAALLTYPLDLDLVEEEEEEARAAAT"
     gene            complement(<343197..>343964)
                     /locus_tag="MRET_1055"
                     /note="MRES_04200"
                     /db_xref="GeneID:38737821"
     mRNA            complement(join(<343197..343407,343434..343450,
                     343474..343662,343686..>343964))
                     /locus_tag="MRET_1055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627682.1"
                     /db_xref="GeneID:38737821"
     CDS             complement(join(343197..343407,343434..343450,
                     343474..343662,343686..343964))
                     /locus_tag="MRET_1055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483964.1"
                     /db_xref="GeneID:38737821"
                     /translation="MTFTVQNVYYLRISATTILTTVLYLDQRHVTWMNDNPSILEHAV
                     HDIIRPQLVHLLHDVALHASDKMQTAEQEAFRVLYYFQDAERSPAVLLKTRTLSFPGS
                     SMSIPLETTDSVHAPIAPKSQPTDMVPESEEEPFSSQYTEDDEVSGQKPHVHVSYTGF
                     QVFSKELVLVIEPTESTVAQNPALFTVDDDDESKKEKRQLNQSARIHFDANATQFGRT
                     SREAPLFRGMDEK"
     gene            <344007..>344776
                     /locus_tag="MRET_1056"
                     /db_xref="GeneID:38737822"
     mRNA            join(<344007..344157,344190..>344776)
                     /locus_tag="MRET_1056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627683.1"
                     /db_xref="GeneID:38737822"
     CDS             join(344007..344157,344190..344776)
                     /locus_tag="MRET_1056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483967.1"
                     /db_xref="GeneID:38737822"
                     /translation="MLGFRASRAFHTTVRRATRRTPTLPRIYRYWIDVHGQLFLYDTV
                     PKNLTSCFKSVPFLNFFFARIERNPARTTPGAPPELSAGPHWTEDAAQLQALWEQEHG
                     WDHLWTRLQSEGMSWWSKCQGEWNVIHAVDTPIVYRHLSPNEGTLTWGGDFRVPFRPG
                     SLRVHPDTGYLYHPSPEPILRRQRNTLQGGGALPWGRYSLVASHVVLQHLSEGLHIDF
                     EAGVGGHLQWRGQMYTLDALAPDADLA"
     gene            <345077..>348544
                     /locus_tag="MRET_1057"
                     /note="MRES_04205"
                     /db_xref="GeneID:38737823"
     mRNA            <345077..>348544
                     /locus_tag="MRET_1057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627684.1"
                     /db_xref="GeneID:38737823"
     CDS             345077..348544
                     /locus_tag="MRET_1057"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483966.1"
                     /db_xref="GeneID:38737823"
                     /translation="MDSEAQRGRQEQLRSAKRALRQFQRRRAQEQGKRASRTLRASVL
                     VRNAEAPPTVLTQYFMASNHPGPIARESAVRATDKTKRRRSRPSTIYMDEGPFSRRTS
                     QICWSGSMEGGDARHPRQGSVSSSRLPTMSAGHRLSLARQSLLETQRQSLDPAFHDGP
                     RRRSRHSRQLSISTRGQGFEVLSGQSLHRTSMHQDASTRRSIRFSALEPASILFGMSS
                     VHKPLPPAPSSVPTDWKAELRGMESDDREDRETALDKLEGRRPPSMMPTLKASDDQRR
                     SIVPSWLSMGDAPPTQLQVPKRSGASKRQSIVPIPPPMRKETPECQDPRDEMDRTPRP
                     SGPETAVPSAEAPRSPLRPLRLSSLSTARRPSTQASHKAARRVSSITYKASYDNDLAT
                     PTRAWSDLEQKHHQPSSSRGVLSAATSWATSDQTQSLFSPDSNVSDSPGATSIDSTDH
                     TSRKRGFRMEDHLLASLHARMDEQRERHQQELTSLQRELEEVRQVMGSQLVAMTGAKD
                     AAEKELAELQKQVHDMGTQLEDTSGERDMYKEDIVDWRSRCSDLEHTIQSQQLRLDQE
                     WTWRRVATKRMQAMSHRLQADTSVYSDESQASPSASGSMSLLEALPELPELPSEDELG
                     LWTQRVTRQLSKHAPNSDAPDLAPETVKLLTDMREQILALYSALRLEESNHALTRDQL
                     RDAQSKSRASDDAQPTMRSLVLDMPTPTPAETEALEPFATVDKTSGTDAQDTAADILF
                     PGTAQDDSAPIGLGFSSPPHEAASLRSAEVFSSHDREYSDESLGLATSQPHAHEPETP
                     KDSADLFHTDSKRASGMFSLTMDPYAPLSGMTSSSTTSQPAWPDVDTSHTVDAEGEAA
                     DAYLQGHIPDAYIDLEGGVMDDSAWVDEEDVSDAEQPDDLVSSPSTPRPEFIPEWSFE
                     QAVFEANRDMQLYKASGKSHRNKYARRGARRMRQNEIEDFFGIFDVATDTITPLPVPD
                     YALDMPPVDTSKLLPAWEYPRPDQDDGTCAPSLDEPWQTPKRRPQPVKTTSPMDDVNR
                     KPVPSVSQTLSEWASSSWTSESYSDGSATNAPVPEIQSFDATQLVDDDMLPCAPNRNS
                     LLAPAIPAPCTPIPRSPGDDSPSPLSPGRMRLVKHNPLTRIPVPTPIWKLDFELTTAV
                     PHAPQPFTI"
     gene            <348678..>350597
                     /locus_tag="MRET_1058"
                     /note="MRES_04210"
                     /db_xref="GeneID:38737824"
     mRNA            <348678..>350597
                     /locus_tag="MRET_1058"
                     /product="Gly-Xaa carboxypeptidase"
                     /transcript_id="XM_027627685.1"
                     /db_xref="GeneID:38737824"
     CDS             348678..350597
                     /locus_tag="MRET_1058"
                     /codon_start=1
                     /product="Gly-Xaa carboxypeptidase"
                     /protein_id="XP_027483971.1"
                     /db_xref="GeneID:38737824"
                     /translation="MNKASGPNVPLGLHPSSTSSSLSKVFAVLSVLALCMWLLVGHRA
                     ADTRLAMDTVPLQDVCPQEPAYNVTEALEGLKLQFPSVLHSAKLLSEAVQIDTTVGDN
                     IPDTDDWAEYWDSIFSPFADWIQTSFPHMHDTASPVRRELVNKHGLLYTWPGSDPTLK
                     PIVLMSHQDVVPVANETLDQWIHPPFSGHIDIENQTVWGRGSVDCKLWLVSTISAVET
                     LVKSDFKPKRTIILSIGHDEESDGKHGAQHLSAELEKRFGRGGIGMIVDEGTPLLSSA
                     DPGSYGVPIAVPAVAERGAMNMKITITSRGGHSSMPPPHTSIGIMSLIIAKLEAHPFP
                     DVLGDESSASIRQLQCVRDGPYMPYELRQALLKVEQAERALSDKGTTSCMHHMWPRMN
                     RLHLKEARLDEARTQLMQALDYASRQLLKTTQAIDIVRGGIKVNALPESVFAYVNHRI
                     APYAKVSTVVQHYKDLLVPLAEQYRLALSMDDDVLVPPTNATTANVQIEKSGLLYDSH
                     EPSPFEGSNADAWRLLSGVIRETWHTDEPRHELRSLDDDHVPKHNMGQYKDPVRVSPS
                     IMFANTDTRWYHNLTSNIFRFGAMTLHPDLTGMSPYLHIHTVNEHASIDSIVKATQFY
                     ANMLVAANHEPIERV"
     gene            complement(<350605..>352332)
                     /locus_tag="MRET_1059"
                     /note="MRES_04215"
                     /db_xref="GeneID:38737825"
     mRNA            complement(<350605..>352332)
                     /locus_tag="MRET_1059"
                     /product="Anion exchange family protein"
                     /transcript_id="XM_027627686.1"
                     /db_xref="GeneID:38737825"
     CDS             complement(350605..352332)
                     /locus_tag="MRET_1059"
                     /codon_start=1
                     /product="Anion exchange family protein"
                     /protein_id="XP_027483970.1"
                     /db_xref="GeneID:38737825"
                     /translation="MPSKQSTRGEVPWSQRSWFYELRPFRGMWSDLCRRAPYYASDWT
                     DALHPSNLFTVATSVVRIFFINLMPALAYVLDMYERTEHSYGVNEVILASALAAIVFS
                     LFGVQPLTFVGVTGLTDLMNYTIYDIFHDHYGFDQIKYLRLQAWVLIWAAGFHFAVAI
                     FNLCDFTRFITEMTSDTFGLYVGVIYVEKGIELLISEFSLPGHDNATGWLSVTIAVLF
                     CVSVYFITQVHSSAYLPFRLRRLVGSLALTAGCIFWTGFSHFPKTSLKEVPISHLPIT
                     RSFFPTLDRGWIVDFWHIEVRWVFIAAPLGLMIMLLFYFDHNVSSVMAQARKFPIQKP
                     AGFHWDFFLLGITTLVSGLMGLPVPNGLVPQAPDHTDSLSVYEQMQAPEDHEMAQAMA
                     PEPMHHVSENASILHVTHFPRVRTVRVVEQRLSHLVIGLLTLGAMSRPILVALGTMPR
                     AVFAGVFLLVGWASIEANPIVTRTLSMLRDQSALAPSKRLRVRRTTLTVFVGIQWLFF
                     GLTMAISQTIAAIGFPIIIVLMIPCRQYLVPVLVPARELTLLDAPTADSPAVMVSIGP
                     EKKETVVPL"
     gene            <352518..>353168
                     /locus_tag="MRET_1060"
                     /note="MRES_04220"
                     /db_xref="GeneID:38737826"
     mRNA            <352518..>353168
                     /locus_tag="MRET_1060"
                     /product="RNA polymerase Rpb4"
                     /transcript_id="XM_027627687.1"
                     /db_xref="GeneID:38737826"
     CDS             352518..353168
                     /locus_tag="MRET_1060"
                     /codon_start=1
                     /product="RNA polymerase Rpb4"
                     /protein_id="XP_027483337.1"
                     /db_xref="GeneID:38737826"
                     /translation="MRVIKVRAALLSDFEVLQLLRDSEAEQRNEARTRKEQQVSDTDI
                     ASNFRTMQFEAITSLSQSFRACSLQTAEHIRAFLDDLHKRGYVIPDERILADEPGLTK
                     TERLQLVNHAPSSVVELHTLVEELGQRMNDDQINDIIQCVTAHLPIPDASNTDPHTMP
                     MEHPPPMMQDNSMTQATDMPDADMDEEDAFPEEHFEHEEPGANMDHDAGGGYDADD"
     gene            complement(<353203..>353866)
                     /locus_tag="MRET_1061"
                     /note="MRES_04225"
                     /db_xref="GeneID:38737827"
     mRNA            complement(join(<353203..353547,353582..>353866))
                     /locus_tag="MRET_1061"
                     /product="small subunit ribosomal protein S18"
                     /transcript_id="XM_027627688.1"
                     /db_xref="GeneID:38737827"
     CDS             complement(join(353203..353547,353582..353866))
                     /locus_tag="MRET_1061"
                     /codon_start=1
                     /product="small subunit ribosomal protein S18"
                     /protein_id="XP_027483338.1"
                     /db_xref="GeneID:38737827"
                     /translation="MLVTRGFLGLVSSLRVPAKGPVMPIWSSLRMLSNVPENEADDQS
                     SQKKLDQLADFLESRPQKASQHSRGHRQKEQRSHLGDARLNLPNKVFQNGHYYDPQTL
                     NPTNMSSIPPRVRTPLLGPSKREAMKNDPFYLLGINPAKPSLADDTYKNGAILSQFTT
                     EMGRIQSRNVSGLTCKSQRQIGKAIRRARALGILPVLSRGHGRGGAGWR"
     gene            <353982..>355658
                     /locus_tag="MRET_1062"
                     /note="MRES_04230"
                     /db_xref="GeneID:38737828"
     mRNA            <353982..>355658
                     /locus_tag="MRET_1062"
                     /product="thiamine-phosphate
                     diphosphorylase/hydroxyethylthiazole kinase"
                     /transcript_id="XM_027627689.1"
                     /db_xref="GeneID:38737828"
     CDS             353982..355658
                     /locus_tag="MRET_1062"
                     /codon_start=1
                     /product="thiamine-phosphate
                     diphosphorylase/hydroxyethylthiazole kinase"
                     /protein_id="XP_027483339.1"
                     /db_xref="GeneID:38737828"
                     /translation="MTLDLSVYLVTGRELLPPGKDYFVSLEESIRDGHVPIVQIREKS
                     ASFQEFLDIARASLTICDKYHVRMIINDSIDVAEHLPERVGLHIGQDDEKIECARRRL
                     GPNRIIGLSVHTVEEAQAALNSDVNYVGIGPCWPTKSKDGVKDDDALMLCGARDIVAS
                     LRRESASTPPGKHTSLPSVLIGSLNARTARRSLLGSSTEHAMADGIAVISAIVSRQDP
                     DAAAKELHDIVTSARREHESIFSSSAQPKELVQQSRELLTAHHARYDCNTRKHDTSRV
                     TLPRPLVQSITSHVSSNFSANITLAFSASPIMSHEAQEAEALSYAQGSLLLNLGSISS
                     EARRGMSVAGPAANERGKPVVLDPVGAGATSYRLATVHSILNETQVTLIKGNAAEIAA
                     LCGSNDAKAQGVDSVGELRSAPALVRRLARQEGAFVLLTGEVDYLTDGECVIESRCGS
                     EMLGCVTATGCSLGCMVAAGLAAAQVKYGVQLGCQTQQRRVPPRTHSALLVGALAALL
                     TFTIASEHAAERPTVHGPGSFIPALLDEVAGFDPTCLPSYVERVTLSPVS"
     gene            <355708..>356351
                     /locus_tag="MRET_1063"
                     /db_xref="GeneID:38737829"
     mRNA            join(<355708..355755,355781..355849,355875..356068,
                     356095..356131,356157..>356351)
                     /locus_tag="MRET_1063"
                     /product="GINS complex subunit 3"
                     /transcript_id="XM_027627690.1"
                     /db_xref="GeneID:38737829"
     CDS             join(355708..355755,355781..355849,355875..356068,
                     356095..356131,356157..356351)
                     /locus_tag="MRET_1063"
                     /codon_start=1
                     /product="GINS complex subunit 3"
                     /protein_id="XP_027483340.1"
                     /db_xref="GeneID:38737829"
                     /translation="MNQDYWGIDDILVESQQIPCVFNIDVPGLGYLEGSEEEDIHKHT
                     RLELPYWMAQMLAVYDIITIQQPKPYGARVRSALNASASSVRLRDLVPYWYAMALRLS
                     QLLDSEEMKHWLAKTYMGRLPRIYELSVLLGRTTTHSDALTAGHMQEAGGLTMEMQEF
                     LQGLDENETACTLVPIHKKC"
     gene            complement(<356399..>359503)
                     /locus_tag="MRET_1064"
                     /note="MRES_04235"
                     /db_xref="GeneID:38737830"
     mRNA            complement(<356399..>359503)
                     /locus_tag="MRET_1064"
                     /product="exocyst complex component 5"
                     /transcript_id="XM_027627691.1"
                     /db_xref="GeneID:38737830"
     CDS             complement(356399..359503)
                     /locus_tag="MRET_1064"
                     /codon_start=1
                     /product="exocyst complex component 5"
                     /protein_id="XP_027483333.1"
                     /db_xref="GeneID:38737830"
                     /translation="MVTSLAQPPPHAAPHRMPRNRPAPRAPARPPRKMDLDMNKPPVE
                     RLCTLPTFQGAFNASEFVSALCEDHMAQAKARPVFDARPFAETISQAAHELQGIRTKV
                     LERTASLNSAVQVSQSVYTKKIRQLTNNFDATQSSFDSLQTRISEVGRTAIRIGEQLE
                     ALDRQRTRASETKDLIEFYYMFARGSSERLDYLRKHAGRDGRLKAATILRRLAVISRE
                     VDIEGSSDTSHAIERYCEQFERDMLRLFDKYYRRSDPKMMSHIAHVLQRFNGGMSCIN
                     IYVNQHDFFISKQRMAEAEKIGTAPLWAHITDPNSVPPRSEPSLDALYADIRRTVELE
                     AQIIAAVFPTPLLVMQLFLRRVFGQSVQAYIEAIMHRALEKDAAAAGTTRQDTTIDAA
                     GLAFLRMLHVTRSSTLLLVSELKTIDLRSAGITVSSGPYSSSNLDGLFALSNQEADAL
                     IGTDSYTSEQLAAAGGSVLGAMLDQSVEELFFQYLEQLRYLDRECRVLSGLFAHTLQY
                     FFAWHQATLKATRTNATIFSRIRDQFTGNTGSFGSSVAFSTLSDSAGYGAAPQVSSFK
                     RLVDRARGISMSEEEVAPPLPVGENPDERGEISLSLAERLLRWHAESLGRCVDLCAAS
                     DVPKNTFILLRVLTDAYLKAYVEAALETATVQMFGYDVRASTPPDNSVLTLLRRVEEL
                     TELWQHYVQTAVLPLTASSVTLRRETAIYNNHNMLRVEGKSEALLQKYTDNLLGFMAS
                     RLSTQKRTDYCPRNDDVALTQLNTEPCLAIVDTLEVLEQEARSTLSERTCEALFTEVG
                     IGFHALLCDHLKKYTVNATGGLMLTKDLAMYQDVCGRFGVPVVNDRFEMLRQLGALFI
                     VQPGVLKSYMREGHLSSVDETLLRPYLLRRQDYARDVRLLEEDNTGDTSTDEVQGRSS
                     TLFASSNQSSTMSTSWSAAEKNREFSRNVSSFVTDVPDLASLSEQLVHPPQERPGSSR
                     SSRGDSSPARSGTPQAMHWSVTGSPGRMDTGNERPSRTPSPSKMSRDPLASLHSLVQE
                     LDLS"
     gene            <359637..>361985
                     /locus_tag="MRET_1065"
                     /note="MRES_04240"
                     /db_xref="GeneID:38737831"
     mRNA            <359637..>361985
                     /locus_tag="MRET_1065"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627692.1"
                     /db_xref="GeneID:38737831"
     CDS             359637..361985
                     /locus_tag="MRET_1065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483334.1"
                     /db_xref="GeneID:38737831"
                     /translation="MSLADSLLAPLLTALDTRVGVREALQAAKSQDVIRRASEAGDAD
                     ALRALEKSIASWLGTSPAQNADEPAWAVGADVAHAFVEQCGWSVVEAHGHAWVQRAMS
                     HLEHVAAKGVPPALLVSMAPLVRLAVFDVMGRESEAHPDFHRAVTAPHISRMGHAIVS
                     VCEACQAGPSSRAFAQLLDALTLHVRLYPHTYRTHVARMHALCMQTLFGPYAAMDASV
                     MPRSAVLVSSATQLLSALHLTGAASTSSVDRDAMAYTGPQKLSQAQLWAATMQEMLDG
                     LVTSLHGCAPSVPWAAWGVPAPSAAMPLAWTAPVPDYAISLPACLRRCEMLLGRRDAP
                     GVLLWFMSTPTPRAVPVPVARCVAIATAMIQARVSRDDAPVDQLRHEEAIVPRLREMG
                     ALLLVHVAKTCQQACWVPMHAAQSLHAVCAMAERAAGAHERVCALWALYHLLSPDSEA
                     CAAVPLDPASPLVQRIARLCVQTQSAYVVQEPASWTCAPPLKRVRAFESDAVHVSSRA
                     AQDAILVKTSDALEAVRYAMQLYVSLFGMLASSAAPGHRDLARTGALALVGLVEALVD
                     ARILDASNEHMVQLCEHGIHALTMLATTHTGALIASILPRVHAVLCRGAQSRVLRVRR
                     ACVLGTSAVLPVLRPRVPPLVDVVDSSALEERIPEADAQDHVPLPAPAWHGADTVAAT
                     WTTVADVAPPGPVGVAPKQASAAPAPTPASVPAPAPAPAPTPAPAPAPAPTLPAPPEA
                     STPAPPLPAAPLASAHDPVDDDDDEEAMPTLDMQASDDEGSN"
     gene            complement(<361991..>363433)
                     /locus_tag="MRET_1066"
                     /note="MRES_04245"
                     /db_xref="GeneID:38737832"
     mRNA            complement(<361991..>363433)
                     /locus_tag="MRET_1066"
                     /product="peroxin-2"
                     /transcript_id="XM_027627693.1"
                     /db_xref="GeneID:38737832"
     CDS             complement(361991..363433)
                     /locus_tag="MRET_1066"
                     /codon_start=1
                     /product="peroxin-2"
                     /protein_id="XP_027483335.1"
                     /db_xref="GeneID:38737832"
                     /translation="MSRPADRAAPAFYEEAYARASSSVARIRDGLPSFPMPELRVQRV
                     GQLDANLLDQELADLLAQPVTAALRRASPSLERRYAAEIRMMLRLILYKFSIYDRRAS
                     YGAMLQNLQYRNEWAAPTTRDAPLSRMQLALYPLCSIIAPYSLAKAHAYMSAHQYDQA
                     PRESAAFVAYALWRHGQRLWNLASLVNFGLFLWNGKYRTITDRLLGMRLVYANRALHR
                     HVSFEFLNRQLVWNALTEFLLFLLPLVRPQRVLRRIAQLPSHPAVLGIVYDVLPRSVS
                     RRMGLQVDESDGQVRMARWIKSQRLGRYWYLPDECCPLCFERLEREAGVYTDTPPSPP
                     PLRRAAIPEDGRSMRLPSETQDMAASQPRRRLDHRAESGSDDKAAHRAERLAARRAAR
                     HGVTAAPGEKRPTLHDTSPMGIKYMDALIVTPYRTLPCATHDHACQYCYVCIAETLRD
                     DNVQLDLQQLGGWPCLRCGEYVWGAERVPV"
     gene            <363504..>364157
                     /locus_tag="MRET_1067"
                     /note="MRES_04250"
                     /db_xref="GeneID:38737833"
     mRNA            join(<363504..363628,363656..363691,363717..363952,
                     363991..364017,364045..>364157)
                     /locus_tag="MRET_1067"
                     /product="magnesium-dependent phosphatase 1"
                     /transcript_id="XM_027627694.1"
                     /db_xref="GeneID:38737833"
     CDS             join(363504..363628,363656..363691,363717..363952,
                     363991..364017,364045..364157)
                     /locus_tag="MRET_1067"
                     /codon_start=1
                     /product="magnesium-dependent phosphatase 1"
                     /protein_id="XP_027483336.1"
                     /db_xref="GeneID:38737833"
                     /translation="MEARWPRLVVFDLDYTLWPLWVDTHVDPPLKRTRHINQVVDRGG
                     QPLSFYDPVPEILFQLRQNNVKIGAASRTQAPSVAKQALAGLMIMPPASQEPPVSALS
                     LFDYMEIYPGSKVAHFRRLAQLSEIPFHDMLFFDDEHRNAEVESKLGVKFVLVGTQGL
                     DRATFDRGIRAWRERSAP"
     gene            complement(<364154..>365602)
                     /locus_tag="MRET_1068"
                     /note="MRES_04255"
                     /db_xref="GeneID:38737834"
     mRNA            complement(<364154..>365602)
                     /locus_tag="MRET_1068"
                     /product="histone deacetylase 1/2"
                     /transcript_id="XM_027627695.1"
                     /db_xref="GeneID:38737834"
     CDS             complement(364154..365602)
                     /locus_tag="MRET_1068"
                     /codon_start=1
                     /product="histone deacetylase 1/2"
                     /protein_id="XP_027483331.1"
                     /db_xref="GeneID:38737834"
                     /translation="MVEPARELGATRSKVAYYYDNDVGNFSYGFGHPMKPHRMRMAHS
                     LILNYGLDKYMQILRPPRASRHQMTKFHTDEYIDFLSRVSPDNAQELTGDGTRYLIGE
                     DCPAFDGLFEFCSISCGGSIAGANKLREGSADVVINWSGGLHHAKKREASGFCYTNDI
                     VLAILELLRTYSRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKFGDFFPGTGDVRDV
                     GMKKGKSYAVNVPLRDGIDADTFASIFRPVIQHIMDWFRPAAVILQCGADSLAGDKLG
                     CFNLSMRGHANCVEFVRSFGVPMMCVGGGGYTIRNVARTWTYETGLLLGKKLGADLPF
                     NEYIQYFGPEYKLDVLPTSMDNLNTPEYLEGLRTRIIDNLRSMPFAPSVQMQHTPRAS
                     PFAGDDGALSEDEDSDLDERITQRLRDRHTQAFGDELSDDEDEPNVVAAYEADMAMMQ
                     AARPLPTPWAPMPMPMPMSGAPPPAMLPFPHA"
     gene            <365765..>368908
                     /locus_tag="MRET_1069"
                     /note="MRES_04260"
                     /db_xref="GeneID:38737835"
     mRNA            <365765..>368908
                     /locus_tag="MRET_1069"
                     /product="general transcription factor 3C polypeptide 3
                     (transcription factor C subunit 4)"
                     /transcript_id="XM_027627696.1"
                     /db_xref="GeneID:38737835"
     CDS             365765..368908
                     /locus_tag="MRET_1069"
                     /codon_start=1
                     /product="general transcription factor 3C polypeptide 3
                     (transcription factor C subunit 4)"
                     /protein_id="XP_027483332.1"
                     /db_xref="GeneID:38737835"
                     /translation="MAGGSRPQALRSPPPPPEDVGSDWDSEGSGSSAFDEYEPSDDED
                     EYVQEAPPSVADNDEEADIAQEDFTRLIRAFQDEPGAEKGTASKGAAARSSSAWKQSM
                     EAEMESFHHELRDVNGYTRKNKTTRIREQALSSEVKALLAQANISYVEANLPMAIQQL
                     EEVIRIEPTVAGAWYTLGMCFEELGEEEKSIQCRIVGAHLTSNASDEWKSLARRSRER
                     GLFQQSIYCLQQAIKKNRYDIDAIWDRAVMLKDSGRLRAAIDAFLAVLKLRPYDAEVL
                     RELIPLLVSAGDYEAGVEILENMRQESLHGRPDPNIDPALAESMSAAEASVQFTLNEL
                     VTLADLLLLLNRPLQVILVIKQTIRWMRGQIREDRVDDAQNDLELDEGESDQPYELDR
                     EVRLRLGKARFMLRDTEEGKRHFSVLMDEADPYDFPVLYFEMAEFYFEYQLYAEALEA
                     YRPLIEEGLVDDMQAWFHMGMCYQYLEMTSEAVQVYESILAEQPTYFDVKLSLAEVYE
                     ELGEREKALGLVNDVLVARSENKQAPSEPDAPGPQDQAEPSLSFFNESAPSQILPAGS
                     IPSRNSRSGLSFAERQRLEQQREEETRLAWIQLCALEPQVFVDGFWHRDFVFLDGPLS
                     RPPSKAADSATQQRFDATRQWMQVAGRLVESFRSMSLLFPKERFTKYRGVVRPRRSRR
                     SKPSDLDSHAEELLSRLRDQMVDEVVAQSAMEDGFEPEQTTFRTIHFDDWVMLFMKYG
                     IGLAKMGGEDDAIDDMFRHVMVSNTVWPSEERKLALHLCWLACALYARDPTRAFEIAR
                     WLPTTYQFHNEPLRLISSLANSLGFYGVDAFVSSTNTKQYQRRMRTHETIVSGGPIKL
                     NPRTGRWTMMGVDEEDDKGMGNDDLVGKVQAQAPPTKSSPIGEIFYGYLMLCANSFQP
                     AMGYLYRALALQQSDPLLCLLCGVASLGRSTNRQVDNRNHTIIQGMALFTHYAELRGD
                     IPEVDYNFARAYHHLNLVHLAVPRYERVLERASSKASKGTFDMAREAAFNLAMIFTQT
                     GSPDLARHLYRTWLAVE"
     gene            <368970..>369836
                     /locus_tag="MRET_1070"
                     /note="MRES_04265"
                     /db_xref="GeneID:38737836"
     mRNA            <368970..>369836
                     /locus_tag="MRET_1070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627697.1"
                     /db_xref="GeneID:38737836"
     CDS             368970..369836
                     /locus_tag="MRET_1070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483291.1"
                     /db_xref="GeneID:38737836"
                     /translation="MRSWPLVTCALSVLNVVASAADARLSEYSMLHRVLDHTDASSMS
                     GPWSPRALIQVPATLEAGPQVKYQGVDDHLAIEEASSNALYQVKIVPGNVFELPNDEY
                     EKALSDDGFVSYTKLCQLQVQQEGASLPDALKLHMMRIPSDAGTKLAIAGVVYAVEQD
                     ADMDLNACPVFANKGMPAIYARSFNTELRLMLPETLSGYVHIPSTNETTQSAGKDGKG
                     SKNTREQPKNLVEFLQRYWIYLLPLLILFAMPAAEEPPAPPSSDKNTGRRQQGRVQPG
                     PAAKAASSGMRH"
     gene            <369978..>370888
                     /locus_tag="MRET_1071"
                     /note="MRES_04270"
                     /db_xref="GeneID:38737837"
     mRNA            join(<369978..370805,370838..>370888)
                     /locus_tag="MRET_1071"
                     /product="18S rRNA (guanine1575-N7)-methyltransferase"
                     /transcript_id="XM_027627698.1"
                     /db_xref="GeneID:38737837"
     CDS             join(369978..370805,370838..370888)
                     /locus_tag="MRET_1071"
                     /codon_start=1
                     /product="18S rRNA (guanine1575-N7)-methyltransferase"
                     /protein_id="XP_027483290.1"
                     /db_xref="GeneID:38737837"
                     /translation="MSRPEHQAPPEIYYNDTEAQKYTANTRNQEIQAEMTLRAIELLA
                     LPEHRHPALIMDIGCGSGLSGEILTESGHEWVGFDISPSMLSVGLERDVEGDMILADA
                     GHGCMFRPGSFDGAISISVLQWLCNADTSYNSPAARLSSFFTTLYASLTRGARCVFQF
                     YPESDDQVTFIMSQATRAGFGGGLVVDYPNSVKAKKIYLVLWVGGEMLVGPNGEGQGV
                     KQTLPAPLDFDESGSTVLHETRKAHDRRRDRHKKSRKIESSKQFIQRKKDINRSRGKL
                     DVPHDSKYTGRRRRHK"
     gene            <370953..>372120
                     /locus_tag="MRET_1072"
                     /db_xref="GeneID:38737838"
     mRNA            join(<370953..371120,371146..371392,371417..372082,
                     372110..>372120)
                     /locus_tag="MRET_1072"
                     /product="syntaxin 18"
                     /transcript_id="XM_027627699.1"
                     /db_xref="GeneID:38737838"
     CDS             join(370953..371120,371146..371392,371417..372082,
                     372110..372120)
                     /locus_tag="MRET_1072"
                     /codon_start=1
                     /product="syntaxin 18"
                     /protein_id="XP_027483289.1"
                     /db_xref="GeneID:38737838"
                     /translation="MRHHGPPPVIDETSTFVGLLKEYSEHQVVERKKPVDPAVSKQLE
                     AAASWTREAYVIKRHISSLFAFLAMIRRPYLDITSKNRRNTDMEEEKMDFSDTFSRWQ
                     GASSLTESERDEVDFQVKLLVKQCLSRVQELERGEMLRSQAVSRAFEKAGLGGLAGLN
                     LFKSTVLLQRQAASNMLGLHHKAITQYLSEQLAQASSIQATLQQRRVDMQRQRFEKLA
                     DRANRPATSQEGAVLSEEDLRGSIGAMGEEGVDVVSQLSSEQLQVFEEEASTLVQSLE
                     ADLFAVQHAEQQLHDISSLQTKIVQHLEEQNEHVDTLLDEGSTHGEQVTRGNQQLRRA
                     KERNRQANRYLSLFFVASGLLLLFMHYLD"
     gene            complement(<372137..>373555)
                     /locus_tag="MRET_1073"
                     /note="MRES_04275"
                     /db_xref="GeneID:38737839"
     mRNA            complement(<372137..>373555)
                     /locus_tag="MRET_1073"
                     /product="pyruvate dehydrogenase kinase"
                     /transcript_id="XM_027627700.1"
                     /db_xref="GeneID:38737839"
     CDS             complement(372137..373555)
                     /locus_tag="MRET_1073"
                     /codon_start=1
                     /product="pyruvate dehydrogenase kinase"
                     /protein_id="XP_027483288.1"
                     /db_xref="GeneID:38737839"
                     /translation="MHAMYGSARRIATSARSFPYGQSISTPSTASASDQDAAVLGRFF
                     YRNRKVNEWANHPAHRTTLRQLILFGRSARRNKTLLMQSANYLRTELTIRVAHRLRDM
                     QTIPFVAMSNEQLDSIYQFYWRTFETLRRMSKIETDEQNKHLIHVVTQLLSERKSKLD
                     LTASICRECIHYMEPETVDLFLARMLRSQISREVLAKQHIALSHMQVVPESSKTPQVV
                     GMIDTQIRVAYSVAQSFKFAKESLAQTYGWDVDDERMPSLEILGDTTIAYLPAHLEFI
                     VQELLKVSMQGTMNLHQKASHTPPIKIRIVDSGSKDDVIIRISDRGGGLKCVHSGNLS
                     DVYNQGSNVIRARGPSLLPGANTVKPWSAKEDTLLWSFHNLGKELERMNIQLDARATL
                     DRTHISADGAETPDPSSSYPGGDGLMRLSVLNMDSRSGLPIVRLYSELFGGKLDFRTL
                     DGYGTDIYLRLPKDGTNKELHE"
     gene            complement(<373689..>375149)
                     /locus_tag="MRET_1074"
                     /db_xref="GeneID:38737840"
     mRNA            complement(<373689..>375149)
                     /locus_tag="MRET_1074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627701.1"
                     /db_xref="GeneID:38737840"
     CDS             complement(373689..375149)
                     /locus_tag="MRET_1074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483293.1"
                     /db_xref="GeneID:38737840"
                     /translation="MLTVFETLWYACLAYTGFILYRRWVVYSRTRHFILEQRRKAGIP
                     DSDHRSLPEAAADAAARRQIDYEKQLQSSDDVFRPHVSRSKALHSGFAPKAVFRPIPV
                     PDVEQEAKTARAPPLEDPETFYGPRVSRRLHSTPILAAKKRMADEISEAPEVEQRRST
                     VPRRVRRKVSVEAPDLHEAEEAEAMDEEVEENASEEEIESSMDEEDISYDDDSEDMDE
                     EETGQVESQPASTSMKRSADTSADHAPGDEWTDANGLRWCIGDDGIPRRAVMLIEMRP
                     KYSMPRDTVHPDAQLRVPTYVERFLSHEEYEEAKRKKQLSWQHELSHAKGSSPSSFQS
                     DDVEDSLASMVARRSRGQASRKGAHDLLFSDMMRSRRPNASSADESPSNISMSDASFD
                     DSASFSSSFRADQSDLSGRLRLSRSTASPMRRDGLPSKSLPLLQQRYTRMYAPSPLSS
                     PARRALDPEAKRKREERLMSRIRDEREKSRRSNQNS"
     gene            <375424..>377130
                     /locus_tag="MRET_1075"
                     /note="MRES_04280"
                     /db_xref="GeneID:38737841"
     mRNA            <375424..>377130
                     /locus_tag="MRET_1075"
                     /product="calcium calmodulin-dependent protein kinase"
                     /transcript_id="XM_027627702.1"
                     /db_xref="GeneID:38737841"
     CDS             375424..377130
                     /locus_tag="MRET_1075"
                     /codon_start=1
                     /product="calcium calmodulin-dependent protein kinase"
                     /protein_id="XP_027483423.1"
                     /db_xref="GeneID:38737841"
                     /translation="MNGGAVDATSFLSKQAIPTMVAHTTATPTILPVPQPQQTTINNT
                     MSSTQTESKMIAPAAADRLYRAQNEDAAAQSAASKNRIPTYNELPARYQLIQVLGSGT
                     FSEVYKAFDSVTGSYVAVKVIHFEDKSQDALNPSIRAQNRSPELASILQEVQIMRRLR
                     HQNIVQLLDFVQTTEYCFLVMEMVNGGELFDQIIKLTYLSEELSRHVICQVAEGIRFM
                     HVECGIVHRDIKPENLLFEQIDMVPSDSFHRKPYDEESKVDEGKFIPGVGGGGIGRIK
                     IADFGLSKIVWQQATKTPCGTVGYAAPEIVRNNQYSLSVDMWALGCVLYTLLCGFPPF
                     YDESIQALSEKVSQGKYAFLSPWWDDISDEAKDLVSKLLCVDANKRLTITQFFEHPWV
                     NSKKSMPSSTPVPLSQYRMKSWSQLSKDVSVDSPLLASLHGNDHYDVKAQLTPYSKEN
                     LHEAFDVAFAIQRIEEEMRQTKRCAKFGLPNYAGVNSTADDIATAPARYGQTAAKVIL
                     DKHDARVKQTGLKLKKSAKDEFHLSMDHATILKRRKFSPGFKNHERLPTGIHAFSERI
                     QA"
     gene            complement(<377158..>378576)
                     /locus_tag="MRET_1076"
                     /db_xref="GeneID:38737842"
     mRNA            complement(<377158..>378576)
                     /locus_tag="MRET_1076"
                     /product="L-threonylcarbamoyladenylate synthase"
                     /transcript_id="XM_027627703.1"
                     /db_xref="GeneID:38737842"
     CDS             complement(377158..378576)
                     /locus_tag="MRET_1076"
                     /codon_start=1
                     /product="L-threonylcarbamoyladenylate synthase"
                     /protein_id="XP_027483422.1"
                     /db_xref="GeneID:38737842"
                     /translation="MWRVGSSFLRRVSSTMSNYNTKLLPLERELDTSKPGNFGLVFSN
                     ADSSPSSSFQDPCEVLDVSFTSDVSQQSMKKAAEHIRAGELVAFPTETVYGLGACALR
                     TDAAERIYRAKNRPADNPLIVHISDLRMLSRLVPRDFHLNKACDALIKAFWPGPLTLL
                     FPVGRDEQDEPYVPTTVTCDQPTVGIRMPSHPVARALIAMAGVPIAAPSANASGRPSP
                     TTAEHVLDDLGQRQVLSYILDGGKCDIGLESTVVDATTVPNEVRILRPGGVSVEQVAQ
                     VLDHAGLSDVAIRVYGKNLQGSPHENLKPATPGMKYRHYSPEARVILVRLCDNDACTS
                     MKDVLQEFLSSFSRDHVPHVGLMCALDSPLVQLLQVPDLVQWTKQATKDDYLSPVYCT
                     EQFQLCFYSLGYQDAPDIAARRLFDGLRTLDACIPWRDEARTCDVIISESLPEHGVGL
                     AIMNRLKKAASRTICVRKNGSA"
     gene            <378708..>379082
                     /locus_tag="MRET_1077"
                     /db_xref="GeneID:38737843"
     mRNA            join(<378708..378971,378996..>379082)
                     /locus_tag="MRET_1077"
                     /product="cytochrome c oxidase assembly factor 6"
                     /transcript_id="XM_027627704.1"
                     /db_xref="GeneID:38737843"
     CDS             join(378708..378971,378996..379082)
                     /locus_tag="MRET_1077"
                     /codon_start=1
                     /product="cytochrome c oxidase assembly factor 6"
                     /protein_id="XP_027483416.1"
                     /db_xref="GeneID:38737843"
                     /translation="MANPAPTRNNRQQCWDSRDLYYECLTKHSILAPPGTDMTGIKGP
                     LGSGSFADPPGSPEERLRRSEEELKTDPCIQLRRQYEQKCAPSWIEYFNKRRVLEERQ
                     KLFYAQAEARAARR"
     gene            complement(<379085..>379772)
                     /locus_tag="MRET_1078"
                     /db_xref="GeneID:38737844"
     mRNA            complement(join(<379085..379224,379259..>379772))
                     /locus_tag="MRET_1078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627705.1"
                     /db_xref="GeneID:38737844"
     CDS             complement(join(379085..379224,379259..379772))
                     /locus_tag="MRET_1078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483412.1"
                     /db_xref="GeneID:38737844"
                     /translation="MWWQRSIAESPASSKNDSAESLYQPSKIPKRGNSQSPIIMPFST
                     ILVVSAFGFGFLSGVMSGARHTALVYLAENAHRRPETVQGWYFYNKTKYYRMMMGGVK
                     QGSRTGLKLTGWVGGWCLLDVLSEDARKYLAEKQQESEMPHGSFVISKLGHWSDGALA
                     GAVTGLIGSIAYRLSSPTVPRMLLLGAVAGGASGALRDIRLSLMRGQDPRQQRRETL"
     gene            <379886..>384295
                     /locus_tag="MRET_1079"
                     /note="MRES_04285"
                     /db_xref="GeneID:38737845"
     mRNA            <379886..>384295
                     /locus_tag="MRET_1079"
                     /product="L-2-aminoadipate reductase"
                     /transcript_id="XM_027627706.1"
                     /db_xref="GeneID:38737845"
     CDS             379886..384295
                     /locus_tag="MRET_1079"
                     /codon_start=1
                     /product="L-2-aminoadipate reductase"
                     /protein_id="XP_027483411.1"
                     /db_xref="GeneID:38737845"
                     /translation="MATDTGVPRSHPVHGFPSQDDLEYWSQQLRNLPRLALPLDYPRP
                     PTTRVVHALKSYVLPPSTCRALARLSLYEDEEVSSRFEEPRGMDEQPRACHLLLAALV
                     VLIHRYTGDTDMVVASNHPTSGEALLLRIKIEPGDAFWQVAKHVQAVEAEAIRHLVPY
                     DEIAKRLESDRLAQEGPAVPGTSQSLFRVRFFDETTSMERFMQQTNATTDLSMFVTGP
                     EASVNAEAGPAQSTAPKHLHSAFRAPTHAEVAVHISYNAILFSGRRIEGILHQFEQLI
                     NSAAKNPMAPVGQIHIRAQAEADILPDPRKDLDWCGYRGPITSYLERHAKSFPDRRCL
                     VESVSTDDMMPPASRVRTVTFGELDRTSNVVAHHLLQSGVQRGEVVTVYAHRGVDLVV
                     AVLGVLKAGATFSVIDPSYPPSRQNIYLQVARPRALVVLRKAGTIHEQVRRCIQEELE
                     LRTEIPALELRSDGALLGGSTDKGDVLDKAQVLASEPTGIVLGPDSIATLSFTSGSTG
                     IPKGVQGRHYSLTHFFPWMGERFGLSEKDRFTMLSGIAHDPIQRDIFTPIFFGAELHI
                     PTAEDIGTPGRLATWMATSKATVTHLTPAMGQLLSAQATTPIDTLRNAFFVGDILTKR
                     DCTRLQALAQNVRIINMYGTTETQRAVSYFAIPPASQEPAFLQRQKDIMPAGQGMIDV
                     QLLVVNRNARQETCAVGEIGEIYVRSGGLSEGYLGQPDVTAEKFLNNWLATGLEIPDT
                     LQGTPEGQFWKGPRDRMYRTGDLGRYLPDGTVECTGRADDQIKIRGFRIELGEIDTHL
                     SRHPSVRENVTLVRRDKDEEKVLVSYFVPTDDSTPEEREDDVSLPAGPSGDLLRRIRQ
                     YNRLIKDIRDSLKLKLPSYSVPTLFVPLARMPLNPNGKVDKPALPFPDTVLAQRMAQV
                     SNAQAETRELSATERAIAEVWKQLLPGLADPAPLDESFFDLGGHSILATRLVFQLRHK
                     LGVHVPLGLVFDAPTIAQLAAATEKISSGGTDFLVAAPDAAKENASSGDLDYAKDAQV
                     LENELPASFMRATPAGEPRVVLLTGATGFLGAYVLADLLDKRRNHVQKVYVHVRANDA
                     GSAQRRLRDALAGRGLWREAWEQEGRVQAVVGDLSKPHLGLNDEDWAHLAKEVDVIVH
                     NGALVHWVYPYSKLRAANVLSTMAVMRLANEGRPKSVAFVSSTSALDTEYYIRFSDTS
                     AQGVLESDPLDGSASDLKSGYGQSKWVAERLLMAAASRGLAAVIIRPGYVVGDSKTAV
                     TNTDDFLFRLIKGSAQLGLIPDMNNTINMVPVDHVARVTSLAGLAATQWPENRQTHAA
                     VFHVTSHPTIRYNEFLGALIEYGWNVRPAEYLEWRTALENHVLASAAAGNTGLDADSN
                     ALFPLLHFVLDDLPTSTKSPELNDANTTKLLTEAHELDVVRGVDVPLVGLYLSWLVAV
                     GFLPPPASKSARTLPTLPEGAARQAMGRGSAAV"
     gene            complement(<384292..>390990)
                     /locus_tag="MRET_1080"
                     /note="MRES_04290"
                     /db_xref="GeneID:38737846"
     mRNA            complement(<384292..>390990)
                     /locus_tag="MRET_1080"
                     /product="cell morphogenesis protein (PAG1)"
                     /transcript_id="XM_027627707.1"
                     /db_xref="GeneID:38737846"
     CDS             complement(384292..390990)
                     /locus_tag="MRET_1080"
                     /codon_start=1
                     /product="cell morphogenesis protein (PAG1)"
                     /protein_id="XP_027483447.1"
                     /db_xref="GeneID:38737846"
                     /translation="MDQEEEAQVVIPDLEDEDVLGSCLDATLNNGFSSPNGLPTDPRS
                     ADISDAQHLPPPFPTPSSSSIPISTSKRTPGKLLHFRTASLTADESASISAKSSLRFG
                     SSFSNAFQGMDYFQSPGRSTDALHNFSFPVKKPSFASLRAAIKGQPSTPTHKEPSSDA
                     GPSPLSRSADISAVSSSLMQSTSTPWSVKWHKKGASQDGSLSGPLNLSPTRPMRPQHA
                     HKISQMSDMLADGMPVSPLGNVAYPTSHDMLSSPVEDVDALHMLSPFSTTPSAEPMTY
                     AMRQIFARFQALADDALHAVLVTQQDCDVLSILFPTQAHRTGWDDVLSTMASLARHNR
                     PLVIESLLTWRSDVLDHPLSLRPTHRRPSDALSISSINSVAGDVLHRRRALASTYLTS
                     QALLVTVPPGTNDRMGDEEEDPAMNEFVTTVFQFLHLCSMDRESERGSQTRLHTSLQQ
                     QCFDVVARLIGELSRHCLPMLGAQFVSILQQSSTVVVSRDNELLTEAAVLGMRYLRII
                     TYPMDVFETGAEFLQVLARFFVHSHGYRIKRAFARVLHTIIEPVARTASAELFHPTWM
                     DAMATLMPKTQGMAMRARYFGTAYPLWTVALCASPPDVLVDRWFPCVEAGWSRMRERK
                     DTETRAMVYACAAQLFWAYLFRCHEGTNPTQRRLDAFFGLCLPPVRSNVSPTDVCVDS
                     CVDMLSAALYRQFEYTYPLILDMLRHTSLDKKSAPAVFQPDLLQPVRMCIAIRSVART
                     RHYYVCGEMPSLPGAALPSMEELAIEPEGSVAVPNAHVEQVQMQLDAVMTQIALHCDY
                     LLKDLTVLDGQVPLAPGTNAPHLPTTPGSEPFEVRTHAQGAFTVAYAAEHQPYLDLLR
                     TCIETWPRCMSHSVSKATCHSLLFRGLFCVEPRVQQASAAALSRIARGGEEAHSILRA
                     LLQWLFRKDGVVWELQSHADVLVAQFAQVADVMVSLLELCGTETPPPDELETGAWLLL
                     CVPSSVLRHRTTRLLLHHTSLSEFYTKFFMRPCTDFIDQSTSSQLSASQRARIAKWRD
                     AGSAYPLNRLASSSENGTLWSAALPRVLQHLEQRAPHLTEQLYVLLLGAVQRLEPSMA
                     SIARLRKGTAQVPLTLTFLRQIWRMYVLALCTVCRAHTQHIALLMPYLVCDDYDLQST
                     AAEALSHCHALAYPTLISALSHLFDNMHWPVRLCIGHILAQTTAALTSASSLAPWLLT
                     WIHQTMHILQFDLAPDVQVYRLRRYLCMVLAGFYSSLEAEHAAHVFPVELRMRLLIVL
                     HDWRSLQDASRLAAQLSAALERTASKPKDKIIVSLRHELHLLALCAEDAMAALCAGGF
                     DSTTMDTSPVLTWLCEMLAAPSSHTRDTAQRGLRALLMHNPSNAVVLDTVVAYCYHDL
                     SQSHASRTAFAVLCDTYPHLEMPAAHIVCLSLCLLAHPDVHLRTRALNMLESFTDRQS
                     TPVSLISMSPSVLSFHPAVYLDAQSSISQLLSHATVINALAEWTRRIDDIPPSFHEPV
                     LTLIPPWLRAASLGNESDALVHLVTLSHLFGRAHPLAVRNLWQAVGWSTADTHALLHF
                     LHTRTLHYRSFEFLEVARLIVANLPPAARQVAQHALLESMVPEAAIPYSPSGISALSI
                     DAYFPPPGTELMPLAPTLISLLFFGECVDASLLRHERLPIVLHLLCMYLDGTSSALHS
                     SILRAAEQILSVLPTRIELQTNLFLALRSAHAMSRIDLVTYGAMHVPQKLEVLVNVLC
                     DAVERHVIPIRDVWCDVAQFWAVNAPVRRMACRSLQVMRALRPTYAISAVPSLLARLA
                     ETLPSSEAMPYTLELLSTLEAIIPTAVPEVLAPIFWAVAACVQTTWIPVFVATVSLLH
                     TWMDHIDMSLSTCNTLWTSRPSSWNVSAAGIQCALVRGLRLPRCDVMVLHLLERMAHI
                     EHPELLESTMQDRVLTLFTAALPWFLQACENEKSAHHALVLRLGDALTNLANNAQRSD
                     VARITASIARGRFRRADDLARQAALSIALGCTQPRAVHLVTLLVLMLYHESEDLCRLV
                     LLALPPCLQALQAQDISSLVPDVPLDPLVRLLHSPLASLALDVLHSPIFVDESSTPTL
                     QVCGWTGLSAESDARMSCSNMQAVSKTWSVPDSERGVLAFVPDGDGDADDERDELDTL
                     ASQLDDLASFFVQDSTEPPSPQPSQVAKILARSARHSYIPQPSLETTTNSLDASTASY
                     DTMSLAPQPLSFSTYSPDPFLSESTKISAPIDEASIKNVSLL"
     gene            <391106..>392818
                     /locus_tag="MRET_1081"
                     /note="MRES_04295"
                     /db_xref="GeneID:38737847"
     mRNA            <391106..>392818
                     /locus_tag="MRET_1081"
                     /product="poly(A) RNA binding protein involved in nuclear
                     mRNA export"
                     /transcript_id="XM_027627708.1"
                     /db_xref="GeneID:38737847"
     CDS             391106..392818
                     /locus_tag="MRET_1081"
                     /codon_start=1
                     /product="poly(A) RNA binding protein involved in nuclear
                     mRNA export"
                     /protein_id="XP_027483448.1"
                     /db_xref="GeneID:38737847"
                     /translation="MPKRTHKPLVSRALRGAGLMEDDSMTVDDDGQIGESMTRAQRRK
                     MARSDPAHGGRRGAVNRKAAMNVNSGIRPANARKGAVLGSHALTKASDVSPKTNVVET
                     LRRFLTSRWNASMNLLNLENMQQDAILSEANIVPPGAPGAHRDLGTALWKLSADMFPT
                     LSTLSLAGNAWTNLQPLALLGQYIPKLANLSLERNDLRWVRDLDVLVTKRHGLHALQE
                     LVLLGNPLQQNAVEGGNEDGYRRDVLVKFPDLRILDMKPVMDVERGFSQLFQGRGHKK
                     AGPEASQVPLRHFCVQTRPGFVDGDAKQVVPEFLSLYFSAYDQDRTRLGPVYSSNARF
                     TYSINSSPPPRARAERLMHTMPHQKDLTFDKYIELGSRNLMRTHNVKPLLRSMHYGGE
                     AIVAFLKRLPITMHPLHDASKFVVDAWLLPNVDVKAQTSATERPDALLFINVHGEFCE
                     APSQGIRSFDRVFVVAPAPPASPAQQLGWPCVIVSDMLTLRHYSRESAFQPNALPMGP
                     SAAPGLTPEQHAMSLELSAQTKLTYPYAVQCLGENGWDMTRAVNVFASLQAAGSIPSE
                     AFAT"
     gene            complement(<392757..>393569)
                     /locus_tag="MRET_1082"
                     /note="MRES_04300"
                     /db_xref="GeneID:38737848"
     mRNA            complement(<392757..>393569)
                     /locus_tag="MRET_1082"
                     /product="phosphatidylinositol glycan, class F"
                     /transcript_id="XM_027627709.1"
                     /db_xref="GeneID:38737848"
     CDS             complement(392757..393569)
                     /locus_tag="MRET_1082"
                     /codon_start=1
                     /product="phosphatidylinositol glycan, class F"
                     /protein_id="XP_027483445.1"
                     /db_xref="GeneID:38737848"
                     /translation="MPRSIWPVRHTFDLALILFVLQPTLLVFTLVDFARTSESTTFLG
                     QSFAYLSRVLRPGQRASNVDKTSLVWEAMHSLFGIALTQAWYCVRMSGWLSMAEGYER
                     KEDAAALKRRRIPIRAQVEAIVFSSFSLPLLWALSASIIFALGAPANTAYFGTAILAA
                     HVTLLGLWPVSHILGLPPSPMWSRILAAPSHATPGEILVLVPSACACLGAALGAWAQA
                     LDWGRLWQTWPLPSMYTSAIGLVVGHLLAFVMAMWQRPRMESSRPPAARQTR"
     gene            <393694..>395856
                     /locus_tag="MRET_1083"
                     /note="MRES_04305"
                     /db_xref="GeneID:38737849"
     mRNA            <393694..>395856
                     /locus_tag="MRET_1083"
                     /product="AHNAK nucleoprotein"
                     /transcript_id="XM_027627710.1"
                     /db_xref="GeneID:38737849"
     CDS             393694..395856
                     /locus_tag="MRET_1083"
                     /codon_start=1
                     /product="AHNAK nucleoprotein"
                     /protein_id="XP_027483446.1"
                     /db_xref="GeneID:38737849"
                     /translation="MSDVEKAADPSISDYMSAVTQLDTSFVQEIHATQDLSAAEPHTA
                     HSFSGVDSTNGVASAPASTLGSPTMLASPLTGFSNLHVAQPEARPRRSAARLKRNAAI
                     TRPRAASAASDSPRHVSRTSHASNVAVLSDNDAASTASEHAIDMTRDTASLLSSLEHA
                     DQGSPVSRAASLRSTYASQPPTILSHLGGHAEHDEHRARLPGTSSAPHKGRSMPPSQR
                     SVSSPMPSRRAHIADDRVAHSLVSLSSSPHTPERPLWSLPNDAQQDSAHNEHIGLSRS
                     NSTASAYSDDPAGAESHKAEPPGPDVPPSNDAPTTSPTSAPPAPTDPWLQTPKSPLLQ
                     DTLRDMFDSFASALTDLGMDTNEPIRGLDDVSVSYHHAPYQGGSHGLPSHPSTLESML
                     PPDPPQPAVKPASTLTPTEPNTPLTRTPSTKSDVPPAPEHRLDVYGYNVWWPHAFDIT
                     SNLNYDSVSTSQRARLFGDAMTDLMTRPTHLDVWIQQVKSQRPNQADVLTRQVQQQQL
                     EELKATLSPRPDDPKETPNELPLPSNIPYPLLAKAQSAAHADPGISLARVSPRKGASS
                     SIMQSSTAFLMNQLERGRDLLTPNTAASPTPSRQRTPTTAAPPTSHTSPNASSVMNRS
                     LSARTLGAASTSGSVPMGLGIVQRSASQAPPDPAFSAALTRVRDALPDIDDATARHYL
                     TKSQGDDVRAINDYMAEHASRHDATQRRGIFSRATRTR"
     gene            complement(<395871..>396779)
                     /locus_tag="MRET_1084"
                     /note="MRES_04310"
                     /db_xref="GeneID:38737850"
     mRNA            complement(<395871..>396779)
                     /locus_tag="MRET_1084"
                     /product="mitochondrial distribution and morphology
                     protein 12"
                     /transcript_id="XM_027627711.1"
                     /db_xref="GeneID:38737850"
     CDS             complement(395871..396779)
                     /locus_tag="MRET_1084"
                     /codon_start=1
                     /product="mitochondrial distribution and morphology
                     protein 12"
                     /protein_id="XP_027483451.1"
                     /db_xref="GeneID:38737850"
                     /translation="MSFQLDWQGLEQSFADSLCERLNAFLSGATLPSFLGPTRVHALE
                     LGSEAPDIQVIHVGDVWREFREAEAQASVHAQAQEKCTRSSTPPPRLPMRLRTFRHYE
                     NDEMPLSVQGSGDGDSVLTDIDDASSHRWSDVDSDVGTSDMSCTWEERAREQSIPSMQ
                     LHFSVQWLTSTIRLSLTSSLQIAYHDDTVMSLPISLIITGLELYAQAIVAVDGVSNCI
                     HVSLTEDSTEPCSADGLRQVYDARIRVRHQGQRILPYLGVESQIGEPVKHVLENVGKV
                     ERFVGDMLRQWLEDELVYPHFYTFYL"
     gene            complement(<396818..>397492)
                     /locus_tag="MRET_1085"
                     /note="MRES_04315"
                     /db_xref="GeneID:38737851"
     mRNA            complement(join(<396818..396910,396937..397257,
                     397285..397381,397407..>397492))
                     /locus_tag="MRET_1085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627712.1"
                     /db_xref="GeneID:38737851"
     CDS             complement(join(396818..396910,396937..397257,
                     397285..397381,397407..397492))
                     /locus_tag="MRET_1085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483452.1"
                     /db_xref="GeneID:38737851"
                     /translation="MAEAADPERLVRMRAALEKFLGLIDHKATAKNFSRVLPQVDPIA
                     VEKARLQFLQELKTDIRNDLETLISKYELSQRLQELEELTAEADKRQHNAFADLKDVW
                     RPDLDIQTAIRARVSADQAPRIEALQAELAELQEQNRASEERLHGTEAQIDAVRSNVT
                     SALEMLDKLLVSVSINAPEDEQALRAMLDALLTELGPV"
     gene            <397663..>398030
                     /locus_tag="MRET_1086"
                     /note="MRES_04320"
                     /db_xref="GeneID:38737852"
     mRNA            join(<397663..397664,397701..397800,397935..>398030)
                     /locus_tag="MRET_1086"
                     /product="large subunit ribosomal protein L29e"
                     /transcript_id="XM_027627713.1"
                     /db_xref="GeneID:38737852"
     CDS             join(397663..397664,397701..397800,397935..398030)
                     /locus_tag="MRET_1086"
                     /codon_start=1
                     /product="large subunit ribosomal protein L29e"
                     /protein_id="XP_027483449.1"
                     /db_xref="GeneID:38737852"
                     /translation="MAKSKNHTNHNQTSKAHRNGIKKPRTNRYPNLRGVDPKFLRNQR
                     YAKHGSEKALREARAAAKSSA"
     gene            <398345..>399184
                     /locus_tag="MRET_1087"
                     /db_xref="GeneID:38737853"
     mRNA            <398345..>399184
                     /locus_tag="MRET_1087"
                     /product="FYVE zinc finger protein"
                     /transcript_id="XM_027627714.1"
                     /db_xref="GeneID:38737853"
     CDS             398345..399184
                     /locus_tag="MRET_1087"
                     /codon_start=1
                     /product="FYVE zinc finger protein"
                     /protein_id="XP_027483450.1"
                     /db_xref="GeneID:38737853"
                     /translation="MSSTQVGDTHGTDVMMSQRDMSPTSHTPSASYSINDAFSRSRPV
                     PGHRCFPTPQTSSWEKDTNVHTCRRCMRRFTLFFRKHHCRRCGRIFCDACTSHRAYIP
                     ENVHITDPALPEMLDSESRSAVRICDWCMNEYHIEPVSPRVRTTATDDTSTWTHLLWR
                     ISTPWSGEAPSPIDPDALNECPVCDLHLPTLASTQEREQHVATCLEDGAPPSRALRMH
                     FLASNLTADSALIGKECIICMEEFVARDRVARLTCMCCFHVDCIRRWMAKGHACPLHA
                     TDT"
     gene            complement(<399187..>401412)
                     /locus_tag="MRET_1088"
                     /note="MRES_04325"
                     /db_xref="GeneID:38737854"
     mRNA            complement(<399187..>401412)
                     /locus_tag="MRET_1088"
                     /product="nucleoporin NUP82"
                     /transcript_id="XM_027627715.1"
                     /db_xref="GeneID:38737854"
     CDS             complement(399187..401412)
                     /locus_tag="MRET_1088"
                     /codon_start=1
                     /product="nucleoporin NUP82"
                     /protein_id="XP_027483453.1"
                     /db_xref="GeneID:38737854"
                     /translation="MWQEALSTHPIVTERRPPNERGGADITRRTSLLATRGTDLLAVV
                     DNELRMTSVAYAKRHVEQGEGALSYKVLTNEALNFPIQSILVNSTGKLLAVVGVYEVV
                     IVILPRRGYMKQVGTALPVKAVRVGTYYHAPHGTSPIAQCRWHPYGAGGVSFIVLTED
                     AVVREYDVSHDVDEPQQTLAVLGQPTRTSSMLSAEDDDAKVAVSCTFGEESSSWLLFT
                     LLVLMRSGDVYILCPFMPKHAALPRLHVETLAALEARNTQNSTLAMRFLGDLVRQMQE
                     ATAPSFDDTSLDLAEPLTEGYVHVVLPACVPHRTAAQGPCLMRPAPVELNEDVASMAC
                     DVIMTRIAEDQAALDVVLIATLEGSIQCGLLAKPVVPHWIMGRSHAELPIMAVCECID
                     LELPRLEASVRTLQFVKDALYPDMVWVTHMHGMHALSLQPWTAPLLSAMASGNTDRLA
                     AEQQHHTTVAPFVCLTTSADAPAITGACIINDVYLSYAFFILTSDTQLLARELNLRSV
                     TEAHPPPTGRVAEYKTLLAEPFEMPKALEPMQLRPPNMPGEIRADAHTLRAFGQATET
                     VRQRLQDVAKAGHAIQTRSAQQMREMQRQVAQLAQASKRVDAVLAEVLRARIERIDQT
                     QRATVQRLDTLLQQLMDEHTPQLSVYERRWFDELQRMSHEFLGDKAKAKEQLLKLEHQ
                     WSHLQHHHHLQSDQVRPKSSELGSRQRERIEHTLAQEAQMLAQARSKIQYLRTALGMH
                     T"
     gene            complement(<402170..>403783)
                     /locus_tag="MRET_1089"
                     /note="MRES_04330"
                     /db_xref="GeneID:38737855"
     mRNA            complement(<402170..>403783)
                     /locus_tag="MRET_1089"
                     /product="phosphatidylserine decarboxylase"
                     /transcript_id="XM_027627716.1"
                     /db_xref="GeneID:38737855"
     CDS             complement(402170..403783)
                     /locus_tag="MRET_1089"
                     /codon_start=1
                     /product="phosphatidylserine decarboxylase"
                     /protein_id="XP_027483454.1"
                     /db_xref="GeneID:38737855"
                     /translation="MMLRLRRAALVRHQVRKYVRDPQQAVEEASTVRGYRLAQQRLEK
                     QVPPPPPPPRSKWEQAWRTWRATPLKWQPLPIMVGACVLVAVQAHRTYSHSRQEKVVD
                     RDHSYPVREDGPWTMYILGALPLNSISRTWGRLNSMPLPVWFRPYGFRLYAWLFGCNL
                     DEIREKDLTKYASLAEFFVRELSPGARPIDPHALLVSPADGKVLHMGVVQGDRVEQVK
                     GLTYSLRSLLGYDSEAHTQQDPELGSSRNMSVAAERRFAKLNGIDYSLTQLLGKDSHM
                     HRASTYAMGWIRGAWRWCKHLVMWKAPAYKTLPIHQASAAEVAADTAEEALEPEQGDV
                     GIPTSDTPTNIGHYATVAYQMGPEALPHFQSEWHVSPGNRLFFCVIYLAPGDYHRFHS
                     PVPWVVELRRHFRGELYSVSPYVATRLPNLFVMNERVALLGRWRHGLFSMTPIGATNV
                     GSIQIHFDRQLRTNLHGTKQFHGTYDEATYNAASRILGGQPLAAGDEMGAFLLGSTVV
                     LVFEAPEHFRFVRAAGDKIKVGEALGHAS"
     gene            <404005..>405045
                     /locus_tag="MRET_1090"
                     /note="MRES_04335"
                     /db_xref="GeneID:38737856"
     mRNA            <404005..>405045
                     /locus_tag="MRET_1090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627717.1"
                     /db_xref="GeneID:38737856"
     CDS             404005..405045
                     /locus_tag="MRET_1090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483385.1"
                     /db_xref="GeneID:38737856"
                     /translation="MSIYLSSPWVSQSFLGCGPSFLPSTMDLYEEALYAQAVRERQRR
                     VAMQREIELRKQRQIEAMMQRMAIESAMRDFAEREYQRAQRQAAWERKRAERERKAKA
                     TNDGHVYLQLGDVLFRLMPQASGEDSDETCDNLASLTSDVPKEPVEAKVPTSTIVRAT
                     SSTEPAEPKAEQDVKETAEEPVHEPEAAPEPKQASKVTAPEPEAVPEPKQASEATAPE
                     PQDRVLFTYDFPDAATAYGRDVRKHVKSDNLHVEANTPNGGSIKISGLWCKTAPSPSS
                     RASSPRSPHVRDVDEDGNEILLAEDTDSDSDTEQGVSFTESAVIPLPSLDELRNMRAE
                     LDDSGFKLWTTV"
     gene            complement(<405076..>405591)
                     /locus_tag="MRET_1091"
                     /note="MRES_04340"
                     /db_xref="GeneID:38737857"
     mRNA            complement(<405076..>405591)
                     /locus_tag="MRET_1091"
                     /product="Rhodanese-like domain protein"
                     /transcript_id="XM_027627718.1"
                     /db_xref="GeneID:38737857"
     CDS             complement(405076..405591)
                     /locus_tag="MRET_1091"
                     /codon_start=1
                     /product="Rhodanese-like domain protein"
                     /protein_id="XP_027483384.1"
                     /db_xref="GeneID:38737857"
                     /translation="MMSVLRTHLLSSSMSRAAILRNPSCARMFSSTIRMCRDETWLKR
                     GPVTYQELKPYTETPSGHITLIDVREPNEVSQGMIPASVNVPLSEFKAAFNPENDAPA
                     STDFERKYSFPRPKFNDPIIFYCRSGRRSQQALEEAQKHGWWNTRNYTGSWIDWVAQE
                     QSNKKDSDEDE"
     gene            <405791..>407404
                     /locus_tag="MRET_1092"
                     /note="MRES_04345"
                     /db_xref="GeneID:38737858"
     mRNA            <405791..>407404
                     /locus_tag="MRET_1092"
                     /product="nucleolar protein 58"
                     /transcript_id="XM_027627719.1"
                     /db_xref="GeneID:38737858"
     CDS             405791..407404
                     /locus_tag="MRET_1092"
                     /codon_start=1
                     /product="nucleolar protein 58"
                     /protein_id="XP_027483387.1"
                     /db_xref="GeneID:38737858"
                     /translation="MVLVLFETAVGFCLFSMSDEAKLSSPDLYKHFESETEANRLLQL
                     SAIHRFQSTVEAVEGATAVNEGKLSKGLKNFLTSEILEKGGAAGTKGGKGVNLIVSEP
                     KLASTINKKLGIQVTAESSLMDLYRGIRENLASLLSANSPEAGALDPRDLNTMSLGLS
                     HSLSRYKLKFSPDKVDTMVVQAIALLDDLDKELNIYAMRVKEWYGWHFPEMGKIITDN
                     IAYAKVVRAVGFRTNASSCDLSDILPEEVEQTLKAAAEISMGTEVSDSDMEHIWSLCD
                     QVVSISEYRAQLYSYLCNRMSAIAPNLTALVGELVGARLISHAGSIMNLAKQPASTIQ
                     ILGAEKALFRALKTKHDTPKYGLLYHSSLVGMAPPKMKGKMARMVATKAALSTRLDAL
                     ADADSKSDLSAPTIGAESRAKLEARARGLDHVQSISGIRANRGADDGYKQKAFAMESG
                     GRGYNAGADAPPVVTGVADDDDEEEEEEEEEEKEPKKEKKEKKEKKEKKEKKEKKEKK
                     DKKEKKAKRSASDLDDDASSKKKKKKSSA"
     gene            complement(<407440..>409065)
                     /locus_tag="MRET_1093"
                     /note="MRES_04350"
                     /db_xref="GeneID:38737859"
     mRNA            complement(<407440..>409065)
                     /locus_tag="MRET_1093"
                     /product="DNA polymerase alpha subunit B"
                     /transcript_id="XM_027627720.1"
                     /db_xref="GeneID:38737859"
     CDS             complement(407440..409065)
                     /locus_tag="MRET_1093"
                     /codon_start=1
                     /product="DNA polymerase alpha subunit B"
                     /protein_id="XP_027483386.1"
                     /db_xref="GeneID:38737859"
                     /translation="MADLSSLLGTPGKQVPSAAPTSHEVDPGNDTWRSHLRIGEAYNQ
                     HLPSTWDASYVPPTASASVPRVSLAVSTDLKQWNYRYMFEKKGERSMELDTRLSVMGD
                     EIRHAFGLTAEWDDPSIPNQESIYTVGRICARVDPGTRNEEQKEHVRLTPANLMLETS
                     RMVGNGQRISLVIDPQCTVRYAWASQAESISSVTGLFPGMILGVKGRNGSGQRFVAEE
                     LLIPPPLPHPATLQSELMTNQYGESRLAGTPLRVMMAGGPFTPTSDLEYGPWHAFMTH
                     VELARPDVLLLLGPFVSVQHPIIATGNLDTLPTDLFKHHISRRITRLIERSPSTVVIL
                     VPSTDDMIHTHYAYPQPFLDKSDPTLGLPKRVRCLPNPSVFYVNELAIGVSTADTLGD
                     LRREELVQRVQSGSQGTPQSKGVNDPIVRLARHVLGQRHFYPLFPPSPVSRVPLDLSH
                     SRLCAFDTSTPDLILLPSTSTKPCIRIVDSSVVVNPGSLVSSDESGTHPSAYVQMQVD
                     PMPRERLQATIDDADPLLTHELYRRARIDLVYT"
     gene            <409149..>410708
                     /locus_tag="MRET_1094"
                     /note="MRES_04355"
                     /db_xref="GeneID:38737860"
     mRNA            <409149..>410708
                     /locus_tag="MRET_1094"
                     /product="general transcription factor 3C polypeptide 5
                     (transcription factor C subunit 1)"
                     /transcript_id="XM_027627721.1"
                     /db_xref="GeneID:38737860"
     CDS             409149..410708
                     /locus_tag="MRET_1094"
                     /codon_start=1
                     /product="general transcription factor 3C polypeptide 5
                     (transcription factor C subunit 1)"
                     /protein_id="XP_027483389.1"
                     /db_xref="GeneID:38737860"
                     /translation="MAPAGRDDEAPSWTIPPTQLVTIEYPGYIHASCKALDSALTSLS
                     PRMGPLAGTASARQALEHLSMLLDRGARIVECHLLSQEPDDTDLYRHPILGDIVQSQD
                     LVVRIRRQVWKRSDQDVYRKQYMLELVGSCTHAVRFRRMADFAYRPDPPSGSSEHPAM
                     SLHRALMTFDVHSLRAYRFEPERELYEVSENGTPISNLAMIPPPFFSRQELPFPYGYR
                     QNPTSSLQTVSHASTSKRSRRTARKGESSAEQPADLEDTAVTRYINRARWRNLAPIAI
                     KFSDTGPVPHAPDPSLAAMPLSEKQTMQLQKLREQWSKRPIWSRLALLNQFSEPEARA
                     LIQAKELFALVAYTFADGPWRDALVQFGYDPRTDRQSRFYQRIHMRGKTPRRPTTRGL
                     FKSEYGTASDTRRSHIRSAELMRSPTHEFDGKTASFHTSTFQLCDITALSIVPLIHVD
                     GPNQLLLTPDVTTGWYAPQAWEAIRSAVSSSFHALLNASTNDQRPQEDVGSSSEDYSH
                     DEDDDDEDMNT"
     gene            complement(<410798..>411433)
                     /locus_tag="MRET_1095"
                     /note="MRES_04360"
                     /db_xref="GeneID:38737861"
     mRNA            complement(join(<410798..411075,411103..411358,
                     411398..>411433))
                     /locus_tag="MRET_1095"
                     /product="Ran-binding protein 1"
                     /transcript_id="XM_027627722.1"
                     /db_xref="GeneID:38737861"
     CDS             complement(join(410798..411075,411103..411358,
                     411398..411433))
                     /locus_tag="MRET_1095"
                     /codon_start=1
                     /product="Ran-binding protein 1"
                     /protein_id="XP_027483388.1"
                     /db_xref="GeneID:38737861"
                     /translation="MSEHETKEPVDAGAEAEHDPQFDPVIKLEHKVEVKTNEEDEDVQ
                     FKIRAKLFRFDKESKEWKERGTGDVRILKHKETKKVRLVMRRDKTLKVCANHYLSPDI
                     KLQPNVGSDRSWVYNVTADVSDGEPAAETLAIRFANSENAELFKKEFQNAQEANKNAS
                     GDANSTSSEAKPESKVDQATEEKKEEKKE"
     gene            <411560..>412181
                     /locus_tag="MRET_1096"
                     /note="MRES_04365"
                     /db_xref="GeneID:38737862"
     mRNA            join(<411560..412125,412154..>412181)
                     /locus_tag="MRET_1096"
                     /product="p24 family protein beta-1"
                     /transcript_id="XM_027627723.1"
                     /db_xref="GeneID:38737862"
     CDS             join(411560..412125,412154..412181)
                     /locus_tag="MRET_1096"
                     /codon_start=1
                     /product="p24 family protein beta-1"
                     /protein_id="XP_027483391.1"
                     /db_xref="GeneID:38737862"
                     /translation="MSWVGAMLIAVLAILVQLASSHTIDLHPDSEYCFYEDMHVGDEM
                     TLTYQVSGGGHLDIDTTVRDPSGRLLFEQKHKDTGTYDFVADTDGRHQYCFSNKFSVV
                     TDKTLSFNVHGVLYLTEEEGLIPAERELRDLANNIQLFKDEQEYLSMRERVHRNTAES
                     TNSRVKWWSILQTLLIVAVVAFQVYFVKRQFEVRRAI"
     gene            complement(<412225..>413220)
                     /locus_tag="MRET_1097"
                     /note="MRES_04370"
                     /db_xref="GeneID:38737863"
     mRNA            complement(<412225..>413220)
                     /locus_tag="MRET_1097"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627724.1"
                     /db_xref="GeneID:38737863"
     CDS             complement(412225..413220)
                     /locus_tag="MRET_1097"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483390.1"
                     /db_xref="GeneID:38737863"
                     /translation="MPLVAAYESDSDEEIAPSDAVNAHHDAPPSGLSLPPPKRPAPQA
                     KRQIVVESAPSSRSSDEKPLPKRARHDKNASSTGTHSLLNMLPAPQNKASKRTPKPAR
                     DESDEDVLLEDDARMTLYDVPNEKPAKGNEDFRAMLGLAPKAPTKDQRQAPVIVSETH
                     HGQHETVQQERQTEPALTAAPSFSAAPVIEDRTKSEPEPSMDAYPGWKRDPDGSWYPV
                     TPEAHAIYAAWAQYAQREAELQVPHHAQVATVDASAELDRIPKAPSQAPAPETRPESL
                     VSEKLRTDKFTNMRARTRGQLTSLLAMAHENRPMLEERWSQGKSKMRENKKRYGF"
     gene            <413492..>414463
                     /locus_tag="MRET_1098"
                     /note="MRES_04375"
                     /db_xref="GeneID:38737864"
     mRNA            <413492..>414463
                     /locus_tag="MRET_1098"
                     /product="Fe-S cluster assembly protein DRE2"
                     /transcript_id="XM_027627725.1"
                     /db_xref="GeneID:38737864"
     CDS             413492..414463
                     /locus_tag="MRET_1098"
                     /codon_start=1
                     /product="Fe-S cluster assembly protein DRE2"
                     /protein_id="XP_027483306.1"
                     /db_xref="GeneID:38737864"
                     /translation="MEKVQSTPQRLLLVGSLEAAKSGAYQEAVKKYQTEGTVLETHMV
                     DRITDLAYTPPPTSFDAVYVMVPAQDTAWSTLLAKLYESLVPGAKLSLTLVDAGAPAT
                     ASDAGAQVQTELTISGFADIRTHADASIEASRPAAAAVSHAPSPAGNAAGAVPLRRKP
                     KGDTSRMQKKASLWATHPETSMDTDAQLQEHARMMASGPKRADCTVDLSVPRTRRKRA
                     CKGCTCGLRELEEEEERGATVVQLDPNEVNAPGTTRKEVTETVVGADGTERRVKRIQV
                     DTRGATSSCGSCFLGDAFRCSSCPFLGMPAFEPGQKVEIPVNMDDDV"
     gene            <414644..>416344
                     /locus_tag="MRET_1099"
                     /note="MRES_04380"
                     /db_xref="GeneID:38737865"
     mRNA            <414644..>416344
                     /locus_tag="MRET_1099"
                     /product="multidrug resistance protein fnx1"
                     /transcript_id="XM_027627726.1"
                     /db_xref="GeneID:38737865"
     CDS             414644..416344
                     /locus_tag="MRET_1099"
                     /codon_start=1
                     /product="multidrug resistance protein fnx1"
                     /protein_id="XP_027483392.1"
                     /db_xref="GeneID:38737865"
                     /translation="MAAGRTERTPLVAAAPLHEHAENDEALLAQESAFSAMYGATHGG
                     DPSASLFMPTDDSVPPPTAAPSTYSLLDRVSVMSTMWIGTFLAALDTTMVATVMSQVG
                     SEFAVSNTVAWLGTSYMLTQMACQPLYGRLSDAFGRRAMTLLASSVFFVGTLSCGLSR
                     TFVQLCIARAMAGLGGSGLTSLATMVVSDMTRVQARATWQGLGNVIFAIGAALGGPLG
                     GAVVDAQWGWRWAFLLQVPLCAAHLLFVFAKVRIPSGPGSVRDKVLRIDMGGTLALLC
                     AVAALVAALACGDADAPRLLVYLWLAGAVIGAGVFVWLETRVAAEPLMPTQILARRMP
                     ACVSLACGLVSLCQFGVLYHVPLYFLAVQGTSTVQAGAYLVPNVLAASVCSLVSGRLV
                     SRTGSYRATVLLSGLLTVLGALSMCFWSRQATPAWAYWLTMPWVGAGFGSTLTVTLVA
                     LVLSVDPMEVAPASGVTYLFRAVGSILGVSCTHSLFQRSLAWYLRRTPLPARLVHDMR
                     ADIGTLATLTGASRTWAVSAYETSMHAVFVWLLCLSLAALACLCCVRAHVAPPHRRPP
                     "
     gene            <416427..>421724
                     /locus_tag="MRET_1100"
                     /note="MRES_04385"
                     /db_xref="GeneID:38737866"
     mRNA            <416427..>421724
                     /locus_tag="MRET_1100"
                     /product="serine/threonine-protein kinase RIM15"
                     /transcript_id="XM_027627727.1"
                     /db_xref="GeneID:38737866"
     CDS             416427..421724
                     /locus_tag="MRET_1100"
                     /codon_start=1
                     /product="serine/threonine-protein kinase RIM15"
                     /protein_id="XP_027483279.1"
                     /db_xref="GeneID:38737866"
                     /translation="MSPRHRVDTKRTTSGMDQHSTDPRRRSLGWGMASLPPTHAHAKR
                     RDVSVESVLSDSTYPRTATHGPSRRGPGGIDTPHPPPLDVFGTDLSRLAQDDRATPTG
                     LLELDPDTPTTSGSETDEPWPPPRSASHSSSARQPLASRRRASSARPVSHGRGASHRA
                     SWHSRGPRPRTTGVHGSPMAFSSRPFRTIPSFSSPLALAPVLPEDEDTASPSSSGSSW
                     RASSDWTRRHAVLGAASQGPPSRRPPRSTGPHETKSPFLLPKHALHRRAHSAYAVPRG
                     TLLCGSPVGGPEGIDPGLIAAIQHDTPSLASAPATRRSISLAQVYAAPTTPPLDAMPS
                     PLATSPRIGRDTIRLQRMPRSVAMANDPVIRPPSQARDAPEMSSPLPSPVDADGMSRP
                     TILGLALALPGHTSWHASAPPPEHTDALLDARILCVSRETKMRRWHRQPQGWDDAWHR
                     HASTHGGQRAGAHCDAVRQSLAQLHTSSAQYARLNDGIRVTCSLPELRALRRANDPPA
                     SKRDMAPRSKPRVVSEKVTTHRRTRPKASVDDASATQREWLWDELVRAKALCDAELDK
                     TLAGLLRLSDDLLDPVDPDTTSVVVPVDGPMPLSPIERLASIAADIRSTKPHALLDRP
                     QLCVSAVTSVQSLGAIWDAHPLWPGRGWYVELLLTLAGLSRVLGWWNAEQRFWSDDEM
                     RPHSQPVNESKTTRSPSPASSDAPMPSSILLELSLDLRIEFVSTVWQRIVGTEPASTY
                     GEPVSSVLASGNAALLERATRQLLESPGHTVEVALDIAVAGTPSADDPLPMTAQGMMV
                     HHHGTPIPSHTMWVLHARQKHEPSTGEMRQGGAIGGMSSDMEAVPTDLVLCRICESDV
                     PAWFFAKHSEMCHELHRLELSLHTCNETLWALIEAASAVRTTLSQGAVAAVYRDHEVR
                     LDAEAAAPMLDAMLDGLNRAMSISTPHLPDDAMLTEGMRLLSPRSNGHVLSLKTWSWD
                     RDTTDTALLLLYEDVSEAIRTKIHAVNRMCNTMVYVETVRQESEDFVASLMQDDHDEA
                     ANTTLHIHDEPAHPPVIVDTAPDEMEDTLAGVNHLLLDPIDDASDDDAWSGAQRAPMT
                     IPRSTLPSNPELLSTPPLSPYVSTSNDSKSPRFGTSVGSFVPSSPHVLPPAQTRATAT
                     SIRDFELLKPISKGAYGSVFLAKKRTTGDIFAIKILKKADMIAKNQITNVRAERMILM
                     NRTQSPFVVKLFFTFQSPEYLYLVMEYLPGGDCASLVKTLGALPDEWAQQYLAEMVQG
                     LDYLHSTGVVHRDMKPDNLLIDHHGHLKLTDFGLSKLGLLGRHRPTPHTPSSAGDLPS
                     TWAASRPGSARLSSPVPFTHVPDAALGISPMSDSPPQTEQFFRSMSQGDSNGRIVGTP
                     DYLAPESILGVGMDDFGVDWWAVGVILFEFLHGYPPFHADTPADVFDRILSRQIAWDT
                     DIPIAPDAYDLMNRLMCMDRKQRLGANGVEEIKTHPYFHGIDWAHLTDTDGPFVPQLT
                     DMASTDYFDARGAVPQLWHDDHARSSVSTDPSAVGGESVSSGSGTPNEFGAFSYKNLP
                     VLKQANDDMLRRIRMECAHGSPSSPGASISSGSSHQLPTTPSSAKPQRSWSDRSRVRV
                     SSAMSSHSDALKSVQRHILLADVNPVSRQVLQTMLHSIGAQTTMATDGADLVQLAMGD
                     TLYDAIFIRLGMHGIDVQDGARMIKSTRNMNAHTPIVAIISGHTHIDVAGSVFDAVLP
                     LPNSPSFISHLLTSLQHESSSSTHMLDEATNMALAQLAL"
     gene            <421805..>423649
                     /locus_tag="MRET_1101"
                     /note="MRES_04390"
                     /db_xref="GeneID:38737867"
     mRNA            <421805..>423649
                     /locus_tag="MRET_1101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627728.1"
                     /db_xref="GeneID:38737867"
     CDS             421805..423649
                     /locus_tag="MRET_1101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483278.1"
                     /db_xref="GeneID:38737867"
                     /translation="MRHNEHSPLLEGQRSTRARGWVDGARTWCFANASMLGLLFIPCL
                     LGLIQAVQIPAEIDAIRSLSCAHYYHLHPDQIPPIPYDSESCMRPEVEQHFSTLATYV
                     TFTVVLANFFGMLVYGRLFEAQQRRRLAAQGIFGLLVARIPFLILPLYQYPILAPPDV
                     RSLNPAQMLGVFWACAILGGLSGTNELVILTVESFITDTKSPEIRSQLFRLTEVALLL
                     GSSIGPLLGSMSTWMFPHASNACIGYKECQNNTIVSGTLLLFNNAPYWLAFVFTWVAL
                     IWILFVFNFASVASTTKASRADSRRDSDVSMGPTTEWGASLGAFQRLVPIRRSRWSYD
                     TRVLQFTFANMCVALSQEGPIVLMYVMGFVFRWGRDSVSLALTTLNTVRFANMVLALP
                     HVLQGMASLSRKPEPISDLTPKQIDACLDAAKRLVPCEPGQGRSSAVPRECDTNMAQI
                     TPKQRALVCLWRAQIDLNVSRISFLFNVVAWLTIFAGVTCTKEWLVIVGTVTLALGSG
                     AQFLLRSAACTICDYIVEQENRFSLPSPTRDTSTTKRVLPSGADSYLIISSTLLLPCL
                     LVGLCVRNEIYAKTVSTNPGIFFVVVAAVNALALIALSWMPSATSTRV"
     gene            <423746..>425305
                     /locus_tag="MRET_1102"
                     /db_xref="GeneID:38737868"
     mRNA            <423746..>425305
                     /locus_tag="MRET_1102"
                     /product="phosphatidate cytidylyltransferase"
                     /transcript_id="XM_027627729.1"
                     /db_xref="GeneID:38737868"
     CDS             423746..425305
                     /locus_tag="MRET_1102"
                     /codon_start=1
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="XP_027483277.1"
                     /db_xref="GeneID:38737868"
                     /translation="MPTRSGTPLRTPSKSANSFDVLGVDHLNSEEDQKSLKNLSPMMT
                     RSKTRAKSKASRSQLAPSNASQPSPKLSSDPALKSKTSSLRQRTPAAPTHAKAATSTA
                     GATTPTTASQPPVFWKKVQERVIFSLLMIAGFTFNLAMGPSYMILLVLVLETLVYREV
                     TALFNVPGRTLLSPQSQNEAEEEEDRMSQRESSREELWNKTLSWYFFAVCNFFLYGES
                     LVYYFKHIIMVDSFFLRFAPHHRFISFMLYIFGFMAFVSNLKRKNLKHQFALFCWVHM
                     SLMLIVLSSHFLVDNILEGIIWFWVPASLVICNDVFAYICGMIFGRTPLISLSPKKTV
                     EGFVGALLITLVFAWFWAGFFQRFDYMVCPAVSLGMSAFHPPRCNVNPVFSLHKTPLP
                     ATLAHGLTAVMGRPITTVSWTPFQWHAVVMAAFASLVAPFGGFFASGFKRAFKIKDFG
                     HSIPGHGGLTDRFDCQFLMGLFSYVYYSSLIRESRISVQMIMQMIITQLPIEEQKQLL
                     YNLTSYLADEN"
     gene            <425523..>428666
                     /locus_tag="MRET_1103"
                     /note="MRES_04395"
                     /db_xref="GeneID:38737869"
     mRNA            <425523..>428666
                     /locus_tag="MRET_1103"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027627730.1"
