GenomeNet

Database: RefSeq
Entry: NC_040195
LinkDB: NC_040195
Original site: NC_040195 
LOCUS       NC_040195            1222814 bp    DNA     linear   CON 11-JAN-2019
DEFINITION  Malassezia restricta chromosome III, complete sequence.
ACCESSION   NC_040195
VERSION     NC_040195.1
DBLINK      BioProject: PRJNA495494
            BioSample: SAMN09478194
            Assembly: GCF_003290485.1
KEYWORDS    RefSeq.
SOURCE      Malassezia restricta
  ORGANISM  Malassezia restricta
            Eukaryota; Fungi; Dikarya; Basidiomycota; Ustilaginomycotina;
            Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
REFERENCE   1  (bases 1 to 1222814)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Complete Genome Sequence of Malassezia restricta KCTC 27527
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1222814)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JAN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1222814)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2018) Division of Polar Life Science, Korea Polar
            Research Institute, 26, Songdomirae-ro, Yeonsu-gu, Incheon 21990,
            Korea, Republic of
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP030253.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 2018
            Assembly Method        :: canu v. 1.7
            Assembly Name          :: MRES_180501
            Expected Final Version :: yes
            Genome Coverage        :: 38.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1222814
                     /organism="Malassezia restricta"
                     /mol_type="genomic DNA"
                     /strain="KCTC 27527"
                     /isolation_source="skin environment"
                     /host="Homo sapiens"
                     /db_xref="taxon:76775"
                     /chromosome="III"
                     /country="South Korea: Konkuk University Hospital, Seoul"
                     /lat_lon="37.57 N 126.98 E"
                     /collection_date="2010-05-01"
     gene            <1339..>2475
                     /locus_tag="MRET_1618"
                     /note="MRES_06495"
                     /db_xref="GeneID:38738384"
     mRNA            <1339..>2475
                     /locus_tag="MRET_1618"
                     /product="cathepsin D"
                     /transcript_id="XM_027628245.1"
                     /db_xref="GeneID:38738384"
     CDS             1339..2475
                     /locus_tag="MRET_1618"
                     /codon_start=1
                     /product="cathepsin D"
                     /protein_id="XP_027484116.1"
                     /db_xref="GeneID:38738384"
                     /translation="MLLLPPALALLVGVSFASASQITLSHTDRSNPDSFHAERRSLLN
                     KYAGFAKRHFNSTGQHLDIVDLHYADKQKRASGKTSLRYNTYWTGSILVGSPPQPAPV
                     VFDTGSSDLILDKSFYNPKKSLSANNLNTPFDFSYINLHVYGDIYSDHVAIGDVKADN
                     VPIGHGREDFDGDLTGGKFGLSFSTAENSGFNVKQDPFIWAAKKQNPIQSSSFQFTLR
                     RSGKATLNVGDVDHSELAGPISWADKNTDKSFWRTSVELNGNKIENAIIDSGTNVITG
                     PNDQVKAVLDQLDGVWVEQSPDGTYQGRYSCQNPPNLHFTVAGQTFKLSSDAINFGYA
                     GDKCFLAMGGTLGLNDWILGSPFMELGSVIFNYDTRRMGFAKAR"
     gene            <3939..>6401
                     /locus_tag="MRET_1619"
                     /note="MRES_06500"
                     /db_xref="GeneID:38738385"
     mRNA            <3939..>6401
                     /locus_tag="MRET_1619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628246.1"
                     /db_xref="GeneID:38738385"
     CDS             3939..6401
                     /locus_tag="MRET_1619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484317.1"
                     /db_xref="GeneID:38738385"