                     /db_xref="GeneID:38737869"
     CDS             425523..428666
                     /locus_tag="MRET_1103"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027483276.1"
                     /db_xref="GeneID:38737869"
                     /translation="MSWQADHHYRSAVQDMDRSMAHRHGRDHTSVDERVAVTAASSSS
                     LSTAAPAISAPLPYTYEASSMSYDHGSIPHSASVTHLASPVASKSTMPGSFSMTELPR
                     YDDHATQSHHASYGKDDPTQPFPELNAAALPSTPQALNPIRTPMEPVTPISEAPKKDA
                     ITTPLRSSETGRTAAWTPQRGIPSSESMDSIRSASQTPSKSLSSAANRVAGTLSRLTR
                     FRNRQHARTQHAESESSTRSSTSATSASLTSAPILAPAAVPDTNAAHDASDSRRTPRK
                     YQDRHDLETNDRSGPHQQVSSVDAQFRRFEMIGRGSYGAVYRGMHVPTNRVVALKVID
                     LDTPDFDVSEIWHEVALLSQIRNARPKNIVRYWGCWLNGPTLCIAMDYYEGGSVRTLM
                     KTGPIAERFAAVITREVLVALNYIHSLGIIHRDLKAANLLVTRTGQVMLCDFGVAASF
                     VQGSARGKRSTFIGTPYWMAPEVILEGKTYDYKADIWSLGITVYEMVTGNPPYSQHDQ
                     LQAISIIPKNQPPRLPDQAGYSPLLQEFVAVCLDVEPSDRIPADELARMRWIKTHAKI
                     PVSILTELLVMYHKWTQAGGTRTSLLPPVQSIRAEETPQPEWQFEETPLDSPPSTQEA
                     EAPISPPVDHPLKKLFDQETEENAAHTRAVTSTPKNVHATIHKPLITPSSRTNTRPAP
                     AGFSGTGSVPFRFGLGSRAAETSKSKALASHVSADAMDDAKMETNSDEAPPPTDLPHT
                     TSSSSICPSPPLRESRSSTSLPSLRQEDSVESTPTSPVLRRVGHIPNRTMRQAPVRTL
                     RLMSSPSTLVRETPNGKHSIDEGHNNPLLFLEEPYTGLRTHSGSHGPRSRGSSGLGET
                     RSRSGTSRSVRSAPSKHKDNEVDGASEARNQSTVTALTSSASMTSIVSPTGAHQRSQH
                     GGSDPTMMATKMRSDQQFSNASMNHERDLSTKASEDDLSTPWTIPTTPDSPGTQHTTS
                     PNDVFQAPVIPVASFEGPPLRTLDYRALINRQDLQAEMARTVEDLGTWLDALSSGLES
                     VLHPTTPPLHHIDPRGI"
     gene            <428772..>429468
                     /locus_tag="MRET_1104"
                     /db_xref="GeneID:38737870"
     mRNA            join(<428772..428820,428867..>429468)
                     /locus_tag="MRET_1104"
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 7"
                     /transcript_id="XM_027627731.1"
                     /db_xref="GeneID:38737870"
     CDS             join(428772..428820,428867..429468)
                     /locus_tag="MRET_1104"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 7"
                     /protein_id="XP_027483283.1"
                     /db_xref="GeneID:38737870"
                     /translation="MVMLTAPTRTVLSAPYGVSCFARAAASRSLHQSVAARREAAPSR
                     QVAQVGSNQLSLETPRNTVEYTLSTLDKIVNWARQSSAWPMTFGLACCAVEMMHASGP
                     RYDQDRLGIVFRATPRQSDIMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGG
                     GYYHYSYSVVRGCDRIVPVDLYVPGCPPSAEALLYGILQLQRKIRRSRQAVLWYRK"
     gene            complement(<429555..>430621)
                     /locus_tag="MRET_1105"
                     /note="MRES_04400"
                     /db_xref="GeneID:38737871"
     mRNA            complement(join(<429555..429561,429606..>430621))
                     /locus_tag="MRET_1105"
                     /product="type I protein arginine methyltransferase"
                     /transcript_id="XM_027627732.1"
                     /db_xref="GeneID:38737871"
     CDS             complement(join(429555..429561,429606..430621))
                     /locus_tag="MRET_1105"
                     /codon_start=1
                     /product="type I protein arginine methyltransferase"
                     /protein_id="XP_027483282.1"
                     /db_xref="GeneID:38737871"
                     /translation="MSDGSSAVPEPGNMTSMDYYADSYAHFGIHEEMLKDEVRTLSYR
                     QAIQNNPHLFKGKTVLDVGCGTGILCMFAAKAGAKKVIGVDMSNIIDQARVIVKANGL
                     DNIISLVKGKLEEVDLGLGPDGKVDIIVSEWMGYFLLYESMLDTVLLARDKYLRPDGI
                     MMPDHATLYLSAIEDQEYKEEKIDFWDNVYGFDYSCIKEIALREPLVDTVELRSVVCD
                     PAPLVDLDLMTVKKEDLQFKVPFKLHATRNDYVHAFLGWFDIGFEACHKPVRFSTGPH
                     SRYTHWKQTVFYTPGTLTVAQGDVIQGTLSCMPNARNNRDLDICIAYKLDGANPVEDS
                     MDYKMS"
     gene            <430766..>431623
                     /locus_tag="MRET_1106"
                     /note="MRES_04405"
                     /db_xref="GeneID:38737872"
     mRNA            <430766..>431623
                     /locus_tag="MRET_1106"
                     /product="golgi SNAP receptor complex member 2"
                     /transcript_id="XM_027627733.1"
                     /db_xref="GeneID:38737872"
     CDS             430766..431623
                     /locus_tag="MRET_1106"
                     /codon_start=1
                     /product="golgi SNAP receptor complex member 2"
                     /protein_id="XP_027483281.1"
                     /db_xref="GeneID:38737872"
                     /translation="MNSLYNLASRQSAAIRADLDACTSDPASSATLRPQITSSLSALV
                     KTIEDYESMAKRELVITKREKALHRAANFHAEVKQFREELARVHTSPAPAPASALAPN
                     MSGMTTRSRAVEPPYVTPAGPALQTGPSYAYQSTTYAPPSMTTPCVMPAQPYPNAYAS
                     TTMPAMAPSDPLAAYRMHQPPAMPEERSYSLRESHALREHSFIQNTEHQLDAFIAQGR
                     SMLGNLVEQRSIFKQTRKRLLDAANTMGLSRELIGVIDRMSTQDTILFFVGATITLVI
                     FYLIYRYLG"
     gene            complement(<431650..>432535)
                     /locus_tag="MRET_1107"
                     /note="MRES_04410"
                     /db_xref="GeneID:38737873"
     mRNA            complement(join(<431650..432191,432217..>432535))
                     /locus_tag="MRET_1107"
                     /product="zinc finger CCHC domain protein 9"
                     /transcript_id="XM_027627734.1"
                     /db_xref="GeneID:38737873"
     CDS             complement(join(431650..432191,432217..432535))
                     /locus_tag="MRET_1107"
                     /codon_start=1
                     /product="zinc finger CCHC domain protein 9"
                     /protein_id="XP_027483280.1"
                     /db_xref="GeneID:38737873"
                     /translation="MTRYTKLDGRRSVAYGPSDMDREDVTPEKPRELCGPQDMPDPKA
                     LLKRAKLLRLKAKKAKSEASRDKFLAQAKDVERQIPSANGARGLLGRRNGRERQLRGP
                     KSNLDPDQRSAFRRMKRAEERKSSTRCFVCRELSHAAKDCPHAIGEGAQGKDTVGLCF
                     RCGSTEHTLSQCRRPHTDGELPFATCYICSNKGHLASKCPQNQGRGVYPDGGECKVCG
                     SVEHLAKDCPKDPRRVTHASTVEAGGVGILDDASHAGADDDEFHLLAQQRRQRPSQTR
                     PRPTGKVVRF"
     gene            complement(<432579..>433931)
                     /locus_tag="MRET_1108"
                     /db_xref="GeneID:38737874"
     mRNA            complement(<432579..>433931)
                     /locus_tag="MRET_1108"
                     /product="tRNA-specific adenosine deaminase 1"
                     /transcript_id="XM_027627735.1"
                     /db_xref="GeneID:38737874"
     CDS             complement(432579..433931)
                     /locus_tag="MRET_1108"
                     /codon_start=1
                     /product="tRNA-specific adenosine deaminase 1"
                     /protein_id="XP_027483287.1"
                     /db_xref="GeneID:38737874"
                     /translation="MPPEADEIARLCLQTYESLPQGGAKPQIRSNGRHEWTVLAGAVV
                     HTNSSNPTVVALATGAKCTPYERLSPQGDVLHDCHAEVLVRRGVRAWLLERLIKEKKC
                     SDSVIDHLPRVFVPVAWDLEVPVRWSLAPHVRLSWYISMLPCGEASSSALQIQHFLDD
                     GHLCTSDTRTSRGVLRGRDMPYASSSACILRSKPGRADAPPSISMSCSDKFMLWNAVG
                     IQGALLSRWLEPIYIDQVVLSWSPSLHMTQAEIQASCSWAFGERIHRANHSRIMCTSI
                     TFPYTRESMKEYISTTTGIRPSSPDWIHIEPVPCAASLLWIRGRPVEKLLGGIKMGAS
                     PKRKNGRPLPMSSCSSVCKRAWFTQYQRACQLLSPTVSLHESYYAQKRASHDTYTAAY
                     AAKKEALFGARHAESILTWFLDTQKDAHSSISQPPLAAPLSAWLQTPRALQDFVVEET
                     "
     gene            complement(<433968..>435094)
                     /locus_tag="MRET_1109"
                     /note="MRES_04415"
                     /db_xref="GeneID:38737875"
     mRNA            complement(join(<433968..434470,434497..434991,
                     435016..>435094))
                     /locus_tag="MRET_1109"
                     /product="NAD-dependent deacetylase sirtuin 2"
                     /transcript_id="XM_027627736.1"
                     /db_xref="GeneID:38737875"
     CDS             complement(join(433968..434470,434497..434991,
                     435016..435094))
                     /locus_tag="MRET_1109"
                     /codon_start=1
                     /product="NAD-dependent deacetylase sirtuin 2"
                     /protein_id="XP_027483286.1"
                     /db_xref="GeneID:38737875"
                     /translation="MGMTKSKEEQTRANCKKIAQLLLDKKTSRVVVMAGAGISTGAGI
                     PDFRSPVTGLYSRLEKYNLPYPEALFDITFFREDPVPFYTLFEELYPDGTKYRPTLTH
                     TFFRLLDKKQKLLRVFTQNIDTLEHLAGLDHDKIVEAHGSFAHARCVSCQKTVTTEWL
                     REKVKSGQVARCEQRSCRAKKVVPPIKPDITFFGENLPERFFERLYDLRRADLLLVMG
                     TSLKVQPFASLIDEVPLNCPRALLNLERVGESRHEHIFTRFGSAYGEGFDFDSERTRD
                     MFCGGAVDDTVRLIARECDWEEELDKLHAQMHQDVDRLHPKLHDKAHSPQPNKVSVAT
                     LQNESADALADQLQATHLRDKEKL"
     gene            <435226..>436512
                     /locus_tag="MRET_1110"
                     /db_xref="GeneID:38737876"
     mRNA            <435226..>436512
                     /locus_tag="MRET_1110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627737.1"
                     /db_xref="GeneID:38737876"
     CDS             435226..436512
                     /locus_tag="MRET_1110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483311.1"
                     /db_xref="GeneID:38737876"
                     /translation="MSHDGGDNDKAPTHTDEKSESQDAMSVIEWEAALLRVQQALALI
                     DAPLASGRPVPPRPMMHDGLLYGLHDLLAPVESVLHMNPSSAQGLAAAITAESSLSPT
                     QGLHTFIQKASHMLVRAEQVKTLLSEPLGVSGNQRNALSMLERGLERSPPTPHDEREI
                     LVRIRKKRRQLDARSHIPDTLKPVKEADNIIVRARLLPVPDSLTFEAATPWVDRVLKR
                     SPNQPLSMAVQDLLHEFQLYINERCKQDSCILTDSQGSFPFPARRVRARLAFWTDTLG
                     SIEVELRDVGLVRIQVRADHHDVCITNMSICAPMEYQSISGSNAVQPSRFMYYGDISN
                     HLLVHALSSQRSYGRGLEALAQTCLHVAGLRTLYDALPTPSTSVAPMISRVTYGMLKP
                     DALLDHNQTLVWHWCRIVSSMSSNQGEWCAYVPSLP"
     gene            <436628..>437581
                     /locus_tag="MRET_1111"
                     /note="MRES_04420"
                     /db_xref="GeneID:38737877"
     mRNA            <436628..>437581
                     /locus_tag="MRET_1111"
                     /product="delta7-sterol 5-desaturase"
                     /transcript_id="XM_027627738.1"
                     /db_xref="GeneID:38737877"
     CDS             436628..437581
                     /locus_tag="MRET_1111"
                     /codon_start=1
                     /product="delta7-sterol 5-desaturase"
                     /protein_id="XP_027483312.1"
                     /db_xref="GeneID:38737877"
                     /translation="MDLVLGIADEYVLDHVWAKLLPASRYSSACAAHHMNALNSTISQ
                     SEFVAKCGAPGQPMSWLPRDNIIRQFLSLYVITYIGIILLYFSCAAFSYHFFFNKELK
                     KHPRFLKDQVKLEIQSSLRAFPWLDLLTVPWFVAEVRGYSRAYDRWDEYGLWYLILSV
                     PLFLVFTDACIYWVHRIEHHPLLYKHVHKPHHKWIVPTPFASHAFHPLDGYAQSLPYH
                     IFPCIFPLNKLLFLCLFGFVNLWSIMIHDSDMINNTGFEKYINGPAHHTLHHLYFTCN
                     YGQYFTTCDRLFSSFREPQAEDDPVLEAQGVSRPTKDIKTQ"
     gene            complement(<437688..>438615)
                     /locus_tag="MRET_1112"
                     /note="MRES_04425"
                     /db_xref="GeneID:38737878"
     mRNA            complement(join(<437688..437744,437779..>438615))
                     /locus_tag="MRET_1112"
                     /product="sorting nexin-3/12"
                     /transcript_id="XM_027627739.1"
                     /db_xref="GeneID:38737878"
     CDS             complement(join(437688..437744,437779..438615))
                     /locus_tag="MRET_1112"
                     /codon_start=1
                     /product="sorting nexin-3/12"
                     /protein_id="XP_027483313.1"
                     /db_xref="GeneID:38737878"
                     /translation="MSMLFASDDNGLGENPLTTSNAEVWGGSAPSDNVLTSASTSLTQ
                     KPSILEEDIDEEHPWGPPPELPSAKQQDPMENVWTSEPSIAQDQTDFQDMSAYDTDAH
                     APTSNAVRRDFVETSDTTFESSTFKRTPKGHSVPNAASELSSKTSVYPTSYSPFARVE
                     SLAPRPTMTEDIYSVPENFLEVEVLNPRTQGHGRKMYTDYQVITRTNIPAFKLQSSSV
                     WRRYSDFDYFRELLERETTRINIPPLPGKVFTNRFSDEVIEHRREGLERFLQIVAGHP
                     LLQTGSKHLAAFLQDSHWKRP"
     gene            <439230..>440391
                     /locus_tag="MRET_1113"
                     /note="MRES_04430"
                     /db_xref="GeneID:38737879"
     mRNA            join(<439230..439255,439412..439523,439765..>440391)
                     /locus_tag="MRET_1113"
                     /product="large subunit ribosomal protein L7e"
                     /transcript_id="XM_027627740.1"
                     /db_xref="GeneID:38737879"
     CDS             join(439230..439255,439412..439523,439765..440391)
                     /locus_tag="MRET_1113"
                     /codon_start=1
                     /product="large subunit ribosomal protein L7e"
                     /protein_id="XP_027483314.1"
                     /db_xref="GeneID:38737879"
                     /translation="MSVAAMVKSAVPNLANVLMPETFLKKRKSDAKVREEKQSKAAEL
                     RKARKQKRQVIFKRAEQYVKEYKAAEREQIRLRRLAKSQGDFFVPTQPRVAFVIRLRG
                     ISNIPPKPRKIMQLLRLRQINNGVFVKLTAATQQMLQLISPYVTWGEPNLKSIRELIY
                     KRGFAKINKQRIPIQDNAIIEESLGKYGIISVEDLVHEIATVGPNFKAANVFLWPFKL
                     SSPTGGFQKRKFNHYIEGGEYGDRESDINRLIRRMN"
     gene            <440873..>443209
                     /locus_tag="MRET_1114"
                     /note="MRES_04435"
                     /db_xref="GeneID:38737880"
     mRNA            <440873..>443209
                     /locus_tag="MRET_1114"
                     /product="heat shock 70kDa protein 4"
                     /transcript_id="XM_027627741.1"
                     /db_xref="GeneID:38737880"
     CDS             440873..443209
                     /locus_tag="MRET_1114"
                     /codon_start=1
                     /product="heat shock 70kDa protein 4"
                     /protein_id="XP_027483307.1"
                     /db_xref="GeneID:38737880"
                     /translation="MSSVVGLDIGNISSKIGVARARGVDIVSNEVSNRATPSLVSFGQ
                     KARALGEGAATAQTSNFKNTVGSLKRLIGRTFQDPSIQQYEKPFVNAELVDAKGEVGV
                     KVRFLGEERIFSATQLLGMYLGKLRDTTQRELGGSGVSDVVLSVPIWFTDNQRRAMLN
                     AAEIANLNPLRVMNEPTAVALGYGITKTDLPEPENPRNVIFVDVGHSSYQVSVVAFCK
                     GQLTVLGAWSDPNFGGRNFDRALMEHFAEEFKGKYKIDVFSNPKSTFRLAAGCERLKK
                     VLSANTFAQLNVESLMNDIDAASQLKREEFESMIAPYLDRIHVPLDRALEQSGLSKDE
                     IFSVELVGGSSRVPAIKERITQWFGRSLSFTLNQDEAIVRGCTLACATLSPVFRVREF
                     SVHDISSYPIKVSWEPAPDVPDEENELVVFGTNNPVPSTKILTFYRKEPFTLDASYAE
                     TETLPVGTNPWLGRVTIKNVAPNAQGEHSIVKVKARLNLHGVLNVESAYTVDEIEKEE
                     EVPVVDPAAPEGSEPKLEKRLVKKLQRKDDLPIVSGIGLHDDSMIAALKEEEGKLYAA
                     DKLVADTEDRKNALEEYVYDTRSKLEERYAQFVQAEEKDKLMTMLAESEDWLYSEEGE
                     DASKSAYVSRLETLQNVGAPIHFRWKENEERPRAASQLREVVNNYMSVFENEPEKYDH
                     LSDEDKTKVIEKAATVGKWLDDYMYKQSEMPKNVDPKLTTEQILKNKDEVIYVCTPIL
                     TKPKPRVATEAPNTEGEGQAPQSEENQQQKQQGDMDVD"
     gene            complement(<443318..>444388)
                     /locus_tag="MRET_1115"
                     /note="MRES_04440"
                     /db_xref="GeneID:38737881"
     mRNA            complement(<443318..>444388)
                     /locus_tag="MRET_1115"
                     /product="hypothetical protein"
                     /transcript_id="XM_027627742.1"
                     /db_xref="GeneID:38737881"
     CDS             complement(443318..444388)
                     /locus_tag="MRET_1115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027483308.1"
                     /db_xref="GeneID:38737881"
                     /translation="MFRCWASVILALIVTATYVTSLPGSYAIQRRASKCNGYQDLCNR
                     KYSNVTHIGAHDSFAVGKLGSLGSNQEANVTVQLEDGIRLLQIQTHASSGHQDSNPSG
                     LSLCHTSCALKNGGTLESYLRQVKQFLDQNKNEIVTLVITNPDNKPVSNFAKAFENTG
                     LNSMAYRANSNSISKNDWPTLQELISQNQRVVVFLDYKADVNQAKYILPEFQNIWENP
                     YDQTSSNFNCTPDRYIHGTQNKMYLINHFKNSMVISSKISSPDTEHIKDTNSVSSILK
                     DANHCAQQQNAYPTFVLVDYYSQGNGSVFKALAKLNGVNYEDKELNANQTQDGDAAVG
                     PLRVSLPILLGAMIGVATVILI"
     gene            complement(<444499..>447554)
                     /locus_tag="MRET_1116"
                     /db_xref="GeneID:38737882"
     mRNA            complement(join(<444499..447230,447257..>447554))
                     /locus_tag="MRET_1116"
                     /product="hypothetical protein"
                     /transcript_id="XM_027627743.1"
                     /db_xref="GeneID:38737882"
     CDS             complement(join(444499..447230,447257..447554))
                     /locus_tag="MRET_1116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027483309.1"
                     /db_xref="GeneID:38737882"
                     /translation="MTNNAKPPVPTFRSFRSQRSKASENCDTSKSSGSSDLEGFNKRF
                     HSKRTLRRNTHEYRGSHETRGDDASKLFVIDRLGDLNSAKYGPSSHSAPLNTTSSDRV
                     KRPRHNKSLSELEGSATEKDFIPVSLKDHSQYPLYRDPYQGSHSASISDVDGGPVFSA
                     TSAQEEIRFLQVQISKHPDDVSAWMKLVDAQILLFDKANIADASLVESTLAQMKLSVL
                     EKAFQASDQNKDSITLRVAQLHIATEGGIWAQEKIQQGWRHLLGLSSLNSGELMLLWR
                     NHLFFLKTNASNFQMDRLLDAYHDAIAAITKRMEIDPEHVHPMEKFRVDVTLDLCRIL
                     QSAGYIEWAYSIIQAELELYLGVWREGIPAHLAAEDILDLFCVWWDAEYPRISDHADA
                     YYGFSIHHPHAGNLSIFPRIDLEDTMTTPETMQNHQHAWQLNELKRAIRTTPVAFHGS
                     QEPDPHCDPYSYIVSSDIRPHLFLPLRASLESVLMVLDAFFAFLGLPEGWITHTCNHD
                     SETTFPKLNGWIQHIPRSVPRWQTLSLSTTFWQGISSQNAFKCPLYSFEILPDTWIPR
                     TEKDPRGFWFHTLPTLPRSTACQVERCLLQMRCILADGCAANISSIMVLPLTMLYAAT
                     YTYKAARHVLRDQLQQTPHMVALWYAYAQLELSIWGNCAALGKVCSEVLGGASHAYSG
                     ASTAYFLSCMWSLWIECLWVTGSWNACMQVIKCAVNCQFGCVPERIQLSNESVSPAEA
                     LQILHSLRKIVKTKPDCTNTFVLAVLEHILQDVSVGDDLTASIRVFAETLIHSPEHLR
                     NVIAQVCQRFLTASQCCQKRHITRPRELRSLAIKLARMSPNNSILLYSLFMQNQKTRF
                     DQYVHYVMEEIALSNTMCREELGWLYALMAQLPCAHQGTLRQFFDKALKALPFSQTLW
                     HAALELEARGVPELRRVKALLYQALWHCPYDKGLILRAMDPILQPAFTTEELYTIARV
                     GDERQLRIFADMIASPHSVQGGACTVAVSPLKSGSCA"
     gene            <447768..>450303
                     /locus_tag="MRET_1117"
                     /note="MRES_04445"
                     /db_xref="GeneID:38737883"
     mRNA            join(<447768..447843,447887..>450303)
                     /locus_tag="MRET_1117"
                     /product="transitional endoplasmic reticulum ATPase"
                     /transcript_id="XM_027627744.1"
                     /db_xref="GeneID:38737883"
     CDS             join(447768..447843,447887..450303)
                     /locus_tag="MRET_1117"
                     /codon_start=1
                     /product="transitional endoplasmic reticulum ATPase"
                     /protein_id="XP_027483310.1"
                     /db_xref="GeneID:38737883"
                     /translation="MVEGNKLVPQDDTKDTSLAILRNKKSPNRLFVEDATTDDNSVAC
                     LSPAKMEELGLFRGDTILIRGKKRRDTVLIVLTDEETEDSKIRLNRVARNNLRVKLGD
                     LVNVHACHDIKYGKRIHVLPFDDSVEGLQGNLFDVYLKPYFLEAYRPVRKGDTFIVRG
                     SMRAVEFKVIETDPAEFCIVAQDTVIHTEGEPVRREDEEANLADVGYDDIGGCRKQMA
                     QIREMVELPLRHPQLFKSIGIKPPRGVLMFGPPGTGKTLMARAVANETGAFFFLINGP
                     EIMSKMAGESESNLRKAFEEAEKNSPAIIFIDEIDSIAPKREKTNGEVERRVVSQLLT
                     LMDGLKARSNIVVMAATNRPNSIDPALRRFGRFDREVDIGIPDPTGRLEVLRIHTKNM
                     KLAEDVDLEQIASETHGYVGSDIASLCSEAAMQQIREKMDLIDLDEDSIDAEVLDSLG
                     VTMENFRFALGVSNPSALRETVVEVPTTTWADIGGLDKVKQELQETVSYPVEHPEKFL
                     KYGMSPSKGVLFYGPPGTGKTLLAKAIAHECQANFISIKGPELLTMWFGESEANVRDV
                     FDKARAAAPCVMFFDELDSIAKSRGGSSGDAGGAGDRVINQILTEMDGMNAKKNVFVI
                     GATNRPEQIDPAILRPGRLDQLIYIPLPNEASRLDILKATLKNSPVSPKVDLGFLAKH
                     THGFSGADLAEVCQRAAKIAIRESIEADRRREQERKERGDDVKMEEEGAAQELEDDPV
                     PEITLAHFEDSMRFARRSVSDADIRRYEMFASTMQQSRGTMGASFRFPEGGIDDSSPS
                     GASTQQVATAAPGAAPAPAAFGNDDADDDLYA"
     gene            complement(<450354..>452138)
                     /locus_tag="MRET_1118"
                     /db_xref="GeneID:38737884"
     mRNA            complement(<450354..>452138)
                     /locus_tag="MRET_1118"
                     /product="IKS protein kinase"
                     /transcript_id="XM_027627745.1"
                     /db_xref="GeneID:38737884"
     CDS             complement(450354..452138)
                     /locus_tag="MRET_1118"
                     /codon_start=1
                     /product="IKS protein kinase"
                     /protein_id="XP_027483317.1"
                     /db_xref="GeneID:38737884"
                     /translation="MELILSPHDNENLQLVLRTRQHLVEYNSASHALILRSTQLPAPV
                     MTNSVARAMSQEASLHSPAHSHVCPVCQRPWEKDFFPSSSMHTSSSWTNNENDLVHVA
                     PHYFRLLSQVPLLGTTNSNVGSPPVCEEVNEGYYERFFVEIRQLGRGSRGTVYLCQHV
                     LNGHELGMYAVKKVPVGNHDDTLSQSLGEVHLMEELIHPNVIHYKHAWVEMSQASPFT
                     PRVPTLHVLMMAANGGSLADWISARSGDSKENSKSPTVKQTYVDRLKTEFRKRRHAKE
                     CGEPRGSTRTGIHFLREEEIVQLMIDITRGLDFLHNRGILHLDLKPGNVLLHWDDDAL
                     LPKALLSDFGSSLPVHENWLRKRTGHTGTLEYMAPETIVPHRGQLAELSSKADIWSLG
                     ILLYVLIFFELPYTQVDDVDLLQSEISAFHSLEDTIHCRRQSRRYSHVHPALGSLLNN
                     MLQVYPPARPTCRDILTVLEHYPDAPTSALQVKQSSAVTILPALKISTYTRPSFAVKT
                     SLHTPVLVLLVISIIYMQILLADHLGWIYGSQYHVWIRHVCTLLALAQLAWSVTSRPS
                     MIGSIDRRWVFPSMILVILIMVYICTEI"
     gene            <452292..>454232
                     /locus_tag="MRET_1119"
                     /note="MRES_04450"
                     /db_xref="GeneID:38737885"
     mRNA            <452292..>454232
                     /locus_tag="MRET_1119"
                     /product="BRCA1-associated protein"
                     /transcript_id="XM_027627746.1"
                     /db_xref="GeneID:38737885"
     CDS             452292..454232
                     /locus_tag="MRET_1119"
                     /codon_start=1
                     /product="BRCA1-associated protein"
                     /protein_id="XP_027483318.1"
                     /db_xref="GeneID:38737885"
                     /translation="MFVLPKYHIHVSELALSPEEARLPSRPFEQVPSPAPFRTPIRTN
                     RGLDLRLGPLEITYLYLHKMNESYVNIGTIQSRFEQISTFEVSSCDTHHKTDQGVVHV
                     PFGIVHLFRVLDNAHDSQHSTKVVEADDATVDDESMGTILAMLNVPAPMNASALLQFL
                     DSALEAIEQVRIIHQLGKNYLLVLIKFRDALDAEEFFKMYNGQPFDAFDTSDACELVY
                     ITGFTASAASSMPVPYPMSSALSPWPIILPSDTEKAPSLHNLQPHRLDSGLRKNAFEL
                     PTCPVCLDRLDSRLSGIVTVLCQHSFHCSCLQRWDDSRCPVCRHSYVRHVKGASADGS
                     DASLLASHCGACQNDSDLWMCLICANVGCGRYTHGHARQHYEETGHLYSLEVETQRVW
                     DYAGDGYVHRLIQSKSGGKLVELPSATNMAASVPGELWNPRYPSGSGFNREGNELQEG
                     ISNPTDQGQVEMLQEKMEAIGAEYSSMIMSQLDSQRVYYEGRLAQVKSQSVSQSEYEH
                     ACRERDQLREECNATKEHLDSMSQELSSTQSTIKRQDAQLRRALETVRMTRHELEEEK
                     SVSSGLYSHVQQLQEGHSKLEAQVADLKEQLRDMMFFVSARDKIDQMDDSFGIAGGDV
                     IVPSEPSEQRTRHNKKNGSSRR"
     gene            complement(<454229..>454561)
                     /locus_tag="MRET_1120"
                     /db_xref="GeneID:38737886"
     mRNA            complement(join(<454229..454405,454440..454526,
                     454559..>454561))
                     /locus_tag="MRET_1120"
                     /product="dolichyl-phosphate mannosyltransferase
                     polypeptide 2, regulatory subunit"
                     /transcript_id="XM_027627747.1"
                     /db_xref="GeneID:38737886"
     CDS             complement(join(454229..454405,454440..454526,
                     454559..454561))
                     /locus_tag="MRET_1120"
                     /codon_start=1
                     /product="dolichyl-phosphate mannosyltransferase
                     polypeptide 2, regulatory subunit"
                     /protein_id="XP_027483961.1"
                     /db_xref="GeneID:38737886"
                     /translation="MALSDRIIGGTCLFVSVSVFMYYTVWAIVTPFFPANAPLQSFFP
                     PREWAVRLPALLLFAGLSFITLFIIRVLRKQAIAKREKEMQKSA"
     gene            <454661..>455532
                     /locus_tag="MRET_1121"
                     /db_xref="GeneID:38737887"
     mRNA            join(<454661..455457,455493..>455532)
                     /locus_tag="MRET_1121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627748.1"
                     /db_xref="GeneID:38737887"
     CDS             join(454661..455457,455493..455532)
                     /locus_tag="MRET_1121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483960.1"
                     /db_xref="GeneID:38737887"
                     /translation="MPMEKDLTTRVAAAYDAACSDTRDPVRGEGGGFLVNDSLAGGFV
                     PDADLYQEEGISQGMKVSALPRALESLGLDSSQRQDVCELLEANAVHGTYDNEPSIPK
                     AYFIEAVQTVMEGVRRSKRRRTNRQATNELHDSESYSDDEYDPSNDEYTSFSEEDAPN
                     TDTKTKLTKTKREQARFLYRLLLERIPLVAPTMLSTLPNTGIRTDVTEEEVDTRCIGI
                     DELRYAARNLGETPSTTELAEMLHEAISLSSGTKARTNTQAPRIGLHEFMHITWRLGS
                     LA"
     gene            <455833..>457539
                     /locus_tag="MRET_1122"
                     /db_xref="GeneID:38737888"
     mRNA            <455833..>457539
                     /locus_tag="MRET_1122"
                     /product="La domain protein"
                     /transcript_id="XM_027627749.1"
                     /db_xref="GeneID:38737888"
     CDS             455833..457539
                     /locus_tag="MRET_1122"
                     /codon_start=1
                     /product="La domain protein"
                     /protein_id="XP_027483963.1"
                     /db_xref="GeneID:38737888"
                     /translation="MTTSPWTTKSGTRSGPTVSYAQRLRQANAAADFTANERDQSKSK
                     KISVNESSPASASSEALSSSSTITHSPKSVPLKVAEPPSTSPGSPPHSAQGESESELS
                     NGNDNVWELRMRRRHQRDLYPRHHSDSSSTQHTNPTSKKCSHSQTSNASSVQNDSELA
                     LDDIANDAWLQRIHMLNGGKSAPLFVKHLTSTPDKPSLSSSTGDVSESHESDNVTSHA
                     MSSSAPDTTMTNGWSQSWLYQAGPQPVFLMTPYGLLPSNATTPATYADGSFSPHRSMD
                     SYQHHMRHDAPFPMGYPRMVPMQDKLEGSVWSRRGRAGRGRGSSRASVITHGMQNGAV
                     AMQPAQRPEGPASLPDGYPHQLVKTKQDEFYDKSHADSHQHHINNESNTASSTSYSGH
                     APNAQNEKAFLSSYGPYAAPYMNQPGAPAAPYSMPVLTYVAMDPNASSPVPTPVFPYY
                     VPAATPPTDASVLSEHLRAQVEFYFSDANLASDFFLRQKMDDQGFVALETILGFKRLR
                     SMFKNAVSNASTDEPQSIPEEGQKETLRSALAQSQVLELNHDHTKVRRQNGWQSYLLP
                     PN"
     gene            complement(<457547..>458830)
                     /locus_tag="MRET_1123"
                     /db_xref="GeneID:38737889"
     mRNA            complement(join(<457547..458718,458743..>458830))
                     /locus_tag="MRET_1123"
                     /product="lysine methyltransferase"
                     /transcript_id="XM_027627750.1"
                     /db_xref="GeneID:38737889"
     CDS             complement(join(457547..458718,458743..458830))
                     /locus_tag="MRET_1123"
                     /codon_start=1
                     /product="lysine methyltransferase"
                     /protein_id="XP_027483962.1"
                     /db_xref="GeneID:38737889"
                     /translation="MHDTDARVAFLDWLRSHGAYVHLSLYFRHNEKDGWGLYTRDVLG
                     EATEAMRIPRSIVLHPMIAHQKLCQGLRVNDGYETLCPREWMLLYLVIQRVLSEKTLT
                     GGTMTILGAHIPYIRIFPTSMLTPLHYSTSELSLLEGTTLYHGAIQRREASKLSSERA
                     KDWLVSAMTSASDDQIRLLLTWIGEIDWHSAWLWAEDGYASRSFPPQVAGWPQGDEPI
                     LIPGFDALNHRRAEPVTWSFREPALAVFTLRRAYSQGEQVYNNYGAKSNEELCSSYGF
                     VEPDGPDDLLALALRSNADDAAGVFYWPQNQTEPPSALLVRLREHVGPTAETGRVARL
                     LLEVQVMEMLEKMLRQRRKAFRLTQREVEDAVPFKNESDFVRESVLYVIRTYRDAQAS
                     MLNKKIQWVQAELDRLLDELEHEGWTP"
     gene            <458940..>459282
                     /locus_tag="MRET_1124"
                     /db_xref="GeneID:38737890"
     mRNA            join(<458940..459011,459040..>459282)
                     /locus_tag="MRET_1124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627751.1"
                     /db_xref="GeneID:38737890"
     CDS             join(458940..459011,459040..459282)
                     /locus_tag="MRET_1124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483957.1"
                     /db_xref="GeneID:38737890"
                     /translation="MSSQAQRVPHLDNVDDASRKKIQSHITVGPMSSKEVSRSAQLTS
                     EQPAVVAPELTDGSGAPIPQVQQDAKTGPEMVGEEDPTNDTVKNKRGAMEKILGFFKK
                     SS"
     gene            <459552..>460799
                     /locus_tag="MRET_1125"
                     /note="MRES_04455"
                     /db_xref="GeneID:38737891"
     mRNA            join(<459552..459652,459680..460200,460233..460573,
                     460602..>460799)
                     /locus_tag="MRET_1125"
                     /product="HAT1-interacting factor 1"
                     /transcript_id="XM_027627752.1"
                     /db_xref="GeneID:38737891"
     CDS             join(459552..459652,459680..460200,460233..460573,
                     460602..460799)
                     /locus_tag="MRET_1125"
                     /codon_start=1
                     /product="HAT1-interacting factor 1"
                     /protein_id="XP_027483956.1"
                     /db_xref="GeneID:38737891"
                     /translation="MVSVKQDLDEANKLFALKRYDSASDLIASALESLRDTFGEDAPE
                     LAPILHIYGRALLEHAISVSGALGGGGTIGSTEDAEPTTAPEMISGARPEDEMHGDDN
                     GLREQNAAARKRKVADEGNFDANKEEEEEEDDDLGIAFTVLDLSRVIFEKLLDGSHTQ
                     ESHQESKGKGKFKPELHLVTGETWSKREIESELAEVRNDLGDIGLETENFEQASDDYE
                     ASLDILKNLLPPYSRRVSDGHLRLGLALEFHPDVEQRKHAKTHIEQAANVLRRRLVQL
                     ERVRSHEDKKPSDESANDHLWDLDEDQLRREKKDIEEMLKDLELKLDELAANPSTVLK
                     DDGKPVNPELEKAIKEAFLGATESLASDSELHAPPADKPVNDLSTRVKRKKH"
     gene            <460897..>461545
                     /locus_tag="MRET_1126"
                     /note="MRES_04460"
                     /db_xref="GeneID:38737892"
     mRNA            join(<460897..461371,461412..>461545)
                     /locus_tag="MRET_1126"
                     /product="adenylylsulfate kinase"
                     /transcript_id="XM_027627753.1"
                     /db_xref="GeneID:38737892"
     CDS             join(460897..461371,461412..461545)
                     /locus_tag="MRET_1126"
                     /codon_start=1
                     /product="adenylylsulfate kinase"
                     /protein_id="XP_027483959.1"
                     /db_xref="GeneID:38737892"
                     /translation="MATNITFHPGNVTYDERSSLLNQKGMTIWFTGLSASGKSTVAVA
                     LEQHLLHLKKSAFRLDGDNIRFGLNKDLGFSPKDREENIRRISEVSLLFASSTAIAIT
                     SFISPYKADRDFARELHRKHNPELPFIEVFVDTSVEECAKRDPKGLYKKAFSGEIKEF
                     TGVSAPYEAPENPEIHIDGAKSSVEDSVKTIMDFLLSKKYIC"
     gene            complement(<461802..>463671)
                     /locus_tag="MRET_1127"
                     /db_xref="GeneID:38737893"
     mRNA            complement(join(<461802..463552,463599..>463671))
                     /locus_tag="MRET_1127"
                     /product="FH domain protein"
                     /transcript_id="XM_027627754.1"
                     /db_xref="GeneID:38737893"
     CDS             complement(join(461802..463552,463599..463671))
                     /locus_tag="MRET_1127"
                     /codon_start=1
                     /product="FH domain protein"
                     /protein_id="XP_027483958.1"
                     /db_xref="GeneID:38737893"
                     /translation="MYDDSFGLLSSHANAEAPLQPCSPSNPQVDLFSPDDLNQFLRQD
                     VNHESKDGMSTPPDSNLSQDFSLSAMGLNELASPFTGVDGSDQGVSNAKAPSRSNPTS
                     MLKSCSDSPVYNQNKQGLSPSKAANPVNTSATMALSTPRQANGQRRFNWAEMICYTID
                     ESPEGKLFVQDLFERMVKKYPELRDRAPEFNWEARVKNRIKSTLSTKNNLFIKLPRHD
                     RPSGKGSWWALSPDAREALREGCISDAIKGIGISPLASRHSVQEPGNKESFSSIHDNY
                     QQHMGAPQRSLSAYGSEPRLQQKELKSINWIQDNTLKQFPAERVGPYTSSMLARRRLG
                     MKKPGLSRLNLSASSFYDTVNDDANTAASVSNPSTLSSMFTQMQEHVSTPESSVFSLS
                     PVTASFPSPLPLSPGIQANTHSNYEQNTYQPSSLCNSSIPGNDSSFFGLIQANDVPFD
                     SSNMPQYSAENLIDFNSTNAELRNMTISNAPEVSESGLLNGNIEENSNDFPPDVRSLF
                     ESSQMQSTTPVFPTMNQSQAATSCSLPLDFRNTTPIESQGPTTFSCPEYTNNDMYDLL
                     MNNILGSVASFKCSPGDAVECNQSTFDPNNNNLAQWNIDLG"
     gene            complement(<464202..>465734)
                     /locus_tag="MRET_1128"
                     /note="MRES_04465"
                     /db_xref="GeneID:38737894"
     mRNA            complement(<464202..>465734)
                     /locus_tag="MRET_1128"
                     /product="OHCU decarboxylase"
                     /transcript_id="XM_027627755.1"
                     /db_xref="GeneID:38737894"
     CDS             complement(464202..465734)
                     /locus_tag="MRET_1128"
                     /codon_start=1
                     /product="OHCU decarboxylase"
                     /protein_id="XP_027483955.1"
                     /db_xref="GeneID:38737894"
                     /translation="MSRTIISAEALPTASVEALTQILERVLLCSTIGAEKLAKQSHAA
                     IQDLPDDSRPCTYDGLVDVARFCLEEEPGWSHDECIEFLSQYPRLDVLVGENQRLSQL
                     CEEYETRFPGLRYISSKNEPDIDAAISEVELSLQHYNSTHSYEPSSVEWRAELDHVLG
                     MMWDSAVDRASALHPGPVTTEPDTFDKVATSPESNAAPSKPQEERGDDEPFLSLSSFR
                     ALAVTSPCIEKFFEHDLPKSFRLDEVQWSSSGGAFAWHAAPVVPRNGQRGPDVKSTKS
                     SAGTVSIASTLLHGNTVPLHAETPVSYSRDITSGARGKVVGFLGGLFGEEGKTRIDAL
                     ADQVALRLQAHSVRGPIPSFAQEPAPEPEKKSRTWRNAWMQGKSAASNVVSEARSSTF
                     SGRLANVFGVQSATSPEKVSSSENEDTTNESCYQDGDSDSRTALRGSDLAREGPEAAV
                     ATLRAANETLLQERSAFVIDETPSADNTMGEGEDEADHDVEGLDALIAGAAEPSLTSP
                     TA"
     gene            <465855..>466916
                     /locus_tag="MRET_1129"
                     /note="MRES_04470"
                     /db_xref="GeneID:38737895"
     mRNA            <465855..>466916
                     /locus_tag="MRET_1129"
                     /product="cytochrome-b5 reductase"
                     /transcript_id="XM_027627756.1"
                     /db_xref="GeneID:38737895"
     CDS             465855..466916
                     /locus_tag="MRET_1129"
                     /codon_start=1
                     /product="cytochrome-b5 reductase"
                     /protein_id="XP_027483954.1"
                     /db_xref="GeneID:38737895"
                     /translation="MQRALPRGARAIALATPVCLGAFYVTQQARQSDEGPLPYRYAPL
                     LLGSTSLLPCQAARAFESDERAMHRHLHLVSKKPLTLGRDCIPFAIYSYYIKEPTLQV
                     ERPYTPLAILSRSDACSLDMLIKRYADGELSRYLHRLRPNAPVYVRGPEVTWQLPSHA
                     KMPDEIVMMVGGTCVAASHQLLSNVLDTRDPATSPRLTVWYAASSLDALQAVPDMVRY
                     LKQYPEHVQLRLWVERMPRHSQQADLCTATGIPVGARVRRLDTATWLGRLWSRRPVHE
                     LVVDGVAVPVHSGRISLEDIQTRLAHSEVWRRLVLVCGPDGFVHALAGPKARDLLSQG
                     PLGGMLRASGYTEAEVFKM"
     gene            complement(<466906..>469104)
                     /locus_tag="MRET_1130"
                     /note="MRES_04475"
                     /db_xref="GeneID:38737896"
     mRNA            complement(<466906..>469104)
                     /locus_tag="MRET_1130"
                     /product="conserved oligomeric golgi complex subunit 4"
                     /transcript_id="XM_027627757.1"
                     /db_xref="GeneID:38737896"
     CDS             complement(466906..469104)
                     /locus_tag="MRET_1130"
                     /codon_start=1
                     /product="conserved oligomeric golgi complex subunit 4"
                     /protein_id="XP_027484018.1"
                     /db_xref="GeneID:38737896"
                     /translation="MARVADEVKVALRQLEHDERTQKHRMEALVKEATKALQQSDTVV
                     HEHTAPPLHRAQRHAHAIESRFQSTTHTAQQLYHDLNVLYEEGNRIQLSLQWCNEAVQ
                     LRTSLGALADALERLDWDACVRHCQHASSVPADVLHSDFVRTVVPTAMHPDAPPQLLA
                     HLRASLIDKMAQQFAHYANARDEAQATRFLAYFAAIHAHEQGLAAYSAFACSLLEAYG
                     HELEERLRSPSANPLFFGMLWTALHEYLAVFISKHQPVVDQLLGQPGHCDFMQGVWPA
                     LERVWSSFALRILEAWRAERNVDQLVRDAQDERFTPLETIRASPYTPGRIYEHHRGGG
                     SEYLAVDALLNEMVSFSAQWSLLMQFLRRSTLPTDAAVFDGRLARTIQDTMLHVFVPL
                     QMYALQANVQQVHMLDTPDVQSLPYASSLPDDMFFALRTVLSRSLSTSSVDVAERIVS
                     QAVAMVETYFVEIVVLRMDGCRRALNISRLVDGPRRAAAAREVRTTLCVYLNVLDISA
                     SYSDRILALLSQPSFLESCFAGGDADSPLAIAQGIVSRLGTLSPKIRTALQFEIDELY
                     RALVEPRLQALLSDIFRDLNYKLNEASYGQLPEAHTLTERLRTGWDALMTGYRDQLTE
                     SNYASLFSMAVDALVRPWEQLVFQLTFTELGALRFDKDVRGVLTMLSERAPWGLRDKF
                     LRLQQVSYVLNMDEEETDTSDAYEAGVSSGISWQLTPAEVQNVRALRVTS"
     gene            <469205..>470014
                     /locus_tag="MRET_1131"
                     /note="MRES_04480"
                     /db_xref="GeneID:38737897"
     mRNA            <469205..>470014
                     /locus_tag="MRET_1131"
                     /product="3-hydroxy acid dehydrogenase/malonic
                     semialdehyde reductase"
                     /transcript_id="XM_027627758.1"
                     /db_xref="GeneID:38737897"
     CDS             469205..470014
                     /locus_tag="MRET_1131"
                     /codon_start=1
                     /product="3-hydroxy acid dehydrogenase/malonic
                     semialdehyde reductase"
                     /protein_id="XP_027484019.1"
                     /db_xref="GeneID:38737897"
                     /translation="MSVTWSSRLHDKVVFVTGASSGIGAAAAQLFAYAGANVVLGARR
                     IEKLASVQAACERANADGATGHGGRYAVLDLDMRNAQSIESVLQRMPSWASDVDVLVN
                     NAGLASGTAQVGDIRREDVDAMLDTNVRGLIEMTQLFVRMFKARNRGHIINLGSIAGM
                     EAYPSGSIYCATKFAVRAFTSALMKELYTTPIRVTNIQPGMVETEFSLVRAYGDQTAA
                     DKVYVGMEPLRAEDIAEEIVWAASRPDHVNIAELTVLPVQQAGPYHVSRRT"
     gene            complement(<469944..>472475)
                     /locus_tag="MRET_1132"
                     /note="MRES_04485"
                     /db_xref="GeneID:38737898"
     mRNA            complement(join(<469944..470076,470101..>472475))
                     /locus_tag="MRET_1132"
                     /product="spindle assembly associated Sfi1-like protein"
                     /transcript_id="XM_027627759.1"
                     /db_xref="GeneID:38737898"
     CDS             complement(join(469944..470076,470101..472475))
                     /locus_tag="MRET_1132"
                     /codon_start=1
                     /product="spindle assembly associated Sfi1-like protein"
                     /protein_id="XP_027484016.1"
                     /db_xref="GeneID:38737898"
                     /translation="MALWQDASSSAMLDESASALSSSMFFPWRGARRETEPARLAQLA
                     SSFALRDVEVAFFNAVIRHLPPASTSFSELKHAYNVCRQDTALVAPIMHDFRASYTPE
                     AQASIDARLWNTLLSLVQVRGHTWAERWDTIRVGLGLEPLDDESSFSVDTRAPVVLSS
                     TPWKPATRRPHFERRWDTYRRRVQRRYLYQWLARTQHLAHMYARAKHTHERVSVWTAW
                     VHWRDARERHVQSVREADAMHRTRLTRASWTSWRLAVGHRHAQRRDAQHRALAVGWHT
                     WHAKKCDRLQRIAWTLWQHAWLAHTATAIDTFRALASAWHAWRARMERLAHLSPKASL
                     FSRYLTQRLASRAWVAWRLRLGERRSDAHDMLLAARLRAHHALRRAWGMWRTSLAQHL
                     VRHHHGRQVSQRVDERVRHAAWMTWRVRTQLVGIDAVRTAHSLRHAWNAWWLTYTERT
                     MARQALVMQLTHRTHARVVRHAWHTWSRRYHAQLREERAAQGTFTWRCLYMAWHAWKA
                     RWRHVQQEWTRAEDVETHHLLRRRWRAWTQALQRRRETRAAHHYTDQLLRRVWSAWRV
                     SYASQRHSQSCEALVLAQQHAHRQREAWRRWTSKLAAHRDRAGRACLVHDALLLRAGW
                     GQWRTRRALCRAMEHTAVTWHETRRGSAHRQLRRAWDAWAARREHRIALQQAYALWTS
                     ARVTRAWWQWRDVYAQLCLQAPELETLALRRRAILRVCWARWTEASACVPMLRARRCQ
                     RQRLVLRRWRRATQAARHRRTARHFGLDTAGRDAWDAWRARAMYQRDTRWISRLKGRR
                     ARLSNVPRVPPRFQARCAETHGTVLPVARAAPSAQQY"
     gene            complement(<472551..>473144)
                     /locus_tag="MRET_1133"
                     /note="MRES_04490"
                     /db_xref="GeneID:38737899"
     mRNA            complement(<472551..>473144)
                     /locus_tag="MRET_1133"
                     /product="pre-rRNA-processing protein TSR2"
                     /transcript_id="XM_027627760.1"
                     /db_xref="GeneID:38737899"
     CDS             complement(472551..473144)
                     /locus_tag="MRET_1133"
                     /codon_start=1
                     /product="pre-rRNA-processing protein TSR2"
                     /protein_id="XP_027484017.1"
                     /db_xref="GeneID:38737899"
                     /translation="MAAAPPPAAVHDAHEAVDTPTKEQLQFARSVYILLQLWPALRQA
                     VQEQWGGEFSEEKRAFLLSHLCDEYGNHGARTRPDLDDLTELIESYVMEEFDCELEDD
                     SAALMAGHICLVHTGIFLEDKGDTILAELESTLSRTGAKAQRAEVQDGFDMIDDHEAS
                     DDERPAQPSARPAEPAPKQERIVDEDGFEMVQPRRRT"
     gene            <473241..>475235
                     /locus_tag="MRET_1134"
                     /note="MRES_04495"
                     /db_xref="GeneID:38737900"
     mRNA            <473241..>475235
                     /locus_tag="MRET_1134"
                     /product="programmed cell death 6-interacting protein"
                     /transcript_id="XM_027627761.1"
                     /db_xref="GeneID:38737900"
     CDS             473241..475235
                     /locus_tag="MRET_1134"
                     /codon_start=1
                     /product="programmed cell death 6-interacting protein"
                     /protein_id="XP_027484014.1"
                     /db_xref="GeneID:38737900"
                     /translation="MPNVLGLPYPQTAPVDVRDGLRAHLHTNFPDIDPQLFERDIEAW
                     QDLRSKCVSSVAPTGPSPLLRDYAAQLDCAARMLKNEAGTAFPWAPGFSHAPPLQWHE
                     SIAAERAYVLLWIAAEHAQSASWESRSTSESLKRAANEFQLAAGCLAHMTTLPLPAPL
                     QDQVPCLRFLMLAQAQECFWQKAVQDALKDTTIAKLAQGVSTLYADSVALAPPAALPP
                     DWLQHMECKRWHFAAAAMYRKSCDDLAQRRHADELGRLRLAASYVERAKRAGTRVVAT
                     AVVDDVQSLYDIIHTNLVRADKDNELIYLEAPTNAAHLPDIGTALLATERCPTPVEAP
                     VAYLEQGQQEAWFRRLMTYGVDVAVRLYADRKAQLLEHTLEATASRLDAQLEAALSTM
                     QMAETLQRLDRPQRLPTHWHEYVSGIADGGVRALEELMQRVVQLADMCRAAYEQARPY
                     HDEALLSEYDTALSEARRSDHRVRASLDQVAPLAHIMERGMTALHAWAMPTIRDLQRA
                     CEAHTDDIRGIHAMMEQLRDGAQARRRLVLRARAEMDSDDLRETLLHMVRARQVGDAV
                     PAAALDDVLATSMQRYDVYVRDLQRCESEQQERMRHLKQALMRLLRQADVAHALDAQA
                     EAWHRVEEAYGQWAALRQHVAEGLVFYETLHDRLRRLADV"
     gene            complement(<475212..>477956)
                     /locus_tag="MRET_1135"
                     /note="MRES_04500"
                     /db_xref="GeneID:38737901"
     mRNA            complement(<475212..>477956)
                     /locus_tag="MRET_1135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627762.1"
                     /db_xref="GeneID:38737901"
     CDS             complement(475212..477956)
                     /locus_tag="MRET_1135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484015.1"
                     /db_xref="GeneID:38737901"
                     /translation="MASRRRPTPLAPPRSWRRVVSRDMKRPRPQRVSRRRASCLGGPC
                     AMEAEAGRRSRLNAWVHACFDGSMARDRPVAWSRQNLVAYGAVHDGAACVVVVPSERV
                     GCAVDDPVATHLHPPTRGPLFAAGRQAPCDLDAPALVSFSPCGYTLMAFFSVSPILAT
                     SDASALPSEPVRARPLTPAFAESKGTESPALTPPVSMPHTYSQPISDATDLLPYDHGV
                     ICIWTRAPGASIAAWSLKQWIPVSPVPSFTHLSGHIIGLHWLDHGRMWKGTESGASYM
                     RAPSCGPATNVPPAGVPSDRMASEQACILVSHVGHVVFVHRANEQAPFRMHVGWLHVP
                     GIYPLPTHYEPTTLHKMFTTLDIRHMSITALPNEPILFVAYQCYAHGSVMFMHVSELT
                     FDLHGELSCFIVNPEPPLTMRSPQDSICGTSHAYLMLTAMTWSCLLDGSLVLVFALAT
                     DESSFDPLSSSTSLCNTSLYIWNVRRSQSRRMDELRCIFESLPDPSRAVDDAYRAWRI
                     TVRSVEHIPGMVISSLLPESSPLPYAGRIYATAFDIPNMGREVWAVLDTRTFAWSVLD
                     QSMPEQALMRSAMALSPCGVLACMCLGPSRPLRMVPLPVSRADVPSLGALFALSLLRN
                     ASPMDVAMYARTHHELSPAMIADVVHATEHALGYDPHSLAQSVRLCPLVEALATCSAH
                     LCLQQRAHTLSQLAQMHHTLCAARTDATCARLDEIHAAGATSASFAAASVWRLAHVLR
                     TLVRLLERVLHTAMHCTAAGARPADVRSDAVLDLVLHAPTSRMVHDIVAGACVFAHWI
                     THMSPHAWLHELVPAHDRATPLKCEQALTTLANVQAFVSDTLHGTPIDVPRVLALFDA
                     PAQPHEPACWDAWMHAPQPTLSDAAWERAQHVRHLHAIRDPLALARLYTPPLDVRETP
                     "
     gene            <477955..>478524
                     /locus_tag="MRET_1136"
                     /note="MRES_04505"
                     /db_xref="GeneID:38737902"
     mRNA            join(<477955..478219,478246..478305,478331..>478524)
                     /locus_tag="MRET_1136"
                     /product="ubiquitin-conjugating enzyme E2 G2"
                     /transcript_id="XM_027627763.1"
                     /db_xref="GeneID:38737902"
     CDS             join(477955..478219,478246..478305,478331..478524)
                     /locus_tag="MRET_1136"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 G2"
                     /protein_id="XP_027484012.1"
                     /db_xref="GeneID:38737902"
                     /translation="MTTSTRNAAAAIRRLTIEYKQLTTDPNTLFPAVGPISEDNYLEW
                     EALLPGPDDTPFEGGVFSARLSFPPTYPLEPPTMRFDPPIFHPNVYPDGLVCISILHA
                     AGDDPNMYESSAERWSPVQSIEKILLSVLSMLSEPNIESGANIDASKMYRDDRAKYEE
                     TIRKQVREQLGL"
     gene            complement(<478539..>480314)
                     /locus_tag="MRET_1137"
                     /note="MRES_04510"
                     /db_xref="GeneID:38737903"
     mRNA            complement(<478539..>480314)
                     /locus_tag="MRET_1137"
                     /product="ribosome assembly protein 4"
                     /transcript_id="XM_027627764.1"
                     /db_xref="GeneID:38737903"
     CDS             complement(478539..480314)
                     /locus_tag="MRET_1137"
                     /codon_start=1
                     /product="ribosome assembly protein 4"
                     /protein_id="XP_027484013.1"
                     /db_xref="GeneID:38737903"
                     /translation="MATQVPKPSAKRQRLAAEAERRANEELSESGLINSHMPNVLVQF
                     KSGQDDTFLGPTISLPAQVGQAEMAKLVNELRRQDRAQNRKSDDDDDEDIPYAFHVLL
                     ASSADATSSQPTRISINTSLQRDVLNSTVAKQLGIGMEDSLTIVFEPQAVFRVRAVTR
                     CSSTLSGHGSPILCCSFSPSGLLLATGAGDKVCRIWDMDTETPLHTLQGHDGWVLCAE
                     WEPLERRLATGGMDGQVWIWHALTPPLPGRRGWGSRSGEQVEEEHRASAGQDARKLSV
                     VERRAARHAAPSGHMLRGHTKWITSLAWEPAHRNADAPRLASSSKDGTVRVWNVASRQ
                     VDFVLGGHTASVNCVRWGGDGAIYTASSDRTIKVWNDQDGRMIRQLSEHSHWVNSLAL
                     STEYVLRTGAFDVQGTYAARLIKQDYTDLHAMTKAVAQERYAEATSHGARPEMLVSAS
                     DDHTLFVWPPQVLGTAPNPKKSVARLTGHQKTVNHVCFSPDGRLIASASFDNSVKLWD
                     GRTGRFIANLRGHVASVYRVAWSSDSRMLASASKDSTVKLWNLKTFKIKVDLPGHEDE
                     VYCLDFLADKLASGGRDRTLKIWRH"
     gene            <480444..>481679
                     /locus_tag="MRET_1138"
                     /note="MRES_04515"
                     /db_xref="GeneID:38737904"
     mRNA            <480444..>481679
                     /locus_tag="MRET_1138"
                     /product="essential protein, constituent of 66S
                     pre-ribosomal particles"
                     /transcript_id="XM_027627765.1"
                     /db_xref="GeneID:38737904"
     CDS             480444..481679
                     /locus_tag="MRET_1138"
                     /codon_start=1
                     /product="essential protein, constituent of 66S
                     pre-ribosomal particles"
                     /protein_id="XP_027484010.1"
                     /db_xref="GeneID:38737904"
                     /translation="MDAAPSYKASLLSHDDAFHTLLNLIPAKFYVPAEDTEVESKFQK
                     NKRTKSEKQREAEERKLQTKKAKRDKLDPDNVKTVDELRADSRDDIDIDFEDDEEVEE
                     MEDADESTSEEPPKETPEPHTQQQNTRSASIAELRERLHNKIQSLHNKRQQNSTSEAE
                     APSTKQELLEARRRQRGEMRDNRRRERKEARRQAKNGAKAVEAKPSTASGSSRSAGLL
                     VHDPSSSAANHPGPLEGKLSFSHVTFETTQAPDTARKNKYALPSDPKAALATLEARKR
                     KEEARIQALVERGEDATQLHEAARENERWGKALAASEGVRIRDNVHHLKQNLKRREKS
                     KERSAKSWNERRKAEQEAQAAKQKRRMENLAARRTGKKPGDKVKKGAGAKARPGFEGS
                     SRSLTGGKASHGSSRASKR"
     gene            <481752..>482181
                     /locus_tag="MRET_1139"
                     /db_xref="GeneID:38737905"
     mRNA            join(<481752..481892,481921..>482181)
                     /locus_tag="MRET_1139"
                     /product="DASH complex subunit DAD3"
                     /transcript_id="XM_027627766.1"
                     /db_xref="GeneID:38737905"
     CDS             join(481752..481892,481921..482181)
                     /locus_tag="MRET_1139"
                     /codon_start=1
                     /product="DASH complex subunit DAD3"
                     /protein_id="XP_027484011.1"
                     /db_xref="GeneID:38737905"
                     /translation="MSASHEDAQETPASAAFQNPYDGHRSLTPSEQELLGEYARLSAT
                     TRRVAQLSTQLSSSTLHNHVLSELRAIERKMGLVLTLFKASVWAIVMQQSDADEEAQE
                     LEYQSRYDIIQEEPEDEWESTDAPDNQGYGW"
     gene            <482436..>483869
                     /locus_tag="MRET_1140"
                     /note="MRES_04520"
                     /db_xref="GeneID:38737906"
     mRNA            <482436..>483869
                     /locus_tag="MRET_1140"
                     /product="protein of unknown function (DUF1769)"
                     /transcript_id="XM_027627767.1"
                     /db_xref="GeneID:38737906"
     CDS             482436..483869
                     /locus_tag="MRET_1140"
                     /codon_start=1
                     /product="protein of unknown function (DUF1769)"
                     /protein_id="XP_027483833.1"
                     /db_xref="GeneID:38737906"
                     /translation="MPHLEVNVGPDRFHMEPCRLNDSRHPHEIDTEHFCGRVLVRILD
                     APGAKEGEPGREYFNDRTRRFCIQIEGRFKQEWSGDDILFGSDFDKFVPFPRAPFNAG
                     MRVARMIDPCTFYEEHPPSGRPYIMSPYAACMNVFCAWPAPHRLDDAIVVSHDHGDMP
                     SSAAEHQNDGGIVPIERIGHEPRSEVTEKRSSKWLPTILSSHKDDRVTDSYWRFLGFK
                     DDPLVQAYIHAHLPVASTNSPAATTNTAVLHAPTPTPSLMRPSPVVACPRPRKLQQGI
                     NTSTMIALGSSNKPHMTLMRGHIDRSDTPDLPVFLSSNLVLSKHDTHGSPGMIQTPVP
                     RPVNTNATVKMLQQMRVTPSPASSLGSVLSLDDKLGPWRFKDPGADMIEDNAFIFKTE
                     SVPVSKRRKYFADEANRKNFKYHPDVVYGTSFFSNLFDFNSFDLSIGPVHINVHPFFR
                     EMPIRYTLRSKTDENIVFCTVSFQLVD"
     gene            complement(<483866..>485257)
                     /locus_tag="MRET_1141"
                     /note="MRES_04525"
                     /db_xref="GeneID:38737907"
     mRNA            complement(<483866..>485257)
                     /locus_tag="MRET_1141"
                     /product="NAD-dependent histone deacetylase SIR2"
                     /transcript_id="XM_027627768.1"
                     /db_xref="GeneID:38737907"
     CDS             complement(483866..485257)
                     /locus_tag="MRET_1141"
                     /codon_start=1
                     /product="NAD-dependent histone deacetylase SIR2"
                     /protein_id="XP_027483832.1"
                     /db_xref="GeneID:38737907"
                     /translation="MTDTQDLAALQRLTELDDDLDSDALDHLEEEAEKELMEEMESEN
                     LACQSPSMSSRSDESESSDYVFGPLAPDDVADILHDLREVGMVECLRRHIMPNPSRIL
                     DILLSLGVMLPRSMLQEADEEPYMLLPILKMVFIRILRQRQKLPHYNTVDDAIQLLRK
                     SKRIVVLCGAGISVSCGIPDFRSKDGIYAILAQESKYELDDPSDMFDKETFLRDPSMF
                     YSFAHSIYPANFEPSPTHYFVREIEKHGKLLRMYSQNIDTLEQKAGIERVVQCHGSFA
                     SATCTDPRCKYQVDGQEIRDAIMSKRIPMCKMCEERRKTKAIKRQKIDESDEDDHGLA
                     FGIMKPDITFFGEKLPDEFEHCVLADRDQVDLILVMGTSLKVAPVADLLSHFPPSVPT
                     VLINRTPITHMAMDILLLGDSDPIVGYLCQQLGWPCEHAAPDAPTRVGDSNVWLFPGA
                     ETDHIATETTITD"
     gene            <485299..>487415
                     /locus_tag="MRET_1142"
                     /note="MRES_04530"
                     /db_xref="GeneID:38737908"
     mRNA            join(<485299..486616,486643..>487415)
                     /locus_tag="MRET_1142"
                     /product="R3H domain protein"
                     /transcript_id="XM_027627769.1"
                     /db_xref="GeneID:38737908"
     CDS             join(485299..486616,486643..487415)
                     /locus_tag="MRET_1142"
                     /codon_start=1
                     /product="R3H domain protein"
                     /protein_id="XP_027483831.1"
                     /db_xref="GeneID:38737908"
                     /translation="MSKGKLTRGRGQGRGRGRGRGRGGFVRGRSRKGLGAGKIGSLPF
                     DLASFSKLDATTPSSDNDERAPERQRGGKKTRGQRGRRGGSHSVTSHNRVPFNYNTRQ
                     AKPPLPEEADKLQVEKELGKQEFRKDSSDHREKSEDEEDKDEEVVIEPHKSYKKSIPH
                     RRKLEGLVVDEYKHVSEKREYNAMALIRHSNPLRRPVLFVRASGSFDKSGVLEPSPPD
                     EPESRAATKEPSHEKDLLEAPNSTYMHASVSEGKVESSSMSELVDNTEEHAEEVAMPD
                     DDEFLSFKLADQILESGTKGKPVSEQDAILADWMENAMMSDTDDVTMPALHAFSDPYG
                     EHTTLEDIAIDAQERENTAWESDSDKEEDRNSDEDDDPEDGTDDDDDDDDDDDILDES
                     LHELMLSKLSQTSSLQAEQSEEERFDSILRGSFSNKNRPDPSRVPARKSKKMPDFRDS
                     LWANELQEQWEKDRSKKAAKKQQRAAARQAADYDPYPNTHGHYNSTKITKKQRRLENR
                     QRRAQLKSLADHAEDGQVVAQAPKSFADICAYIDEFLLDETHTTLTLPPLGKRDRAVV
                     HNMAGAYALKSKSHGKGTERFPVLMKTSRTGHSVDYSRLKRLSRIPFALSERECDAHP
                     GLGGGGVRIEVGRRHKDGTHVGKGAKQISEDNIGHKLLRSMGWSSGQGIGQAGGRTEP
                     VQATVKITRSGLGM"
     gene            <487753..>492804
                     /locus_tag="MRET_1143"
                     /note="MRES_04535"
                     /db_xref="GeneID:38737909"
     mRNA            <487753..>492804
                     /locus_tag="MRET_1143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627770.1"
                     /db_xref="GeneID:38737909"
     CDS             487753..492804
                     /locus_tag="MRET_1143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483830.1"
                     /db_xref="GeneID:38737909"
                     /translation="MDTDTPGIGINEFQHDVASQHMREREILEHNERAMWISPAEEAD
                     PPLPPDALINVRRAKNRLIESSLPIGTLKLDFCPSIDDADALEPGAMKENTDVVSRRE
                     SQSLHSDIALEEDASPVFDMRRWPLASPPPQHSPRVQSRGDMPPLPPDAALHVAIAKG
                     RVAKDKSSIKRVSDSMEDDVVPNPVHDRPRMPHSAIRRTRPWPTSTFSQHSHRSYSPD
                     DDELQSDYDPPSLRRTVSTVTIVRKTSTRPDIDRLPKMPPPRPKPQTMAPPPRPVEPV
                     SSTENDWSTTFDSLDAFEPSSLDLLGEPKQMKPTSRSLPRTTRPDSSTSTTQMSQEDD
                     SVESAFEAPLKVPPTPREPNKTSIRLLSHNSLSPEPLSPSSSVHRSMMMRAPLTPSYP
                     LRDSPRSSEPTTVRSSTQTVLARDMREINDVHSTPSTPAPAHSRAALLMTDSTPVSSS
                     FSMPSAPTQSMPNLSSSSATSPRSSSPRTQLPSTAHVSPPPPPSWASTPPSGSPPASP
                     PIVQGPAPYPGSYLSLMERVKMASSMNASTRHLAARGVPMYGSGMDDYVQTNQVLTSP
                     APAEIYSTGANVDEPEEHPVGQSKTNESEAPTVPSKDSVWLSDSGEGLGATVPPASGP
                     VQTMPTMASTPSQPRSVPVSASNTFAMPSSSAAEAPPPPSMTGHEPAEPQPQGAKLPQ
                     PLPASEAPMRTSEPPQFSWNIMPVWPSAAVDTAKQGIPEEVSMADTSSATMFVRSDSE
                     LPTEAMRDMNLVQETNEQAPPAHVSEPKPLDPSEREEQPSLDEVAWSLLRQPNPETPL
                     TQSLPGAMPSSEQHERPESNPFRQLQSSRDHSLAPEADLESDARSSLYTDVRTAQMMR
                     NSADAPLAQSDVNENANAVWVKASAHDMRETLHLVSSKSEANVRMNKDTPALASNYKR
                     DEYTHAAPLLVDDLAPTPRPSHSVLGAQTPDNERWTQSAAKATPPPASPLPSVPIVRN
                     ISHTPMSTPMTSSVPPEPQSEFLIDRRSKTPVNASDSLSWTRPSHAGQLSPPIPQAPG
                     SPLLSMLGSPTNTHYPSAVSPTSQRAFSPLTFDSPRVPSKKLTYPPGTPVAAASPKAA
                     LPESIKNVETPPISTMPDGASPKSVFSTPYRTGSSSFRKQGVATPFEPSTPPMPIRAA
                     RNHLAPSSLTDSPAPQQQTAHPPILMPGGVKDLSDPLSDSSPPPVQFYEGIERKISKI
                     RARAHSPSQYPGLQPQHSHVAPFELQNRSLVFPAGVDPRNPGSGFCVECMMRDEDMAD
                     VTVMDSDVWERASDADFYEAMKVEESIRARNKDPMQMPEFLSLAVAGTQSISPSTELT
                     QGNLREHTTTSRLSPATKARSIFMFVSQQRHILGLEADDAATPSTSSPSRSQSALPVM
                     PATTARRAAPQSPRTALDKSEARSITGASDARSEQPGRRRKSSETVRRARSTGRSQPA
                     SPETDLRSSSRTSGRSTPVRSPRKRAMQAVVAPTMRGEAPDAEADSRIEVGDESMTST
                     RAATPPRSPSGPSGSTRSMRRPTGRSASRPDVPKQQGRPATPPMPSPSADEFAPKVLA
                     GFPRLTSTQSPQYGPDMSMNSTNASGADDTAMSVNPEMDDETDVLRRKSSQGHSLRGL
                     FRKMAHRGDDAESMHSRKKRSSEYAPDVSFEDDGQKSFWKRLTRSPKSTSSHKSVKPS
                     STPPPPVPRLPTSEA"
     gene            <492954..>494251
                     /locus_tag="MRET_1144"
                     /note="MRES_04540"
                     /db_xref="GeneID:38737910"
     mRNA            join(<492954..493051,493078..>494251)
                     /locus_tag="MRET_1144"
                     /product="ubiquitin-activating enzyme E1 C"
                     /transcript_id="XM_027627771.1"
                     /db_xref="GeneID:38737910"
     CDS             join(492954..493051,493078..494251)
                     /locus_tag="MRET_1144"
                     /codon_start=1
                     /product="ubiquitin-activating enzyme E1 C"
                     /protein_id="XP_027483829.1"
                     /db_xref="GeneID:38737910"
                     /translation="MEAGIQGKRSVDVLIERPCRTAPDILGDHDSDKAKAFLHNECRV
                     LVVGAGGLGCEILTNLALSGFRDIHVIDMDTIDISNLNRQFLFRDKDVGQPKATTAAA
                     FVQSRVPGVKITSHVCRIQEKDDEFYMQFRMVICGLDSVEARRWINATLIRLVDDQNP
                     ASLKPLIDGGSEGLKGQARVILPTITSCYECSLDMLPKRTTFPICTIANTPRLPEHCI
                     EWASVLEWPRVHAGKKLDKDDPEHVQWVLDTALARAEKFQISGITWSLTQGVIKNIIP
                     AIASTNAIISAACTQEAFKIATSAAPYLNNYMMYAGNEGVYTFTFEYEKRADCPVCGG
                     ESRSIHIRPDDSLAHLVAMLHDLPDIQCKRPTISGPSGPLYYSTPDALEKATRPNLDR
                     CMTELGIQQGDVLTVADGQWPFVLTLEILYT"
     gene            <494315..>495466
                     /locus_tag="MRET_1145"
                     /note="MRES_04545"
                     /db_xref="GeneID:38737911"
     mRNA            <494315..>495466
                     /locus_tag="MRET_1145"
                     /product="deoxyhypusine synthase"
                     /transcript_id="XM_027627772.1"
                     /db_xref="GeneID:38737911"
     CDS             494315..495466
                     /locus_tag="MRET_1145"
                     /codon_start=1
                     /product="deoxyhypusine synthase"
                     /protein_id="XP_027483828.1"
                     /db_xref="GeneID:38737911"
                     /translation="MSGHAAASAEAQSAVFMRSEPVPEHTKQATGPHFDHLNPNDLGA
                     LMDSMATIGFQGTSVSDAVRIIERMRTWRLSDDPSYDSTGDDCANLPANDPAHPSNVR
                     CTILLGYTSNLISSGLREVIHFLVKHKYVSGIVTTAGGVEEDFIKCLGPTYLGSFHLD
                     GATLRKRGLNRIGNLIVPNDNYCKFEDWVMPILDQMRAEQDTAPPEANGERFAWTPSR
                     VIERLGHEINDERSVYYWAAKNNIPVFCPALTDGSLGDMIYFHSYKNPGLTIDIVRDI
                     RRLNDISVKAKKAGIIILGGGVCKHQIANAMLFRNGADFGVYINTGQEFDGSDSGARP
                     DEAVSWGKLKSKENGGDTVKVYCDATIVFPFIVAQTFGRAHWAQKPLVS"
     gene            <495544..>496581
                     /locus_tag="MRET_1146"
                     /note="MRES_04550"
                     /db_xref="GeneID:38737912"
     mRNA            <495544..>496581
                     /locus_tag="MRET_1146"
                     /product="phosphatidylinositol glycan, class K"
                     /transcript_id="XM_027627773.1"
                     /db_xref="GeneID:38737912"
     CDS             495544..496581
                     /locus_tag="MRET_1146"
                     /codon_start=1
                     /product="phosphatidylinositol glycan, class K"
                     /protein_id="XP_027483827.1"
                     /db_xref="GeneID:38737912"
                     /translation="MSTGTGRRRVTLGIAVVVAVMAVLWGCLPIMLPEWFVPASQLEA
                     VTTFFQSHTSTNGAHETSTNATGRPRATTHTNNWAVLVGTSKFWFNYRHLANVLGMYR
                     TVKRLGIPDSHIILMLADDAACNPRNPYPGSVWASYKHELDLYGDDVEVDYRGYEVTV
                     TNLLRLLTGRVPAHMPRSKRLDSDEHSNIFLYMTGHGGDEFLKFQDSEEISAYDLADA
                     IEQMWEKRRYHELLFMIDTCQAATMASRLYSPNVIAVGSSLKGENSYSYTTDYAVGVP
                     LIDRYTRVVLEYMEKVTRTSAQTLQELFSSVGEARTYSTQFVRSDLFHRPLDEVRITD
                     FLGSVAQVQLT"
     gene            complement(<496630..>497363)
                     /locus_tag="MRET_1147"
                     /db_xref="GeneID:38737913"
     mRNA            complement(join(<496630..496656,496691..496704,
                     496735..496771,496805..497259,497285..>497363))
                     /locus_tag="MRET_1147"
                     /product="V-type H+-transporting ATPase 21kDa proteolipid
                     subunit"
                     /transcript_id="XM_027627774.1"
                     /db_xref="GeneID:38737913"
     CDS             complement(join(496630..496656,496691..496704,
                     496735..496771,496805..497259,497285..497363))
                     /locus_tag="MRET_1147"
                     /codon_start=1
                     /product="V-type H+-transporting ATPase 21kDa proteolipid
                     subunit"
                     /protein_id="XP_027483826.1"
                     /db_xref="GeneID:38737913"
                     /translation="MGVIAYSTLGTLLAFALYGAGYLILTGSGDQFAVGTFLEQTSPY
                     VWANTGIGLCIGLSVIGAAWGIFITGSSILGAGVRAPRITTKNLISIIFCEVVAIYGV
                     IMAIVFSAKISGRLQDGADGLWTPQNYFTGYALFWGGLTVGLCNVVCGVSVGITGANA
                     AVADAADPQLFVKILVVEVFSSILGLFGLIVGLIMTGSTEEFK"
     gene            complement(<497531..>500091)
                     /locus_tag="MRET_1148"
                     /note="MRES_04555"
                     /db_xref="GeneID:38737914"
     mRNA            complement(join(<497531..499890,499926..>500091))
                     /locus_tag="MRET_1148"
                     /product="oleate-activated transcription factor"
                     /transcript_id="XM_027627775.1"
                     /db_xref="GeneID:38737914"
     CDS             complement(join(497531..499890,499926..500091))
                     /locus_tag="MRET_1148"
                     /codon_start=1
                     /product="oleate-activated transcription factor"
                     /protein_id="XP_027483837.1"
                     /db_xref="GeneID:38737914"
                     /translation="MGRQLKRSSFPRSHCSSVSSSESGTNLSSSNRSDSMEESPSPSF
                     VCDRCHKSFAREDLLRRHQIREARALANPSVGRQKSCYACARSKARCDLGYPSCERCR
                     KRQIACVYAPHTGNPNARRAREQELHQIHTQPTRDTYGTPYPVSNVPVMGTNLSESAF
                     RPLNQLMPWNNMSNVSLSMHSSQNVTDTSGDESDGNITTDSLETKFASNRWDSSAGVG
                     PHVATSSAPSTHAAQGAFPYGVGPSQWNSYGQPPVLSSQAADARSSYPDKHRATSPIL
                     GNMFQASSNTGLGELVLPLASQSSQSQSQPLASSSLPGGLMSAATSKMEPPSISFGAS
                     NLASNNEREPRRKSTTELTQICTSNLSVPNNMTSSCTPTRLINMSLFSPAHFGSLFGS
                     NELSMWLDEPVAPSPMYETGACTGWTGLISAIDTGRTPTANSTRMGLIKGPRQEEEAS
                     AQRSSTSAPALISSVDWWAHDYGAQRRFHRYTLMSLPAASLIRSDDCRSTLSASVSSR
                     FLTYCSFLCLRDPGAPQPPFMHRYMLLSQRDKLPASLSIARSALSALAMRLPTSEEWA
                     WRQVGVELGVLVGQASSLVRQYRPGQAEATPLEKQLWFQQATSWDGCWECLSLLQAMW
                     CYTVVGSFSDSMDRAQKTPTFCSAQNVWDPGLLDTAVEMLEQLMCILATIGVTLQAQM
                     WKSNVASNKPGQGDTFEFLWWGLCDSIRRTVLATHALLVLWQYTRSSSPGSQGALPSL
                     GMPLISAGFSSAAWKNVMTLELPAVAAVFEADNVTQWRQMHSKNQWRADQPPLNLATF
                     MQYRPLPNKENSDIPFSITSYFHQHDEFTNICMSTLFGLTESC"
     gene            <500228..>500698
                     /locus_tag="MRET_1149"
                     /db_xref="GeneID:38737915"
     mRNA            join(<500228..500263,500293..500374,500406..500448,
                     500476..500595,500626..500651,500694..>500698)
                     /locus_tag="MRET_1149"
                     /product="transcription elongation factor B, polypeptide
                     1"
                     /transcript_id="XM_027627776.1"
                     /db_xref="GeneID:38737915"
     CDS             join(500228..500263,500293..500374,500406..500448,
                     500476..500595,500626..500651,500694..500698)
                     /locus_tag="MRET_1149"
                     /codon_start=1
                     /product="transcription elongation factor B, polypeptide
                     1"
                     /protein_id="XP_027483836.1"
                     /db_xref="GeneID:38737915"
                     /translation="MSSREWVTLLSDDGYKFIIDREWAMLSGTIRTMLSTDDGGFSEA
                     ESGICTLQIRGQVLEKVVEYLQWHARYSHQSQYPIKEFESKIPPELALELLMAADFLE
                     L"
     gene            complement(<500755..>502049)
                     /locus_tag="MRET_1150"
                     /db_xref="GeneID:38737916"
     mRNA            complement(join(<500755..501355,501382..>502049))
                     /locus_tag="MRET_1150"
                     /product="protein STU1"
                     /transcript_id="XM_027627777.1"
                     /db_xref="GeneID:38737916"
     CDS             complement(join(500755..501355,501382..502049))
                     /locus_tag="MRET_1150"
                     /codon_start=1
                     /product="protein STU1"
                     /protein_id="XP_027483895.1"
                     /db_xref="GeneID:38737916"
                     /translation="MQSTSIHGSVVIASDADLDVAVSSLVPVLDLVETEETWDRIDHA
                     LAQFQILTKCGATKVPSYIMRVHEFAPCISRSLLSDRTRLSGTASDVLNSMAPRLRER
                     FAPFVNVFIPPLLQLCARTNKVSLRRAEKSLHLICRHCHLPYILSSLVHALKEKSSSL
                     RASAAECMVIYMESCDLSQLQKRVTDVEQAIRLLATDAHPQARATCRHLYGLYAGLFP
                     ERRATFYCTLSATAQRYLAAVQPVAPDKTVTDAKVPDDTQYTSQPTQPTITRVSRLKG
                     PTLAGPVSHTSKTYSDPYESTGIPPLPTRGSNPSDGVAHRLALAREQARLRSTQRQGA
                     ATPTDTNAAARLASRALVRSSSSIGSARRVVVSRPDIMTPRTPTGKMSVDSKVSSPFC
                     TSSQFTPKRKPFSVVNEDRSPRNRVTPRNI"
     gene            complement(<502137..>503072)
                     /locus_tag="MRET_1151"
                     /db_xref="GeneID:38737917"
     mRNA            complement(<502137..>503072)
                     /locus_tag="MRET_1151"
                     /product="very-long-chain enoyl-CoA reductase"
                     /transcript_id="XM_027627778.1"
                     /db_xref="GeneID:38737917"
     CDS             complement(502137..503072)
                     /locus_tag="MRET_1151"
                     /codon_start=1
                     /product="very-long-chain enoyl-CoA reductase"
                     /protein_id="XP_027483896.1"
                     /db_xref="GeneID:38737917"
                     /translation="MSGINLTIESRGKIKGAYFPLQISLPHDATLGVLKNGIANLVPS
                     LPVSRQRLSDQQKRPLLGDEKRLSDLGVENVATLTLKDLGPQISWRTVFLVEYAGPLV
                     IHPLIYLGAPLLWARFGYPFSMSFVQTTVFVLVMAHFLKRELESVFVHRFSNATMPAF
                     NIVKNSTHYWLLSGLVLGGGVYSPSLGVEAVRGTVRDNHAFIWFFVLLWLLSELGNFR
                     AHITLMNLRPKGTRVRQIPRGGAFELVSCPNYFFEALSWFAITAMTLSLSALIFLVVS
                     SVQMTLWAIKKHKNYRKEFGDQYPRQRKIMYPYVF"
     gene            <503256..>504974
                     /locus_tag="MRET_1152"
                     /note="MRES_04560"
                     /db_xref="GeneID:38737918"
     mRNA            <503256..>504974
                     /locus_tag="MRET_1152"
                     /product="N-lysine methyltransferase SETD6"
                     /transcript_id="XM_027627779.1"
                     /db_xref="GeneID:38737918"
     CDS             503256..504974
                     /locus_tag="MRET_1152"
                     /codon_start=1
                     /product="N-lysine methyltransferase SETD6"
                     /protein_id="XP_027483897.1"
                     /db_xref="GeneID:38737918"
                     /translation="MRDAEELAFLSWFTEHGGWIDQSLSLEKIPGMGRGLVATRPIAE
                     NERLFSIPRSMLLNLGTSALVPACEAAERARPPKAGHAWSDVMDRGWCPLILMLMWEH
                     RHASTQEHNERFTWGPYFGIMPTLFTTPMFWNSNQLHELQGTDVEDKIGRTEAEADYH
                     ECVLPYVQQYPDVFLGPGVHDVPAEISKWYHIDLYHRMGSLLLSRSFHVKRDLNHAES
                     DDADISSAPAEVAVERAIPRNEAQDEQGDDEEEEAEIEIQDDEDDEEKGENEEDVRDI
                     SMVPMADMLNAKFGSENTRCFYKREALEMRCTRPIAIGEQLLNTYGNPPNSDLLRRYG
                     FVDEPNRGDLLELPATTIFDAALTKLCLATQASEDVIRTFLMPRFEWACTELGIDEVF
                     LLCRLSKPKNTAPYAGTLSLDASRPLTSADRRVLSRASGEISDDLVGFVRLLCVTQDD
                     FERAKKKEALPNARLDAVEAMDASWPGSPPKGAMLSVASVLRDALALRGQAYPTTWND
                     TAKALVECTASSEDPYRMALVVRAGDQAILQEHTTVTELVLAHARAQASGAASNPVPS
                     KKARRT"
     gene            complement(<505028..>506860)
                     /locus_tag="MRET_1153"
                     /note="MRES_04565"
                     /db_xref="GeneID:38737919"
     mRNA            complement(<505028..>506860)
                     /locus_tag="MRET_1153"
                     /product="zinc finger protein, C2H2 type"
                     /transcript_id="XM_027627780.1"
                     /db_xref="GeneID:38737919"
     CDS             complement(505028..506860)
                     /locus_tag="MRET_1153"
                     /codon_start=1