                     /translation="MDMQVPHESLLLASAVNPVLDLVALVSREAPPEKPASTLPPGVN
                     AAQAAMRQRVLDMQARKKGQLAHPASSSISVQSGPTVRISVWRTGKYPSPVWDKPFEL
                     PPGPPGATSQSLQVLSMTWAPKGDRLAVRACITNILGGTPHHTLLLYLLSVYDGGLLH
                     ARLVPCSHPPSHASLLWIPLRLSGSLDSQALHILQRLAPLYPAQPFDDDKARWHGSSL
                     PHSPPGESPSAACVRGIGVLASIPFMLRLDEDAPSLLLSAENQAIEAWMDGTVPLAPT
                     VLPGSILSLAAADHSASALIHDASSLRTFRISLPWDISFLHIARLSSSFQHCLAIALD
                     ATFYATHAWSTFVRPRANEWLALWHDLANAYGVDIVADWMTLLTTALPSQPCEQLLSQ
                     LTEGALIAMESDMKRGLKRIRRLAATNVVPACERLLILLTEWMGCASWSTRYPPSSPR
                     ISSLISLIQTCHGLAISLQEHAERELLAFDEFYKWWRYEQERLERAKSDIPSAHVPIQ
                     HDTLSVLELCRRGFLSPELDAILSAPAQEAAPAPPGQATDNAADSSDDSHAISEPLFP
                     PQRVLYEETRPLHEPSCVTVQDALAWLDAQEASESNQSQPADDQWHQVFHHTSLFTGP
                     AASAEPHMLPGHALSLFQQLEDAGKAAGHIFSAALLHESTSSSECADPWPMPASPCLH
                     DDALRSVAANAAAHVASHIPRPMMRAIPTQRDTHTHLYLSDTQLSLVQVSSSPCAVQT
                     IQVPSGGQLLDATLSPLYLFVLWVDAEQSTYVGAFPASRTPSWPPPHSVPMHRGRFLA
                     ASQRDACLVLKEDKRSLSVYVP"
     gene            complement(<6414..>7442)
                     /locus_tag="MRET_1620"
                     /note="MRES_06505"
                     /db_xref="GeneID:38738386"
     mRNA            complement(<6414..>7442)
                     /locus_tag="MRET_1620"
                     /product="electron transfer flavoprotein alpha subunit"
                     /transcript_id="XM_027628247.1"
                     /db_xref="GeneID:38738386"
     CDS             complement(6414..7442)
                     /locus_tag="MRET_1620"
                     /codon_start=1
                     /product="electron transfer flavoprotein alpha subunit"
                     /protein_id="XP_027484345.1"
                     /db_xref="GeneID:38738386"
                     /translation="MFAVRSMLRAGSRAATPLRAFSTSSMRQANTLLFVEHKNGVINP
                     ASLSAVTAAQKLGGEIHALVAGSSSHAKAVAEAASKVQGVSKVLVSTSDAFSALLAEP
                     IAPLIESLVKSKSYTHVVAGHTAVGRDIIPRAAVCLDSSQVSDIIEVQGEDTFVRPIY
                     AGNALATVMSKDGVKVVTVRGTAFDAASAEGGSASVEEVDAGEVPQPTKLVQEKMSES
                     TRPDLATASRVVSGGRALKSSEGFAKYIEPLADKLEAAVGASRAAVDAGYADNALQVG
                     QTGKIVAPELYVAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVADMGLVADLYEA
                     VPELTEKL"
     gene            complement(<7549..>9258)
                     /locus_tag="MRET_1621"
                     /note="MRES_06510"
                     /db_xref="GeneID:38738387"
     mRNA            complement(<7549..>9258)
                     /locus_tag="MRET_1621"
                     /product="NAD-dependent histone deacetylase SIR2"
                     /transcript_id="XM_027628248.1"
                     /db_xref="GeneID:38738387"
     CDS             complement(7549..9258)
                     /locus_tag="MRET_1621"
                     /codon_start=1
                     /product="NAD-dependent histone deacetylase SIR2"
                     /protein_id="XP_027484346.1"
                     /db_xref="GeneID:38738387"
                     /translation="MLVVCLPAPSEPVELSRKPVSQGRRVFTRSSTLGSVKTETQSEP
                     VGQAVPTTLTYQAPRDIQMPNYAQVSTQVEHDLGRVYQSFRQARRIAVVCGAGISVSS
                     PANIPDFRSASGLFASLKRRYPTSGLTSGKDLFDARLFQSESSTALFFAMIAELKDMS
                     DAAQPTLFHHMLRRLDMEGRLQRVYTQNIDGLEEKVGLSFGVGSPEACLPTSKRKRGA
                     QFARSQSDSSVRLSTHPSCEKPLFPRAIPLHGSLSSMTCMLCSHKLRLTREQEAGRQA
                     LETLRRGEPVWCEQCEVTDQLRTSAGLRSRGIGRMKVDVVLYNGENDAAEHVGACVER
                     DLLGIRDPHEPDVPETMAETRARERKERQREEIGDLSVTSGSIKAEDALGDAFQSEDQ
                     VSDPPPRRPRRLKPLPPDMLIVAGTSLKVPGTKRIVREFSKACRMQNADRKKGAHEPP