                     /product="zinc finger protein, C2H2 type"
                     /protein_id="XP_027483898.1"
                     /db_xref="GeneID:38737919"
                     /translation="MPKSGPQLHLTMKTYPCMNSWGTQAASTSSSPDMRTAANEVLPP
                     KTDSMSKSCYLPETSTDYIQNIMVPTLIELGTDAPLSDAATNPGMGLLLSLSEKLDSS
                     VDTHAFESEPPSSAALSSDSFAQSAPKSTLSFNLTAQCSPSAPNHHLSNDISLLSSQL
                     APSFDPSSHLDSIASAASAAAATQYQEAAAFHERQQCQGLTPQRAQVSPRLSPAPGTY
                     TFLPTPKPPPSHQSLARRTSNHDFSMDTHKLEDKVDASSAEGPTVTSSIVPHTSNADF
                     SLSQAFNVQAHSESVLPLSHPSSVGITPRIAPICVGASGSTSLDETTKKIQAQQQQIR
                     TALGQPMDGLQQSFSTSVQPEKRSVSTSTDDAKRVKTDTDIAIQERSPKQEAVQKRFQ
                     CPKCFRAFARAYNLSTHLSTHDPDPSRAKPFPCPYRSCRAEGGRSFSRKHDLQRHVAS
                     VHEWEPEPGIHGDSGDVGEGQDTGGLASLGLGTPGKKFRCEQCGRAFVRRDALRRHHC
                     DAAASRAPLFDKKTTTAVASVPMPPSHSSASVAPARALPGDVMQRVSLQLMNKADPKA
                     VSAFTQDTAAMPMAPRMDHSSDKRADTTRMRQSASSNIATAFAT"
     gene            complement(<507200..>509269)
                     /locus_tag="MRET_1154"
                     /note="MRES_04570"
                     /db_xref="GeneID:38737920"
     mRNA            complement(<507200..>509269)
                     /locus_tag="MRET_1154"
                     /product="beta-glucan synthesis-associated protein KRE6"
                     /transcript_id="XM_027627781.1"
                     /db_xref="GeneID:38737920"
     CDS             complement(507200..509269)
                     /locus_tag="MRET_1154"
                     /codon_start=1
                     /product="beta-glucan synthesis-associated protein KRE6"
                     /protein_id="XP_027483899.1"
                     /db_xref="GeneID:38737920"
                     /translation="MSLGHTGDPDPEKMKTDAAKVEHLDTRHQKESTEAGLRTPEPAM
                     YQNIEDVRSESFMSEQRQGSVADAASTHSDVQHTVVPYSWMSGYDDNSFADDLHDPAK
                     PLRGAFEPKRAVLNVGSLIILVLCLLMLFAGYPILHHYTEGNGNDDRINDFKKIFDVH
                     SPIPDSIPISRVNSSKLQKAFDEKAKMMIDPDTPEDAFELGSTYSKSEGKKFKLVFSD
                     EFNTDGRSFYPGEDPFWEAADLHYWATNNYEWYDPAAVYTKDGSLRLRLDQHQEHNRY
                     FRGGMLQSWNKFCFRNGILIASIQLPGYRSVAGLWPAFWIMGNLGRAGYGATLQGTWP
                     YSYDHCDVGTLMNQTLFNSVHPDGYPRENIIRGGATAFNEQHETRSLSFLPGQKLSRC
                     TCPGEDHPGPFRNGEFVGRSAPEIDVFEAQKMGRNMGVSQSCQMAPYNYQYDITYGKN
                     KSDVYQFFTSQGSLNPYNGEITQQSLSGTSLASQEAIQYVADSLDTTEEGNFATYSLE
                     FKGGSDGHVSWTSNGRKTWELYPGALAPDNRTLINSRQYPKEPMYIIMNLGISKNFGD
                     PEWDDIMEGFPYEMAVDWVRVYQDPDDPESDTGCSPDDMPTSGYIERHLEAYTNANLT
                     VWGGGPDEGGYGAYWPLNRLYSKGCKGTRSTEPGDPDRSHVPAKHVPSASVTMIPGAQ
                     PFQQNQS"
     gene            complement(<509567..>512062)
                     /locus_tag="MRET_1155"
                     /note="MRES_04575"
                     /db_xref="GeneID:38737921"
     mRNA            complement(<509567..>512062)
                     /locus_tag="MRET_1155"
                     /product="beta-glucan synthesis-associated protein KRE6"
                     /transcript_id="XM_027627782.1"
                     /db_xref="GeneID:38737921"
     CDS             complement(509567..512062)
                     /locus_tag="MRET_1155"
                     /codon_start=1
                     /product="beta-glucan synthesis-associated protein KRE6"
                     /protein_id="XP_027483900.1"
                     /db_xref="GeneID:38737921"
                     /translation="MNNLPYDRHYEGVPPNGGEEDRIPADDLMRAMHSNMAESSFSLS
                     DSPYLYGTVDPNSSRASLIPNADNSPVSPARKHDISHDASSPMLDYHHVNLDGASVTR
                     HGHPLYTSPTSPLGYTDSVDHSESSSIMMQPPHRVLVDDDASKDSGDEVPIATLVDSY
                     MNKSSSGFREGDTFVTNNLHGRTGYRDEDSEISDSDSELDPFPWMTMADVKESDDVIH
                     NPDVASPKSRFEPWRAVFNLGTIFILVLSILMLFAGYPILHNYTERQNNDQLSQTMGH
                     LQYTNPQFPSGAPLRRINNSKVTEKLDSTSPMLIDPDTPDDAYEVTSHYTGDNKKRRL
                     KLVFSDEFNTDGRSFYPGEDPFWEAADLHYWATSNYEWYDPASVTTKDGSLRINLDYH
                     PEHNLYFRGGMLQSWNKFCFRNGLLTAKIQMPGFNNVSGLWPAFWMMGNLGRAGYGAT
                     LEGTWPYSYDVCDVGTVMNQTLYNDKYPHGYPPMAQELGGAAIFNMKHNSTSISFLPG
                     QKLSRCTCPGEDHPGPFKDGEFAGRSAPEIDVFEGQVSGDDDFRYGQVSQSFQMAPFN
                     WQYNITWQFGKKASYHFFDNKTGTLLNPYTGEYTQQAMSGAHMTNQGAYQYTANDTDT
                     SKEGNFSEYSLEYRGGPEGYVVWTCDGKPSWELFPKAIYPDPLAKVDHRQFSKEPMYI
                     ILNLGMSRAFGAVDWETIPKYFPHVMAVDWIRVYQDPDDPEADIGCDPDDMPTAAYIN
                     RHIEAYTNPNLTAWGGERKDGGYGAHWPRNRLYVDGCKAKPSTEPGETNPKYRKQYQT
                     IPADDVTKKPGSEGKWMDVYNVTVAPDAAVKKW"
     gene            complement(<512308..>513673)
                     /locus_tag="MRET_1156"
                     /note="MRES_04580"
                     /db_xref="GeneID:38737922"
     mRNA            complement(join(<512308..512404,512444..512527,
                     512559..512623,512658..512942,512970..513625,
                     513661..>513673))
                     /locus_tag="MRET_1156"
                     /product="flap endonuclease-1"
                     /transcript_id="XM_027627783.1"
                     /db_xref="GeneID:38737922"
     CDS             complement(join(512308..512404,512444..512527,
                     512559..512623,512658..512942,512970..513625,
                     513661..513673))
                     /locus_tag="MRET_1156"
                     /codon_start=1
                     /product="flap endonuclease-1"
                     /protein_id="XP_027483901.1"
                     /db_xref="GeneID:38737922"
                     /translation="MGIKGLTSLLADEAPGCIKHHDIKTLFGRKVAIDASMSLYQFLI
                     AVRQSDGQQMMSDSGKVTSHLLGFFYRTIRMVDYGIKPVYVFDGKPPDLKKDVLAKRF
                     GRREEARAEEEEKKDIADSETLDQLARRQVRPTREHNAEVQRLLTLMGIPWVVSPSEA
                     EAQCAELARAGKVYAAGSEDMDTLTFGSPILLKNLTASEQKKLPVTEVNLHKALEELN
                     MPMSQFVDLCMLLGCDYLDPIRGVGPKKALKLIQEHETLERVLDHLHLTSAKKNPPSD
                     GNDEEVSSKKRAGAIQVPDIWPFQEARSLFQSPEVLDGHNIQLKWDQPKTEELVSFLC
                     GENGFGEERVRRSCEKLSHAVGQKQQGRLDGFFSIQPKQQAPSAPTSTKRKAASNSAN
                     EKSSRRR"
     gene            <513774..>515852
                     /locus_tag="MRET_1157"
                     /note="MRES_04585"
                     /db_xref="GeneID:38737923"
     mRNA            <513774..>515852
                     /locus_tag="MRET_1157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627784.1"
                     /db_xref="GeneID:38737923"
     CDS             513774..515852
                     /locus_tag="MRET_1157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483902.1"
                     /db_xref="GeneID:38737923"
                     /translation="MADQEGDESFHDDWWESLAIDQDIESQLNAVEQQAEMLASSSTM
                     SLGTHMPELRAMYEEQQHTINQLRQQAQQQQGEISVVRSNLTRAQQQNRTLQQHQQQM
                     EQDYRHRIETLQQEHGRQMERLEATSAFRRIEQDSNRTVWPSTTRRRAPVVFPKDALA
                     TPMVPGQDTPTRYVASHRQRAEPETPSRPRSFPHFDNSFVDPAPSSSPATAPDVVPSS
                     STPTPDSSPHVGALDALSSDDYEYVLAALFTRQARWTSHILGHPPRSQTGSMLLHLVM
                     MDVPECPSFSRTAEQLWQCVARAGSYEAFLCDCAPIVRLYLQRGKEPQQAVRDVWADY
                     SPSLYGGVATLLCAATHMLLQADKIKAVCHMLDWMTALGLSQPAFVSFLACRDKPMLP
                     DASVSPPITHILIDGMKRDVALYPSVVRLSQVLAWSSELYGYQDVHPVFHAKGVLLAL
                     LDTHEPSVLIPTLQLCTLVVSDATTLHMCLSAQFDPAWQPRVPPRLGQVRFPVVDVLS
                     KHLVDRRGDMPADASHRIHMSILLFLTQAARWPDTSIMLAESTPLLPALIQCLSWDVS
                     TLWNTEPVPDAPGTRDAAWALERVCQSVQFLHDLYMPEGIATRNLAEKLVSAQAQAVL
                     NGVRYAFIVALGRIAFANEPDWLMHDTQAHRRRTQLECAAMLASDLIDSVLSPNETDE
                     IYELLVEEAE"
     gene            complement(<515853..>517316)
                     /locus_tag="MRET_1158"
                     /note="MRES_04590"
                     /db_xref="GeneID:38737924"
     mRNA            complement(<515853..>517316)
                     /locus_tag="MRET_1158"
                     /product="glutamate-5-semialdehyde dehydrogenase"
                     /transcript_id="XM_027627785.1"
                     /db_xref="GeneID:38737924"
     CDS             complement(515853..517316)
                     /locus_tag="MRET_1158"
                     /codon_start=1
                     /product="glutamate-5-semialdehyde dehydrogenase"
                     /protein_id="XP_027483893.1"
                     /db_xref="GeneID:38737924"
                     /translation="MESSATVVARQAREAFDDVQQRLSLGPAGEADVQRVKALHAIRR
                     ALEQAQDEIRAANQRDVEEATALVQQGKLSAQLVSRLDLFAKAGKWESMVQGVSDVAS
                     LPSPLDVCTKATRIADASPACEGRDATGTLDLYRVTCPIGVLLCIFEARPEVIVNIAS
                     LAIKSGNAAILKGGKESRHSGQVLSRCISEALAQSDMPPHLIQTVESREEIRTLLQED
                     RYINLVIPRGSNEMVRHIQREARVPVMGHADGLCAAYVHDDAPAKLTIETVLDAKLDY
                     PSACNAVETLLLHRHHLTSGLWLSLGKALIHAGVRLHCDEASRTALVPGLSESEAALV
                     VAATDADFDTEYLDLDLAVRVVDSVQDAVHHIQTHGSGHTDTILCAPLNGEASSASVR
                     SAADIFTRSLSSSSVYVNASTRFADGFRYGFGAEVGISTGRIHARGPVGLEGLVTYKY
                     VLRSAGSGAQTAAAFSPGAHQRAWSHQPIEAVYPSLT"
     gene            <517440..>518708
                     /locus_tag="MRET_1159"
                     /note="MRES_04595"
                     /db_xref="GeneID:38737925"
     mRNA            <517440..>518708
                     /locus_tag="MRET_1159"
                     /product="acyl-CoA-dependent ceramide synthase"
                     /transcript_id="XM_027627786.1"
                     /db_xref="GeneID:38737925"
     CDS             517440..518708
                     /locus_tag="MRET_1159"
                     /codon_start=1
                     /product="acyl-CoA-dependent ceramide synthase"
                     /protein_id="XP_027483894.1"
                     /db_xref="GeneID:38737925"
                     /translation="MSKGGRRSQHKSKSQKGVAGQRPALAPTKAASVSRWEMSAVVMV
                     STVLLSIVWLHWLTDVSQRPLRMQWLQSAFQASKPLSLPTWLFSPEVWDSWCETIHRV
                     TSACFFLSGAVRANSAANGWQYLRSLWTGASSSTKYERDPFDLLFAFVWGMILFVIRF
                     VCMQCLLLPLGHMLVSRPSGNPAQSEKKLHRRIGRFAEQGWVLILYATSLLLVVLAIQ
                     RQPFWVWKPEHLWLGYPVTTMDALSKAVYLWEASNYIHQVFVIHLEERRSDYWQMLTH
                     HFVTLLLIGGSYVSCFHYVGFAILLLMDPADICLSLAKLSKYMGCTTLCDVLFAIFML
                     VWIITRHIGYAFVWWSCYKDAPRLTSFGTTYNLASGHMLTPTSYVFFLVLLGMLQMIL
                     LVWLGMILRIALRVVTAQGAVDTRSDDDSD"
     gene            complement(<518920..>519525)
                     /locus_tag="MRET_1160"
                     /note="MRES_04600"
                     /db_xref="GeneID:38737926"
     mRNA            complement(<518920..>519525)
                     /locus_tag="MRET_1160"
                     /product="riboflavin aldehyde-forming enzyme"
                     /transcript_id="XM_027627787.1"
                     /db_xref="GeneID:38737926"
     CDS             complement(518920..519525)
                     /locus_tag="MRET_1160"
                     /codon_start=1
                     /product="riboflavin aldehyde-forming enzyme"
                     /protein_id="XP_027483700.1"
                     /db_xref="GeneID:38737926"
                     /translation="MFAPKVWAAVLLAAVLALTLATEISSGHSTMPTPGSHHGMIRRR
                     GLIESILRGGEFGSTDTPAPTTTRSTSTSRTHSATHKSSSSSSSSSDSGQGKTYEGEA
                     THYQPGLGSCGDNSDASEMVVAVSHSKYDAKAKSQNPNENPFCGKKVKVTYEGKSIEV
                     KVVDRCPGCSENDLDLSPSAFKKLAPLGKGRLKQVKWKMID"
     gene            complement(<521387..>523009)
                     /locus_tag="MRET_1161"
                     /note="MRES_04605"
                     /db_xref="GeneID:38737927"
     mRNA            complement(<521387..>523009)
                     /locus_tag="MRET_1161"
                     /product="Rab geranylgeranyl transferase escort protein"
                     /transcript_id="XM_027627788.1"
                     /db_xref="GeneID:38737927"
     CDS             complement(521387..523009)
                     /locus_tag="MRET_1161"
                     /codon_start=1
                     /product="Rab geranylgeranyl transferase escort protein"
                     /protein_id="XP_027483699.1"
                     /db_xref="GeneID:38737927"
                     /translation="MTDDNHFDVLVIGTGVTESVLSAALSRAGKRVLHIDTNAYYGAE
                     WTSLTLSELSQWAAKSNADLAFPREPAAPGCIPSACKEVDRHYSIALRPALLPARGPM
                     IEALIRSNVASYATFRLLGRTGIYDGEHLECVPKSKSDIFRDKRFSLVDKRRLMRFLQ
                     TTMDPSAQEASDDHVSISEYLRKSMGFDAKLERAVIYGVALCWDSNEPSTSAMDRTRY
                     SLSGLGRYGDAAFLVAQYGGAGELTQGFCRSSAVQGGVFILGHDVHSLERTESVWTLR
                     MNGIHESFTADQVAAPAANMPHNRVTAPPSMLEHVSVLITDASIDWAKHMPLEEDEPV
                     PETALLVFPPTKENEHAVMVLAQGEGTFSCPKGQFVYYVTTYRRADGTSARTCLAEAV
                     AKLHSLLTHDAPWIAEMYCSHTLTTDHDGSSAAYVDTSARPPSTSMESSLCLSSQECA
                     SISKRQAVPNMTESLDLCVEAAEHAFWRIVGEQHRDPALRLARARLREHAPSEYQGRG
                     GVDPDGPPVEVMNSPVEIEFFAPQSTLNENAL"
     gene            <523157..>527006
                     /locus_tag="MRET_1162"
                     /note="MRES_04610"
                     /db_xref="GeneID:38737928"
     mRNA            join(<523157..523165,523191..>527006)
                     /locus_tag="MRET_1162"
                     /product="tripeptidyl-peptidase II"
                     /transcript_id="XM_027627789.1"
                     /db_xref="GeneID:38737928"
     CDS             join(523157..523165,523191..527006)
                     /locus_tag="MRET_1162"
                     /codon_start=1
                     /product="tripeptidyl-peptidase II"
                     /protein_id="XP_027483702.1"
                     /db_xref="GeneID:38737928"
                     /translation="MRTCISRIISHSSSVPRRLMASTRMAHISTATSSSSFPIHGLLP
                     KQATKVESFREKFPNYDGRNVRVAVLDTGVDPAALGLDGPNKVVDIIDCSGAGDVKLQ
                     EVAAKFNADRSTLQLVSPTTKRTLLVDPSWPNPSGVWKVGTKRAYDLWPTSLVERRTR
                     ERKQAFDVSHSALFQKALNDLATYEANEGAEKPSDKNAAAQHHEDLKARVAVLKDLAK
                     NWKDPGPVLEAVVFHDGVNWRAVVGGAEGDVVDPSQGEPAAYRHNVIDLRSKPRMTDY
                     RLEREWSYFGEMDLLTFSVNIVGDGDVLSIVTLSGTHGTHVAGIIGAKTQDPATDGVA
                     PGTEIVSLRIGDARLGSMEQGQALLRAAQALIDTRCDVANMSYGEDGAFGVEDKGAFA
                     NALKRVIREHDVCFVSSAGNNGPALTTVGQPGGTTSGVLSVGAYVNEGDMQQAEYALV
                     ERGVPSSVTTWCSRGPTADGAAGVSIYAPGAAITSICRYALQSTQLMNGTSMSSPNAA
                     GAVALLVSACKAESIPPTPFRIFRAIQETGVDVQDPQGVKFLDVEKAWEYIVAHRDDP
                     YADADMQVSVTPPGKPLGVVDRRGVYLRGTEETHRTTQFLVTVQPSFRAGETKRAYAL
                     DVKASLCATQPWVHVPDFLALGSNGRTFEIRVAADTLPPGLHTACVVGRDTERNGTVV
                     FDVPITVVKPVVPSHATYKYPRVRLSSGEIRREFVHVPSGATWADVCVRSMNHEAPNT
                     SVRFWLHMLQLVPQRRLSRVEHHFVLALNENEPMSKRIPVHGGMTLELCAAQFWSNKA
                     GFDLEMDVEFHGLDTVPQVSGHTGQGLVKLDVASLVRCEELKPSVSLDTHRTFVRPSK
                     HVLRPLRDARDRQPSGHHLHELVLEYPLSVKEAGSWTWQTPLSGYVYDATTTLLTQLI
                     DVNQAPVAFGDVYSKPVELVKGEYTLRVQALHENAAVLEALQALPLALEHKLKKPISL
                     DVYRDHVDLTAGAHAAKEALKLHKGERAVLSISTALDNEQWPSDAKLGDVVLGTLTLG
                     GHAKVPIEVVLGPAPPSSVPKETDDAPTLPMLLAGLVSKVPKEEKYNFVDQLLHDYPN
                     DLSINLAAMDASDTDDAVIGAAQNARSCIDETGLLLWLGTQQPPAAEQTHEQKAKAKE
                     MQAQKAALVRTLVREAQAYRTLGHKGPAIQAMVHARQFMDAADAPTKATHANLLIGWH
                     QDHARYGYALQMVQKQLEELGRGASDTKQDLHRAQDLQIELLGHLQWDVWQHHLQRWT
                     WLGRPVDGAPPF"
     gene            complement(<527003..>529492)
                     /locus_tag="MRET_1163"
                     /note="MRES_04615"
                     /db_xref="GeneID:38737929"
     mRNA            complement(<527003..>529492)
                     /locus_tag="MRET_1163"
                     /product="SET and MYND domain protein"
                     /transcript_id="XM_027627790.1"
                     /db_xref="GeneID:38737929"
     CDS             complement(527003..529492)
                     /locus_tag="MRET_1163"
                     /codon_start=1
                     /product="SET and MYND domain protein"
                     /protein_id="XP_027483701.1"
                     /db_xref="GeneID:38737929"
                     /translation="MEKLVHSLRNLDLAVPNGEQIVALIDADPRAEKQLAQQLAVPVR
                     IELSEEDAGSAVMDAALMSGATEAMLENYNTTLKKETDMLVREVENLKKPIKLKRVPL
                     KALLAAQDATIRRREVERAAGTSENGRVYIPRQIMDTEHTYCSERPLSELSRIDWDDL
                     CAPKRFEHKYLLVQVASRLALYASCSFVGVTPNGGALPVSIAHFTPNLHLHGPELDAL
                     LPVGTKLLIREPYLSQHYLGVGGPITGDKGVVGVRVDTPSDVHVLDDDAPVLRGVTWT
                     HDLDAPMPSDVLWRQEGPVSRAPSHAAPFISRERVQSAVRALLDQERPGAAWREVRAA
                     ERYGIWGASLEDTLLQVDVLLALGQYDQALERLQHAPDLEESVLQRRQAAEVALRLGR
                     GGPSDTDLHEMFLCTLHDPTPRFAYAEYVGPVNVQDIPGAGRGLVLTRDVEEGELLLF
                     CRAIGSAYAKDPACDGLPLLRCNPDVGVTSTTTQVLAATRCIHAILDRPELARIFLGL
                     TAGPQTPCSRYVYEPYPLHKPAASDVLEPVYVSAHYVNNVLRFNAFGPAAVPAAEAGN
                     DPMSRSTMPHPLPAILNHACLPNVSSVFFGDFVTTRALHPLPKGTQIMHQYVQGELPY
                     DARQAQLSKHGFICTCRLCALDVADGVEQRKRREEVFARDWPPLLERSRALFKGRADS
                     EAHKDMAEALLAAASTLESTYAPTRGALRPDMVDVWYRVAMHVRQYDVPQAVRLARQS
                     LEATGAVIEPFQPGKRHVSHLPDLHFDGAIRSMLMLFDTHWQRHEADEALAWIDAALQ
                     THMCMIGGGRALFVQRWAHGDYPLDAWLATC"
     gene            <530087..>531446
                     /locus_tag="MRET_1164"
                     /db_xref="GeneID:38737930"
     mRNA            join(<530087..530561,530605..>531446)
                     /locus_tag="MRET_1164"
                     /product="G1 S-specific cyclin Pcl5"
                     /transcript_id="XM_027627791.1"
                     /db_xref="GeneID:38737930"
     CDS             join(530087..530561,530605..531446)
                     /locus_tag="MRET_1164"
                     /codon_start=1
                     /product="G1 S-specific cyclin Pcl5"
                     /protein_id="XP_027483704.1"
                     /db_xref="GeneID:38737930"
                     /translation="MSPPSKFTCPSTWLVQDVMHEGHDVHRSQSSQSTSSTTSDVSTA
                     LSRTDVSPFSLNGNGSSTETSPATSSYSNKTRRLSDVMDADHDEFMSSNAPIPSTKRR
                     KSSPFTNLASSSSTLTLQCPETTVKRPVSNDDPNVTKLNDNVTMHLSRTLFVESLVEA
                     AVATISSTWGRFSRESRVCEQDTMSQNILCPNNPLPLVLFVREILRRSRTSCLTLQAA
                     LLYCARCKESLNEMIDKATNPVSGAGEACRALYTDTFTSSPPSLNPNFQPPLPSLSVQ
                     SNDYGPESRPTHKPQPTIPVRSASPLLCGRRMFLAAIVVASKFLQDRTYSNRTWSKIS
                     GLRTIEIDQVERVFLKTIRYDLVVSDALWRKWTADLSVFCSNKSPFVGLGQYYEKPLT
                     APASRLHRVTSENVIGQAFQFDSSLNNSQPSAVLGKRIFTRHGSSF"
     gene            <531698..>532672
                     /locus_tag="MRET_1165"
                     /note="MRES_04625"
                     /db_xref="GeneID:38737931"
     mRNA            <531698..>532672
                     /locus_tag="MRET_1165"
                     /product="RTA1 domain protein"
                     /transcript_id="XM_027627792.1"
                     /db_xref="GeneID:38737931"
     CDS             531698..532672
                     /locus_tag="MRET_1165"
                     /codon_start=1
                     /product="RTA1 domain protein"
                     /protein_id="XP_027483703.1"
                     /db_xref="GeneID:38737931"
                     /translation="MNSTMNSSVASVLTAEEAENSLFGYKPMLAPNAVFLALYALTTI
                     VHIIQVFIYREWWLFILPIGTLAEVGGYIPRILGRDHEKLMDPDKMRDTYVATMCLLI
                     ITPCLFAAVHFTTLGRVTTLFPRKYVFIRPIFIMPLFVTIDVISLVVQGVGAGSSATA
                     DSDEDAKPGSHVTEAGVAVQLFGYLIYMILLLTFCRAVRKDPPPGIDRFWPLLIATFF
                     SSLCIILRSIYRLVEMGMGWTGKIATTEWFLFAFDSSFVLVACVILNIWNPGRYLPKN
                     FSWRYDPERDPSNPNYQGTLREEDPEKDHGGPVSPSDDEHFYDTAGAI"
     gene            complement(<532833..>533820)
                     /locus_tag="MRET_1166"
                     /note="MRES_04630"
                     /db_xref="GeneID:38737932"
     mRNA            complement(join(<532833..533612,533646..533698,
                     533732..533750,533788..>533820))
                     /locus_tag="MRET_1166"
                     /product="proliferating cell nuclear antigen"
                     /transcript_id="XM_027627793.1"
                     /db_xref="GeneID:38737932"
     CDS             complement(join(532833..533612,533646..533698,
                     533732..533750,533788..533820))
                     /locus_tag="MRET_1166"
                     /codon_start=1
                     /product="proliferating cell nuclear antigen"
                     /protein_id="XP_027483706.1"
                     /db_xref="GeneID:38737932"
                     /translation="MLEAKIEQAVVLKRVLDAIKDLVEHANFDCNEEGIRLQAMDSSH
                     VALSAVELRADGFEEYRCDRPMSIGIAIASLNKVLRSANNNDILNMRKADNADSLHLV
                     FEGSSSDRIGEFDLKLMDIDTEHLGIPDTEYDAVVKLSSNEFARICRDLSNVGESVKI
                     TITKEGVTFSTEGEIGDARMTLKQGSGSSARLEDDDDIDPLDDEEGDRFSKKRKTSAA
                     GSSTTGAVVPVEIQLEKAVALTFSVQYLVNFTKAAPLSSAVTLHMADKVPLLVEFAFE
                     NGHVRYYLAPKLAETDDD"
     gene            complement(<533971..>536757)
                     /locus_tag="MRET_1167"
                     /db_xref="GeneID:38737933"
     mRNA            complement(<533971..>536757)
                     /locus_tag="MRET_1167"
                     /product="magnesium transporter"
                     /transcript_id="XM_027627794.1"
                     /db_xref="GeneID:38737933"
     CDS             complement(533971..536757)
                     /locus_tag="MRET_1167"
                     /codon_start=1
                     /product="magnesium transporter"
                     /protein_id="XP_027483705.1"
                     /db_xref="GeneID:38737933"
                     /translation="MRRAERLPEPVHRGNGRGGWLRRWWHKRPLETQEKHALDTFAMH
                     TKEEAKQVSDHETKQASRLKFAHAHQRILPEDLPQDYEPDEVYRGLDEYVAARRSVRR
                     KEQRMNRRSASHDSDSDSSHSSSSDSSSGPQVISRIRALFGDSSDSSSDSESDNDDSD
                     AESSLRSSSARDSHDTDVSDRLSATSVRSRRDTSVVNTPNMSSAFSPWTPRLSALTST
                     RRRRRHKRRQQRQERPAHIVKASRMARRNARRLRELSGGVTEYTLFSPTGDARSNTVY
                     SHSWDQIWERMEEYFQYHRQTDGHAGDLGIPGVSEIPSERMQRLNDEDFLKLPSPALN
                     LDNTESKPTQADDHAEISFEQERLTGRHMSDVPLTPYFRSNISGEVAPSPMPFASLST
                     KLKPQMKSDPVSPLPGSNLPNSSTIDTIPEEPAELYLPEAALDIYGQPHNVQPNVTPP
                     DVAITKHSLRSDPWWLDIRCPTYKDMQQLSQHFPLHPLTVEDILKQEPREKVETFERL
                     GYYFVVIRALDENHFRFTRPSTKRKDDKSTQDTMLLSPGLVEAQVPKTPRARNIAPKQ
                     TSEEGRVHIETVKSESGKEGLEGLTAGSVSLYLVVFSHGVLSFHFEDLRNHTERIRDK
                     LDSAYTDMQHNADWIVHSLYDSIVDAFSPYVTFLQSEVEYVEFLSNDLDITPFQDEKR
                     SLSTKIRRFFTEPLFSTPDDKRTGLIAEDLLRSLPEGSKEYVEYLVRRSKKRKAFSTY
                     DALHQSHFILRLTRVREVVMGLTRLLLPKADVVRTLRKRLFDSKNFVRESNMLELYFD
                     DIFDHVASMLTQLQDREYGLNHTHSAFLSISSLSASRFQRRVIITLIWACMIINIVFF
                     CTLYCTSFSMNVQIPADSALCEGDDGSIGDCTHTPFAGIASSLVVFPTILIAVYRVIM
                     RRSEARSKRKMASR"
     gene            <537012..>539277
                     /locus_tag="MRET_1168"
                     /note="MRES_04635"
                     /db_xref="GeneID:38737934"
     mRNA            join(<537012..537086,537124..537215,537241..537315,
                     537348..>539277)
                     /locus_tag="MRET_1168"
                     /product="cell division control protein"
                     /transcript_id="XM_027627795.1"
                     /db_xref="GeneID:38737934"
     CDS             join(537012..537086,537124..537215,537241..537315,
                     537348..539277)
                     /locus_tag="MRET_1168"
                     /codon_start=1
                     /product="cell division control protein"
                     /protein_id="XP_027483708.1"
                     /db_xref="GeneID:38737934"
                     /translation="MMQVNAALGAAPDNVDAYAFCNSFWGENDAGYHVMQSFIKNTTR
                     TMEDLRAYYQERAEIEHEYAKRLSKLAKTSLGKYETGPMRHALDTVRLETDSQARSHV
                     QLENSIRKEVEGPLIDFMRRVDSLRRDAQTSVTKLHKHKQTQTQYMNRAREKYETDCT
                     KINSYTAQSNMVQGRDLDKVMSKLERVQSGIESEDRDYQSYVRALQETTQKWNSEYKS
                     FLDICQDVEEERQEFLKTNIWGLANAISSICVTDDEACERVRVALEGCESTRDVRDFV
                     REFATGSNIPAAPEYVNYAQSIAPPAAATTGSAHFSRLSTRVADGMHPPSASVLATQT
                     PATSSYGASPSLHSSTPSVAPGNIPPSMLRPVSPSIHPGTPLTPASMALQSPQGPNVP
                     NYLAAMSRSSPSQVISPPTRTPPPSNSNRNSMFAPGATPLAQAQSPSMQPPLVSPVVA
                     PANHTQPPLQAASVPMSQVAAPPPGDTNEDDPIAKALANLRLRQSRKSPTPSSRPTST
                     ISTTMSAPMSQEPLQPSSQAQSRPPSQVMTDPRWHRAITPDARPPRSTSPAAAFMHPP
                     ERSISPLPVEQIHSHYGQAFPTERRAGQGKQEPRATSPLGISLDARGQVTEDTMAGRY
                     ASSAGQGTASSQVSGPSSSQLARPPTGQYSESGEPILFYVKALYDYEASLPEEFSFTA
                     GDIIAVTHTEPDGWWQGELLDEARRTPGANTFPSNFVVLLM"
     gene            complement(<539365..>539720)
                     /locus_tag="MRET_1169"
                     /db_xref="GeneID:38737935"
     mRNA            complement(join(<539365..539377,539416..539521,
                     539615..>539720))
                     /locus_tag="MRET_1169"
                     /product="cytochrome c oxidase subunit 7c"
                     /transcript_id="XM_027627796.1"
                     /db_xref="GeneID:38737935"
     CDS             complement(join(539365..539377,539416..539521,
                     539615..539720))
                     /locus_tag="MRET_1169"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 7c"
                     /protein_id="XP_027483707.1"
                     /db_xref="GeneID:38737935"
                     /translation="MSAIFAATRASLRNTRAPTMMLRRSLHIENTPETVLPFRTGRKH
                     KTFVGISVASFFATGLILPTIAALYQQLKQ"
     gene            <539850..>541151
                     /locus_tag="MRET_1170"
                     /note="MRES_04640"
                     /db_xref="GeneID:38737936"
     mRNA            <539850..>541151
                     /locus_tag="MRET_1170"
                     /product="ribosome production factor 1"
                     /transcript_id="XM_027627797.1"
                     /db_xref="GeneID:38737936"
     CDS             539850..541151
                     /locus_tag="MRET_1170"
                     /codon_start=1
                     /product="ribosome production factor 1"
                     /protein_id="XP_027483764.1"
                     /db_xref="GeneID:38737936"
                     /translation="MAGAGADADDTRRKTGSVSHIGNKHKRQDMYQQYRKDKAKSKLK
                     RRLKLAKAERSSKEGKSLRRERLASNKQQTIENTRDFNPTILNLPNTHEVPEWMKSQE
                     APPTSVDAQDEEDEEDKGEDEEEEDEDEEEDEDEDEEEAQNHSEAPEQVEEEESIEEE
                     VQDPQLAKYDMDNDPTAPPAILITTSLPSNSTSPHLTSANARSHPAEAVREFIKELLN
                     VFPGAEYRARAKAKGAGLGKICSWARARRFDAVLVVGEANKKPCSVTLVALPLGPTAL
                     FRLTSVELGKEIYGHARPTPHTPELILNNFTTALGHRVGKLLQRLFPLVPDLEGRQVV
                     TAHNQRDFVFFRRHRYEFRSADKAALQEIGPRFTLKLMSLSSGLPKGAGAWNGRFVDE
                     LEEVPAADDPHAGDSAEYSTNDGIEFKWKPKMSVSRRNFYL"
     gene            complement(<541163..>543488)
                     /locus_tag="MRET_1171"
                     /note="MRES_04645"
                     /db_xref="GeneID:38737937"
     mRNA            complement(join(<541163..543200,543229..>543488))
                     /locus_tag="MRET_1171"
                     /product="nuclear pore complex protein Nup107"
                     /transcript_id="XM_027627798.1"
                     /db_xref="GeneID:38737937"
     CDS             complement(join(541163..543200,543229..543488))
                     /locus_tag="MRET_1171"
                     /codon_start=1
                     /product="nuclear pore complex protein Nup107"
                     /protein_id="XP_027483765.1"
                     /db_xref="GeneID:38737937"
                     /translation="MAAEMDEDVPSSSFEAFAQAYRTARNLDVGAQLDPESGTALVFA
                     DLCAERTQATSLSLPHLQDHYTEDDAAWEAEEHTWKLIHALFAERKLESRSSTIPPAL
                     HVYETPLGTVQRVLQHSPELSELKIIREWLQDVLPVRHAVEVRKGYMPFTKNALRAEK
                     RAQVSGMASTRLGREKLVQHLDPDAASRGPGTWDVEDLHYEKALVRSLFEYVRAGELD
                     MALDLCAQTSQSWRAASLRGAIFYHDPSISEPREGVDGPLGNRSRSAWRRIARKAALN
                     VSLDRYERAMYGALCGDLSSVLAVSESWEERLWSYVNARFEQQLEQLAIQNAPNGNVQ
                     RIEESTAEATESLESIFEQLAHASPHASTEALDPYHVVQRAVITNSVPDLLARVNERL
                     PEMQLLEDKVYARLIRFFAHLALFCHLIHIPLPVSLRAPILNAYVNVLQNAGEGCELV
                     ALYSSSLEPDNAHQVYAEFLCAMDPDTSLEDRRHALLQVQPHGMDPAVVASKTVDLLL
                     AELVPAIVDEAEIREWNANLSMDERRLILSIDWLTFFDATFPHAILQTNTMMRVFMST
                     GRLHAAHSLLKHLPSELLGVLSDVSVAPDQLIELDHWRSYFDVLNKNVAVRGLWSDAA
                     LANSHTDYHNWVEALAQASESTRLACLELLELGWLQFDMEDDSLRREHLMFIRRKYIP
                     EIVTSLHLMLVDTSQVLAENLTHALALPNLVADERLCLYLEFSELASGSPEPLQKYLA
                     HVREAALVALDRRQDVLGCNKTPSV"
     gene            <543604..>544788
                     /locus_tag="MRET_1172"
                     /note="MRES_04650"
                     /db_xref="GeneID:38737938"
     mRNA            <543604..>544788
                     /locus_tag="MRET_1172"
                     /product="transcription initiation factor TFIIB"
                     /transcript_id="XM_027627799.1"
                     /db_xref="GeneID:38737938"
     CDS             543604..544788
                     /locus_tag="MRET_1172"
                     /codon_start=1
                     /product="transcription initiation factor TFIIB"
                     /protein_id="XP_027483762.1"
                     /db_xref="GeneID:38737938"
                     /translation="MSMEAERSHAAPPSLSDAFAITPRFAAERAAAVQNATGQAPTAP
                     AKKETFLPDLNVHLICKDCKTVPPNIAEEFTNGDLVCADCGLVLGDRIVDTRSEWRTF
                     ANEDGDDPSRVGSVSNPILDGITEQLESRIAARDGGTGASRELLKTMSRASAPRDRSL
                     LDAFDSIQNKCDSIHLPRTVCDTAKQAYRRVEQEKLLRGKQTDAIIAAAIYVACRVNR
                     VPRTFPEVCALTSARKQQVARCFREMKEAFGLNATGTGSIDGADTSADVAVASAGTGG
                     AAPLGLAVGATDLVARYCNHLGLDMSIVRVTEAITMKIQEHGCLAGRSPITIAAATIY
                     LVTLLVNEQRTARRISVAAGVSDVTIKHSYKELLKVLDQVLTPDILAKDRRIDLSRIE
                     AK"
     gene            complement(<544841..>545875)
                     /locus_tag="MRET_1173"
                     /db_xref="GeneID:38737939"
     mRNA            complement(join(<544841..545773,545810..>545875))
                     /locus_tag="MRET_1173"
                     /product="zinc finger protein"
                     /transcript_id="XM_027627800.1"
                     /db_xref="GeneID:38737939"
     CDS             complement(join(544841..545773,545810..545875))
                     /locus_tag="MRET_1173"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_027483763.1"
                     /db_xref="GeneID:38737939"
                     /translation="MSFVFPELPSWLLHDTSPPIEYSTHTRSSVPAAPTDTSSLFLND
                     GSTHMAPETHFEKRWTQGASGISPWSSLHSPYPSTLTSFPTASHLPGYELAAVPSMPL
                     VPHERNSYSNMPSMDLAYSRPSNLYNESSRVGRASLLQPHLSGAFAPLSMPGHARHPL
                     TTQPVMFDSHHPPSTAQVPQHLPSTSISSVGLRNNALYADGYYRTLSETPPPVPNTED
                     SQSSDMSISWLSPSHGPARHAKLEQGQVKPPKSRPFVCSRCSRAFSRKHDLERHARVH
                     SGDRPYVCRVCKKGFPRSDALRRHIRVERDTHESYFASKTSDVLVMSERDSASMNG"
     gene            complement(<546097..>549351)
                     /locus_tag="MRET_1174"
                     /note="MRES_04655"
                     /db_xref="GeneID:38737940"
     mRNA            complement(<546097..>549351)
                     /locus_tag="MRET_1174"
                     /product="histidine kinase"
                     /transcript_id="XM_027627801.1"
                     /db_xref="GeneID:38737940"
     CDS             complement(546097..549351)
                     /locus_tag="MRET_1174"
                     /codon_start=1
                     /product="histidine kinase"
                     /protein_id="XP_027483768.1"
                     /db_xref="GeneID:38737940"
                     /translation="MPCDRATVTADANTSQSMCNGPVDDWASFAARYVTGSQDTACHQ
                     MKPGSCASPADIPQDPYTLALGKKMQHVYETEGYLPTYTHAKHINHLRAVWYSRQIKK
                     HDTGTLSRICRLISQLLQLPYVSVKIMAPQSKSLDEDLSPYQVMSEWTHASEDGIQPD
                     ETGLCQSIWSHALYLPLNQVLAVPDAQEDWRFSHHTSRHKLRFFACTPIFDTHNEALG
                     VCCMGDIKPRHGSDLEDAAYSILDMKQMIINDIDLAVNRAQVLRRDELKGCTESLLRT
                     FSMETVADPHVNMELEGCDQIYHLAANALQSSMHVSDVIILDLSNFIMIQKPFEKDGN
                     SNQQVVHSHTMDPNMSQTHIAPLSILGSSERQVHVPEREAALDMSDVRAIQDFLMFTE
                     SDDENRFRLHVPPVIRRLLPRQAEDVFAVPVWGAKHQPSLLVCAYCLPNCYSLMIDQM
                     QHTAHQHIQAIGLMMLDVVDKETVLIADRAKSTFISNMSHELRTPLHGILASTDILSE
                     SGLNELQGFYLETIKSCGHGLLELVNHVLDYTKLSGGASGSQRRPRNISMSDFDLSRL
                     VQEVCDSHALGHQVTPLHDNQIGSIYDPKGAAEERAQRWSDVEFVVNIEKRLHGWYVH
                     SDCGGLRRVLMNLVGNALKFTTKGFVEVSLSGADIDQDTLQIFLRVRDSGCGISRQFL
                     DQQLFHPFSQENPLGSGTGLGLSIVHDIMHSMDAGTVDVRSTQGIGTEIIASCHVRKA
                     PASSDVAYIPQLDVHQSCTAHLFGFPTDTDGGRILQETIVHYLSTWWGFLVRVHHEDE
                     DASSLVASMTQRNVVLLNSRSALVHRLLSQDRLPPLISLTDLYSKQLFKDTLEAYRKA
                     GGATYFLQKPTGPARMEDVLRACLEQVPEQPSGSISLARLKVSDLPEESSAIPAINTS
                     RSNVLASPDRNELERSLNEVAAYASPSSPTVKVAPDAAFTFRVLFADDNPINCQMLAA
                     YLRKLHVPYVEAHGGCEAVTAFATKPHGYFHLVLMDFSMPNIDGLQACMMIRHIEKQR
                     NMEMETQHRCHTYMLSGASMEEILRQGTNAGADGYLVKPLSFKAFVALIQKLDE"
     gene            complement(<549498..>549952)
                     /locus_tag="MRET_1175"
                     /db_xref="GeneID:38737941"
     mRNA            complement(join(<549498..549764,549791..>549952))
                     /locus_tag="MRET_1175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627802.1"
                     /db_xref="GeneID:38737941"
     CDS             complement(join(549498..549764,549791..549952))
                     /locus_tag="MRET_1175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483769.1"
                     /db_xref="GeneID:38737941"
                     /translation="MSPHSENPTPRPPSRWGVPPPGLHARPIQTSLTHKPRDTEPSAR
                     SSTFLPDMDEIQKLHAQRMEHVRSYYLASNKGSKERGGASISPHFALQSAFMELSDAN
                     VEMEAMRLRTTYIDDILARTQEDAFAYTSVAAAAPTLSSS"
     gene            <550078..>550770
                     /locus_tag="MRET_1176"
                     /note="MRES_04660"
                     /db_xref="GeneID:38737942"
     mRNA            <550078..>550770
                     /locus_tag="MRET_1176"
                     /product="small subunit ribosomal protein S7"
                     /transcript_id="XM_027627803.1"
                     /db_xref="GeneID:38737942"
     CDS             550078..550770
                     /locus_tag="MRET_1176"
                     /codon_start=1
                     /product="small subunit ribosomal protein S7"
                     /protein_id="XP_027483766.1"
                     /db_xref="GeneID:38737942"
                     /translation="MFRAFTPAWRLLSTNTAALVSSRTIRRQAVRFLSVTSQEAKTQP
                     DSYTSADAQESVASGLKVMLPGQSSLNVDSISGKSSSFMYSPAALPPRQDPLLHFLVN
                     LLMRDGKKASAERYVADMLSEMARLTNKDPLPLVYEAVELAKPLLRMQTRKQGGKSLQ
                     VPMPLNERQSTRRALKWIIQASDRRADRAISRRLAVEMLAILEGNSSVLSRRDEQHKV
                     GTINRANASVRI"
     gene            complement(550872..550972)
                     /locus_tag="MRET_t0017"
                     /db_xref="GeneID:38741211"
     tRNA            complement(550872..550972)
                     /locus_tag="MRET_t0017"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:38741211"
     gene            complement(551039..551139)
                     /locus_tag="MRET_t0018"
                     /db_xref="GeneID:38741212"
     tRNA            complement(551039..551139)
                     /locus_tag="MRET_t0018"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:38741212"
     gene            complement(<551197..>553284)
                     /locus_tag="MRET_1177"
                     /note="MRES_04665"
                     /db_xref="GeneID:38737943"
     mRNA            complement(<551197..>553284)
                     /locus_tag="MRET_1177"
                     /product="alkaline phosphatase D"
                     /transcript_id="XM_027627804.1"
                     /db_xref="GeneID:38737943"
     CDS             complement(551197..553284)
                     /locus_tag="MRET_1177"
                     /codon_start=1
                     /product="alkaline phosphatase D"
                     /protein_id="XP_027483767.1"
                     /db_xref="GeneID:38737943"
                     /translation="MSDHPPAQAREPVPDTYSPDAKNATGIRDVAVRRSDKLLVLQSM
                     FSLVFRTIAYIFLRVIPGSFGFYAIHFYLGYLAIWVLYDVRVASQKTRRMSSLSSLVF
                     GHSTSNRPWNMVQLVVHTLVLLFVLDLYYMPYMFPSHREASLKFARVGALSSSSATLH
                     VRYPEPLPHVTGLWETGIQDALVDASDINKSPLRIVWRRVHESEVKIRAPSTVRDPRR
                     WERGPVLHLSNESDWTATATLSDLWPATKYEWRLAFVHNNTFAPMPERPIPFVTWPDP
                     RLSAYGKSKFVRTNKTSSIPLDDPNHFSFATLSCIKPDFPYHPAQFWGWNWLLRMFGI
                     GTQPGGITSRNSIRGFDLMADHYLRRSKMPSLRFLLELGDLIYADVPRYEGPDIGSYR
                     KLYRNVFASHSFRRVYQSIPVMGIFDDHEIINNWSGAGYTNATEDEDRPQAPAGIHAG
                     LHAWSEYIGRANPSPAVKNQHYYSFRYGDSAFFVLDVRGHRTHPQSAVDTPTILGEEQ
                     RDALFSWLAQVNHTATFKFIASSVPFTSLWGGPLDLDGRTDGWAFYQEERKQLLDILQ
                     YVPNVILLSGDRHEFASVSFRDALLEFSTSPLSMFYIPIRTLAQEHSIDPPGEETLLK
                     YIPDGNHKWTEFEVDTRDPEQPLVVVRVYVDGKEAWNLRVLGKPVNKTQSALGKLAQS
                     LLELFGFRQRDWF"
     gene            <553394..>555145
                     /locus_tag="MRET_1178"
                     /note="MRES_04670"
                     /db_xref="GeneID:38737944"
     mRNA            <553394..>555145
                     /locus_tag="MRET_1178"
                     /product="glutamine amidotransferase/cyclase"
                     /transcript_id="XM_027627805.1"
                     /db_xref="GeneID:38737944"
     CDS             553394..555145
                     /locus_tag="MRET_1178"
                     /codon_start=1
                     /product="glutamine amidotransferase/cyclase"
                     /protein_id="XP_027483770.1"
                     /db_xref="GeneID:38737944"
                     /translation="MLYLLDYGAGNIQSLANSLTKLGYTYEWVREPSDISKADKLLFP
                     GVGSFASAMDALHAKGYVEPLRAYIQSGKPLMGICVGMQVLFEGSDESPGVQGLGIVP
                     ARVGRFATQDAFGRKAVPHMGWSLANVVEWDGCADQRHELAKSYGMHDANPSHYYFVH
                     SYRVAWDANVAEWALTTTQYGNEIFVSSIQHANVFATQFHPEKSGQAGLDLLAAWLQL
                     EHVEPTTRVGRPVTSTEHMPTRRIVACLDVRSNDAGDLVVTKGESYDVRERGEQDAGA
                     SHVRNMGKPVELAQRYYDEGADEIAFLNITSFRNWALNDQPMLSLLNVAAATIFVPLT
                     VGGGIRDFTDPDGTFHPALKVAHAYFRAGADKVSIGSEAVYAVEQLLARANEAGDTSG
                     DPVAAPAAALRGDTGIEQIAHAYGVQAVVVSVDPKRVYVESAEAAGVHAPSVVSGPDE
                     RPETRGQPVSWWYKCTVKGGREERDVDVVQLARGVERLGAGELLVNSIDRDGSHAGFD
                     VQLVDLVRSSVSIPVVASSGAGCADHFCEVFAPRPGAQGAPIEAALAAGIFHREQVSI
                     ASVKARCASAGYSMRHA"
     gene            <555513..>556922
                     /locus_tag="MRET_1179"
                     /db_xref="GeneID:38737945"
     mRNA            <555513..>556922
                     /locus_tag="MRET_1179"
                     /product="secretory lipase"
                     /transcript_id="XM_027627806.1"
                     /db_xref="GeneID:38737945"
     CDS             555513..556922
                     /locus_tag="MRET_1179"
                     /codon_start=1
                     /product="secretory lipase"
                     /protein_id="XP_027483771.1"
                     /db_xref="GeneID:38737945"
                     /translation="MFPPLWKFTLLCLFLLACTSAEVLERSSKPQTPDKDPFYDPPSG
                     WEEKEHGTILRSRKVDIAFFQIAKVKYKEAYEILYRTSRSEEDQPSTTVTTVIVPENA
                     KKDKLVNMNVYVDSNGARCAPSYVLQRNAKLATDPALSYQQVLFSTILDEGYILTVPD
                     YQGPKRAFAAGRLEGHMAIDGILATLNLKELCLSKDTKVIGYGYSGGSIATGWAASLQ
                     PSYAPNLNMVGWTFGGTPANLTSTLEHLNGGTPAGFAVSGVAGIVDEYESVADWINDK
                     LTHKGKHALDFVREHCTVGIVLRYPFTNILSDSFMKHGAQLLQSPIMKKVLGTLNMGV
                     RPDETPKAPVYMFHAKLDEVIPYGSAHDAAKRWGDHGADILFEEFTGLVMGHASTELL
                     NLPNVLLFMRDRMSGKPFIHGYEHKHTDNPLEDPGVIAKGFDALAETIKNAIDNTVGM
                     GDKHMKAKIEQSRRRRIVS"
     gene            complement(<556963..>557997)
                     /locus_tag="MRET_1180"
                     /note="MRES_04675"
                     /db_xref="GeneID:38737946"
     mRNA            complement(<556963..>557997)
                     /locus_tag="MRET_1180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627807.1"
                     /db_xref="GeneID:38737946"
     CDS             complement(556963..557997)
                     /locus_tag="MRET_1180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483588.1"
                     /db_xref="GeneID:38737946"
                     /translation="MDHEAGPSRQRSVFSCSPRDFHLPQSIIEVEDVAVPRTPESRIP
                     IPAKRHTPARCVPAVLRDKNKMRVAELLQEERAPSCFEIASEARLQRHLMGQTSLQDH
                     VSRRVRRSRIAQERGVRVTSLLGVSHDEEEEEEEEEEEEEEEDNMSDLGPMALPPADD
                     GVMCEDVDVPLAWATPPLPPHPPTASPRTGTKRKWDDDTSMTRRRPAPLPPWVANAST
                     HIASPRWPLWSASGGGTVSPSSSPLAHSGTTTRRVPTPVLSSNAYCHGHARAATPPAI
                     AIPRPMSPTLSAWQPLARSPGTGGSGPGYGSGAIGLRLGSRVAWDTAHVSTHAEGHDM
                     DEGVRMMGLS"
     gene            <558087..>559919
                     /locus_tag="MRET_1181"
                     /note="MRES_04680"
                     /db_xref="GeneID:38737947"
     mRNA            <558087..>559919
                     /locus_tag="MRET_1181"
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /transcript_id="XM_027627808.1"
                     /db_xref="GeneID:38737947"
     CDS             558087..559919
                     /locus_tag="MRET_1181"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_027483587.1"
                     /db_xref="GeneID:38737947"
                     /translation="MLSATPPPHEAPGRLPGNARSIDANDPLSIVRSALGAEEQVIRV
                     SDSDTRETYDVTLSRTMPYASPRVTPKYDDNAPAPVMLTPPPTRRRRLRWMRSLDDAR
                     TAASPTPPTAVPPSATLASSSAQSSPSPAGSTSTPMSYPYTPLPPLANVQRMLGPRRT
                     HQAPAPPLLAPRDTGGSSSELTFDEEMAENADALRRSWRVKEHRSKMPLALKGHLIGE
                     DHVNYVLMYHMLTGIRIAVSRNESRPRTQLTPADFTAKYKFTFDIIGNELRPSSNYDF
                     KFKDYAPGVFCELRRHFGLDAGDYLLSLAAKYILTELGSPGKSGSFFYFSHDYRFIIK
                     TIRSEEHRLFMRFLPAYYEHVRGNPHTLLSQFYGLHRVKLPGRRKIHFVIMNNLFPSH
                     RDVHEVYDLKGSTVSREQLSAKPSAVLKDMNWLQRDRYVELGPQKRAQFERQLRADVS
                     LLQRLQLMDYSLLIGLHDLSYGPSTSPINKSAPMLRRPSILVSPVDDKEADASSTQLQ
                     FSRNHPHQTSLQDMQGKRAEQQRSLFYQDEGGFRATDEHDQPLGLVYYFGIIDLFTRF
                     DARKRSEHIWKALWHDRHAISPVPPVEYGERFIRFLLRKKPSGT"
     gene            complement(<559936..>561486)
                     /locus_tag="MRET_1182"
                     /note="MRES_04685"
                     /db_xref="GeneID:38737948"
     mRNA            complement(<559936..>561486)
                     /locus_tag="MRET_1182"
                     /product="DNA primase large subunit"
                     /transcript_id="XM_027627809.1"
                     /db_xref="GeneID:38737948"
     CDS             complement(559936..561486)
                     /locus_tag="MRET_1182"
                     /codon_start=1
                     /product="DNA primase large subunit"
                     /protein_id="XP_027483586.1"
                     /db_xref="GeneID:38737948"
                     /translation="MNAYALRVGRFLAFLSMFRSAAPAVAGENGRPAQVVHHPSRATG
                     LAAYPFRLNMYTVPPVQDITVEEFEQWALDRLHVLAEIENASARNQAWPETKALIEKR
                     MGEYMPLRSNAVAQSGTTTTSSAKSKELLAERHKDHVSHFVLRLAFSRTEELRRRFLY
                     AETTLFRWKLETEHIAEREAFLRSQDFVWRMVSPDEQRRFREQLLAVHPRLASSFDAE
                     SFVQVPWHRVPDLVEKRRVFVHKGTAWIPTKEQSSLVLAEFQSHLQSQLELTARALPR
                     LDEDDRLMPVLEHLTMGTILGASTEYATSALLSSDGETLALTANMIEPLVQQHAPLCM
                     RHLQATLSKTHHLRHYARLQYNLYLKELGLPVEEALLFWRRSFSTMSDDKFAKEHRYN
                     IRHGYGLEGRRLSYPAKSCARIITQDQPGGQDTHGCPFRHFSAANLSAALAAHYHLSP
                     QEQNDIVAAAQAGHYQVACTRVFELTHRAQGVRAGDGLGQGENVSHPNRYTEASWRLA
                     QSSTAGDM"
     gene            complement(<561502..>563850)
                     /locus_tag="MRET_1183"
                     /note="MRES_04690"
                     /db_xref="GeneID:38737949"
     mRNA            complement(<561502..>563850)
                     /locus_tag="MRET_1183"
                     /product="U3 small nucleolar RNA-associated protein 6"
                     /transcript_id="XM_027627810.1"
                     /db_xref="GeneID:38737949"
     CDS             complement(561502..563850)
                     /locus_tag="MRET_1183"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 6"
                     /protein_id="XP_027483585.1"
                     /db_xref="GeneID:38737949"
                     /translation="MERVQYSLERTLPQLRVLDEHGILTKDELRSLTSQRQSFEARLI
                     RRKADKNDFVRYLDFEDDLHALIMLRARERNRLVMERIKSGDEDAKSQLLPRSFFPKQ
                     AAHSSAHCVAIFERMVLKFRWDLDAWERYIAWAKKRKMRVVAGRVYARALAMHPMQPS
                     LWLSAADYELNTHADTSAARALLQRAIRTNKLSETEDGRSKAQRTSRGASHLGAYRWR
                     LTSYERDVLRLWVEYFRMELVFMERLRRRWRVIAGDDADEEAAAADQAVASDVPEADT
                     PESEPHAPTEAQDHIRQGAIPLVVLDSIRTTVPGSLHLFVYVALLQLLSSFPFSDSLV
                     VKQHGDIASLRTTHGVQGQGDAIRDKLMRGVLSACDLDTLSCLFPLYHALPSTEALPA
                     SQADEELDTHAILHGASQLHGTYSSAIDPLYTYAQVPEELRETGIVAGANDPWTACQP
                     VILLLEVLRQRFVQDEHATPYLRMLTKKGDLPAVVQRTVSQFREHPAESLPFLTTLCA
                     LSTRFGLHEPHLLAYLSRIEAQLTQSLDMPWIALVTASDRAQELVESQRMNPCAWLAY
                     AHAAKWDERTWNDALHACMAPQPDAPVWGLLVAWQSNKRLAYVSPSIARTDLWRMYLE
                     WVPTSTQNPFPLYKRAVQKTGAVLASSQLVGTARAHAQALHDDVVHQVVEQTLPDEQV
                     LSMALSISSASTSCWLAIADHCAQSASLAADRVYQRAVDQAEREGHVADATQTWLAYL
                     AYLAQNDMRKALTQLGHASTRMRTMGGAEAVVALEQQWQAMT"
     gene            complement(<563911..>564895)
                     /locus_tag="MRET_1184"
                     /note="MRES_04695"
                     /db_xref="GeneID:38737950"
     mRNA            complement(join(<563911..564405,564438..564537,
                     564570..>564895))
                     /locus_tag="MRET_1184"
                     /product="mitochondrial ATPase complex subunit ATP10"
                     /transcript_id="XM_027627811.1"
                     /db_xref="GeneID:38737950"
     CDS             complement(join(563911..564405,564438..564537,
                     564570..564895))
                     /locus_tag="MRET_1184"
                     /codon_start=1
                     /product="mitochondrial ATPase complex subunit ATP10"
                     /protein_id="XP_027483592.1"
                     /db_xref="GeneID:38737950"
                     /translation="MLRTWVRSSPYHARAWLNLAARAGLPRAYATKPPKGDDETPPTS
                     FGPPEPSSYMSSVSEAATEANTKPLPFLSQPLGITKRPTSEKPSWTERHAEWFDRDVR
                     LEKRRLIIKDATRGYFHDFHEIRSHGGKTWRSPQTMIRADKARYFPDIQGTCLADKSK
                     KHTADMLFGHVSIVAIVTSRVSEEHTRSFYEAALERFRSHPHFQLVQINLQENTLKAY
                     LLSLFLSSLRAQVPTDLQSTYLLSQQNMDMVREPMGLHNKHVGYTYLVGPDGKIRWAG
                     SAFAEADEARTLVACTGVLLDRMPGGRKAS"
     gene            <565188..>565937
                     /locus_tag="MRET_1185"
                     /note="MRES_04700"
                     /db_xref="GeneID:38737951"
     mRNA            join(<565188..565242,565274..565404,565448..565556,
                     565589..565683,565710..>565937)
                     /locus_tag="MRET_1185"
                     /product="Ras-related protein Rab-8A"
                     /transcript_id="XM_027627812.1"
                     /db_xref="GeneID:38737951"
     CDS             join(565188..565242,565274..565404,565448..565556,
                     565589..565683,565710..565937)
                     /locus_tag="MRET_1185"
                     /codon_start=1
                     /product="Ras-related protein Rab-8A"
                     /protein_id="XP_027483591.1"
                     /db_xref="GeneID:38737951"
                     /translation="MPQPHYDLLVKLLLIGDSGVGKSCLLLRFCDDSWTPSFITTIGI
                     DFKIRTIEVDGKRIKLQIWDTAGQERFRTITTAYYRGSMGILIVFDLTDEKSFQNVRN
                     WYKDVQQHANDGACKILVGNKCDWEEKRVITEEQGKALAEELGMQYIETSAKSNTNVD
                     EAFFKLAQQVKDHLVDQGITSNVPGSNGTQRLNSTSNTQSKGGCC"
     gene            <566123..>566656
                     /locus_tag="MRET_1186"
                     /db_xref="GeneID:38737952"
     mRNA            <566123..>566656
                     /locus_tag="MRET_1186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627813.1"
                     /db_xref="GeneID:38737952"
     CDS             566123..566656
                     /locus_tag="MRET_1186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483590.1"
                     /db_xref="GeneID:38737952"
                     /translation="MKCPDTVLTLLLVCLIGEVIPAHEAELASESTGVSEPSLLTYAG
                     DEHHPTSTVRLELDKRRGGIGGAGRGRIGGGRIGGGAAAGAGIGAGAGAAAGAHRYHD
                     PRRNTTSSEPASSPTTSATSPTSRTSPPTTSAAFPTSRTSSMATHSAPGGAASIDITT
                     TLTALVVMLCALSLSMV"
     gene            <567275..>567949
                     /locus_tag="MRET_1187"
                     /note="MRES_04705"
                     /db_xref="GeneID:38737953"
     mRNA            <567275..>567949
                     /locus_tag="MRET_1187"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627814.1"
                     /db_xref="GeneID:38737953"
     CDS             567275..567949
                     /locus_tag="MRET_1187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483589.1"
                     /db_xref="GeneID:38737953"
                     /translation="MVKLSVPLTLLAVAVASVFAQDDNNSQSQSQSQSQSQSAAPSSS
                     QPQSQSSPSAAGSASSSESRPTSASKSEDSKGGAGGVPVVTSPVCSALFGSPKDQPLG
                     ECKEKSTRVPPYNLSSLVDYFVGGYQNQRGNPVKVVDVADDLADSVVKYYPTVTQSRD
                     VIKYSMYNGLIRTIHEIQGDKKFKPSEEMKRPPGAEPGNSAVKNMLVPGAVGVAAAVM
                     GGAIFL"
     gene            <568115..>570922
                     /locus_tag="MRET_1188"
                     /note="MRES_04710"
                     /db_xref="GeneID:38737954"
     mRNA            <568115..>570922
                     /locus_tag="MRET_1188"
                     /product="vacuolar protein sorting-associated protein 11"
                     /transcript_id="XM_027627815.1"
                     /db_xref="GeneID:38737954"
     CDS             568115..570922
                     /locus_tag="MRET_1188"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 11"
                     /protein_id="XP_027483584.1"
                     /db_xref="GeneID:38737954"
                     /translation="MTSGSTSGCRGPSALPTLRTWRSLRFFDAVPLQEEMYDDAMAGV
                     SCVAYAPKSSGPWASPRGALVTGLHSGQIRVVDARTFVELASWKAFDHECMQVHVASE
                     HGAILTMGCDDDTNVSTVRVWRLDSTAANAWQAVLCACVMVDAHITCAAVPSHLSDVA
                     LGLSDGRVYVLHALSDSMHAKEPHIIKPKLAREASFVDESTEPDVVTGLVIDASTLLI
                     ATVSCTLKFTLHGPRAGQAPSVIDTIGCPPRCGAAFRTCAATEAKDGVVPSVSAPKLV
                     LAREEALYVIGSRGRETSFALEGIKRSIHTLHGQLVIVMLDRILVFDLDTKCITYADE
                     YRNVGHIWTNEAECIPDEYIHLHHARMRLVAKPLVARLEHLFSVHLYVQAIPFIYAYA
                     ARYPHARLPSLPSSASTMPLQTRPSPVELLVADAYRRFGEHLYARGDFENAMQQFCHT
                     IGIMSPSVVIRKFLDAQRLQYLTVYLEALHARHLAHTGHATLLLNCYTKLRNIEAVDR
                     FLRASDVPLDVPVALDVCRRGGCVAQAAYLAQVHGMHDVYLSIQLHDADDPKAALDYL
                     ASLPHSDVMRYFHLCARKLLDAEAGATMDLLVRVYTAESATVSTGDFQVLLSHFVGHP
                     RLLEHFLERIRDACADASRKPDFFVLAQDTLLELYLAHTPDKALHVLEGDASLYTPSR
                     ALIFCAKARYTPGLLRVYERLGMVDAILQHWIHAGDSERVLRTLERYGATHAQLYGPT
                     LSFFTSTHELFAQHREAVERIVQHVLQHALFSPIELVELLSRNDVAPLGLLTPHLVAH
                     MEQEQAELSAARKLVASYRTEARAKQTELAALQSSDEPRIFQHERCELCHQALDLPCV
                     HFMCRHSFHVRCLLEGERTRECPVCAAEHTTIETLRDVSPLTSLDAVLDEVRAADDED
                     GRGFDVLADLFAKGIDAGQQA"
     gene            complement(<570937..>573054)
                     /locus_tag="MRET_1189"
                     /note="MRES_04715"
                     /db_xref="GeneID:38737955"
     mRNA            complement(<570937..>573054)
                     /locus_tag="MRET_1189"
                     /product="long-chain acyl-CoA synthetase"
                     /transcript_id="XM_027627816.1"
                     /db_xref="GeneID:38737955"
     CDS             complement(570937..573054)
                     /locus_tag="MRET_1189"
                     /codon_start=1
                     /product="long-chain acyl-CoA synthetase"
                     /protein_id="XP_027483583.1"
                     /db_xref="GeneID:38737955"
                     /translation="MRFTKEEIEARWAAHIEKQMVEIPGTQRPGFSPVYRNAAFPMNP
                     PMTNPYDSFMNHLKEKPDANCLGHRPFDEGKGDLADYYSWRSYADVAKELTDLGSALS
                     KFQEEGLLKPRPNDKNISEPGLTNFTVAYWGANRPESMITMLSQHSYTRQSVLLYDNF
                     DAAGSCYILQHSVTRVLLCPSKYVPIVLRNADKLPALKVIVLIDRPGSASATLGELSK
                     LQLVREWAAMHGIEVRNYKEVLDIGARHPYPHVPNKDLNNLSTLCYTSGTTGLPKGVR
                     VTTRGLLEGLEGLRWVISDRELVSISYLPLAHIYERGWETFVLYMGGSIGYFSGQIER
                     LMEDLQILQPTVMPSVPRVLNRIAGQIQMQMDAPGLKGKLLTKAVHAKLENYHKTGSV
                     THALWDRLVFRKVRALLGGQVELILTGSAPCRRDVLELLRIALCTDIREGYGQTENNA
                     YASIMGPGDRRVGCVGPVNPGVELRLRDCPELGYTSQDKPCPRGEIVLRSNSVFDGYE
                     GDEKKTKETLMPGEDGKGPWLLTGDVGRIDEYGRLQIIDRVKNLIKLAQGEYIAIEKV
                     ESVFSSLPLVQQVWLYGDSFQPHLVAVAVPEPSVFAPFASKVLGQTVSPTDAAALESA
                     VNDSRVVEAVLREFVKLGKTQKLGTLEQMRALKLRMEPFSPDNGLMTPTLKVKRQEAA
                     KVLKADLDELYRREPINLNNIKI"
     gene            complement(<573936..>575591)
                     /locus_tag="MRET_1190"
                     /db_xref="GeneID:38737956"
     mRNA            complement(<573936..>575591)
                     /locus_tag="MRET_1190"
                     /product="squalene monooxygenase"
                     /transcript_id="XM_027627817.1"
                     /db_xref="GeneID:38737956"
     CDS             complement(573936..575591)
                     /locus_tag="MRET_1190"
                     /codon_start=1
                     /product="squalene monooxygenase"
                     /protein_id="XP_027483648.1"
                     /db_xref="GeneID:38737956"
                     /translation="MSEAYDVIVVGAGVVGAALSTSLGRAGRRVLVLERDMSEPDRIV
                     GELLQPGGVRALQLLGLADALEGIDAVQTLGYQIFLSPEENVRIQYPHIAELPSRYGR
                     SEPLGQDMHYEGRSFHHGHFIMSLRARMHAQKNVTAIEAAVTSLVHDAHDQRVLGVRT
                     NTASYYAPITIVADGIFSKFRKEYGGAYQPKVWSHFVGIELPPDAVLTPKHGHVILNQ
                     KAAKKNAQNHQVGPALVYQIGSDVTRLLVDVPGPVLPSASNGALQRYLSSVVVPCLPS
                     KIGSALAQELEKGARLRTMPNSFLPPSMQGMRQQQFGLIVVGDAMNMRHPLTGGGMTV
                     AFWDCVYLTHILGTGAWSPLDAYDDSFPVPTSARDLSNWTEVQSMLRAWHWKRKKLAS
                     VINILAMSLYSLFGVPNDHLTILRTGCFRYFERGGDCVRGPISLLAGLAPDPLLLVYH
                     FFAVAVYSVLLMFRGDLFVPIGAVSKEHAKPQRPSFLQWPALCARAIMVMTYACFVIF
                     PVIYTETCTNIATASYHTFLRNSCWLLAVAGLGLAVVYRHTTM"
     gene            <575707..>576438
                     /locus_tag="MRET_1191"
                     /note="MRES_04720"
                     /db_xref="GeneID:38737957"
     mRNA            <575707..>576438
                     /locus_tag="MRET_1191"
                     /product="U3 small nucleolar RNA-associated protein 23"
                     /transcript_id="XM_027627818.1"
                     /db_xref="GeneID:38737957"
     CDS             575707..576438
                     /locus_tag="MRET_1191"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 23"
                     /protein_id="XP_027483649.1"
                     /db_xref="GeneID:38737957"
                     /translation="MRQKRAKTYRRLVHQYVLYYRFREPFQVLIDDTFAESLVRLNVQ
                     EPLKQLGMVLQAKVKPMITQCCMAALYEAEMHSQGDEKQMYKRVIALAKEWERRKCNH
                     KETQPPIECLSSVIGPVNQHRYVLAADSASVRRAHRRQVPGLPMLHYSQSVLILEPMS
                     DVTERHIAHLEQSRSALDPEEQRLLPTMPAPAPAPAPKRKRAKGPNPLSVKKKKAAPA
                     AAPPTPAASVKRRRHKKRGRGSTVQ"
     gene            complement(<576425..>577429)
                     /locus_tag="MRET_1192"
                     /note="MRES_04725"
                     /db_xref="GeneID:38737958"
     mRNA            complement(<576425..>577429)
                     /locus_tag="MRET_1192"
                     /product="leucine-carboxy methyltransferase"
                     /transcript_id="XM_027627819.1"
                     /db_xref="GeneID:38737958"
     CDS             complement(576425..577429)
                     /locus_tag="MRET_1192"
                     /codon_start=1
                     /product="leucine-carboxy methyltransferase"
                     /protein_id="XP_027483650.1"
                     /db_xref="GeneID:38737958"
                     /translation="MSGEPRLSLGRPYRRAQPDAVRATDADALLSRLSACRAGYLPPD
                     AYADMLRGHAEAPHRPPIINIGTYLRASEVDAHVQHFIETGACGRPYTPAPRVQIVSL
                     GAGSDTRFWRLRHARLARYVELDFPSTTSQKAAAIHAHPALRHALEDARVTADGLVSS
                     PYVLLGIDIRTLPHGTWQRVATYLDPALPTLLLCECVLAYMDIEVANAALRACLATLP
                     RASILSYDMCISSDTPHAAPTRFGQVMLQNLAARQLTLPGARGCTSTAAYVERFQHLA
                     GSASHLECHAYTLRESWHQLGDEERRRVSMLERLDEVEELEMLLNHYCIAWIDRAIVQ
                     "
     gene            <577456..>578415
                     /locus_tag="MRET_1193"
                     /note="MRES_04730"
                     /db_xref="GeneID:38737959"
     mRNA            <577456..>578415
                     /locus_tag="MRET_1193"
                     /product="solute carrier family 25 (mitochondrial
                     carnitine/acylcarnitine transporter), member 20/29"
                     /transcript_id="XM_027627820.1"
                     /db_xref="GeneID:38737959"
     CDS             577456..578415
                     /locus_tag="MRET_1193"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial
                     carnitine/acylcarnitine transporter), member 20/29"
                     /protein_id="XP_027483651.1"
                     /db_xref="GeneID:38737959"
                     /translation="MSHEVRERVKGFVGGTVSGLTKLLVGHPFDTVKIRLQCDPGRYA
                     GPIACLRSLVRHESVWAVYKGCVPPAIGWMVTDSVLLGSLHTYRRMLMRWHPQRERLP
                     VALQGLAGVGAGWTNAFVTAPVELLKTKLQMQRARFSARAAEFTSTYDCARQVVRYTG
                     VCGLWRALPATLLFRTSFGPMFASYDVCQRALGAWAQPYREGASWTYAWLVSPASVTF
                     LAGGLAAEVFWFVGYPADVIKNRVMADSMHSPRYAGGVRGMCEAARDLWAPRDMPARE
                     RGLGGLPRRLRRIYTGYLTCAVRAFPTNAGALLAFETAMYLMR"
     gene            complement(<578412..>578966)
                     /locus_tag="MRET_1194"
                     /note="MRES_04735"
                     /db_xref="GeneID:38737960"
     mRNA            complement(<578412..>578966)
                     /locus_tag="MRET_1194"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627821.1"
                     /db_xref="GeneID:38737960"
     CDS             complement(578412..578966)
                     /locus_tag="MRET_1194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483644.1"
                     /db_xref="GeneID:38737960"
                     /translation="MRSLVAYDDLPHTPQGLAQASHAKRRRCDAPYVGPHWDDTAPDL
                     DDAVIASPHHEPSFFTSDAHVPMSSHAWTAEDVWDDTFLVDVWHAAEQEYRDFHARRT
                     DALERDSLWHALPPVGASIVPPPPPLPEQPQPAEAESATPGWHEAQRIVRTTPNAIGG
                     ESFQNAAMAWYYAGYYTALYQAPT"
     gene            complement(<578993..>582715)
                     /locus_tag="MRET_1195"
                     /note="MRES_04740"
                     /db_xref="GeneID:38737961"
     mRNA            complement(<578993..>582715)
                     /locus_tag="MRET_1195"
                     /product="nuclear pore complex protein Nup155"
                     /transcript_id="XM_027627822.1"
                     /db_xref="GeneID:38737961"
     CDS             complement(578993..582715)
                     /locus_tag="MRET_1195"
                     /codon_start=1
                     /product="nuclear pore complex protein Nup155"
                     /protein_id="XP_027483645.1"
                     /db_xref="GeneID:38737961"
                     /translation="MSEAAATQLDERLSDAQRLLEKWCQPGALTLPEVKARLPSRDAP
                     YEEHTQPDDAWTGFRVRRRLPIPGMVFETITSRAPVATLALFPEIARACITVEKRLYL
                     WDYARGEHAFEFHELPSDDLILSVGLVRARPGVFVDTIQHVLVLSIGPTAVEGRRVVL
                     LGIQTTDTGIKLYETGMQASTNGVVMRSIHGTDTGRVFCVGSDHCVHELVYQAQEGWF
                     YSRCYLHNITQPHLANLLPSFFKADKKISMVSVDNARRLLYVLRDGDQIDVYALGHGR
                     VPSHTGSMYGVTRQAGLLHSQQQVGPIIWLGPTEPDPRSSVCLVAVTERGYRLYLDDF
                     QRRSWAQLAVRIPPGTQPCRATSALYADGVFLCACASGSDAQLYAVGPSTPASNTTLT
                     YASGMHPAWQEGATLIPLGVGGAPPVLAEAPHHTLLHGAVSRPCAAQVMAPARTFYVL
                     DANGLTEIVERRPADVLSYLLLGSAASVASVASAPAMVDFFSRHGPVEACMCALALAA
                     QHPYMATSRPDDVAHAIRVFFGPLGAWPAEQRVPAPLHAPRSARLEALACYLACLVRP
                     VWLEPLVPAAFVDAKPSGAPPVVGRLAGVLTHLAPLHAFLQRHTQLFDDERAERLGAL
                     LTRTMEACHFVLFLADHHLGPLAQALSPGMRAKLTSLTLAGLVATSEGRSVAQALVTA
                     LIESQSGARASVDAIAEALQAQCASFCSADDVRQYKASECLRHAVELDARLRAESSDS
                     TAVTDELAHSLRLLLPGAAHLPWDKFEHVCTTYEQLRYATGVVALGLASAHAVDPADA
                     AVSFRADGCPADEPMSHRHAMYALRRRIYALVLRALRDDAEAMRQALASDDALFHEEL
                     YTYMIAHGKTSELLSTPTPFLEDFLQGTPVLLDGQSLETYERRLRDLLWQWYVRQGEY
                     LAAAQTLDALAHTDTYALHLYERIEYLALAVGNAKSVRQTAAYDLVGFATQLEEDLEV
                     AQVQAKILSALPPVETLELDDTREHTRETAALLDRSLMDITTLYRHVAEPFGLLEEQL
                     LILHTAQYHDASLVASLWEALVAREHNASAPAQAHRAVAALVTDVYVRLGGSHIACAV
                     DIVLSLLERYAYDTYVVAQLGEQPAPSSLHWHAFTKGAGLPPGWAPRVLLEAGAPPDA
                     LFHVLQGLLSTAPAPWNTHTGVGYLLPDLADLVDAWLRRAEHDRHVRFPAHEVEQALN
                     DAVLQLTTRRFTRTDDALDARIEHIQALVHRVRRRF"
     gene            <582814..>583899
                     /locus_tag="MRET_1196"
                     /note="MRES_04745"
                     /db_xref="GeneID:38737962"
     mRNA            <582814..>583899
                     /locus_tag="MRET_1196"
                     /product="elongation factor Ts"
                     /transcript_id="XM_027627823.1"
                     /db_xref="GeneID:38737962"
     CDS             582814..583899
                     /locus_tag="MRET_1196"
                     /codon_start=1
                     /product="elongation factor Ts"
                     /protein_id="XP_027483646.1"
                     /db_xref="GeneID:38737962"
                     /translation="MLRAGVRGLCTSRIVRAARPSIQSISALRKAVPGTSMLKAREAL
                     AATRTNDTDHVEAAIEWLEAHRAADGAKREAKVASRITAEGTIGVCTLSDGLLGTGAR
                     ASIIELNCETDFVARNDMFGALARDIAHTAAWFPIVSAAHAGLLSDVDVATFLECPLM
                     PFEPVPGQRDVQTVRSAISAVIARLGEKVALTRVASLAPVDHQVHVCGSFAHGTAAAP
                     PAPHGPVTAAFASGRIASLLAAHVQGAPTACAQRTAQADDANVKQLRAMMRSLARQAA
                     GFPTASIDGEDALLTQPFAMLLPTAGLDASVHEQTVRDALQIWSQKTQGQLDVAALRR
                     WEVGETATKPQAEASFADQVKEAAGLA"
     gene            complement(<583896..>584594)
                     /locus_tag="MRET_1197"
                     /note="MRES_04750"
                     /db_xref="GeneID:38737963"
     mRNA            complement(join(<583896..584434,584462..584507,
                     584534..584539,584565..>584594))
                     /locus_tag="MRET_1197"
                     /product="Ras-related protein Rab-7A"
                     /transcript_id="XM_027627824.1"
                     /db_xref="GeneID:38737963"
     CDS             complement(join(583896..584434,584462..584507,
                     584534..584539,584565..584594))
                     /locus_tag="MRET_1197"
                     /codon_start=1
                     /product="Ras-related protein Rab-7A"
                     /protein_id="XP_027483647.1"
                     /db_xref="GeneID:38737963"
                     /translation="MATRKKVLLKVIILGDSGVGKTSLMNQYVNKRFSAAYKATIGAD
                     FLTREVVVDGRLVTMQLWDTAGQERFQSLGVAFYRGADCCVLVYDVNNPKSFETLDSW
                     RDEFLIQASPHDPDNFPFVVLGNKIDVEESKRVVSQKRAMTWCQSKGHIPYFETSAKE
                     AINVEQAFQTIAKNALQQEAEAELYADYPDPIRIDASNSRASGCNC"
     gene            <584715..>585833
                     /locus_tag="MRET_1198"
                     /note="MRES_04755"
                     /db_xref="GeneID:38737964"
     mRNA            <584715..>585833
                     /locus_tag="MRET_1198"
                     /product="Ras-related GTP-binding protein C/D"
                     /transcript_id="XM_027627825.1"
                     /db_xref="GeneID:38737964"
     CDS             584715..585833
                     /locus_tag="MRET_1198"
                     /codon_start=1
                     /product="Ras-related GTP-binding protein C/D"
                     /protein_id="XP_027483642.1"
                     /db_xref="GeneID:38737964"
                     /translation="MAGVAPQDDAVTDAARRKILMIGPRRAGKTSICKVVYESFQPND
                     TLFLTPTMRTQTVNMDTFQALQLLDVPGSALANWVTDSPRASDADERGPRTKMAFDIP
                     WTDVSAVIYVVDAQDEYFDALVRLNAVIVAAYMENPDIHVHVFINKVDGLSEDYKYDT
                     QRDIEQRVYEGLLNSTHELQGVLDEDTRLDKAVRLHFYLTSVFDASAFLAFSRIQQRL
                     LQGTESEVQHAPPGMVSLSDALETACNLLCTACYFEKAYVFDVPSRTFVGCDTSPFDA
                     SLYNIVFRYMHFLLQFSELYAQVPDAVEHPVRTRDWSTSVMRLSHDTTVAFWQLDHHL
                     ALLAVVHTNVQLRNATILDYNLGLFRDAVAQLAALARS"
     gene            <585873..>586472
                     /locus_tag="MRET_1199"
                     /note="MRES_04760"
                     /db_xref="GeneID:38737965"
     mRNA            <585873..>586472
                     /locus_tag="MRET_1199"
                     /product="translation machinery-associated protein 22"
                     /transcript_id="XM_027627826.1"
                     /db_xref="GeneID:38737965"
     CDS             585873..586472
                     /locus_tag="MRET_1199"
                     /codon_start=1
                     /product="translation machinery-associated protein 22"
                     /protein_id="XP_027483643.1"
                     /db_xref="GeneID:38737965"
                     /translation="MSADVAVPMPARSVRYCEICSFPYEYCEYGSSLSKCKANLELKD
                     AELYARLYSDAALEDKLKSLTTEQAESLERESAKKERKAQAKAEKERAQLASSKIVLS
                     RIARTKRKVITCVHGLHQFSPPLPALKVIAKGLSSSFATGASVTQSTQHPGIDEIHIQ
                     GDVVEDVRALIAERKKPFDQMPSEQDGGVLTKNIVLESK"
     gene            complement(<586473..>587789)
                     /locus_tag="MRET_1200"
                     /note="MRES_04765"
                     /db_xref="GeneID:38737966"
     mRNA            complement(<586473..>587789)
                     /locus_tag="MRET_1200"
                     /product="COMPASS component BRE2"
                     /transcript_id="XM_027627827.1"
                     /db_xref="GeneID:38737966"
     CDS             complement(586473..587789)
                     /locus_tag="MRET_1200"
                     /codon_start=1
                     /product="COMPASS component BRE2"
                     /protein_id="XP_027483321.1"
                     /db_xref="GeneID:38737966"
                     /translation="MLPVSIEAPAPRTDLGLAHEAPTPLHAPAQDVRPSHRVPPGFRA
                     PPPQDDDAEDTAPMPWWVPHSAAGAGSLGTVPNVPMNKNGWRYVAAGPAAHRLPRTVY
                     HTLDVAPACVHWSWQDRSAFTRISQDASIVGTDKGYRSARANVGVRHGAWYVEMQVLP
                     PDASSAPAVPMRDGPHVRLGWARREASLNAPVGWDAYSYGVRDQNGACVTQSRLVPYG
                     RAFGPGDVVGMYIRLPEAHVPPPPGTEHGIAQKRIPIRYKGQLYFESLEYAPSREMEA
                     LMDEQRRSGTIWTPQPAHVRPLPTLHDSCIGFVVNGEPQGMAFANLYDYRPLRTHKKR
                     QHEVSAHASVSAILKSRQNALDDGMLGYYCMASMYGGARVRIIASDFVHPPPPDLEDR
                     LWRAGTAPGVSCTRQHPAPPWRPLADRYAEVCQEAWELDEADDRAT"
     gene            <587821..>588741
                     /locus_tag="MRET_1201"
                     /note="MRES_04770"
                     /db_xref="GeneID:38737967"
     mRNA            <587821..>588741
                     /locus_tag="MRET_1201"
                     /product="maintenance of mitochondrial morphology protein
                     1"
                     /transcript_id="XM_027627828.1"
                     /db_xref="GeneID:38737967"
     CDS             587821..588741
                     /locus_tag="MRET_1201"
                     /codon_start=1
                     /product="maintenance of mitochondrial morphology protein
                     1"
                     /protein_id="XP_027483322.1"
                     /db_xref="GeneID:38737967"
                     /translation="MTSTSAWMPSLAFTQGFMAGQAVLLCLFLCLFRYCFMTSAPSSR
                     ARRQAEMAQRLHTLHTSLEARSAPPTYARVPYEQGVQACIDDLMAQVEYDAAEPESLG
                     WLNVLVAQLLMTYRSYILRTGACIPSDELPSSATAEKAAARLVFERILNEALQSRTMH
                     ILDPLTVTDIDIGCRYPRCSHARVRSAGTIEVDIEYVDALTLGIDTRLWLHVPHYRFG
                     ALDAAMCLRIERFAGTLAIEITETDVRVYLHPGFVLDAHLSSVFGSKSKLQDVPKIED
                     IVLARLHQWIKHRLVWPHAWHIPLPGVAAT"
     gene            complement(<588734..>589285)
                     /locus_tag="MRET_1202"
                     /note="MRES_04775"
                     /db_xref="GeneID:38737968"
     mRNA            complement(<588734..>589285)
                     /locus_tag="MRET_1202"
                     /product="DnaJ chaperone Caj1"
                     /transcript_id="XM_027627829.1"