                     VRVVYMNYDFPSSASEWSGVFDMWIQGDVQQAALGLCEPMVMKEGMDPAVEALVARHS
                     WHAYPTKTPPPRILTMKSTETKKRPSNRLGMVSGKLRTSSNQATGKAGLVRPPTPPAP
                     IAP"
     gene            <9426..>12032
                     /locus_tag="MRET_1622"
                     /note="MRES_06515"
                     /db_xref="GeneID:38738388"
     mRNA            <9426..>12032
                     /locus_tag="MRET_1622"
                     /product="Rdx family protein"
                     /transcript_id="XM_027628249.1"
                     /db_xref="GeneID:38738388"
     CDS             9426..12032
                     /locus_tag="MRET_1622"
                     /codon_start=1
                     /product="Rdx family protein"
                     /protein_id="XP_027484274.1"
                     /db_xref="GeneID:38738388"
                     /translation="MHQMGPHAPAIPPRNKNRPVYTGTSPEFTAFPPAQSPTSPIRAR
                     SPLQHTSPPANLSSATPNATVPQSFDIPQSASSRHDASHVPPPWGLPIPSPNLSETTR
                     DENAFPRTSVRSLRFSDDRGSLSDSSQSSLQQGASTWQRPGGSFEGRSRVPEGAYTIY
                     APAPPSVVRSVPRHSSRSRTSGSTSDQDGSSFMTKSSTASVIMNDQTDPGDANALSTK
                     SSLPLYIEPQAPSTNRSYGSSETKAPVFPASSPTDISLPSQPPLPARPVPPTPAPPST
                     DNGSATSPHSDAETRPDPTNKKKEKRLFFLNLPKRNSESKLRDLVGSKKEPHDVSSTP
                     SITKETLLTKDSMPPSPKTVPVSAPPGSVSEDETLIASRRLAFAPAHANSPWAPSEVV
                     HTQRESHASALEVVQVTPPKFKETRHAFDAQSPSKLPTEAWTFAPSASALQAGHDAEL
                     DERRMPWAVSESPWPVDNNVPFELEEVETVQPVTSLPILSHADSAAQEAEVSKDLPVV
                     PPTEANDVSSKMTEASRVSPKTVETTNESPANTKENANIIPSNISQEPNDLPAPAAGE
                     VPTSKDTLEETTHNAVTQTDANASEATMPERTVDGAAPDSSAAPATDAFATEQAPKDQ
                     EKEDSTLEHLAETIPPASTAGIAAESVGIRTSEEVDRADVSDTGERTEKEAAPDGVSE
                     ATTTTNAQDAAETSQTDTAQADQSSESMPGALPPKCVPCDSTTETPIHSAPDIPPPIA
                     PEQTDAVPKPCLVIEYCDRCRWMHRAIWLQTELLITFSEKGALDNDAPKASGGGYLAS
                     SMLVPQAKPETAGRFRVWLVLANAVELIWDRKTQGGFPELRELKNRVRDKIAPTQHLG
                     HSELASRGSSYG"
     gene            complement(<12047..>12985)
                     /locus_tag="MRET_1623"
                     /db_xref="GeneID:38738389"
     mRNA            complement(<12047..>12985)
                     /locus_tag="MRET_1623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628250.1"
                     /db_xref="GeneID:38738389"
     CDS             complement(12047..12985)
                     /locus_tag="MRET_1623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484344.1"
                     /db_xref="GeneID:38738389"
                     /translation="MQPLRWVAILWFLYASLAMAQRRSPSSRASSISSRSSRRSTLSR
                     NRTASTTKPSSPPSPPLPKGFMNPLDTGGSMLGQYPDRPYEGEPLNVIISNTSSPDVL
                     KPEGFLIWATALGFGVSCLGQGDSQTIMYANLGNGNRNVKQGSESGLNGVLRWNYGFP
                     DVGTCKESIVGGNHFRWFQQRLHMDRSIFISVSLEQSLENLHNIERDGYNRGRDDVIE
                     RATNPDGIEWEGNKFRATVQWIDSGILMNATSNNISHAEMAAKGQPVVDGRVAVLYIQ
                     TIARSDGEPPNAAAHVVLPITALWSVLLGTMLILSM"
     gene            complement(<13061..>14075)
                     /locus_tag="MRET_1624"
                     /note="MRES_06520"
                     /db_xref="GeneID:38738390"
     mRNA            complement(join(<13061..13881,13907..>14075))
                     /locus_tag="MRET_1624"
                     /product="transcription initiation factor TFIID complex
                     subunit 8"
                     /transcript_id="XM_027628251.1"
                     /db_xref="GeneID:38738390"
     CDS             complement(join(13061..13881,13907..14075))
                     /locus_tag="MRET_1624"
                     /codon_start=1
                     /product="transcription initiation factor TFIID complex
                     subunit 8"
                     /protein_id="XP_027484342.1"
                     /db_xref="GeneID:38738390"
                     /translation="MVGVSSYVPPTAARADVLEQDARAAVSKLIAHVAQDAGFEGTRR
                     RALDRFEGLVDMFVMTLLYNCMRYNQLVNRNYPTIHDVMDTLEGLGISLEELGAFASR
                     LRGQTEQRCRVHVAEPKRGHEAWESPSSSFLPSEDEGDESESQTTTWATLMHDIIPDH
                     LPPEPPRHCWMFTPVYATEMLSDMPALQLVNRKLDNARLVESSLRKLIKHTDAAAPPK
                     LWTPPDPTRSDDTMARPKVQPAQAVGDDSIMSVDEPDATVHDMPLTTTLDNVGRSDPS
                     RRVLPRAVNYKAAWYTATSSTDSKLPTANLYTARLRGNMDESARRTRRYIVPT"
     gene            <14180..>14746
                     /locus_tag="MRET_1625"
                     /db_xref="GeneID:38738391"
     mRNA            join(<14180..14339,14370..14468,14495..14534,
                     14563..>14746)
                     /locus_tag="MRET_1625"
                     /product="Cdc25 family phosphatase"
                     /transcript_id="XM_027628252.1"
                     /db_xref="GeneID:38738391"
     CDS             join(14180..14339,14370..14468,14495..14534,14563..14746)
                     /locus_tag="MRET_1625"
                     /codon_start=1
                     /product="Cdc25 family phosphatase"
                     /protein_id="XP_027484343.1"
                     /db_xref="GeneID:38738391"
                     /translation="MLRTARGVWQHGARTRHAFSTMSFQPPYMYIEADALASKLKEQR
                     PSTAVVDVRDDDFEGGHIKGAFHSPSSTFLDGVNTLLKPLETYENVVFHCALSQQRGP
                     KAARIYREIRDANIEAGRMPPTTQQVYVLRDGFSHFGNKFKRDPELVEDWDEEAWQFR
                     "
     gene            <14816..>16585
                     /locus_tag="MRET_1626"
                     /note="MRES_06525"
                     /db_xref="GeneID:38738392"
     mRNA            <14816..>16585
                     /locus_tag="MRET_1626"
                     /product="adiponectin receptor"
                     /transcript_id="XM_027628253.1"
                     /db_xref="GeneID:38738392"
     CDS             14816..16585
                     /locus_tag="MRET_1626"
                     /codon_start=1
                     /product="adiponectin receptor"
                     /protein_id="XP_027484340.1"
                     /db_xref="GeneID:38738392"
                     /translation="MPFPSEEQHAAHASTSALEDRSTLIHRRASHSSLPDVSGDETSD
                     PCTSHSLVDALDLATSLPYWFAYARARMSDYIKDMEHLVYANKAHRMSILVPLEYMEA
                     RFSAAYDAMLRMAQEASFSRYEGKEASRCKLSSSDEIKHRIHVLVQEWERRAMTLQPT
                     LFARTPTSESKTQSSLRMPATAAYLSEEVQKSMSAMRNHFQNVTIPLLRDTSSAWAHD
                     AQAFLPDRATLHHLPQHVRETLAMLGSRGMEAGAQIVHAVHDVEDAIYEAACRLANNG
                     RELISYHALPELWRNNDFIVTGYRFIPKDQWHRLILSAFHIHNETGNIHTHLGGLFLV
                     GVLFWLTSSLDPTTTTTMDRWIVTIYLFAAAKCLICSVSWHIMAGCADLQWFTCFACI
                     DYTGISWLVAASLETIVYNGFYCQPGLIALYTVGVIAIGVIMSILPWSPWFNDIRYRT
                     IRITLFLGMACMGIVPFVHGTILHGYDNMAQFYAPLIPSLGSYIVGVVLYSFRWPERW
                     APGKFDIVGHSHQLWHVAIVLAIYLHFQAVLSFHENRHAYSCAAGSTPSPTLAHIADI
                     FHTSQQWLVLSAKKFTPGAYYIQ"
     gene            complement(<16711..>18058)
                     /locus_tag="MRET_1627"
                     /note="MRES_06530"
                     /db_xref="GeneID:38738393"
     mRNA            complement(join(<16711..17723,17752..17920,18023..>18058))
                     /locus_tag="MRET_1627"
                     /product="protein phosphatase PTC2/3"
                     /transcript_id="XM_027628254.1"
                     /db_xref="GeneID:38738393"
     CDS             complement(join(16711..17723,17752..17920,18023..18058))
                     /locus_tag="MRET_1627"
                     /codon_start=1