                     /db_xref="GeneID:38737968"
     CDS             complement(588734..589285)
                     /locus_tag="MRET_1202"
                     /codon_start=1
                     /product="DnaJ chaperone Caj1"
                     /protein_id="XP_027483323.1"
                     /db_xref="GeneID:38737968"
                     /translation="MTLPDYYAVLGLEARASGAEIKKAYQRASLQCHPDRYPDATPEE
                     KRAWTERFQSVADAYYILSDAARRAEYDAARARGQTYFDAGDTRPAADRQFADVWADL
                     LRPEMERQTSVWRTSGAVSGAVLGYIVANLPGAIGGAVLGHGLGAIRDAKGQPVSQVF
                     LSLPLEARASVLRAVAAKVLASM"
     gene            <589328..>590256
                     /locus_tag="MRET_1203"
                     /note="MRES_04780"
                     /db_xref="GeneID:38737969"
     mRNA            join(<589328..589399,589426..589465,589490..>590256)
                     /locus_tag="MRET_1203"
                     /product="NADPH-dependent beta-ketoacyl reductase"
                     /transcript_id="XM_027627830.1"
                     /db_xref="GeneID:38737969"
     CDS             join(589328..589399,589426..589465,589490..590256)
                     /locus_tag="MRET_1203"
                     /codon_start=1
                     /product="NADPH-dependent beta-ketoacyl reductase"
                     /protein_id="XP_027483324.1"
                     /db_xref="GeneID:38737969"
                     /translation="MPRDAAPDVMPDMSLSALFGVRGKIALVTGGASGLGKMMTAALV
                     QNGARVYIASRKLHDLESVAASMNETARGGPWPAGTACIPLQADLSSKAGCDALAAEL
                     ARHTSRLDILVNNSGLTWGGPRDDFPEDKGWDKVFHLNVKSQFYLTVALIPLLEQGKS
                     NTHHASVVNIASTAAMMPQASGALSQPGSGTYSYQPSKAASVHLSRMLAVDLAEQHIH
                     VNAICPGVFPSRMTAWSLGEFGEALEAGQPTGRIGTPEDIGGLLLFLVSRAGSHVTGA
                     AIPLDGGQLVQFYPRL"
     gene            complement(<590253..>590593)
                     /locus_tag="MRET_1204"
                     /note="MRES_04785"
                     /db_xref="GeneID:38737970"
     mRNA            complement(join(<590253..590271,590297..590336,
                     590361..590369,590398..>590593))
                     /locus_tag="MRET_1204"
                     /product="complex 1 protein (LYR family)"
                     /transcript_id="XM_027627831.1"
                     /db_xref="GeneID:38737970"
     CDS             complement(join(590253..590271,590297..590336,
                     590361..590369,590398..590593))
                     /locus_tag="MRET_1204"
                     /codon_start=1
                     /product="complex 1 protein (LYR family)"
                     /protein_id="XP_027483325.1"
                     /db_xref="GeneID:38737970"
                     /translation="MLPRGHALRARAIGLYKELHRLGRDYPDPNYHFIPKLRSAFRKN
                     AHLTDPAQIEKLHALGQFVKKETETLYMLKKYRTLRRRYVQDD"
     gene            <590694..>591605
                     /locus_tag="MRET_1205"
                     /note="MRES_04790"
                     /db_xref="GeneID:38737971"
     mRNA            <590694..>591605
                     /locus_tag="MRET_1205"
                     /product="zinc finger protein, C2H2 type"
                     /transcript_id="XM_027627832.1"
                     /db_xref="GeneID:38737971"
     CDS             590694..591605
                     /locus_tag="MRET_1205"
                     /codon_start=1
                     /product="zinc finger protein, C2H2 type"
                     /protein_id="XP_027483326.1"
                     /db_xref="GeneID:38737971"
                     /translation="MDDDGLAAPPWATKPLDEISTSESETEMDEEHADEASARPSTDP
                     PEPAPEVRCMWEDCGEVFTDLQPFIAHLHSFHIGINKSRYACEWTGCPRKGKSQTSRF
                     ALLSHLRSHTGEKPFTCPRPECDKSFTRSDALAKHMRVQHNMPTTSQGRSNGADGDES
                     RDGAMADDMADVAEYERRLQEAETSYVLIAQRAADNSRYLLPAQEASELEKMAMYLPP
                     GDKKDDDDDDEDIDLSSPPHAAPKPYLVAKAKWRYLSQRRDAWLREVQTLQEEETELL
                     KSCRDALDQLLHNAYGDDAARVITHSH"
     gene            complement(<591622..>592587)
                     /locus_tag="MRET_1206"
                     /note="MRES_04795"
                     /db_xref="GeneID:38737972"
     mRNA            complement(<591622..>592587)
                     /locus_tag="MRET_1206"
                     /product="phosphopantothenate---cysteine ligase (ATP)"
                     /transcript_id="XM_027627833.1"
                     /db_xref="GeneID:38737972"
     CDS             complement(591622..592587)
                     /locus_tag="MRET_1206"
                     /codon_start=1
                     /product="phosphopantothenate---cysteine ligase (ATP)"
                     /protein_id="XP_027483327.1"
                     /db_xref="GeneID:38737972"
                     /translation="MRRAWTPEEFYREFDEPPHVQDITESVQAFVETHRQAGHKVVLV
                     TSGGTTVPLEKNMVRFLDNFSAGTRGAASAEYFLQQGYAVLFLSRQHSQFPFTRLYSH
                     TTNPLFDLLEEPVANDDSVRVSRDHVAHLLPTLHAYHDAKRNKRLLTVSFVTVVEYLF
                     LLRHICHILAPLGRHAMLYLAAAVSDYFLPPERMSEHKIQSSDGALTIELQQVPKVLG
                     VLVREWLPHAYVVSFKLETDESLVIPKAERSLRHYGHQLVIGNQLQRRKWEVVLVEHT
                     SRTKQQDTASFEHAWIQLPQDAEHEIERDIVRMLAQRQHAWIHAV"
     gene            <592722..>594221
                     /locus_tag="MRET_1207"
                     /note="MRES_04800"
                     /db_xref="GeneID:38737973"
     mRNA            <592722..>594221
                     /locus_tag="MRET_1207"
                     /product="DNA methyltransferase 1-associated protein 1"
                     /transcript_id="XM_027627834.1"
                     /db_xref="GeneID:38737973"
     CDS             592722..594221
                     /locus_tag="MRET_1207"
                     /codon_start=1
                     /product="DNA methyltransferase 1-associated protein 1"
                     /protein_id="XP_027483328.1"
                     /db_xref="GeneID:38737973"
                     /translation="MSLPARAAGEPSRAQAPASRAPPTLPGDARPKQRPEGMSRELYA
                     LLGPNAPSLVMSGMAAPDEQATALPFQPKFQRKSLASVRKWAWTPFRNPARDDTPSMS
                     GEPSADDAMLTDAPARRGLVLHHWKPVPVGGGVDDEADDDIALDDAWAPFNTSSQVFH
                     YTTDEYTQHLQDADWTREETDYLIEMCDAYDLRFIVIADRYEWPGKQRSMEDLKARYY
                     TICRRLLRERISNEDIETRHNQLQTYAYDRQQETERKRAVQKLFSRTPEQLAEEEALY
                     VEARRLEQNEAKFAKERADLLRLLGSFDDVPTCSPATVAAVGAGLIWPGSGYQDAPAE
                     DKKAKRRRTDAAASPSKSKSDAKQALFDAQHLITRFSTSGPEVLRTPYPHLMGTPSAS
                     PPVVQSAAGTKSESSAHHGAYLRSTRMLTFRPNQYARMLQALAELHPPIGARLVFPTA
                     TNVEKWETLLGAVAGDLEVKKQLDRVEAEYQVVQARLAAAEAGEQPPAS"
     gene            <594243..>594452
                     /locus_tag="MRET_1208"
                     /db_xref="GeneID:38737974"
     mRNA            <594243..>594452
                     /locus_tag="MRET_1208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627835.1"
                     /db_xref="GeneID:38737974"
     CDS             594243..594452
                     /locus_tag="MRET_1208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483319.1"
                     /db_xref="GeneID:38737974"
                     /translation="MAFSPRAHRRRTRAAGALLGGGASTSSSETANSSAGRLGLTRLL
                     AALVQQVHERLIVACERGSCTTRAL"
     gene            complement(<594447..>596069)
                     /locus_tag="MRET_1209"
                     /note="MRES_04805"
                     /db_xref="GeneID:38737975"
     mRNA            complement(join(<594447..595875,595903..>596069))
                     /locus_tag="MRET_1209"
                     /product="galactokinase"
                     /transcript_id="XM_027627836.1"
                     /db_xref="GeneID:38737975"
     CDS             complement(join(594447..595875,595903..596069))
                     /locus_tag="MRET_1209"
                     /codon_start=1
                     /product="galactokinase"
                     /protein_id="XP_027483320.1"
                     /db_xref="GeneID:38737975"
                     /translation="MTDSIPTRALDEIYSPHTLPGEQARWRSVVEHFTHIFHHQPQFV
                     ARAPGRLNLIGEHIDYVGYNVMPMAIEKDILMATSFEPASTPRLRCELHNAITHFAHS
                     TFECDMTDPHSIELVHFGSKRWANYFKVVLLGLQSVLPPEVRQNAHGTIKVLVDGTVP
                     PESSLSSSAAMTTCSSIVILTALKALHVVPRKVIADVACHSERLVGVHSGGMDQAVSV
                     FGQRDKALFVSFAPTLHVSPIELPLGHQYVFLVTNTMIKSDKKATAPERYNLRVVETR
                     LAAAVLKRVLQTKSDIPIQFRDTLRSVSDTFWAGHTGEWDKIVHEFDDVRHACNDLGL
                     DAGHLQAMLNIVEHHIPRRGLSRQEVEDLVGLHGDEFDHHFLKDFRVHASEFFLHARA
                     FHVYSEALRVLQFHAVLQRAHADHAHGPPHFDPHRVARRLGAIMNASHESLCSDYDCS
                     SPELNLVVHIARQHGSLGSRLTGAGWGGCAIHLVHRDQVSTLMDLFKELYYSIKFGYM
                     TEHMLNDAMFVTCPGEGACVSFL"
     gene            <596190..>596918
                     /locus_tag="MRET_1210"
                     /note="MRES_04810"
                     /db_xref="GeneID:38737976"
     mRNA            <596190..>596918
                     /locus_tag="MRET_1210"
                     /product="GINS complex subunit 4"
                     /transcript_id="XM_027627837.1"
                     /db_xref="GeneID:38737976"
     CDS             596190..596918
                     /locus_tag="MRET_1210"
                     /codon_start=1
                     /product="GINS complex subunit 4"
                     /protein_id="XP_027483273.1"
                     /db_xref="GeneID:38737976"
                     /translation="MSHAAAAKYVWHEDDEPPPVSSSVVPDEDVAHVADPRPAIVRLT
                     HAWLNERGTPELQPWPADAFDAVMDQLQHQQAILDSLMTDTSTSEEEHFRLNLVQLDA
                     DRAKWLVRSFLRARLVKLETYAPYLASQPSEQVRLSDLELGYVKRYEQLMSEHMQSAV
                     LQYLPEPMRGMDDPPPGGASGAPGGMVTAPRLDAPVFIYCRDDGGFLTLSEDEKVALL
                     RGSIHVVPYRAVRTLLHQGRVELL"
     gene            complement(<596925..>597533)
                     /locus_tag="MRET_1211"
                     /note="MRES_04815"
                     /db_xref="GeneID:38737977"
     mRNA            complement(<596925..>597533)
                     /locus_tag="MRET_1211"
                     /product="putative DNA replication factor C complex
                     subunit Ctf8"
                     /transcript_id="XM_027627838.1"
                     /db_xref="GeneID:38737977"
     CDS             complement(596925..597533)
                     /locus_tag="MRET_1211"
                     /codon_start=1
                     /product="putative DNA replication factor C complex
                     subunit Ctf8"
                     /protein_id="XP_027483272.1"
                     /db_xref="GeneID:38737977"
                     /translation="MRIPIHRATQTLEHVDVSHVPPPLVRLSPSGELVLVEMQGTLEM
                     EGGDPRGGETIGTLTFPPGREDKPILQISHHRLEGTIVKLRKPLAVLQKRTAPRSRQP
                     ASPPTSPTASPTLSRQRARETLVTPPRSSAAAPASSSPMPARPTSLLDGYADFSSPHA
                     GASDGMPLPTTTSYAIVTLIRHKLLFSQRPEPIVALDRAPEP"
     gene            <597670..>598884
                     /locus_tag="MRET_1212"
                     /note="MRES_04820"
                     /db_xref="GeneID:38737978"
     mRNA            <597670..>598884
                     /locus_tag="MRET_1212"
                     /product="GATA zinc finger"
                     /transcript_id="XM_027627839.1"
                     /db_xref="GeneID:38737978"
     CDS             597670..598884
                     /locus_tag="MRET_1212"
                     /codon_start=1
                     /product="GATA zinc finger"
                     /protein_id="XP_027483271.1"
                     /db_xref="GeneID:38737978"
                     /translation="MSVGVPPCPFPVAVSEMEQPAMHRPMLTHLAQQQVERTRCYWAI
                     CRCSHDPEPAFSFVYVDPRAHRKVGSALYGAPMLQFVHPDEQPRVMDHMRTIMQDSTL
                     FGRVIQCRYATLTSMPAYLHGVHVPDYDTVDVIVSRLHEQLVVCFFHATEDASHACGL
                     APGSFEALECERLWQSLWASCPPPWGPATHVFQILSSDEPRSLLMSWPPPHTYYARDF
                     VQLVKDAALPEHATCMHRLRASHRLTSKQATFSVTSVLVPCASIVLACFQIAQQQASP
                     HAAASSPWSDLEASRQVDVSVSKCTSCGRTDSPEWRRGPSGLKTLCNACGLRYARSLA
                     SRQRRHEHGSITPSDLQHVPPSRGAGGGSVPGMHRRSRPRSPFEPAQDDAARLWPPPS
                     TPSAEETHIPSA"
     gene            complement(<599288..>599658)
                     /locus_tag="MRET_1213"
                     /note="MRES_04825"
                     /db_xref="GeneID:38737979"
     mRNA            complement(join(<599288..599582,599612..>599658))
                     /locus_tag="MRET_1213"
                     /product="transcription initiation factor TFIIA small
                     subunit"
                     /transcript_id="XM_027627840.1"
                     /db_xref="GeneID:38737979"
     CDS             complement(join(599288..599582,599612..599658))
                     /locus_tag="MRET_1213"
                     /codon_start=1
                     /product="transcription initiation factor TFIIA small
                     subunit"
                     /protein_id="XP_027483270.1"
                     /db_xref="GeneID:38737979"
                     /translation="MSAGRNQYYEFYRQSSIGIQLTDALDELIQSGHINPILAMKVLE
                     QFDKSISETLAHNVKSKGNVKGHLHNYRLCDEVWTFIIKDAMFKLDNGEMLSVDKAKI
                     VACKLGEGSNR"
     gene            complement(<599743..>600348)
                     /locus_tag="MRET_1214"
                     /note="MRES_04830"
                     /db_xref="GeneID:38737980"
     mRNA            complement(join(<599743..599830,599856..600003,
                     600030..>600348))
                     /locus_tag="MRET_1214"
                     /product="centrin-3"
                     /transcript_id="XM_027627841.1"
                     /db_xref="GeneID:38737980"
     CDS             complement(join(599743..599830,599856..600003,
                     600030..600348))
                     /locus_tag="MRET_1214"
                     /codon_start=1
                     /product="centrin-3"
                     /protein_id="XP_027483269.1"
                     /db_xref="GeneID:38737980"
                     /translation="MSHLSRVRARRTPSFGGSQVLTSGISYSNARAAAPAIELSEDQR
                     QEIREAFDLFDTDKDGAIDYHELKVAMRALGFDLKKAEVLDILRENDPSGTGLLDWPA
                     FNRLMTERIAARDPREEILRAFALFDEDHTGKISLRNLKRVAKELGESLDDEELQAMI
                     DEFDLDQDGEIDEQEFLQIMMDEP"
     gene            <600537..>602729
                     /locus_tag="MRET_1215"
                     /note="MRES_04835"
                     /db_xref="GeneID:38737981"
     mRNA            <600537..>602729
                     /locus_tag="MRET_1215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627842.1"
                     /db_xref="GeneID:38737981"
     CDS             600537..602729
                     /locus_tag="MRET_1215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483268.1"
                     /db_xref="GeneID:38737981"
                     /translation="MPRLAWVPPSLRWLTRHAVLQALPPTTFTRYWQPFQPPPSEADV
                     GETTRAFMTALENQDIDACLAMLRAHTPTYPLWLSLWTLVAEGPNPIPASGLYERLDT
                     VCWHLCELYRFHQSAYPTRSIPPQMRQRLVYLLLKRAERIDATFVAEARTQQRRAQAS
                     ILLDVAGDLHTLDGELAGRLVFRLARMQAMDALGPCLTAYMTHDAPPQDMVSAAQPLA
                     AVLDEALAWHERTGQEAALILGVEAIRLAFLRSWPIKHTLVQRWLRQAGPTLTRLCLV
                     PPSIPRLPLAYTALPLDELVRDVHALQPQYMHERAAVVLCRMNDARAALDLVETRRPH
                     IPFDVYASAISALTWMVRTHVSPQAALSLALRTFKALYEAGMHADEQMYGELVRAFES
                     RMHSRPAETRTWVEARVGEHIPWTTLLASWTRHMIAHHDVPLVRADHLSRLLRLHIRC
                     RHGWLSRQLYEQMREHHASMLPCTSPTLFGWLFMQSYSRPTSLSFAMRLYQDWCASGR
                     ALPQAHIEPYLRSLLAYGMASMVQRVVSDQRAYVPLPTLASYVVRAHLAHGHDEAAFA
                     WASDLLNTPEEAVDWDDTSHPPVPSLTYYAVCFYETSRYPQYALDPHARQRLDALFSE
                     FQLGLAHAIASSCVCMDTISRAYYGMLRVTLQVLGADGPPADPLPLPDRQAAWDRIHT
                     LWHEWHDLNRSLGPTATSLQGDVDALYAQFQHVPRPSAAHIDGGQYGG"
     gene            complement(<602890..>603135)
                     /locus_tag="MRET_1216"
                     /db_xref="GeneID:38737982"
     mRNA            complement(join(<602890..602911,602936..>603135))
                     /locus_tag="MRET_1216"
                     /product="mitochondrial export protein SOM1"
                     /transcript_id="XM_027627843.1"
                     /db_xref="GeneID:38737982"
     CDS             complement(join(602890..602911,602936..603135))
                     /locus_tag="MRET_1216"
                     /codon_start=1
                     /product="mitochondrial export protein SOM1"
                     /protein_id="XP_027483267.1"
                     /db_xref="GeneID:38737982"
                     /translation="MIDSPPKPACELYELMQYHCRLQQHRILCHPVERVFRKCGERRP
                     VVEVTHVVEYTREGIPYLPPGVADALPQG"
     gene            <603359..>604660
                     /locus_tag="MRET_1217"
                     /note="MRES_04840"
                     /db_xref="GeneID:38737983"
     mRNA            <603359..>604660
                     /locus_tag="MRET_1217"
                     /product="adenosylhomocysteinase"
                     /transcript_id="XM_027627844.1"
                     /db_xref="GeneID:38737983"
     CDS             603359..604660
                     /locus_tag="MRET_1217"
                     /codon_start=1
                     /product="adenosylhomocysteinase"
                     /protein_id="XP_027483266.1"
                     /db_xref="GeneID:38737983"
                     /translation="MSNYKVADISLAAFGRKEIQIAEGEMPGLMALRQNYGPQQPLKG
                     ARIAGCLHMTIQTAVLIETLVALGAQVSWSSCNIFSTQDHAAAAIAAAGIPVFAWKGE
                     TDEEYNWCIEQTLKAFPDGQPLNMILDDGGDLTWTIHNKYPELLDNIRGLSEETTTGV
                     HHLYMAVKKGELKVPAINVNDSVTKSKFDNYYGCRESLVDGIKRATDVMLGGKVAVVA
                     GFGDVGKGCAESLRSYGCRVIVTEIDPINALQASMAGYQVDTMDDVAAQANIFVTTTG
                     NRDIITTKHFEMMPEDAIVCNIGHFDIEIDVAGLKQIAKEVVNIKPQVDRYTLPNGRH
                     VILLAEGRLVNLGCATGHPSFIMSASFCNQTLAQITLWNDKENKFQRGQVYMLPKTLD
                     EEVARAHLTKLNVKLTKLTKVQSEYLDIPVDGPYKADHYRY"
     gene            <604930..>606756
                     /locus_tag="MRET_1218"
                     /note="MRES_04845"
                     /db_xref="GeneID:38737984"
     mRNA            <604930..>606756
                     /locus_tag="MRET_1218"
                     /product="Xaa-Pro aminopeptidase"
                     /transcript_id="XM_027627845.1"
                     /db_xref="GeneID:38737984"
     CDS             604930..606756
                     /locus_tag="MRET_1218"
                     /codon_start=1
                     /product="Xaa-Pro aminopeptidase"
                     /protein_id="XP_027483275.1"
                     /db_xref="GeneID:38737984"
                     /translation="MGAVSTGVVRTASLVEQLRERMRVHQLQAYIVPSEDEHASEYPS
                     DADLLRGHITGFNGSAGCALVTLKEALLFTDGRYFLQASQQLEPGVWSLMRAGEPGVP
                     TWDEWLVENMEPHSRVGVDPKLISAGEAQALRSALDEASSSSLVPLAENLVAQVWTDR
                     PSRPHEPVFALPDSITGRAFTSKIQALRDEVQKKRASGFVATMLDEVAWLFNLRGSDV
                     PFNPVFFAFAIVTLDTCTLYIHESQLTHEVRAHLGSHVAIRPYEAFYDDLRALNERVL
                     IGKRASWAVYDALGGKARITRSILVDHKSIKNDRELDGFREAHIRDGAALVSFFAWLE
                     EALTSGQTVTETQAADQLEAFRAQQPDFRGLSFPTISSTGPNGAIIHYAPPEKGSPPV
                     DANDLYVCDSGAHFAFGTTDVTRTFHFGSPTAEQRRCFTRVLQGHIAIDQLIFPVNVT
                     GYVIDALARAPGWRDHLEYRHGTGHGVGHYLNVHEPPMGIGTRAVFNETGLQAGMVLS
                     NEPGYYLDGHWGIRIENLVIVRPHTLPDGVSEPPTSKGFLRFEHITLCPIQTRLIDTD
                     LLSPSEIAWVNAYHDEVLAKLRPRLEKDVRALRWLEKECAHI"
     gene            complement(<606753..>607730)
                     /locus_tag="MRET_1219"
                     /note="MRES_04850"
                     /db_xref="GeneID:38737985"
     mRNA            complement(<606753..>607730)
                     /locus_tag="MRET_1219"
                     /product="serine/threonine-protein kinase 24/25/MST4"
                     /transcript_id="XM_027627846.1"
                     /db_xref="GeneID:38737985"
     CDS             complement(606753..607730)
                     /locus_tag="MRET_1219"
                     /codon_start=1
                     /product="serine/threonine-protein kinase 24/25/MST4"
                     /protein_id="XP_027483274.1"
                     /db_xref="GeneID:38737985"
                     /translation="MSCSTTATMSAATQPDTLTSDARYVCLDLLGAGAYGHVYRGMDR
                     STGAAVAIKIVELDMSTEELNAVQKEIHILSQVRCPFVTRMYDSFVVGMQLWIVMELC
                     VGGSCADHARQGRLHEAHIAVILRDVLRALVYLHAEDMVHRDIKAANVLLYMDQHGTG
                     IRVADFGVAGRLQQAHAKCERAFVGTPYWMSPEVIKQSSYNTKADIWSTGIMAIELAE
                     GEPPYADLHPMKVLHLIPRNPPPQLSPTYTSAFRDFVAQCLTRDPAKRPTAAALLKHK
                     FIRHAGSAVSILTPLAQQYKPLKHSASSQYAVAPTPDPPPLWEFASLRR"
     gene            complement(<607759..>608799)
                     /locus_tag="MRET_1220"
                     /note="MRES_04855"
                     /db_xref="GeneID:38737986"
     mRNA            complement(<607759..>608799)
                     /locus_tag="MRET_1220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627847.1"
                     /db_xref="GeneID:38737986"
     CDS             complement(607759..608799)
                     /locus_tag="MRET_1220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484000.1"
                     /db_xref="GeneID:38737986"
                     /translation="MATAPIPSCRVDPLVERAERLWRHLRFASHEAGLASSKPTPPPK
                     AFEMPALSSPTSSASSSSASSTVPAMSLYESLFGRHYQLEPLHEQKHSEPVMRLVSPP
                     QPLPPPRLHASTASERLTLAASSPQHGSELHKRRRLAPSPSAPFQFPPRSSLAQGPGL
                     APHSRRRLPAARAGHARIASMPEQRHEHYVPVRGQDAVPQVASLHPAADAMLRLASTP
                     AVHKPRSHVRTQSRDDQDATQLPPAMRTHRRSVSHSTAELNVPVSHDRTSGITTPPAG
                     VAALPVTPKSMGSQSMSYGDYLIMSPSPRPRMHPHRHADTLPISPPRQRAWPPDTPGR
                     RGVRPLWAQPSR"
     gene            <608956..>609727
                     /locus_tag="MRET_1221"
                     /note="MRES_04860"
                     /db_xref="GeneID:38737987"
     mRNA            join(<608956..609010,609036..>609727)
                     /locus_tag="MRET_1221"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627848.1"
                     /db_xref="GeneID:38737987"
     CDS             join(608956..609010,609036..609727)
                     /locus_tag="MRET_1221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484001.1"
                     /db_xref="GeneID:38737987"
                     /translation="MQPAAPQRPEPTKFTPQELEALRNISSNVMTCRLVGFVGGTAGM
                     YYALRRMKNPPRFAGLCFYTLLGGLGGSMLMVPFGIAWSRSSLRSIEDPRHLMNAMQY
                     TMDQRRRGIKTNPLSDAPTAEPVDRSNDWADAAPRSSEAPPAASANWSSSSWGDAPPS
                     SSAPKSRWDELRQNRTSEPSQWEHLRQQHARNALPAEARGKASPPPPSDEPVSDYDRA
                     MKEYRAAFERERQGIDVTTGFVEQNNTLRT"
     gene            complement(<609724..>611442)
                     /locus_tag="MRET_1222"
                     /note="MRES_04865"
                     /db_xref="GeneID:38737988"
     mRNA            complement(<609724..>611442)
                     /locus_tag="MRET_1222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627849.1"
                     /db_xref="GeneID:38737988"
     CDS             complement(609724..611442)
                     /locus_tag="MRET_1222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483998.1"
                     /db_xref="GeneID:38737988"
                     /translation="MAATTIPPERGKVGHSVSYAYMYGDAGAKENMSLGISRRPSTQR
                     QAPGIPRSAGFDSLQDLLEREGYKDTRIITPKIPKAISIDDADDMGLVSDEPTRHKAR
                     PMHGSYLPKKPDDIEPWMHQVTASAQGPPPPRLRTSRSDHTLKKRPRRRQSTIWDASV
                     AYLHSAGQEMPSVPPPVPPIPPQYKSRPGVAGGPPGESAPGFASSPAAPVLSREDAVV
                     HVYETDSTVLPRGLRRSKSEDLLHKTLKSRRTQRLDAPPECTCGHTRSKVPIEPRWHL
                     QLCPIRVQWEATMTEPIPPPPPRLTVSTPRGISTPKHLELSGAEFDPVDTPNTLSRYM
                     PFSRPGFALAKRATLEGLHGFFKGQEKGSDVPSSRHPSKPRSSPQPRCVPAPRLSHAT
                     SLPQLSKTPKRLPDVPAIRIEASPALTGSQRVHELHQHFQNRIKQDDSTELPATPKLD
                     GLLVSDESNHASLMESPTLQRARSRSRLTGAGRLPDLAASHEIPPSRPPLDDTVNLCH
                     DAMPRPPTTDTLLAPPTRKLRRSTRSRPDLVRHTAAPRVLSQASLSDRRPMRPISPHN
                     NVFMTI"
     gene            <611664..>614349
                     /locus_tag="MRET_1223"
                     /note="MRES_04870"
                     /db_xref="GeneID:38737989"
     mRNA            join(<611664..613641,613679..>614349)
                     /locus_tag="MRET_1223"
                     /product="N-acetyl-gamma-glutamyl-phosphate
                     reductase/acetylglutamate kinase"
                     /transcript_id="XM_027627850.1"
                     /db_xref="GeneID:38737989"
     CDS             join(611664..613641,613679..614349)
                     /locus_tag="MRET_1223"
                     /codon_start=1
                     /product="N-acetyl-gamma-glutamyl-phosphate
                     reductase/acetylglutamate kinase"
                     /protein_id="XP_027483999.1"
                     /db_xref="GeneID:38737989"
                     /translation="MRAWTVSGRCALRRLGSRRIPSAGVACRSLYASRAMHTQSPALR
                     ELSGDRETIVRLLYSIASKNEVERYLRIFSTANKFAVIKVGGAILTNELDDLALSLTF
                     LHRVGLYPIVLHGAGPQLNEILEREGVVPDYSDGIRITDAATLRVARRVFLEENQKLV
                     EKLESLGSRARPIPLGVFSASYLDQERYGLVGKIERVDKEPIESAIRAGCLPILTSLA
                     LSEDGQILNVNADVAASELAKVLEPLKIVYLNEKGGLFHGRTGELIESINLDEEYDAL
                     MKEEWVKYGTKLKLREMKELLDHLPRSSSVAIISVDQLQKELFTDSGAGTLIRRGYKL
                     FRASSIEDAGSERLRSMLREYDQDVRENRKSVSQIFSELSRSPYTVYGDEGMNCIAFV
                     SHPPNEVPVLLRLVITRDAVMNNILDNVWAMIRKDYRRLVWTARADDENRAWHFEHAD
                     GSFTRNRRSLFYYGIQDVGEVEQTMRELERLGRIERAYLPLNMRRTTDAQQKRGFTSW
                     ARVSSVRPQLASRAYEALQQRTYATAAPKRVALVGARGFTGRSLVQLINEHPHLELSH
                     VSSRELAGLPLQDYTKGEVFYANMGPEDLKKLESGRADVPPPDAYVMALPNGVCRPFV
                     DAVREGGEGKPQGHGVIVDLSADHRFDEAWTYGLPELYSREAIRNAKLIANPGCYATN
                     MQMLLAPLLPHTDLSRLPTVVGISGYSGAGTKSGGRPAPGERPVTLPKLDPASLNGAV
                     RPYSLTDHIHEREARYHLSTLVSQGSQVQVAFTPMVAPWFQGIISTAIVPLATKLSAR
                     DVKQLYEDKYGHEKLVEILPRVPEISDIALKHGFKVGGVQVHSSGDHVVVVGVIDNLL
                     KGAATQCLQNINLALGFDEHAGIPWP"
     gene            <614463..>615374
                     /locus_tag="MRET_1224"
                     /note="MRES_04875"
                     /db_xref="GeneID:38737990"
     mRNA            <614463..>615374
                     /locus_tag="MRET_1224"
                     /product="ER-derived vesicles protein"
                     /transcript_id="XM_027627851.1"
                     /db_xref="GeneID:38737990"
     CDS             614463..615374
                     /locus_tag="MRET_1224"
                     /codon_start=1
                     /product="ER-derived vesicles protein"
                     /protein_id="XP_027484004.1"
                     /db_xref="GeneID:38737990"
                     /translation="MSYGHSAFVPPSHMNQNMYGMPPSSSYNTSWLDKLKSLSSSAED
                     LMDSLSQPIRPYIPAIGRFLIVVTFLEDVLRILTQWSDQVSFLHKYRNMPLFIVYVFL
                     IINVVFMTVASCLVIIRRMPELSIGALLCVIVLQGIGYGLITEPNFFLRNLSVVGGLL
                     MVFTESLASRRRNLFAGLPSISETDKKIYYQLAGRVLLIFLFIGFVLRGEWSLFRVLV
                     SLLGFCACVMVAIGFKARWSAMFLVLLLSVLNIAVNNFWTVHSALPQRDFLRYDFFQT
                     LSIVGGLLLLINLGPGGLSMDERKKVT"
     gene            complement(<615488..>616402)
                     /locus_tag="MRET_1225"
                     /note="MRES_04880"
                     /db_xref="GeneID:38737991"
     mRNA            complement(<615488..>616402)
                     /locus_tag="MRET_1225"
                     /product="phosphatidylinositol transfer protein"
                     /transcript_id="XM_027627852.1"
                     /db_xref="GeneID:38737991"
     CDS             complement(615488..616402)
                     /locus_tag="MRET_1225"
                     /codon_start=1
                     /product="phosphatidylinositol transfer protein"
                     /protein_id="XP_027484005.1"
                     /db_xref="GeneID:38737991"
                     /translation="MLHLFGRKNSVKEHEKEIDPATATSEVILTPPAHCRLAPPKPKN
                     PGDDEKAREIEQYVAEYRAAHPCPPDYEKFEQRWFSEPSLWHRYLRSTHGDVKHSKKR
                     AIETLEWRRDYKPDIIPPDEVAPEAETGKHVLTGFDKESRPILYLRPGRENTKPSPRQ
                     IRYMVWTLERAIDLMAPGQETLTIIVDFYGAHFSSMPSLGTARHVANILQTHYVERLG
                     RALVCHTPRFISAFFTALSPFLDPVTKDKIRFNPDNLTEFIDPDQLDAQFPGGTYNYQ
                     FDFPKYWSALVERCNVAPDGTRKNMEAQ"
     gene            complement(<616548..>618314)
                     /locus_tag="MRET_1226"
                     /note="MRES_04885"
                     /db_xref="GeneID:38737992"
     mRNA            complement(<616548..>618314)
                     /locus_tag="MRET_1226"
                     /product="serine/threonine-protein phosphatase 2A
                     regulatory subunit A"
                     /transcript_id="XM_027627853.1"
                     /db_xref="GeneID:38737992"
     CDS             complement(616548..618314)
                     /locus_tag="MRET_1226"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 2A
                     regulatory subunit A"
                     /protein_id="XP_027484002.1"
                     /db_xref="GeneID:38737992"
                     /translation="MEADEQLYPIAILIDELKSDDVTLRLNSIHRISTIALALGPERS
                     RDELIPFLHESLDDEDEVLLALAEELGTGLVEYIGGPQFAHLLLGPLENLAVVEETVV
                     REKACDSINQLAGIMSDQQIQTFYLPLLHRLSSGEWFTSRTSAALLFASVYEKIPLSM
                     RADVHSMFVSLCTDETPMVRRAAARDMSALVKRMSPEVIINEMLPLYRRLSADDQDSV
                     RLLTVQNLVAMAEVLSPAETQQLLLSSICGAFQDKSWRVRYMAADNFVQLATAVGEDV
                     VKEDLVPAYINLMRDAEAEVRTAAATQLPGLAKLLDQNTIIERLLPVAKELADDPSQH
                     VRGALAAQVSALAPLLGKDATTEHLLPLFLQLLKDEFPEVRLNIISRLEQVNEVIGID
                     LLSQSLLPAIMTLAEDKQWRVRQAIIENIPLLAHQLGVEFFDEQLSGLCLSWLGDTVF
                     SIREAATVNLKKLTEVFGVEWARQSIIPKVLQMSSHPNYLYRMTTIFAVTTMTQSLDP
                     DTIINCILPSLLNMVQDPIPNIRFNVAKAFEVLIQELKSSSVGIQTVQEQIVPALQAL
                     SDDPDADVRYYAQKALVAAQDM"
     gene            <618512..>622321
                     /locus_tag="MRET_1227"
                     /note="MRES_04890"
                     /db_xref="GeneID:38737993"
     mRNA            <618512..>622321
                     /locus_tag="MRET_1227"
                     /product="DNA polymerase zeta"
                     /transcript_id="XM_027627854.1"
                     /db_xref="GeneID:38737993"
     CDS             618512..622321
                     /locus_tag="MRET_1227"
                     /codon_start=1
                     /product="DNA polymerase zeta"
                     /protein_id="XP_027484003.1"
                     /db_xref="GeneID:38737993"
                     /translation="MPTGEPLALYLLHVEHTLQQPCDLDTFQSPFGTNGRLERVPVLH
                     AFGAMRDGTRCCVHIHNVFPYCYVEYRGALDEHAVQAYTKRLARALNAAFATSLPPSL
                     VQPQHQYIAAIHLCKAKLFYGYHDRWSYFLKISYTNPALRMRLSTFLEQGRAMHTFQP
                     YEAHVQYHLQWMLDYKVFGCDWVFFEHAISLPRSTSCRVEVHAQAHDILNRRVNHASD
                     SQASQSSFQDDPVVPSLRALWKQYRERRAQYDMGPPPSLTGERSVDASDRAWDATSRM
                     LCQWEDRVRQAPAGPASPPPLDAHVPAAYDTVELFHETRPSTAHVETCSSSTLTPSSL
                     VVPSTPSMNSSAPISTPRPRIKSRRATSSLFLFHAPPLSCAELDQTWSQYNLLPIEYQ
                     TCHYTSTADVPRHHGFSTALDGLEAFRGRSPRLSRAVGRIPRWQWAHAPPSHAQVSAW
                     LAPERGTQPMILATPNSQESGPSEKKYLSTLCIEVLVHTQGDHVPNPQHDPISCIAYS
                     WMEEADNSATGYVYSSGVLLVSEEHVKLALPILTVPSERALLDTLISLVRSWDPDILA
                     GYDLSRSSWGLLANRAQAAHGIDMAQELGRMYGAKDYCGRSVLNVWRLMSTHIALSQY
                     TLEHVVLHVLHERSPVYSWATTATWMQSRQATDRERALSYALRRVKYCALLLAKTEVL
                     LRTAEFARMYGVDFFSVLSRGSQFRVESVVLRITKPRSFMLPSPSRAQVGRQNAPECI
                     PLVMEPLANMYHSPVIVLDFQSLYPSIMMAYNICYSTCLGRIAPFKGTYKLGFTDYTP
                     DEHTLRALRDDVYLLPNGLAFVKPHIREGVLPRMLREVLSARVMTKHTLRVMHMHRGM
                     QKRLQAQQLALKLLANVTYGYCGATFSGRMPCVEIADSIVQAGRETLEHAMSLVERTP
                     EWGAELVYGDTDSLFVHVPGRSKNDAFRIGREIAERVSALHPAPVLLRLEKVYQPSLL
                     VSKKRYAGYRFDSPQQARAVLDVKGLEMIRRDGHAVQRRLQEACIRLLFETRDLSAVK
                     RYCQRQWTKLYAGQISPHLLIISRQVRLVYASQASLPPGAVVAMRQHRLFGLAPHDGE
                     RVPYLIVHGAPASKLQDLAIAPSELSTYPLHMEYYVQRTILPVLDRILGLVGVNVYAW
                     HDAMPRTSNTRASWSLAPSCHVCGYNGPDDICVDCLRNPETSMYRATCALYAAEARQL
                     GLYSMCTTCAHTKEQPPCKAYDCALLYARAEQERRIRVLSTLPARLEKAWLAEPDELP
                     QSDAWTW"
     gene            complement(<622322..>625084)
                     /locus_tag="MRET_1228"
                     /note="MRES_04895"
                     /db_xref="GeneID:38737994"
     mRNA            complement(<622322..>625084)
                     /locus_tag="MRET_1228"
                     /product="phosphatidylethanolamine N-methyltransferase"
                     /transcript_id="XM_027627855.1"
                     /db_xref="GeneID:38737994"
     CDS             complement(622322..625084)
                     /locus_tag="MRET_1228"
                     /codon_start=1
                     /product="phosphatidylethanolamine N-methyltransferase"
                     /protein_id="XP_027484008.1"
                     /db_xref="GeneID:38737994"
                     /translation="MTTHSSSFDELHATDGIRRRPAANVKANDPTNATPGGTDKDEKR
                     DEAPRTTELVLGRTPDGQLFRVVETRDMVKSVFHPQHPKTLLDLVLLGLLLCQVFLYC
                     ILTREQAQTFFLVYFAIWRITYNGGLGYILTKQSQTRWIVRFVERRGWLDAKKAPRMH
                     AWIHSFYKTKLGAAYDMTCMPNEFNVWILFRSLVDVILLNDVTAYALFSLSHVQGLGN
                     YGMLLFVVRWCIGLLLLAFNAWVKLDAHRVVKDYAWYWGDCFFLCLQNLKFDGVYEVA
                     PDPMYSIGYIGYYGLSLLTGSYMVFFVSLAAHALQLLFLVAFENPHMDRVYGERVPIA
                     ARVSEQEHSTKATPPDAPRTNAHDLHHRLFHGDNVIFSHMDLFRSSDFLLVLCVAYAV
                     APVVLVHCSHTTLLVISVAHALAWRLFHSFGLGLALRWQSEQRWVVHHFLKHYHFEDG
                     DAAVKEAFTNWKAIYNTSLIMTYTSFALMSLCSYMTWTDELYKLRYVLGVLLILLHIW
                     SARSSYRVLGPFGWLYGDFYIDAYPKRLSYTGIYRFLNNPERSMGSAAIFGMALLSGS
                     LSAIVVAAISHMSHWWFLSCVEGPHMRRVYGADVRKDSGVTKQLKQLGRSQWLSVAQP
                     SVHELENALKKAQGLMGQFFDKSRPHMEHIVDQARTLLQQKTEHILTMRTGDSVRDID
                     QAKYHVSPIASKHTKEQRFHIGEPIVTQWAAAHNHSRRDWIGIYPVEALHTDERHGHM
                     LVTRTRSRGKWLGIAEAEWDGPVHLGTEQGSLGTKGVSNVDMDKRQVHGVSVFQGSRL
                     PWTPGTYEMRYHHDNTHDVLARSERFTIYVDTPADPMSFDETYMILAKIVRFALVDSS
                     PAIDAYESADKDDLTLWTQDQAKNIAEGIKQAFHVDFSKDVIVACANTTILTKDILTA
                     RALLAR"
     gene            complement(<625278..>626067)
                     /locus_tag="MRET_1229"
                     /note="MRES_04900"
                     /db_xref="GeneID:38737995"
     mRNA            complement(join(<625278..625740,625779..625789,
                     625854..625940,625969..626020,626060..>626067))
                     /locus_tag="MRET_1229"
                     /product="2,3-bisphosphoglycerate-dependent
                     phosphoglycerate mutase"
                     /transcript_id="XM_027627856.1"
                     /db_xref="GeneID:38737995"
     CDS             complement(join(625278..625740,625779..625789,
                     625854..625940,625969..626020,626060..626067))
                     /locus_tag="MRET_1229"
                     /codon_start=1
                     /product="2,3-bisphosphoglycerate-dependent
                     phosphoglycerate mutase"
                     /protein_id="XP_027484009.1"
                     /db_xref="GeneID:38737995"
                     /translation="MVGTLILTRHGQSEWNKLNLFTGWKDPALTELGEAEALKGAEEL
                     KKAGYTKFDQAFTSDLQRAQKTLQIQLKAIGQEGISITKDQALNERDYGELTGLNKDD
                     ARKKWGEDQVHIWRRSFDVPPPGGESLKLTADRVLPYYREHILPLVKAGKSILVTAHG
                     NSLRSLIMDLEHMSGEEIVKTELGTGVPIVYKIDEEGKVLDKQILQ"
     gene            <626386..>628030
                     /locus_tag="MRET_1230"
                     /db_xref="GeneID:38737996"
     mRNA            join(<626386..626412,626458..626610,626648..>628030)
                     /locus_tag="MRET_1230"
                     /product="zinc finger protein, GATA type"
                     /transcript_id="XM_027627857.1"
                     /db_xref="GeneID:38737996"
     CDS             join(626386..626412,626458..626610,626648..628030)
                     /locus_tag="MRET_1230"
                     /codon_start=1
                     /product="zinc finger protein, GATA type"
                     /protein_id="XP_027483539.1"
                     /db_xref="GeneID:38737996"
                     /translation="MAPKLKIAVGDDTSFTKEQNPFTIMKNVQLLSRLHGILEMSERL
                     ENASWRLWHTQYEKQRKSQSTSKRWIEFQKLPSLSFPSPSDPLSSSTIPITHGSMDVP
                     QLALSAFAEKCNSQKLDMPTMCESTNLLQQRVHEYPHVSQSIPDSVPIKQHLSSADLL
                     QLNPFESTTQVCGMQGCNVYAGQDLLMQALASASSELSGEAPIGTLMNKDPLTENEPT
                     HTTFVSKPSDERNAWKEKNAKLNPEASTEKPNVDVEPEELPICSNCGTNNTPLWRRNH
                     NTLLLCNACGLYLKIHKTHRPLMLKKRHQSGNSSRTHSREGCYGPASTGCTNCGTKVT
                     PLWRKGLGGALLCNACGLYLKLHHVNRPVRYRADFIRKRSRFDHKEKQSQPDSPVAHI
                     ESLGSLNDHVNHSYGQTWPSSSPSLQGLDSNDYSIVAPCPDRCDSVSEAKLVLNMSEE
                     LLSSPVSIECCASENCTGPVLLNDPSLFEYSNQDARMVDLDLLAMDNDALMSPALPDS
                     DKHSLWPVYPPL"
     gene            <628662..>630794
                     /locus_tag="MRET_1231"
                     /note="MRES_04905"
                     /db_xref="GeneID:38737997"
     mRNA            <628662..>630794
                     /locus_tag="MRET_1231"
                     /product="protein of unknown function (DUF2841)"
                     /transcript_id="XM_027627858.1"
                     /db_xref="GeneID:38737997"
     CDS             628662..630794
                     /locus_tag="MRET_1231"
                     /codon_start=1
                     /product="protein of unknown function (DUF2841)"
                     /protein_id="XP_027483939.1"
                     /db_xref="GeneID:38737997"
                     /translation="MPRIPVRVEPYSSPSKQHRHYKSKRDQVLRSLGKAAYINGSQFA
                     LLLVSARGDVETYASDALQGHLDTWFVKSGIADEARQLAQKSHDENHPHSPTFDADEE
                     LTENVEDVCASASASSVPKATDDPFLDSWNSLPVGTPKLERNADEWDNVLKQEIVSDD
                     NHSLMESKADTYSPQPIALPQTSTPIHPSSNTPLPSSRTPMHTAQPGYTLELKDENAR
                     TEFIELRFSQLQQVMCKMIAKEWVKVIEPKKQTRFPYNKGDAGKPTWWPADVRHKEPD
                     HLMKPERHALLLAILRSPQTRIARLQLATAEVIALIKAGKVTYLMDVYRVAREEERLR
                     DEGLDPNSPITVSVSSLEGWDAANGCASRTAVGSSIKMIENTRSKEWKVERRASSRFD
                     EDETSEMRSTMSWTPATQRSYPSNVSSIMQNFAQLPNHMSPHGMDHRTAVEMPSKLGL
                     TTNVPQDPAIFSPSMSTDTQPQRASFHGLGVTVPHVQSPLNAVRSTPAASSENVDIPR
                     SASVSYPVTSVPMRPAHSSPANFNQPENWMDMRYAQRAVPHMHFEHSTHHGMDMKTLP
                     THQQPRPPWEFQIPGTPYHQPPQASLWAPMPETPIHRSHPVMPMHMGMNTSPTHDVMV
                     SNSFDSSFSSSHLGPVTPAQAPFVFMNGPAASYPTTKSPPVNHAMTFQDFGLSQVPSP
                     SQDIHSVQAKQHGQYASFTSAPMDWSTR"
     gene            complement(<631010..>631518)
                     /locus_tag="MRET_1232"
                     /db_xref="GeneID:38737998"
     mRNA            complement(join(<631010..631317,631347..631461,
                     631492..>631518))
                     /locus_tag="MRET_1232"
                     /product="ubiquitin-conjugating enzyme E2 N"
                     /transcript_id="XM_027627859.1"
                     /db_xref="GeneID:38737998"
     CDS             complement(join(631010..631317,631347..631461,
                     631492..631518))
                     /locus_tag="MRET_1232"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 N"
                     /protein_id="XP_027483941.1"
                     /db_xref="GeneID:38737998"
                     /translation="MALPKRIIKETERLIADPAPGIKATPHEDNLRYFDVEMAGPSQS
                     PFEGGTFKLELFLPEDYPMAPPKVRFLTRIYHPNIDKLGRICLDILKDKWSPALQIRT
                     VLLSIQALLSAPNPDDPLSNDVAEHYNTNEKDAIETSRQWTRQYAMK"
     gene            <631703..>633076
                     /locus_tag="MRET_1233"
                     /db_xref="GeneID:38737999"
     mRNA            <631703..>633076
                     /locus_tag="MRET_1233"
                     /product="Wiskott-Aldrich syndrome protein"
                     /transcript_id="XM_027627860.1"
                     /db_xref="GeneID:38737999"
     CDS             631703..633076
                     /locus_tag="MRET_1233"
                     /codon_start=1
                     /product="Wiskott-Aldrich syndrome protein"
                     /protein_id="XP_027483940.1"
                     /db_xref="GeneID:38737999"
                     /translation="MPPSVFSSSEKTLIKSVFPSSSYKIITVSPARIYAAYPTPDRWY
                     YLGVEGALAFVRDAKNTFHFKLVDLASTGTISWDHELYDDFYFYEDKPYFHTFAGDHC
                     MLGLCYADESSAEQMYKKVSNRSKYMKSSSGLSGFGLAKKLTNFMSSSSSDDRKSKSH
                     VSEDTKLEAGLVAQLSNMGVSESDIRSNEGFIRDFLGHGAGNAASAAEGYTGRLPPPI
                     TDTLSMRHAPPPPPSAASTSSSAAVPRLPTRNVSSTAVPPPTPPISTRPSLPPAPPAR
                     PSAGTSTAPPPPPPPPVGGRIPPAVPSRPSLGGRGPPPPPPTRPSAVVGVPPAPPAPP
                     APPAPPAPPAPPAPPAPPTPSAPPAPPAPPAPSCAPSGVSGLPPPQPGRDALLASIQG
                     KSVKDLKKTDSSVPSPIPTGGSPQSSTNTGTNGGGMDLASALSSALNKRKDNMGRSDG
                     EESDDDW"
     gene            complement(<633308..>634690)
                     /locus_tag="MRET_1234"
                     /note="MRES_04915"
                     /db_xref="GeneID:38738000"
     mRNA            complement(<633308..>634690)
                     /locus_tag="MRET_1234"
                     /product="elongation factor 1-alpha"
                     /transcript_id="XM_027627861.1"
                     /db_xref="GeneID:38738000"
     CDS             complement(633308..634690)
                     /locus_tag="MRET_1234"
                     /codon_start=1
                     /product="elongation factor 1-alpha"
                     /protein_id="XP_027483943.1"
                     /db_xref="GeneID:38738000"
                     /translation="MGKEKQHVNLVVIGHVDSGKSTTTGHLIYKCGGIDKRTVEKFEK
                     EAAELGKGSFKYAWVLDKLKAERERGITIDIALWRFETPKYNVTVIDAPGHRDFIKNM
                     ITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLSFTLGVRQLIVAVNKMDSTGY
                     SEERFNEIVREVSNFVKKVGYNPKTVAFVPISGWNGDNMIEATTNMPWYKGWEKETKS
                     GKVTGKTLVDAIDAIEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVV
                     TFAPSNVTTEVKSVEMHHESLAEGLPGDNVGFNVKNVSVKDIRRGNVASDSKNDPAQE
                     SASFNAQVIVMNHPGQISNGYSPVLDCHTAHIACRFNNILQKIDRRSGKVLEENPKFI
                     KSGDAAMVEMIPTKPMCVESFNEYPPLGRFAVRDMRQTVAVGVVKTVEKSSGKGGKVT
                     KAAEKASKKK"
     gene            <635094..>636593
                     /locus_tag="MRET_1235"
                     /note="MRES_04920"
                     /db_xref="GeneID:38738001"
     mRNA            <635094..>636593
                     /locus_tag="MRET_1235"
                     /product="RAT1-interacting protein"
                     /transcript_id="XM_027627862.1"
                     /db_xref="GeneID:38738001"
     CDS             635094..636593
                     /locus_tag="MRET_1235"
                     /codon_start=1
                     /product="RAT1-interacting protein"
                     /protein_id="XP_027483942.1"
                     /db_xref="GeneID:38738001"
                     /translation="MSRRGGAAWQRAPVHSYVTPRTYAQMVHDTNNSSSPPIISQPPP
                     LAVLGRPTTALPPVSVQQPVLMATFSYDENRSLCFNNSAKRWYKMPPTRENSAQGADL
                     NVGFERYQEKPHVPDPLDSVLYTIMHQSRAGISQEEAVQGKLSVPADSLEHEMLRAQV
                     VTWRGILTKLCTAWSCHVEAPTMFREGFELNVMMLGDTLIMEEVPPTIFQRQNMQSGR
                     PKSRRSQLSSYYGYSFESYCTKSRPGYAQTCGPPGWSGDVNTNVQWGHIVKTKLGHTR
                     IIIGGEVDCVETLDAGTDHEREGVVELKTNLQIQSAEDQNRLDAKMLKMYMQSFLLGV
                     RSIVIGFRDQQGTLLSHSMYRTADLPRMVRGHTAEWNANDNLAFGAAMIDFIRHVVRA
                     ETERWFFHFAQRVRRNEHMFGPYAWRVHRSTSAFLAHLPLPALQDAEQEYPVFRIRFE
                     PPFSHVTIRYVPPSELAMDGRRQARCGLVPSDFYTWATEPMAHLLRDEI"
     gene            complement(<636648..>638177)
                     /locus_tag="MRET_1236"
                     /note="MRES_04925"
                     /db_xref="GeneID:38738002"
     mRNA            complement(<636648..>638177)
                     /locus_tag="MRET_1236"
                     /product="solute carrier family 30 (zinc transporter),
                     member 1"
                     /transcript_id="XM_027627863.1"
                     /db_xref="GeneID:38738002"
     CDS             complement(636648..638177)
                     /locus_tag="MRET_1236"
                     /codon_start=1
                     /product="solute carrier family 30 (zinc transporter),
                     member 1"
                     /protein_id="XP_027483945.1"
                     /db_xref="GeneID:38738002"
                     /translation="MGLDNQAKIIILLGIDIVFFFIEIISGYAVGSLALVADSFHMLN
                     DIMSLVVALYAVRLVKKGGKSPQYSYGWQRAEILGALFNGVFLLALCFSIFMEALERL
                     VAKPQVSNPSTVVIVGSLGLLSNIVGLLLFQGHAHPHSHSHGHDHSHAHAGSDHHHDI
                     ESGVVHDHDHDQHDRKHEHDDRTTEFNKNVGDIVGHPARARAFVMNQAHSLGYDNTAS
                     KSGDGESQQLLSPQYATNSYGAAGSSSHDHATGTRRLSQADATTEEEVRRHRQSMALN
                     GGHSHGNMNMKGVFLHVLGDAIGNVGVIFVGAFILFTHYSWRHYADPVISFIIACIIF
                     QSALPLVKSASFILLQGVPTTVSLGGVRDSVLRIEGVLSVHDLHVWQLNENKNVASLH
                     IMVDCSGEQTDRYMHIADQVRRTLHIWGIHSSTIQPEFVPGGLNEAAKLSGVAVASKN
                     RFDEHGHLLTPDGHRVKEEIAERDMACLLACQEEECRDAKCCDGAAPNHVKSSSSKTS
                     S"
     gene            <638707..>639372
                     /locus_tag="MRET_1237"
                     /note="MRES_04930"
                     /db_xref="GeneID:38738003"
     mRNA            <638707..>639372
                     /locus_tag="MRET_1237"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627864.1"
                     /db_xref="GeneID:38738003"
     CDS             638707..639372
                     /locus_tag="MRET_1237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483944.1"
                     /db_xref="GeneID:38738003"
                     /translation="MSQADAGAAQARPAILPRIDATRCLVQADHLIASIHEVVRQIGW
                     FLERRAQLVRERRPPQDGIPALSPLMQACRAYYENVSTLSDQLLHAQTQLEHLLAQAH
                     APVSTERDATVLPRPEPMPLDLYGMMFPLGLQGEDVKPLLSAESAVGVSDDTHEPSPS
                     SDAKRRKTDDDGVPLDTGASPETSQPSARDMLDFSWLDFASTDKSTPASDILSFPMDG
                     SAP"
     gene            complement(<639369..>641318)
                     /locus_tag="MRET_1238"
                     /note="MRES_04935"
                     /db_xref="GeneID:38738004"
     mRNA            complement(<639369..>641318)
                     /locus_tag="MRET_1238"
                     /product="hypothetical protein"
                     /transcript_id="XM_027627865.1"
                     /db_xref="GeneID:38738004"
     CDS             complement(639369..641318)
                     /locus_tag="MRET_1238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027483947.1"
                     /db_xref="GeneID:38738004"
                     /translation="MPPTAFRAAYEALLAGEHPWDAGDGERSQRVSEKANAAPRAQYL
                     ADILSMPVERATILDLLAGVSPTELLDDRYARRRDNITALWKEALRVWVEGDEALVPH
                     AMDTLEALACALLPKAYTNFTLDVITLLAGRMDEADDVFYALMSVIDRTLRTAPGPQQ
                     HCALRLAVVVAAYTSSSSLSTYLLHRDLFAAAMQAMLAASSTMRCEIALLTALLATAG
                     HVHGAARSLDVDVPTAVLSFAIMQPYQRRLRDTQDPTLLAQACSEGLTRMLEAYAPPD
                     HSIWHDWMGHAPSQATLPPPCAWLLLAVWVWLLSNDAFGHAVFETDTPLVVPLLSVAS
                     FVLTHAASHARATTYAHTTLQILLGLLGPTDTSTPAHRLLVDEDTLPTPLVERIVQCR
                     DKPGALPLAPHTGTKRPRRLVVPILHNVTLFLTYNRSKRLDVPSFRTALIIVQRVALL
                     CAKHRIQLEYDWLEVWRAILATADFVVARQAQLSRECILALAPCLLETLAIVLVLSDR
                     CLQTPAEIHWLVYELARSRHTLEKLVPMAGAARHTHWALLADMLQCIDTQLAQRDAAR
                     SSPSFMTLIPFFRRDQTEEPVSMRSILQIIQRLDLEALLAADKPVCAAITRAAYASSA
                     SKRSSVVPSPSATLLRIVQLDWLQS"
     gene            <641360..>642703
                     /locus_tag="MRET_1239"
                     /note="MRES_04940"
                     /db_xref="GeneID:38738005"
     mRNA            <641360..>642703
                     /locus_tag="MRET_1239"
                     /product="transcription initiation factor TFIID subunit 7"
                     /transcript_id="XM_027627866.1"
                     /db_xref="GeneID:38738005"
     CDS             641360..642703
                     /locus_tag="MRET_1239"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 7"
                     /protein_id="XP_027483946.1"
                     /db_xref="GeneID:38738005"
                     /translation="MSSSGPPRIRAHFHKPRVRLNFSRNAAGAAVTGDGPKTRPYMQG
                     YDRELDSEDDETGEGMAFEEQLILRVPDGPGEHGELDALRQAIRRRGEYDDVWFKFKD
                     ARRAVFHIGRQLYAAKLVDLPCIVESHKTLDNKQMFKIADISQMLLIERPIADEAEAT
                     AQSSHKSSNDDYIYPHGITPPMTWVRKRRFRKRVHNRSIDTVEMEVETLLNDDKRADR
                     VEYEFIDPALADQMEQDIAQQKLHAHAERTASDEEHKPEDESRAHAEAEEEEDDDDDD
                     LNVDQDLAAELDAALAREQGAEQNDSASDAGAESTGDSDLEDLWDDDDEDQADGEEDV
                     PKSDKEDDDDDDDGEEEAERRVRESQLEAECREIETLIKRKQHDTESTMNTLIKSRHQ
                     QALRKLQVEHESKKRLLGDLKHIRRTRREERAAHARSQQDAHAEASTDPSPTEAS"
     gene            complement(<642728..>643525)
                     /locus_tag="MRET_1240"
                     /note="MRES_04945"
                     /db_xref="GeneID:38738006"
     mRNA            complement(<642728..>643525)
                     /locus_tag="MRET_1240"
                     /product="DNA-directed RNA polymerase III subunit RPC5"
                     /transcript_id="XM_027627867.1"
                     /db_xref="GeneID:38738006"
     CDS             complement(642728..643525)
                     /locus_tag="MRET_1240"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC5"
                     /protein_id="XP_027483544.1"
                     /db_xref="GeneID:38738006"
                     /translation="MAQDEAAAAEPVVSLPVYVSASVPPSSRLELFQYPLYARGRPLP
                     VPATAAQRGQRVTSRWRPHANRVEMEIPLDMRETVYNHDRGMEWAENSASMGVIPTPG
                     ESTVKQEDRAMDAPSRFDRMRLESHAVPNATHYMVGTVRDGELHLVPLDAVLQLRPSM
                     QHVDLMSQAEDQNRRMPTSDDEGDAQDARRAHVVPLNVSMRTEAQARTALTPRFGAQA
                     SSGLATQRDAEAERWVDLRFSEAQGADQLLAQQREPLACTTHIRDLF"
     gene            <643646..>644305
                     /locus_tag="MRET_1241"
                     /note="MRES_04950"
                     /db_xref="GeneID:38738007"
     mRNA            <643646..>644305
                     /locus_tag="MRET_1241"
                     /product="nucleoside-diphosphate kinase"
                     /transcript_id="XM_027627868.1"
                     /db_xref="GeneID:38738007"
     CDS             643646..644305
                     /locus_tag="MRET_1241"
                     /codon_start=1
                     /product="nucleoside-diphosphate kinase"
                     /protein_id="XP_027483545.1"
                     /db_xref="GeneID:38738007"
                     /translation="MFVRAAAMTSALRGAARAFTTASAAPVSRAVPLTVAATVGVAGL
                     SLYSLPSVQLEGPRTIAGEYQTANERSFIMIKPDGVSRQIVGKIVDRFESRGYKLVAI
                     KSVVPSEQLAKEHYSDLASRPFFPSLVKYITQGTPVIAMVWEGKDVIRQGRRMVGATK
                     PLEADPGSIRGQYAVSVGRNIIHASDGFDSATKEIGLWFNESELASYEPCTWGQIMAD
                     N"
     gene            complement(<644311..>647274)
                     /locus_tag="MRET_1242"
                     /note="MRES_04955"
                     /db_xref="GeneID:38738008"
     mRNA            complement(<644311..>647274)
                     /locus_tag="MRET_1242"
                     /product="exosome complex exonuclease DIS3/RRP44"
                     /transcript_id="XM_027627869.1"
                     /db_xref="GeneID:38738008"
     CDS             complement(644311..647274)
                     /locus_tag="MRET_1242"
                     /codon_start=1
                     /product="exosome complex exonuclease DIS3/RRP44"
                     /protein_id="XP_027483546.1"
                     /db_xref="GeneID:38738008"
                     /translation="MVIRVQKRASTAGEVAASTFKFHRKTARGKVRAVVRETYQRDDV
                     PCGCIACEACASFVEHGTPPPILDQHGTQNTYTRKKHYVVVDTNVILHQMDVLESPVF
                     TNVIIMQTVANEVRNHSMPLYNRLRTLLMDPDRRFWLFYNDFHQDTNVVRFADESPND
                     RNDRAIRQAAAYYTAHLRTHALPGHADTTVIVSEDVENVHKARVEGLEACSVREYITG
                     FQNAEQLSDLLSARTVDENRAPRGSRVFDEYWPTTQLEAGYKAGTLHKGFFNANAYNF
                     LEGAVRSEALSKPILLQGREAMNRAVDGDVVYVALLPQSEWKGASDAVLEAESAQRND
                     DARDSDNEDEDVGLEAQPESSGGDTQPTGRVVGIARRNWRSYVAHIDASSVNERALAT
                     LGPQTLFASPVDRKIPRIKIRTRQAQALLGCKILVTMDEWKSTSRYPEGHFVRSLGAI
                     ESKEAEQESLLLEFDVPYRPFSKSILACLPSEGDHWTVPPKGEQDARSLAIWRDRVDM
                     RAENICSIDPPGCQDIDDALHAKRLPNGNIEAGVHIADVSFFVRPDTPMDAEAASRGT
                     TVYLVDRRIDMLPHLLGTNLCSLRPFVERLAFSTVWELTPSAEVVNVRFFKSVIASKA
                     AFTYEEAQNRKDDLSLNDAITESIRLLNDMAIKLRRGRMEAGALNLASPEVRIHLDSA
                     ESSAPIDVEQKEMRETNSLVEEFMLLANTSVARRIYEAYPTTGVLRRHAPPPADNFET
                     LQDILKKRRGMDLDVSSSGALAASLDRCADTRDPAFNTLVRILATRCMLSAEYFCTGS
                     VPRNSFGHYGLAMDMYTHFTSPIRRYADVLAHRQLAAAIQYEPLPSNLYSKHYVDQVL
                     DNVNKRHRLAQMAGRASVEFFVGLAISAKNAEQGVDATKVGQERLLRADAYVVRTFRN
                     GLAVFVNKYGLEGVITFPGECQFDPDEYQVTIPASLSQLGRDVTLGIFDRCTVEIGIE
                     KDRNTKRGRTKMVLV"
     gene            <647672..>651859
                     /locus_tag="MRET_1243"
                     /note="MRES_04960"
                     /db_xref="GeneID:38738009"
     mRNA            <647672..>651859
                     /locus_tag="MRET_1243"
                     /product="sulfite reductase (NADPH) hemoprotein
                     beta-component"
                     /transcript_id="XM_027627870.1"
                     /db_xref="GeneID:38738009"
     CDS             647672..651859
                     /locus_tag="MRET_1243"
                     /codon_start=1
                     /product="sulfite reductase (NADPH) hemoprotein
                     beta-component"
                     /protein_id="XP_027483547.1"
                     /db_xref="GeneID:38738009"
                     /translation="MKETSMQAAWYVAQYAAHHAVAVDMDDMLALSGKSVQRISSAAD
                     VGSVVHELASASTNPEPIAVFMRASPQGLLRLVPHLPALAKLPVVFHVETPQALHAHV
                     LQLRHSGISMVYSSGEPLETEAYALFAHILAAKTHTGALHFFDIVSANNLPSTQASLL
                     QVPLAPEPSELSDVTINGIFSDVNERLGTDIQALRVLGAHATDTVAVMLGAETTKLSA
                     YVPIVSLHLVRPLSARCLVDSIPTSVKRVAVLEHSSKRTTRLPPVLVDVASAFQHVSD
                     RQVPVLVSGLLNELDDSAGPALAGVLASEETASFTLGSEKPQKSEAVVPRTFEHEHAY
                     HTMLEMLFKDRLDIVNAPSDDSHPGASSPEYAFGIVLSHLLKEETLLSRAQRMADDAT
                     TPSPLQKALQAWLSNRRDAAHAEAVQKALEGVASTDAEALRSTNLTQSSRWIIGNDAW
                     AYDAGMGGVHHVISSQRNVNMLIFDSVPYTQRDSVPLHQRKKDIGLYAMNYGNVYVAS
                     TALYSDYTQVLRTLMEADKFDGPSIVLAYMPYLMSNVPALDVLRETKLAVDSGYWPLY
                     RWNPSAGVSGLPVFQLDSVRIRQQLQDFLDRENHLSLLANVRPELPYDLAASQGAALR
                     EKQRVKAKEAYDQLLGSMQGPPLLVLFASDGGGAEKVARRLATRAKLRGLGARVLAMD
                     DYPVDELSSEPNVVFVTSTAGQGEPPQNGRLMMKALAKQPTGLLNEETRFAVFGMGDS
                     HYWPRPEDAGFYNKPGKDLDKRLAELGASRMLNLGLGDDQDADGWQTGYKAWEPQLWK
                     ALGVDSVTVTEAEPEPITNEHIKVASNYLRGTISEGLQDASTGSICETDTQLTKFHGT
                     YMQYDRDTVDERKAAGLEPAYGFMIRVRMPGGVCTPQQWLQLDDVVEKYAGIKSLKIT
                     TRQTVQYHMILKRDMKRAMQGINKSMLDTIAACGDVNRNVMCSPNLHREKVDVVMAQI
                     ARKLSESLLPRMNAYHEIWLDKGTDSSSKLLVGGALQDYEPLYGPYYLPRKFKIAMAL
                     PPRNDVDVFAHDIALIAIANKDHTELLGFNVGVGGGMGVTHSMKATYPRLASIIGFIT
                     VDKVYDVCREILLIQRDTGNRQNRKQARLKYTIDKYWGGADNFRAELERRLGYAFEEA
                     RPFSFESNTDDYGWLQDMNGRWHCTLWLENGRIIDEPGMPFRTGLRELAKFHKGTFRL
                     TPNQHIIVSDINEADKPRIEAHLREYRMDNWEKSGLRLSASACVAFPTCGLAMAESER
                     YIFKLVDKLERIYLANGLKHDEIVMRMTGCPNGCARPWVAEIGFIGKAPGTYVMCLGG
                     GHAGQRLNKIFRESVTEKEIIEILEILIPRYARERLHGEPFGDWVIRAGIIAETTHGA
                     AFYDNVNTGKTLEELAA"
     gene            <652086..>653471
                     /locus_tag="MRET_1244"
                     /note="MRES_04965"
                     /db_xref="GeneID:38738010"
     mRNA            <652086..>653471
                     /locus_tag="MRET_1244"
                     /product="mannose-1-phosphate guanylyltransferase"
                     /transcript_id="XM_027627871.1"
                     /db_xref="GeneID:38738010"
     CDS             652086..653471
                     /locus_tag="MRET_1244"
                     /codon_start=1
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="XP_027483540.1"
                     /db_xref="GeneID:38738010"
                     /translation="MSGTNQEAILGQILTGISDLRREVYRLSDRLDNVERTEPNTPTA
                     ANFSPIFSPARRQSFGVYQSSLDHWTPERSRPHAKSGLSVTQEESQVEPTDPSLNLWT
                     VVPAGGAGTRLWPLSRENCPKFLLDLTGAGRSLIQNTWDRLLPLSGVEKFMVVTGQAH
                     VGAVSEQLPLVPSANLFAEPSPRESMAAIGLAAAVLALRDPTAVLGSFAADHIISGRE
                     AFESSVREAVMAARDGYLVTIGIAPSHPSTGFGYIKLGGKLDIADAPNVQRVEEFKEK
                     PDARTASAYLSTGEYRWNGGMFVVKAQVLVDMMAVYVPELHDGLQKIAKAWDTPERQT
                     VLNEVWPGLPKIAIDHAVAEPASKTGQVAVVPATFGWDDVGDFASLTDLLPAEKNQAR
                     VLGDPSLVVTEGQVGGIVVPASGRKIACLGMDDVVVVDTPDALLVTTRARSQDVKKIV
                     AKCKKNFPELC"
     gene            complement(<653543..>653832)
                     /locus_tag="MRET_1245"
                     /db_xref="GeneID:38738011"
     mRNA            complement(join(<653543..653554,653581..>653832))
                     /locus_tag="MRET_1245"
                     /product="large subunit ribosomal protein L36"
                     /transcript_id="XM_027627872.1"
                     /db_xref="GeneID:38738011"
     CDS             complement(join(653543..653554,653581..653832))
                     /locus_tag="MRET_1245"
                     /codon_start=1
                     /product="large subunit ribosomal protein L36"
                     /protein_id="XP_027483541.1"
                     /db_xref="GeneID:38738011"
                     /translation="MLLRASVPIIRQAVASARVPSLSMMRPIQAQMIQRAMMPQPIVP
                     PLARGMKVRSSVKRMCNHCAIVRRKGRLYVICSKNAKHKQRQG"
     gene            <653959..>657795
                     /locus_tag="MRET_1246"
                     /note="MRES_04970"
                     /db_xref="GeneID:38738012"
     mRNA            <653959..>657795
                     /locus_tag="MRET_1246"
                     /product="Urb2/Npa2 family protein"
                     /transcript_id="XM_027627873.1"
                     /db_xref="GeneID:38738012"
     CDS             653959..657795
                     /locus_tag="MRET_1246"
                     /codon_start=1
                     /product="Urb2/Npa2 family protein"
                     /protein_id="XP_027483542.1"
                     /db_xref="GeneID:38738012"
                     /translation="MSSLSLAACGILTSEQLIQILKRNESSSDSISSGAKSAPKIDIL
                     RSAWADDTMYVPRKVELILDCTLDIMTSSAKAGSRVEPKYLEADYWELLLQVLSTVSG
                     DSDFLHAIVSRHNVLTLVSALSEEPSADAWIKAVPVLTILLPACIRRIGASQIDAVNA
                     CFRDLIKVMAHVDLASMVETCTHMWEAVCKPWASDLALGSNAKKSAKFFVAESLLPYA
                     TARIHTDTTYLAELLDHVAGLSLYGPLALELKASATAIPDSVDLLTSSLCALLPSHPA
                     YDAVLAPLLLHLVKHTSAMHSHAPPAIIRHGALERCLVPLASALLALPDKVPTLLSLV
                     QAIDQSGLYQPGGDDQDTWTTLWTKVLAYTLRDMDATAAGRDTSFSLLHTLWRLCPEE
                     VAHHLTTVWTHAARLSVKMPAFNTALALAHAVLARVSQERRLPWLLDTLCEACESLNK
                     PLSELMQSPILCVQSARAWEESLTKHATIEQAHAMMLDMLSKVRSAQSSMTVCMTYLL
                     CLLVPSFTPLGDQRALLADWAASCMNASDSLVVSVGLELHVRLVQCGYCITSLPCERL
                     SAYLSDAKCDPVLRLSSFRALCCEAEVTGTPPPWNEDALIDLLLAGLHTDMAPSTWDG
                     QVLGLTETDQAPVALWRLITTRWLHIIEQMASDALLDHLVAFMAQTLDAHGMLRTVSA
                     LLLRNAQFFEQKRWQAAVLRYARVSLSGKDALRTVRILTRVPVEYVTRPVALELAPYF
                     WQLDQSRVQDAELKQLLFRWLQAYPHTASFATPLAAYVDSLLKLPQAYLNGAHETMSL
                     SLVRAMLPHAKEASLPIDDWMSLAAASKPSPKQHMARCALAEILPFAVDNRILAWMPT
                     LAPSVESAVAQIHSDMSFESAKELALLFRILAAYLRAHPQSMAPLLQAVDALCSSATP
                     HLAPLAPALLSCIMSVATDKGRFMHMVCAFAMLSSTFSQTSDDLIPQLVAVIETMEVD
                     AYGSTLNALTSLFHTDTTCTLSELVSFLQVIALMFQHAPPRSSRASDKCFSHLVLSLG
                     PMATHFPMLTKPIVEVLFCVCQYRPHMLRPFDVPRILALLGILLGPRLAEPVDEHDAS
                     AIFGGICGVLRSLIRHRKDLIKPCLPHLTEILSQQWRLLSHASSAHTGMAIERQIHAS
                     MPCWLNMVVSPLGLDAAQAFRRVLSELAGKTSVIHVSKKAKPHTPNMNETLAKSMTKH
                     AVYILVAYARCVTMPHTTIAPNLRQEILPGLFALCDICGDFERDAALKSMLDASAQLV
                     FKDIWRQWDAQRYKGA"
     gene            complement(<658543..>660222)
                     /locus_tag="MRET_1247"
                     /note="MRES_04975"
                     /db_xref="GeneID:38738013"
     mRNA            complement(<658543..>660222)
                     /locus_tag="MRET_1247"
                     /product="transporter"
                     /transcript_id="XM_027627874.1"
                     /db_xref="GeneID:38738013"
     CDS             complement(658543..660222)
                     /locus_tag="MRET_1247"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_027483543.1"
                     /db_xref="GeneID:38738013"
                     /translation="MKNQTFEEDQAAQGVNMIEFSEDHNELAAVQVAYARKVHIFNTI
                     INNKIGMTPWQYGLSMVAGLGWLLDNAWLQLVGVIQAQITVEYYRDQYVKDHPYISNP
                     AWLTLALFTGLSIGATFWGYAADVVGRRLSYNATLLICGVFGVAAGGARNFASLAGLI
                     GASCFGVGGTLPVDRMIFLEFLPGHRQFLLTLLSVFWSLGQLATSLIGWGFISRWHCD
                     SHDECMNNTTSAGWLTDNVGWRYLIFTTGAYTLFAFCVRFILFRIPESPKFYLSNGRD
                     AEAIRALYTFAKMCGKPLPEGYLTVASLHAAANEVESPNPEALIEAPSGILSYFKVWM
                     EDIKLNRSHSQAKLPFTQLKPLFSTLPLGYTTCLIWILWLLIGLAYPLFNSFIIAYFN
                     EGQGVGLSGFSSKPYRDFVIVSACGVPGSLLGVWMMTWPRSGQRVAMAIATLLSGVFL
                     FGFTGVSSDPVSQLAFSSILNFMENIMYAVLNCYTPESFPAPLRATAGGIASMLNRAM
                     GVVAAIFKVYTTGYTSFTTAQAPIYTSAALFVCSALLMLALRVDNAARTSI"
     gene            complement(<660541..>662280)
                     /locus_tag="MRET_1248"
                     /db_xref="GeneID:38738014"
     mRNA            complement(<660541..>662280)
                     /locus_tag="MRET_1248"
                     /product="transporter"
                     /transcript_id="XM_027627875.1"
                     /db_xref="GeneID:38738014"
     CDS             complement(660541..662280)
                     /locus_tag="MRET_1248"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_027483550.1"
                     /db_xref="GeneID:38738014"
                     /translation="MTQVPTEEVKQVPTVDHQANDTAIEADRLNVLGDIQKGKLDVST
                     EMEGPIHVEMSAVDDVYLRKVYIMNKIINEHIGMTWWQYGLLMVAGVGWFLDNAWLQL
                     VAVILQPAHDEFKDPNNDYGNQNSAMLTLSLYAGLIVGAAFWGFAADVVGRRFSFNAT
                     LFICGVFGTASGGAKNFYTLGALLACTGVGIGGSLPVDGMLFLEFLPGVRQQLLTLLS
                     VFWPLGQLVTSLIGWGFIATWSCTSDDDCMHLPKNSRGWVEKNVGWRYTLFVTGAYTL
                     LCFFLRFVVFQIPESPKFLISKGRDGDAVRAMQRFAKICGKPLPEGMLTVASLRAAAG
                     EEVNEDALIEEIEDEPDGFMDKIMKPVREMRINLRNSHPAETFTHLRPLFSNFAMGYT
                     TALIWTLWALIGLAYPLFNAFIVLYLGNGDDESISKTYRNYVIISACGVPGCLFATWL
                     VDLPRAGRRGAMAIGTLLTGIFLFGFTGLDGSNSSGKLGFFCAISFTQNVMYGVLFCY
                     TPEAFPAPLRGAADGVGSSLNRLFGMFAAIIKSYQPNSDSATPLYVSAALFIACGLLM
                     ITLRVETAARTSI"
     gene            complement(662427..662535)
                     /locus_tag="MRET_t0019"
                     /db_xref="GeneID:38741213"
     tRNA            complement(662427..662535)
                     /locus_tag="MRET_t0019"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:38741213"
     gene            <662597..>664375
                     /locus_tag="MRET_1249"
                     /note="MRES_04980"
                     /db_xref="GeneID:38738015"
     mRNA            <662597..>664375
                     /locus_tag="MRET_1249"
                     /product="SMR domain protein"
                     /transcript_id="XM_027627876.1"
                     /db_xref="GeneID:38738015"
     CDS             662597..664375
                     /locus_tag="MRET_1249"
                     /codon_start=1
                     /product="SMR domain protein"
                     /protein_id="XP_027483551.1"
                     /db_xref="GeneID:38738015"
                     /translation="MEKQHGSGAGAHLGMSNETEADALIERYASVLDPSLILAIANEP
                     GQSTDEASKILDALVETVPPECVQEKPVSAELTLLFLQQSFPHVAYEKLETLLISSDG
                     DIDMVIDKLYAEDMLAQEPTMPVPKGLDYDALAEGLASKKSKPSNKFKKRTTGPITVS
                     LTDQRSPHHIYYDKRVPRPASKLPDTSVDTFGLTDEEMARKLQNAERDAADAASEPVA
                     DQQWLLASSSLSQLAALLGMSPARIQSLFHQSSFNLHLTFGRAVEAAMISPQAQEAVQ
                     APEFATTCASLASITEETEREIARLLQAAQGHQDAVLDLLQLRNVIREAADGLVDGPD
                     ILDPAGRIGTHRDNAERVTSTQSVHKPVTGSVPHWLPSGDAAFTYAGRASRAGVSRAE
                     AHQPGGITLPASAGRVAMAPAWQDEMDDRVYSSEDCRERAAEYRARRNEALQQAARSA
                     QQSRTSRMGGAAMVYAEEARKYDMEARRWQLRASSALVDQRRLDAQSSGHDSRAADRI
                     DLHGLTVHEALTVVAQHVARWQSTPLGEARSRPPLEIITGRGVHSRHSVSVIRPAIER
                     YLRQRGFRVDTVSNAGALYVKAPTAT"
     gene            <664611..>666530
                     /locus_tag="MRET_1250"
                     /note="MRES_04985"
                     /db_xref="GeneID:38738016"
     mRNA            <664611..>666530
                     /locus_tag="MRET_1250"
                     /product="mitotic cell cycle regulation protein"
                     /transcript_id="XM_027627877.1"
                     /db_xref="GeneID:38738016"
     CDS             664611..666530
                     /locus_tag="MRET_1250"
                     /codon_start=1
                     /product="mitotic cell cycle regulation protein"
                     /protein_id="XP_027483502.1"
                     /db_xref="GeneID:38738016"
                     /translation="MVGTMEMDMNELDLAREVQTLRARRRLSTSHPAAIDPDFAGVQL
                     YDKSPSVHDLPPLPDTPSSVSSGASVPPPSTPTLDDGCPFDEETLSQCSPIFGSSKRE
                     RYLARRQMRQTQAAADPATPPPPPKGPSEGMWLSASMHPEVSPDEFRAFLKAQAERNV
                     HHNLTAHQLDTPSRTRQPAILRRSSTLRRQVKAEESVPEMALHRHSMTEPESVHDRPI
                     VRAESVPPRSPSYHSRVHRKPPPTFSHAMQPPLAPQPTPDTAPQGPRPPSNEHAFMRP
                     ILPPKDQLPEPPPKTVSVPPPRRVVPQVPEAAQPRPRPDEVRVAPRRSDDKGPRHTPK
                     LDESPRASTMRDRKTFGLSWFSLTKEDDVRKKEAACDDEAPRREKDTFLTGLFSKRKG
                     MDSYDSLRHRARSLFSGSSPFSHHTEYPLAKRYPVPVERSLYRLSHVKLSHPRRPLYQ
                     QVEISNFMFWYLSIIDSAQARPPRSLSSSSSQRGNGLSEYDEANQLRMPGTQPRTVHT
                     GSLVPTAPASLEPVQYQGAPVVAWQEPASDPASHVQRPARGPLPTVPSQPSRKVPPSP
                     TRRPVPRVARRTAHLENHLDELQKQALSTHYALRHPQGVPSHAPISLRSSHAHPLPLP
                     PLSMPPAPRPSPYAP"
     gene            <666641..>667036
                     /locus_tag="MRET_1251"
                     /note="MRES_04990"
                     /db_xref="GeneID:38738017"
     mRNA            <666641..>667036
                     /locus_tag="MRET_1251"
                     /product="small subunit ribosomal protein S17"
                     /transcript_id="XM_027627878.1"
                     /db_xref="GeneID:38738017"
     CDS             666641..667036
                     /locus_tag="MRET_1251"
                     /codon_start=1
                     /product="small subunit ribosomal protein S17"
                     /protein_id="XP_027483501.1"
                     /db_xref="GeneID:38738017"
                     /translation="MGATVLTGIVTKAGFMAKTVTMTVSKLKMHPKLHKSYVRHSKYL
                     VHDPDSVLTIGERIRAQACRPLSARKRFVLLERLGFQHGPEHADASHDDAARLRREKT
                     EASMPAAQREWLEIEKRVRDEVRSSSTRK"
     gene            <667240..>668124
                     /locus_tag="MRET_1252"
                     /note="MRES_04995"
                     /db_xref="GeneID:38738018"
     mRNA            <667240..>668124
                     /locus_tag="MRET_1252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627879.1"
                     /db_xref="GeneID:38738018"
     CDS             667240..668124
                     /locus_tag="MRET_1252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483500.1"
                     /db_xref="GeneID:38738018"
                     /translation="MSQADEGKALESVPAPSARPSHERVMDRLFQQLLKVPSPKTLAH
                     LVRFLGTWTGTDKFFMLAQYGSNVLVAVLLFLQALRKRSDKSSVIQRLVPRIRALGSL
                     TADARILFRIWAILPMVQWMLDLERHLPVTRNLKLIERLQALSMVVYAPMEAAAYLAM
                     HKILPLSDVVQNELWLWGCRLWAAYVVLDFWHIVEDHRMLRAEAKALERSHGHPTPVG
                     AAEKAMSDDQKATQHLWTQMRARKEALLTQFWVNVGYLPLTVHWSVSTGLISEGWVGV
                     FGVIAGLASWRKQWKATA"
     gene            complement(<668125..>669336)
                     /locus_tag="MRET_1253"
                     /note="MRES_05000"
                     /db_xref="GeneID:38738019"
     mRNA            complement(<668125..>669336)
                     /locus_tag="MRET_1253"
                     /product="serine/threonine-protein kinase 16"
                     /transcript_id="XM_027627880.1"
                     /db_xref="GeneID:38738019"
     CDS             complement(668125..669336)
                     /locus_tag="MRET_1253"
                     /codon_start=1
                     /product="serine/threonine-protein kinase 16"
                     /protein_id="XP_027483499.1"