                     /product="protein phosphatase PTC2/3"
                     /protein_id="XP_027484341.1"
                     /db_xref="GeneID:38738393"
                     /translation="MGQILSEPIVDKRTSQDEDENLAFCVSDMQGWRISMEDAHAGVL
                     NLSHEATTSPTERVSFFAVYDGHGGANVARYSGRTLHSRLLDLPEFKEKKWEAALHRA
                     FLKTDEDLRSDPVYANDTSGCTAVAALIVPDANEKGRRIYVANAGDSRCVLGLAGEAK
                     PMSYDHKPGNAEEHSRILNAGGFVEFDRVNGNLALSRAIGDFEFKQNPSLPAEQQIVT
                     ADPEVRSHQWTAEEEFLVLACDGIWDCLSNQQVVDIIRRGIAQGKALDVITEDIIDRC
                     LAPDAEVGGIGCDNMTLLIVALLGDRTKEQWYEWVKSRVENNVGYNTPESVPPVFRSH
                     LQQQSTASMLGQAASNVQQNASMSLGGLSGGDILAAIPRVLSGQAVHEDFDEQNTEHG
                     RIVAEENGAPANE"
     gene            <18275..>19358
                     /locus_tag="MRET_1628"
                     /note="MRES_06535"
                     /db_xref="GeneID:38738394"
     mRNA            join(<18275..18277,18318..>19358)
                     /locus_tag="MRET_1628"
                     /product="translation initiation factor 3 subunit I"
                     /transcript_id="XM_027628255.1"
                     /db_xref="GeneID:38738394"
     CDS             join(18275..18277,18318..19358)
                     /locus_tag="MRET_1628"
                     /codon_start=1
                     /product="translation initiation factor 3 subunit I"
                     /protein_id="XP_027484347.1"
                     /db_xref="GeneID:38738394"
                     /translation="MRPIVLSGHTRSLNKIKFNREGDLLFSVSKDNLVNVWFSHNGER
                     LGTYNGHNGTVWSVDVDRETLLLVTGSADNQVRLWNVKTGECLFVWEFPTAAKCVAFN
                     KRGTQILVITEERMGHRGALRVFNINRDPASWTKQETEPMRMITFSGSKASVACFDVF
                     DHHIITGHESGKVALYSHDEKEGETGIDAELEIHHTMAHAEIVTDLQLGWDGTYIITS
                     SKDKSSHIIDASTLDIIKTYMTDTPLNSAISLPTRPYVIMGGGQEAMSVTTTSARQGK
                     FESRFWHKIFEEECARLPGHFGPINTLAVHPAGTAYASGGEDGYVRINWFDESFFKSK
                     PYGPDFEIENKDQ"
     gene            <19510..>20751
                     /locus_tag="MRET_1629"
                     /note="MRES_06540"
                     /db_xref="GeneID:38738395"
     mRNA            <19510..>20751
                     /locus_tag="MRET_1629"
                     /product="pachytene checkpoint protein 2"
                     /transcript_id="XM_027628256.1"
                     /db_xref="GeneID:38738395"
     CDS             19510..20751
                     /locus_tag="MRET_1629"
                     /codon_start=1
                     /product="pachytene checkpoint protein 2"
                     /protein_id="XP_027484348.1"
                     /db_xref="GeneID:38738395"
                     /translation="MDTETYSSHLPSIAHVEVRLRATSDAHVSEIETAVRALLDKIPL
                     VECESDLRGWQQNAFLAEHVDRIYVAEADEPGIKTVSPTNGKFEFHTYQPCPVDNIDE
                     FGVGEADTSDNAVAATLCELPNHSLDGVWNSLVYEDDVKWRLLRYIYSTILFSDADVD
                     FHLIAWNRVVLLHGPPGTGKTSLCRALAQKLSIRLHERYTHGKLVEINSHSLFSKWFS
                     ESGKLVHRLFDMVSQLVEDETGFVVVLIDEIESLSKARSSVATGAEPSDSIRVVNALL
                     TELDKLKHKRNALVMTTSNLSDSIDTAFLDRADIRQYIGPPGTEAIYSILRSCLIELI
                     RAGLAQEECIPSYGAIDASDNKVAHQLRHLAEYCHGASGRSLRRLPVLAHAQYLHAPG
                     AFSCAEWIGAMQRTFENTSLS"
     gene            complement(<20792..>22528)
                     /locus_tag="MRET_1630"
                     /note="MRES_06545"
                     /db_xref="GeneID:38738396"
     mRNA            complement(<20792..>22528)
                     /locus_tag="MRET_1630"
                     /product="non-canonical poly(A) RNA polymerase PAPD5/7"
                     /transcript_id="XM_027628257.1"
                     /db_xref="GeneID:38738396"
     CDS             complement(20792..22528)
                     /locus_tag="MRET_1630"
                     /codon_start=1
                     /product="non-canonical poly(A) RNA polymerase PAPD5/7"
                     /protein_id="XP_027484653.1"
                     /db_xref="GeneID:38738396"
                     /translation="MPPRAPNETGPVTHEESNALGSDFISFDQSDESHVEESESEPEP
                     VVVDDTVREHASARSTPWAQHVPWHKCRNVSEMLCEEVRTYTEWISPTKEEHATRTMV
                     IALLQRALCSRWPDAEVYSFGSQDTELYLPQGDIDLVVLSKAMDSQSREGTLREIASC
                     LRSHKLATNIQVIGRAKVPIIKFVCPYGHFHIDISINQANGLQTAHFINRWLQKQPAL
                     RPLIMVVKQFLQQRALSEVFTGGLGSYSVTLMVLSFLQVHPKLQRGEMPPEQNLGALL
                     MEFFELYGKNFGYDECAITVRGRGGYVSKRQRGFFDPRKPFMLSIEDPHDPEGDVSKG
                     SFAIISVRSALGGAFDILHAALCERSNDLHNFRRRQRLLYNRQMQSTHVHFDADASDN
                     RLHLTSQIKEPESLLGSVLGVSREMIRRRNEIKQLYDSEVLQKLLDIPVDSTPSAPAV
                     RVNAPTPHDTSDNSIMIHAQESIKRRVHPDEQDTPESKYDAKRPKKRAMQDPWSSRVQ
                     SVPSDTEEEELMANDAPYVAVSSDSDGPSPAPVASTPVKTQGLRIAGRAKQSKLSKKD
                     RLQYWHNKASAT"
     gene            <22626..>25235
                     /locus_tag="MRET_1631"
                     /note="MRES_06550"
                     /db_xref="GeneID:38738397"
     mRNA            <22626..>25235
                     /locus_tag="MRET_1631"
                     /product="ATP-dependent RNA helicase DDX46/PRP5"
                     /transcript_id="XM_027628258.1"
                     /db_xref="GeneID:38738397"
     CDS             22626..25235
                     /locus_tag="MRET_1631"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX46/PRP5"
                     /protein_id="XP_027484660.1"
                     /db_xref="GeneID:38738397"
                     /translation="MADAAAIDAEAKKRAKRERLEAWRREQAKKKRQVSGDDDASSKK
                     AKVSDTPTPPAGKFATTLGFHTQGSPRPPSVKPRVRLDAQDESDDELLRKPHRRFTLD
                     AFTESEGTKADSKEDPLDAYMNQLEGEVQRERNHHSEVLTADDEEPDHATVANEEDEV
                     DIDSIRAEDILAMANRGSKKKQLPTVDHASIRYEPFRKAFYHAPEDVATISEADAERL
                     RLELDGMSVRGKHCPAPIKKWTHCGLPVHCLDVIKRLGYTAPTPIQSQAMPAIMSGRD
                     MIGVAKTGSGKTMAFLLPMFRHVKDQRPVEPGEGPIALIMTPTRELAVQIFRDAQPFA
                     RAFGLRGACVYGGTPISEQIAEMKKTVEFVVATPGRMIDLLSANSGRVTNMQRVTYLV
                     LDEADRMFDLGFEPQVMKILGLIRPDRQTVLFSATFPKPMESLARKMLRHEPMEVIVG
                     GRSVVAPEIRQVVEVRDESTKFHRLLVILGQLYHNDQDARTLIFVERQDAADGLMHEL
                     MKRGYPAMSLHGGKDQADRDTTISDFKAGIVPILTATSVAARGLDVKQLKLVVNYDVP
                     NHLEDYVHRAGRTGRAGNEGTCVTFITPDQDRYAKDLVTALRASKAPVPPELETLSMQ
                     FKEKLAEGKTHASSSGFGGRGLERLAESRERLLQAQASIMIEDEEADPEAAAARAAEE
                     TNRLNNTDIQVCTGPIPEAVRENKQPLPSEADHAAHQARMEAARLAGADTSKLQGVIA
                     RINATASRRREELENSRRARDPDATKFHAIFPINDFPQKARWNVTNKETMAMLIESTG
                     ASITNKGAFYERGREPHPGDPPKLSLLIESNDSFRVEHAIREIKRHLLEGTQAYLDGE
                     SRTSSMGGRYSVV"
     gene            complement(<25232..>26380)
                     /locus_tag="MRET_1632"
                     /note="MRES_06555"
                     /db_xref="GeneID:38738398"
     mRNA            complement(<25232..>26380)
                     /locus_tag="MRET_1632"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628259.1"
                     /db_xref="GeneID:38738398"
     CDS             complement(25232..26380)
                     /locus_tag="MRET_1632"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484663.1"
                     /db_xref="GeneID:38738398"
                     /translation="MRWPSLVCRTARSRAWIRSYTQSAWDELLADTNSSTHGSSLNQD
                     TPTNSVLRDILYAQERPNSPSLRQRRRHYDTSALTPSESAQFRRIFELLGQETDHTPV