                     /db_xref="GeneID:38738019"
                     /translation="MDLVRSALSHNELATRVYAYAQDGVLALLSCLDCADAYGTVCVN
                     GVSYNVMQLLGEGGFSMVYLVRDPSTGSAYALKKMRCQHGDESLRMALGEIQSMQRFR
                     GPHVLRLIDSAVVQDQEGRGAGSFLAGGFGRVPSDDVENPRSGKIVYLVLPYYQNGNV
                     QDAIHAHIVHHTRFDERVMLSLFAGACEALKTMHHYVLPQPHIAAPPRAKADDDSLLF
                     DAASTASDAYPPAEPMSLAPQDTQRVPYAHRDVKPANIMIDDDGVTGVLMDFGSTTRA
                     RIKISNRREAVAQQDVASVHTSMPYRAPELFDVKTDTILDEKVDIWSLGCTLYAMAYL
                     HSPFETPSTVEQGGSIALAVTNGAYKFPDDDPYSPHIRDLITRCLAHDPQARPEIDEV
                     LHDVYSALASI"
     gene            <669369..>670343
                     /locus_tag="MRET_1254"
                     /note="MRES_05005"
                     /db_xref="GeneID:38738020"
     mRNA            <669369..>670343
                     /locus_tag="MRET_1254"
                     /product="subunit of COMPASS (Set1C)"
                     /transcript_id="XM_027627881.1"
                     /db_xref="GeneID:38738020"
     CDS             669369..670343
                     /locus_tag="MRET_1254"
                     /codon_start=1
                     /product="subunit of COMPASS (Set1C)"
                     /protein_id="XP_027483506.1"
                     /db_xref="GeneID:38738020"
                     /translation="MDTKRKDAAALADERDAKRSLTGRAWSASASASPAPEDVKLYCV
                     CRQAYDDDRLMMACDVCDEWFHASCMRVAEHDVELIDTFVCAPCASRTAQRTSFKVPC
                     GHRACRRPARLPMSRYCSDACGLAEIRARMDVMHVSQDTHHITCAPKDARRGVVMWMH
                     GDQAPREPPPGTSWGAFVRQHATRLDTREHDTAQLHTELKRLERQCAALHASLDLLSV
                     RSKLLQHADDRPAGSACGFDARLCMDDEALAAWTLSPQGRAVMADQDGGSGAADVCDV
                     PKRQCKRHADWSAIRAADLDVLRDIQTAQLSALSERSHALRIAMELHS"
     gene            complement(<670340..>671144)
                     /locus_tag="MRET_1255"
                     /note="MRES_05010"
                     /db_xref="GeneID:38738021"
     mRNA            complement(join(<670340..670549,670614..>671144))
                     /locus_tag="MRET_1255"
                     /product="DUF543 domain protein"
                     /transcript_id="XM_027627882.1"
                     /db_xref="GeneID:38738021"
     CDS             complement(join(670340..670549,670614..671144))
                     /locus_tag="MRET_1255"
                     /codon_start=1
                     /product="DUF543 domain protein"
                     /protein_id="XP_027483505.1"
                     /db_xref="GeneID:38738021"
                     /translation="MSSDKPRLASEDVLNKKMDLCLSNTIVKTGIGFSAGVVLSVLFL
                     RRRAWPVWLGTGFGLGAGYTDCERSFNPVAVPGVRILPSTANVAVPPSRFSQLQDRVG
                     ELLGHAREQATEAVEGTSDIRSAAHERFTDLTQSGKEQLEKQLSNLQESTHNIREKVA
                     EAVSKEDDSKNHDSDKKWYVHAPREHEPCLACKVTGAAAMSCTGIAALLEARRLRQAA
                     VVRQPRWCAFLFAVGVAGLGGGAARLWF"
     gene            <671266..>672861
                     /locus_tag="MRET_1256"
                     /note="MRES_05015"
                     /db_xref="GeneID:38738022"
     mRNA            <671266..>672861
                     /locus_tag="MRET_1256"
                     /product="putative ATPase"
                     /transcript_id="XM_027627883.1"
                     /db_xref="GeneID:38738022"
     CDS             671266..672861
                     /locus_tag="MRET_1256"
                     /codon_start=1
                     /product="putative ATPase"
                     /protein_id="XP_027483504.1"
                     /db_xref="GeneID:38738022"
                     /translation="MASQPAEHERVACPNCAARLPFAVMNEHLDRCLQKTPSPEKKRP
                     AQNEAPRSKARRTTTLPFAERMRPHSLDEYVGQDEVVRGSLRALLRKGHIPSMVLWGP
                     PGSGKTTLARIVTHEATTPQGPPFRFVELSATTASANDVKRLVDEAVHRQSLTGQRTV
                     LFIDEMQRFNRAQQDLFLPVLERGHITLLAATTENPSFRLQGALLSRLRVVVLSKLTE
                     DDCLYILEQAMARVRRGHDDEFQGGAYAWIDSELLRWIARMADGDARAALQALELALV
                     SEGHQDREHLQTSLRRTALKYDRAGDAHYDTISALHKSIRGSDPDAALYWLARMVAGG
                     DDPLFIARRLIVCASEDCCSAEMLNLATATYRACEIVGLPECGINLSHCVVTLAECPK
                     STRSYRAWKKALSKVASDYNYPVPLHIRNAPTRLMKELGYSAMYRYEPSFAHPVYQEF
                     FPPELHGTRFLSPPPSPESVSHVLPTEAATGPGSCQRQFQLGDRAVDLDLLQEWEEKR
                     NDHQPWAGRAALERRLQRQGSAP"
     gene            <672888..>674483
                     /locus_tag="MRET_1257"
                     /note="MRES_05020"
                     /db_xref="GeneID:38738023"
     mRNA            <672888..>674483
                     /locus_tag="MRET_1257"
                     /product="E3 SUMO-protein ligase PIAS1"
                     /transcript_id="XM_027627884.1"
                     /db_xref="GeneID:38738023"
     CDS             672888..674483
                     /locus_tag="MRET_1257"
                     /codon_start=1
                     /product="E3 SUMO-protein ligase PIAS1"
                     /protein_id="XP_027483503.1"
                     /db_xref="GeneID:38738023"
                     /translation="MVYTVERKNPSRSVATPRRWAMDLVPVTDVCEYIQTLKVAELKE
                     HIKEFNGRLPFCPHMRLSGNKNDLVQRLTEAVVMACANIQSYQEMLAVIRPLGFDEWC
                     MDHVHLRRAMSRYRACYGCAPTADQGGHDSAALPSVTMRSAATDAANPMTWTAPTQGL
                     TPRSLKQLRFWSSPFYEVLEFVSSIVQVPEAPPSTGRRQVGMSFTLSQQQVDQLRDTQ
                     HLHQLRLFCTTFDHFMASVSPSHQAAPVEFPFTCDARINDHSLNVNLRGNKKHAGRVS
                     PPNLNRNGHLSMQPGKLNRVELSYANSPARHTMVVALCKITTAEYLTEQLKLRRYRSK
                     EAVMAMMREKAKDEDIETGASTLKLTCPLTYMRMSIPCRSNTCDHIQCFDALSFYSMN
                     EQSPQWQCPVCSKDIRSEDLHMDGYVEDILRRVPADCEAVLVESDGTWHTADDQYHTD
                     SPFIKQPVSAPPLPMDDDDTPDNSPMPSTHASPPHGFAQPKEELATPPVTPSIPISVP
                     PPESEAPPPSHVIDLTLSSDEDM"
     gene            <674550..>675992
                     /locus_tag="MRET_1258"
                     /db_xref="GeneID:38738024"
     mRNA            join(<674550..674675,674703..>675992)
                     /locus_tag="MRET_1258"
                     /product="SAGA complex subunit spt20"
                     /transcript_id="XM_027627885.1"
                     /db_xref="GeneID:38738024"
     CDS             join(674550..674675,674703..675992)
                     /locus_tag="MRET_1258"
                     /codon_start=1
                     /product="SAGA complex subunit spt20"
                     /protein_id="XP_027483510.1"
                     /db_xref="GeneID:38738024"
                     /translation="MATSASVYNYERTTRQILKRHRKDPASFILHLHPQFMRFEKQDG
                     YFLLESRTTDFLDYLCRQIIPVDLMDVFQQAGVPFFEGCLIVEVHDHRKPCPGSGTSL
                     NHFGPDGRRLYPSNTSLYYLREGGRYGTQANNGACRFLSLKDETSPSPEGVEIYRMIL
                     RSSDETIWNDLRMMDIKAGGVWSDEDALRIESQILHLTAPPLCLTPDSHVTRIANTML
                     SSTMPSAFHAGSASRPHSRVDRATGHKLNSVELEQVENRDARRLQIMNMMRHGWSSTT
                     QNDLPGESKAGMSRSSCLETLRKMRQNYAETAQEGPTVVPVTQNISDKSEAKKIPAAT
                     RKKRSKGNDESNTPDTKNAAASSTEAQRVRTKRRKKDASPVEDKTKSKSDMSPARAES
                     KTPSSPFIPGPSDSNNLSNTSVSTILSPTSKGKSSPLVLPGGTELNKTPKITNSPILP
                     SGKVKPTFSSGLFNSWNQQNS"
     gene            <676382..>677428
                     /locus_tag="MRET_1259"
                     /db_xref="GeneID:38738025"
     mRNA            <676382..>677428
                     /locus_tag="MRET_1259"
                     /product="hypothetical protein"
                     /transcript_id="XM_027627886.1"
                     /db_xref="GeneID:38738025"
     CDS             676382..677428
                     /locus_tag="MRET_1259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027483509.1"
                     /db_xref="GeneID:38738025"
                     /translation="MFQAHRALAASNTVAHLFAQVIRHILSPHLQPFSRRTLDVVYTT
                     LQMKLSMSALCIMAASLAVSSVLADFQYGLPWGGDSRWAASIAKKSSSWYHHWENGLV
                     HELGHLEYVPTFWGPTKWSQWNKRKHEMNHLHIEHLLAFNEPDVKGQANIDPDTAVGL
                     FMQELQPYARKGVKVSSPQMVWDLDWLSKFMNKCHEAGCSISFIALHWYGGPRDIEAL
                     KKWVRSVHDKFKMPIWITEYGLNAKSNPSDDDTIGFLAESLEWMSTQPYIHRVAWNGC
                     YDVGSKPDSFISAKNAYFKDGSGALRAIAHAWFSGKGNILMSNPNFKIVNNTRNSADD
                     SLSRHKAHRKRFLL"
     gene            complement(677699..677799)
                     /locus_tag="MRET_t0020"
                     /db_xref="GeneID:38741214"
     tRNA            complement(677699..677799)
                     /locus_tag="MRET_t0020"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:38741214"
     gene            <677917..>681003
                     /locus_tag="MRET_1260"
                     /note="MRES_05025"
                     /db_xref="GeneID:38738026"
     mRNA            <677917..>681003
                     /locus_tag="MRET_1260"
                     /product="chromosome transmission fidelity protein 4"
                     /transcript_id="XM_027627887.1"
                     /db_xref="GeneID:38738026"
     CDS             677917..681003
                     /locus_tag="MRET_1260"
                     /codon_start=1
                     /product="chromosome transmission fidelity protein 4"
                     /protein_id="XP_027483443.1"
                     /db_xref="GeneID:38738026"
                     /translation="MSIAGDDLPVQVTHIPGITRVRYTNSTKQDVRLVTAGEDHLVRL
                     LPSEPTATDVIPLVMEDATQNISWIEANNKYLVTASEDGAVRLYQHALQSEDDPQKAT
                     SCIRIVRREVLPVRCVSLERATESPRAAICSDELIIRVASVEDPRQITLLTGHTRGVR
                     AASWSPILPLLVSCGSDGDIRVWDMSSSEGSCVKVISNQLPALRPESEYTSLACWHPS
                     GRLLAIPLKTKEIGLFNAPEMLQQARSPDMWCMVSVLSASSGVDSAEYRPSSGSISAL
                     EFCPNGRYLAVATEDNRICIWAIDSQKVVRAHATEALVTGLSWHPSKDVLAWTDTQGQ
                     LTRWETVLGSNMPSPCEDIAVQAPVISIEGKGALDHELDDLFNDTPLDDDQAEEPQPK
                     RMRMSRGTEDVSIRQSTFQPSSTPMIAQRRYLGVSTLGTLTSVDQDTHQTIVFESYDT
                     SARRNFRFTDHFGYSLASMAAQGILFACESEAENPSVVFYRPFDDIPGVQTEWSISLP
                     PGENATALALGGVPNVGSLADMHENGSGLVDESRTSPATSVVATSRGMLRFFGPSGMQ
                     RYVWALGAPVVTLAANAHGALVVYQAAPSTTAQTFLAYLLVEFSQWCIMQQGTLPLGP
                     DSTLTWAGMDELGTPAIFDSMGMLYTLDRAWRPGQGRWVPALDTQLALQPRSADAETT
                     RPRVRCWPIGITATHLLALLLPTSQLYPQPSGPRPLVQELELSLYMAQRDSTATPLEE
                     LALRRALLASAIRDARAATGLDLMPKRLSAQESDPVQLDMEADKALLQIVQLACKADR
                     YARALDASRALHSEATLEAALKIAHFFHLPSLADRMEQIRAPLIIHQQFQTEMVERSC
                     GTDALLRNIARMQVPAPTPAPPAPVLDDPRTALRKDGFGSRTPRASSSVLAREGLAHQ
                     QQMQAPTPSMTSSDWLPPSSSLPSAAPSPAPPTEPDEIAAPSSTPPVRMNPFARTHSI
                     AKERHLHKSTSFFERVDATAKRKDDTDDADRTEKRSSSSRQSTLASFAYKDASQDA"
     gene            complement(<681005..>682225)
                     /locus_tag="MRET_1261"
                     /note="MRES_05030"
                     /db_xref="GeneID:38738027"
     mRNA            complement(<681005..>682225)
                     /locus_tag="MRET_1261"
                     /product="phosphoserine aminotransferase"
                     /transcript_id="XM_027627888.1"
                     /db_xref="GeneID:38738027"
     CDS             complement(681005..682225)
                     /locus_tag="MRET_1261"
                     /codon_start=1
                     /product="phosphoserine aminotransferase"
                     /protein_id="XP_027483444.1"
                     /db_xref="GeneID:38738027"
                     /translation="MSTTESRERTINLGAGPSMLPTNVVLEASKGFIDYEGSGIGVAE
                     LSHRSARFKTILSNAENDLRSLMNIPENYAVLFMQGGGTEQFSASLLNMLAAHAAKHG
                     EGRTTAPPVDYVVSGTWSSKAVKEARRLTSRVNVVCDMTSLLGDATAKIPQPDSWQLS
                     SIDEYPAMLYYCDNETIHGFEFPQDFIKQLPPAYRERVPIVADCSSNILSRSIDVRAH
                     GIIFFGAQKNVGPSGVTIAIVRRDLIVDPDAFKSPYVPPIPAMLVYKNMADNDSLYNT
                     PPSFPIYVSGIVFRDLIAQGGITKSKERAEAKSELVYKTLDAYPDVYKPTVAHQEFRS
                     HMNITLRVLNRSTHEPSPEAESKLISFFGEHDIVEIKGHRSIGGIRISLYNVVTLKQA
                     EKVASLLKQFAEST"
     gene            <682350..>683501
                     /locus_tag="MRET_1262"
                     /note="MRES_05035"
                     /db_xref="GeneID:38738028"
     mRNA            <682350..>683501
                     /locus_tag="MRET_1262"
                     /product="transcription initiation factor TFIIF subunit
                     beta"
                     /transcript_id="XM_027627889.1"
                     /db_xref="GeneID:38738028"
     CDS             682350..683501
                     /locus_tag="MRET_1262"
                     /codon_start=1
                     /product="transcription initiation factor TFIIF subunit
                     beta"
                     /protein_id="XP_027483441.1"
                     /db_xref="GeneID:38738028"
                     /translation="MDNDVDTGPEPASEPSTSALRHENLNREHSPEPDLDLDLTRGTH
                     QVWLVKVPKFLIDGWSRIQHDDVPLGHVRVYDPDENGNQPMELILPESPAWPIPIEDP
                     LVRSQFAHMPRKYDMKLTSSTSETYAKNLYAFEEELIDEDDVASDLGVDEDVVPDAVD
                     IKGPRSTGPARGVHKKRRTTALTGTVTNETSVQPQKLQAPVTSSTESKPSLRAGQSRS
                     LLTPEYREILRRRRIESSTPKRSVIMMESGDTGMNNMLAAGVGKGHIKPRATNIVAGA
                     MQSRSGDSTEKFARMPRNELLDLLFNLFDKYSHWSLKRLREETQQPYVYLREVLSTIA
                     NQHHNGPYAGSWSLKREYSEGSREGLVSSVNERSQNEISDENQDMEDVV"
     gene            complement(<683527..>684339)
                     /locus_tag="MRET_1263"
                     /db_xref="GeneID:38738029"
     mRNA            complement(<683527..>684339)
                     /locus_tag="MRET_1263"
                     /product="zinc finger protein (RING finger)"
                     /transcript_id="XM_027627890.1"
                     /db_xref="GeneID:38738029"
     CDS             complement(683527..684339)
                     /locus_tag="MRET_1263"
                     /codon_start=1
                     /product="zinc finger protein (RING finger)"
                     /protein_id="XP_027483442.1"
                     /db_xref="GeneID:38738029"
                     /translation="MESDTNDVKLVEENCAICLEPVQDRCVLPKCFHSCFCFQCILEW
                     IRTQQGTKRCPLCKVPLGPYILHSLDASEHDALQHVISKDSDSISSTALGPSSDEADL
                     NTVEPPHASGRAIFEQARPSLDDIRMRDERRFRQKQRAALAFRRHVYRHNLYAKHVAS
                     NRYTRYRPYPGPSGFRRNPVYARLLSTFLQRELQVWPHVDIAFLSYYIPALLSQLDVT
                     SDTFVQRLAEWIGNDCDARLLAHEMELFVRSGRGGLGLDQYDTNPWLQYDNV"
     gene            complement(<684490..>686406)
                     /locus_tag="MRET_1264"
                     /note="MRES_05040"
                     /db_xref="GeneID:38738030"
     mRNA            complement(<684490..>686406)
                     /locus_tag="MRET_1264"
                     /product="heat shock 70kDa protein 1/2/6/8"
                     /transcript_id="XM_027627891.1"
                     /db_xref="GeneID:38738030"
     CDS             complement(684490..686406)
                     /locus_tag="MRET_1264"
                     /codon_start=1
                     /product="heat shock 70kDa protein 1/2/6/8"
                     /protein_id="XP_027483439.1"
                     /db_xref="GeneID:38738030"
                     /translation="MTKAVGIDLGTTYSCVAVWQNDRVEVIANDQGNRTTPSYVGFTD
                     TERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFSDADVQSDMKHWPFAVVDRSGKPVIK
                     VEYKGEEKIFTPEEISSMVLLKMRETAAAYLGGEVKDAVVTVPAYFNDSQRQATKDAG
                     VIAGLNVMRIINEPTAAAIAYGLDKKDSAEKNVLIFDLGGGTFDVSLLTIEEGIFEVK
                     ATAGDTHLGGEDFDNRLVNHFVQEFKRKNKKDLTTNARALRRLRTASERAKRTLSSAA
                     QTTIEIDSLFEGIDFYTSITRARFEELCGDLFSHTIDPVEKVLRDAKIDKGSVNEIVL
                     VGGSTRIPRVQKLLRDFFNGREPNKSINPDEAVAYGAAVQAAILTGDTSEKTQDLLLL
                     DVAPLSMGIETAGGVFTPLIKRNTTVPTKKSEVFSTYADNQPGVLIQVYEGERARTKD
                     NNLLGKFELSGIPPAPRGVPQIEVTFDVDANAILNVSAADKTTGRSEKITITNDKGRL
                     SKEEIERMVADAEKYKAEDDAAAERIKARNGLESYTYNLRNSLNEEAFASKLDASDKD
                     NLKKAIDETIEWIDNTQEGSIDEYNDKQKELEGIANPIMQKAYGAAGGAPGGAPGAGP
                     APGGDGGPQVEEID"
     gene            complement(<686727..>688448)
                     /locus_tag="MRET_1265"
                     /note="MRES_05045"
                     /db_xref="GeneID:38738031"
     mRNA            complement(join(<686727..686954,686988..687035,
                     687063..>688448))
                     /locus_tag="MRET_1265"
                     /product="microtubule binding protein HOOK3"
                     /transcript_id="XM_027627892.1"
                     /db_xref="GeneID:38738031"
     CDS             complement(join(686727..686954,686988..687035,
                     687063..688448))
                     /locus_tag="MRET_1265"
                     /codon_start=1
                     /product="microtubule binding protein HOOK3"
                     /protein_id="XP_027483440.1"
                     /db_xref="GeneID:38738031"
                     /translation="MSMPSEAEALTAFIHWVQTICVGRHIKDVNALCDGSALFEVLQG
                     VDDVHFLPPRSSSLETLHRRVVSFCTQELHIPEEVLPVIDIKEASKERSPSKSDLLKL
                     LRLVLVIVLKSDHNDEQVNAMQTLSLDEQLIMKQVVEDVLSDYTSSDTTPPTTKEPID
                     GGANREEVITLRRDVELGKQRLSDCQDQLAHTESHVDRVTTENKELLSQLSALRQIQH
                     ERDALRDQLDEAKPMLEAYKKQERSLSKVRERAEEATELKRSVKELEKQIAELMEQSS
                     EAADRSASQLAEQHRSVTLKSDRKYTELVEEHTQLAHEHEELKMQLEKLMEERRQDQT
                     QMHSLLERVRTLEVDTPHDDLAPSLDLETQQQEFESMSPLEDDPMSSTDVTVMMDAVK
                     ADVTALRNNLTSKHAEAENLLRKLEKKAPKEAGKTSTKDIKNIGDLLTDSFRHEDLIM
                     QRLQRCWDHVNKHMQQRVLSSPVLTDVERERDALRQEQRLMASAYHQLSQRLYREVSW
                     QHVIPPVPVDSDDRVPEVPRVSGSGLSWIAQQRNAVSGALGFTSK"
     gene            <688548..>689333
                     /locus_tag="MRET_1266"
                     /note="MRES_05050"
                     /db_xref="GeneID:38738032"
     mRNA            <688548..>689333
                     /locus_tag="MRET_1266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627893.1"
                     /db_xref="GeneID:38738032"
     CDS             688548..689333
                     /locus_tag="MRET_1266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483437.1"
                     /db_xref="GeneID:38738032"
                     /translation="MTAEHGPVNERLWTLVLELSAQLAANKQQVDALRKQVASLEGQA
                     LHAKTGYALRRFNVDMSQEAFTSQLERLNAQLVNENTTLAYEAKQMGSLLRESESTLE
                     AIMNKFRAFSHAAQQHGLDLSAYYESRIESQRNRIDHLMMHDQDTMHRLSDRVSGLVR
                     DAMHSMDSDFPDMRSDAMEGATELERLRQENAILRSLMGLSHEDADVDDNADRVSTSD
                     LSISRSSLGHAEQPVEESTTTGTMTPEGEAPVDEIDAGVPAPS"
     gene            complement(<689350..>697755)
                     /locus_tag="MRET_1267"
                     /note="MRES_05055"
                     /db_xref="GeneID:38738033"
     mRNA            complement(<689350..>697755)
                     /locus_tag="MRET_1267"
                     /product="E3 ubiquitin-protein ligase HUWE1"
                     /transcript_id="XM_027627894.1"
                     /db_xref="GeneID:38738033"
     CDS             complement(689350..697755)
                     /locus_tag="MRET_1267"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase HUWE1"
                     /protein_id="XP_027483438.1"
                     /db_xref="GeneID:38738033"
                     /translation="MKITKVPKRKPEVPEDLAALGARIVEEPESSLASLLRSVDQWAW
                     PRGDLYAWIPVLNRFDDILARICHTTPLKPVQKEPFGAHDRELLLAVLSFTRLLLENC
                     LNRKLYSSYEYVDMLLATEDADVLEQLLYLVLRSAQQRSASNRIDVPLSHFRLRILAT
                     VWPPREAGLELVDVAQADMPFPAAMHSVHVNGYRRSPQAADGAASLPSTPAKQGEQDH
                     TLPSLNGTFRVVISGLDTETRPPSALLQACDSAKELSDDEQFELFHKVRVALACKHPS
                     TRHQALVCRLLAVACFIHIAPHAMANTHIFMIEPSIVLRTVALLEPPEVVDDSLHSAV
                     LYALDAFRHYRTYYGDVLTAINASMSHGVLRQLLQCTIQRLSELAPTTSIPSKFDRLV
                     DALITLVANMTTIMTPTSMTISTGLLPQLLDIARIKSTSNLLVLRTSTRAVGLLDTIM
                     YTYPSTFEHFIAIHGIDVLVERLVADMPAPEESEPFMYSRSHLIRQILRTIHHLMTTP
                     GTADGLRTLIDTPILGVLRTIIERKNIFGPHVLTLAISIMSTFVHNEPTQLSTIQESK
                     LPEAFLQALSDGFEPNMELLMSLSTAIGALCLNEAGLRLLTESGIVARILHILNDTRF
                     HGILLDHDCANAFGGSIEELVRHHPSLKEGVLTEVLRVVERIVTEARTFTPPSDAKER
                     ELYVVDTPVQLEAKPIRTSHIELDDIDHYMPSASAGEGNAPVGSFDVLCRFLEGLFRN
                     ESTCREFMSRDGLAQLLVMYDTPCITPYFPSSAPAESFVMLLRAMTEEDPDTVLSLLL
                     QQVKRSIDEWTPGIMTVDDTRFRAFCRLHARTQLLSDVCQMFNDTFSFSPPNNKIPLA
                     FLRALRRGGDVATIAQLAEVLRSTVWERMTVKAALQDVDQDTMSLTLKAVDFLCMRIP
                     AALRSTLLIVTRQMVPRRTVDMEYLTAAKQVAVDLSGVLRSWSSLRTDVSEVEALAEH
                     TYMYLILRHVLYEKRSGHGEYAHTMVLREWCEQGGDAVLVEQVRSLSAYFEHGALDND
                     ETSVMSHAAHALHVYLSMVMRFVPARTLNDSQQSVQLSKDPSFHVHVLLVQLRKHAID
                     VLTQLWDAPWLTKLPLATVREVAQALGMVLFADREDPSQRPTPAPLRSMSRLPHHVPT
                     GMAMTMSASPQPVRPPAAAPAVDEGRLMQLVEMGFPRGASRRALQRCRNNVSAATEYI
                     LLHPELEDEPEAPPPEPAAEPEMSAVSEPDELAQALAGALHAHIPSTEPTRQETPPLP
                     EPAWPTPAKIELEKCREDMRPHFFPRLLELADVHEELVFDARHVFVFFSRDQEQTQRL
                     WHIVTERMTYDTTQPVIMARMHLLALLLTTEQTPFKVPWSSLPPLAHGLLGCLREAAT
                     APDAPEPPWLPSALLALCGVLSACEVPEGVLALPRDAQECEAFLLDVRPKVTEYVLHA
                     LAHSSRLSFSVNLSLARALMIVSRHASVGGALVERRAVPLVMRPLLSRRRFQRALYQH
                     LVVSVLRHMVESGGALLSLFTQEVHIWFKQGTRPRPTEVNAMIKKFGLSLLRAPSTFI
                     EAAGKQVDLLDFHSIQSPTHLRTKPGACPADEPAEAHVVRDVVIHMLLDELIAARQEH
                     ISPTDEGDVSVADARDSYILVLLQCLTELLSSYMGCKQSFLEYRVNGSESILTYFMNE
                     LVPSGFLAQYEPDELRKRTTESNWAISVMVALAADPLPDHEAQVVPDALIVARKTLLD
                     ALHKALREAMATQEMVEIKFGRLYALTDMCYRLLTSRPASDAATPRHSGVVLHMAKTM
                     LEKNFVVLLTQAISDLDVHVPSLTSLLNSVLRPLEHLARVAIKMARRDTHARNEGTED
                     PEEEDDEEDGDVEEEVVMHGESSEDEGTPDFYRNSSLGMHTGEMEQGAYDSDHLSEDL
                     GDDEDMEMEEYNSDDAESELSTDAEDLDGDSTHVVEVVEDDDEEEHDSDNHSQEDFDD
                     MEEDGFSDDMFSDDMIDDEAFDDDELDVRDFDDMQDEEHDMSRTGNMDSVREIMEALN
                     DMEHVPELEDSDHDTVHTDAFDMDLGVERQGADDVSDEDDIGDADDDDGPNQLTWRPT
                     MPRMSQESANVDYNWVERQDGRHGAARRGPPTFFQASAEPVRTRSDSARAAPPSHDAS
                     FHPLLVDNNDNDPDREPASWQRAMESYMGANTLQFLESFVQQNVPQGGNASIQIELDP
                     GRGMPRMQITNMIDGPSTRRSMNRRAPSTTGAHHERQPSDAPFDAVAESQRFTPNHTH
                     GRWMSEAHVVYAGASMDMNAAFRRPLIEHLLPSFYARRDREREEQHKSKADSSERPTE
                     SKRKHHDMEGHSDDEEDKNDRAGRVTATVHGDTVDLTDTGIDPTFLEALPDELREEAL
                     LSQQLNAQMSRQARGIVPDFLNVLPRSLRTELQQFDAPASHSAPASRQTDDQPQERSS
                     EQAPPSTDEPQASPQQGPRESERGRDAIQLLDRASLASLVRLLFLPSVHARTSLLHKL
                     LAHLSVNARTRTELLGMLLMVLWDSMHSAASVDRSFTALCNKAAKHTPQRNMSRHQSS
                     SLTSSGLLPPSTPSAALPLTWMGDEAPHLIASRSLETLTHLAHANHQAALFFLREDRS
                     RKGNKRVPIQILLGLLEKDAMLEHAPLLNELLALLQSVSKPLTTAQPGKDGTGAVLDS
                     TYDNMEVPGIASERLAAIVRPLQTPMTSRAFQHTLAVASHLSHLPGAHESISAALQNA
                     AQQASYALVSHLEAVIASLPEVATDAVANDQNSQPKADAQAPSEPMATEPASSPVPST
                     SLPLARLASPTSSQAELLRCLRALDYLYMGK"
     gene            <697909..>700038
                     /locus_tag="MRET_1268"
                     /note="MRES_05060"
                     /db_xref="GeneID:38738034"
     mRNA            <697909..>700038
                     /locus_tag="MRET_1268"
                     /product="cullin 4"
                     /transcript_id="XM_027627895.1"
                     /db_xref="GeneID:38738034"
     CDS             697909..700038
                     /locus_tag="MRET_1268"
                     /codon_start=1
                     /product="cullin 4"
                     /protein_id="XP_027483435.1"
                     /db_xref="GeneID:38738034"
                     /translation="MLAEALGSYVAGRTHAARHAPASCVVQSLQSYEAVQDAAVSYEK
                     DVLVSAVQAVLQRDQLPSSVQTTYLYLASMAPMPDVWKVAMQDACEVIRTFLVHTLRP
                     RCQADAALALWIVRLMDTWDRMMARFHTILDMLRPVHVPEVEFLSTCTAMLQRTCRDT
                     HDAATWDRGVYAVAEAVRHGQYEPSTLQRVCGLAGVLERSTHALIEQAYTYYGARVEE
                     LLRGSFAEAVPHIHAWIVKEHEWAAQLGEAAVPDVVATQVVRPHQEALAATLSYFLDR
                     QDTERIQSCYAIFDDAGILPVLYATMRKHVESRVKDLMQSTDDSVLIEKLCQQHHIWH
                     GLVTSGLHADPMMRDALHDGFEHGLSVRGTHMAQLLAQFAGAQLGQGMDTWIDDMLLI
                     FRCLYEKDVFEVCYRHAFAQRLLQQCSHEAELVMLERLRQECGPDYTRQLETMHRDMD
                     VSNELLHEFDSAHMPFEFDARVLSQSHWPAYEEIPLRLPPEMTSVLQRFEAFYEAKYK
                     ARSLHWCHALGSVVMQADFGRAGTKELVVNTLQAVVLLAFSTKHVLSYAELATRTGLP
                     PASLDVTLQSLTCGAPPTRVLCKSPAGRAVHKHDTFRVNEDLVPTARRICIPQSERPT
                     THTQQHAASSYVLVDRDMFLQAAVMRVLKRRTLVSLSDLLAEVGDQCRGRFALDHAEL
                     KHALERLMEKDCVERADEERHMYRYVP"
     gene            complement(<700035..>701702)
                     /locus_tag="MRET_1269"
                     /note="MRES_05065"
                     /db_xref="GeneID:38738035"
     mRNA            complement(<700035..>701702)
                     /locus_tag="MRET_1269"
                     /product="biotin---protein ligase"
                     /transcript_id="XM_027627896.1"
                     /db_xref="GeneID:38738035"
     CDS             complement(700035..701702)
                     /locus_tag="MRET_1269"
                     /codon_start=1
                     /product="biotin---protein ligase"
                     /protein_id="XP_027483436.1"
                     /db_xref="GeneID:38738035"
                     /translation="MAKVLVYKDAGVLDASHASVSRTLRELCRDTHDVQTVSSQVLAL
                     APWDTSTRLVVLPPIHPTGHDPWTRAYGLRTAQQRVLDYLNRGGAVLCLGQSLACIDA
                     ALEPDGDVCRVTRGQGQVLWHASPEPDAHAIEDLLRTASMRVQSVSPGSIPKCTSLFL
                     ASCSRPLLDACVSALRAHATLSETAAYVADASDTWKLCEDASHAALSSDEADVTHVVC
                     VTRDQFGVVREATRAFDLASYFGALASARATSAALLPWTPPRSFHFAAGNLIGYARVL
                     KSTQTLLDSHPRMLGACPPGTTMFATQQVQGRGRGSNVWISPYGCLQFSTLVPLPLHI
                     GNKAVFLQYLAALAVVYGVGAAYPSSRGRIRIKWPNDLYAHVPAPQNGSLCVVEDGVK
                     KHFVKIGGILVTAVCHQDTFQAIVGCGVNCLNEEPTTCIRALVPDETVTQEGCAGAIM
                     AALESLVRVFADADYTFEPFASAYRDAWLHSDQPVELSDVPGEPRRRMVGITSDFGLL
                     RTVPYDASIRATDPRAWSAAPIPGAVDVQPDGNSFDMLRGLVRRKGD"
     gene            complement(<701737..>702708)
                     /locus_tag="MRET_1270"
                     /note="MRES_05070"
                     /db_xref="GeneID:38738036"
     mRNA            complement(<701737..>702708)
                     /locus_tag="MRET_1270"
                     /product="4-nitrophenyl phosphatase"
                     /transcript_id="XM_027627897.1"
                     /db_xref="GeneID:38738036"
     CDS             complement(701737..702708)
                     /locus_tag="MRET_1270"
                     /codon_start=1
                     /product="4-nitrophenyl phosphatase"
                     /protein_id="XP_027483381.1"
                     /db_xref="GeneID:38738036"
                     /translation="MALTAVPRGTYQFLDSEEARAALLDRYDNFLFDCDGVLWSGNEA
                     LPGVTSFLRKLRARGKRLLFVSNNASKSRRTLLEKIKAMGIEGTEEEVFSSAYATAAY
                     LKDVLHFPTDRKVYVIGMQGLRDELSHVGISHVGGADDDSVGLEGLDFAPLAQEGVVD
                     PSVAAVVCGIDTKINYRKMAKAHVYLTRPGAQGPARSGEKNGGCHFVCTNGDATFPTS
                     YGMFPGAGAIWAGIQYASGREPVVVGKPNQPMIDTIFARFDFDKSRTIMVGDRLNTDI
                     AFGQAGDIDTLLVLTGVSSLEHVHADDAAAVPTYVVSGLCDMDRAID"
     gene            complement(<702759..>703592)
                     /locus_tag="MRET_1271"
                     /note="MRES_05075"
                     /db_xref="GeneID:38738037"
     mRNA            complement(<702759..>703592)
                     /locus_tag="MRET_1271"
                     /product="ion transport protein"
                     /transcript_id="XM_027627898.1"
                     /db_xref="GeneID:38738037"
     CDS             complement(702759..703592)
                     /locus_tag="MRET_1271"
                     /codon_start=1
                     /product="ion transport protein"
                     /protein_id="XP_027483380.1"
                     /db_xref="GeneID:38738037"
                     /translation="MSSMSRTLLGESNRSSVPASDARGVYHPAPVLDEPYGVDVLAPA
                     YELPDGRTNFRYSMSREEMLKGLANRFVHSTTYLYLYATMAVLSLVTVIFSLLWTCPG
                     PAFYILELLVNVILVAEVCVRFVAYGRNFWKSTYNIIDLFLVVLCILTLIILFVGHGC
                     SPIAERPGMSEELLDSVLLIVRNVMQCMRLISVIRRSGYNVASRITAIDLSDAHDYNL
                     DLDLEHESSQALQRMRDGGDQHSSGNGWSPQTRPETLVSNHPNESVIAMDSAELDDTH
                     L"
     gene            <704150..>705473
                     /locus_tag="MRET_1272"
                     /note="MRES_05080"
                     /db_xref="GeneID:38738038"
     mRNA            join(<704150..704171,704278..>705473)
                     /locus_tag="MRET_1272"
                     /product="casein kinase I"
                     /transcript_id="XM_027627899.1"
                     /db_xref="GeneID:38738038"
     CDS             join(704150..704171,704278..705473)
                     /locus_tag="MRET_1272"
                     /codon_start=1
                     /product="casein kinase I"
                     /protein_id="XP_027483383.1"
                     /db_xref="GeneID:38738038"
                     /translation="MDLRVGGKYRIGKKIGSGSFGDIYLGVNIISGEEVAIKLESIKA
                     KHPQLEYEAKVYKTLAGGVGVPFVRWFGQECDYHAMVIDLLGPSLEDLFNFCNRRFSL
                     KTVLLLADQMISRVEYIHSRNFIHRDIKPDNFLMGIGKRGNQVNVIDFGLAKKYRDPK
                     THLHIPYRENKNLTGTARYTSINTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKA
                     ATKKQKYERIMEKKMMTPTESLCRGFPTEMAIYLNCCRSLRFDDRPDYSYLRKLFRDL
                     FVREGYQYDYVYDWSIQPRDRVEQPSRGLAPQTGAAEEQTQQKAAAAAGQAQRRRVLP
                     QDQAAGITEPAARAPIMPSTADYARMPAALTGERGTADAPNVVNATASGVMGNGAPVY
                     ANDAQPLNEAEWR"
     gene            complement(<705620..>707275)
                     /locus_tag="MRET_1273"
                     /note="MRES_05085"
                     /db_xref="GeneID:38738039"
     mRNA            complement(<705620..>707275)
                     /locus_tag="MRET_1273"
                     /product="transporter"
                     /transcript_id="XM_027627900.1"
                     /db_xref="GeneID:38738039"
     CDS             complement(705620..707275)
                     /locus_tag="MRET_1273"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_027483382.1"
                     /db_xref="GeneID:38738039"
                     /translation="MPLEEQGESSPLARHPTRNLPDYGATDGRLHTSDDQENVSFLHI
                     MIPCLAMWSVTFIGSVDTTIVAMLLGNISSSFLAAERASWIGSTFLLSVCCTAPLYGR
                     LSDLFGRKRSLLLAVSIFTLGTLWCATARTMDEFLVARALAGLGGGGLNTLTSVIMSG
                     LVPLKSRGIFQGLANIVYGLGVGTGAPLGGVLNDTIGWRGAFYIQIPVLLLALMALTF
                     CLEHDEAVHFGPGDSVWKRIKDVDMLGLLLFSFVPLTMLCALDMISVRNLPLTNPYVL
                     TLLGVSSVALALFLFVERRVARFPLLSLDILSLRTARSTLVGNFFLSVALFSYNYYLP
                     LFFQTVARMTASDVGVRMMPSSFAIGVGSLVSGFYMRYHGRYCRYLVACSVVVFMSCL
                     PSVLYLVDPPTVTPFVLNVFWSFAQAGYLTCALVALIHVVDKRSLGVATGMSYLFRTT
                     GQVTGVAFSGCILQLTLARELSGRILGPGSAELIEQIRHDSTILPSLPEDLRYEALWS
                     YTYALHNVFIFVNICYFITMITTMFVEDKHLDEVFPSQERDDE"
     gene            <707609..>708499
                     /locus_tag="MRET_1274"
                     /note="MRES_05090"
                     /db_xref="GeneID:38738040"
     mRNA            <707609..>708499
                     /locus_tag="MRET_1274"
                     /product="U3 small nucleolar RNA-associated protein 11"
                     /transcript_id="XM_027627901.1"
                     /db_xref="GeneID:38738040"
     CDS             707609..708499
                     /locus_tag="MRET_1274"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 11"
                     /protein_id="XP_027483377.1"
                     /db_xref="GeneID:38738040"
                     /translation="MALRNYVQRRNHKERSQPQHRKHLGLLEKHKDYVQRARAHHINR
                     DKLQRLRQKAADRNQDEFYTGMIGKKTQHGVHMSSRGNEAMDNDIVALLKTQDAGYLR
                     KQLISERKKYKALVEDIAPRVPGMRLAFLEKKRDLADTLKRANLLDEKAMASKRQERV
                     QGAGTKTKWVDNTEELQAYASKSKSKSEKSSLTQSDKMGEIQLGIKIRELASRQHRLN
                     ALSEAAQKLDTVRALMRTRGSHAVSKKKLDEMKDAVSKKGARVTANGLALDENDDDDD
                     DDLHERSKPKYYKWSNERKK"
     gene            complement(<708500..>709361)
                     /locus_tag="MRET_1275"
                     /db_xref="GeneID:38738041"
     mRNA            complement(join(<708500..708617,708652..>709361))
                     /locus_tag="MRET_1275"
                     /product="hypothetical protein"
                     /transcript_id="XM_027627902.1"
                     /db_xref="GeneID:38738041"
     CDS             complement(join(708500..708617,708652..709361))
                     /locus_tag="MRET_1275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027483376.1"
                     /db_xref="GeneID:38738041"
                     /translation="MSTFPLTWRESFGFKALNVIAYVLFASSNTYAAITGKHIAGDVD
                     TYITPAAWFYGIWHILNVLLLGLIVYQFWPGTAQLTQYSLGWRFPTALVLHALCTLLY
                     TQKNSTPIYCVAFITFCMVTTLVNQLYGILRTNAEPLNWADVFFVFLPISLYHGATIL
                     LFFVSVFAISGFHSTEHEAGMVTKVLVFLILFFLDSTVTGYVFYGNGDIGGASVISIG
                     LLAIAQHQQTSRFIHWSALVFFVISFIAVIRVIIAMIQDRQNILRLGTNEENAPLVP"
     gene            complement(<709418..>710026)
                     /locus_tag="MRET_1276"
                     /db_xref="GeneID:38738042"
     mRNA            complement(<709418..>710026)
                     /locus_tag="MRET_1276"
                     /product="26S proteasome non-ATPase regulatory subunit 9"
                     /transcript_id="XM_027627903.1"
                     /db_xref="GeneID:38738042"
     CDS             complement(709418..710026)
                     /locus_tag="MRET_1276"
                     /codon_start=1
                     /product="26S proteasome non-ATPase regulatory subunit 9"
                     /protein_id="XP_027483379.1"
                     /db_xref="GeneID:38738042"
                     /translation="MPDSVRQDVLRLLDKRKDIETELRHQRDILEANHVTMSTNVLDA
                     EGFPRSDLDIPTIRAAKSQIRCLLHDRELINAKLEALLPSALRHGVTLDTSSSSLPKT
                     DHHIPPPHQLAIRSVQRNSPAATAGLEAGDLLVSWDDLRPLSAMHLSQLPSRVKEGVP
                     IILEVNRTLTNGVTMSLKLTLIPSSQWDGRGLLGCHIVPVGT"
     gene            <710267..>712216
                     /locus_tag="MRET_1277"
                     /note="MRES_05095"
                     /db_xref="GeneID:38738043"
     mRNA            <710267..>712216
                     /locus_tag="MRET_1277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627904.1"
                     /db_xref="GeneID:38738043"
     CDS             710267..712216
                     /locus_tag="MRET_1277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483378.1"
                     /db_xref="GeneID:38738043"
                     /translation="MHDMLSTIFQPCELQVNLIQNVIFLRPPQRAELDAEHRTHELPP
                     LSNDELVRGIIHLYAPSSRHIDGLRVHLRATMSLAHLDTAQNQSPSSWETSTFMDRIL
                     EICVPPRLSKLNAPRSSSSSVPRPRSPSIVPGGGGRHGDSHDIFRNMVRGVSKNRASR
                     SGSQTPALLRIPHGMPTTHHEDPRCSNHSLSRTPYEHSGTSTPQYGFGGGAMTDEDLQ
                     HVTEQLEAQNVHDDEFERRGRAVSRREPLAHNEEKRGRSKSKHLEVISQGGDEDGMEL
                     SKGVHMFEFAFIVPADSPPYDRSPFGKVRYMVKVTALGAGRARSNVEEWRDFFPMVNP
                     APDGGVTPLTVLFNDVHPTMGLLSVACTSNNISVGGLFNIDIHSPSPPPDLIVYMARV
                     SLHTTIEVTTRRRGRQVSPVQKRRLFEKGIVAHEKSNLDDIDHMPGYIRYAGDDSAWT
                     VQGVARIPDDNAIRPSTMSGTRSPLRFHHTLVVEVVHSRSNPSVPDALTPEGRRKIKV
                     FTLRQGVIIPSCCCALDAVTLPAYSPSSNSAPNVPQLKHLTGSTWEQIVMANQDRGES
                     HNMCVCGMSLADLSAAEQAMLPPPDPTDLMISEATPGRKPGELQSSDDLHAGLSDHSY
                     YEPMQRPTASRAASSFTDLPPAYTK"
     gene            complement(<712248..>713402)
                     /locus_tag="MRET_1278"
                     /note="MRES_05100"
                     /db_xref="GeneID:38738044"
     mRNA            complement(<712248..>713402)
                     /locus_tag="MRET_1278"
                     /product="S-(hydroxymethyl)glutathione
                     dehydrogenase/alcohol dehydrogenase"
                     /transcript_id="XM_027627905.1"
                     /db_xref="GeneID:38738044"
     CDS             complement(712248..713402)
                     /locus_tag="MRET_1278"
                     /codon_start=1
                     /product="S-(hydroxymethyl)glutathione
                     dehydrogenase/alcohol dehydrogenase"
                     /protein_id="XP_027483375.1"
                     /db_xref="GeneID:38738044"
                     /translation="MSTEGKTITCKAAIAWEANKPLSVEDVHVAPPREGEVRVRVTFT
                     GLCHTDVYTLSGGDPEGAFPSILGHEGAGVVESTGEGVTDVRPGDNVILLYTAECRKC
                     KFCTSGKTNLCQAVRATQGQGVMPDGTKRFTSARTGQELFHFMGTSTFSQYTVVSQYS
                     LVAVDPKAPMDRTCLLGCGVTTGYGAAVYTAKIEPQSTVAIWGMGCVGLAVAYGAKER
                     GAKRIIAIDMNPAKEAWAKAFGATEFINPKDVPRVEGGDAMVQHLVAITDGGLDYTFD
                     CTGNIHVMRTALEACHKGWGVSTIIGVAKSGEEISTRPFQLVTGRKWQGSAFGGVKGR
                     TQLPGIVNRYLQGDFKVDEYVTHREPLSRINEGLEHMHEGQCIRCVIDLA"
     gene            <713517..>715328
                     /locus_tag="MRET_1279"
                     /note="MRES_05105"
                     /db_xref="GeneID:38738045"
     mRNA            <713517..>715328
                     /locus_tag="MRET_1279"
                     /product="carbohydrate kinase"
                     /transcript_id="XM_027627906.1"
                     /db_xref="GeneID:38738045"
     CDS             713517..715328
                     /locus_tag="MRET_1279"
                     /codon_start=1
                     /product="carbohydrate kinase"
                     /protein_id="XP_027483374.1"
                     /db_xref="GeneID:38738045"
                     /translation="MYFVGIDVGTGSVRAALVSHAGEIFAQASRPIQTWTYEEDSRLY
                     EQSSAQIWHALAECVRTLVEQSRVRPEEVHGIGFDATCSLVAVQNVTGQPHCITPQHL
                     PQNSERNVILWADHRAEDEARLINAVHHKVLDYVGGTMSLEMEMPKILWLQRHWPART
                     FQDTEFFDLPDYLTFRATDSRARSNCSLVCKCGYIPPGTAGSDIGWQPDFLARIGLDS
                     LGPGYEALGGIPGRGGLVLTAGMPVGAGLSERAASELGLLPHTPVASAVIDAYAGWVG
                     TAAAPSLEQEARFTSLRDAQTRLVAIAGTSTCYCIQSEAGVHVPGVWGPYQHAVFPHR
                     WMNEGGQSSTGQLIDTVLQTHPAYATALAEATSRNLSVFTLLEEALDAQMEAAGMQRT
                     SPSSYALLVRHMHMYPDFHGNRSPLADSTLRGMLSGLDLDRSRADLARKYVLTLEAIA
                     LQTRHIVDEMNHSGHRIEAMYLSGGGQARNLIYAHLLADVCGLRIQVPTEASASVTVG
                     SAILGQLAAHVTQEQTRAPRTAQPVLSSQTDAVACAEAQAERLWHMMAASTKPGHSIQ
                     PTTDVKLRRLFDVKYRIFLECIDTQRRWRAEVDAALA"
     gene            complement(<715325..>716770)
                     /locus_tag="MRET_1280"
                     /note="MRES_05110"
                     /db_xref="GeneID:38738046"
     mRNA            complement(<715325..>716770)
                     /locus_tag="MRET_1280"
                     /product="ceramide glucosyltransferase"
                     /transcript_id="XM_027627907.1"
                     /db_xref="GeneID:38738046"
     CDS             complement(715325..716770)
                     /locus_tag="MRET_1280"
                     /codon_start=1
                     /product="ceramide glucosyltransferase"
                     /protein_id="XP_027483663.1"
                     /db_xref="GeneID:38738046"
                     /translation="MTWWDVLRALTSAVALVWYVVLWGVCILGYTVSKKLFEHSWPRS
                     PLSSANAESVPGVSILRPLAGLDCNLFTNLCSTFEQRYPYDSYEVILSVRSADDQALG
                     VARRVQERYPHVSSTILVGDVEAGVNPKINNLVRSYAAAKYDIIWVVDSQVWLSSDAM
                     GRAVDALTMPPTRPSPHWLHRVPHGHRVGLVHHVPLGVLPADTLASHVERVFLSTTHA
                     KMYLAINAVAVDSCVMGKSNMYRKSDLERVPDTFFHYAQDAQSSIGSRAFDDHDVTHA
                     ESGALAHARALARFGIYLAEDNMLALSLWRPPVQLAHRVSPGDVAQVAVGDINTLAEY
                     AKRRMRWIRVRRHMVPMATYLEPFTESILAGVCGWYAVRVLLLNAIIHSPLQAWLACA
                     LFFALHWAAWYYVDMSVLLALRHGEPLPEAEQRYVFVAWCVRELLAFPIWAWAMLGHT
                     VTWRGRRYRILRDARAAAAETDAADASLLSD"
     gene            <717064..>717694
                     /locus_tag="MRET_1281"
                     /db_xref="GeneID:38738047"
     mRNA            join(<717064..717086,717112..717154,717183..717266,
                     717292..717364,717395..717605,717640..>717694)
                     /locus_tag="MRET_1281"
                     /product="ubiquitin-conjugating enzyme E2 I"
                     /transcript_id="XM_027627908.1"
                     /db_xref="GeneID:38738047"
     CDS             join(717064..717086,717112..717154,717183..717266,
                     717292..717364,717395..717605,717640..717694)
                     /locus_tag="MRET_1281"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 I"
                     /protein_id="XP_027483664.1"
                     /db_xref="GeneID:38738047"
                     /translation="MSGICRTRLQEERKQWRRDHPFGFYARPEKEADGSLNLLVWEVG
                     IPGKANTPWEGGVYKLKMYFPEEYPSKPPKCKFTPPLFHPNVFPSGTVCLSILDEEKS
                     WKPAITIKQILLGIQDLLNDPNPGDPAQADAFHLFKQDRAAYERRVRQIARELVAQGQ
                     AG"
     gene            complement(<717795..>718311)
                     /locus_tag="MRET_1282"
                     /note="MRES_05120"
                     /db_xref="GeneID:38738048"
     mRNA            complement(join(<717795..718277,718309..>718311))
                     /locus_tag="MRET_1282"
                     /product="tropomyosin"
                     /transcript_id="XM_027627909.1"
                     /db_xref="GeneID:38738048"
     CDS             complement(join(717795..718277,718309..718311))
                     /locus_tag="MRET_1282"
                     /codon_start=1
                     /product="tropomyosin"
                     /protein_id="XP_027483665.1"
                     /db_xref="GeneID:38738048"
                     /translation="MDRIKEKLNLLRAEADAAIERAEVAEARNKELEQDNLSKEQEIS
                     SLQHKLSVVENDLEAAETKLSEAKVGKEEGESHKSNVDILQRRIDMLEEQLDTTDKSL
                     KETTEQLRLTDVRAEQLERQIQGAEQERDQWEQKYEEANEKYQVSKRELDEVVQQMES
                     L"
     gene            <719081..>721015
                     /locus_tag="MRET_1283"
                     /note="MRES_05125"
                     /db_xref="GeneID:38738049"
     mRNA            <719081..>721015
                     /locus_tag="MRET_1283"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027627910.1"
                     /db_xref="GeneID:38738049"
     CDS             719081..721015
                     /locus_tag="MRET_1283"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027483666.1"
                     /db_xref="GeneID:38738049"
                     /translation="MLLGASSLTGFFGIPVRANGASAHQDKNEERFIARRRPTRSRTR
                     TRSRNASRMIDQTGSISGTSAGWTRYSPKNHPLSPQNLLKRGYHTFTCFQMPFRVKKR
                     YTLVRELGIGSYGCVALAYDSETDRHVAIKKMTRFFGKDVLTRRVLREVVCLRHLLDC
                     PNIVEVIEFDVSFIEFNEVYLVLLACDADMFQIIRSTQELTHSHIKYFLVQLLRAVHY
                     MHTAHIVHRDLKPSNLLVNANCTLCVCDFGMSRAFDSDNAEYLEKLASLGDPRTWDAA
                     FKNFDSGMRESFYVNSIDITPAKEVSLRTDPSDHNTFLRFATVMSDDEKQEGSLPEMS
                     NPVHYPGAPLTDYVSTRWYRAPEIMLCCHGGYGPAMDMWSVGCILAELLGRTPVFPGS
                     DYVDQLARIHKVLGNPPESIRASVGSERAKEHLEAMGDSPGIPWSHIYPDAPEQALDL
                     LSRMLQWDPQKRITAGEALSHPWLRRYREASYSAKTAQPFTRFDDLEYIFTPSEFKRA
                     FEEESAAILRVFKMAQKELSPSKTTSSIQSSSSTCHNDVSVYESDTHTYMETENGRVT
                     PSSEDDPALSLAPNSAYDLPSGVNSSIIPGSMMSNRQRGCASSHSLSDSEQRDQKMQK
                     RTDKLEDTLFNRACAFIGWS"
     gene            complement(<721093..>721527)
                     /locus_tag="MRET_1284"
                     /db_xref="GeneID:38738050"
     mRNA            complement(join(<721093..721227,721261..721372,
                     721406..721486,721520..>721527))
                     /locus_tag="MRET_1284"
                     /product="PHD finger domain protein"
                     /transcript_id="XM_027627911.1"
                     /db_xref="GeneID:38738050"
     CDS             complement(join(721093..721227,721261..721372,
                     721406..721486,721520..721527))
                     /locus_tag="MRET_1284"
                     /codon_start=1
                     /product="PHD finger domain protein"
                     /protein_id="XP_027483667.1"
                     /db_xref="GeneID:38738050"
                     /translation="MSKHHPDVILCRKLPGISIGRLCEHCDGKCPICDSYVRPAELVR
                     ICDECNFGSYGGRCIVCGAPGVSDAYYCAECTRLEKDRDGCPKAINLGHTRMDALFNR
                     KMQNMFQKG"
     gene            <721692..>724227
                     /locus_tag="MRET_1285"
                     /note="MRES_05130"
                     /db_xref="GeneID:38738051"
     mRNA            join(<721692..721868,721903..>724227)
                     /locus_tag="MRET_1285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627912.1"
                     /db_xref="GeneID:38738051"
     CDS             join(721692..721868,721903..724227)
                     /locus_tag="MRET_1285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483668.1"
                     /db_xref="GeneID:38738051"
                     /translation="MNDAHDNGIKGSLTQEQSITNSKLSTEARGTGRRSRVHFACTEC
                     YRRKQKCNRQIPCDNCIARRIPEKCKTFEQQEASNDLSTQFQNFERILDGKLSFLNKR
                     MDSLYEEIKHTKLKSDSQHSKKSDHGMSASYESFPGPVSDGEGSDTDTSDTGLEELRT
                     SLEPETISSAVRSLPGNQQLSLSHSFIPTKAKEVLDMEFFSPVMQESFTHCLGRKQDV
                     YKLINMYFEKLNILRHPMPEDIMAQALDGVYEHNGQITETNLSKFCLVVAVVGITVLF
                     LNVSYPELISKLELDTSQLDCDAPRRLTNVAKIACGATQNLNREDHYVILAYGILSRY
                     YFVTGNQGRSWAAVVEMVRLAHSLGLHRDGTVFDLDPETCEQRRMIWALVYPPAQNHS
                     LGYGRPPLIVNIMTDTRPPHPATPIEQVPESIRHLFKKVDPPNLLTINMIRVQFAKFL
                     SVLCLELHSVVKTFTYSKVLKLHMEFKAFVSNLPFYFQVNPMHGSLSLSPECDEHFPF
                     LKLQRCYLWFDIAFFYLSLHCPYLLRMLGRNNPKQRYMLSYDSCMDAVKLSLAMRHNL
                     LKDMPDNNRTTLLAFRWFNTTVVAGILLLLTPPGKNADTLRGFMEEFIAWRQKQQYLG
                     REVESQKDIATIRAFLHEDTRRSQGDSTWNEPDAQPNESVDTKRRRTHYDNGTSNDEK
                     NKSSDTSASPANDQNPKLQGFPAGPWPSGDLPLDMSVHTPGMFMWPDSQSMDQGSNVL
                     HEALTGLPSELPTIPMFTDPSAPSSAGVGMPVPTLNLGGMFRLPSILPQDGMSPRTMM
                     PIWPMNAGSMPNASQALKVDVTHQDQDTHELLNLW"
     gene            complement(<724246..>725001)
                     /locus_tag="MRET_1286"
                     /note="MRES_05135"
                     /db_xref="GeneID:38738052"
     mRNA            complement(<724246..>725001)
                     /locus_tag="MRET_1286"
                     /product="negative regulator of eIF2 kinase Gcn2p"
                     /transcript_id="XM_027627913.1"
                     /db_xref="GeneID:38738052"
     CDS             complement(724246..725001)
                     /locus_tag="MRET_1286"
                     /codon_start=1
                     /product="negative regulator of eIF2 kinase Gcn2p"
                     /protein_id="XP_027483669.1"
                     /db_xref="GeneID:38738052"
                     /translation="MRPQRDVSEPEAPAKRPRVSVAAWVTSSTQSADTRELPAPTTCS
                     EAYIRDRDSVFIGYVYPLVTASPTYRSALLENLSHVVHPLIPNDQFPPQFQDIAPKKR
                     KSTHDMYAFRVMQLKPGRNGLGGPSDFGTAEGHDDDGETWGSEKIMRVIREMGASDVL
                     VIVSRWYGGQMLGPVRFQHITHVARAALQKHFDLEALQECRQQLQSMDAKIQALRQAP
                     VQSHAYEDLTMDRARRLLLARKKTLDALQRPKS"
     gene            <725110..>725748
                     /locus_tag="MRET_1287"
                     /note="MRES_05140"
                     /db_xref="GeneID:38738053"
     mRNA            <725110..>725748
                     /locus_tag="MRET_1287"
                     /product="FUN14 family protein"
                     /transcript_id="XM_027627914.1"
                     /db_xref="GeneID:38738053"
     CDS             725110..725748
                     /locus_tag="MRET_1287"
                     /codon_start=1
                     /product="FUN14 family protein"
                     /protein_id="XP_027483670.1"
                     /db_xref="GeneID:38738053"
                     /translation="MSMSLFRRLPISSPLVSGAVRAPPTMRMCVRPIVRTYRPMALAA
                     TVPRVASRSSFVGAAGLLAGGSLFMGGLLGWNDKSTHCEPAPVVEPPIDGNPKSMVNV
                     YQLSFGTICGLCAGIFIKKGLKIIAFILGGAYILLQYLATKRLIHIDWNSFKNTYSSS
                     VDRLAGPVDANQNKFQQLPLMRIWRRTIDFLTTDFQERATFIAGLVLGLRLG"
     gene            complement(<725772..>726225)
                     /locus_tag="MRET_1288"
                     /db_xref="GeneID:38738054"
     mRNA            complement(join(<725772..725879,725906..726147,
                     726171..>726225))
                     /locus_tag="MRET_1288"
                     /product="fungal protein of unknown function (DUF2015)"
                     /transcript_id="XM_027627915.1"
                     /db_xref="GeneID:38738054"
     CDS             complement(join(725772..725879,725906..726147,
                     726171..726225))
                     /locus_tag="MRET_1288"
                     /codon_start=1
                     /product="fungal protein of unknown function (DUF2015)"
                     /protein_id="XP_027483671.1"
                     /db_xref="GeneID:38738054"
                     /translation="MLSLTSLAWSLVFLTLVIFLYWQRHRLWGLLPECARARLLSWRR
                     QYVPLEVFDWHSATRAGLSSTLFDIEANIRDGDARAGLDEAGMQQLHHIMQQQGISFD
                     EARLQRHRQLLQQNRIDPQTGIPLDAKAVTRL"
     gene            complement(<726285..>727445)
                     /locus_tag="MRET_1289"
                     /note="MRES_05145"
                     /db_xref="GeneID:38738055"
     mRNA            complement(<726285..>727445)
                     /locus_tag="MRET_1289"
                     /product="trafficking protein particle complex subunit 12"
                     /transcript_id="XM_027627916.1"
                     /db_xref="GeneID:38738055"
     CDS             complement(726285..727445)
                     /locus_tag="MRET_1289"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 12"
                     /protein_id="XP_027483672.1"
                     /db_xref="GeneID:38738055"
                     /translation="MDEAPSREACIAHAVASLQRSDLMSEIPTTDTFQALMTRYAPGY
                     RRSRSDTFPLTDPTLTASQLVSQAAQADHWRRIVSMTKEYILTSVRHSEAPPASDVDT
                     LLAWWHLRLVSLWKLHFFSHLQEEMHALWQVLESVQVYEGNDLRVLVDTPHVSFPMHV
                     LRAQVLLQNDRRRGVQLLWKHMQRAKEASADSLWRARYVRVALLLSSLLVEMDALPAA
                     TSLVDELASGLGSTDAALALVLCRLYLQMSDMASASRMLSCAKSAADPADAALHTAIL
                     NHEAMTRFIHEPHADHEKLVVNKEVVDQALTNTMALDAFFHGHILESIQILERLMHEH
                     PTTFTTTRALAPNLLTLHSMGANHPQEEKQRVVRFLVQSAGDDPWFVDQRAG"
     gene            <727548..>728735
                     /locus_tag="MRET_1290"
                     /note="MRES_05150"
                     /db_xref="GeneID:38738056"
     mRNA            <727548..>728735
                     /locus_tag="MRET_1290"
                     /product="histone acetyltransferase 1"
                     /transcript_id="XM_027627917.1"
                     /db_xref="GeneID:38738056"
     CDS             727548..728735
                     /locus_tag="MRET_1290"
                     /codon_start=1
                     /product="histone acetyltransferase 1"
                     /protein_id="XP_027483613.1"
                     /db_xref="GeneID:38738056"
                     /translation="MSSKWTCSANEATCLCLAGAPPPCDTVFHPDFTYPIFGEAEVIY
                     GYQRLHIRLSFTSGSLRPCLVVEYAAKHTTTSAKIDDVDAQLREFLPVDDLVAPDAWE
                     EVTRTEHDTFQPHGTQVASYRQGGKGREREFGIFHATWDTPGFRAWHKRAQIFTLFFI
                     EGASYLQDDEPYWEFFTLFERTGDAWHFVGYTSLYRFWCWPDKTRTRLSQFVILPPYQ
                     GQRHGSRLYGAVYAHILSNPRMCELTVEDPSEAFDKLRDTCDLAFLHQQSDVLAHCKA
                     PIDPAWRQAARKQYKIAPRQWARLLDMLGLLQLEENASAEQLESYRLQVKARIYQVNR
                     EVLDMLPHEQKTEKLQEAFEAVMDEYAEVTGAEIPEALLHPCTQKRKAESEEDAYRSK
                     RRL"
     gene            complement(<728730..>729974)
                     /locus_tag="MRET_1291"
                     /note="MRES_05155"
                     /db_xref="GeneID:38738057"
     mRNA            complement(<728730..>729974)
                     /locus_tag="MRET_1291"
                     /product="type 2A phosphatase activator TIP41"
                     /transcript_id="XM_027627918.1"
                     /db_xref="GeneID:38738057"
     CDS             complement(728730..729974)
                     /locus_tag="MRET_1291"
                     /codon_start=1
                     /product="type 2A phosphatase activator TIP41"
                     /protein_id="XP_027483612.1"
                     /db_xref="GeneID:38738057"
                     /translation="MSRAQHRVFEHVHTVPDRGHVAPAHAHGRPVTYDKVLERGIEIG
                     AWTIRVMRGSIANAADMDALSDKLGISPPEMPFLHNALILEHKSSGFSYIFDAVRALQ
                     CVQGVRSDQRRVPMDCVRAMSDSSRDPAAACTILRRASRSGVQVSYAKKWGESRQRAL
                     SSSPSASSSQPLSMTKSFDWTYSTTWPGMPGESNTVNVHASTVPTTTAWDTAFHFGTD
                     PVRDRIPIERLGPSSGEPILFYDDIVLFEDELADNGTSTLNVKVRVMPSGWLVLQRFF
                     LRVDNVLFRVFDTRMYVSFDSQDAERDEKTSELLPRVIRECRGMEAPYDAVLKRLPIH
                     RSQDLSLLTNVAWVTEILDQMAVQNRRMAPMAPAPAHAPHAPGVPAATIESPDKAVLE
                     SDAWDGHGYCVQVAVLRQASDS"
     gene            <730360..>731495
                     /locus_tag="MRET_1292"
                     /note="MRES_05160"
                     /db_xref="GeneID:38738058"
     mRNA            join(<730360..731439,731475..>731495)
                     /locus_tag="MRET_1292"
                     /product="cell cycle checkpoint control protein RAD9A"
                     /transcript_id="XM_027627919.1"
                     /db_xref="GeneID:38738058"
     CDS             join(730360..731439,731475..731495)
                     /locus_tag="MRET_1292"
                     /codon_start=1
                     /product="cell cycle checkpoint control protein RAD9A"
                     /protein_id="XP_027483611.1"
                     /db_xref="GeneID:38738058"
                     /translation="MELVVSGDGIRALTHILSCLYRLHDHCWMTVYREDPQQDDDSDA
                     PTAPQVHWSAVNPAGSAYGLFVLSDAFFDVLRPPQDSMFECYVHVKTLLDILRSQTKM
                     HTCTVTTAEDRLVIVLDGNHGVQKRHKLTYEDRPCVFPAVDMTSPYTLSVQPSMARDW
                     TEKLLNTGKAGECSFHCTPTTCVIRSCVYGPLEGHLRHSIQTEVRISVEQLKEYIVQR
                     DTSIYFSLWEFRAAISAAEVLGSYVRLEFAHGGDPLFLRLDTGGTFRGEFILATAGEP
                     TSAPPPPPKKRTAPPLKQPVRRPQPTAEVAIKESQDDDVLPVRPKPEPSPTTTPIPHD
                     FEENWTVYEAPDEEVPPTQTTEPTRMFEPLFP"
     gene            <731626..>733773
                     /locus_tag="MRET_1293"
                     /note="MRES_05165"
                     /db_xref="GeneID:38738059"
     mRNA            <731626..>733773
                     /locus_tag="MRET_1293"
                     /product="p21-activated kinase 1"
                     /transcript_id="XM_027627920.1"
                     /db_xref="GeneID:38738059"
     CDS             731626..733773
                     /locus_tag="MRET_1293"
                     /codon_start=1
                     /product="p21-activated kinase 1"
                     /protein_id="XP_027483610.1"
                     /db_xref="GeneID:38738059"
                     /translation="MADRSGGVSTPVGKDKRLPSEAFDPVAPFVDPFTVPPASADRFT
                     PRRHAPIPPGKARPPQPPSPTKTNYSVSSSPMYSTPPPLMPGYMPPSTYKPAYTHGAE
                     PVPPLWPKWGGHMRSHSVDTNWVPPSNEVDRQRQQLENARQEAWKQHTLSKSKSNRSL
                     VSSGSRRTSMEAGVRTNEGGSGTPRSIKSMIDGFVNSMSDAFVSPSPKRPDISTPYDP
                     RHLTHVGFNATTGQFFGLPKEWQILLQQSGITLQEQERNPQTVMDIVAFYQDTAQDRP
                     PGDENDTVWSKFGANMDDSQDSGEWLSEAYGIEVGTTGPYLQSQSPQATSKRPLPAPP
                     AQPPTFKPPELLQANKGTPTKPHVEGVTSQPYTSNPYPGKAELLVRTHSKKALQSASG
                     KDMDLRPPLGGAVIPRRRTTRSKASDAEVLARIRAVCMPGDPESMFHDLHKIGQGASG
                     GVFTARSVGTNQLVAIKQMVLAQQPKKDLIVNEIEVMCQSQHPNIVNFLNAFLRRGEL
                     WVVMEYMEGGPLTDIVLHSILSEGQIAAIARECLTGLCHLHAHGVIHRDIKSDNVLMS
                     MRGEVKLTDFGFCAQLSSAQSKRVTMVGTPYWMAPEVVSRKEYGARVDIWSLGILCIE
                     MIEGEPPYLNENPLRALYLIATNGTPKLQHPEKLSPSIRDFLATCLEVDVEKRPDADT
                     LLEHPFLEEADDLRTLIPYIQAAHKLRQDKASS"
     gene            <733845..>735344
                     /locus_tag="MRET_1294"
                     /note="MRES_05170"
                     /db_xref="GeneID:38738060"
     mRNA            <733845..>735344
                     /locus_tag="MRET_1294"
                     /product="cryptococcal mannosyltransferase 1"
                     /transcript_id="XM_027627921.1"
                     /db_xref="GeneID:38738060"
     CDS             733845..735344
                     /locus_tag="MRET_1294"
                     /codon_start=1
                     /product="cryptococcal mannosyltransferase 1"
                     /protein_id="XP_027483609.1"
                     /db_xref="GeneID:38738060"
                     /translation="MLRSRSDEVRVGHGQDMDEPLSVSERFMLDGDLYLDYDTPRASR
                     WVWSKWRSWVRSWTRSDMAMAGMSLGLFACMSFYFYIPSSLYIYVTCVCFTAPAMLVT
                     TLMRRLRTRRTDQKKRLQVTGVITAFVLACLVRDLFFSASVPRHWRTPRTSTYYIASL
                     LHNSEAILPHYSRSLLHLAKDLGPSNVYVSIYENDSRDRTPALLRTLDQQLQSLGVST
                     HIVTDTQSKDTRQKDRIERLATYRNLAMAPLNEALGGMLHGKPFDKVIWINDVFFESD
                     TVHALLDTEGGEFDQACAMDFCWLGFYDTWVMRDADGKTMRPFWPYFRATQDQAAVRA
                     RLPVPVNACWNGITAFDARWFMNATTNASLPTLTAAMALPPHRPLLHQDALDRAATVP
                     LSFRSSSTCFASESLLSSLDMHRISWPHRPRIYVNPDLVVAYDRPNYVLYGSMMRWSV
                     VAPWRYIWQYWVEHRLMGFALHILRRVDPCTEVFQPYWVPRLPHLLSSP"
     gene            <735400..>737688
                     /locus_tag="MRET_1295"
                     /note="MRES_05175"
                     /db_xref="GeneID:38738061"
     mRNA            <735400..>737688
                     /locus_tag="MRET_1295"
                     /product="conserved oligomeric golgi complex subunit 2"
                     /transcript_id="XM_027627922.1"
                     /db_xref="GeneID:38738061"
     CDS             735400..737688
                     /locus_tag="MRET_1295"
                     /codon_start=1
                     /product="conserved oligomeric golgi complex subunit 2"
                     /protein_id="XP_027483608.1"
                     /db_xref="GeneID:38738061"
                     /translation="MAEEPIPALAMPTPLGPGMPLLSPAAQPCFDVDAFLCSRTVGQD
                     VHIIVKELRAYKHTIQENLVQVINEKYRDFVALLSMLQREAGDIHSMRDKDGLQDVQA
                     SLGSLRDTLGRVEADMVALVQEEERIMREKQYLHTLLDMDRMVQKLSSLLGLGSEAEP
                     VEPPTYQRVLSQVAQCDFDDPDADECIPEELHELTHAQRMANAKQFYAALQHLLASID
                     KDQAGAYLVQLEPVLKDIYHRLLHDTMRLYDQSLHEPVDESCHTLSLALDLSLELGER
                     AVDAILDRMSAQHIEPHVKMGFDTPGPPHLPLPWDPAEAERVEALTHLAWDKPVVPPA
                     TLQLRATFDALLHQTRSLSHLFQVTEKVGGDMLDVFNDLWWQRVATSLEKVCGSQLFF
                     VGKADEFCSNYYLTQAFLRELKALAPTPRAAEAFQRHAKTMALQRRWAFSAFFQLRAR
                     DIITSLEQGLETPGQDERFYHAAFSHFLYAFTAPWYMTRHFAALSAREWRLSLHVLSR
                     YRTWLDAHTWPESHTETTARAEDSTLSNDELQELHGAMGLLVDLRVFEDRVRCVQREY
                     ILPKLLGDTARAQALCDSLNEAMEVSLHAYDAMQPRITQFVLNKLSKKCAAPLRHVRA
                     SHAQYRTRLPTDAPSAFVEQMLRPLHQVWGSDAAPIRQLPTELVTSWMNHILDGTFAR
                     YTSAVDTITRNLESLRRLKRGTLGLAADDAATADQAVYQQLATDIEALAAHIEAWAHK
                     TGLPLTLSSPAWKALWDAARRT"
     gene            complement(<737692..>739125)
                     /locus_tag="MRET_1296"
                     /note="MRES_05180"
                     /db_xref="GeneID:38738062"
     mRNA            complement(<737692..>739125)
                     /locus_tag="MRET_1296"
                     /product="UDP-N-acetylglucosamine/UDP-N-
                     acetylgalactosamine diphosphorylase"
                     /transcript_id="XM_027627923.1"
                     /db_xref="GeneID:38738062"
     CDS             complement(737692..739125)
                     /locus_tag="MRET_1296"
                     /codon_start=1
                     /product="UDP-N-acetylglucosamine/UDP-N-
                     acetylgalactosamine diphosphorylase"
                     /protein_id="XP_027483607.1"
                     /db_xref="GeneID:38738062"
                     /translation="MSHVEELRAQYEAAGQSHVFSYWDKLSGGEKAHLERQLRGIDPA
                     KLNDIVKNALIADEAARHEQAARVEPPPVESQVSTVGDVNAEYYREIGMKATAAGQVG
                     VLLLAGGQGTRLGSSAPKGCYDIQLPSGKSLFQLQAERIAKLQELASQDGAQVIVPWY
                     IMTSGPTREPTETFFREHGFFGLDPANVIFFEQGTLPCISNEGKIMLDEPGKVATAPD
                     GNGGLYAALRAPVREGQPSVLDDLHRRGVKYLHAYGVDNCLVKVGDPVFMGVCIEKQV
                     ATGVKVVKKTDPAESVGVVARKNGAFSVVEYSEIPSSLSEARDAKGELLFRAANIANH
                     FYTTEFLSKDVPAFEPKMAYHVARKKIPSIDLSTGERVKPSTPNGIKMELFIFDVFPF
                     CSNLAIHEVERREEFSPLKNASGTASDNPETSRRDLLAQHRRWLEKAGATVTADVELS
                     PKVTYGGEGLEKAAGRTFDTAQNIESL"
     gene            <739204..>741042
                     /locus_tag="MRET_1297"
                     /note="MRES_05185"
                     /db_xref="GeneID:38738063"
     mRNA            <739204..>741042
                     /locus_tag="MRET_1297"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627924.1"
                     /db_xref="GeneID:38738063"
     CDS             739204..741042
                     /locus_tag="MRET_1297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483606.1"
                     /db_xref="GeneID:38738063"
                     /translation="MDRDTGEADASAPGMNATLPRADKAGAARSNAAPTTTSFTLAPE
                     PCQEPPKKRVALTTLPGEASKREPILLNGEPAPAKEPAPAKEPAPAKEPAPAKEPASC
                     QDADHKQAKESARESSETSRKRRRSPSPIDPLSMPKPPRPTIRLQLVLTHNPTKDTDY
                     IFQIPRLAVEQLEDQHSDWAAWYKAMYLDQNTASSSHEVGLSAQELRDLGGLAKLLQK
                     YPAHGPSTQLSRKRQATEYDVGSYDTKDPFVDDSELGVDEPTHTVRTSKDGFYVASGR
                     VELAPARASTLISSHATSAFRTGPTFNRGWAAGRTNKLLAKRAASLRQQQRALPVKET
                     SEAVLPPPEPDLAPPMTAPESVQTSVPDATEKKKNKYPTRPVHPQLQGMFDHLKALVS
                     KASFAVKTKFPPELKPPLVETAKVAVELDEYNDNFFNYLPSIFPYNRFTMMKLTKREF
                     FHKHMEYFRDLQEEHIEKLSKLIDEQFPVQASEYEALCREHGVEGKDNNDHQGVDEEK
                     VGDTSVPVAETDELVRRFRWTDEMREELFTIITVENAMSEIRNEKLKLENVPDSYSEI
                     NARKAMYKRIADLFPEEGWVNTTHVSREYGSIKKRRDREDDLEEDE"
     gene            <741278..>743299
                     /locus_tag="MRET_1298"
                     /note="MRES_05190"
                     /db_xref="GeneID:38738064"
     mRNA            <741278..>743299
                     /locus_tag="MRET_1298"
                     /product="heat shock 70kDa protein 5"
                     /transcript_id="XM_027627925.1"
                     /db_xref="GeneID:38738064"
     CDS             741278..743299
                     /locus_tag="MRET_1298"
                     /codon_start=1
                     /product="heat shock 70kDa protein 5"
                     /protein_id="XP_027483605.1"
                     /db_xref="GeneID:38738064"
                     /translation="MLAQARQSFMSVLFALVSLLSLSLLLSSTPYAGSAVAAQDKRGE
                     YGTVIGIDLGTTYSCVGVQRQGRVEIIANDQGNRITPSYVAFSKDDERLIGDAAKNQA
                     AQNPENTIFDAKRLIGRKWGEADVKKDIKHFPFKLVEKKGKPAIQVTVHGKPKVFTPE
                     EISAMVLQKMKETAEAYLGHKVTHAVVTVPAYFNDAQRTATKDAGTIAGLEVLRIVNE
                     PTAAAIAYGLDKKEGESQIIVYDLGGGTFDVSLLSIDAGVFEVLATAGDTHLGGEDFD
                     NRVSEYLLKQFKKKEDLDASKNKRSVGKLKREVERAKRTLSSQMSTRIEIESFFDGKD
                     FSETLTRAKFEELNMDLFRRTLKPVEQVLKDAGVKKDEIDDVVLVGGSTRIPKVQQML
                     KEFFNGKEPSKGINPDEAVAWGAAVQGGVLSGDESLGGVVLIDVNPLTLGIETTGGVM
                     TKLIPRNTVVPTKKSQIFSTAADNQNTVLIQVFEGERSMTKDNNLLGKFELNNIPPAP
                     RGVPQIEVTFEVDANGIMKVMAADKGTGRSESITITNDKGRLSKEEIDRMVAEAEEFA
                     EQDEAIRKRVEAVNNYQNFISMLRTQVTDKEGLGGKLDSNDKATIQQHIKDAEKWMEE
                     NGQAAEAQDIEEHLQELQAAISPITAKVYSAGGAGGAGSDEPLNYHDEL"
     gene            complement(<743407..>744666)
                     /locus_tag="MRET_1299"
                     /note="MRES_05195"
                     /db_xref="GeneID:38738065"
     mRNA            complement(<743407..>744666)
                     /locus_tag="MRET_1299"
                     /product="peroxin-10"
                     /transcript_id="XM_027627926.1"
                     /db_xref="GeneID:38738065"
     CDS             complement(743407..744666)
                     /locus_tag="MRET_1299"
                     /codon_start=1
                     /product="peroxin-10"
                     /protein_id="XP_027483604.1"
                     /db_xref="GeneID:38738065"
                     /translation="MQEHSGPHAGTPSRLTIPNSAQAEIVRLHQKDAYYGELFREQVR
                     DVAVEFLGARLTHKLDNLLALGASMAYLCLCTLGGSQSLGEEYVNAIMRDRRKGGIVS
                     AKRRILFLVLYIMAPFFAVRMYSITRMYILRMDMHITRKRLREAQSMEILVHEPSLLT
                     RLWNNIEHVVHWLAHKLPGSHALTGTNGMFAYVSSAQLAMFYLSGPYYTLAHRLVKSD
                     YVYASTRRPSSQPLSYEILGMLLAFQLLIKLGLTIRRINFPALASSDDTNAATASAKS
                     ERVNPVSLKIDGAIVSPHSDSHRKDSSSSATNVPLVYADPDVSASPESLGLSPIRTES
                     EKQAFDLAQTAVRTKTVQMEAIAHEVLRCTLCMDRREPENGSSAVTECGHVFCWSCIE
                     EWLREKADCPLCRQAVQVSRLLPIYNV"
     gene            <745188..>745970
                     /locus_tag="MRET_1300"
                     /note="MRES_05200"
                     /db_xref="GeneID:38738066"
     mRNA            <745188..>745970
                     /locus_tag="MRET_1300"
                     /product="cysteine-rich secretory protein"
                     /transcript_id="XM_027627927.1"
                     /db_xref="GeneID:38738066"
     CDS             745188..745970
                     /locus_tag="MRET_1300"
                     /codon_start=1
                     /product="cysteine-rich secretory protein"
                     /protein_id="XP_027484041.1"
                     /db_xref="GeneID:38738066"
                     /translation="MYAKTLSAIAVISAAAVAAQDPPKVNTPAFVAQCKPVKLTWQGG
                     EAPYHLYVTAPGNIKEVKADLGDQKGTSMTWKVTVPEGEKFTLNLCDKSGQCQQSGQA
                     GPVGSGDDSCLKGGDDKGSKSGGSGGAAAGGGGNSKSDDDSGKSKSDDSNKSKSAGGS
                     SKSSDSKSSSSSSSSKSSGSPSSSSSGGNKSSSGSSSQPSSSSSGAAGGDGKDSEKNG
                     DDKNSDSKDGEDDKGGNDGAATFSGVPAVVAGVVGIAIAALI"
     gene            <746348..>747421
                     /locus_tag="MRET_1301"
                     /note="MRES_05205"
                     /db_xref="GeneID:38738067"
     mRNA            <746348..>747421
                     /locus_tag="MRET_1301"
                     /product="sphinganine C4-monooxygenase"
                     /transcript_id="XM_027627928.1"
                     /db_xref="GeneID:38738067"
     CDS             746348..747421
                     /locus_tag="MRET_1301"
                     /codon_start=1
                     /product="sphinganine C4-monooxygenase"
                     /protein_id="XP_027484040.1"
                     /db_xref="GeneID:38738067"
                     /translation="MKDSVAASEVHALVRQTLPFFYSNAPRYFTAISDHDLALLMPVL
                     VYWSASLFFHALDVLRPAWSEKFRLHEPEELKRRNRVSMTRVILMVMLQHAIQTALGI
                     AIMEDTPATPTERLDADPYKDIPVILNWMRSLHLPVYDGFLVRAAIALYWWGIPWFQF
                     WFACFVLDAWQYMLHRTMHEVRFLYRMLHSHHHRLYVPYAFGALYNHPLEGMLLDTPG
                     AELARVLSCMTLRQTIVFFTLSTFKTVCDHCGYAFPWYYNPIHALFPNNAAYHDVHHQ
                     TQGLRFNYSQPFFVHFDTILGTRVDPADFHAMLVKKGIKKADDEKAPLPSPSTSPYTT
                     ATVWSSVLFAGILVVPVVAYSLM"
     gene            complement(<747448..>750219)
                     /locus_tag="MRET_1302"
                     /note="MRES_05210"
                     /db_xref="GeneID:38738068"
     mRNA            complement(<747448..>750219)
                     /locus_tag="MRET_1302"
                     /product="osomolarity two-component system, response
                     regulator SSK1"
                     /transcript_id="XM_027627929.1"
                     /db_xref="GeneID:38738068"
     CDS             complement(747448..750219)
                     /locus_tag="MRET_1302"
                     /codon_start=1
                     /product="osomolarity two-component system, response
                     regulator SSK1"
                     /protein_id="XP_027484043.1"
                     /db_xref="GeneID:38738068"
                     /translation="MTSAQNPYHRVAQTLQYCLDATLQTMYKQKHTQVTVHVSAPIML
                     ASVYMSYAMQFLQARTTVGMTSSTAPSVLASVSLSAHISDLMQATLDAIAAQASANRV
                     ELFMSSASTFLLMTTRSYGTHAPRFVDNADYDEDVPWYPSSSYPIAALSLLIHTFSCL
                     VHNTAQDSRVMVEPQLGTQANQISVNAYFDASMPVDEATWPPWLGPYVDLQAVLDDFG
                     FELSQMPLSRTDMEQNEKLASFSDAKHPTRLSITLGRPLGADLLTSEASSDRDAPMIA
                     PGITMISVLPMLQRHRVYMPFPDMALCRQLREYLEDWECTLVDMHERPDLAIVCHDTQ
                     EVHTITKARIPCIFISTLPRIASTLAEPLPRSTVPITEPVSRGRLALAFYHIVCKGDK
                     QKEVSEHLLATESHSDIHALTLEAMASHLATVSTRQQVSLPSVALMSPTSPSVQGGAS
                     IMPTLDTRTPPLAQASPHVHSVGPQKIDALAPSSDYFTQAVSRLASQANIAGGRLVHG
                     ADGRPAGLYFQPRESSASQNSKAGSINPASDARRPHIQTRRSDKTGRSTSTPAPPTPS
                     YPTASMLRAAQSHLPSVKGSASAVHVPQLPTTLSFSQRDSMSRPNAPTSIQLPPRNFD
                     PKTQPSRPTPFAHLPSRSVRTSAQPQEGVVIGKRGEARRASNEVSSSPSALGAVSSPA
                     YTPLLSPHSVSRIQKRKMALREEFLPPVNVLVVEDNMVNQRILSTFMMRKKIQYDLAR
                     DGREAVEKWRRGHFHLILMDIQLPVMDGIAATKEIRRLENLDQQAENTDEGGDAPMQL
                     ARHSVIIVALTASVHTKDRVEALAAGCNDFLNKPVNLPWLQRKILEWGSMQYLLHAGL
                     TPGPSTTDCEQQTARYAPKSLWTQADMKAYSVARHLHLPKRLPSSTEDSDDDNDGKFS
                     LPPPQHASP"
     gene            <750333..>751910
                     /locus_tag="MRET_1303"
                     /note="MRES_05215"