                     PDPALDAFAQRNALRPKKLTARGGGVGTRFEASMEGLAAQIPVEELDRGVDHIWEALQ
                     TKNTVVETWQWAEKHVWAQDAAYGAHTAFFAPALHMLLLTLRDKYRAPHTALAVMDRT
                     RKNGAHAYVLGCTSSLFAEMIRTQWLCLGDAQGVLATAREARSAGVFTDSIAKKTERD
                     DASLHTQMERVRDQLRAHVMNGAQARVRNPDGTLAMLADDHDALQMAAELGRIMGRKS
                     LRPKPATKPKAPRKSKTPKSLLIYPQDPQSLLRTEVHRRIERPVDHDD"
     gene            <26443..>27482
                     /locus_tag="MRET_1633"
                     /db_xref="GeneID:38738399"
     mRNA            join(<26443..26605,26634..26800,26830..26915,
                     26942..>27482)
                     /locus_tag="MRET_1633"
                     /product="protein KTI12"
                     /transcript_id="XM_027628260.1"
                     /db_xref="GeneID:38738399"
     CDS             join(26443..26605,26634..26800,26830..26915,26942..27482)
                     /locus_tag="MRET_1633"
                     /codon_start=1
                     /product="protein KTI12"
                     /protein_id="XP_027484662.1"
                     /db_xref="GeneID:38738399"
                     /translation="MALLVVTGLPCSGRSTRVKEIQSYFESRLESNPSLSRVCVIQDA
                     DVHVDRHVYESQRTEGRARAAYLSAVRRALSPSAIVIADGGAGLNIKGSRYELWCATR
                     ELGLRCATLYIACPSTLCHAWNTRRRERGEPSYTDICLDELIYRFEEPTPEARWHRPL
                     FTTTTTGAPDAPECLPTPLDGLWEAITQAKVQPPKAVTLVRKKTTNNSLELLDTVTQA
                     VLGAISEYRAQGGAMCGSISLSLPQFIPPPPIVFTCPPLNTFPSPARLQTLRRQFVRV
                     YAGKAEYADSLALTSQPEPERHIAQMFTAWLQETLTSNKIHS"
     gene            complement(<27501..>28868)
                     /locus_tag="MRET_1634"
                     /note="MRES_06560"
                     /db_xref="GeneID:38738400"
     mRNA            complement(<27501..>28868)
                     /locus_tag="MRET_1634"
                     /product="bZIP transcription factor"
                     /transcript_id="XM_027628261.1"
                     /db_xref="GeneID:38738400"
     CDS             complement(27501..28868)
                     /locus_tag="MRET_1634"
                     /codon_start=1
                     /product="bZIP transcription factor"
                     /protein_id="XP_027484658.1"
                     /db_xref="GeneID:38738400"
                     /translation="MDHTSPAPPPPMPDGAFGTVIQLANVSSRPDGELGNNHNNSQHH
                     HNPSDYTHQRGLKSRESEMSENPRSSKQIRMDNGAPHAGVDAQALSWAPTAPPAYPGH
                     GLDQSGMPGLTHGDANAFDAAAHDVSAYGDASGVQNDQTRMAPPPPVANTASEQAKLT
                     SEQTGLVGARGKTGMTRTLSTSRRAEQNRNAQRVFRERKNKYISDLESKAASLESALL
                     AAEEHRRRFNEAIETIEILKRDNDTLRVALRALGGHQAVPSAPALPIDRPSHTPALLS
                     TFHHQHAGAPAPPARGTEHDDPAHAQGQPPTIHESTDHAAQDPATAAAVAAAASGGAP
                     YWLLEAVSNANQQHGFHVPNHFSSQLADSGMAAGPHAHMHPNDPNAMRARGAIQPQRA
                     EGMLDPSLEHATLGEASRAPGRVQGEENKGEGIDAAGNPDNLASLSAVAAAAAAAAAS
                     QKVNT"
     gene            <29299..>30732
                     /locus_tag="MRET_1635"
                     /note="MRES_06565"
                     /db_xref="GeneID:38738401"
     mRNA            <29299..>30732
                     /locus_tag="MRET_1635"
                     /product="protein SSH4"
                     /transcript_id="XM_027628262.1"
                     /db_xref="GeneID:38738401"
     CDS             29299..30732
                     /locus_tag="MRET_1635"
                     /codon_start=1
                     /product="protein SSH4"
                     /protein_id="XP_027484656.1"
                     /db_xref="GeneID:38738401"
                     /translation="MPALQHMSQRQETIPSGGDSITALILLLLPLLIISVALIFVLIA
                     PFIIYLVLRFRPGVTLSERDGPINVQYEEQLEFSSSFQRACQNWADQLDDNTRAGYEL