                     /db_xref="GeneID:38738069"
     mRNA            <750333..>751910
                     /locus_tag="MRET_1303"
                     /product="nuclear control of ATPase protein 2"
                     /transcript_id="XM_027627930.1"
                     /db_xref="GeneID:38738069"
     CDS             750333..751910
                     /locus_tag="MRET_1303"
                     /codon_start=1
                     /product="nuclear control of ATPase protein 2"
                     /protein_id="XP_027484042.1"
                     /db_xref="GeneID:38738069"
                     /translation="MSMAVHASIGDALYALPEPSGRTSSVSTLLRLRTCAALGTALAR
                     TRHEPGATDADMARVVYAVYFHVTNTLMSDARALQEAESYWRRIQKEPLRAGLLWLQT
                     LPARITTRPPHTHGWGLRGLRADAEAKCSRLRRARAATVRALGMLVMAWYASETQPVS
                     ERTSYLCRVGCDAMSYDEHVDAKASLDVAAAALLDTVAMHESGVSRVLQACGVPGLWT
                     HAWPLVIVYPLISWAAATLVYRHGADIFAQITTAWDAVQGLVVGWIYVPAMRLLDTLR
                     AGRKERALLVRRDSLVADEQSLERMVEALGRDTLHMNASQLAALAERTRTGDLTQVWQ
                     VYESAMRAPLRGFLSGSLLRTLLIQVQKAKVDLEVALSGIDWLLKSQELLLGAVGLAP
                     ALALVYLLYAGLRRSVRWVSGRKLSLHASGIVQARFEAWQALRHADKLCADDADDASK
                     LGYLLLDASTLRTALHILIRHACMGHHTMRTRLLDEVEADISALECGHLSRDGWSGRA
                     HLLTRMWHSWGQLIRVP"
     gene            complement(<751914..>753497)
                     /locus_tag="MRET_1304"
                     /note="MRES_05220"
                     /db_xref="GeneID:38738070"
     mRNA            complement(<751914..>753497)
                     /locus_tag="MRET_1304"
                     /product="glycylpeptide N-tetradecanoyltransferase"
                     /transcript_id="XM_027627931.1"
                     /db_xref="GeneID:38738070"
     CDS             complement(751914..753497)
                     /locus_tag="MRET_1304"
                     /codon_start=1
                     /product="glycylpeptide N-tetradecanoyltransferase"
                     /protein_id="XP_027483370.1"
                     /db_xref="GeneID:38738070"
                     /translation="MAGDKAPDSSSGQNADASPSIKNLARLLSMLQSGAEDAPPAPHE
                     HKFWKTQPVKQPGDKSELPMGAIEPNKPPESVRSEPYALPSDFEFVTVNMDRDEELKE
                     VYDLLTHHYVEDGEATMRFKYTPDFLRWVLHHPNYNKAWHVGVRVKSSQKLVAFIAGI
                     PQELRVRDTAFHVTEINFLCVHKRLRTKRMAPVLIKEITRRCNQSGIFQAIYTAGQVL
                     PTPISCARYYHRTLRARKLVEIGFSSVPRGMTMEEHEARFALPSTTSVPGLREMQASD
                     VPAVGRLLRRYMARFDMAPRFSDAEVRHMFVRAAPTTPAAQPVIWAYVVEAPNGSITD
                     FFSFYNLPSSVLGNEKHDTLAAAYLFYYASDAAFDNEATPSTSDEASPYDIARREKPA
                     WQCSDQSHLTAREAADEAHVQPWYTESLDCKKRLKARLCALMDDMLILARDQGFDVVN
                     CLTGMDNALFTQELKFGPGDGFLRFYLFNWRVAPIAGGMGTRKDEEGLDPAAVDESAA
                     VARPLPPTTYGSGNGIVMV"
     gene            <753625..>754569
                     /locus_tag="MRET_1305"
                     /db_xref="GeneID:38738071"
     mRNA            <753625..>754569
                     /locus_tag="MRET_1305"
                     /product="pre-mRNA-splicing factor RBM22/SLT11"
                     /transcript_id="XM_027627932.1"
                     /db_xref="GeneID:38738071"
     CDS             753625..754569
                     /locus_tag="MRET_1305"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor RBM22/SLT11"
                     /protein_id="XP_027483369.1"
                     /db_xref="GeneID:38738071"
                     /translation="MSYGFLNKQGAASAGSSSADTPIVCETCLGPNPYVRMSKHHLGK
                     ECKVCGRPCTVFRWNPGSGMRFKTTEICTTCAKIRHVCQSCILDLDYHLPTQVRDAAL
                     GTSVKIPMSDINRQYFVNRMDALLDGASPEATKELVGPSRAGHEVLKKLARPEPDYQQ
                     LRPVVCSFYARGNCARGQACPYKHENASSLTPAPPSVPHHAPGHVDMPVLKKAAGAKA
                     LTAPPDERIRTLFFAGLPHNINQDELHTLLTTTMPALNKQKALASIQLVTSSHCAFVH
                     FNTRRDAENMATLLANKVILQDHPIRVAWGRRPPPSDT"
     gene            complement(<754580..>755377)
                     /locus_tag="MRET_1306"
                     /note="MRES_05225"
                     /db_xref="GeneID:38738072"
     mRNA            complement(<754580..>755377)
                     /locus_tag="MRET_1306"
                     /product="LYR motif containing 7"
                     /transcript_id="XM_027627933.1"
                     /db_xref="GeneID:38738072"
     CDS             complement(754580..755377)
                     /locus_tag="MRET_1306"
                     /codon_start=1
                     /product="LYR motif containing 7"
                     /protein_id="XP_027483371.1"
                     /db_xref="GeneID:38738072"
                     /translation="MTTTAPAFTSAQRQRAAALYRSLIRTTRELFQGDQRALLAAHQE
                     TRNRFLAAKNERDAAKIDENLDMGEQVNYLLKHNVVQGVSEPESGSTYKLRFTEHTEL
                     GSNDTIKHTRPAPTLSEIERTKGKRGTSVRAFSTGRRVLAAAGDDSGSIPRPVPRFPG
                     IVILSDGSAVRMTTTSPRHITRTTRDFTNHPLWNPMSGGRGEGDVDDDMGRLGWFRRR
                     FADAGAGEAQKPSVTFDESDLSWMSGGREARPGAAIQTRKGKGKGKK"
     gene            <755584..>758201
                     /locus_tag="MRET_1307"
                     /note="MRES_05230"
                     /db_xref="GeneID:38738073"
     mRNA            join(<755584..755612,755650..755698,755742..>758201)
                     /locus_tag="MRET_1307"
                     /product="E3 ubiquitin-protein ligase NEDD4"
                     /transcript_id="XM_027627934.1"
                     /db_xref="GeneID:38738073"
     CDS             join(755584..755612,755650..755698,755742..758201)
                     /locus_tag="MRET_1307"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase NEDD4"
                     /protein_id="XP_027484044.1"
                     /db_xref="GeneID:38738073"
                     /translation="MVSPSAPGRLTRKVRITVVAADGLTKRDVFRLPDPFAIVTVDGE
                     QTHTTSVIKKTLNPYWNDSFDVSVNDASVVAVQIFDQKKFKKRDQGFLGVINVRVADV
                     IDLELGGKALLTRDLKKSNDNLPIHGKLIIDLNTNVSTPLPANASATTSHVTSAGLAP
                     VTSTTSSSNASHAAAAASPVPSTLPGASGTTPAAVSSPALPARTGHPEAAVRPSGLSS
                     VGSSSTNIEPAVPIVVPSDSQTSATSTPHPAPNVTLSSNTQASTQSRAAEPRNPDSDP
                     LPPGWERRTDHLGRMYYVDHNTRSTTWTRPSNDPSVQRQNAELDRTRLNNMAVADDFL
                     GVEGQNQGQSNSSNRTTPVGAASNSTSSGAGPLPSGWEQRTTAEGRPYFVDHNTRTTT
                     WVDPRRQQILRIMGPNGNNLSLQPQSVSQLGPLPSGWEMRLTSTARVYFVDHNTKTTT
                     WDDPRLPSSLDQNVPQYKRDFRRKLIYFRSQPALRPIPGQCHVKVRRTHIFEDSYAEI
                     MRQQPNDLKKRLMIKFEGEDALDYGGVSREFFFLLSHEMFNPFYCLFEYSAHDNYTLQ
                     INPHSGINPEHLNYFKFIGRVLGLAIFHRRFLDAHFIVSFYKMILKKKITLADMESVD
                     ADYHRSLQWMLDNSIEGVMEETFSTLEDKFGEMVTVELKPGGEHIDVTNENKHEYVDC
                     MVEWRIIKRVEEQFRAFISGFSELIPLDLINVFDERELELLMGGMSEIDVDDWKRFTD
                     YRGFTEQDDVVQWFWQCVQQWPAEQRSRLLQFATGTSRIPVNGFKDLQGSDGPRRFTI
                     EKSGEVNQLPKSHTCFNRIDLPPYPSKEVLENKLVLAIEEGMRFGNE"
     gene            complement(<758273..>759496)
                     /locus_tag="MRET_1308"
                     /db_xref="GeneID:38738074"
     mRNA            complement(<758273..>759496)
                     /locus_tag="MRET_1308"
                     /product="integral membrane protein"
                     /transcript_id="XM_027627935.1"
                     /db_xref="GeneID:38738074"
     CDS             complement(758273..759496)
                     /locus_tag="MRET_1308"
                     /codon_start=1
                     /product="integral membrane protein"
                     /protein_id="XP_027483373.1"
                     /db_xref="GeneID:38738074"
                     /translation="MASQLRINLISMDVYICFFVTGMFITGIFNSIVVKWQDMQCVKN
                     CDAESTEAPVFYSQPVWQTLQMFIGESFCLLVYVVRSITQAYQDAKVSEECQSLLSHW
                     QVRVYGSMETAQHPTIPSYPWYKRSFKFFLPATFDIISSTLMNLALLIMPVSIFQMTR
                     GALVLWVGLLSGLFLRRYLPLYQWLSLVLVMLGIVTVGLSSLLVSVNASQIITSAMST
                     TPNSAIKTLLGLMVVFGAQIFSALQFVWEEKMMEDYLVEPLLIVGLEGIFGIFQVLIL
                     MWLLHFFIGSTPQGRSGIFDMREAWHQTMGIKNVRISAFGCAISIALFNVFGMTVTKY
                     LSATTRSTIDTFRTLGICVVSVALGWEVLYPVSGTVQVLGFAILAYGTFMFNGVISPP
                     HFLQRKQIITNYDDM"
     gene            <759696..>761048
                     /locus_tag="MRET_1309"
                     /db_xref="GeneID:38738075"
     mRNA            <759696..>761048
                     /locus_tag="MRET_1309"
                     /product="histone deacetylase"
                     /transcript_id="XM_027627936.1"
                     /db_xref="GeneID:38738075"
     CDS             759696..761048
                     /locus_tag="MRET_1309"
                     /codon_start=1
                     /product="histone deacetylase"
                     /protein_id="XP_027483372.1"
                     /db_xref="GeneID:38738075"
                     /translation="MVVLEYDASAYSKARVLPTFSDAPFFYDRTRYKADGAPDLNAGA
                     LLADAKTVHSHFNPRVSYYFTEGVSDYHYGEHHPMKPARLALTNRLVHGYGLHKYMDV
                     YSPRWASREELERFHDSDYVDFLSKTTPTTPLSSAFTRFNFADDCPVFDGMYDFCRAY
                     AGASLAAARRLRAGATDIAINWTGGLHHAKKFEASGFCYINDIVLAILELLQTFPRVL
                     YIDIDIHHGDGVQEAFYTSNRVMTVSFHKYGNDFFPCTGDISETGVGLGKHFCLNVPL
                     QDGIDDSSYVYLFKSVIEPCIYTFQPGAIVLQCGADSLGLDRLGCFNLSITAHGECVA
                     FTKAFGLPLLVVGGGGYTIRNVARCWTYETSILTGTQIPDDLPHTPYDAFFAPTHRLH
                     EPLNTRVENQNTRASLERTRVQILEHLRYLHGAPSVQMQELPPDLAGGWVDEPQEALA
                     "
     gene            <761459..>762940
                     /locus_tag="MRET_1310"
                     /note="MRES_05235"
                     /db_xref="GeneID:38738076"
     mRNA            <761459..>762940
                     /locus_tag="MRET_1310"
                     /product="chitin deacetylase"
                     /transcript_id="XM_027627937.1"
                     /db_xref="GeneID:38738076"
     CDS             761459..762940
                     /locus_tag="MRET_1310"
                     /codon_start=1
                     /product="chitin deacetylase"
                     /protein_id="XP_027483426.1"
                     /db_xref="GeneID:38738076"
                     /translation="MKFAGLLAALLLVSGASAQMQKAPGRHAIFARANAPQNAEDMAK
                     VYDPEKACKPYSPQEITQLLKGKRFPKPNKIATIVDGDDEARKLWEEIQQSNVIPKDI
                     KVKPSVDKSHDEVDGNTDKYNDDKDPDCWWTASECKKPKHQNIPEDIYECPEPNTWGL
                     TFDDGPNCTHNAFYDFLKEKKLKATLFYIGSYVMNLPYQAQRGLADGHDICGHTWSHH
                     AMSTLTDEQVFAELYYTGRILKAVLNVSTTCWRPPFGDVDDRVRAIANALGYRTIIWK
                     QDTNDWELSDTSKKGKVQKDYKKIISKAGKESPIVLAHELYNSTMGTFMENYDELSKA
                     YKNVVPVTACQNVTSPYLEGDILYPTFDELTSGKAQYKGLPSLKDMKINTDVQYKPVP
                     FSQKKVGFAPGAKQPESKGKGDTEEGDNNRSSESSKDHKGGEDDNEDESSTSQKDGVS
                     QDKQNSDNNDKGDGSGALSLSGASMLHVYFATLFALLTVMVSF"
     gene            <763103..>764992
                     /locus_tag="MRET_1311"
                     /note="MRES_05240"
                     /db_xref="GeneID:38738077"
     mRNA            <763103..>764992
                     /locus_tag="MRET_1311"
                     /product="LETM1 and EF-hand domain protein 1,
                     mitochondrial"
                     /transcript_id="XM_027627938.1"
                     /db_xref="GeneID:38738077"
     CDS             763103..764992
                     /locus_tag="MRET_1311"
                     /codon_start=1
                     /product="LETM1 and EF-hand domain protein 1,
                     mitochondrial"
                     /protein_id="XP_027483427.1"
                     /db_xref="GeneID:38738077"
                     /translation="MSALLMRTVVVNAERQSAKAWYVGGAWIVPHIQARSMRARLNAQ
                     MPVPVRVMSTSLVRLSPNDNKDVSKSDGPKQPMHIRAWNKLKEEVLHYWHGTKLLGKE
                     VSISTRLLRRMVMGYTLTRREHRQLRRTMGDMLRLIPFIPFILIPAAELLLPLALRFF
                     PNMLPSTFESKFALEEKRRRLLKLRIEMAKFLQESIKAGGLQLSESVKDSDVFKEFYH
                     KVRIGMHPTRDDVIKVAKLFDDELTLDNLSRPQLVSICRYMQMTAFGTDNYLRFQIRH
                     SLNRIRQDDMVISNEGTDSMSYQELLVACQSRGVWTHNRTREQLKEGLDVWINLHIRE
                     KISGTLLILSRAFYFVGEPEDANATYNDMQIRGLELTMSSLPDKLLNEAELHFSKEAA
                     TNKQRLEVLQEQEELIEDEAEQEEEVQAARNAEKSRKDAETKEASKIVPNAGNVTNDD
                     ARMTEEQLSELGEALAILSAKSSVLHERRELSELMKELPPEEKDEAPESDGSSSPKAK
                     SLYRRIRSMLKRIDTQLEDFDKDVGGRMNLIEASSTGKISVDDLEQALRLIKHRPDEE
                     VMHKLVDKLDVDHDGLVPLNDVLELAGKDSALAYGGQIDDIEKESAKLRSKKPRKSDI
                     VEESK"
     gene            complement(<765023..>769003)
                     /locus_tag="MRET_1312"
                     /note="MRES_05245"
                     /db_xref="GeneID:38738078"
     mRNA            complement(<765023..>769003)
                     /locus_tag="MRET_1312"
                     /product="ribosomal RNA-processing protein 12"
                     /transcript_id="XM_027627939.1"
                     /db_xref="GeneID:38738078"
     CDS             complement(765023..769003)
                     /locus_tag="MRET_1312"
                     /codon_start=1
                     /product="ribosomal RNA-processing protein 12"
                     /protein_id="XP_027483424.1"
                     /db_xref="GeneID:38738078"
                     /translation="MSTDVVSSADERRAGLLDALGRIRHLKDSKLENQRASAQLLVAI
                     EATLLERAATDSQHAEPGPTQYLLALESLLNSESTNADILGSSIYLLSIVLPYVTPGV
                     VRAKSHALLIAVAVPLAEPHGASENMNARLRASLSVVDTLLSIVPVQERATLERERTW
                     LTVWDLVLNLCMDARPKVRRRAHEVVTHILGLPSWEHAHPYAERTMAWAARTLHSVAA
                     ARGVSSTKASHKVEFDKHQGKAKHARSAAAERQKQAADGAASTGIWVCALLQTILPLV
                     PMASTTPLVHELLTLPALQNPFLTVSVYDVFAVLFRTPRTEASLDVSAPVQRDVTLLR
                     HTLDALQTNVPAHTDVHILPAYLNVLESCMVAYSAADIETAWSLTPAMWKSTMQLALS
                     ASSDASRSSADVRMAGRKLLQALARYCIPDHAVAQALTSEDALFAHMIRSLRDAFGKH
                     ALRYTHTRSDILHILASMLRRLRYPLENGGVPPAEPLLMSAVEDVAALRVQRNFDARP
                     DADAVLGAAISACGPRAFLEHLPLDLLDQHGRPNTQGGAGGARGRAWLLPLLREHISN
                     TELAHFVEELVPLSEALFEVRVRAEQPTDGSAPRPVEVKVMEALIEQIWVCFPGYCDL
                     CRDIDTALTPSVLELLVNVLRTQSALRPAILKGLQLLVQRTESVIASQVPSVQLLRQF
                     GVDQNDGRRFLEHLRSMSGVLLASLFQLLTELPAQSRGYVMECVATYLAILDAPSISK
                     TFAKVAHMLQQALATYHPSAHAPTPGKPEPNSPRYVPPVPHTMLDLFIVLVPYVHGAD
                     AASLFDACMHVLQVDDSGLQKKAYRALSRLLDGKDAAALRAHVGCAALVSRYLELDVP
                     PGAVRDRLALFRTLVPHMPDDDLGTLAALVPEAVLGTKEANQGAREEAYALLVDMGHR
                     MARGGRINRAQAGTDVQDIVAASVPEYVMMVAAGLAGASPRMIGASITALARLLYEFH
                     LALPDDMLAELLTTMLVYLESTNREIVKASLGFCKVATLSLSPQQIEQVLPSLVPALL
                     QIRHVHKNHFKAQVRHLMERLLRRFGEKAVSAHVDPENQRLIANIRKRKERAKRRRAH
                     ADGGEDEIEPIARSGGMDAFEDALYGSDSDDSDEEEEEDAAVPRRSRHREDDTYLLED
                     DDAPMDLLDEAAVGAIRTNVRHKARRQPGQEAKSFETDESGRMRISEHDHDADQDTEP
                     SSAASQAGRAYMEREMGVDGLTFRGRGGSVKFNKNNKRTRANERMDDEDEEESNGSNA
                     LPRQKKKRGKQAIGSEFKARRAEGDVQKGGMSPYAYVPLSAVAGKRNAKKASSLAITG
                     KRRKAT"
     gene            <769002..>771860
                     /locus_tag="MRET_1313"
                     /note="MRES_05250"
                     /db_xref="GeneID:38738079"
     mRNA            <769002..>771860
                     /locus_tag="MRET_1313"
                     /product="putative ferric reductase with similarity to
                     Fre2p"
                     /transcript_id="XM_027627940.1"
                     /db_xref="GeneID:38738079"
     CDS             769002..771860
                     /locus_tag="MRET_1313"
                     /codon_start=1
                     /product="putative ferric reductase with similarity to
                     Fre2p"
                     /protein_id="XP_027483425.1"
                     /db_xref="GeneID:38738079"
                     /translation="MTKRAALQKKATAGQLFFQDPLSSTLCINHVFNTRAAFWVFCVP
                     EYTPLWPPAALCQAVMRDEHIPLAKRTAPDIALAMSYLNAHELSSPSERYVYILWILV
                     AVLAVLLGLEYILCLTQRTILGVIWSKWATMQYNPRHVHRLAFVNLQLRRVVFVLLLL
                     LPLLLLTFIGPDYVDPSVALFDMNYRAPTSPSQVPTLKRRDIQWGLGQYPRIMTKKPT
                     YTLPYHTFWTMGSRFGDFCNALTPLIILFALKQAPCALFALPVFGHMASNALQYLHKW
                     GGYLLWIYAVVHTLLWIVQVAYDARVQPDLWTHLLGLPRFRWAIVAFIFLTLLVVLSF
                     PPIRRHYYEFFYVTHVICVIGFMIATWAHHPQLGGWMLAGFLVWGLERVWRAFRTLHF
                     NYSERPADLKRSMHLHEQSIKEPTTKGVLVTPKGEVPEDTESIVSLYMASTTSLTSKS
                     IETFRSPIPSDLQEELYPGFAFIQPLAGQMLRIVLRTSKPMSWSPGQWVYVGFPALSW
                     IQTHPFTIACSYVDEFEQLYESHDSASQARRDAHLLVLLVRARNGLTRRLWDHVTKRC
                     EMHAPESATSTDTVFPPIQGTSFRTQVQGIYMRTIVDGPFGGSARIDWSAYATCVVVC
                     GGCGVTLGLSVLEYLCAKVALAQMGCNVQGSWGRPFRMHRIRFVWIMRDYAHLQWAAS
                     ALRRCLEILPPEHLTIEMYATRVHYAMSQPHHDASKYEEQEDMYRPPLPQKLLHDMGL
                     RAADLTQFEDGEEKPPNAMEQSMSEHIRVQGKCRRARTRLNRARSATHDRHAPTPLPV
                     QHANRQADNELEFIQNGRMPPSALHVDTCDHYSDTSLNAYPLKPIPPPFMNASSHDIK
                     TPRSMSPPPVSANLDPLEQQDFSVLSELTRPGYPDLSGILHEEVRQSQGRTLTVGCGP
                     SGLMALLRTAVSDHTSIRKVWQGDASGHVSLFTESYEI"
     gene            complement(<771838..>773490)
                     /locus_tag="MRET_1314"
                     /note="MRES_05255"
                     /db_xref="GeneID:38738080"
     mRNA            complement(<771838..>773490)
                     /locus_tag="MRET_1314"
                     /product="phosphatidylinositol glycan, class T"
                     /transcript_id="XM_027627941.1"
                     /db_xref="GeneID:38738080"
     CDS             complement(771838..773490)
                     /locus_tag="MRET_1314"
                     /codon_start=1
                     /product="phosphatidylinositol glycan, class T"
                     /protein_id="XP_027483430.1"
                     /db_xref="GeneID:38738080"
                     /translation="MRRLFAYLVLVADVLLTSVLGVESFNETLTLRPLVGGRVHAAFT
                     FELASDASSIHHFSLLPRPLLQPVASLGVQELRLAMNKGRWMYEEWGSPAPGTLGDDG
                     VASGAEVWASINNDTEMWPRWRVLTSALASVSCASLDGIDETTTIMPNYPYFGTNSPV
                     VHAYLTSESVCTENISPLLKLLPCKSGAGLASLIKPHSILQAEFHGVSLHVRQINSVW
                     HVTIRVHVVKRPSQRQDTQWTMHDLFSAHLEKTCPVSTSSQVHVRSSTVPEPAVQSDE
                     SLREEQEWTWDDEEDEKPLPYTVPMSTYTYDTRAYRDKGLNVAFVSNATSPLLRPPPL
                     RASRQVLGHGQEDNKVHLTLRNDMPAETVHVMYYEHLPPTVLPLLHTLHSDAQVDDYD
                     EADDMVRFRDDVTEPFVVNATYKPPKVRKIMGFMELELRVPAASTLTVTYTLKKHMLH
                     YDEHIPDPHRGMDLPPAMFTPLGAHGTLWSQEHRHLPVYHVQAPHLYTTPGLIDMVLP
                     DFSMPYNVILFYSTFVALFFGTMLNHLLRRYRDVYVKSRMTQ"
     gene            complement(<773591..>774310)
                     /locus_tag="MRET_1315"
                     /db_xref="GeneID:38738081"
     mRNA            complement(<773591..>774310)
                     /locus_tag="MRET_1315"
                     /product="protein ROT1"
                     /transcript_id="XM_027627942.1"
                     /db_xref="GeneID:38738081"
     CDS             complement(773591..774310)
                     /locus_tag="MRET_1315"
                     /codon_start=1
                     /product="protein ROT1"
                     /protein_id="XP_027483431.1"
                     /db_xref="GeneID:38738081"
                     /translation="MRLAQHKRYLQRHAFQGGSSTISRHSFHSELEDRFDKMITILQC
                     LALLLWGIHCLAAEPPKDTSLTGTWSSGTGSVLTGEGFFRINNTFSVPKNTGISYSFV
                     EKNDTTGFWEQAIYQYTRGDDPDCFTVHLIWQHGNYTIHRNNSMTLTPFKTDGLQQYT
                     DTCKHEEDKIDFYSQPEFMKSFEITTYKHYALGADPQWSYKLQLYEFDGNPKPPMYLH
                     YRPPLMYPTQPMHKMMWGLMG"
     gene            complement(<774335..>775330)
                     /locus_tag="MRET_1316"
                     /db_xref="GeneID:38738082"
     mRNA            complement(<774335..>775330)
                     /locus_tag="MRET_1316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627943.1"
                     /db_xref="GeneID:38738082"
     CDS             complement(774335..775330)
                     /locus_tag="MRET_1316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483428.1"
                     /db_xref="GeneID:38738082"
                     /translation="MGWKNEKAASSQAEMPRLDMSTIMQTQFEYECHAEHAHPRGHTS
                     KLLSLLTLAILRHLLWTKTQIPQPLQALEREAFAILDEDDEASCLCLSYGTEGNIILP
                     FAMTRHLPSPVQRVTQLLYSCTKLETRLYDLLASLESTPPTTLHIAMVTGQSLSFPQH
                     VLVLHFDQMLAFGKNYISDSDSCKDRRRKVSALMERKFVRFTMDKDLLLPDTCRPTRT
                     RILVCAPPQLQISGWHPRPHWRAPAPTVAPDPELESETEDLLAQASEPRVSKMNQATH
                     TFLSRHSARKEACTRLKRRSTRSVHISVDGGLRPARGVATPNVTWYECDVHVVGF"
     gene            <775568..>779299
                     /locus_tag="MRET_1317"
                     /note="MRES_05260"
                     /db_xref="GeneID:38738083"
     mRNA            <775568..>779299
                     /locus_tag="MRET_1317"
                     /product="coatomer subunit alpha"
                     /transcript_id="XM_027627944.1"
                     /db_xref="GeneID:38738083"
     CDS             775568..779299
                     /locus_tag="MRET_1317"
                     /codon_start=1
                     /product="coatomer subunit alpha"
                     /protein_id="XP_027483429.1"
                     /db_xref="GeneID:38738083"
                     /translation="MQMLTKFESKSNRVKGIAFHQKLPLLAASLHNGSIQLWNYQTGT
                     IYERLEDHEGPVRGVCFHPTQPLLVSGGDDFKIKVWNHKTGKVLFTLHGHLDYVRSVF
                     FHHEHPWIISASDDQTIRIWNWQSRTCIAVLTGHNHYVMCAQFHPYEDLIVSASMDQT
                     VRVWDFTTLKQKSTTAQPMSLEDQIARANSTQMDLFANMDVVVKYVLEGHDRGVNWAA
                     FHPALPLIVSASDDRQIKLWRMSDTKAWEVDTCRGHYNNVSASLFHPHAELILSVSED
                     KTIRVWDMGKRIAVQTFRRENDRFWVLTAHPHLNLFAAGHDSGLIVFKLERERPPFAL
                     HDHSLYYVRNKQVRHMDYNTGKDHALLSIRRLGNQYVQPRSLSFNPAERSVIVTSING
                     DVGVYDIAPLPHSPPAELGESGAVGRRGQGSTALFVARNRLAVLQKSQQRVEIRDLLN
                     QVVKTLMLPQPTNEIFYGGPSHLLLSTAMGVQLYDTQQQTVTGEIAAPSVKYAVWSPD
                     GARVALLSKHTITLTDKHFSSSHLIHETIRIKSAAWDSNGVLLYSTLNHIKYALPQGD
                     VGIIKTLEQPLYLTRVKGSTVYCLDRQACPRTVVMDPTEYKFKLALLEGRYDEVLSII
                     RTSRLVGQAIIAYLQKKGFPEIALHFVQDKTTRFDLAVECGNLDVALETAEAINVPEI
                     WTRLGQAALRLGAHHIVERAYQKTKDFDQLSFLYLITGNFEKLAKMTSIAERRGNVQS
                     LYHNAVFNQDAVTQTRVLQGAGLGVLAYITAQRSGDSTWAAEIAQESGLDADEAQSLA
                     GIPVSTTAGLPPVVYPTSQQDWPLAAPTENFFDKELVAGTDGGVIFEDNVVDAPSHDI
                     DSWLEGDALVDDEEDAYGEPNADGGIVDLNEAEEAWDLDDGVVAPAEEELGQQIAPLA
                     DVASLEGLTAGSAEDEHWLRNSPVAADLAAAGAFDTALQLLQRQAGIVSFTPLEPWLW
                     RCFVAARAIVPGAPGMSPLIVHLRRNNEASEGDLGKVLPASPLRLSYLETHHLASAYR
                     AVSGNKLHDAEHEFRSLLHMLVLTPALNELEAQRILELIGECREYLIGISIELERRAL
                     AADAAQANEPAQVARIVELAALFTHVQMQPQHQMLALRIAMMEARRVGNLAMAGHFAR
                     RLIELQPPAKVVQVAQQIVSLSDRQPRDAVQVSSYSVHESDYVICAGSHTLIPAGGMN
                     AVEDPLTGAKYLPEFRGSLCKVSHISEVGRLATGLRNLA"
     gene            <779829..>781328
                     /locus_tag="MRET_1318"
                     /note="MRES_05265"
                     /db_xref="GeneID:38738084"
     mRNA            <779829..>781328
                     /locus_tag="MRET_1318"
                     /product="mitochondrial ribosomal protein subunit"
                     /transcript_id="XM_027627945.1"
                     /db_xref="GeneID:38738084"
     CDS             779829..781328
                     /locus_tag="MRET_1318"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein subunit"
                     /protein_id="XP_027483432.1"
                     /db_xref="GeneID:38738084"
                     /translation="MASSVLTRLLQRTRASTFDPYVSQVYQTPIAHAVRGDFGGKRPL
                     PSSWQSTADMPAPRSHAGDLRYVTIQDIDDKHGMTNWKESEREPLFRKRWFEAGVRVS
                     DKPRRDVLGVGVTGEDDVNSTFGPPPRIVYDHATLEDTNKLTSNVVWGTHHGRFASSA
                     DVLPNYHAMDERTFQRFLSDIRRRRPKFRKALEQNRKNVAIHERMERLAHEATDRTVT
                     QDEWDKAATYPQNSSGVDMWTEARLPHAPQSAADYLRSSAEARYNAPNSQVLATPTHA
                     APAHPLRGLQYAQPDNIYTYLLNEPMQGRALHRVEEARRNRYFMNTDASLTVAIGGRA
                     GHLPLQYRYGLDTVDYSRVNPKRGESYFRVLHAWMDMAPTVANARRAPPHVDCEPELG
                     SLRTQVMALRRPGVENSYEAPPMPGSRRWIDDPDASHASAFGGNALRASSPEAGSLFG
                     SLARKGRSGHMPRQDSRRQRLQKRKRDVPGSVQRDIQMLNNIKNLLSSQ"
     gene            complement(<781391..>781922)
                     /locus_tag="MRET_1319"
                     /note="MRES_05270"
                     /db_xref="GeneID:38738085"
     mRNA            complement(join(<781391..781427,781456..>781922))
                     /locus_tag="MRET_1319"
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /transcript_id="XM_027627946.1"
                     /db_xref="GeneID:38738085"
     CDS             complement(join(781391..781427,781456..781922))
                     /locus_tag="MRET_1319"
                     /codon_start=1
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="XP_027483433.1"
                     /db_xref="GeneID:38738085"
                     /translation="MSSIKGPAPAPESFPRAEKLKIGIVHARWNKEVIDALVTGTLES
                     LEKAGVKAEQVAIDSVPGSWELPMGTLKMIKRENVDAVVSIGCVIKGSTMHFEYICDN
                     SLKGLMRVSLDTQVPVILGVLTALDEDQALERAGIGRKKPGHNHGLEWGTAAVEMALK
                     EPKPETP"
     gene            <782170..>783879
                     /locus_tag="MRET_1320"
                     /note="MRES_05275"
                     /db_xref="GeneID:38738086"
     mRNA            <782170..>783879
                     /locus_tag="MRET_1320"
                     /product="3-hydroxyisobutyryl-CoA hydrolase"
                     /transcript_id="XM_027627947.1"
                     /db_xref="GeneID:38738086"
     CDS             782170..783879
                     /locus_tag="MRET_1320"
                     /codon_start=1
                     /product="3-hydroxyisobutyryl-CoA hydrolase"
                     /protein_id="XP_027483497.1"
                     /db_xref="GeneID:38738086"
                     /translation="MWRRVSFNPALSLSSSVRTRLNASSRATPRVNLIVRHMTNAQWA
                     AVSADLAHPPKHLLHQPDSPVQLLNNGSMRILQLNREKALNAIDRYMISLINVAFDEI
                     EPSPNAATVLFRGVGRSMCAGGDVMSLVTLADKEDIVERSKSVWFFQWELMQNYRVHY
                     LRRATTQLGHPKTYIGLWDGIIMGGGVGMTVHSTLRIASERTLFAMPETAIGYYPDVG
                     LTYVFSRLDGGVGMYIGLTSSRLSGADAYITGLATHYVHSHAVEEMIRRIGSMPLSTA
                     AHEENVVSAINEFATDPFMDDPSLAQKSVFLGDTRIAMDYAFTRDSIEQIIAVLEDIA
                     QRRHDSFTGKDLAARGLSLTEEVAEWASVTHATLLSRSPRSLKVTFHAIRLAHHQTYE
                     ENMHTNIRLSTAFCDLSIGRDFHTGVMHVLGKDPVTGQRRTGVPNWEPSRLEDVSDDY
                     IQTFFFGEASKAHRAGMQLEVPKLSNVPHTGKDREARKEREAKLRGVGPLRWNPKFNV
                     HALPTEAELAALHEGSHPASGSYVLEPNELLDTIDKYYQHKPGVRVKVQDWLDRRQRA
                     QKA"
     gene            <783967..>785517
                     /locus_tag="MRET_1321"
                     /note="MRES_05280"
                     /db_xref="GeneID:38738087"
     mRNA            <783967..>785517
                     /locus_tag="MRET_1321"
                     /product="asparaginyl-tRNA synthetase"
                     /transcript_id="XM_027627948.1"
                     /db_xref="GeneID:38738087"
     CDS             783967..785517
                     /locus_tag="MRET_1321"
                     /codon_start=1
                     /product="asparaginyl-tRNA synthetase"
                     /protein_id="XP_027483496.1"
                     /db_xref="GeneID:38738087"
                     /translation="MLGRASRVVCAYQHAMRLPILARFYASSSLPPTLHVLRRDAETK
                     LASLQDMDTPVTAHGWIVSVRRHKTRTFVELTDGTLGGAATLQVVLPGEARELTPGQA
                     VQLSGRMAAGRGRTSSQRVEMHAEDVHVLASTDLATYPLANVMHSTKPDSVAADIVRQ
                     ASHFKARTLHFGAIQRTRTRMELAMAVWMDQNDFCKVQPPVITSSDCEGGGEIFRVVA
                     ESDVAQHPSSKENMTAFWSGNDAYLTVSAQLHLEAYALGLSRVWSLCPVFRAEGSATN
                     RHLAEFWMLEAEMCWLPSKNALGAILDCTEEVIKSAIRAAWHEGRARDDMTFLGATDE
                     HAAIIEAPWPRISYTHAVQLLRAQCTEVPAPVWGDSLRSDHERWLAAHFGMPVFVTDF
                     PSNIKPFYMRENDEQVILDETLHPEAAGASRKTVACFDLLVPNVGELVGGSVREERHD
                     VLLQRMKQSGLQSSSLTWYIHDLRRYGGPPHGGFGIGMERLLSWLTHTYHVRDLVGFP
                     RVKGPLRH"
     gene            complement(<785529..>786572)
                     /locus_tag="MRET_1322"
                     /note="MRES_05285"
                     /db_xref="GeneID:38738088"
     mRNA            complement(<785529..>786572)
                     /locus_tag="MRET_1322"
                     /product="cell division cycle protein"
                     /transcript_id="XM_027627949.1"
                     /db_xref="GeneID:38738088"
     CDS             complement(785529..786572)
                     /locus_tag="MRET_1322"
                     /codon_start=1
                     /product="cell division cycle protein"
                     /protein_id="XP_027483495.1"
                     /db_xref="GeneID:38738088"
                     /translation="MTTRSAETDEIVPKPSRTDTTTALWATQYGAWYPIHKRYTPKSI
                     VIDLESVEPRFVEWLDEDGVVLANANDSRHARTLPQNDEAEVMSEPSDDEDEGAFFPA
                     LNAEIERALQAYGAVFPKLNWSAPQDAAWIMPGHTLRCQTPNDVYLLIKSSDFAMKDV
                     VQLRELAQACEADSRYQRPRLQLVLKKWFDMPRSHEFRCFVRDAHVVAACQREISFYE
                     HLQNTATQERIQSMLMDFYNENMAQTTPPDIVFDVYLTKNLDSCFLIDLNPWLDRTDT
                     LLWTGEELEQADAQPTRIPLRVLTSPAQASQALPTYSAHMVPADVIELSQGEHIAEFA
                     QKWSSQLQEAARP"
     gene            <786657..>787465
                     /locus_tag="MRET_1323"
                     /note="MRES_05290"
                     /db_xref="GeneID:38738089"
     mRNA            join(<786657..786696,786725..786944,786973..>787465)
                     /locus_tag="MRET_1323"
                     /product="nuclear cap-binding protein subunit 2"
                     /transcript_id="XM_027627950.1"
                     /db_xref="GeneID:38738089"
     CDS             join(786657..786696,786725..786944,786973..787465)
                     /locus_tag="MRET_1323"
                     /codon_start=1
                     /product="nuclear cap-binding protein subunit 2"
                     /protein_id="XP_027483494.1"
                     /db_xref="GeneID:38738089"
                     /translation="MSHIVEHLNAPSSYRDSRARSSAHEQQMALAQSATLYIGNLSFY
                     TTEEQMYELFARVTNVTGGGGIKRIIMGLDRNTKTPCGFAFVEFYTHDEAVDCMRFVS
                     GTKLDERVIRCDLDPGYRDGRQYGRGRSGGQVRDEYRQEYDAGRGGWGHNRMREEEER
                     KRIEEQQKRESERHERREEVYQESQGAIDAHKAPAGADAEYYETERSQRAGPEATMDD
                     TAMSAKRQRDEDDYADAAAHDSSDAKNPRTEE"
     gene            complement(<787554..>788098)
                     /locus_tag="MRET_1324"
                     /note="MRES_05295"
                     /db_xref="GeneID:38738090"
     mRNA            complement(join(<787554..787831,787867..>788098))
                     /locus_tag="MRET_1324"
                     /product="nascent polypeptide-associated complex subunit
                     beta"
                     /transcript_id="XM_027627951.1"
                     /db_xref="GeneID:38738090"
     CDS             complement(join(787554..787831,787867..788098))
                     /locus_tag="MRET_1324"
                     /codon_start=1
                     /product="nascent polypeptide-associated complex subunit
                     beta"
                     /protein_id="XP_027483493.1"
                     /db_xref="GeneID:38738090"
                     /translation="MPIDQEKLAKLQSAQRVGGKGAPRRKVVKKPKGAVAGGDDPKLQ
                     AAMKKLAVQPLTGIEEVNMFKADGNVLHIDAPKVHGDVGSNTLAVYGKAQNKELTELL
                     PGILSQLGPESLASLRKLAESYQAISAQQAEAQKAAENEGVPEVSGNFDEVEQGKDAP
                     AETQVDQLD"
     gene            <788336..>788675
                     /locus_tag="MRET_1325"
                     /note="MRES_05300"
                     /db_xref="GeneID:38738091"
     mRNA            join(<788336..788546,788602..>788675)
                     /locus_tag="MRET_1325"
                     /product="F-type H+-transporting ATP synthase subunit e"
                     /transcript_id="XM_027627952.1"
                     /db_xref="GeneID:38738091"
     CDS             join(788336..788546,788602..788675)
                     /locus_tag="MRET_1325"
                     /codon_start=1
                     /product="F-type H+-transporting ATP synthase subunit e"
                     /protein_id="XP_027483492.1"
                     /db_xref="GeneID:38738091"
                     /translation="MSPTPVVNVVRYSALIAGIGYGIMHGQKLQAKYDDRVEKQAIKH
                     REDQIKKAKEEYAKIRAAKLAPASPNAVVSDPEDPNFDLERLLKHWEEKL"
     gene            complement(<788849..>790881)
                     /locus_tag="MRET_1326"
                     /note="MRES_05305"
                     /db_xref="GeneID:38738092"
     mRNA            complement(join(<788849..788884,788932..>790881))
                     /locus_tag="MRET_1326"
                     /product="acetyl-CoA synthetase"
                     /transcript_id="XM_027627953.1"
                     /db_xref="GeneID:38738092"
     CDS             complement(join(788849..788884,788932..790881))
                     /locus_tag="MRET_1326"
                     /codon_start=1
                     /product="acetyl-CoA synthetase"
                     /protein_id="XP_027483491.1"
                     /db_xref="GeneID:38738092"
                     /translation="MTGNYLVDIPPRVNGSDETRPKAHIDESTYPILHQRSIHDNDAF
                     WADEANRMISWFVPFKTVQYGTFDRGNIAWFVEGQLNASYNLVDRWAFERPNDTAIIW
                     ESDEPGNDVKISFSELLERVCQVAGVLQSMGVKKGDIVIIYMPMIPDAVVSMLACSRI
                     GAVHSVVFAGFSSESLRDRIQDCRARIVMTSDEGRRGGRTIATKSIVDAALKECDSVE
                     HVLVSKRTGAVDVPWVDGRDQWLNELAVRQRTYLPPVMVNSEDPLFVLYTSGSTGKPK
                     GVVHTTAGYLLGAGLSVKHVFDVHPGDRFGCMADIGWITGHTYIVYGPLMNGTTTLLF
                     ESTPMYPTPSRYWEVVDRHELTQFYTAPTSIRMLRRMGAEHVEKYDLSSLRVLGTVGE
                     PINPEAWHWYNDVVGRKHCAIVDTYWMTEGGSHMITTLPGAIKSKPGAASKPFWGLEP
                     VLLDSQTGAVLEGFDVEGVLAMSKPWPSLARTILNDHGRFLDTYMRPYPGYFFTGDSA
                     YRDHDGYIWIRGRVDDVINVSGHRMSTSEIESALILHPGVAEAAAVGAPDEVTGQSIT
                     AFVALKPDYLGNTAEDLTKELVMQVRRAIGPFATPKRIMCVRDLPKTRSGKIVRRVLR
                     KIVCNEADQLGDLSTLQDPSILDHLLSVFNEDTANAK"
     gene            complement(<791396..>791809)
                     /locus_tag="MRET_1327"
                     /db_xref="GeneID:38738093"
     mRNA            complement(join(<791396..791460,791490..791592,
                     791631..791696,791723..>791809))
                     /locus_tag="MRET_1327"
                     /product="replication factor A3"
                     /transcript_id="XM_027627954.1"
                     /db_xref="GeneID:38738093"
     CDS             complement(join(791396..791460,791490..791592,
                     791631..791696,791723..791809))
                     /locus_tag="MRET_1327"
                     /codon_start=1
                     /product="replication factor A3"
                     /protein_id="XP_027483490.1"
                     /db_xref="GeneID:38738093"
                     /translation="MSQAIPLVNSAQLAERQSEEVRLIGKVLKVSGDILLLEASDHGT
                     VEVKLQVDDSPATQYVEVVGRVSRTGDSVTQHALLSMGDDIDLTLVEHLVHLTPKYPA
                     LFSE"
     gene            <791953..>793011
                     /locus_tag="MRET_1328"
                     /note="MRES_05310"
                     /db_xref="GeneID:38738094"
     mRNA            <791953..>793011
                     /locus_tag="MRET_1328"
                     /product="sensitive to high expression protein 9,
                     mitochondrial"
                     /transcript_id="XM_027627955.1"
                     /db_xref="GeneID:38738094"
     CDS             791953..793011
                     /locus_tag="MRET_1328"
                     /codon_start=1
                     /product="sensitive to high expression protein 9,
                     mitochondrial"
                     /protein_id="XP_027483434.1"
                     /db_xref="GeneID:38738094"
                     /translation="MSRRLCMVGINARPIWTGNLGNKSTNSLAKMPLAIRCLRFCAAY
                     SSSSHVLGRWRHKLHLWIEHTKPVAKDKLIEWNHKWNDYSGYAEINALKEQVQRQSDR
                     LSELQHNKNVAKMVYLQAVSDRSASQRRINDLLSRKSSWKDDDLTEYTTLLHSEHNHV
                     RAEERSQHEYERTESEMQRGFDDLMRSVMRRYHEEHLWSDRVRSISTYVSVGLGILNV
                     MVFILALFFVEPFKRRRLAQTLETRLLTSEDAFRERMQTVLVSVDERLANMESMLSLP
                     DAPQSSTAHSIPKLGTNFLWVSDIFSWLSICGTYVAKVWNQVNVFTAPQELARITATS
                     TGVVIGGVFSYLLLLLII"
     gene            complement(<793152..>796349)
                     /locus_tag="MRET_1329"
                     /note="MRES_05315"
                     /db_xref="GeneID:38738095"
     mRNA            complement(<793152..>796349)
                     /locus_tag="MRET_1329"
                     /product="elongation factor 3"
                     /transcript_id="XM_027627956.1"
                     /db_xref="GeneID:38738095"
     CDS             complement(793152..796349)
                     /locus_tag="MRET_1329"
                     /codon_start=1
                     /product="elongation factor 3"
                     /protein_id="XP_027483498.1"
                     /db_xref="GeneID:38738095"
                     /translation="MPPKSAEGTAHIDASDFKNSAAAEAAAAGPQQEVKAALFDEAQL
                     LSTGDKKAAVELTNLVKIEGPFALRNLGIEDVIKKGLGDKKNAAGREGACMLVMTLFD
                     EGVGHEVEPFIMNGVFETIVEAMGDKEKIVRQRAEDALLLVVRNMSTWAGPQVIRVLL
                     HQMRTAGKWQVKTGCVRLLEELVQTCPDMVARMMTEIIPVMAEVIWDTKSDVQKASRA
                     SLEKLCALVSNKDIERFIPALIQSLIHPVEEVPKTIQLLSATTFVQEVDSPTLALMTP
                     LLSRGLTERPTATKRKVAVIIDNMSKLVDNERTVRPFLPKLLPGLIKIETTVSDPEAR
                     SVVQRAINTLRQVGKVDGDGSEVKPLEDIDLNKTVELVDAALKQQQLSGPDTLVHYVS
                     QLVTNLSNFRVFEPEEWDGTLSRYLRLFRPSNQEKAHAIVHDLLKQLAKSTGEEVEVF
                     DDEEEGEDLCNCQFSLAYGAKILLNTATLRLKRGHRYGLCGRNGSGKSTLMRAIQNGQ
                     VEGFPSPEEVRTWYVEHDLDGSEGDISILDFIQTDKRLNVDRETASKTLQEMGFDEQR
                     QAGPITALSGGWKMKLALARAVLFKADILLLDEPTNHLDVLNVAWITEYLQKTSATSI
                     IVSHDSQFLNNVCTDILHLNRFKIKRYPGNLDAFVKRVPEARAYVELNSGEDYSFKLP
                     NPPLLDGVKTKEKSLVKMRDVVFQYPNTPAPQLRGITMQLSLSSRVAVLGPNGSGKST
                     LVKLIVGDTEPNEGELWKHPNLVIGYVAQHAFHHIDQHLDKTPLEYMLWRYQTGEDLE
                     EHMKATRQISAEEEEAMKRGAIYEHEGVKRVIDDIVGRKKLKNSFQYEVSFKNMSSAD
                     NLWLSRDELMRRGFEKKIMEVDSREAQKAGMLRPLVRREIEKHFEDFGLEREFTSHNT
                     MRGLSGGQKVKVVLGAATWRMPHIIVLDEPTNFLDRESLAALIAAIQSFEGGVAIITH
                     SQEFSEGTCKEIWRMQDGTLHASGHNWVEGQGSGERIDKKKNDEEEVKFDALGNKIVE
                     EKKKKKLTSSEARKAKKERMARRKRGEEVFSDEEL"
     gene            complement(<796680..>799172)
                     /locus_tag="MRET_1330"
                     /note="MRES_05320"
                     /db_xref="GeneID:38738096"
     mRNA            complement(<796680..>799172)
                     /locus_tag="MRET_1330"
                     /product="DNA excision repair protein ERCC-2"
                     /transcript_id="XM_027627957.1"
                     /db_xref="GeneID:38738096"
     CDS             complement(796680..799172)
                     /locus_tag="MRET_1330"
                     /codon_start=1
                     /product="DNA excision repair protein ERCC-2"
                     /protein_id="XP_027483553.1"
                     /db_xref="GeneID:38738096"
                     /translation="MKFYIDELPVLFPYPKIYPEQYSYMVDLKRTLDAKGHGVLEMPS
                     GTGKTVSLLSLIISYQRFYPASRKLVYCSRTVSEIEKALAELKRLMAYRAKYNTNSSL
                     ADGSEPMDVEDNDIKSGMEDILALGLSSRKNMCVHPVVSQERKGKVVDARCRDMTSAW
                     ACEKGRQEPGSVELCDFHEELGKLDPGHLIPHGVWTIEELIEYAKDKGICPYFAVRRM
                     MAFCDVIIYSFHYLLDPKVAEQVSKEISKDAIVVFDEAHNIDNVCIESLSIDLTRPIL
                     DNAYRCVNRLAEKVDEVKQVDSARLQDEYLRLVEGLQQQSDEREAESFMANPVLPDDL
                     LQEAIPGSIRRAEHFVAFLRRFVEYLKTRMRVLHVVAETPASFLQHLKEITFIERKPL
                     RFCAERLRMLVQTLELTRIDEYTALQTVAFFATLVSTYDKGFLLILEPFETEQATVPN
                     PIFHFTCLDASLAIAPVFERFSSVIITSGTISPLDMYPKMLRFDTIVQESYTMTLTRQ
                     CFLPLVITRGSDQVAISSRFEVRNDPSVVRNYGNILIEYSRCIPDGVVAFFPSYLYME
                     SIVAAWHDMGILDEVWKHKLVFIETPDAPETSIALENYRRACDNGRGAVLLSVARGKV
                     SEGIDFDHNYGRAVIMFGVPYQYTESRILKARLEFLRENFRIKENDFLTFDAMRHAAQ
                     CVGRVLRGKSDYGIMVFADKRFARSDKRAKLPKWIAQYIEPVFSNLSTDMAIVESKRF
                     MRTMGQPFPAGKNGISLWDVDDIERRQQKERDAFERLMQQDSDSWVAKHLADAETTSK
                     DSKDPSTALHELADEFDAEFGTGTELTQVTVP"
     gene            <799316..>800245
                     /locus_tag="MRET_1331"
                     /db_xref="GeneID:38738097"
     mRNA            <799316..>800245
                     /locus_tag="MRET_1331"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627958.1"
                     /db_xref="GeneID:38738097"
     CDS             799316..800245
                     /locus_tag="MRET_1331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483554.1"
                     /db_xref="GeneID:38738097"
                     /translation="MSAALTTLCQGDRRVRDKARMYIDRVKIWETQGNARSTQDISVS
                     VPAVCVWLAAESLGVDSIQRRDLQRSSGLAPARFDRAENLLRQVIATFDRTRHERVRT
                     IPAARPERPNTRRRSSSQGELIQRAKEIQESAQLGHGAVEAIPPPSLSEAFDAAMKQP
                     PQTKVPKRIREESPNTPLSATDSAPDRPKADPSHIRLLALGVPSYREGLQFEVQHRRK
                     RGRPPAKRLSIQEMNDKQFLDSLWSNSPLPSHLRIAGMPLRYVQKAHLDAHDSHWIRP
                     LPRPLSIYSGNPSGTRLRPSHIWNKWVSQTLCP"
     gene            <800370..>802610
                     /locus_tag="MRET_1332"
                     /note="MRES_05325"
                     /db_xref="GeneID:38738098"
     mRNA            <800370..>802610
                     /locus_tag="MRET_1332"
                     /product="Rab guanine nucleotide exchange factor SEC2"
                     /transcript_id="XM_027627959.1"
                     /db_xref="GeneID:38738098"
     CDS             800370..802610
                     /locus_tag="MRET_1332"
                     /codon_start=1
                     /product="Rab guanine nucleotide exchange factor SEC2"
                     /protein_id="XP_027483555.1"
                     /db_xref="GeneID:38738098"
                     /translation="MGRNRVDKTAPIDDDRKEKEADSNEMRGELKSSALDESASTSND
                     ANDHASSISLPEQSSSGAMGSLKQKENDDQTRAIAEDALITEAFEVASSQDRATDSGA
                     AVAQEEVESVPRSKMMSSPSQSTVILTKMQPEELEAELRSQVSSLNTKLVAAINRMSD
                     LEDELTVSQNSLRTNKAMVEELSKERDQYVSALSTGLLVEKSHVSSEMQRMMERVVDA
                     TAQRGKAENDRTRIEAELEELSASLFNEANKMVAVERLNRSRSETRSKELEASLQDAE
                     RIMADHQEMLKSLQSEVDALRKQPAQQGSSLTSPMCAPQIHINIPPYQEFLAFLSHIR
                     GLRQQLDPFFAMQKRGEDWTKDPSINTTMSANGNLTATSAASYTRHNDYPHLPVFSEQ
                     LVRLSSQTSLPFIRRVMEEDTDPCLRLSQAPGLTWLARRQASASVLDGEVVIEPLFVG
                     GIVPDERALRTDYGALPAASCTLCSAPLLNVTSIMEGTPHVSSADAGLHRPHSTARTN
                     PTTRRSFPSLFQTLRRGHADRSRTLPSDDPKEKAPMAESTSSPGLNESLPIPTHYFRL
                     SEQASNRYLLCSQHCLYRLRAICAIWAFIRALERAVVLEGKDESDMLRPSSILPLTNL
                     SDKPSVPDADASNSDASEPANEAENDKDPIPHSDTSKPGDVQELEGSEAPSDPSLTGE
                     NPSSSETPSPAIPAAPTAARTSFTGRNDRQGLKWEESLWMEVLRYKEVIWKARVGMDL
                     ENLHIV"
     gene            <802665..>803093
                     /locus_tag="MRET_1333"
                     /db_xref="GeneID:38738099"
     mRNA            join(<802665..802733,802762..802888,802912..>803093)
                     /locus_tag="MRET_1333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627960.1"
                     /db_xref="GeneID:38738099"
     CDS             join(802665..802733,802762..802888,802912..803093)
                     /locus_tag="MRET_1333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483556.1"
                     /db_xref="GeneID:38738099"
                     /translation="MRRWTRILEQVLTAYATVAVTRWLSRSPSFLRLTERVLHEWDHL
                     PHRWQGKPVPPFEPMTSDSKIDYEEKHDEPSPYPLSDNQPQASSGFAKRRTETHRAPP
                     PPKSESDRVAEQIREIQEKLRRR"
     gene            complement(<803095..>804861)
                     /locus_tag="MRET_1334"
                     /note="MRES_05330"
                     /db_xref="GeneID:38738100"
     mRNA            complement(<803095..>804861)
                     /locus_tag="MRET_1334"
                     /product="5-oxoprolinase (ATP-hydrolysing)"
                     /transcript_id="XM_027627961.1"
                     /db_xref="GeneID:38738100"
     CDS             complement(803095..804861)
                     /locus_tag="MRET_1334"
                     /codon_start=1
                     /product="5-oxoprolinase (ATP-hydrolysing)"
                     /protein_id="XP_027483557.1"
                     /db_xref="GeneID:38738100"
                     /translation="MPALAADPVLLSLFSNRFMAVAESMGRSLQQTSISTNIKERLDF
                     SCAIFAADGSLIANAPHLPVHLGSMSFAVKYQADHLHELGQGSFKRGDVVLANHPSAG
                     GSHLPDMTCITPVFAPDRDEIIFFTASRGHHADIGGILPGSMPPNSTNIFEEGAQIRS
                     FKIVSEGVYDRDGLVRVLVDEPSKYAGCSGTRCFRDVESDLKAQIAANHKGIQLLNDL
                     VEEWSLETVQTYMTHIRENAELSVRNLLRRVAAIQNATELHAIDYMDDGSPIELHITI
                     DPQTGSAVFDFDGTGPEVCANHNCPTSVAYSAIIYALRCMVSEDIPLNQGCLAPIDVR
                     IPQGSLLSPSDTAAVVGGNVLTSQRITDVVFRAFEAAAASQGDCNNLTFGTGGNDETG
                     RLIEGFGYYETIAGGSGAGPSWHGTSGVHTHMTNTRITDPEIFERRYPVYLRQFGLRS
                     GSGGRGHFVGGDGVIRDIEFLEPRMQVSILSERRVHRPYGLQGGEPGSNGVNLWIKQR
                     REEDGDLLEPDRDGHLPPRVINLGGKATAQFGMHDRIVVYTPGGGGFGTPGHQEARAS
                     PRPTPLPYRGSVVDWQSRQVSA"
     gene            <805164..>807791
                     /locus_tag="MRET_1335"
                     /note="MRES_05335"
                     /db_xref="GeneID:38738101"
     mRNA            <805164..>807791
                     /locus_tag="MRET_1335"
                     /product="mitogen-activated protein kinase kinase kinase"
                     /transcript_id="XM_027627962.1"
                     /db_xref="GeneID:38738101"
     CDS             805164..807791
                     /locus_tag="MRET_1335"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase kinase"
                     /protein_id="XP_027483558.1"
                     /db_xref="GeneID:38738101"
                     /translation="MDYTFDSVTYQAVRSWGLSEITAWLQKNKLGQHSSAFVRNDIYG
                     GALLHLDHGVLKEMGITNVGDRLRLISAIRLLHKQCAMNAAPNNSSMLTAESCMNYAN
                     APLSYAPPIISSNTPLQRSATMSHPSTHPVRTASPLPLNGSLPPLGVMQSARVMSMVN
                     PLAHPMTPTQRAHTMEPPLSDLGSRSTTPSSSSSTNSRRPNTATGVTDAHDCPAPSIL
                     NAPRSPSSSHVRRPASALSTTNPTSTGYTVGRGAFGPKSRLGQISAPYNLRRPETESE
                     ERPPETTTDPMTGTPVKSLETIRRHIVKFLAEDGSSRSVDVSQCGRASDILSKVLHKF
                     GLPTDPEFIRYMRHWVVAMTDADAQLKVLSEMELMTVCSQPHNYAPVWQHGLYLLRTT
                     DNAPLRPGSQREVPNDSFRYALAKTKRASTFSILNGLGGNSIHGTEDFISPTRSTAYN
                     RVKAATPDLTSSLPAVRRRVQNFFGQRPPSELISSHLSDFFPSTNSNDLHSCSDPPDS
                     PGFDSRRPSPPMRLHPVSKLYQANKSDEDMKDLAKAMVTVDEITLDLERRESMHSPSF
                     DSTSLSTVLEHPTTHVECKETTEIFTQPRMRWHKGALIGAGSFGKVFLGMNAKTGMLM
                     AVKQVELPPSDDDCTRRWRMMVDSLESEIELLKSIHHPNIVQYLDSHSDGKFLNIFLE
                     YVPGGSVVSLLRNYGAFEEPLVQNFVRQILLGLQFLHAGGILHRDIKGANILVDNKGG
                     VKISDFGISKKVESGLLGPKSGKFPGLQGSVFWMAPEVVKQSMYTDKGDIWSLGCCVV
                     EMFSGVHPWPRLDQMQALFQIGQNRAPPLPDDISPLATDFLRCAFNLDHTVRPSAEAL
                     LGHAFLLQPADTSEIEGSD"
     gene            complement(<808036..>811732)
                     /locus_tag="MRET_1336"
                     /note="MRES_05340"
                     /db_xref="GeneID:38738102"
     mRNA            complement(join(<808036..811696,811731..>811732))
                     /locus_tag="MRET_1336"
                     /product="manganese-transporting P-type ATPase"
                     /transcript_id="XM_027627963.1"
                     /db_xref="GeneID:38738102"
     CDS             complement(join(808036..811696,811731..811732))
                     /locus_tag="MRET_1336"
                     /codon_start=1
                     /product="manganese-transporting P-type ATPase"
                     /protein_id="XP_027483559.1"
                     /db_xref="GeneID:38738102"
                     /translation="MRVAVQSDEIASVTLHRRSPLLLHVYVLPFLFLYPLLAYTYYVK
                     YDEWVKSEEWTFVYTAGLLTAHALTYLATHWSVQAKALFTSTSVDAVDMADYVCVLPH
                     PHKGEGEMLRLTRVRREKERDEYSFVYQADKYVLAFPDSQAPPTSITSSSDIRERTFR
                     RVMYPPDAHMPIGDVQECKGLKADKLARAKRIYGGNALDIPVPRFMDLFIEHAVAPFF
                     VFQLFCVGLWLLDEYWWSSLFSLFGLVAFECTVVFQRLRTLSEFRTMSIQPYQVHVYR
                     DGQWEELSTSELLPGDLMSVTRTKADSALPCDVILASGSAIVNEAMLSGESTPLLKEG
                     ITLRNKTDILNDQGADKQHCLFGGTKTLQVTPGEPLEGVPAPPDGGALAMVLRTGFGT
                     TQGRLIRLMVFTNENRVSANNWESFVFIAFLLIFAIAASAYVWVNGLKMNRPKGKLML
                     DCVLIITSVVPPELPMELSMAVNASLVALAKHAIFCTEPFRIPYAGRVDVCCFDKTGT
                     ITGEDLEVQGIVGTTSNGSEPLSDTLVDPTQASTTTKLVLAAAHSLVIVDDEVVGDPM
                     ERRALESIGWTVKPGDVICSNEAKGSQVKIQTRFLFSSALKRMSTLSQLPSNKQLLAA
                     TKGAPEVLKPMFAVLPSNYDDLYRHYTRRGSRVIALGYRWMDASAARSIKREQVECEL
                     QFAGFLVLHCPLKADAIDSIQQLNESSHRCVMITGDNALTAVRVAEEVEIVVREPIVL
                     DKREGGEDHDLVWRTTEDKIVHDQDVDCDLHRHLFDEYDVCVTGAALRQFETQPAKLR
                     ELIANTVVYARVSPNQKELILSTLRSLNYITLMAGDGTNDVGALKAANIGVALLDGSE
                     EDLKKIMEHQRLERMKKVYESQLNMMARWNQPPPPVPPALKAAYPQLEEAHQKAARKM
                     HSQRASNPMAQFDLSSITSSMQDMDDEEGPPQIRLGDASVAAPFTSKLSNVKAVCSII
                     RQGRCTLVATIQMYKILALNCLIQAYALSVQYLDGIKMGDYQLTVSGLLITVCFYCIS
                     RGRPLDRLAPERPVSTIINVYVFGSILSQTALHVATMILIQRLSVEFEHPGEVDLEAK
                     YTPTLLNSGVYLLSMSQIVSTFAVNYIGRPWRESIPENKALYYGLLGASAVAYLGALE
                     LLPEMNEWLQLVKMSSDYKSWLIGAMFVDFVGSYLLEIFWKLFADLQPKPLIVQGQKL
                     RTQYKQKVVGSDKKRD"
     gene            <812016..>812930
                     /locus_tag="MRET_1337"
                     /note="MRES_05345"
                     /db_xref="GeneID:38738103"
     mRNA            <812016..>812930
                     /locus_tag="MRET_1337"
                     /product="solute carrier family 25 (mitochondrial
                     dicarboxylate transporter), member 10"
                     /transcript_id="XM_027627964.1"
                     /db_xref="GeneID:38738103"
     CDS             812016..812930
                     /locus_tag="MRET_1337"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial
                     dicarboxylate transporter), member 10"
                     /protein_id="XP_027483560.1"
                     /db_xref="GeneID:38738103"
                     /translation="MAMEQEKQIPSKNEVVKKQTKKYPFWLGGVAASIAVCFTHPLDL
                     AKVRLQNSPAKISTAKLLRNTFVNEGVRGLYIGISASILRQMTYSLTRFAAYEELKTF
                     VSHHTDPSQPTSIWTKISVASLAGAAGGVAGNPADVILVRMTSDLFRAPSQKFQYKGA
                     INGLMRAYREEGAHVLFRGITPNVVRAMLMNSSQLASYDFFKETLQNTGLFAPGSLIQ
                     YLASSLLAGTVATTITSPADVIRSRVMNARGTDSGIPQLLKAMRIEGPMFMFRGWVPS
                     WIRLAPNTVILLTVLEKLRETVDWVRGT"
     gene            complement(<813002..>813418)
                     /locus_tag="MRET_1338"
                     /db_xref="GeneID:38738104"
     mRNA            complement(<813002..>813418)
                     /locus_tag="MRET_1338"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627965.1"
                     /db_xref="GeneID:38738104"
     CDS             complement(813002..813418)
                     /locus_tag="MRET_1338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483552.1"
                     /db_xref="GeneID:38738104"
                     /translation="MARNIRAAPASKKKTRSSLAFYQKKEDANQVSKSAQRRRKQRER
                     EQLAGNKAGMQELTDMVSMIKSEEAIKPASRQTDSTFKSKREMLRRERQRQPVILADL
                     HQSVNPFAALRTHARNTLDLAPRKPLTENDEQMDAS"
     gene            complement(<813490..>816627)
                     /locus_tag="MRET_1339"
                     /note="MRES_05350"
                     /db_xref="GeneID:38738105"
     mRNA            complement(<813490..>816627)
                     /locus_tag="MRET_1339"
                     /product="Rab6A-GEF complex partner protein 1"
                     /transcript_id="XM_027627966.1"
                     /db_xref="GeneID:38738105"
     CDS             complement(813490..816627)
                     /locus_tag="MRET_1339"
                     /codon_start=1
                     /product="Rab6A-GEF complex partner protein 1"
                     /protein_id="XP_027483654.1"
                     /db_xref="GeneID:38738105"
                     /translation="MYWPTGSARRLSVESLGFADIHKEAVHMSCARDGLLWLVLTRSA
                     LLIWRAKPAELVTAMVRTARSIHEYGANVCALWRHDSGALVVRTERDTLLFYDLVQPT
                     DSPAVHALSDSTAPDLVPSAQALLSTFQPATGDAYHTIGSDLFGGRIALQLVFRDALQ
                     VDPGISAIASIDPEILVATRSPAAVQLVPWPSASDEKPSAPPAPPILLTSLPWLTPSP
                     LVHAEHSYATDLSAWLTEDGCAYIVGQSDAWVGARAYSASEKDAMPVTTAVNARFSLL
                     AIGLEQGDIVMFEFHTPTQSPEKTHTLSLSPHVTGRVTSLAWTADGHALAVGYERGWA
                     VWSMFGHLMTHSFRSDWHSMTRVYRDTFQFGTQSVFWALGGTELFVLPRVPPADAPVK
                     DDDKTLVYILPFLKAASTAQLMPAETDGCFLVGDTGAYIYRGNEQSDAGLLMPDNDIW
                     RHVPFPPEYLTWQWPIRYAAQSSDGRFLAIAGRRGLAHYSTVSGHWKMFEVASQALSF
                     CVRGGMVWFQHVLIAACDCMGEIQIRLYSRDQALDNAHLLDLAVLDAPVVTLQLLDTS
                     LLLYLANNTLVHYNITTTREHVRLILCGSISFEGIIGEPSRVRAFSWLLPEQAELLPT
                     DDLTMATLVFLIDGMLVLLRPARASDDDQLSYDLQVLHEHIESYWTPIYAYEALQQSL
                     WSFDGQRVLVWLNLLQHSDAPDYVFSVDDTYPLCILTDRGIILGADSQAVVRRTLDTT
                     AYRLRLSTSLFLDRILRALLQRRRVSEAIHSAAPYVPLEYFAHVLEVLVHDILEKEAD
                     ESTSASLEDNAPLLPAALAFLDHFDVALQVIVRAARKTEVSRWAYLFDAAGRPSDLMQ
                     RCLDRGDYASAGAYLLVVHEMEDRPTSIQATATALARFEENEEWEILRHALSFLHGVD
                     QNGETLRVCASIAAKLVRGKSLLSMENDLEGAQEVPLSRTPFQPKQSSRKYSLNESPR
                     RPSSLARKTSLSSMPLSPAQNTPVLRASSAHVLHRAARSASITLSPSMPRMQANGRLV
                     IPVSPSPGPLTPKPS"
     gene            <816738..>820787
                     /locus_tag="MRET_1340"
                     /note="MRES_05355"
                     /db_xref="GeneID:38738106"
     mRNA            <816738..>820787
                     /locus_tag="MRET_1340"
                     /product="mitogen-activated protein kinase kinase kinase"
                     /transcript_id="XM_027627967.1"
                     /db_xref="GeneID:38738106"
     CDS             816738..820787
                     /locus_tag="MRET_1340"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase kinase"
                     /protein_id="XP_027483619.1"
                     /db_xref="GeneID:38738106"
                     /translation="MSPRDHRHPLMAWDGRHEVRRGEPAQAADKNMEYLRSYMERLPT
                     DSHGPLETPEQLSTPQAEYNMLDHVASEDDPKKRMEWQKMLHSVLESDVLSSETKRIA
                     AADATTPTPAQTMYGVWLSVRALHVGHRSTFDDAELEEHLVIEERERLVPSVIDDVMQ
                     FRRPEPQAGEDERKALYKAVHDVLERVDMVDELFPSQRQLEAAYPAWAQAPFQQKLAA
                     LQAWYNVVRELQAQVQLLHRWTGTLTSSDGELRPTMSPAVPQVESDDDTSAVERIFRE
                     SNINEAFEQRTLKRLRMLIEMARKTLREYHHMFCDMNLSSLEPDVMPLVRFPMWLAEG
                     ALRQRLEYADKLNEPSVVLVESLAEDLRSVLALACRIKKSYVQLTVPEPDIGWNLPVE
                     SDEKFDASICSALHFFFRLLLFRLKSTPYFKEVDLLEPEWDFLASAVHVVPGGDVIVA
                     HKMAAMINRIFARIITYFQRELQVPVAAAESKLAQHGRAEPPKTGRLTGGRVPMSVAD
                     MTRWIQTVFNNARVRSRRLIGFARRIRTQLETAAEYDLRSLRAAKTQPPLDLNGFLQT
                     LLKADYFLVYTSAFEERGVFLLAEPSLHDKPHVIQDLVFQCVRPRWETLDEDISSAVS
                     ETAPPHPQYLLFLTPREPFLWTGRVMTLPLPWIEVDMKEQRLRLVANGVGPHLEQCKQ
                     HLAWQFSMYGPGATPSGSHEHASMTHHEEPGKEPKASNVSMYTFPLAPVYERMAHLSL
                     IQHELKLMTKAGYALTDVVVHSVPAIRQQMLRLRPLTLADQALCDELVHACFSIAFDQ
                     GSRVLGYIQSMRLHSHLSTALVQLSVEWIAFICDDCVLTERRTFKWAVEALENAMTMT
                     MGENIFLLSEQEFFSLRSKVSSCMALLISHFDILGARSSAVKEKEEKRAKRGAQGTLK
                     NTASYSQEVMNLLERRMDALSVCDKQREDVLRERHVIGRVLDDTRLEDRGLQLLASRG
                     VQMRWQQGRFIGGGTFGTVYLAVNLDTGGLMAVKEIRFQELTSSPNLFKQIHDEMNVM
                     EMLRHPNIVEYYGIEVHREKVYIFEEYCQGGSLTQLLEHGRIEDEIVLQVYALQMLDG
                     LMYLHSQGVVHRDIKPDNILLDHMGVIKFVDFGAAKVLSRRSISTNASRRSSSFLQPG
                     AVNAQGQSLQGTPMYMAPEVVKGETQGRENAMDIWSLGCVILECAKGTRPWHNLDNEW
                     AIMFHIGMAKQTPALPDESQLSPLGIDFIRQCLTIDPEKRPSAVELRQHAWIQALVEE
                     LNAANEEEEEAQRLMDEEESTDHALVDDARLSVPSGTHGTRRSSFSLSSVPGAPDHSH
                     PRYEALVADVQYRREGEQIKAMLEPDDGL"
     gene            complement(<820789..>822216)
                     /locus_tag="MRET_1341"
                     /note="MRES_05360"
                     /db_xref="GeneID:38738107"
     mRNA            complement(<820789..>822216)
                     /locus_tag="MRET_1341"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627968.1"
                     /db_xref="GeneID:38738107"
     CDS             complement(820789..822216)
                     /locus_tag="MRET_1341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483618.1"
                     /db_xref="GeneID:38738107"
                     /translation="MLKVRHLVAGALLALVWSQSWYIRTIFPKAFFSVPREMPSWYIR
                     GGESSASPPVTCTPIRSEYVADPQAYETNPSTSQHAQIADACEDLRMSDTLGAVFLSC
                     DPGRKEWNVFMGPTANPASRGALWVLDYKTAPDALPVLVPMEGYPDSYDFHPHGMSLF
                     VYDENHARMFVANERAAASTIEVLDLERSHEWRAQYVRTLQHPVGTHMPNALHAVGPH
                     ELYVSNSKLVSHRPPPRASYEAAIAAQLGNFLAPWLYVALTYRPLFHIFSFLDDLLGL
                     GYVSHVRFTDDGDVTHSIFAQRISFANGVVVSGEQLYVAATGAAGIYVYDRHKKAASK
                     RRTYVPLPFLPDNLALTVPSEHRTSPGVLAAGHPSLSDMHLYALHSTPARRAPSWVAE
                     VWYNASSSTEHDEAGVPFPSDRAIPRLPYGWHVQTLFQSSGRHAPDVSAATTALWDPT
                     PQGHGAFFVTSLYGPSPLLCKGMYS"
     gene            <822360..>823069
                     /locus_tag="MRET_1342"
                     /note="MRES_05365"
                     /db_xref="GeneID:38738108"
     mRNA            join(<822360..822361,822390..822397,822426..>823069)
                     /locus_tag="MRET_1342"
                     /product="YKT6 protein"
                     /transcript_id="XM_027627969.1"
                     /db_xref="GeneID:38738108"
     CDS             join(822360..822361,822390..822397,822426..823069)
                     /locus_tag="MRET_1342"
                     /codon_start=1
                     /product="YKT6 protein"
                     /protein_id="XP_027483621.1"
                     /db_xref="GeneID:38738108"
                     /translation="MKLFGLLIFANQPGQQAVPLVSAWDLNSFSWMQRGTVQDMMAFM
                     AKTVSERTQPMQRQSVQENNFTAHVHARPAADGVSGVLVSDSEYPVRVAYSLLGKVLE
                     EFLIKLPKSIWQAQARQLAASGQIPPKGEGIVRTSEFPYAQDYLARYQDPRQADTILR
                     VQQELDDTKIVLHNTIDSVLQRGEDLDKLVEKSGSLSQQSKMFYKSAKKQNSCCGIM"
     gene            <823137..>825044
                     /locus_tag="MRET_1343"
                     /note="MRES_05370"
                     /db_xref="GeneID:38738109"
     mRNA            <823137..>825044
                     /locus_tag="MRET_1343"
                     /product="Vps51/Vps67 family protein"
                     /transcript_id="XM_027627970.1"
                     /db_xref="GeneID:38738109"
     CDS             823137..825044
                     /locus_tag="MRET_1343"
                     /codon_start=1
                     /product="Vps51/Vps67 family protein"
                     /protein_id="XP_027483620.1"
                     /db_xref="GeneID:38738109"
                     /translation="MAGPPPPRSAEKLPGDVDRLFEEHSVRDIREYAENLSQQAHAKQ
                     QAVRTLVGDRFHDLLSVSRTVVDMSDQLAVLRQTIDMLLSTSSDVARQHASRANEALP
                     LQGEASDVESAAAMLLVADAPETIRSALKSHAFIQAAWSIIFAGKAWTWIKERLDMQQ
                     FPMLVSQWADVQALRKYVLTRIDVCMQQAGMHTSYVLDVMLAYILLQHVSLASALSHF
                     HAQRVKAALRTCTEGEYDHADRLQRLLRSVTRTLHHTHELWARPSLSRILSHLSRAFF
                     ELGAPRSQNLSFAPVAARDFYAHVPMPVQAYELPPMQETLPESDIYHYNEMFVRRVCS
                     ELDSVLSFITTEHRLDSLLPCRDRLKACVQNSPALSILEARLSDILVTQVRHILQQML
                     SDVPRKFAEALEQGKKDTNAMHDLFTAENVPPTHWRTVRTAGMEACISLVETRLRRIM
                     CSNEDVTASPVHETCMILCDELMQADTSTTEQMHWLLRVCVALYTSPVLTQMLSRTFF
                     ERLADIYMELGTRWAHACVQHVVSMDRGAMPSLLMLAHELHTLGPSPLPPPPVWDEWA
                     RQTHRAHRASPTQQPMPWQAILEAEDIDTNRVRLILAPWIFTHGQPHQATARRDSPAR
                     VARVAPPFISW"
     gene            <825140..>826789
                     /locus_tag="MRET_1344"
                     /note="MRES_05375"
                     /db_xref="GeneID:38738110"
     mRNA            <825140..>826789
                     /locus_tag="MRET_1344"
                     /product="PHD finger domain protein"
                     /transcript_id="XM_027627971.1"
                     /db_xref="GeneID:38738110"
     CDS             825140..826789
                     /locus_tag="MRET_1344"
                     /codon_start=1
                     /product="PHD finger domain protein"
                     /protein_id="XP_027483616.1"
                     /db_xref="GeneID:38738110"
                     /translation="MDVTPPIVDLSHHGEGPAAARKEKTRVAAPHLPSTEILPSNGLA
                     ALYDPVPLPLPKSSASAPRRTSRASRKRMRTEEAIEQQASKSSSTSSAADLAALGVTP
                     RATEDELEALNNDFCDTCHGHGRFICCDGCPRSFHFACVCPPLDVDEMPFPNGTLLPH
                     ADHAQPHDMRAQRALADDSWFCQVCFSERMLPTRAPEGYGPFGVLLQHLDTQNPRIFA
                     LPDDIRTYYKGVGTGPDGVYMDTIAQRPVKLSRQGFAEDRDPYQLRDKHGAAVLCFRC
                     GQSALPDGPTAAQGGASHGRRMLSCDFCTLHWHLDCVDPPLTGMPPATRRWRCPAHNT
                     PGRPRMRIPRAPQHTRTIQVAPGAPLPATGDAYVHIVPDPHDKFFDPETGAGRAKPYE
                     DVTLDTDHIRTRYRIPEKTIRLAFWTAITRQWRRQQPPTPSAPAPTSSPRVSYPPLDT
                     LVDVAVSQNEPLEFVPTPTGEVHAEYATATRASLQPDALPYVPSQRSSYEGNERPSGQ
                     VPSTYLYPREIRELRDLKRTVEMLGGFERVRGLLEKVASHE"
     gene            complement(<826801..>827418)
                     /locus_tag="MRET_1345"
                     /db_xref="GeneID:38738111"
     mRNA            complement(<826801..>827418)
                     /locus_tag="MRET_1345"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627972.1"
                     /db_xref="GeneID:38738111"
     CDS             complement(826801..827418)
                     /locus_tag="MRET_1345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483615.1"
                     /db_xref="GeneID:38738111"
                     /translation="MHATVLRALERCCICDAYFLPRDSAPKRRTHIEACARFAGLGSD
                     EVEDLVVKAGAQALASLRAAHEVQYAKSTLFTKMGERHVPDKRLVKLSAVIGPRLEAC
                     ALASAAEEHRAARVTCRAYLQRLCVNEMPHGPRRCPIRRGRARTRAVAFHAALTGEVS
                     LESIAADMDRQPSPFPPVHRRPYTHSVHASVPTSDDEHDVYDTYV"
     gene            <827535..>828761
                     /locus_tag="MRET_1346"
                     /note="MRES_05380"
                     /db_xref="GeneID:38738112"
     mRNA            join(<827535..827647,827672..>828761)
                     /locus_tag="MRET_1346"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627973.1"
                     /db_xref="GeneID:38738112"
     CDS             join(827535..827647,827672..828761)
                     /locus_tag="MRET_1346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483860.1"
                     /db_xref="GeneID:38738112"
                     /translation="MSTSTPDTSVSVPDNQSPFLVSDSSYQSDEGVLERARILLEEHA
                     HDTPGVQALKERFQRTTDPEDVLADTELQLDWDLYRDVPDAIVQEEALLLDYFRKLKF
                     IYLEQETKLRFLADLQDDPETGQEPQILSTADVAHREQECKRVKQQLVEAKTNVRRLR
                     SDIDEVSDALIEPWEAVEQHTSEAASLLSDITDMELELAKIKAAEGTHGSLTTAEAEA
                     VCDEQILSMQAIDDETTHIVHDMEAAKKELSEALHQLDRLKAERTAAEKLANDARLGM
                     GRDRGRDWELERLCAKHTSTLDALEHALGITQMSAPRPNELHVAITRPAAKRSRRSTR
                     SAPVEHQRTLVLRFNEPGGRLEHLELWDANDTKPLTIDEDLSALVKEAIHTNHAAALV
                     QAVWRSYA"
     gene            complement(<828782..>830047)
                     /locus_tag="MRET_1347"
                     /note="MRES_05385"
                     /db_xref="GeneID:38738113"
     mRNA            complement(<828782..>830047)
                     /locus_tag="MRET_1347"
                     /product="2-oxoglutarate dehydrogenase E2 component
                     (dihydrolipoamide succinyltransferase)"
                     /transcript_id="XM_027627974.1"
                     /db_xref="GeneID:38738113"
     CDS             complement(828782..830047)
                     /locus_tag="MRET_1347"
                     /codon_start=1
                     /product="2-oxoglutarate dehydrogenase E2 component
                     (dihydrolipoamide succinyltransferase)"
                     /protein_id="XP_027483617.1"
                     /db_xref="GeneID:38738113"
                     /translation="MLSIATFASARAMARAAPKYSAALAMASSRHFSMSTRLLGIVKV
                     PEMAESISEGTLSAWHKKVGDYVNESDEVATIETDKIDVSVNSPESGVITEVFAQPED
                     NVEVGKDLFKIEPGEPPKDQPKEEPKKEESKPEQPKEEPKKEEPKKEEPKKEEPKQEQ
                     PKQEPKKEEPKKAADNQAQEQVPKAGARTESRVKMSRMRKRIAERLKESQNTAASLTT
                     FNEIDMSPLMAFRSRHKDRILKETGVKLGFMGAFSKACALALREIPSANASIEGEGLG
                     DTIVYRDYVDLGVAVSTEKGLVTPVVRNAESMSILEIEQAITELGLKARDNKLSLEEM
                     TGSTFTISNGGVFGSLFGTPILNLPGSAILGMHAIKEKPWVVNGKVEVRPVMVVALTY
                     DHRLLDGRDAVTFLVKLKQYLEDMPTMLL"
     gene            <830184..>831167
                     /locus_tag="MRET_1348"
                     /db_xref="GeneID:38738114"
     mRNA            <830184..>831167
                     /locus_tag="MRET_1348"
                     /product="solute carrier family 25, member 38"
                     /transcript_id="XM_027627975.1"
                     /db_xref="GeneID:38738114"
     CDS             830184..831167
                     /locus_tag="MRET_1348"
                     /codon_start=1
                     /product="solute carrier family 25, member 38"
                     /protein_id="XP_027483772.1"
                     /db_xref="GeneID:38738114"
                     /translation="MSSQNGDRQRSIPAWKTLGVGGTAGLASCVLLQPMDLLKTRMQQ
                     ERTVGQAPLSAMKRLVRAYKSVVDTSGYRGLWRGTVPTIARNVPGVAAYFYTLNQLRW
                     FVAKWQIPMLSIRGATNASLSGQTSTMARLSNTGNILTGAITRVSIGLVLNPISIVKA
                     RFESNHFTQDAYPTLWTSFRTLYKDGGLKGLFRGFSATALRDAPYAGLYLALYEQHKT
                     WLGRLSRTGTGSWWVVSTSGLCAGTLATILTHPFDILKTRLQTTPAHLLHSTANGQMK
                     LSLFATARHILSSDGWQAFCDGLGLRCARKAASSMIGWSIFEIGHRWVSIT"
     gene            complement(<831220..>832875)
                     /locus_tag="MRET_1349"
                     /note="MRES_05390"
                     /db_xref="GeneID:38738115"
     mRNA            complement(<831220..>832875)
                     /locus_tag="MRET_1349"
                     /product="RasGEF"
                     /transcript_id="XM_027627976.1"
                     /db_xref="GeneID:38738115"
     CDS             complement(831220..832875)
                     /locus_tag="MRET_1349"
                     /codon_start=1
                     /product="RasGEF"
                     /protein_id="XP_027483603.1"
                     /db_xref="GeneID:38738115"
                     /translation="MKHIQRRGLSRSRSSSSSSFSSSSSSTTSDTWRDDGLDELLYKS
                     LWNKSVMSDVRDQDLNDLLSQNPVFYTTKQENDVETCMKMLIHDERCPVAGANVCGLI
                     STLCHTENGPASLFTQIFLRNFRTFCSPRNCLRSIIQKYEMAEDNAHRERILSILVVW
                     VRDYWDTVQDSPILNDFLDFSRRTSLTYQSKSVQELEFTSNWLLRSRHLPTSPQVYDI
                     TQHTLRTQGSSVPPLSIVSRSLLNALKNSSSIWEVPILEFDPLELARQITLCENTLFC
                     AIDPFEPMYPVETDVPGSLCPQYIRKMTKMSTQLTSWISQCILRETNLKQRTLVLRFF
                     ILFAEASYKLQNFNLLMEILGALGSSNLHRLKKTWKGLPPRKIAKFEFLSQLMDPARN
                     FSAYRTCLHNAQGPTLPFLGLILTDITFAKEGNPVQRVFPGLDFPLVNLARFYQLKQI
                     LRDFQKFQKPYSISPVPEIQTFIRGIYEDGRHRTPSEYFAENEQFYYRSLELEPRMAA
                     PMNVPASPRSPGSRMFVRTLTALRNSSETLSLSANNRSDSRSR"
     gene            complement(<833445..>834668)
                     /locus_tag="MRET_1350"
                     /note="MRES_05395"
                     /db_xref="GeneID:38738116"
     mRNA            complement(<833445..>834668)
                     /locus_tag="MRET_1350"
                     /product="mitogen-activated protein kinase kinase"
                     /transcript_id="XM_027627977.1"
                     /db_xref="GeneID:38738116"
     CDS             complement(833445..834668)
                     /locus_tag="MRET_1350"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase"
                     /protein_id="XP_027483400.1"
                     /db_xref="GeneID:38738116"
                     /translation="MPSMLHRRNRNFKGLLLKDTQPPEPPPPDERAAPFARFIQSDGS
                     SCSLHTPSEQRSRSSLEEATTSPGNVGGLSSSTSSLPHSHDAVTQRMNNLDLGPGQLP
                     RLDLSASNLRTLADLGAGNGGTVTKVLHIPTGILMAKKVNFIDAKPEVRKQILRELQI
                     LHECRSEYIVGFYGASLSDVHIFMCMEYMDMGSLDTIYQKHGPIDVNICGKIVYTVVH
                     GLSYLYEKFRIIHRDVKPSNILVNRQGQIKLCDFGVSGELINSMADTFVGTSTYMSPE
                     RIQGDQYSIKSDVWSLGVTVIEIAHGCFPFAIETEDDPDATTHAAPRGVQDVRSLSIL
                     ELLQHIVHEPPPKLNPDADFPPDMINFVTVCLCKDPVKRPTPMELRNHPFVLQGQRCD
                     VNMVEWVMSLSSSKE"
     gene            complement(<834843..>835909)
                     /locus_tag="MRET_1351"
                     /db_xref="GeneID:38738117"
     mRNA            complement(join(<834843..834971,835019..>835909))
                     /locus_tag="MRET_1351"
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 6"
                     /transcript_id="XM_027627978.1"
                     /db_xref="GeneID:38738117"
     CDS             complement(join(834843..834971,835019..835909))
                     /locus_tag="MRET_1351"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 6"
                     /protein_id="XP_027483698.1"
                     /db_xref="GeneID:38738117"
                     /translation="MMLRRAASAPHQFVRAQHTSAHLQPLIDTVRTRDYAAYLSHVAY
                     PPRLQPHFWALRAFHIELASIKDAVSNELVGRIRMQWWRDAIEGVYANRPPKHPIALG
                     LCDAVMDPAVMKHGSLVKDHFLRIIDAREADLAEPLSPPTLEELETYAEATSSRILYL
                     LLNLQGISESTVDVLFSHLGKAMGLGIFVASLPRHTHPPPLPASPTAGPGGGMSRYAR
                     QAGGVPRTPTLPLPLEYIMDAGVSQEDVYRHGPHAHGLKDAVFATATRANDYLITARS
                     IIRDELHGHVPAQAVAPMLLLIQTRRFLEKLEVVDFDPYDSRLSRRDWLLPWHMWLAT
                     RRQFI"
     gene            <835969..>837480
                     /locus_tag="MRET_1352"
                     /note="MRES_05400"
                     /db_xref="GeneID:38738118"
     mRNA            <835969..>837480
                     /locus_tag="MRET_1352"
                     /product="origin recognition complex subunit 2"
                     /transcript_id="XM_027627979.1"
                     /db_xref="GeneID:38738118"
     CDS             835969..837480
                     /locus_tag="MRET_1352"
                     /codon_start=1
                     /product="origin recognition complex subunit 2"
                     /protein_id="XP_027483678.1"
                     /db_xref="GeneID:38738118"
                     /translation="MTAGTQQVDEARNVRRKTEALSDSEPDDEEADKDDEEEADVQKK
                     EQARRPAPAFTHTSFLRSTSSDAWFLSNSHRRNFASLKLGRDILRGTSTKRISQVLGT
                     LDVSTVPHLAHLAAHQTRTRAALPVCTAHSQRAHSLHLQPERIHMLVTQLLNGCQLML
                     YGVGDRTSIVRAVLEHTAQRHASAGVLIQGAAGRALTSDRIMDAIDRALRISTSAHTL
                     REDRIVQRVQHLCHTLETRTQGPRRLVLGLLAFDHAHFHSTTRMHTLIHALAQCERVH
                     MVASVSHVNAGLVLDSNAGAFSLGISGHAEYTLPRVPGVRTLRAPWLWHHVTTYIPPI
                     AELVQARGTSATASSSAGLAALKLPSAVDLAGGRARAAPGASAAVAVAQPISESAAIQ
                     VLQTITSRARSLFSHLASIQLVAQADTTSGDDDAMPPRTPYVALMREALREFIASSDE
                     GVRQLLGEMVDHGLVIVVRGSTTVTNSHAIAVGDELCIPLPVPALEQVLAHIA"
     gene            complement(<837765..>838649)
                     /locus_tag="MRET_1353"
                     /note="MRES_05405"
                     /db_xref="GeneID:38738119"
     mRNA            complement(<837765..>838649)
                     /locus_tag="MRET_1353"
                     /product="Integral ER membrane protein"
                     /transcript_id="XM_027627980.1"
                     /db_xref="GeneID:38738119"
     CDS             complement(837765..838649)
                     /locus_tag="MRET_1353"
                     /codon_start=1
                     /product="Integral ER membrane protein"
                     /protein_id="XP_027483679.1"
                     /db_xref="GeneID:38738119"
                     /translation="MSVEISPSAQLGFPRPLTQVVKRSLFLTNSNSQPVAFKVKTTAP
                     KQYCVRPNSGRLEAGERVEVQVLLQPLKEEPPMSAKCRDKFLIQSAIITPEKETIPIA
                     DFWVQQETQKDAIAEHKIRCVYLPPSSETVPEENEDLSNVSGMGTGAPSYASAGVPSG
                     PGLGELGAGAGYLGSRSTGAEPPISIASLNNPDLAQKYTSSTSSSSYPFSASQQKPAA
                     AMAADKSAAAASPAAAPLPRSTQELEAEVLRLRAQVAAQSNAGVSKSTATVTSSGVPV
                     HIVAAIAVGVFAVTYLFF"
     gene            <838936..>840090
                     /locus_tag="MRET_1354"
                     /note="MRES_05410"
                     /db_xref="GeneID:38738120"
     mRNA            <838936..>840090
                     /locus_tag="MRET_1354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627981.1"
                     /db_xref="GeneID:38738120"
     CDS             838936..840090
                     /locus_tag="MRET_1354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483676.1"
                     /db_xref="GeneID:38738120"
                     /translation="MVQASPFLQRIAVRRTHEPGVFEGMLPPLSMGNVRPIAYGGFAI
                     ATAIVAAGHTIPTHTRFVPYSILGHFLGPGSIDVPFVCQVSSIRDTRTFVTRSVIVKQ
                     RVRGKHGEAQLRNVLSITLDMIASPRSEPAYMEEAKKHHVDVSCVGSLLRYDPAPSWK
                     IDEPNEHSETPDTYFSRRLQEGTLDKQSMAIYNKIIGLWHQIFDTVPVPSSMMLQNLL
                     GMVKIPTSQDHLTITDRRSFDWMRIHDALPCATGTEPAHGTSETKDMLPISPVMAHAA
                     TMAFALDGALAFAPLSLGKKSMLDASAASTLDFATRFHSDVLDMNQYLLREIRPIQAG
                     WQRTYSEARLFDTNGHLVATCTQQGVLRPVQEGAMATPADPPHYAPTPKL"
     gene            complement(<840125..>841711)
                     /locus_tag="MRET_1355"
                     /note="MRES_05415"
                     /db_xref="GeneID:38738121"
     mRNA            complement(join(<840125..841541,841567..841626,
                     841656..>841711))
                     /locus_tag="MRET_1355"
                     /product="V-type H+-transporting ATPase subunit B"
                     /transcript_id="XM_027627982.1"
                     /db_xref="GeneID:38738121"
     CDS             complement(join(840125..841541,841567..841626,
                     841656..841711))
                     /locus_tag="MRET_1355"
                     /codon_start=1
                     /product="V-type H+-transporting ATPase subunit B"
                     /protein_id="XP_027483677.1"
                     /db_xref="GeneID:38738121"
                     /translation="MSGPKLSDKELFELNAKAAVKNYSVDPRLDYRTVSAINGPLVVL
                     ENVKFPSYNEIVSLTLPDGTRRGGQVLEVSGNKAIVQVFEGTSGIDVKDTHIELTKSS
                     MKLPVSEDMLGRVFNGSGKPVDNGPRVFAEDFLDINGSPINPYSRAYPEEMIQTGIST
                     IDTMNSIARGQKIPIFSASGLPHNEIAAQICRQAGLVKKATKGVHDDHEDNFTIVFAA
                     MGVNMETARFFKQDFEENGSLDRVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEK
                     HVLVVMTDMTSYADALREVSAAREEVPGRRGYPGYMYTDLATIYERAGRVEGRNGSIT
                     QIPILTMPNDDMTHPIPDLTGYITEGQIYVDRHLHNRQVYPPINVLPSLSRLMKSAIG
                     AKHTRVDHSDVSNQMYAAYATGRDAASMKAVVGEDALSNEDKLTLEFMERFEKEFVAQ
                     GAYETRTIFDSLDLGWSLLRIMPKEMLNRISPKIIKEFYSRKATKHADETEDAKPSVT
                     EE"
     gene            <841857..>842518
                     /locus_tag="MRET_1356"
                     /note="MRES_05420"
                     /db_xref="GeneID:38738122"
     mRNA            join(<841857..842010,842036..842095,842120..842211,
                     842240..842329,842354..>842518)
                     /locus_tag="MRET_1356"
                     /product="peptidyl-tRNA hydrolase ICT1"
                     /transcript_id="XM_027627983.1"
                     /db_xref="GeneID:38738122"
     CDS             join(841857..842010,842036..842095,842120..842211,
                     842240..842329,842354..842518)
                     /locus_tag="MRET_1356"
                     /codon_start=1
                     /product="peptidyl-tRNA hydrolase ICT1"
                     /protein_id="XP_027483674.1"
                     /db_xref="GeneID:38738122"
                     /translation="MGLSARAWIPLLHARAFSVSHCRSAEVAIDWSDDRARRAWIASF
                     REQPLDPSHVHIHFARSSGPGGQNVNKLNTKVYARLELGPRAPRVMPPALVRELAKRS
                     PMYIQSTHSLQVSSERHRTQSQNIQDALGKIHAEIVRLASEGLRGETSPEQRRRVEAL
                     AKRERDRMRKAKQMRSFTKSGRRAKE"
     gene            complement(<842508..>842960)
                     /locus_tag="MRET_1357"
                     /db_xref="GeneID:38738123"
     mRNA            complement(<842508..>842960)
                     /locus_tag="MRET_1357"
                     /product="large subunit ribosomal protein L28"
                     /transcript_id="XM_027627984.1"
                     /db_xref="GeneID:38738123"
     CDS             complement(842508..842960)
                     /locus_tag="MRET_1357"
                     /codon_start=1
                     /product="large subunit ribosomal protein L28"
                     /protein_id="XP_027483675.1"
                     /db_xref="GeneID:38738123"
                     /translation="MFASLVRWSRTTYRGVRGSGAGRSGRTDARSSMASRPTEVMAAH
                     AGQTFKRAQRGLYDGRIIQFGNSIPKSRHKTPRRWIPNIQRATLWSETLQESIKTRVA
                     TSAMRSIKKHGGFDQYLARTKGTHLGEFGRMLRLRVARALREKRLATP"
     gene            <843077..>843949
                     /locus_tag="MRET_1358"
                     /note="MRES_05425"
                     /db_xref="GeneID:38738124"
     mRNA            <843077..>843949
                     /locus_tag="MRET_1358"
                     /product="U3 small nucleolar ribonucleoprotein IMP4"
                     /transcript_id="XM_027627985.1"
                     /db_xref="GeneID:38738124"
     CDS             843077..843949
                     /locus_tag="MRET_1358"
                     /codon_start=1
                     /product="U3 small nucleolar ribonucleoprotein IMP4"
                     /protein_id="XP_027483673.1"
                     /db_xref="GeneID:38738124"
                     /translation="MLRRQARERREYVYKKALESKQRQLYERKQKIREALASGKPLPP
                     ELRGAEAEELARNLSLDAAQAEPMTSIDDEYSRAGQYDPRILITTSRSPSSRLSQFAK
                     ELRLVFPNSTRLNRGGYTMPELAAAARANGMTDMIVVHEHRGVPDAMVVSHFPHGPTV
                     MFTLHNVTLRHEVASHANSTVSEQYPHLIFDGFGGRLGERVKSALRFLFPVPKDDARR
                     VMTFANRNDFISFRHHVFIATHRDVHLAEVGPRFDLRPYEIRLGTLEQGEADVEWVLR
                     PYMNTTRKRSQLAE"
     gene            complement(<843998..>846121)
                     /locus_tag="MRET_1359"
                     /note="MRES_05430"
                     /db_xref="GeneID:38738125"
     mRNA            complement(<843998..>846121)
                     /locus_tag="MRET_1359"
                     /product="glycerol-3-phosphate dehydrogenase"
                     /transcript_id="XM_027627986.1"
                     /db_xref="GeneID:38738125"
     CDS             complement(843998..846121)
                     /locus_tag="MRET_1359"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="XP_027483393.1"
                     /db_xref="GeneID:38738125"
                     /translation="MFRASLSRLTQQTSKAAANASAVAASNKGSQRNRVAILVTAAAV
                     GAGTVLALTRRKEADEYALPHDVSPAQFWSPPTRTQMIEALKQSSPHSLRSDGSLDQA
                     KSLLVPSHQAVGHSPIPEVEHAYHSPEEDDGDGFDLLVIGAGATGAGVALDGATRGLK
                     VAMVDREDFGGETSSKSTKLIHGGVRYLEKAVKQLDWEQYKMVTEALRERKTFLHIAP
                     YLTSPLPILIPAYSWWLIPYYYAGTFLYDLIAGKQNMGNSYVVSRNKALEAFPMLRAH
                     NLAGGVVYYDGQQNDTRMNIALVLSAIQHGAVAANHCEVVALNKSDKGRIIGARLRDQ
                     MTGDEFDIRAKGVVNATGPFCDAIRRMDEPTVSEIVSPSSGVHVTFPGYFSPRGMGLL
                     DPATSDGRVIFFLPWQGATIAGTTDVACKVEPHPLPGEKEIEWILDEVRNYLNTDVTV
                     KRSDVLSAWSGLRPLVKDPSAPDTQSLVRNHMIHVSDSGLLTISGGKWTTYREMAEQT
                     VDRAVEAFNLKPIRDCVTSQVRLIGSHSWSRTMYVRLLQEFGLDTDVAFHLSNSYGDR
                     AWSVCSIAKPTGERYPLHGIRLDSQLPYIEAEVRYATRSEFAVKATDFIARRSRMSFL
                     NTEATIEALPRIVDIMGEELDWSETRKQAEFSNAILFMASMGVDMTRVSELAKESLVK
                     ARTWKDHNSPRHLSPALSASPVMST"
     gene            complement(<846247..>847908)
                     /locus_tag="MRET_1360"
                     /note="MRES_05435"
                     /db_xref="GeneID:38738126"
     mRNA            complement(<846247..>847908)
                     /locus_tag="MRET_1360"
                     /product="cell cycle checkpoint protein"
                     /transcript_id="XM_027627987.1"
                     /db_xref="GeneID:38738126"
     CDS             complement(846247..847908)
                     /locus_tag="MRET_1360"
                     /codon_start=1
                     /product="cell cycle checkpoint protein"
                     /protein_id="XP_027483722.1"
                     /db_xref="GeneID:38738126"
                     /translation="MPRPTTRTDSRLGGRLAFVDRTCAPARRLRPLSGTRIVGDEPTL
                     STLAVHKRKVGDVRAWLTEALEGPPLLAKHRRILVLTGPAGAGKTATVRALSHRDALH
                     FDVVEWLNQEAYSDRGMTRSVCEQFRSFLLSTARFRPLPLASRHCAARSQSRCVLLVE
                     DWPNISHLETRHGVHAALEQFLEAVPHMPLILIVSDSIPRADTEAWDGSMDWRARLAG
                     QMDIRTAVSERVRMHPACAEIRFNPLTPRMIQSALARQAPHIPISVLADLSEASGGDI
                     RRACTAAQAPTQLSQSDAALALFHALGRLLYNKRLGDPDVMDHRLAEPLPLHRPRRSM
                     VDVEALWTQLPVDASTFQLYVHHNLLQFADDVDHVVTALDAMSYADTIRLSSHGSYAE
                     QYAFECMARGVLLSLPSPVQRRGQQLTKPALWEAMERRRACDEVFWRVVSDDVRCGRA
                     RCRIDELASYVLPLSARTSHTWSAIAAPLTHFRETTNVGAVVQEALDALDEAHASELA
                     NDIPNCTSHVEDEVDATYADEASIASSLDDLDEDDLDTIAAEPST"
     gene            <848003..>851128
                     /locus_tag="MRET_1361"
                     /note="MRES_05440"
                     /db_xref="GeneID:38738127"
     mRNA            <848003..>851128
                     /locus_tag="MRET_1361"
                     /product="importin-7"
                     /transcript_id="XM_027627988.1"
                     /db_xref="GeneID:38738127"
     CDS             848003..851128
                     /locus_tag="MRET_1361"
                     /codon_start=1
                     /product="importin-7"
                     /protein_id="XP_027483721.1"
                     /db_xref="GeneID:38738127"
                     /translation="METLLRLFPSTLSPDVHVRRASEQELHQLESQPGMLAASFQLVA
                     SPEVDTSIRQAAAIYVKNRISRTWDASLARGFSDAPSAVSDQDKEVVRSGLLPTIASL
                     PPTLRVHIASAMYSIVRCDFPQAWPTLTEEIVKLLSSGEQLQIFAGVRALLELVRAFR
                     FDCTDSKLESIVSHTFPALLATVSALMDSDHSDLPAVGEIVYYAMKTYKTSMMVTLTQ
                     HQQSNESIVPWGSVMLRIVQKSVVTDADADADAREKAPWWKAKKWAFYSLNKLFSRYG
                     TPSQLAASMKMYKPFAETFIHNFAPEILKAYLHTADGIVSQHVWVSKPVLRHLLTFFS
                     ECIRPKSMWQLLRPHMQQIIETLVYPHLCFSDEDEELWELDPIDFVRLGSDPFEELGT
                     PSSAASMLLNVTVTRRTKSMFEPTLTFITHVLNAYPAQCTARQFDGALRMCMTICQTM
                     VHHENVQNMLDAFFVQHVLPVLKSPEPFLRLRACALIHAFDSAGMKWQTSQSLETAFR
                     GVMDCIMDTELPVRVKAAEAMGELVAHDEVHNAVAPNACRLMQELLKLSDETDLDVLM
                     TTQEKIVNNFAEELLPFSVDLTQQMANNYMRLLQDNLAGAGVDGGVDGVHAFNMDQGE
                     EDKYFAAMGCLSTMYQMVTTADSRPDILAELEKVLLPVVAFTIQTETLDLYDDCFQLT
                     DVLTYYQKSVSPAMWDIFTLMYKSFKSSGIDYLSEMIGTFDNCASYGTEMLRQHAEYR
                     HMLIDIFHTAISSDQLVSSDRIAACQIAEVVLLLLRGYVDDAVPGILTALLPFLDKST
                     ESHLLRKWAALIVLESMYYNPTLSLSILESHGATQAFFATVLPMLTKCRRVHECKVAI
                     VALLSLLAMDPQSVPAALRNGYPHLFGALLTQLKALPKLVAQRKELHKVFDEGLDDLD
                     DDVNAALDEFDDDADVQEDDNDYLQLLAEEANRVRAQVHIADGDAPADDGIGSADDLE
                     DDFDDDDLVYESPLESVPVYEPFRAVIRQLQTQQADLFQSLTASLNEQQQQDLQQVYD
                     LQDSEDTGTSA"
     gene            complement(<851125..>851703)
                     /locus_tag="MRET_1362"
                     /note="MRES_05445"
                     /db_xref="GeneID:38738128"
     mRNA            complement(<851125..>851703)
                     /locus_tag="MRET_1362"
                     /product="succinate dehydrogenase assembly factor 2"
                     /transcript_id="XM_027627989.1"
                     /db_xref="GeneID:38738128"
     CDS             complement(851125..851703)
                     /locus_tag="MRET_1362"
                     /codon_start=1
                     /product="succinate dehydrogenase assembly factor 2"
                     /protein_id="XP_027483720.1"
                     /db_xref="GeneID:38738128"
                     /translation="MWMIRAAAPAAKAASRAALLPRSRAWHACAVLCSKDTLSDPFPL
                     PFSKELDPKQRAEGVNLASERQGVEGMSVPIRVPNRENEPRPRLLARLQYQCRKRGTL
                     ETDLLLSTFAQSELASLPDEELHELDALLDEPDWDIFYWCTDRKPVPERWQASFTTQG
                     RLGYRLRIHTRNDHGLVRRFPPLKGDIQSPSA"
     gene            <851864..>852290
                     /locus_tag="MRET_1363"
                     /note="MRES_05450"
                     /db_xref="GeneID:38738129"
     mRNA            join(<851864..851866,851980..852218,852254..>852290)
                     /locus_tag="MRET_1363"
                     /product="large subunit ribosomal protein L37Ae"
                     /transcript_id="XM_027627990.1"
                     /db_xref="GeneID:38738129"
     CDS             join(851864..851866,851980..852218,852254..852290)
                     /locus_tag="MRET_1363"
                     /codon_start=1
                     /product="large subunit ribosomal protein L37Ae"
                     /protein_id="XP_027483719.1"
                     /db_xref="GeneID:38738129"
                     /translation="MSKRTVKVGITGKYGTRYGSSLRRQIKNIEISQHSRYTCSFCGK
                     DTVKRKAVGIWDCSACKKVVAGGAWSMNTTAAATVRSTIRRLREISEA"
     gene            complement(<852482..>853010)
                     /locus_tag="MRET_1364"
                     /note="MRES_05455"
                     /db_xref="GeneID:38738130"
     mRNA            complement(join(<852482..852528,852556..852653,
                     852681..852794,852823..>853010))
                     /locus_tag="MRET_1364"
                     /product="DnaJ subfamily C member 19"
                     /transcript_id="XM_027627991.1"
                     /db_xref="GeneID:38738130"
     CDS             complement(join(852482..852528,852556..852653,
                     852681..852794,852823..853010))
                     /locus_tag="MRET_1364"
                     /codon_start=1
                     /product="DnaJ subfamily C member 19"
                     /protein_id="XP_027483726.1"
                     /db_xref="GeneID:38738130"
                     /translation="MTMWWPTARASVRQLYAVRTPMAWASRSMMTSPFRPTTPLLLQA
                     TQPKEMTMPVVVGCGLVGAGLIAMMMRPTGSTGGKWVKGGFQAKMDRKEAIQILGLRE
                     ASVNRNRIKEAHRRMMIANHPDRGGSPYLASKINEAKDLLERTTSR"
     gene            <853119..>853565
                     /locus_tag="MRET_1365"
                     /note="MRES_05460"
                     /db_xref="GeneID:38738131"
     mRNA            <853119..>853565
                     /locus_tag="MRET_1365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627992.1"
                     /db_xref="GeneID:38738131"
     CDS             853119..853565
                     /locus_tag="MRET_1365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483725.1"
                     /db_xref="GeneID:38738131"
                     /translation="MKISSTGPYRAMLLFHHIRMAKKISAFHKWSEDLELQGLLKIGY
                     PGLCLITDRTDTPSQVPEFIRRVKRLSWFTCELREHGPIDVQAVEALSHALETHATPT
                     SVSRRSGIVQLERLKEVPAFLHAADHALPSAREAVWASFYQAAMRP"
     gene            <853593..>854978
                     /locus_tag="MRET_1366"
                     /note="MRES_05465"
                     /db_xref="GeneID:38738132"
     mRNA            <853593..>854978
                     /locus_tag="MRET_1366"
                     /product="WD domain, G-beta repeat protein"
                     /transcript_id="XM_027627993.1"
                     /db_xref="GeneID:38738132"
     CDS             853593..854978
                     /locus_tag="MRET_1366"
                     /codon_start=1
                     /product="WD domain, G-beta repeat protein"
                     /protein_id="XP_027483724.1"
                     /db_xref="GeneID:38738132"
                     /translation="MHTAQATHLFQSDASLAQGRDRASKAQRTASGAVHGSPIWLGMH
                     GSAKLDGSDAPPSVDMARLAERAAGADGGVHKVITAHRPNDTSSPFLWTAESGRVARC
                     THLESGRVVQLVRGHAGPVSGLATWSVSDHRAFVCTASWDRCIRIWPVLPGKRPPCLV
                     KLDEAGADLLKALCVDPVHCILYAGGNDKTVRAWNLAPLSKWAHDLDDAAWAALATVP
                     APCPVPTVRGALQGQHTRPIVCISTLPPPPHGAVVANDVPEPGTVFSADSMGRVLQVT
                     PDLSVVRELNGHETSVNDIKPVWREEDDTWTAHVWTASSDQSVRCFPLSSQKDRPARW
                     GARSSHAGDVLGSQPPVYATHMIPVPCKAHAVLPLRDETVLVGMEDGTLQVYRDDQPE
                     TALDGHWHNVTYAGWWTTPQAYVVTASLDGTVRRWPLSMLEGHMPETPAAAALTAEEE
                     AELAELMEGEV"
     gene            complement(<854975..>857293)
                     /locus_tag="MRET_1367"
                     /note="MRES_05470"
                     /db_xref="GeneID:38738133"
     mRNA            complement(<854975..>857293)
                     /locus_tag="MRET_1367"
                     /product="protein transport protein SEC23"
                     /transcript_id="XM_027627994.1"
                     /db_xref="GeneID:38738133"
     CDS             complement(854975..857293)
                     /locus_tag="MRET_1367"
                     /codon_start=1
                     /product="protein transport protein SEC23"
                     /protein_id="XP_027483723.1"
                     /db_xref="GeneID:38738133"
                     /translation="MNVDEVEDRDGVRLSWNVWPATKLEATRTVVPVAALYTPLKERE
                     DLPPVLYEPVMCKPPCRAVLNPYCQVDVRGKLWICPFCLSRNPFPPHYKDISTTNLPA
                     ELLPKYTTIEYTLNRKSQIPPIFMYVVDTCMEADDLKALCESLVLSLSLLPPHALVGL
                     VTFGTVVQVHELGYEGCPKSYVFRGSKDYSPKQIQDMLGLTPGSRPTPNLAGAAAPGG
                     PSAQPRAPTSGQIGATRFMLPVSQCEYQLTNILEQLQRDPWPVANDKRPQRCTGAALS
                     VAVGLLESTFQNTGARVMLFCGGACTEGPGQVVSTELRERIRSHHDIEKDNVKYFKRA
                     VRFYENLGRRCAHNGHVIDVFSGCLDQVGLLEMHSLCNVTNGHQLLVDSFQMGIFKQS
                     FNKIFEKDENDDLRMGFNATLEVQCTKELKVSGLIGHAISANKKSNCVGETEIGIGQT
                     SAWKMCSITPRTSAGLYFEIATPAGQPLQPGARGLVQFVTHYQHASGQFRLRVTTIAR
                     NFADGESGHVSLSFDQEAAAVLMARIAVFKAEIDDSPDVLRWLDRMLIRLCQKFAEYR
                     KDDPTSFRLSENFNIYPQFMFHLRRSQFLQVFNNSPDETAYYRHVLNCEDVNNSLIMI
                     QPTLMSYGFEGPPQPVLLDSMSIRPDVVLLLDTFFHLLIFHGETIAQWRKAGYHEQEG
                     YENFREILEAPQADAQELLMERFPIPRYIVCDQNGSQARFLLSKLNPSTTHMTGGAYG
                     VSGKGAAIYTDDVSLQVFIEHLKRLAVGANSS"
     gene            <857467..>861813
                     /locus_tag="MRET_1368"
                     /note="MRES_05475"
                     /db_xref="GeneID:38738134"
     mRNA            <857467..>861813
                     /locus_tag="MRET_1368"
                     /product="DEP domain protein 5"
                     /transcript_id="XM_027627995.1"
                     /db_xref="GeneID:38738134"
     CDS             857467..861813
                     /locus_tag="MRET_1368"
                     /codon_start=1
                     /product="DEP domain protein 5"
                     /protein_id="XP_027483728.1"
                     /db_xref="GeneID:38738134"
                     /translation="MPRYAGAPSGGTSRARTLPLSAPVSADYDEEQEENASASAVHMR
                     PILLWTHDPPNFSQHDFVMNPAISLPNESDTELLMLMSASTFEEREAALTLGKDPMTL
                     DTTRTLVFRAKQAVADAAVVARQPQLQLSVSRSIASLCHLSNRSQAVIMRTPREHHII
                     THMELYFRDQYMGRADMWRLALSRIDSCVYIGQVISLPTGLRAKVGRLFVHKHSVLSG
                     YVDTSTKPIFRSESARCTIFIQMSKEMWEFDEHGELYYEKVLHGFLPDMLRRWKVIGT
                     NHVVSLVLFTRVLYDESEKAYLNGLPLQCTSSGEWYVDYYKVVLDLDSLTQWPAVMRI
                     LKEEFYHFQHDILLRPVSPGADIDRRRLLGRFASAYQGNLLEAVNMELNSSNKHYIDR
                     DLTRTGFLLIVLTAGTGHFHADKALLRLTTQRMFDQAISMDLVCLSQMPLHTVPLFHH
                     KSTEPTKHSPSHDPLFQDATPRGSQYTYYSMPYWINCSFYQADHSHLRRRNRFVPRCR
                     MNDIHLLELLGARKQHITLPYLLLPHASLPTASGSHAREQHDRDQFAPLHGMPSAPPP
                     WPPDLQAEAPRPASLPATRWSQGSSTPSLSSAVSGQAVHRLPYQHAVGKAAPVVGETA
                     TTLLAVRSAASSRFQVPATMSDVLFRSPSWRSLLPWQRPTKISRGQSTTSGNASRVLN
                     AVLRASHTKTAPTLIEHCTRAASHVVADTPTLDDGSDGMQPKLSPDTPRQLPVGPPTS
                     HSSQHALLLRWQHVFLERANKHTVKWWSMSSPACLPLTTRYLPHARELATSWHEYPYT
                     VSVHSDTSSIMLKRGASSSSPALRMLREMCAQRLSQGFQLVERPVFLPNMASPHHIVV
                     RYPTELLRPGNFADGEPIYLSTMNQVHCITYNRQAGMIHVTRYIHKVPYDTTPTTYRC
                     CVWPRAQVGYHPIDVHFQYPDPHAYNWAYLDSIIAGYEDTFTESLLYWRARFVVVPSE
                     HPPNRIIARTGEYLNDEEVRLAGMDRLADLFARAEHFHDNESLRFLPTTLDPSCSMRD
                     ESFLCALTEMHDELERQRSHKDRAPMRDVASRSLAQLADDMLAASAELKIHSRQWHNV
                     WYSDTFTGADLVTWLCRSFSDVHTRDEAVQLASRLQQAGHITHVLGVHGFMDGHYFYR
                     LTRLRQDLTTSSTPMATSSSGTNKRKERRRVPLSRRMLIDVDPDRRSSRSEVAILHHD
                     LAHNAENGFNFQIHWLGATARLIDDLVQTWTRAVERYGLRLVEAPIGQIKDVGLHNPF
                     QAPVPISLVLDPPTQDMYLPTLERIHGTRNAHAPCEPTDHLESWITRHVFGRDPKHTD
                     HLFETALLRHFGFVLDQEAQDHFPRDIEFHYSSRPNNFDYTQFVHRSGVAFVQMIGGP
                     SGFLWLDNRLFNPRAHFIRGLSGGIKSKRAPPPDADHVRCTFQHMCQDRDALASFYDR
                     VWGVLRRLCPSD"
     gene            <862119..>863384
                     /locus_tag="MRET_1369"
                     /note="MRES_05480"
                     /db_xref="GeneID:38738135"
     mRNA            <862119..>863384
                     /locus_tag="MRET_1369"
                     /product="Aur1-inositol phosphorylceramide synthase"
                     /transcript_id="XM_027627996.1"
                     /db_xref="GeneID:38738135"
     CDS             862119..863384
                     /locus_tag="MRET_1369"
                     /codon_start=1
                     /product="Aur1-inositol phosphorylceramide synthase"
                     /protein_id="XP_027483727.1"
                     /db_xref="GeneID:38738135"
                     /translation="MSAAPAAQAPKREPWYRQTWLAVLAAAKRLSFSVSPRDNFKKLA
                     AYKMSKQDGFKYGFMLPIAVFSMVIMAEPSFPYKLIIPLLYILVLCIPLTSQLFLPAA
                     PILLWLLLFYSCRFIEVSARPHIWVSVLPTLETIWYGANISDILTRFGHPLLDILAWI
                     PYGVVHFMAPFIVAAFLFVFAPEGSVKVFSNAFGFMNLVGVIIQIAFPCAPPWYELRE
                     GLTPANYSMRGSPAGLARIDAIFGGFGYTMAFSGAPVVFGAFPSLHAATATCEALFLS
                     YFFPIKIKIGSLRFDARALYWTYCFWLYWSTMYLMHHYLIDLVAGGCLATFSFYFFRT
                     EEVRNAMERREAMMEQAERAERGEPEDDGFKLEDMPSASTTTTNDPLFTIDEGDVERA
                     LTDTDPRPALESQNSNMARPAVAASASLR"
     gene            <863419..>864447
                     /locus_tag="MRET_1370"
                     /note="MRES_05485"
                     /db_xref="GeneID:38738136"
     mRNA            <863419..>864447
                     /locus_tag="MRET_1370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027627997.1"
                     /db_xref="GeneID:38738136"
     CDS             863419..864447
                     /locus_tag="MRET_1370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483787.1"
                     /db_xref="GeneID:38738136"
                     /translation="MSSSFVGTTVRLTPREGAPFFGTILSVDPKTATLSLRRADTSDV
                     VSVRREDLIDVSTVTLQTPSPATRPELSDKKKRNRKKSERTGSPAPGAVSKSAPETVP
                     APASSASRPSVRSSTPTDAPTSAVDEEFDFVKSAQNFDKKKIWDEIRNQESSSNAQLL
                     VDINRNPALHQTASSTPSQTRQPMLAADESVLDDALNEKEARLAKNDTLRNALDMARD
                     EVERLRTQLALSEALSGVHLEPLDDGAYQVSIFRDGWTSAAHWRRKHTGGDSVGPEGA
                     LRYYLNAPGIKDTENVSLGYEGPDRMASDPNVLDALPEHFQAGNIKVKLDNAPMFHQR
                     LYDVLRGA"
     gene            complement(<864386..>865133)
                     /locus_tag="MRET_1371"
                     /db_xref="GeneID:38738137"
     mRNA            complement(join(<864386..865000,865038..>865133))
                     /locus_tag="MRET_1371"
                     /product="mitochondrial inner membrane protease subunit 1"
                     /transcript_id="XM_027627998.1"
                     /db_xref="GeneID:38738137"
     CDS             complement(join(864386..865000,865038..865133))
                     /locus_tag="MRET_1371"
                     /codon_start=1
                     /product="mitochondrial inner membrane protease subunit 1"
                     /protein_id="XP_027483788.1"
                     /db_xref="GeneID:38738137"
                     /translation="MAFSRVGKIGVATVQLMCLVHLINTHMFEVRSCRGASMVPTISP
                     MGDLVFHVRLNFLRSLSKTPFASEDLKSRFPQVPRGMPSHKLDPSCGLGLRLGDLVVA
                     TSPSDPSRTVCKRILGMPGDTVLLDPRDHISESALQLAAHFEAGSHVMPYLRMHTGRT
                     VTVPPGHVWLTGDNLANSTDSRHYGPVPMALIKGRVMARIYPSMHWYGSALKKVPKVM
                     PHEEHRTDADETWAHYQA"
     gene            <865397..>866344
                     /locus_tag="MRET_1372"
                     /db_xref="GeneID:38738138"
     mRNA            <865397..>866344
                     /locus_tag="MRET_1372"
                     /product="solute carrier family 25 (mitochondrial folate
                     transporter), member 32"
                     /transcript_id="XM_027627999.1"
                     /db_xref="GeneID:38738138"
     CDS             865397..866344
                     /locus_tag="MRET_1372"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial folate
                     transporter), member 32"
                     /protein_id="XP_027483789.1"
                     /db_xref="GeneID:38738138"
                     /translation="MSKYPPDRRQKEVRNSAISGACAGLVSSVVTCPLDVIKTRLQVR
                     PEASASGSITHGGFDNVTTVIRKIWTEDGLRGFYRGLGPTVIGYLPTWAIYFCVYDAG
                     KKFFGEHTALSHMHPFATHIASAMLAGATSTTCTSPMWVVKTRTMLQTASVPKHELYR
                     HTFDAFVKIYRSEGMMAFYKGLLPSLLGVFHVVVQFPLYEHFKSMTSEFKRGDALSPG
                     SILLCSGGSKMLASMATYPHEVLRTRLQMVPKCTTHNGVVMRQYSGFVQTFVSILRYE
                     GISGFYRGMGVNLVRTVPNSGLTILTYEVIMHYFATHSI"
     gene            <866522..>867411
                     /locus_tag="MRET_1373"
                     /db_xref="GeneID:38738139"
     mRNA            join(<866522..866784,866811..867132,867163..>867411)
                     /locus_tag="MRET_1373"
                     /product="PIN domain protein"
                     /transcript_id="XM_027628000.1"
                     /db_xref="GeneID:38738139"
     CDS             join(866522..866784,866811..867132,867163..867411)
                     /locus_tag="MRET_1373"
                     /codon_start=1
                     /product="PIN domain protein"
                     /protein_id="XP_027483790.1"
                     /db_xref="GeneID:38738139"
                     /translation="MSTYADYFNEHYQGDVPSGPVRMIISRNEKSAGDMDSDSVEAES
                     CTVEELMDQEVPQPAQQKPAESLPGSELRLDWIPSSSAVWVLDTNVLLHTLEHIQALC
                     KAQLHELSHNLVSFPRIYLVVPFVVLEELDHLKLTNKQDNGTHIAASSRSASHWILST
                     VQSQKYMRTISQDALHPHRWVLHVQTMLSVPSRDLTNDLTIVALCAELLRSCQAQVML
                     ISDDTNARTHAEIMNIASISLPRVLQNIRKAAGSSSLHNEVQQLFFLSLPENRHLLTQ
                     S"
     gene            <867504..>867822
                     /locus_tag="MRET_1374"
                     /db_xref="GeneID:38738140"
     mRNA            join(<867504..867549,867574..867656,867700..867754,
                     867785..>867822)
                     /locus_tag="MRET_1374"
                     /product="ubiquitin-like protein 5"
                     /transcript_id="XM_027628001.1"
                     /db_xref="GeneID:38738140"
     CDS             join(867504..867549,867574..867656,867700..867754,
                     867785..867822)
                     /locus_tag="MRET_1374"
                     /codon_start=1
                     /product="ubiquitin-like protein 5"
                     /protein_id="XP_027483783.1"
                     /db_xref="GeneID:38738140"
                     /translation="MRMIEVLANDRLGRKVRVKCSPEDTVGDLKKLIAAQTGTAPEKI
                     VLKKAYSTFKDHITLADYEIHDGDSLELH"
     gene            complement(<867960..>869165)
                     /locus_tag="MRET_1375"
                     /note="MRES_05490"
                     /db_xref="GeneID:38738141"
     mRNA            complement(<867960..>869165)
                     /locus_tag="MRET_1375"
                     /product="translation initiation factor 4E"
                     /transcript_id="XM_027628002.1"
                     /db_xref="GeneID:38738141"
     CDS             complement(867960..869165)
                     /locus_tag="MRET_1375"
                     /codon_start=1
                     /product="translation initiation factor 4E"
                     /protein_id="XP_027483784.1"
                     /db_xref="GeneID:38738141"
                     /translation="MSTSFPECADNMRKRDVKSHPPTLVDIASKFNMPVGDAPATREK
                     VPESTHNLRRLELTGRLELAAANVDTTKQAKHTHSKLGSMPSLNDIRARLNQRGVDIT
                     PSAWSPTKQKSISSSQEKASSSTAQNIGLALTEAHKTDVAQDTAKTSTPDQALTNDAN
                     SQEHEHVDSSMQNATNPGPSSSSLAGRKAALEAKNGVKHPLQNEWTLYVDMQRAHGTF
                     SGDQYEATLKRVGHFTSLESFFDTFATLRRPSRQEKNSNYHLFKNGVKPMWEDPVNAA
                     GGRWIITLRDRGRTAGSRLIHEALLDRSWMWLVLALIGETLDDNDLVTGAVCSLRGKG
                     DRIAIWTRRKEPIDELNAMGEKLLDVLNLQHEPSVQMEFSFNFGSKDKPHLYTKKSMA
                     GLASTAPSA"
     gene            complement(<869349..>871253)
                     /locus_tag="MRET_1376"
                     /note="MRES_05495"
                     /db_xref="GeneID:38738142"
     mRNA            complement(<869349..>871253)
                     /locus_tag="MRET_1376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628003.1"
                     /db_xref="GeneID:38738142"
     CDS             complement(869349..871253)
                     /locus_tag="MRET_1376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483785.1"
                     /db_xref="GeneID:38738142"
                     /translation="MASDRIMQRTLNQASQHTLEPTRIVASQNGFYKVVFKVLDNPMG
                     PSNVLEWVPKQAVSDHLVSTWRAQRAERMAFRQHRKSQTSVVRDARADDVEFEPMEAS
                     HAASSHVVSPLSSSASQHPQAPTLAATSSMPDSHETPTEPFNVGASTSSHVSHDMSVP
                     HSSGAAVTDAVRQHGKDMGASHHPSTSEPLSVDGNAAASMHLHAICDHPAEPVNHNAP
                     TLEITETSRHVLEDAQFEPMPPTPPEQRTRQEIIDSSANQSDHTSESLLAQKPGLPLT
                     QSRSGRRIQPPPTETLSKDEQIAALQKKLEMQLEEITLLRGLYEEASQSASRDAAALK
                     EANTTLEALKVQLKDGIETQRQLCSVEIAHRISESEKAQKQLAMVQWQLNEGQVELRR
                     KADLWEKHVKQLEIEEKERLKREQAAELQNDMMQELAELAVEAQEFTPPTPLPDNSAH
                     DKSYVADAISTTSTQNQMEAGQDVIQQRPAEAPVHANHETSTATRPAVRQRKTPVSAA
                     GESLAPFSQPGQEITSPSPASIPQTRAEADTHLQPSPATPPRDVSQESLELSISVLAD
                     SEADTPVGNPNMAHTTPSHSHSMNTPVPESTNAPLQESSPTHSPPSHSEAPKPRWKRR
                     RYSRMSSVSL"
     gene            <871365..>872486
                     /locus_tag="MRET_1377"
                     /note="MRES_05500"
                     /db_xref="GeneID:38738143"
     mRNA            <871365..>872486
                     /locus_tag="MRET_1377"
                     /product="histidinol-phosphatase (PHP family)"
                     /transcript_id="XM_027628004.1"
                     /db_xref="GeneID:38738143"
     CDS             871365..872486
                     /locus_tag="MRET_1377"
                     /codon_start=1
                     /product="histidinol-phosphatase (PHP family)"
                     /protein_id="XP_027483786.1"
                     /db_xref="GeneID:38738143"
                     /translation="MHSHHSHSGEFCKHASSTLDEVISRAHELGFTHFHLSEHVPRMR
                     DAHLYPEECEAGMTPASLTTQFLAYLSKARELQSKYATMPHGMTVLVGCETENIESPH
                     SIDALTALLHGVAVQDTPVPPPFVGRGTVDYIVGSVHHVHGIPIDFDEPTFLKALQVH
                     GTKDGYTSLLHAYLDAQYEMLERLRPEVIGHFDLYRLFDPSAPWYPECTTPHGREVLN
                     KLKRNIHFASSYGALFETNSSAFRKGWKEETYPGRVILQLILRAHGRLALSDDSHGVH
                     QVGLNYTRVRDYLLREGVNELWYLVPGGTLPCADKGGNLSEVHAASEEARQARELSDT
                     PGRDAPTLFPRGTKALCLSDWHTHPFWDRLSSALPVPPP"
     gene            <872701..>873603
                     /locus_tag="MRET_1378"
                     /note="MRES_05505"
                     /db_xref="GeneID:38738144"
     mRNA            join(<872701..872853,872893..>873603)
                     /locus_tag="MRET_1378"
                     /product="succinate dehydrogenase (ubiquinone) iron-sulfur
                     subunit"
                     /transcript_id="XM_027628005.1"
                     /db_xref="GeneID:38738144"
     CDS             join(872701..872853,872893..873603)
                     /locus_tag="MRET_1378"
                     /codon_start=1
                     /product="succinate dehydrogenase (ubiquinone) iron-sulfur
                     subunit"
                     /protein_id="XP_027483791.1"
                     /db_xref="GeneID:38738144"
                     /translation="MVSLPNTLRVAVRANIPRTMGTAAFSTSASRAMASPAAEQPNMK
                     KFKIYRWNPEQPTQKPRMQTYELDLNQTGPMVLDALLKIKNEQDSTLAFRRSCREGIC
                     GSCAMNIDGVNTLACLCRIDKNAPQSNIYPLPHTHVVKDLIPDLTQFYKQYRSIEPYL
                     KPAGPPPGGREYLQSPEERRHLDGLYECILCACCATACPSYWWNGDAYLGPAVLMQAY
                     RWMADSRDAHGAERREKLENTFSLYRCHTIFNCTRTCPKGLNPARAIAQIKKDMAIGA
                     PEVTKRPLQTP"
     gene            complement(<873650..>874915)
                     /locus_tag="MRET_1379"
                     /db_xref="GeneID:38738145"
     mRNA            complement(<873650..>874915)
                     /locus_tag="MRET_1379"
                     /product="DNA ligase 1"
                     /transcript_id="XM_027628006.1"
                     /db_xref="GeneID:38738145"
     CDS             complement(873650..874915)
                     /locus_tag="MRET_1379"
                     /codon_start=1
                     /product="DNA ligase 1"
                     /protein_id="XP_027483792.1"
                     /db_xref="GeneID:38738145"
                     /translation="MPLDPLDASITTGPVGEECTIYPARTMDVGARVETHSGFTVQRF
                     TSHYSCSCPAWRCDTGKNVRYRTCEHLADILGEEYERIRTNCDSQAEHSTPKKRACDM
                     ESWRAWDANLSPSHSKRSRTSPTAYKSPSSSSSERPFSFLLASTWPCEVGPRPASKSL
                     SSRKDPTGWWISEKFDGVRAWWDGETLWSRRGQMWHAPPWFTAPLPSHMSLDGELWID
                     RGLFEHTSGVCRASNSDEWHRVKYMVFDAPDGCIEPVEDRWGRIRALFPVARFGEPIA
                     RHTHHVYAVEQVRCHGPSHLDALVHQVLSAGGEGVMLRAPHSVYERRRSSTLYKWKPF
                     LDAEARVIGYEQGQNGAAGLVGSLVCETYSQEQQDESPKRFCVGSGLTQFLRQHPPPI
                     GTMIRYHYSGLSSQGLPRFPRYAGTRVDM"
     gene            <875006..>876037
                     /locus_tag="MRET_1380"
                     /note="MRES_05510"
                     /db_xref="GeneID:38738146"
     mRNA            <875006..>876037
                     /locus_tag="MRET_1380"
                     /product="mitochondrial inner membrane protein subunit 18"
                     /transcript_id="XM_027628007.1"
                     /db_xref="GeneID:38738146"
     CDS             875006..876037
                     /locus_tag="MRET_1380"
                     /codon_start=1
                     /product="mitochondrial inner membrane protein subunit 18"
                     /protein_id="XP_027483739.1"
                     /db_xref="GeneID:38738146"
                     /translation="MLLRTKTAALFVPRTSLVYRLPWVQARQNHSSTAVSATLGWLDP
                     LARHMVSFPEYMGLLDVGLAYPYTYSVVALTMVMRSFVSIPLAIWQHRRNDRYAQVVL
                     PEWRAWQKQIPANVIQQHQPADGEQVSMETKRLVSRKIQRRLSEKWNRLIALYHCSPA
                     RTMMTSLALHIPLFVLMMALLRQGAVLPGTPFAQELIPWWTPDQEFAAHSAATRQILL
                     DKGLDPGLADRLTKLGGPTLADRDPTYIMPLICGSLNMVNVELTAWTRQQRRVRESAM
                     GLSTENEADLAEEPPRARILSNVLRVGAILSIPIACQVPSVLLVCWGTSSLMTLAMNS
                     YFARRSSKI"
     gene            complement(<876056..>877258)
                     /locus_tag="MRET_1381"
                     /note="MRES_05515"
                     /db_xref="GeneID:38738147"
     mRNA            complement(<876056..>877258)
                     /locus_tag="MRET_1381"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628008.1"
                     /db_xref="GeneID:38738147"
     CDS             complement(876056..877258)
                     /locus_tag="MRET_1381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483738.1"
                     /db_xref="GeneID:38738147"
                     /translation="MRNGRGGRTRGAVPRGRWKDEDPMDIIRQSRDAGRETLVKGGIA
                     RLSFGSEGPGDDDDTLWVWDDPDLLPNGAVMVSARKSTFDSRWPYTGRRGWRPTSNKV
                     AEAGFHFTPTEEEDDACACIYCGVELSGWERTDDPIHEHQRRRPSCPFFHCILADALA
                     PPTSPTPASTSKHEKEDDDTSDYDIPHQRKKRTTSRGVSATHTKVSHDEHIPSVEPEH
                     DTNGLAPSASRRSGSVDHANDGRSKTEMNKLAQDMQHKRRSVPESEAETASEAEPQPQ
                     AEPEPEGGPMPVSAALPQGTASVGPESDDEATVERMVTSSAPSSMGLSLPHIRDYLPI
                     PFPHRHSQVPMPPPVTDPRQVTVVEWIQEQQRYLLDTMRERTEQQLTAMRQRNAEVRK
                     TLEKMLRS"
     gene            complement(<877417..>878234)
                     /locus_tag="MRET_1382"
                     /db_xref="GeneID:38738148"
     mRNA            complement(join(<877417..877804,877832..877941,
                     877982..878049,878078..>878234))
                     /locus_tag="MRET_1382"
                     /product="Spo7-like protein"
                     /transcript_id="XM_027628009.1"
                     /db_xref="GeneID:38738148"
     CDS             complement(join(877417..877804,877832..877941,
                     877982..878049,878078..878234))
                     /locus_tag="MRET_1382"
                     /codon_start=1
                     /product="Spo7-like protein"
                     /protein_id="XP_027483741.1"
                     /db_xref="GeneID:38738148"
                     /translation="MDTSNASGVRGTTTMDRCTPMPSTAAFRDLLIFEERLKQNAARL
                     KNRKQKYQAFLAFLVTFILYMLYTVLRASSERNVLYYIRVGLLWIGCMMLFLFFASGY
                     YADAIRTANEFVPQANRSLHTFNMHLHMPRSSWMGSWRMPWSSPSLNGGDASGETRAC
                     HGPFSDGRRPRSIFPHHGTPTTSPPPNERGELIFSSRVDHDFREGYERYRNAFERKRH
                     EKIKAQQRHQPALWDSWPFFKK"
     gene            <878439..>881114
                     /locus_tag="MRET_1383"
                     /note="MRES_05520"
                     /db_xref="GeneID:38738149"
     mRNA            <878439..>881114
                     /locus_tag="MRET_1383"
                     /product="recyclin-1"
                     /transcript_id="XM_027628010.1"
                     /db_xref="GeneID:38738149"
     CDS             878439..881114
                     /locus_tag="MRET_1383"
                     /codon_start=1
                     /product="recyclin-1"
                     /protein_id="XP_027483740.1"
                     /db_xref="GeneID:38738149"
                     /translation="MDRWVPLAPRRITPVAAHVPDHVGAEKDPDEDIPSVRGLSRKVV
                     LQILDYVPLCDLPRVAMASRECQVLVSQEKLWKWRWDRLGWQKTNVLSDPLLDAPPEP
                     IPIPARAKPTPVVSASSRAVSKTVDLLSDLDFDAFSVPSSASKPYARRVQRAYTVLRP
                     YLLSLVESPSPTSSWLFTKSSDVREQCALVCMLARFASMCVCGVPAPGLEDVSAMQAK
                     LQQATMALCTQLRTAFVASEEQYQSESSCATALASMKQHAELAWSLRYVHEALGIDRS
                     LTTETRPSLVWSAQLYDMGGSVIAQTFLASRPVLTSRVPFSPHDALDANLAFCAGPVR
                     EFVQYLERAVSDECALIQSVFPPAQPVHMALLERVVHDLVADYVVSLLQEAREASAEA
                     YLDAFVQSCVEMQRLCRVPALDTEEARALVDSVWLTHVDEYIQMELAWQHRHLKDVCD
                     QWLRDLDRMLHSSEAESSSLAPHSAAEKRSFMASFKHALLRPAVRVQPASSGEPSSSS
                     QQEAREGYVGLQDAPGGMDEKDEEEDEAVLSYARAPAPRRAPSNMASLLNVETAVDMV
                     NMTRVSLQRLDALRQTHTELSGRAQAACIQALVQLYASLNDEHMAPGFLTAQEQIRAY
                     DPAKHDRAGGRGEAADHVGPLLVFFELVHIGDTIQLMMQVFFERLDPGLLGKADFTNA
                     AVREKRRFESDLDDHVAVGLSAGVELLVQQIEYIVTVHQNPRDFYPETEAAVDVSQPT
                     AACMECCATMQTYCDLLAACADKALLDVFYQEIGFRLYSILCKHLKRQIISTYGGVRA
                     ISDLNHYYHFIETMKQPSLTTLFGALKRVATLFIVDEPKELAKLIQDTTLSSGTMRPE
                     EMYEFLRARCDFKTIESKVDAEMYGIKVREDCVIT"
     gene            complement(<881143..>885072)
                     /locus_tag="MRET_1384"
                     /note="MRES_05525"
                     /db_xref="GeneID:38738150"
     mRNA            complement(<881143..>885072)
                     /locus_tag="MRET_1384"
                     /product="cell division protein"
                     /transcript_id="XM_027628011.1"
                     /db_xref="GeneID:38738150"
     CDS             complement(881143..885072)
                     /locus_tag="MRET_1384"
                     /codon_start=1
                     /product="cell division protein"
                     /protein_id="XP_027483743.1"
                     /db_xref="GeneID:38738150"
                     /translation="MHREHDEPVSPNLDAMMSGPDPTLEEKQSPRRSFRARVSDTIQR
                     ARGRSPSPAPAHTDQPPASPAPSVSSPSKLRGMGKFIRKSFEIGRSPSPSPSRNRDVV
                     YSYHAPEYQMPDLPDWQLYDGTSVSVNLDQLAERQESLVPPPTAPSSLSQAPMEQPMS
                     APPLVTSAPPPPPPAPMMPPPPMMAPPHAFPVMPPRFDGPPPPAPMGPPPSGPPMRMD
                     PSDAPLFGHTGPRSRSARTSLSPAAPVLMEPSTSPEPPVPQVREPGGDEADGSDEVDV
                     VNAYADVSGGNTTVAPGDDTVIEHEPRGDLLLPTAPSCASISLDGSEGDERDGQSSPG
                     DPSRPASAALDEDQKQQRILSAMERAPQGAGLTDLMNRVVNPRHQSWLQGLWSRKSSG
                     ASEASKPTSERSASQDHGDDGVIFRGMDASPSIYSTESMDRASDMSPRPERAPSVTTH
                     RTRSMLSRKSTATSKHSHHTSSTQASSRPSDDEREAFERRRASNLAAREILERESKQG
                     MSGDFRTQVLGSPHQPTTPTIHTPDPAAEAPAQDWSSAWHVHPEARRDYDEAQAQAEA
                     QAQAYAEWHAQQQAYAAWYSQWQTEAPWQEQAPWQTDAPWQGEAQWGGDPNAPWPTET
                     PWPETRASMPPVRRKAVPGTQAPSKPEPMPQPAAPSHERSSMPPPPDSKVPTILPDVV
                     DDDESVIDEQGRRLKPDGFGGLQPVESGEPAPPTPPASPPKPAAATRDPMPTPQGTPR
                     APQVESMRADFRPEDGRPLTSLSARGLSPALSPHASAVPQRASMPPAPSSSSDRGPFH
                     VAPELYTTPQSLQSSVQRMTWTPEMAEAAAKYIQTMTSSASRHQLQELSVSQSGVWQP
                     PVPGAPEPLPPVKDTEEAPGLPPSLSIVDQLHRKGMDLDIDAGVGAGTDDDMPLRDAL
                     KEAMVRFYFYERHSIPLLHELDKRLVAMEHWSMLDPEADGDHGQQPAWNKDAVARVSS
                     EMRREVRMLMHGVKMLNESRLSIQALAQHASTDRKRKRPTTPSEPHKRLVSTSTSSRV
                     SSGSRVSSGATVHVATPTVSQVRRSLPSPPAAQADGADETAPSMYGDASQSASDSIVH
                     HPPLPSPPAAREAEVTPPMPEPEADAPPNAPEPDAQAPRPDTHPLSAPNAPPAPAPTL
                     HAAPTKALESASREDEATPLARAKSLQVPSAPVEARPVRARSLLLASLQRADERSRTP
                     PPALAPAPAESPAPAPTPPPAARPPLANVENHAPAPAMAPTSGLRARAQKYLQTVEKT
                     SSDSHASGPSPADASSAAENQPPKPMYPPSALSESLRRRMAHFESAK"
     gene            complement(<885213..>886553)
                     /locus_tag="MRET_1385"
                     /note="MRES_05530"
                     /db_xref="GeneID:38738151"
     mRNA            complement(<885213..>886553)
                     /locus_tag="MRET_1385"
                     /product="ribosome biogenesis protein Sqt1"
                     /transcript_id="XM_027628012.1"
                     /db_xref="GeneID:38738151"
     CDS             complement(885213..886553)
                     /locus_tag="MRET_1385"
                     /codon_start=1
                     /product="ribosome biogenesis protein Sqt1"
                     /protein_id="XP_027483742.1"
                     /db_xref="GeneID:38738151"
                     /translation="MSDEWKDDAEAQGDLQLTQEDVDVDVTEGADEMPMDEVDAELDN
                     QDDETFQDDSIAAFYSHRKSVFCVQLHPKFPTPPLAVSGGEDDAAWIWNTIDGSEVAH
                     LTGHTDSVVAVAFSHDGEYVATGGLDGRVRVWRRHGSGDAWHTWEFLTNLEGPSEVVW
                     LTWHPRGPVLVAGASDTTIWMWKLPSGAEMMIFNGHTGSVTCGRFTPDGRRLVTGSDD
                     GSLIVWDPTSGAPLAKLKDSDTRFALDGGITSLCVSPDNKLVVVGGAAGGIRVVSIAQ
                     LDSGGAAQLVNALDAHDSGESVETIEFIDLVPSSAQGASVGLTSHTSTHIVSAGTDGR
                     VIAWDLKAGKVRGEARHEAAVTKLIVHPFTPLFSTSSMDHRVRTWDVRTMQNIGTQHG
                     FTDGVLDLAVGADDGITQGAESGGIGAYVDKSQFKGYKFVGAGDEGVALVFRLL"
     gene            <886728..>887483
                     /locus_tag="MRET_1386"
                     /note="MRES_05535"
                     /db_xref="GeneID:38738152"
     mRNA            <886728..>887483
                     /locus_tag="MRET_1386"
                     /product="ribose 5-phosphate isomerase A"
                     /transcript_id="XM_027628013.1"
                     /db_xref="GeneID:38738152"
     CDS             886728..887483
                     /locus_tag="MRET_1386"
                     /codon_start=1
                     /product="ribose 5-phosphate isomerase A"
                     /protein_id="XP_027483745.1"
                     /db_xref="GeneID:38738152"
                     /translation="MASSSSLSSVEAAKRAAAYAAVDAYVKPHHQVIGIGSGSTVPYV
                     VERIYERRHELSQSCTFIPTSFQAKNLILERNMRLGDMDTVQELDVTIDGADEVDDGL
                     NLIKGGGACHLREKVVAEASKEFVVVADYRKMSHVLGESWKKGVPVEAAPFAAQRIIR
                     ALERFGSTDVKLRMAVAKAGPVVTDNGNLCIDAIFPQTLMRNPDYLLKQIKLITGVVE
                     VGIFTNVCKAAFFGHEDGTVTRQWPDGAKTRTT"
     gene            <887816..>888382
                     /locus_tag="MRET_1387"
                     /db_xref="GeneID:38738153"
     mRNA            <887816..>888382
                     /locus_tag="MRET_1387"
                     /product="25S rRNA (adenine2142-N1)-methyltransferase"
                     /transcript_id="XM_027628014.1"
                     /db_xref="GeneID:38738153"
     CDS             887816..888382
                     /locus_tag="MRET_1387"
                     /codon_start=1
                     /product="25S rRNA (adenine2142-N1)-methyltransferase"
                     /protein_id="XP_027483744.1"
                     /db_xref="GeneID:38738153"
                     /translation="MELWPFSRRIQLLDVGAIAGTAYAKWKHKFDVTSIDIQPRAPHV
                     LQADFFDFPMPAREEERFDVIGLSLVINFVGDLAKRGDMLLHAHRYLRRGGYVYVVLP
                     LPCLTNSRYMTHDHFARLVRATGYDVVRNEDSHRLTRWLLQESEPRTAISPDTDVSRA
                     FWDGTVLAKRQLRPGAQRNNFCMLLSPA"
     gene            <888476..>888819
                     /locus_tag="MRET_1388"
                     /note="MRES_05540"
                     /db_xref="GeneID:38738154"
     mRNA            join(<888476..888652,888685..>888819)
                     /locus_tag="MRET_1388"
                     /product="glutaredoxin 3"
                     /transcript_id="XM_027628015.1"
                     /db_xref="GeneID:38738154"
     CDS             join(888476..888652,888685..888819)
                     /locus_tag="MRET_1388"
                     /codon_start=1
                     /product="glutaredoxin 3"
                     /protein_id="XP_027483737.1"
                     /db_xref="GeneID:38738154"
                     /translation="MAAKQIAEKLISENAIAIFSKSYCPFCVRAKQVISGQNVDPSKI
                     GTMELDEVSEGPAIQDYLAEKTGQRTVPNIFISGKHIGGCDDIMRAQQSGELQQLVGK
                     L"
     gene            complement(<888816..>889940)
                     /locus_tag="MRET_1389"
                     /note="MRES_05545"
                     /db_xref="GeneID:38738155"
     mRNA            complement(join(<888816..888853,888881..>889940))
                     /locus_tag="MRET_1389"
                     /product="autophagy-related protein 18"
                     /transcript_id="XM_027628016.1"
                     /db_xref="GeneID:38738155"
     CDS             complement(join(888816..888853,888881..889940))
                     /locus_tag="MRET_1389"
                     /codon_start=1
                     /product="autophagy-related protein 18"
                     /protein_id="XP_027483736.1"
                     /db_xref="GeneID:38738155"
                     /translation="MDLVRTAAGRREGILVADFNQDYSCIALGTQSGYSITNCEPWGQ
                     VHAKELGPTCLVSMLFSTSLVAVVVRSPAGGDKRLHILNTKRNSTICELTFPADIRAV
                     RMNRRRLVVVLATALYVYDISNMKLLHTIETGMNTTGLCVLAPASDECYMAYAAHEAG
                     DSHVVVYNLHTLAMVHVIPAHRSRVACLAFNAAGTVLATASEKGTVIRLFSVPSGRLL
                     HQFRRGTYPARIFRMSFNVAGTILCVTSDSDTVHLFRVPAWTTPCDPNQALAQKKRRA
                     WRSTSMAQTLGTYLPSSVTEMWEPTRDFAWLKLPRPGLRAIAVVSNTLPVVLVLTYEG
                     ILYTYTLDLELGGECQLAQRHSLLSASSASP"
     gene            complement(<890002..>891714)
                     /locus_tag="MRET_1390"
                     /note="MRES_05550"
                     /db_xref="GeneID:38738156"
     mRNA            complement(<890002..>891714)
                     /locus_tag="MRET_1390"
                     /product="ribosomal RNA-processing protein 9"
                     /transcript_id="XM_027628017.1"
                     /db_xref="GeneID:38738156"
     CDS             complement(890002..891714)
                     /locus_tag="MRET_1390"
                     /codon_start=1
                     /product="ribosomal RNA-processing protein 9"
                     /protein_id="XP_027483805.1"
                     /db_xref="GeneID:38738156"
                     /translation="MSDPFFQKKRKRSGETGAGKGRAPPRRGDDADSDDAGLEAVEDM
                     DLRHTFDEDEAQESETPAEAKVRLAKLYLEGLHEKEEIDGIDAAAVDRDNIAARLRKD
                     VEEGSGRMHLAVASRLSKPETKDVLCVRGHRACMTCARTGANAVHLFTSDKDGRIVQW
                     RLRDGRQVSVMPRGRDYAAEAPTSSTSGAARRRARHLEHVALQPGEGHTSSVLSLAVS
                     DDGSLCASAGGDKRIGIWETTPPRWVKALVGHKDAVRSVAFRGGSKELYSASYDRTVK
                     LFDAEQLSYIETLFGHQEAIQDLSCLRAERAVTAGGRERTCRLWKIGEESQLVFRGGA
                     RSKVHALLEGGDLVDTPVDKKNEVHEGSIDCISMIDDHHFVSGSDSGALSLWSIAKKK
                     PLFVVHAAHGYAPPSGETGRALPRYICSVACLPYGDVFASGSWDGVIRLWALEPGLRS
                     FRFLFDVPAPGVVNSLQLLTPAIERMEQYPVDPSQWRRRGGVHAPLHHAEQQDQPRRS
                     AASLRDTVHTSADGRVLGHKESIPPLLIAAVGPEPRADRWIHIPDAVSAALVVPLWLE
                     GSDT"
     gene            <891825..>893930
                     /locus_tag="MRET_1391"
                     /note="MRES_05555"
                     /db_xref="GeneID:38738157"
     mRNA            <891825..>893930
                     /locus_tag="MRET_1391"
                     /product="telomerase activating protein Est1"
                     /transcript_id="XM_027628018.1"
                     /db_xref="GeneID:38738157"
     CDS             891825..893930
                     /locus_tag="MRET_1391"
                     /codon_start=1
                     /product="telomerase activating protein Est1"
                     /protein_id="XP_027483806.1"
                     /db_xref="GeneID:38738157"
                     /translation="MSTVDPADLRREARARKQAQEDAIRHAKALTSDGTYDPCDAAVV
                     QARQALRTVYMALLMTCTFTRAAQLVDIMIWHDTTYHVISYLRARIVHAEQQVTNAPR
                     GKGRAPKRERKSAKASDHKRLQQQLLQFIDEEVAYYADTIACLVQRYALDETCSVLSA
                     LAIQIQPQHEATLAESARVPAHRHQLYEIIQRLLTCMGDLHRYRELHSAVPDRHHRVF
                     FHFTRAVLFYHQAHVLLPDHGNPSNQLAVVATTVGDSFGAVYQYYRALCVRVPFDNAR
                     HNLQRMLEKALHAWSSSARRDDVLVAWRQAALEDCPARRVPVPSISARWDSTHDYFDS
                     LVAFHSLCFLRADLDTACVLHDAILRHMLMAVDMHELRAVDYLRILVTGLCASWTTRL
                     CPAPLHERLPFSLGAPYSAHMDADVLAEHVRAAWGTLLVCHVLGMLTALLAVIRHELM
                     SLLRDRRPDSEAGPMDMGRILRRTLPSVRIGLKWVRGHVDYMASCRAQAAQAAEELQQ
                     AVDQQKTPSSLATDAVARLACVQRSVEARMSSFWSALIDFGNLLQAAYPPSVLPVAPE
                     ASIFIEEDVDLQFLGPIRRVMHPTEASPYALPDLAPLPSAHADYARVLDVERDIRGMA
                     TSEACGLVYDEARAMFVSRAAPVEADDPIELAMRAMDVHMDHAWSQSKPAQDAPAWPS
                     STWTDPWTTSNSIWTTWPS"
     gene            complement(<893872..>895125)
                     /locus_tag="MRET_1392"
                     /note="MRES_05560"
                     /db_xref="GeneID:38738158"
     mRNA            complement(<893872..>895125)
                     /locus_tag="MRET_1392"
                     /product="COP9 signalosome complex subunit 1"
                     /transcript_id="XM_027628019.1"
                     /db_xref="GeneID:38738158"
     CDS             complement(893872..895125)
                     /locus_tag="MRET_1392"
                     /codon_start=1
                     /product="COP9 signalosome complex subunit 1"
                     /protein_id="XP_027483803.1"
                     /db_xref="GeneID:38738158"
                     /translation="MSGWEATLGGWTRVRYLLHVAAVAPAQREAALVEAAAYMQAHLW
                     DADKLRSVRCEAGMPNEAAWDTWLATTAAHVHEEQERLLADLAASQHTPERARRIHCL
                     LGAHFRRRGAFRAALEHYESAREYGITNEHALASYVGILQTAHDMGDAERVLLCYEQA
                     HTMLRALVRSHSTEGWQLVRDVAGLPDASCEDVAARLAAWRLVAQWTLCRDALPEPLL
                     SEHSDAYADLLGPAQGAWYAVLWALCVHPPSVQRARAAQVLQDASFRQYTDVARAPRD
                     VLSTYLVSDWPSCIALVRDAHASAWRCDPAIGVQRADTLLHTLLTRLIECHVQAYTCV
                     PLASLSRLFGDSVPRILLDLIRSGAVRARIDWARQVLEKEDVHVVDVRPSDMSALRAR
                     LTVLQRLSLATSSKSSSMSSTDPST"
     gene            <895219..>896370
                     /locus_tag="MRET_1393"
                     /note="MRES_05565"
                     /db_xref="GeneID:38738159"
     mRNA            <895219..>896370
                     /locus_tag="MRET_1393"
                     /product="COP9 signalosome complex subunit 4"
                     /transcript_id="XM_027628020.1"
                     /db_xref="GeneID:38738159"
     CDS             895219..896370
                     /locus_tag="MRET_1393"
                     /codon_start=1
                     /product="COP9 signalosome complex subunit 4"
                     /protein_id="XP_027483804.1"
                     /db_xref="GeneID:38738159"
                     /translation="MTWAPQLEAVGRIASSEERIAQYTRLLEHALHDTPSASLPSLVR
                     TYVDGAVLDPVNTTGAGLLVGRHMLAHLATQLAAAHIPANILCTIVSDTLATCEASSI
                     MGDDELGPWRVLLAEQYASLSRWRDAAQALQSITPHAARRIPQLSFAQLCVRVVELWL
                     HDLPSHVAEAEQAIKRANSAILDERDNKALVHELWSYHARVLAIQHRFMEAAARYMDL
                     PHADMYAAVYAIISPPSAQRTSMLTRLAQRASAWPFAQTLHHAAEGRFLRPADLEALA
                     PFLGGVPVQPDVFVEHNVCVALSFFSSVPLTQLTRLVGLDAHEHGVQACEAAVARLLS
                     QGVLPTDTCWIDQVTQAVYLDAPDAETDREARISACLQALDAAHARLSA"
     gene            complement(<896377..>897243)
                     /locus_tag="MRET_1394"
                     /note="MRES_05570"
                     /db_xref="GeneID:38738160"
     mRNA            complement(join(<896377..897044,897072..897134,
                     897162..>897243))
                     /locus_tag="MRET_1394"
                     /product="Rwd-domain protein"
                     /transcript_id="XM_027628021.1"
                     /db_xref="GeneID:38738160"
     CDS             complement(join(896377..897044,897072..897134,
                     897162..897243))
                     /locus_tag="MRET_1394"
                     /codon_start=1
                     /product="Rwd-domain protein"
                     /protein_id="XP_027483809.1"
                     /db_xref="GeneID:38738160"
                     /translation="MVSAEEHEQVLSEELEVLESIYIEELQKLSPTHLQIRVVPEDYD
                     EAKQDPILLLDVQYTEQYPDDVPELHIHVLEDGRQVLGMPPPEDEEPPRDDPREGVQL
                     LAKELEQVAKESLGMPMVFALASHLRESLTDYMTRQAQEAEKAASERREAELRAEEEK
                     FRGTAVTVERFNAWRIEYMRKQELLRAQKEEAYVASLTPKEREEYRRMKAKPTGREIF
                     AKPDARVEEEKTDESVKEVDFSLYSREDRERQAREDHEDDAAQDGYVDDMDE"
     gene            897363..897448
                     /locus_tag="MRET_t0021"
                     /db_xref="GeneID:38741215"
     tRNA            897363..897448
                     /locus_tag="MRET_t0021"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:38741215"
     gene            <897968..>899947
                     /locus_tag="MRET_1395"
                     /note="MRES_05575"
                     /db_xref="GeneID:38738161"
     mRNA            <897968..>899947
                     /locus_tag="MRET_1395"
                     /product="molecular chaperone DnaK"
                     /transcript_id="XM_027628022.1"
                     /db_xref="GeneID:38738161"
     CDS             897968..899947
                     /locus_tag="MRET_1395"
                     /codon_start=1
                     /product="molecular chaperone DnaK"
                     /protein_id="XP_027483810.1"
                     /db_xref="GeneID:38738161"
                     /translation="MIGALTRGLRMAPSTGRLLSQPLRAAPLGGVRFNSGKVSGPVIG
                     IDLGTTNSCVSIMEGQQARVIENSEGGRTTPSVVAFTKDGERLVGVPAKRQAVVNPEA
                     TLFATKRLIGRKFTDREVQKDIDNVPFKIVAHTNGDAWLEARGQRYSPSQIGAFVVGK
                     LKDTASGYLGKSVKHAVITVPAYFNDSQRQATKDAGTIAGLEVLRVINEPTAAALAYG
                     LDRQDNATIAVFDLGGGTFDVSILEMSKGVFEVKSTNGDTHLGGEDFDIVIVEHLVKE
                     FQKENGIDLSKDRMAIQRIREAAEKAKIELSSTSSTDISLPYITADASGPKHINSKMT
                     RAQLEGMISKLIQRTVDPCNKAMADAGVKPSDVNDVIMVGGMSRMPKVLDTVKNIFKR
                     EPSKGVNPDEAVAIGASIQGGVLSGHVTDILLLDVTPLSLGIQTLGGVFTRLINRNTT
                     IPTKKSQVFSTAADGQTAVDIQVYQGERELVKDNKLLGNFQLTGIPPAPKGVPQIEVT
                     FDIDADGIVNVGAKDKATNKDQSMTIAAGSGLSEQEIERMVNDAEQHAEADKARRVVI
                     EEANRAQSVAGETSKAMAEFKDQLDKEEAEKVQKLVEELEGLASRGISGDAELTADEI
                     KAKIDETQQASLGLFKKVYESRAQSDNQGEGEKKE"
     gene            complement(<900036..>902681)
                     /locus_tag="MRET_1396"
                     /note="MRES_05580"
                     /db_xref="GeneID:38738162"
     mRNA            complement(<900036..>902681)
                     /locus_tag="MRET_1396"
                     /product="PX domain protein"
                     /transcript_id="XM_027628023.1"
                     /db_xref="GeneID:38738162"
     CDS             complement(900036..902681)
                     /locus_tag="MRET_1396"
                     /codon_start=1
                     /product="PX domain protein"
                     /protein_id="XP_027483807.1"
                     /db_xref="GeneID:38738162"
                     /translation="MGSETNPFRRAGFHSANKTQYAPDSAAHALTPLRAHYLKKTLVR
                     LQLEKELAQMQQPDALEQLGPPFRTPNPVQRDNLPLIRHLLHQFVLTFPFFESAPPDF
                     FPNKVQAFVERMLERNLIMIDPVRESKSASMADKTTAYLTMLVSGGLRAKGVEEEIVR
                     VSGVDRERLFTMDAHRMATRKSSSDKGTKIDIVSVRRTIRRGHIRNKTLDEFIVSTRA
                     HQEEIHVARRYSDFHRLYKVLRAQFPAQEIPELPPKDMAAVEVNGALQQEDRDGEWVD
                     MTAVTPNALLRERNRLTLRAFLRHILGIPVLADSEAFQDFLVHDPTILTSEDKADAHA
                     RRQADAVRETELKEFADQMAERARILQSHLDTFKSMLLKPDGLSQVFATIRSCPHVQD
                     LPPEYKVIVDWATVSMASGLFTMFVARDSSSRAFAHLKYMHSMMPYFVVRGILRISNP
                     VAMMRSFLDLFLAQPFGQKSLLQRMYTGKLHEELHEIKELTLNVRAKIPDPVYADKVD
                     AFIALSHEMQCLFYEQAEAEGVDVLVVVLRSPLAAELQPRQLSRINRACTAYQKFKKQ
                     RAHARSLGLPDAEPESDDAWLLEDLRVYLSLCSAIHTKEQIISLIYDNATTELLKDMV
                     TIFYAPLAQVYRVANVSDTLGDVQVFVNDLIKTVEENASLHASNPDAVVSAFVNLVQR
                     HQQKFYHFVHQVHTKGSGLFQRLIHWIELFVNYVRDPREAKACGLGWIDLEQCLALSH
                     VDRACVMKEVDAVIQHVYKLKLQRELKRRRKLVNKAVARAADEPQEEEAFINTMSEQF
                     GFGSGLQDEIEELDGSDDETSDSDPLSSSDDDSGPEDADATALRRARMMQAEQPAGSS
                     LVAPTTHAIKTMLPTFVQLILSSSK"
     gene            <902835..>903506
                     /locus_tag="MRET_1397"
                     /note="MRES_05585"
                     /db_xref="GeneID:38738163"
     mRNA            <902835..>903506
                     /locus_tag="MRET_1397"
                     /product="mitochondrial import receptor subunit TOM20"
                     /transcript_id="XM_027628024.1"
                     /db_xref="GeneID:38738163"
     CDS             902835..903506
                     /locus_tag="MRET_1397"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit TOM20"
                     /protein_id="XP_027483808.1"
                     /db_xref="GeneID:38738163"
                     /translation="MKLSSVLTAAASTLAVATIGYAVYFDYKRRNDPDFRKKLRKQSK
                     QSVKVAKKELKAAAQQESMMIEKAVRDAAEPGVLPAGVQEKEAFFMEQVATGEALFAQ
                     GAAYHVPAAIAFFKALKVYPAPVELVMIYQKAVPKEVFDLIMKLVTRDAAVNGAGGAS
                     AKSADLDQVDDAVGAKESSEPKDSSDAKSETTSSKATELPNDAGKKEETEKDDKTPQA
                     GAETA"
     gene            complement(<903559..>905802)
                     /locus_tag="MRET_1398"
                     /note="MRES_05590"
                     /db_xref="GeneID:38738164"
     mRNA            complement(<903559..>905802)
                     /locus_tag="MRET_1398"
                     /product="choline/ethanolamine kinase"
                     /transcript_id="XM_027628025.1"
                     /db_xref="GeneID:38738164"
     CDS             complement(903559..905802)
                     /locus_tag="MRET_1398"
                     /codon_start=1
                     /product="choline/ethanolamine kinase"
                     /protein_id="XP_027483801.1"
                     /db_xref="GeneID:38738164"
                     /translation="MSRWYRPPTPTLYESIDEELDALEIEGVPGPALKHAAPQAWSPA
                     VFEPQDESDDDLAEQFDENEDDMHASGIPAARGWRLDPRHADTFAFKDRVLRMFSEQL
                     GILGWAPEHVAPGALPLVPERVTIKRITNALTNAVFFVGYDAASLPAPPTVLLRVYGA
                     GSEALLSRRAELLILHTLSSLYEIGPHILGTFANGRVEEFYECYSIGQEGMRDLGTPR
                     AEGPAHWVARRMREMHEVPLDVMRTILEQGDLKSTSAGFGRGIENHIMASSHRPRRQR
                     RQPPGATSPAWQSYSYFAHPSPGLFSRRANASTMSFDSLATSYDSAASPRSTLFTPMD
                     APQGDSSAMSPLSLGPSDAPLQPTSHGPYPGVWRRLKRWTREASKVIELVNAFALSPE
                     GRVVCDAHGVSSLPVSVDAPRTPRLPPAASLRATRVYFRDMMLSLLACDLSMLCREIA
                     EYKQYVRKWEQVEGKSRRVFCHNDSQCGNLLLLRVDQHGELPAMASGMPRDHQSVVST
                     SPQSPVLEATRSRRRSRSRSRASEPHQRLVVIDFEYATPNPRAFDIANHFHEWRSNYL
                     HPTYSWSLRHHGAYPTQEQRQQWLHAYVDQGQRMRRRSTSASKLCTNESVPPISDISL
                     PPAVLSRTPSTPSFSPLTPLTPHGAQAQVDRLEQEVHVWSPATHAVWGLWGIVIARND
                     IETLLAHVKSHVRTTPEGLVYEDPGEPAPPCDETGAEDFDNLRFALGRIELFREELGE
                     RGIGRRL"
     gene            complement(<905915..>908440)
                     /locus_tag="MRET_1399"
                     /note="MRES_05595"
                     /db_xref="GeneID:38738165"
     mRNA            complement(<905915..>908440)
                     /locus_tag="MRET_1399"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628026.1"
                     /db_xref="GeneID:38738165"
     CDS             complement(905915..908440)
                     /locus_tag="MRET_1399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483802.1"
                     /db_xref="GeneID:38738165"
                     /translation="MGVLGLTRWTNDVERIISSEFTIPVPKGSGSVLENSEPIELNPD
                     GDWLVIDAWAWIHYVWHSMNTNVYQGGSFLHFRVVLKAWIDTLREAGFKVLVVFDGPR
                     LHQKIGALLTRTENYVRLNAKLMRAGRNLRGDHEFMHARMLPRGLTEFVCSLLRSYDV
                     EVIMGAEEVDGVVAQLADERAGYVLSRDSDFLILCSNAPRCKGYIPLNTFEFVAMETA
                     APQPEAPPADDDGFTAVSTVKRNKKAAQQARNAHLPHTKNTPVLPSDSETLRQTALKF
                     RCFSSYKCAEQLKLPMSLLPVFAALVGTENRAQVHAELFGGLLHGVSNRMNVIATHLA
                     EQYAAVKEGNAPPLAVDEESEHEERLDLSDPVTRLLAQTFDSLVQYGRQRRGAPLPVS
                     WDMRTEIVQSMHATALSYMPDRGCEAMDRFMAPTDNESLKKYQAAYWDGHFDQAMIST
                     MLERIYIARVYLEEPDEPASQRVVVRQMRQFVWSILFTAWFAAHPEEKARIEEALAKL
                     RVEEEAAQQEEMPDDEENVEADHDEEQDDEDEAEEEPEPEPEETGPEPLTTVTEYTRT
                     EYALRKDEVPVHPLAVHLKSMERIMPIPESITPIVEKYGEAMEAHAADESKPVPTPVF
                     AAELPEAERLDLWRYIHCSCIPELEQLPVDVRSFAAGLRYTIVMNHERLGSMRTRHNW
                     SQSEIEAAVHSACISRRVSKEASEMEMQAIVNAYPKGSPSNRAITLSTTLGFVLQMSA
                     LLTQSLALSEQIPNARPLWEPPLFHVCLGSSMDANAPKPQPNEAWTRFDDPELYDTLL
                     AVVTHGLEKRIGRTRTAPVQQPAKKSGGQRQRRHLALLEETML"
     gene            complement(<908566..>909279)
                     /locus_tag="MRET_1400"
                     /note="MRES_05600"
                     /db_xref="GeneID:38738166"
     mRNA            complement(join(<908566..909064,909096..909121,
                     909151..>909279))
                     /locus_tag="MRET_1400"
                     /product="poly(ADP-ribose) polymerase"
                     /transcript_id="XM_027628027.1"
                     /db_xref="GeneID:38738166"
     CDS             complement(join(908566..909064,909096..909121,
                     909151..909279))
                     /locus_tag="MRET_1400"
                     /codon_start=1
                     /product="poly(ADP-ribose) polymerase"
                     /protein_id="XP_027483537.1"
                     /db_xref="GeneID:38738166"
                     /translation="MPYRIEYASTSRATCKGPQPCAGTKIEKGELRLGTLTEIQGHHG
                     MAWRHWGCVTSRVLANMRKEIEDVANELDGFEDLEPTDQEKIMAAFALGHVREQDTTP
                     VLLDEKPSDAPTHKGTKRRRTGRENDDDDVAYESDDNDDTKALEMIENLPSKRARKPT
                     QRYGASSARPKEEDVASEEDEEEEEEEAEDSDDSDVFEQDDEDEDDEDDEEEYEEED"
     gene            complement(<909339..>909978)
                     /locus_tag="MRET_1401"
                     /db_xref="GeneID:38738167"
     mRNA            complement(join(<909339..909495,909525..909687,
                     909720..>909978))
                     /locus_tag="MRET_1401"
                     /product="smad nuclear-interacting protein 1"
                     /transcript_id="XM_027628028.1"
                     /db_xref="GeneID:38738167"
     CDS             complement(join(909339..909495,909525..909687,
                     909720..909978))
                     /locus_tag="MRET_1401"
                     /codon_start=1
                     /product="smad nuclear-interacting protein 1"
                     /protein_id="XP_027483538.1"
                     /db_xref="GeneID:38738167"
                     /translation="MSPHESVRREASPSRRDRDMMKRERSHSPHGEYVPPVAPPNFER
                     SGLLAKESNNINGVALKYHEPPEAKKPRHTWRLYVFKDGHEKDMFLLGRQSCYLFGRD
                     RAIVDIPTEHPSCSKQHAVIQFRQITKRNEFGDVRRHVQPFLIDLESSNGCTVNGNEI
                     PTSRYYELRSGDTCQFGTSKREYVLLDESQAP"
     gene            <910077..>912764
                     /locus_tag="MRET_1402"
                     /note="MRES_05605"
                     /db_xref="GeneID:38738168"
     mRNA            <910077..>912764
                     /locus_tag="MRET_1402"
                     /product="tRNA ligase"
                     /transcript_id="XM_027628029.1"
                     /db_xref="GeneID:38738168"
     CDS             910077..912764
                     /locus_tag="MRET_1402"
                     /codon_start=1
                     /product="tRNA ligase"
                     /protein_id="XP_027483535.1"
                     /db_xref="GeneID:38738168"
                     /translation="MDHRNEQVEAFVQALHTASQREKKPLVRSTHFLLPPGDNDPIEH
                     NILSWKAQEFAYRQFSQDREELPTLARGLFTEKVNGQYERIVIRGYDKFFNQDELAWT
                     LPNAIATYSTGPFILSFKENGCIIFISAITPKRLVVTSKHSLGFRTEGDKPTHAEMGW
                     HWVRHHLAQAGRSEEALANELWNRNETAVFELCDDSFEEHVLPYSPERTGLHLHGLNK
                     NTVDFETRPMVEVKAFAEAWGFFPVRYLTFQTHEEVDAFTKSVALTGSLNGEPIEGFV
                     VRTTIPDDISNPPPGVVPPPYKPGQTWFYKIKFDEPYLMYRDWRELTRTMLREKNNWD
                     ALQLALLDSQTKHLEIEDQEPEEKQEPQEHDLAAPSKNAMKRAQRALRRKKDELDRKT
                     GVAKPWAPTPKSRRPETMLYVLWCYDRIYGNPQQNVAPQPELFAEFGQGRGIISLREA
                     FLAYLASEDGQKALSDKTQSKASETRDLRSDERPYEKTLIVPIAVPGSGKTALFVALS
                     HLFGWAHTQSDDVQTKRTGPGFLKNVEKELLAHDVVLADRNNHLIKHRDELVDIVRRI
                     SNPQRGSVGRVRLCAIVWDIAGLPHSEIQALCSKRMIDRGDRHQCLRIETPGKFEYDV
                     ILTRFIKETQPFRGAQSGEGSVGVSDDQFDEVVRLDIHDPMKVSLQRVLKHLCPVLGL
                     SMPTDERISEAIDVAMHYRPSVRKPLPKLESDQDKQKNLAVLPSSYLGVSVFMTPSEF
                     VLQLLDRKPVSETVLSARRILSIIINENRMIQRPHMTIVHQQDVKKGIVDQAAWDKLY
                     TFAISDPAVNPRVFLEVTALLWNHRVMALEVSPPHCPDWKDTTKFSPRERHHITIGTA
                     ELSATAFEANKLWDDPEAERLEVPIQRLEGCLKFYSNRK"
     gene            <912975..>915020
                     /locus_tag="MRET_1403"
                     /note="MRES_05610"
                     /db_xref="GeneID:38738169"
     mRNA            <912975..>915020
                     /locus_tag="MRET_1403"
                     /product="multicopper oxidase"
                     /transcript_id="XM_027628030.1"
                     /db_xref="GeneID:38738169"
     CDS             912975..915020
                     /locus_tag="MRET_1403"
                     /codon_start=1
                     /product="multicopper oxidase"
                     /protein_id="XP_027483536.1"
                     /db_xref="GeneID:38738169"
                     /translation="MVASKQPWGLRQWMLLVIGAGLLGLFSCLIWTDVALQQSLLHTW
                     DQGWQVVRKQSMAYYQQSPVSMNTKFNTSESPRERVFDWTVDRRIQAPDGVPRLMYTI
                     NGQFPGPTIQATVGDTVVVHVRNRINDDYVVPDPPTTSKLESVHPKGTDRKFSLHWHG
                     LSMRGSDEMDGAAAFTSCPLQPGNETTYRFVVQPEDVGTHWYHSHVGTSRADGLWGML
                     IVHAREDERKVLKERAPTFDTHWDEEIPIALGDHFHKMSPESLAKYVSIVLGEAEPVP
                     ESGLINGRHIFSCDMARYTGVPCPAGDKDEVGEYTEFHLRHDKQYRLRLVNVGSIADI
                     TFSVDGHTMTVIEADGTLVEPMHVHRIPISPGQRYSVILHREPSMKDSRVWMRAELQG
                     ECFKYMNPVLDPFIKAIVVYDNASPKDDWLAPLRVRQNYAKRFGPFRAFAKSERPTTH
                     PWSPDIQDQGIPTEPCHDLEPGTLVPLIPDPAPEFHPERGDRREIINIEVLIRQKFRA
                     PMSYMNLSSWRPYGARGPAMQPLLHRISHSNLTTADEWEAHGLVNREHELVVSTHPTK
                     PIVYDLVIVNLDDGPHPFHLHGHKFWVLHTGEMEVPSYRYKPEVEKEFDLKRAMKRDT
                     VVVPMMGHAIIRWVADNPGVWAFHCHMLVHLASGMAMAIVEQPALLQANPSVPSTCQ"
     gene            <915144..>917237
                     /locus_tag="MRET_1404"
                     /note="MRES_05615"
                     /db_xref="GeneID:38738170"
     mRNA            <915144..>917237
                     /locus_tag="MRET_1404"
                     /product="multicopper oxidase"
                     /transcript_id="XM_027628031.1"
                     /db_xref="GeneID:38738170"
     CDS             915144..917237
                     /locus_tag="MRET_1404"
                     /codon_start=1
                     /product="multicopper oxidase"
                     /protein_id="XP_027483533.1"
                     /db_xref="GeneID:38738170"
                     /translation="MATKGKMRTAGYALVFFLSSALISAYLWILYAKVDIHGVVHTAW
                     DASANAFRLGRNTHLVPAGAVTTGPNTMNPRYDPTEPPRERFFDWTVERADLAPDGVT
                     RLMYTINGQFPGPIMQVTEGDTVVVKVRNHIFDNYTVPPAPMSSKLYDVHAKDTDRKF
                     TIHWHGLSMRGMQVMDGASAFTSCALTPGDEYTYRFVVQPEDVGTHWYHSHVGTSRAD
                     GLWGMLIVHAREDERKVLKERAPTFDTHWDEEVAISVGDHFHDMGPESLARYVSRWLQ
                     KAEPVPENALINGKHVFSCEHSRLSGVPCPAGDADEVGEYSSFHFRPDRAYRLRLVNV
                     GSLADITFSVDGHTMTVIEADGTLVEPLRVHRIPIAPGQRYSVILHKEPTTKADRMWM
                     RAEMSHECFQYTNPVMELESKAIVAYDGRPPAWEDDETHQLFPLRLRSNRAKVSEYVY
                     SNGATLKLPDTKAWSPNVTDAAIPTEPCHDLEPDTLVPLIPDPAPELRLDQGDKREFI
                     YVTVPILEKYGIVPMGFMNGSTWRPYGQRGRDRQPLLHRISHANSTSVRDWYSTDVAD
                     PMHELIASPHPSKPVVFELVINNQDDSPHPFHLHGHKFWVMQTGEIDPAYGGYDYYED
                     VGQVYPLDRRMKRDTVVVPMMGHAVIRWVADNPGVWAFHCHMLVHLASGMAMAIVEQP
                     ALLQANPPVPSVCKL"
     gene            <917363..>919309
                     /locus_tag="MRET_1405"
                     /note="MRES_05620"
                     /db_xref="GeneID:38738171"
     mRNA            <917363..>919309
                     /locus_tag="MRET_1405"
                     /product="phospholipase C"
                     /transcript_id="XM_027628032.1"
                     /db_xref="GeneID:38738171"
     CDS             917363..919309
                     /locus_tag="MRET_1405"
                     /codon_start=1
                     /product="phospholipase C"
                     /protein_id="XP_027483534.1"
                     /db_xref="GeneID:38738171"
                     /translation="MQFVQSAAALAAALLIATPVLAEQKWYNPHGVNDGLKKVKHVVL
                     FMQENRAFDHYFGTMAGVRGFQDPNVQVSNNTGKNVFHQPVDQSILSPAPPKDVDEVQ
                     PFYLNWAGKDWHQKTQCMLAGVNDWVFNHAAWNNGNNDHWALRNSVYSLGYLKEDDIP
                     VQWNLADSFTVGDMYYESIIASTNPNRVAFFASTINPPHGSTINGTNKHMGGPVLNNN
                     GHDGCFVTAELTPLSCRPLRWKTVPEYLQESGISWQVYQDEDNFGDDPLDHFEQYEKA
                     AKHKSELAKRGTSYVGLDKFYEDARNGNLPEVSYIVAPENLSEHPPFKPMDGSWIQKK
                     VADAVMEGKAWDSTAIIYSYDETGGWADHVMAPHPPRSEKGEWIEDPFLKFKGVQPIG
                     PGYRLPFYIVSPWTRGGNVFTEHAAHESQIMFLERWAEAHGKSFYAKEVPLWRRAQLS
                     DLVKAFDFSKEDTSVPFIPRVHKPSQDALTHRFNGGIQCLLKHAGFVFPPVPYGKQNS
                     KNSMEVKKGFKSVRGNLTEGRRLTFEANGHALSHANKKLGTSSAKKSHDDDNQLFVLH
                     WLGSEPRDNRFHISTEKGHYITKKLSLSNNKNEAGVFSIQDIGNGVGYKVTETEKNQQ
                     VTINKDGSVAYGDSSYLNIYSVTR"
     gene            <919521..>921467
                     /locus_tag="MRET_1406"
                     /note="MRES_05625"
                     /db_xref="GeneID:38738172"
     mRNA            <919521..>921467
                     /locus_tag="MRET_1406"
                     /product="phospholipase C"
                     /transcript_id="XM_027628033.1"
                     /db_xref="GeneID:38738172"
     CDS             919521..921467
                     /locus_tag="MRET_1406"
                     /codon_start=1
                     /product="phospholipase C"
                     /protein_id="XP_027483531.1"
                     /db_xref="GeneID:38738172"
                     /translation="MLVHLHIAALAALAASSAWAKQAEEKWYNPNGVNPELKKLTKIV
                     LFMQENRAFDHYFGTMPGVRGFQDPNVMVSNNTGKTVFHQPVDDSILIPAPPKHVKEI
                     KPFYLNWAGAEWNDKTQCMVAGTNSWQANHAAWNKGNNDHWALGNNVYSLGYYHKDDI
                     PIQYELADKFTVGDMYFESVIASTIPNRVSWWTGTINPPHGSEVPGPNVLRGGPVVDN
                     DVIPGCKPASGGGLYTCVPFDWKTTAEYLQERDISWRVYQDIDNFFDDTLYYFKKFQA
                     AALKGEEMAERGLTFPGLERFYEDARTGNLPDVSYIMAPTNLVEHPPMRPQDGGWLQK
                     EVANAVMNGKDWNSTALIFSYDETGGWADHVMAPHAPQSVKSEWMTDPFDKKLGNQPI
                     GPGYRLPFYIISPYTQGGHVFTEHTTHESQIMFLEKWAEAHGKPFYTKEIPKWRREQY
                     SDLVKAFDFSKKESKVVPLPQIPDASKDLLTGLYNGGIKCLARNLGQRPPVPYERQDE
                     SNTLETTKGFKPVRGDLTEGRRLTFEAHGRALSHANAKLGTSRSNIDHDGDDQLFVLQ
                     WLGTAPKDNRFHITTEKGHYITKDLSLSGNKHEAGVFSIKDMGNGVGYKVTELHAHKQ
                     LSIQKNGEVSYGDASYLKIYSVTR"
     gene            <921662..>923629
                     /locus_tag="MRET_1407"
                     /note="MRES_05630"
                     /db_xref="GeneID:38738173"
     mRNA            <921662..>923629
                     /locus_tag="MRET_1407"
                     /product="phospholipase C"
                     /transcript_id="XM_027628034.1"
                     /db_xref="GeneID:38738173"
     CDS             921662..923629
                     /locus_tag="MRET_1407"
                     /codon_start=1
                     /product="phospholipase C"
                     /protein_id="XP_027483532.1"
                     /db_xref="GeneID:38738173"
                     /translation="MVQVTTLAAAVVLGAAASTSAVERWYNPHGVNPGLKNIQHVVLF
                     MQENRAFDHYFGTMAGVRGFQDPNVHVSKNTNKDVFHQPVSRNMWNGDTLQPLGYFPP
                     KDVNELKPYYLAWQGGDWANRTQCMVAGTNDWRQNHAAYNRGEMDKWAMANTPYSIGY
                     VHEADIPVQYKLAEAFTVGDMYYESIMSSTAPNRVSWFSGTINPPKGSKVNGTNKHMG
                     GPTLDNRDSVGCERTDSGKPFSCVPLRWKTVPEYLQEAGISWRVYQDKDNFGDDPLVM
                     WKQYQTSAKKKGDLAQRGTSFPGLQKFFDDARDGKLPEVSYIVAPMQLSEHPPYMPMD
                     GAWIQGEVAKAVMHGKNWDSTALIYSYDETGGWADHVVSPYPPQSEESEWIEDPYDKS
                     NGITPIGPGFRLPFYIVSPWTSGGHVFTEHAAHESQIMFLEQWALAHGKPFTSEEIPT
                     WRREQLSDLVKAFDFSSKDTSVPEVPHVRKPSQDIFTGHFNGADVCQAIHLKKVQPDI
                     PYKKLNPSNSMEVNKGFKRLRGDVTEGRRLTFEAHNRALSHSGSKLKSSSSSKEHDQK
                     DQLFVVHWQGVNPKDNRFRIATTDQLYITKSLSLSKNEEKAALFSLKDMGNGVGYSIS
                     ELDSGKRLQLNEDGSVALGGDTYFQIYSVTL"
     gene            <923982..>925937
                     /locus_tag="MRET_1408"
                     /note="MRES_05635"
                     /db_xref="GeneID:38738174"
     mRNA            <923982..>925937
                     /locus_tag="MRET_1408"
                     /product="phospholipase C"
                     /transcript_id="XM_027628035.1"
                     /db_xref="GeneID:38738174"
     CDS             923982..925937
                     /locus_tag="MRET_1408"
                     /codon_start=1
                     /product="phospholipase C"
                     /protein_id="XP_027483529.1"
                     /db_xref="GeneID:38738174"
                     /translation="MMFPVAKSWLAATALLSVIAPSVAVHDELKQIKHIVIFMQENRA
                     FDHYFGTMAGVRGFQDPNVHISKHTGKDVFHQPVNSSMWDGDSEQPASYYPPKNVTEL
                     KPWHIPYQGGDYAERTQCMVAGTNDWRQNHNAWNKGEMDQWAMANTPFSLGYYRRDDI
                     PTMYSLAGNFTVADHYYESIMSSTDPNRISLFSGSINMNGSVVGGGGLKKGGPVIDNN
                     GDPHCLVADNKEFFSCRPLKWKTVPEYLLEKNITFQFYQDFDNFGDNTLVAFTQYREA
                     AKNKTELAKRSMSFIGIDRFVEDARKGTLPEVSYLVAPMQLSEHPPYTPKDGEWIQAK
                     IANAVMNGKNWNSTVLFYSYDETGGLADHVVPPLPPKDAKGEWMTDPYDKKKGKVPTG
                     PGFRVPFYAISPWTRNGGVFTEHAAHESQIMFLEEWSKAVGKGFHTKEINPWRRAQFS
                     NLVNMLDFSYHDGSVLKLDEVPEASKDPITDQYNGADVCALKFRSDVQPTVPYNNTEA
                     QSLRVEKGYKPVRGNLTEGHYLTFEKDGKALQHKGHKLSLTNACNDHDGKDMRFVLWW
                     QGKNPKDNAFYISTADKHDRKYIASSLELTTKEKAAQFSIADLGNGKGHVITEIDSGK
                     QLSVEKDGCVALTKNASDAFKVFSVTF"
     gene            complement(<926132..>927049)
                     /locus_tag="MRET_1409"
                     /db_xref="GeneID:38738175"
     mRNA            complement(<926132..>927049)
                     /locus_tag="MRET_1409"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628036.1"
                     /db_xref="GeneID:38738175"
     CDS             complement(926132..927049)
                     /locus_tag="MRET_1409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483530.1"
                     /db_xref="GeneID:38738175"
                     /translation="MSTYAQDDKFPHQRDNESPETPAEAFHQDFNNQYYNTINRMTSR
                     MSNDERTVAIHAARYGYGPFAHLNFKNELVNYPFGGEMQPGLFRNVQDRKIANPAPLG
                     LCAFALTTFVLSLINLGTLNLSNTNVVISLAFGYGGLVQILAGMWEMAIGNTFGATAF
                     ASYGGFWVSFAILLTPGGFDIMNTVSKAEGEAGMMHAFSLFFFGWFVFTTLMLFCTLK
                     STIAFFFLFFTLDLTFLFVGLAYLYNTGEAPHTNLLRSGGGFGILAAFASWYNAFAGL
                     ADDTNSFFVIPAVYFPWTGRKSKQEASKA"
     gene            complement(<927219..>929466)
                     /locus_tag="MRET_1410"
                     /note="MRES_05640"
                     /db_xref="GeneID:38738176"
     mRNA            complement(join(<927219..927292,927321..927370,
                     927397..927464,927496..>929466))
                     /locus_tag="MRET_1410"
                     /product="histone-lysine N-methyltransferase SETD1"
                     /transcript_id="XM_027628037.1"
                     /db_xref="GeneID:38738176"
     CDS             complement(join(927219..927292,927321..927370,
                     927397..927464,927496..929466))
                     /locus_tag="MRET_1410"
                     /codon_start=1
                     /product="histone-lysine N-methyltransferase SETD1"
                     /protein_id="XP_027483487.1"
                     /db_xref="GeneID:38738176"
                     /translation="MAPEDGGPLPAPHSLPVSYENTLLPSEIPSTGRNYYTTNDPQIT
                     GIKEMKRRYEADPRLATVDPRQRHMKPPRWSRLRPRRHLEQIFYKYDEYSVGPPPPRE
                     IVIRGLSPLTSPATVLQQCRMHGKVEASELKMDPQTGESIGIMWISFASSTQSDAHES
                     AQQAKRTLDGQRVGPSLVHIVLDHERKNYVQQYRALLKKRYERKHEERVKARERERQQ
                     RRERHDQEQKMAKEARNALPRPSRWGQKRDDVSPTIARHLVALGHPYIHIPRMPSSAL
                     DARDIRTHFSSFSPVFVEQDIHGWYVGFDRHDSALRCKLVLETGTLHGYRLHFEVREP
                     KELKISSSANEASSSLKAPKQDPPPSKKIWTPDELIQEATSRILSNFTKMFLRDIKTR
                     TVIPHVSQYLRADGKGGMIIANQKAQLMARSATQAGYIPSFRRLDAIPKRVTVQSAAS
                     RNLPSPTHSSQQLDPFAAGLVQDDEELYYLGQVLQNAPLAPSEREEPAHEAGSARAQG
                     FYRIPAAEKAVHLADRNRAAVTETTTTHSLASARNNRADTRRLALDIEQSRRETQADT
                     DLLHINQLQTRKKQLRFAKSPIHDWGLYAMELIPAGDMVIEYVGEIVRQQVADHREKM
                     YERAGNFSTYLFRVDDDIVIDATRKGNIARLMNHCCTPNCTAKILTVQGEKRVVIFAK
                     QVILPGQELTYDYKFQAAEDDADAIPCLCGSPACRKFL"
     gene            complement(<929565..>931966)
                     /locus_tag="MRET_1411"
                     /note="MRES_05645"
                     /db_xref="GeneID:38738177"
     mRNA            complement(join(<929565..929732,929758..930093,
                     930119..>931966))
                     /locus_tag="MRET_1411"
                     /product="DDHD domain protein"
                     /transcript_id="XM_027628038.1"
                     /db_xref="GeneID:38738177"
     CDS             complement(join(929565..929732,929758..930093,
                     930119..931966))
                     /locus_tag="MRET_1411"
                     /codon_start=1
                     /product="DDHD domain protein"
                     /protein_id="XP_027483486.1"
                     /db_xref="GeneID:38738177"
                     /translation="MEAVVGTSPTKSPTEQKEPPVSAVWFHSHGRIWVPFPEDDIASL
                     EETWGVVKDELARAAASRPVPENAQTQRGWLSTSFWGEQANEQDSVLPPRPPRPMPTE
                     KQAVPTYRLTDPDEPEEQRRFRVPVLEDHLFDVDMERMIMYPALWAGYDQQVVRATWF
                     YVASDGACSPIACNSPLEQDIILAYNTAQPWRLAQRLKGTLSKNRKADEPPVQYNLAS
                     VVGGAKIQFESAYSARVYAQNFGSKLFPFLREAVIVRGFDHARDISERYGSRLSSWQR
                     RPEPASPRRTPSASPAMTAEDMNMKAESNTSAEEDSNPTGIISERTAPDPTVSPTPWV
                     PLSEAFLSRAWPSKSPRMSPRVEDVDEQARPRDPFDDDFDMPSTSNRPPELLFCIHGI
                     GQKLSEDYTSMHFVHDLDRLRNIMRSQSQNPELKCLLNGGRVKLIPICWRRTLEFDPE
                     HGMYTLEDIGNATSIPTVRTFVNKVLLDIPFYFSKHHDMMERSVLLEMNRLYRLFVQR
                     NPDFERQGGRVSILGHSLGSMLAADILKDQPTQVPPLCETATHDIHNTSRHLLFNVRH
                     FFCIGSPLPLLFYMNGARLVARRRSEEDYEDATSDQVGQMGCLAVESIYNLYIATDPI
                     SFQMSATSDAPYARLVRPVHVPRDPALLPDALEEPRVNMGKLLKRVVDERQSQETPPL
                     DAKQVPDTPRSRPIPLEEMERGERRFRALNPNGCIDYVMDVGYASSFSQYIDMLRSHV
                     SYWTNKSLANFLLHQLLLNPDAERLHSTASIPDLSLDPTTESV"
     gene            complement(<932017..>932988)
                     /locus_tag="MRET_1412"
                     /note="MRES_05650"
                     /db_xref="GeneID:38738178"
     mRNA            complement(<932017..>932988)
                     /locus_tag="MRET_1412"
                     /product="fluoride exporter"
                     /transcript_id="XM_027628039.1"
                     /db_xref="GeneID:38738178"
     CDS             complement(932017..932988)
                     /locus_tag="MRET_1412"
                     /codon_start=1
                     /product="fluoride exporter"
                     /protein_id="XP_027483489.1"
                     /db_xref="GeneID:38738178"
                     /translation="MAWTTLATAGAITLGSIWGTLARLGLVALNTYDGQSIAPLVWAQ
                     AVGCLVFGYASHKRSKAAIEGWYAPAFPMITVGFAGSCTSFSTWALDVFQAFSNGEHH
                     DRIGLYSVMDALAQTATTVGMGLAGVWAGRALADAYPLSAIPTIRMHTTAGHVTVVLL
                     GALFWIGSALLCGLHAPFRHVTFALVLCPPGALARWQLSLLNPPRSADDRVHVRQWTR
                     WPLGTFLANILATLVLCGVVTGKLSRTFSSKTSCDALQGLQDGFAGCLSTVSTLIAEL
                     LVLRPMRTSFAYLFTSWALAVISCVLLVGVPRWTLDINDTCQWQVLS"
     gene            <933081..>934130
                     /locus_tag="MRET_1413"
                     /note="MRES_05655"
                     /db_xref="GeneID:38738179"
     mRNA            <933081..>934130
                     /locus_tag="MRET_1413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628040.1"
                     /db_xref="GeneID:38738179"
     CDS             933081..934130
                     /locus_tag="MRET_1413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483488.1"
                     /db_xref="GeneID:38738179"
                     /translation="MGRRLHPEDASSSSSPSAHPDDDDDLRAEFLSDFDEQAFLRQLD
                     AFQTSLQSMPPVASTVAPVPVAQPAAAPTVPPPSAPSPSAPVMAPSIPAENSSSEFYS
                     TAIQILTHILGSSTPYPWLNDVSVPKADDNSHSVASNDHMHQLINVLVERLGGSSDRR
                     VKEQDLTHLLQTLLAQQQKPPAPQPMYPQPTSAHFADLAFPDEEEDDPDFLPVPSEHD
                     GLATAPSTTAWTRAMDEVMPTETPKPRRGRPRRFTTEEAAERKRDRNRDYMARQRTTK
                     KQRAPYTPESSATGASTDAPGNASDRLVLEAENRFLRAELERLREENAKLRGREEMRA
                     YAAQLGINHRQSFRS"
     gene            complement(<934191..>936113)
                     /locus_tag="MRET_1414"
                     /note="MRES_05660"
                     /db_xref="GeneID:38738180"
     mRNA            complement(<934191..>936113)
                     /locus_tag="MRET_1414"
                     /product="cell wall protein"
                     /transcript_id="XM_027628041.1"
                     /db_xref="GeneID:38738180"
     CDS             complement(934191..936113)
                     /locus_tag="MRET_1414"
                     /codon_start=1
                     /product="cell wall protein"
                     /protein_id="XP_027483483.1"
                     /db_xref="GeneID:38738180"
                     /translation="MRLAILGLLLAAIEVLAGKERCGPNKPSCPSDKPCCSADGYCGG
                     GAEQCTSGCQPQYSQYPFSCIPNSVCEDMDLAIKPDMYNQDNYFRPLLRYNGDASQTA
                     FVFEQGYLGQGHNGVLFEKTSATDSRVSTARYLLYGTVTARLRHNPTSGLVTTFGTAS
                     DVGDAILFRLAGPESGRITTNYAAHGQSAQNIGTQKRMDKFTVANFHNYTIDWSPHHI
                     TWKVDHQVIRTVSRKDAGDKFPRTPSRVLFTAYGVSESSNKNMKNWANGTLSFDDDGY
                     RSRGFYSHELAHLRIQCADLKLANISQTGVGSEPVAYVYSKKNHSQTQPLDFSLSTDQ
                     VLLLKNPAKDGRPGTPGKPGTGPNGDRPNMYTGGSGRSTKKNSDDDDDDTSTTSNGVK
                     IGIPVGIGGAALLGALALLIFYFVRRQKRALRRPASLVSVQEPMQMRDTSASFGTPIA
                     GEPTHHIAVPVSMQPQRGEQPFDLQQSIAVPQEEHAIDRMPEAQGVAPSDDSIHEAAL
                     YYQDPYGAEMSYEVESDMGSQASDDKAHRMHYAEHGDMRRYYPYLSEEENERIAAQDA
                     WDELREAANGRTEVPHFKSANTSSTNPRRDSDLFLTRHRRGQDSTYRARRVHQRAAYS
                     EGGALSPSLPDTPSFS"
     gene            complement(<936299..>939298)
                     /locus_tag="MRET_1415"
                     /note="MRES_05665"
                     /db_xref="GeneID:38738181"
     mRNA            complement(<936299..>939298)
                     /locus_tag="MRET_1415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628042.1"
                     /db_xref="GeneID:38738181"
     CDS             complement(936299..939298)
                     /locus_tag="MRET_1415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483482.1"
                     /db_xref="GeneID:38738181"
                     /translation="MVYALPRKSRAHSDQLAHSPPDTSRSVNDLKNVLDASTQPHRFG
                     HADHGVSSSTPHRARPAAFSQTVRLTPMTPRRSLRPYSEQSGQPWSNTSRQSASAQSH
                     RVPAMSILEDDVPTASFARDFVEAPSLSRAPFVPQRRPADHPSHLAQRPASPASSTDD
                     PLLLHDPTLTNMSMRAAQGDASLLAMVRRFEQEDMGLTEPVSMTPKRPLSSRRDISTP
                     LRRTPKPAPKLTPKPTPKATPSLYDRTLGVKERIALIRSPDKSMSHVEQQQVHSPEPD
                     LDLQPELESELEPESKVAAEPEPELEPELEWVPEPEREPQMEPERPETEREPELEPVM
                     HSELDLEPEPEPEPEPEPELEPGPEPELEPDLEPAEEPESEPEAVLEPKTHASPSLTG
                     LNTKNEALAAPPTHAMPAYDPSISDQVNSSRFSRESHASREPVFIDFLHANDEHVNVS
                     SQEPVDHDTSWFERPSQSEPQSYTPPSRHTPIPEWRASPSVEASTRKQLRQNLGTPSE
                     KSVRQEASVLPALSHEPKRWGDDPEDVDDLPDEALEALDILEEELRRKSPDPVPQSPL
                     PNDVSVHSARIRSLSPSKSPHPAMRVSAQDVSSDDTPEEEAPMVVWSLPLQAPAAPST
                     AAEEDASLGDLSASLSASSHSRALMLSRTRPTSCVEISSLDPVAAARAAAILKVHHKY
                     IQEGWLGDTSSLPHINNDLASLFHAAELDLRQSTHPTPRVPGAYAPRASLPPQLDSHA
                     LRPQAQAGHWSEFAWMELDRHLRSYVPEEAMDKAAAVLDLDIDLVILQFLEAQGLEPD
                     DLHGDWTLTRLYARVPALQARYVREMEQDVTEEMQEKSFQLLSQRKRTHDVLLDSPQY
                     VRGSHSTPVVPPSPAKAGKNVAPESSVLSQSNHSFVPTDDVMIEAGHAPKRMRTHAPR
                     PSSVMSKLWSWVSGSPSSQQQPLPSAAARHHRPPASRLPRPRRRQARRSAALRPSVVT
                     SATHDGPRADWLQNEVEDEAMSASLHA"
     gene            <939519..>939965
                     /locus_tag="MRET_1416"
                     /note="MRES_05670"
                     /db_xref="GeneID:38738182"
     mRNA            join(<939519..939544,939587..939741,939781..>939965)
                     /locus_tag="MRET_1416"
                     /product="small subunit ribosomal protein S26e"
                     /transcript_id="XM_027628043.1"
                     /db_xref="GeneID:38738182"
     CDS             join(939519..939544,939587..939741,939781..939965)
                     /locus_tag="MRET_1416"
                     /codon_start=1
                     /product="small subunit ribosomal protein S26e"
                     /protein_id="XP_027483485.1"
                     /db_xref="GeneID:38738182"
                     /translation="MTKKRRNGGRNKHGRGHVRFVRCTNCSRAVPKDKAIKRFTVRNI
                     VEAAALRDLSEASVYDEYVLPKLYIKLAYCVSCAIHSKVVRVRSVEGRRVRTPPRLRF
                     NRDSRKNPAAQMASGGARA"
     gene            complement(<940039..>943638)
                     /locus_tag="MRET_1417"
                     /note="MRES_05675"
                     /db_xref="GeneID:38738183"
     mRNA            complement(<940039..>943638)
                     /locus_tag="MRET_1417"
                     /product="cleavage and polyadenylation specificity factor
                     subunit 1"
                     /transcript_id="XM_027628044.1"
                     /db_xref="GeneID:38738183"
     CDS             complement(940039..943638)
                     /locus_tag="MRET_1417"
                     /codon_start=1
                     /product="cleavage and polyadenylation specificity factor
                     subunit 1"
                     /protein_id="XP_027483484.1"
                     /db_xref="GeneID:38738183"
                     /translation="MAFAVHHERVPASGVEHCVAIRLVRDEAAWPPSRGRLVCHAVLA
                     RENVLRVMEVRQRADGACVLVQVGMHHLFGQVTGLHAVRTLASQIDGRDRLLISFRDA
                     KVSLMEWDDVYHDPTAISLHTFERAPPLAQGLPPTFVPHTMVDQASRCAALLLPHDTL
                     AIVPLVQDVTELGADDPKDIPLLEQVPYMPSFVLSFRDDIDEHIHNVRDCVFLPGFQN
                     PTLAVLYESQLTWTGSLTQARRTMQVCFVTLDLTVTKYPVTVTSDALPYDALYLVACP
                     ESLGGVLVVTPSSLMHLDQTARMVGVSVNGWTDQTTPDIGLRRATELSADLDLQESVL
                     VFTDAHRALLSLRSGRMYTVECAVEGRTVTRLVLGEVHVPERRGGAACMQMLSSSLVL
                     CASMQDDTYLYVMEDQRAPQAPIVPAAPLGDDEELDLYGSADPTPPAPTQAVHLHVHD
                     TLPTLAPLNDVAHGLACDAQGRTRPLMVGALQHGLVVLEPRLSCFKERTLVPARSVWI
                     ALRQALLFAQSDDDDKACAVYKLDTLSLVAEHPHDTLACGTVGDYAVRVTTQGIQVLD
                     EHAQMVREISSPCHRATLTESYVVLVGQEASVWTIDGTCVVQVACQCADVTSDMLVCV
                     LPDGRLALHSLPDGACTWQSQASLTTLPALLSEHTASEDLVVAHIKWCKLTDVPVLLV
                     QYTQGLLAMYEIRDTMSLVLVDAYMLRAPSTALVPLSLFGRSCIGVAGPHSLVIVRDR
                     KGPPLWLETSMPFSSMCDHASGFVGVHEGEASVWTVPPLEVDAPVPYQRWATRTYTHV
                     AIHEETGCLVASSAQPTQFVLYSEEEEPVRDPALDPSPTYSERGALELFARIGEPPIH
                     GHEFEPCETVTCIHMAPLDALDRRSGRRTFVTVGTVISHGEDRTAKGFMYVFDIVQVV
                     SGALRLRLMCAEEMRAPVTTLHDLNGFLVACVGQKLLVRSWELGEWLVTVAFLDLGMY
                     ATSVQRVKNFLLVTDVQQGAYFCAFQEDPARLVLLGREYAPACLLQGAMLIDHKRLAM
                     VTCDVGGCIRLLDYAPSNPTSLGGQRLLVRCEYHAPGDAVRALMLHGPRNANGERLTS
                     EIVLAKSNGAIDVLVPVSAKIYPTLQLFQSQLVRTVPHMAGLHPRAFRTVAPLHTSRP
                     LSKGILDGTLLHTAESLPRAKLLSLVRDLSPRSTGGIHADDLLRCLVHLQSHW"
     gene            complement(<943690..>944418)
                     /locus_tag="MRET_1418"
                     /note="MRES_05680"
                     /db_xref="GeneID:38738184"
     mRNA            complement(<943690..>944418)
                     /locus_tag="MRET_1418"
                     /product="WW domain-binding protein 4"
                     /transcript_id="XM_027628045.1"
                     /db_xref="GeneID:38738184"
     CDS             complement(943690..944418)
                     /locus_tag="MRET_1418"
                     /codon_start=1
                     /product="WW domain-binding protein 4"
                     /protein_id="XP_027483481.1"
                     /db_xref="GeneID:38738184"
                     /translation="MADVWVSRKRWTCKYCNVTINDDPPSRKHHESGVRHKRNVARAL
                     DDLHKLKDAKRREETQMQMTLQHMDRGALRRGEEGASLRMDRAPAPSPQPWKPSEAAY
                     TTASSLGFSPEQDEEEWHRRCQRRSLSADVGEWHTLSPAPPTPSRAASGDHCTPEEQV
                     RGSEAPMSDRQRALTFTLQERGVGDEEDEDVPIVLKRPHPNDATAKSGASTSQDTPST
                     QEDATLFKRRKPRRGTSAHSVDPK"
     gene            complement(<944485..>945912)
                     /locus_tag="MRET_1419"
                     /note="MRES_05685"
                     /db_xref="GeneID:38738185"
     mRNA            complement(<944485..>945912)
                     /locus_tag="MRET_1419"
                     /product="transcription factor"
                     /transcript_id="XM_027628046.1"
                     /db_xref="GeneID:38738185"
     CDS             complement(944485..945912)
                     /locus_tag="MRET_1419"
                     /codon_start=1
                     /product="transcription factor"
                     /protein_id="XP_027483480.1"
                     /db_xref="GeneID:38738185"
                     /translation="MSNQTRLGSFNTSNVGVNNFLGAPIPKNQDGSYAGLYGMSSGSM
                     PIGQSLDGLHAPWSFPMGNTGSANADNMNEQQTPHMSHHASTLLPQSFTGEYARYTSE
                     PQTIKTEALGDEAAVPLPQVPSAQAAAPAPQRSVPQAGMPVYREQRNLPRHASMSAIP
                     STPTNTTPADTNHDHDNNNNNTSSRASGKKRSMAKGEKDSRTGRRKIKIEFIDDDSRR
                     HITFSKRKAGIMKKAYELATLTGTQVLLLVVSQTGLVYTFTTPKLEAVVKQPEGRNLI
                     QECLNAPDPSEVNDNEAEAGPSTVSSMEGGAIGGLQMVGEEPYDEEEDDDEDGDEPLD
                     IGRADAGFTAQAMGTAVPDLGSSDSSNVLGHAPLFHPGWTPLSNRSMGDGSGTPSIKR
                     RRTQPNLSRTQRSSLNTEPVPELPTDLYHASAMMSSMPVNNVLGHEPFLSSNIPMFLG
                     QDPSLGAAPSTSHDAPANDRESSHT"
     gene            complement(<946129..>947484)
                     /locus_tag="MRET_1420"
                     /note="MRES_05690"
                     /db_xref="GeneID:38738186"
     mRNA            complement(<946129..>947484)
                     /locus_tag="MRET_1420"
                     /product="tubulin alpha"
                     /transcript_id="XM_027628047.1"
                     /db_xref="GeneID:38738186"
     CDS             complement(946129..947484)
                     /locus_tag="MRET_1420"
                     /codon_start=1
                     /product="tubulin alpha"
                     /protein_id="XP_027483636.1"
                     /db_xref="GeneID:38738186"
                     /translation="MREVLSLHVGQAGVQIGNACWELYLQEHGLTPDGRVTEESNTKN
                     DDGFSTFFSETGRGKYVPRSIYVDLEPNVVDEVRTGPFKSLFHPETLVTGKEDAANNY
                     ARGHYTVGKELIDQTMDRVRKLADACSGLQGFFVFHSFGGGTGSGFGSLLLERLAQDY
                     GKKAKLEFSVYPAPMMSSSVVEPYNSVLTTHTTLENSDCSFMVDNEAIYDICKRNLGI
                     SAPSYTNLNRLIAQVVSSITASLRFDGSLNVDLNEFQTNLVPYPRIHFPLASYAPIVS
                     ADKAFHEQNSVSEITTASFEKGNQMVKCDPRDGKFMACCLLYRGDVVPKDVNSAVSLI
                     KTKRTIQFVDWCPTGFKIGICNEPPALVPGGDLAKVPRSLCMLANTTAISTAWSRLDR
                     KFDLLYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMETALGDEDGLDAEE
                     Y"
     gene            <948154..>950476
                     /locus_tag="MRET_1421"
                     /note="MRES_05695"
                     /db_xref="GeneID:38738187"
     mRNA            join(<948154..950234,950273..950405,950450..>950476)
                     /locus_tag="MRET_1421"
                     /product="solute carrier family 25 (mitochondrial
                     phosphate transporter), member 23/24/25/41"
                     /transcript_id="XM_027628048.1"
                     /db_xref="GeneID:38738187"
     CDS             join(948154..950234,950273..950405,950450..950476)
                     /locus_tag="MRET_1421"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial
                     phosphate transporter), member 23/24/25/41"
                     /protein_id="XP_027483637.1"
                     /db_xref="GeneID:38738187"
                     /translation="MSEIECQQRPQDGTAVPQPAPDKWDPSKSHSKISSLFKRRKRRC
                     MTYEEFRAQEPPQARLLRLRGLFDLLVDHDSASALAGGRAKQMWRVRASRARYGAGGP
                     LATGSLVERDEPVPSDAKSSSIREIFSHARQTAYAPELLAKCRARHAEMAKQFEENQL
                     CSDDTSHWSTWRCLVSMVKEDHNLVPRELSWLWNHVVGVSERSPMMLFESGWTGSRVW
                     GLRATEDTSHHAKAGEPLQNDEQDMQRVRQRQIEWEGFVAYAELQERELYNLFYDMDT
                     EHDGVLSDDEIRAAFDKAGIRINDTILDDFIASLASGGVQDVKELHGNDLYVTFPEFR
                     DYLLLLPRRPTLSEIYHFYKVRKVVGLFGSEGIFAELGANFGKTARGVTSVNFDGDVS
                     LAGDLTEPSDGNAQAVTSTTPSSEEQHTHSQNVTSSRRSTSDVIQLDVAFKFLLAGGV
                     AGAVSRTATAPFDRLKIYLITSQSTRNLNTPFPAAQQTRSTFGALSQSLAMIYREGGL
                     RGFWLGNGLNCMKIIPESAIKFFTYEYMKRFFAKYVDGVSDSRDVSGMSRFISGGVGG
                     ITSQLSIYPIETLKTRLMSSMSNPGHIRGMKLLFATAREMSAHGGIRSYYRGLGAGLV
                     GVFPYSAIDMSTFEGIKLFYLRYTGKDEPGVLALLAFGSISGSIGAATVYPLNLVRTR
                     LQASGTPAHPTIYKSFFDASYQTFKNEGIMGFYRGLGPTLAKVVPAVSISYVVYDHAK
                     KGLGVA"
     gene            <950768..>952894
                     /locus_tag="MRET_1422"
                     /note="MRES_05700"
                     /db_xref="GeneID:38738188"
     mRNA            <950768..>952894
                     /locus_tag="MRET_1422"
                     /product="acyl-CoA oxidase"
                     /transcript_id="XM_027628049.1"
                     /db_xref="GeneID:38738188"
     CDS             950768..952894
                     /locus_tag="MRET_1422"
                     /codon_start=1
                     /product="acyl-CoA oxidase"
                     /protein_id="XP_027483638.1"
                     /db_xref="GeneID:38738188"
                     /translation="MANLEMQTLAKERTNPPFDVEAMAISLHGSKERLEYKRRVMQEL
                     ERIPAFFNDDIYDLTKDELRVRTFIKIGHIVNWFQKEDMATFRQRLELISILDPGFWT
                     RFGVHLGLFSNCVVSGSTPSQLAYWASQGMLSCHHFYGCFGMTELTHGSNVQGIKTTA
                     TFDRDADEFIIHTPELGATKWWIGGAAHSATHCAVFARLIIDGKDHGVKTFVVQLRDP
                     YSFDNMPGVTIGDIGKKMGRDGIDNGYIQFTHVRVPRAHMLMRHTQVSREGQVFEPPL
                     QQLAYGALLTGRVMMSIDSSNIGKKAITIAGRYAAVRRQFKSDAKNEHETQLLDYPIH
                     QRRLMPLLAQSIAFQYTGYQLSHMLERMNEQLSSLEPGDPRLNEAIELLKSTHAASAG
                     LKAFCTWGTLSAIEVCRQSLGGHGYSSYAGLAPLYADFAVHCTWEGDNTILALQLGRA
                     LMSAYEESRKGKKQGKALAYLNDIDAVLSYRCTSEKDLDTLAGVEAGWLTASAHFVKV
                     AFDEFQRYLKAGDSREVAAEKCSQLRFVAGSVHTSGFIFRQFRAAVESMPDSKDGVKK
                     ALSTVALLYGLWQMEEKSGFLLRSGWLKPEQFDYVARRVTELCAEVRAFAIPLIDSFS
                     LSDFVINSPFGRYDGDVYRAYFDMIRRNNSPLKPHPYRDTLVKPLLNREIRETVSASD
                     FMNIDDEIKEIQSELKEAAVSAPKKA"
     gene            <953172..>953824
                     /locus_tag="MRET_1423"
                     /note="MRES_05705"
                     /db_xref="GeneID:38738189"
     mRNA            join(<953172..953305,953344..>953824)
                     /locus_tag="MRET_1423"
                     /product="lactoylglutathione lyase"
                     /transcript_id="XM_027628050.1"
                     /db_xref="GeneID:38738189"
     CDS             join(953172..953305,953344..953824)
                     /locus_tag="MRET_1423"
                     /codon_start=1
                     /product="lactoylglutathione lyase"
                     /protein_id="XP_027483639.1"
                     /db_xref="GeneID:38738189"
                     /translation="MSNPWRETRGYSFHSICLHVKDISLSSMFYQDVFGMDVVREANL
                     GQISKVWLQFPTDKTDRGFGVATSIIELAQRNGTEYDNTFDVQANAGGFHHMTFSVPD
                     LLSARSRFEKLGVTIEDLQIPHTQLIVLRDPDNYPIQIMSQDFDLHAELHDVCRNVVV
                     EGTEKSLEDIMRSQNPETLAEAGLTTGGNNLSVPHAKAPCTSPC"
     gene            complement(<954037..>955446)
                     /locus_tag="MRET_1424"
                     /note="MRES_05710"
                     /db_xref="GeneID:38738190"
     mRNA            complement(<954037..>955446)
                     /locus_tag="MRET_1424"
                     /product="bZIP transcription factor"
                     /transcript_id="XM_027628051.1"
                     /db_xref="GeneID:38738190"
     CDS             complement(954037..955446)
                     /locus_tag="MRET_1424"
                     /codon_start=1
                     /product="bZIP transcription factor"
                     /protein_id="XP_027483632.1"
                     /db_xref="GeneID:38738190"
                     /translation="MNMANEQESSIAFLLGLHDIHDTFDLHQQEGHVPAQSSRSDHPT
                     LLTGLDAIPLTATTPNATSNQQAAPALQNHHQSAGESMDMFSNQLSMWMNTNFSFDGP
                     MGHALLADDEKDGDHLEKGDDGRQRDEDIERQRRMAASSAHSNAARDKLRALDRDPSP
                     TPSQPSLDSRRDRIPSHNLEASSEPFHPTYFAPSHDSLSQAPSYLPPVAPWANQKMSG
                     ETPCPSSSASTLFSQPQQQRAPGAAQSDWDLTSTLALQHLMSKSPDALSTLWQSHLLQ
                     QMGKASSTPNLPPELSSNEPSSSSSANEHPLPPMQPLLPTSAESKRAKPESPSSAESQ
                     QQPSPMEKQDPDVSVTIPKAGASTAQASDRVKLANTGNSQTDAETNRLALEEDKRRRN
                     TLASARFRIKKKQREAALEMSARELEKQVNELKQENERLRSENDWLRRLIMSRPETLP
                     GFFNVLNNTSGSASNSNGN"
     gene            <955852..>958671
                     /locus_tag="MRET_1425"
                     /note="MRES_05715"
                     /db_xref="GeneID:38738191"
     mRNA            <955852..>958671
                     /locus_tag="MRET_1425"
                     /product="coatomer subunit gamma"
                     /transcript_id="XM_027628052.1"
                     /db_xref="GeneID:38738191"
     CDS             955852..958671
                     /locus_tag="MRET_1425"
                     /codon_start=1
                     /product="coatomer subunit gamma"
                     /protein_id="XP_027483633.1"
                     /db_xref="GeneID:38738191"
                     /translation="MSFKKDEEVSFRHDKTAVIQEARMFNQSNISPRRCRILLTKILY
                     LLYTGERFSQQEATDLFFGATKLFQNKDAGLRQMVYLAIKELAPYAQDVIMAMASIMK
                     DMQPNTEVVYRPNAIRALMRVIDPSMVQGLERYLKSAIVDRHPSVSCAALVSSYHLYF
                     ESRDTVKRWGNEMQEAINMRPSITQSSPSFGGFGGLRPGLTLRFGGDRQNSPVEQVNM
                     PSMSYMMQYHALGLLYLTRQGDRIAVTKMVQQLGQPRQGVVIRNPYALCMLVRYAAKI
                     AEEDPNMRAPLTQMLEGWLRHKSDMVNYEAARALCTMSGVSVEQQTRAISVLQMFLSS
                     PRTVLKFAAVRTLAELAQVRPAAIQSCNVDMESLITDPNRSVATYAIATLLKTGNESS
                     VDRLIKQISGFMSDISDEFKVIVVDAIRSLSFKFPSKQSAMLTFLAGVLRDEGGYEFK
                     RAVVEAIFAMARYVKGCKEAALSHLCEFIEDCEFTKLNVRILHLLGSEGPHMPEPHKY
                     IRFIYNRVILENAIVRAAAVNNLAKFGIHNKHLTDRIRVLLQRCLEDVDDEVRDRATF
                     ALHLLDSSASPAPSALAAVPLNEAPPNLEVLEQSLQAYVDSMATSKPFDYDSVPRVSE
                     DAATEAPPSDSLLTLHGTSSSMGVTEAGASAATTADIEGTPLVDTYADHASLLGNISE
                     FASYGTLLTTSPISAPVQLTEAETEYIVTAYKHVFAEHIVLQYNVTNTLAETVLEDVV
                     VVVGGLMEAGLDEEFILPIPRLSAAAPSGTVYVSLRRDANLPFPVATLSNTLRFTSKE
                     VDPSSGEPEPEGYQDEYQTEELDLGVSDYIQPADLDFAATWDQLPASASETFALTALD
                     SLDAACSTLVEILGMQALGGTDVPANPSVHTMTLAGRLANTTGIDTVLARVRMMHQPE
                     EGITMELSVRAPSDEACLFILSAIA"
     gene            complement(<958846..>959130)
                     /locus_tag="MRET_1426"
                     /note="MRES_05720"
                     /db_xref="GeneID:38738192"
     mRNA            complement(join(<958846..958858,958888..959045,
                     959089..>959130))
                     /locus_tag="MRET_1426"
                     /product="small subunit ribosomal protein S28e"
                     /transcript_id="XM_027628053.1"
                     /db_xref="GeneID:38738192"
     CDS             complement(join(958846..958858,958888..959045,
                     959089..959130))
                     /locus_tag="MRET_1426"
                     /codon_start=1
                     /product="small subunit ribosomal protein S28e"
                     /protein_id="XP_027483634.1"
                     /db_xref="GeneID:38738192"
                     /translation="MDAAPQKVPVKLARVTKVLGRTGSRGGVIQVRVEFMDDSTRSII
                     RNVKGPVRENDILALLESEREARRLR"
     gene            <959403..>960731
                     /locus_tag="MRET_1427"
                     /note="MRES_05725"
                     /db_xref="GeneID:38738193"
     mRNA            <959403..>960731
                     /locus_tag="MRET_1427"
                     /product="peroxisomal membrane anchor protein PEX14p"
                     /transcript_id="XM_027628054.1"
                     /db_xref="GeneID:38738193"
     CDS             959403..960731
                     /locus_tag="MRET_1427"
                     /codon_start=1
                     /product="peroxisomal membrane anchor protein PEX14p"
                     /protein_id="XP_027483635.1"
                     /db_xref="GeneID:38738193"
                     /translation="MCSPGDEAIQARHAQAVRFITSLRSEAKDPHIPLTQEHIQFLHS
                     KGLSDADIDRAREDAERPEYASMPHAFDEDRARVADSSDTQAFERAEDAFREEGRAPP
                     PPVPSYPRSPLALYATPETEKLPPYQYDTNQVLAEYAASVSRPRYDTLISFLRTLHFL
                     LILTGGATAVLVAVFRRYLIPKLTSMIDARVDLLSLQKEQFRKVGEALSSMRAGHLSR
                     LLPKDYEPTWTEVQVNEEVSTPPDTEALCDAPPKTTLPDERADALDTSCPIEEQEPAP
                     APRPRRVLAPIDITQSVRDSLDQLAQSLRHVSVVTSGSVTESDDEGLLDLWSSPRSPP
                     DGKTASTPADSIAMAPSASMASFRHTFESVRNELRASVLADESSMNMIGSRFSAFTQP
                     SARPTSGPAVEMLQMKAEIRSLKGLLLSRRNFPSFMRTARTSARVDNESS"
     gene            <961033..>965301
                     /locus_tag="MRET_1428"
                     /note="MRES_05730"
                     /db_xref="GeneID:38738194"
     mRNA            join(<961033..961158,961189..>965301)
                     /locus_tag="MRET_1428"
                     /product="DNA helicase INO80"
                     /transcript_id="XM_027628055.1"
                     /db_xref="GeneID:38738194"
     CDS             join(961033..961158,961189..965301)
                     /locus_tag="MRET_1428"
                     /codon_start=1
                     /product="DNA helicase INO80"
                     /protein_id="XP_027483640.1"
                     /db_xref="GeneID:38738194"
                     /translation="MDMRPDAAPLPMHADTVRTAPDDTSVVTDDASSPVPTYPNESSP
                     HMASPSDDWADADWAHSRRPAMSISNILNDHQEPVSSYHEDEPMMTSSPVVPPSDDHE
                     MKSEADETRPLAYHPRATPKSSSSRMQRSMSASRRAEEGATSAAYDSDLSADENVSAW
                     TEDIAAYKAQREAHEAQLADAFAAWMNETQHFVTKRLCLSYERRLLLAQKRARAQRVQ
                     KHESDDIDMELLDTLAERPGGKWSKNDAKGRYTETTDDLDDLAAEGQADDDTEEAAGE
                     AVASAELIPELIDPNTGEVRGTIPLGARRAALLGEAHDRVWTTIAKRDIPKVYRTVVA
                     SATNKAMYWRRLSSVVQREARRGAARNNKSTKDIQLRARKVMRELLLYWKRNEREERD
                     LRKKAEKEALEKARKEEEMREAKRQARKLNFLITQTELYSHFVGNKLKTAEAEESEDT
                     APAAQPGGPQQPHPQAAPVSMASQEAADLQAIDFDDEDESNLRAHAARNATEAVRAAR
                     DKAQAFDAAIAQERHQQGTEEGAPQPFSADDMDFLNPSSMGVTEVQQPKMLSCTLKPY
                     QIKGLSWLANLYEQGINGILADEMGLGKTVQSIALMAYLAEVHDIWGPFLVIAPASTL
                     HNWQQEITKFVPALKALPYWGNVKDRAVLRKFWNRKQISYDRHAPFHVLVTSYQLVVS
                     DEKYFQRVKWQYMVLDEAQAIKSSSSNRWKTLLGFHCRNRLLLTGTPVQNSMQELWAL
                     LHFIMPSLFDSHDEFSEWFSKDIENHAENKGTLNEHQLRRLHMILKPFMLRRVKKNVQ
                     NELGEKIEVDLYCDLSARQKLLYQSLRSHVSVAELVDKANANDEGGLKSLMNLVMQFR
                     KVCNHPELFERADVRAPLAVSHYSASAAIPVRDEITTCMDAAHSLLDMPIPRLMAHDA
                     IQHIPTPQNRVGFDTHYLGSLMNIWRRSHIHDAVVATDTFAFLAFLGLSASEAEAAFH
                     APMLTRVVTQADAQRRLALMLPYMDGELAVSVHRPLGLVESALPHAHERPAPSLVPLG
                     EVVERVMDERCGHITRTTMPAAVAPPPVLHVNDRTFCERQVQARKDVALEHVLFGLPP
                     KAREDVAQVRQLETRLPGVPPRGYVATSSPMQLWGPPMQVPRMDKLIVDSSKLARLDT
                     LLRELKAGGHRVLIYFQMTRMIDLMEEYLIYRQYKYLRLDGASKISDRRDMVTDWQTR
                     PELFVFLLSTRAGGLGINLTAADTVIFYDHDWNPSNDSQAMDRAHRLGQTKQVTVYRL
                     ITKGTIDERIVKLARNKKEVQDIVVGNKAYSESGMARPQEIVSLLLDDDELADSILRR
                     KQADEAQLAQGKAENARAMHARRRQNNQAASSTSSHDPSIHWTLDDDEDDFFGAKPPP
                     KDEPEDTPQPRKRAKRDSAPKRRKKSDASSPPPA"
     gene            complement(<965315..>965653)
                     /locus_tag="MRET_1429"
                     /db_xref="GeneID:38738195"
     mRNA            complement(join(<965315..965489,965515..965560,
                     965587..965626,965651..>965653))
                     /locus_tag="MRET_1429"
                     /product="splicing factor 3B subunit 5"
                     /transcript_id="XM_027628056.1"
                     /db_xref="GeneID:38738195"
     CDS             complement(join(965315..965489,965515..965560,
                     965587..965626,965651..965653))
                     /locus_tag="MRET_1429"
                     /codon_start=1
                     /product="splicing factor 3B subunit 5"
                     /protein_id="XP_027483641.1"
                     /db_xref="GeneID:38738195"
                     /translation="MSDLKYSGNPQLEHLHARYTGTIHPDITKHEWATHQHRDTAAAI
                     VAHSPLLNYMAVADGESRARTKFRLCEQMIQPCGPPPKQQEMM"
     gene            complement(<965682..>966482)
                     /locus_tag="MRET_1430"
                     /db_xref="GeneID:38738196"
     mRNA            complement(<965682..>966482)
                     /locus_tag="MRET_1430"
                     /product="3-oxo-5-alpha-steroid 4-dehydrogenase 1"
                     /transcript_id="XM_027628057.1"
                     /db_xref="GeneID:38738196"
     CDS             complement(965682..966482)
                     /locus_tag="MRET_1430"
                     /codon_start=1
                     /product="3-oxo-5-alpha-steroid 4-dehydrogenase 1"
                     /protein_id="XP_027483576.1"
                     /db_xref="GeneID:38738196"
                     /translation="MYHWVLQGMQATAAALPFLGTVVDAPFGKFGLPSRWNVHGNAGW
                     MVMECVAPIITTLSFFSVSAHHEVHVWAWRMLSLFQLHYANRALIQPLLNAPRSPLHI
                     SVVLSAVAFNAANGFLMGTWLAHGGSAPPPGMKLWAYIGLVLFVLGFVGNVYHDALLR
                     SLRLKPPSSSEQVVQHGACIYRIPHGGLFRWISYPHYVCEWIEWTGYALTCIAVVPHT
                     PDALVSYPPVLFVMLEVGAMLPRAMRGHAWYQRHFATYPARWAIVPFV"
     gene            complement(<966517..>968325)
                     /locus_tag="MRET_1431"
                     /note="MRES_05735"
                     /db_xref="GeneID:38738197"
     mRNA            complement(<966517..>968325)
                     /locus_tag="MRET_1431"
                     /product="CTP synthase"
                     /transcript_id="XM_027628058.1"
                     /db_xref="GeneID:38738197"
     CDS             complement(966517..968325)
                     /locus_tag="MRET_1431"
                     /codon_start=1
                     /product="CTP synthase"
                     /protein_id="XP_027483575.1"
                     /db_xref="GeneID:38738197"
                     /translation="MKYIVVSGGVISGIGKGVIASSTGLLLRTLGLRVTSIKIDPYMN
                     IDAGTMAPTEHGEVFVLNDGGEVDLDLGNYERYLNVTLTRDNNITTGKIYREVIEKER
                     RGDYLGKTVQIVPHLTDAIQDWIERVAALPVDESGESPDVCIVELGGTVGDIESAPFV
                     EALRQFQFRVGHENFALIHVSLIPVIGGEQKTKPTQAAIRDLRGLGLVPDLIAARCAA
                     PLERHVINKLSLFCQVGPDQVLGVHDVSSTYHVPLLLEAQGMIRFFEQRLHLDLQHDV
                     PKARVADGMELRRRWKVLTLNQERVFETVEIVLVGKYTALQDSYMSVVKALEHASMQC
                     QRKLVLKWVEASDLESHTEHEDPVRYHQAWQHLCSSRGIIVPGGFGQRGTEGMILAVR
                     WAREKKIPFLGICLGFQLAVIEFARHVCGREKAASAELHPECQDPVIVYMPEISRTHM
                     GGTMRLGLRPTLFSDDSAPWSKIRQLYGGQSTIWERHRHRYEVNPDVAGVIESEGSSS
                     ETPLYFIGKNEQGNRMQVAELRNHPFFVGMQAHPELASRPLNPSPPFLGLVAAAAGVL
                     PGQLQYQLQTFKPPHPQSAMVLESQATESIDTKAAA"
     gene            complement(<968439..>969551)
                     /locus_tag="MRET_1432"
                     /note="MRES_05740"
                     /db_xref="GeneID:38738198"
     mRNA            complement(<968439..>969551)
                     /locus_tag="MRET_1432"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628059.1"
                     /db_xref="GeneID:38738198"
     CDS             complement(968439..969551)
                     /locus_tag="MRET_1432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483574.1"
                     /db_xref="GeneID:38738198"
                     /translation="MSSCTAATQRILLFVVACVSIATGLWINRKAVHEDPKPDLEAFG
                     ALNLAQAREALGFPDYSLLMCSGPKCERFERMLMTLIYVFKLMNSGKAGHGGFMVLLS
                     MSLPLVLAMCAQALKPETTFLQRGISVTIVILFGQVFCLGASVPLLYIPITALVRSLD
                     LLKTFPERPYGKYAPLLIKQLVTCLCIMAVVNVLAPMDHWTWPYINFVFQFSPLIMLS
                     LSVFTTLFGRQKSVTTTKVSIFFEDDCLVSAAMYWYGMYHLLPTLGRWYRGEDLGLND
                     GEKLILWDNVGIFLTLIYWVVVDGIADYQLMFEQTRPLHRVPPTAWILGIIRSIFIAV
                     LFGPGVVMDLYFAGREDAVTPVHSFIKQDLPKQKRS"
     gene            <969743..>970534
                     /locus_tag="MRET_1433"
                     /note="MRES_05745"
                     /db_xref="GeneID:38738199"
     mRNA            <969743..>970534
                     /locus_tag="MRET_1433"
                     /product="zinc finger protein"
                     /transcript_id="XM_027628060.1"
                     /db_xref="GeneID:38738199"
     CDS             969743..970534
                     /locus_tag="MRET_1433"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_027483573.1"
                     /db_xref="GeneID:38738199"
                     /translation="MEAAVDLAPHVRPMMAQHRSTIAMLRTQLEILPDVAAELEEQTT
                     ESERVSRLDQVARDMIDMLMEAETRLQILEELGTSMSSSQTTSLADTYGERVQAKMDG
                     YQAQTARQRYARHPAYIEFRSRVWEVSHQGAMPPLVDLLPREPGDDDVAATPAGEDEE
                     DIVVGGAVLQLRCPLTAHLLQDPVVNTTCQHAYSREAISLYMSENRTRSGSVQCPATG
                     CTASVTRSTLQDAPALKRRVERYERHQLRLEEQRRTQLGTTTLLD"
     gene            complement(<970551..>971150)
                     /locus_tag="MRET_1434"
                     /db_xref="GeneID:38738200"
     mRNA            complement(<970551..>971150)
                     /locus_tag="MRET_1434"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628061.1"
                     /db_xref="GeneID:38738200"
     CDS             complement(970551..971150)
                     /locus_tag="MRET_1434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483580.1"
                     /db_xref="GeneID:38738200"
                     /translation="MAPLSSLPLVSPLETHVLELTGFSSMIRTRDLHLILAPWSYGEP
                     EAYRIKWQDDNTVYILFQEASVAKKVYLSLLCSPPDILRADFHGTELYDATRIPCGRL
                     QSVPYAHIRPLNGPKADALLANANMNVRKNMTTAAALAWPSPPASPSVPDYRRIHRRI
                     VSGTAVPSRTSDPFFHLPTDFPHAGSRRYVSADSSDVLL"
     gene            complement(<971221..>972078)
                     /locus_tag="MRET_1435"
                     /note="MRES_05750"
                     /db_xref="GeneID:38738201"
     mRNA            complement(<971221..>972078)
                     /locus_tag="MRET_1435"
                     /product="pre-mRNA-splicing factor CWC26"
                     /transcript_id="XM_027628062.1"
                     /db_xref="GeneID:38738201"
     CDS             complement(971221..972078)
                     /locus_tag="MRET_1435"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CWC26"
                     /protein_id="XP_027483579.1"
                     /db_xref="GeneID:38738201"
                     /translation="MSQEAKQQYLAERYGDAGSSSDVRRKKAKKKHDDLMIRDEEHVW
                     FEHAAHEAPPAVQETAPRASTSTGWHAIGPSTSEKQDHVPMVPASRPQAGLLSREQLR
                     AQREARKAAEEAASREAPVAEPAVPQETVYRDAQGRRIDLQEEELRMREEEELRARKE
                     AEKKEWNRGLVQRREEAQRLAMLQQASTDSVSRYEDDARWNDARRGQMHWDDPAQAFL
                     SRHSRGRRIVRPVYEGPAPPPNRFGIKPGYRWDGVDRSNGFERKYLVSLNNAQRTKAE
                     FHAWSAEDM"
     gene            <972203..>973642
                     /locus_tag="MRET_1436"
                     /note="MRES_05755"
                     /db_xref="GeneID:38738202"
     mRNA            <972203..>973642
                     /locus_tag="MRET_1436"
                     /product="transcription initiation factor TFIIIB component
                     B''"
                     /transcript_id="XM_027628063.1"
                     /db_xref="GeneID:38738202"
     CDS             972203..973642
                     /locus_tag="MRET_1436"
                     /codon_start=1
                     /product="transcription initiation factor TFIIIB component
                     B''"
                     /protein_id="XP_027483578.1"
                     /db_xref="GeneID:38738202"
                     /translation="MSRIEKGTQRFRPTVVARRAPQADHANDAVPRPAPVVPSADAPS
                     TASAARTDTPPQRRATSSSVPTPIVPTRMAPRPRVVPSTGASENRVQPAARSYAFASQ
                     PTKVRVPIHPRAPSQPPRSADVLHAESTSISPYERFLHAAQANPHGVLHMDTEADPSA
                     IAEQAAETWQTLDPAIRAQYNVAEAPRSMPTSSAPPARTRAPRKRTGTSISDDEAEYK
                     QQCAQQENGMDGSELPPLRVDIGTTRMESIAVTNWKSGRASSRTFELERVRARQLKKR
                     RSEAHEDAEQGGIKQSETPVPSTPRDTPAPSDVSEEPQLGENRFAVQTRIVDGKIVLD
                     EQSLFANYRDDEQQEREQRHWEVIDEREGDQFVNSASRSKQRRTQRWTAEETERFFQA
                     ISQWGTDFEMITRLFPRRTRREIKAKWTKESRQNPQRLDAAFQRRVAVDLHAYGRAAG
                     VDLSGPPPTITPRPEPKSDVEIVSESSVQ"
     gene            complement(<973658..>974419)
                     /locus_tag="MRET_1437"
                     /note="MRES_05760"
                     /db_xref="GeneID:38738203"
     mRNA            complement(<973658..>974419)
                     /locus_tag="MRET_1437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628064.1"
                     /db_xref="GeneID:38738203"
     CDS             complement(973658..974419)
                     /locus_tag="MRET_1437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483577.1"
                     /db_xref="GeneID:38738203"
                     /translation="MARRGTRFCCCAFPLVKFGAYLLVIETAFVALCLGILALAPPPI
                     VGGMDAIPSWGKYVVAVIAFVLAAWQILGLCTVVTDSPWSYKQYSRMNFLATVVLLCF
                     TIAFTVTAAAKHNDAIEACLNEFERPLANDGYGVEEVQDRLDEGRHDVCNYLGWADVG
                     LMGGLVVVVGLLQLYMCYMQGQYGKRQRAAQKESLSQHDAGSFPMNPTSTWTDPSHGA
                     MSTGTVLHAPSHRNAYEPVMLQDNSTRPLYQTYSH"
     gene            complement(<975567..>976147)
                     /locus_tag="MRET_1438"
                     /db_xref="GeneID:38738204"
     mRNA            complement(join(<975567..976103,976133..>976147))
                     /locus_tag="MRET_1438"
                     /product="translation machinery-associated protein 16"
                     /transcript_id="XM_027628065.1"
                     /db_xref="GeneID:38738204"
     CDS             complement(join(975567..976103,976133..976147))
                     /locus_tag="MRET_1438"
                     /codon_start=1
                     /product="translation machinery-associated protein 16"
                     /protein_id="XP_027483582.1"
                     /db_xref="GeneID:38738204"
                     /translation="MGGKKHTSKTLVKKDAMHPNSRHAFQRARVVLRSRRLNEAHAAR
                     RRQRSAKVDRILAFVLLLSEDKTHIPDLYAFHDFMTTFFLARHDEELAELQKAQRPGR
                     PKSKRLLELERLIASEKREYHDGMVVPDLCNETNVELLRQWEGDPQALPLFRFVRISS
                     SERDSFRVIQAGTHKLLQNTSSH"
     gene            complement(<976316..>976834)
                     /locus_tag="MRET_1439"
                     /db_xref="GeneID:38738205"
     mRNA            complement(<976316..>976834)
                     /locus_tag="MRET_1439"
                     /product="hypothetical protein"
                     /transcript_id="XM_027628066.1"
                     /db_xref="GeneID:38738205"
     CDS             complement(976316..976834)
                     /locus_tag="MRET_1439"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027483581.1"
                     /db_xref="GeneID:38738205"
                     /translation="MMTTMFFDVTSPNYSLFALPIMYILTLIPHWYAVSICVAQNGWK
                     NEHPRTFVTQLAARPILGTKKMEHTPAERKVLRAEACQQNGFENLPIFGMALLCGLVA
                     ELPGYLMNAMATLYLLSRIIYTILYIFADSHAMSLLRSFTFLGQVILYMAFFMQAAFA
                     VASRSQTQRWGF"
     gene            <976892..>978130
                     /locus_tag="MRET_1440"
                     /db_xref="GeneID:38738206"
     mRNA            <976892..>978130
                     /locus_tag="MRET_1440"
                     /product="inositol-pentakisphosphate 2-kinase"
                     /transcript_id="XM_027628067.1"
                     /db_xref="GeneID:38738206"
     CDS             976892..978130
                     /locus_tag="MRET_1440"
                     /codon_start=1
                     /product="inositol-pentakisphosphate 2-kinase"
                     /protein_id="XP_027483692.1"
                     /db_xref="GeneID:38738206"
                     /translation="MTEAWPPVLSSASMDPAHWAYHAEGAANMLVRYVGPHMWPFWNT
                     QGGDEVMVLRIPKKIHASDAEQVPAADIFLSQVLVHVLPSSSLPCMRRLDMDTSWLPF
                     LQALADKCEPVRPIFRKAAGGMDMSTPHIWMMRDDSRPLPQSRLVVEIKPKCGYLPSL
                     PTTRYPCKASMPKCHIQKLYQLGQKAQDADTHEWYNPLDLFSGDEGKIQRAVNALLDD
                     WTHGSGYLHMFVDGARMSFGDIQEHIPWLQVPRRLSWRIAQILTENRHLLHTLAHQQQ
                     RLDPYDIEGIAQLWHARTGKPLNSTPVEELPRITLADYAFVAANSVPVVSSDKDMHYV
                     MAAYLLAATLKDVTLFIPLDDVEGTPMYRANPIGARIVDLDAKRPSKLCQHARKDAAM
                     SAFVHCLAPDQRCATYLRRV"
     gene            <978354..>979952
                     /locus_tag="MRET_1441"
                     /note="MRES_05765"
                     /db_xref="GeneID:38738207"
     mRNA            <978354..>979952
                     /locus_tag="MRET_1441"
                     /product="SRP40, C-terminal domain protein"
                     /transcript_id="XM_027628068.1"
                     /db_xref="GeneID:38738207"
     CDS             978354..979952
                     /locus_tag="MRET_1441"
                     /codon_start=1
                     /product="SRP40, C-terminal domain protein"
                     /protein_id="XP_027483693.1"
                     /db_xref="GeneID:38738207"
                     /translation="MLQRPMMSWIVALVLAFVAMVPVLADMQHHRIRMHHDIKRALKE
                     DDKYYTPSRFMDVSSQFDMDHFGISKQHKSHGKLKVPKGSEIRHVKVHDTGTNFLAYF
                     SKGVNEKKVTHAYVMFHGRNRDGDRYWSIMNRALESARKDNYPGAPKHAVVVAPQFFS
                     AKLNEGQYGNSTLAWSDINAWQSGSIAVHPKGTDVSSMDAVDALVDLFSNEKKYPNLK
                     NLTLVGHGGGGQLMNRYATVGKDSSRKGIHIRYIVGDPSTSAYFTYHRPMTDKSIASP
                     ETCTSYNNWRYGFDTFPGTLQDSKEPHDYFKQYISRDVVNIVGLKDVLENGDQKCMAL
                     LQGGRKRRDRNLSWWRYINMLGRTNENLHGFPGNFSDLPDWSMHSNGIIKTRLTVVPH
                     VKHNAEKVFGSKHGRSALFDHYDVDMGWRPDGWTYHAPKARIALQNKKASSSSSSSAS
                     SSSTSSSSSSSSTSSSTSQPPSSTSLSLSSSSVSSSSPSSSSTPSESALGGKVFAHDG
                     SASHSCSLFSLLAPLVFVCVIMML"
     gene            complement(<979982..>981499)
                     /locus_tag="MRET_1442"
                     /note="MRES_05770"
                     /db_xref="GeneID:38738208"
     mRNA            complement(<979982..>981499)
                     /locus_tag="MRET_1442"
                     /product="tRNASer (uridine44-2'-O)-methyltransferase"
                     /transcript_id="XM_027628069.1"
                     /db_xref="GeneID:38738208"
     CDS             complement(979982..981499)
                     /locus_tag="MRET_1442"
                     /codon_start=1
                     /product="tRNASer (uridine44-2'-O)-methyltransferase"
                     /protein_id="XP_027483690.1"
                     /db_xref="GeneID:38738208"
                     /translation="MACALFEPVWCEQVDAVSDGWPWTRVIEACAHFSYSDWLATMYA
                     WIEHPERNSSTILRGEVWCESEHENDSIQYRCIRRLLPRRVKMDRGMLQECVVYACGP
                     EHGRVVYTTLRPSDAATEAPDPHKFASLSSRDLCASAADVPYYHPAVRGVAFHYIPTT
                     PKATIRIDLSLFPTEPRPVSPTSRLGRTALSLLRMMHQHAYGHATSYVKRVHHDMLVP
                     RDEYQDLYLSLRTKHAHRLLETWAEVTDPKKHVFEDLGIAAWLILLWRDMFGSSHVPL
                     GPAPRCADLWGQPPGGFVDLGCGNGLLVLILSLEGYRGLGLDARARKSWAHYTDLGAH
                     LEASVIEPNTCVFPPGCFLIGNHADELTPWIPSWASRTPHCSGFVNIPCCPWTLEGTR
                     FTPTNHTIEWANIAEWLDVSDLPAMCMPPAPLRRPSPHMAERLAHTLWFVDRTIHDAS
                     GATHSKHLAYYAYIVRLHIQAGWCLETEALRIPSTKNWAFVGRSQEPLNTYRRST"
     gene            <981605..>985168
                     /locus_tag="MRET_1443"
                     /note="MRES_05775"
                     /db_xref="GeneID:38738209"
     mRNA            <981605..>985168
                     /locus_tag="MRET_1443"
                     /product="splicing factor 3B subunit 3"
                     /transcript_id="XM_027628070.1"
                     /db_xref="GeneID:38738209"
     CDS             981605..985168
                     /locus_tag="MRET_1443"
                     /codon_start=1
                     /product="splicing factor 3B subunit 3"
                     /protein_id="XP_027483691.1"
                     /db_xref="GeneID:38738209"
                     /translation="MQLYNLTLQPPSCVTTAVVGQFCGTRQQEILLVRGSRLELYRID
                     TATGHMMRVLSQHTFSNVRSAACFRLMGGTKNYLILGSDAGRIVVLEYNAARNRFEKV
                     HQETFGRSGNRRIVPGQYLATDPKGRAVLIGAIERSKLIYTLNRDADANLTISSPLEA
                     NRPTAIVQCIVGVDVGYENPVFASLETDYADADADPTGEALARTEKRLTYYELDLGLN
                     HVVRRWTEPVDRSAHHLISVPGGYNYSTEAWDGPSGVLVCIDDYIVYRHPDQPPHIVP
                     IPVRENASIHRGSMIVASVLHKMKTSFFLLVQNEDGDLFKVTVEHDEEQVKAVRIKYF
                     DTVPVAASLCILRSGYLFVASDSGSQCLYAFEKLGDDDDEPEYLSTSHDGTIPTFVPR
                     PLGNLMLAHEIEALDPLMDAKIGNPLGSDVPQIYAACGRGPRSTFKRLRHGLEVSEVV
                     SSELPGVPQAVWSTKLCSTDTFDGYIVLSFVNGTLVLGIGETIEEVVDSGFLTSEPTL
                     AVQQLGADALLQVHPAGIRHILPNKQVNEWAAPVRDDGVQTRIVAATTNHRQIVVALD
                     NQDIVYFELDMDGQLNEFQERRSIGAHIVALSISTCPEGSQRTPYVALACSDQTVRII
                     SLDPDSTLAPISLQALTAPPSSICISEMLDASIDRHHLTMFVSIGLINGVYIRTVLDP
                     TTGQLTDTRTRFLGGRPVSLVRTRVHGDTAVLALSTRTWLTYTLNEHIQFTPLMFDAL
                     THVSSFHTELCPDGLLGITGDTLRILTVPQMNGTQMKMDSLPLSYTPRKMAVHPHNAS
                     LFYVIESDHRTVAAGAEYDAARMGPVRADPGRWVSCIRVVDAVTMSTCACVELPNDEA
                     AFSITLVPLAACQNEWFLIVGSTQSLTHKPRAMKAAFLSTYRLACQGRQIELMHKTEV
                     DDVPLALHAFHGRLLAGIGMHLRIYDMGTKKLLRKCQSRPFPSTIVRVSVQGHRIIVG
                     DSQESVHYVVYKPGTNSLISFADDIMPRWTTALLMLDYDTVMAGDKFGNVYVLRIDSS
                     TSMSSDEDPTGLMLQNERAYLMGAAHRAQVLAHFHIGDIISSLALESLVPGGRPVAIY
                     TCINGTIGALIPFISREDVRIFSTLEMHMRQEKLSVTGRDHLAYRGQFAPVKSVVDGD
                     LCELYMSLSHEKQEEMAEELGHAPNDIGKKLTQMRESTTEL"
     gene            <985374..>989185
                     /locus_tag="MRET_1444"
                     /note="MRES_05780"
                     /db_xref="GeneID:38738210"
     mRNA            join(<985374..985764,985980..>989185)
                     /locus_tag="MRET_1444"
                     /product="RhoGEF domain protein"
                     /transcript_id="XM_027628071.1"
                     /db_xref="GeneID:38738210"
     CDS             join(985374..985764,985980..989185)
                     /locus_tag="MRET_1444"
                     /codon_start=1
                     /product="RhoGEF domain protein"
                     /protein_id="XP_027483696.1"
                     /db_xref="GeneID:38738210"
                     /translation="MSGLWSGRQRTDASNRDGAETSKTKTSAFRRPSLVPRRSNRDSP
                     SKDVFMTSERRSISMPFDTQSSNPNVSGQYASTSAETPPFHSNRHASTSVSSTESRPS
                     SVLAPSGGYQARSPIIQARDSDKASPSSAPSNPLMSQFKPFGDLPRRMPRPSHAKGMQ
                     FDTPPHSPPFMDVGIPPSYQRLLSSSPVDSKALSRGDDACSIVTDSSSIRQRPASRAA
                     SLYGVQPPLSPVGTQRSISPPPVPQKSSSPTSDRRIGPKSPLRAPVMASGRNTPASLA
                     VKVPSIHELDMAPPSIDSLWRSDSVKTSGSTIRSESEDGAWDSYDSTPSTPMRDGFQP
                     PLSTPLAVQFVQTGKGVLSVVSSEDDAPRRVTSSTTHLSMVNCPLPSYDMLRIPNMLV
                     VLDMSSSHLSALPESLALCTSLEELNISCNPLGTSNMAAPMSCLRALENLRVLLVDGC
                     KLPVVPHEILSLERLQILGLRQNRLTCLPSWMHALDYLDCLLLAGNTQWTPAWKAIVG
                     PLLHPSNDPPSPATNIMPTTPTVNTQISPKPPPIQSPSEARKRSGGFLNKLKTNNRTG
                     AQLDGSSLVRAPSRAGTVSDTASISSAASVTTDSPVRSSNAGGLRVPHQTPTRTFMVP
                     LPRLGQLPSNSHETRSLSCFLPVYADNGDRESVLAWYARVGTSYVRNLRAYLRDMDEL
                     LPERHRQVPQTASSVADSSGFGSPIMTSGDASDSTPSGTAGEVSSRHSILEDVGETNK
                     THVKDNAAKRYCVLREIIETERTYVAGLSELMDIYVKRARQPMDGVSDERVMSVEKER
                     IIFGHIEVIIQFHQGAFLPELERKTAALFKISELDEEQHASLSAQVAADVANVFSEYA
                     TYFKMYTNYVNQYETALKIISQWHEPISPRVKSAIKSSSTSLASIGQRFLNIDPALSS
                     TSPTALTFEEKALSDLQPISHAEHRRMQLFLRRCRDDPRHSQINLEGYLLLPIQRIPR
                     YRLLLEQLVKCTSHGVLPDLDREALARALAHISLVASWVNEGKRQSEQGKRLLQWQSR
                     LRGTFSAPLVQPHRRLVCDGPFRLCRVSKRVYQGTPPGDVSGPRMSCDEDFLEQMTMD
                     LPLHLLLCNDLIAAVSSSVSSTEDASPISGKSRVMHGSASGETGALDLVAVLKPQVHM
                     LPPGMHKTVMLPPASVVGPSLLRIVDAKYIYYFMAPSHTEAQRWQSFINAQV"
     gene            <989305..>990621
                     /locus_tag="MRET_1445"
                     /db_xref="GeneID:38738211"
     mRNA            <989305..>990621
                     /locus_tag="MRET_1445"
                     /product="oxidation resistance protein 1"
                     /transcript_id="XM_027628072.1"
                     /db_xref="GeneID:38738211"
     CDS             989305..990621
                     /locus_tag="MRET_1445"
                     /codon_start=1
                     /product="oxidation resistance protein 1"
                     /protein_id="XP_027483697.1"
                     /db_xref="GeneID:38738211"
                     /translation="MQGSSSTHARSDSFGEFQIADEPLELGTNQQDDRILDLRPIEQK
                     LDAHRHEQIAEAITTEQAGPSSSLRAIEHENTEQKDSKPSSYAGAIWSKLSALSAFHD
                     ALSKPHPPRRRPSVVRRHTSSAPISGAPGFDPNASPHWNRGNWTLSSSELSRDRQPIP
                     VILKDRNQDTDAVIEPWHAARIQSLLPLRLRLGKSWSLVYSLDQHGSSLATLYSRIER
                     FTGLRSSSDSMQSEGWLRGSSLAAQSAVLGTSLSDESLGKGVSTEMAMVLAVSDTDGN
                     VFGAFINEPLHKSSHYYGNGQCFLWKTVQRRLPVPPTETDGDASNYDDMHPDRAIEYF
                     CWSGENDYMVLSESDYLSVGGGDGRYGLWLDDTFSNGLSSRCPAFHNEVLCNAIESQA
                     TNAADTAPKPSVDLLIPLDETHGASPLPETSRFTCIGVEVWAVGLD"
     gene            <990641..>991105
                     /locus_tag="MRET_1446"
                     /db_xref="GeneID:38738212"
     mRNA            <990641..>991105
                     /locus_tag="MRET_1446"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628073.1"
                     /db_xref="GeneID:38738212"
     CDS             990641..991105
                     /locus_tag="MRET_1446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027483694.1"
                     /db_xref="GeneID:38738212"
                     /translation="MLEPGALRLMAKWSFDAPAYHREKVDAALHMDGRDAPIPALNTE
                     EMCTAVQHCVRAVSAYRTQLGTQTLSEQEQQELYEMRYQVCGCYILQHDLTLARSELE
                     LLTKSLRPWRGQPPWQAQLNARVLGTLAWLTEALGDVNASKRYALWRTQLST"
     gene            complement(<991107..>992741)
                     /locus_tag="MRET_1447"
                     /note="MRES_05785"
                     /db_xref="GeneID:38738213"
     mRNA            complement(<991107..>992741)
                     /locus_tag="MRET_1447"
                     /product="F-box domain protein"
                     /transcript_id="XM_027628074.1"
                     /db_xref="GeneID:38738213"
     CDS             complement(991107..992741)
                     /locus_tag="MRET_1447"
                     /codon_start=1
                     /product="F-box domain protein"
                     /protein_id="XP_027483695.1"
                     /db_xref="GeneID:38738213"
                     /translation="MSSLELALSAHPLGVCPLGNAYLEGAKNLRPKGLGCFAYWEDAF
                     LVQFLIEWLDVRSLLALSSASRSFYALVNTPQVWREKYIRDKSGYVLKWNGSWRGTYA
                     ATETQMKACQDAATACRIHLSGVYSDTIYQEFITASFDPRLFIEMHARREMRKLSRVR
                     KIATDMVPERPSIPDNIERLDARTCNVSEFLTKYSQQGQPCILMHATENWPCHAWSLD
                     FIEKVWATRMFQAEALRVNGENYVSYARSVGGGGMPDPTSGVVPDTSPFYLFDADVAV
                     EDAQAARDWRVPTLITRYPRSESLVDEEANDEQIRADLFCLFGNARPDYRWLIAGPKR
                     SGSCWHKDPNMTSAWNAVMQGSKYWMLLPPKTVPPGVYVTEDESEVTAPASLSEWMLD
                     FYAETKAKHGRRECGGDGQLVEAVCHEGEVMYVPSGWWHLVVNLDDSVALTQNFVSVT
                     ELPDVLSFMKYTPDQISGFRKDVAKTSVFEQFVEKLRSYDQDLTNDALARMPSRKVRK
                     PAEPTRDWRERLCEESETMCTFSSLVDDAELGETPW"
     gene            <992888..>994301
                     /locus_tag="MRET_1448"
                     /note="MRES_05790"
                     /db_xref="GeneID:38738214"
     mRNA            join(<992888..992989,993033..>994301)
                     /locus_tag="MRET_1448"
                     /product="tubulin beta"
                     /transcript_id="XM_027628075.1"
                     /db_xref="GeneID:38738214"
     CDS             join(992888..992989,993033..994301)
                     /locus_tag="MRET_1448"
                     /codon_start=1
                     /product="tubulin beta"
                     /protein_id="XP_027483315.1"
                     /db_xref="GeneID:38738214"
                     /translation="MRELITFSVGQAGNQISTAFWETILEEHGLNKDGQYVGNDPLEL
                     SKINVFFEDSNQEGKYVPRSVNIDLEPGTIDHLRTGSLGHLFRPDNYVHGASGAGNNF
                     AKGFYTEGAELLDAVLEVARHETERADMFQGFQLIHSLGGGTGSGLGTNLLSKLREEY
                     PDRMLATWSVLPSPKVSDTVVEPYNATLSFHQLVENADLSFCLDNQALYDICQRTLRT
                     ESPRYDDLNTLISYAMSGCSTTLRFPGQLNSDLRKLGVNMIPFPRLHFFTCGYAPLVA
                     SSLQSYQALNVPQLVQQGFSPHNNMAAIDPRSGKYLTVAAIFRGKVSSEEVESEMHKV
                     QLKSTGGFVEWIPQNVLTSLCNVPPPKLKLSATFIGNTTSIQELFKRTHSQFGAMFRR
                     KAFLHWYTNEGMDEMEFTEAESNLLDLVAEYEQYEAAGVDDDEMYEGEYVEEVYDEQG
                     EYVQDY"
     gene            <995093..>996811
                     /locus_tag="MRET_1449"
                     /note="MRES_05795"
                     /db_xref="GeneID:38738215"
     mRNA            <995093..>996811
                     /locus_tag="MRET_1449"
                     /product="aspartyl-tRNA synthetase"
                     /transcript_id="XM_027628076.1"
                     /db_xref="GeneID:38738215"
     CDS             995093..996811
                     /locus_tag="MRET_1449"
                     /codon_start=1
                     /product="aspartyl-tRNA synthetase"
                     /protein_id="XP_027483316.1"
                     /db_xref="GeneID:38738215"
                     /translation="MSSETTKQVNVSEGAPVELDQKAQPKMEANKDAGSEELNPDGTP
                     LSDKQRRKRAEKAEKERIKAEKAARLAAEQAARQAADVDFATENYGVLPMNCSQERKN
                     EQLFAIEDIHPEKDGQPITLLARLQTSRLPSAKLAFLTFRNGVHCVQATLAVTPEKIS
                     RQMVKWAAAVTPESIVRVEGTISKVPKPVESPSVTVKDAEIKISRMFVAVPVTWEGQI
                     PFYVDDATRSDAEIEASQNTPRPLPPIALDTRLDNRVLDLRTPTNQAIFRLNHGVCRL
                     FREFLENNGFIEIHTPKLQGAATESGASVFKVDYFKGKAFLAQSPQLGKQMAISADFG
                     RVYEIGPVFRAEDSNTNRHMTEFTGLDLEMAFQEHYHEVVDLLNQLFMYIFSELPKRY
                     ATEIAAVRRQYPSEEFLVPEAPVCLNFKEGIQMLRDAGYEVNDLDDLSTETERALGKL
                     VRDKYKTDFYALDKFPMEVRPFYTMPDPEDSRYSNSYDFFMRGQEILSGAQRIHDAKF
                     LEERLAAANIPVSSMKHYVDAFRLGAPPHAGGGIGLERVLMLYLGLNNIRRVSMFPRD
                     PKRVEP"
     gene            complement(<996792..>998075)
                     /locus_tag="MRET_1450"
                     /note="MRES_05800"
                     /db_xref="GeneID:38738216"
     mRNA            complement(join(<996792..996845,996870..996940,
                     996967..997701,997730..>998075))
                     /locus_tag="MRET_1450"
                     /product="acylglycerol lipase"
                     /transcript_id="XM_027628077.1"
                     /db_xref="GeneID:38738216"
     CDS             complement(join(996792..996845,996870..996940,
                     996967..997701,997730..998075))
                     /locus_tag="MRET_1450"
                     /codon_start=1
                     /product="acylglycerol lipase"
                     /protein_id="XP_027483345.1"
                     /db_xref="GeneID:38738216"
                     /translation="MSHLVSCVAWYTREIYYVFIEPWLAKLGLVYFGFGDASYGREAI
                     PYSNIERELIYEAPGVKVTRRRVFFSYNEPILDLKMQGQGLRLPFSYLGKPVTAWVNY
                     YVWERPDEVARAKLNADIYMAHGINEYSGRTATAASVHLRNGFRVIGIDMPSFGRSSG
                     LHGYLPTLRWNEGALNAVMLHVHMWDEYEQLENLANRKRFAQGASMGGFTCAYHAALH
                     PPPSTSVSMSLNGICLTAPMLQISPITRPNVCIEAIARMVSLVAGRLGVLQPIRGHLS
                     DDPNVEFYARQDRQGYLGRLRIDTGLGIADGLTHLDQIAESIRCPILIFHGTADRVTD
                     PDGSQLFYDRLLVQDKTIKFWPGWEHVMIKNYPGMSEQDKAARTKLLSDISQWFMDHT
                     RVDSTAPHA"
     gene            complement(<998184..>1000106)
                     /locus_tag="MRET_1451"
                     /note="MRES_05805"
                     /db_xref="GeneID:38738217"
     mRNA            comple