                     AQRWCANHPPLSPRDTDITMPQFLGIQEKGVSAWSFDPAYESNQGVMVSARTELQFFA
                     DSPGMATEEGGACTIQSNLPLPKSNDIYYWESKIFSKPEATTIAIGLSTKPYPSFRFP
                     GYCKHSVAIFSQDGFKCYNHPLNAQSYGAPFVKGDVVGVGFRPRTGSVFFTRNGVRMA
                     EAFTGLQSYNLFPTISADGAAEVHVNFGQAGFVFIEANVKKWGLAPMIGTLAPPPAYG
                     QDKDSVLIEACNVPGTSTQLASDTRSGQVLRVPPYEVARSIAQAPDMHRDVSSQGIRM
                     NTLKQDDEESASSHPPPYMDAMIASSPTSLTNQAQNDHNNANVSLHRGAIHSFQSWMA
                     SWRKARRDTSSGTPETPSTELVGVTID"
     gene            <30800..>32359
                     /locus_tag="MRET_1636"
                     /note="MRES_06570"
                     /db_xref="GeneID:38738402"
     mRNA            <30800..>32359
                     /locus_tag="MRET_1636"
                     /product="serine/threonine-protein kinase 24/25/MST4"
                     /transcript_id="XM_027628263.1"
                     /db_xref="GeneID:38738402"
     CDS             30800..32359
                     /locus_tag="MRET_1636"
                     /codon_start=1
                     /product="serine/threonine-protein kinase 24/25/MST4"
                     /protein_id="XP_027484638.1"
                     /db_xref="GeneID:38738402"
                     /translation="MTDRPVLSPDENDERISDRIPFPLMNKSNPWDEYSIVRKLGRGS
                     FGHVYEAVHKPTRHVVAVKQIALESSDSDNESHMQDLEEIQREIASLAQCQDCDRVTR
                     YFGSFVKKYTLWVIMELMDGGSCLSLLKRAGPLPDEVTAVIAREIVLGLCYLHAQGIM
                     HRDIKAANILLTRTGQVKLADFGVAAQLIHRESQRNTLVGSPYWMAPEVIRQSMYDGR
                     ADIWSLGITIMELATGRPPLSEYHPMRAMFLIPKATPPRLDTSNHHPGLVRFLDRCLV
                     LKPHDRATAHQLQADPWIEGAGSTELVRNIIDKRGVPKQADTSVSLHDSSLLDTSILS
                     EWDFNMSASDALGLDPERGVTEEAPAPSTAATVPSHTDSPPWPITPTMSPTREPHTPS
                     NPHHHHGMPRNRMMESPTRSATNRTPHLPVPDTPARIQLALEQLAYLAGQDVSELAPV
                     ALVHQLHGLLSQLGRYTPEYLDMLVDILMDPTARGGDAPRIPAARSRLASLLFERWHE
                     ALRSRWDVLDT"
     gene            complement(<32401..>33864)
                     /locus_tag="MRET_1637"
                     /note="MRES_06575"
                     /db_xref="GeneID:38738403"
     mRNA            complement(<32401..>33864)
                     /locus_tag="MRET_1637"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628264.1"
                     /db_xref="GeneID:38738403"
     CDS             complement(32401..33864)
                     /locus_tag="MRET_1637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484659.1"
                     /db_xref="GeneID:38738403"
                     /translation="MARLRVSGGGSRGAPKDDARAIKTHLFEKLGTHAEEYWQLLGAL
                     CTASIDRAEFHHRVKKWMTPACVPLHNALVLSILAQACSKSATSAFSAGARSLTSPIE
                     PRTALLDEADEAADAMEPSVYGHDGRGLKRLRHMYAGLTEEERTRLDSLAKQNTSSAH
                     TSASIWAGAGAELLEKKRKEDEKRRAVEDRRRTREVKTAIGASHWRLSAMQTAAQTET
                     LRSRLSTTMQETLIRSVSTPYCTESHSLPDVHSLQDRMSLAAIESGLSGGVHAQAAAV
                     ALSALQDYLQNILRRIFMHTRARQKNTARPSRITIPDVMAVLDLAPHLIVEPLGQGPL
                     ECLLAPESAHVPSSSVDAKGVSWAEEDAVAHFARSCATSKLAEHTVPLAVPANADFEQ
                     AQLFRQQQQRDAVRNQVIIDQLAPLRLLDRRTLSESLAPKSKDKPPFTTPLSTALEQH
                     YLAGQHHHHQHLHRMHRHKDELFDVIDPVALFHNKCE"
     gene            complement(<33976..>37023)
                     /locus_tag="MRET_1638"
                     /note="MRES_06580"
                     /db_xref="GeneID:38738404"
     mRNA            complement(<33976..>37023)
                     /locus_tag="MRET_1638"
                     /product="scaffold protein involved in the formation of
                     early endocytic sites"
                     /transcript_id="XM_027628265.1"
                     /db_xref="GeneID:38738404"
     CDS             complement(33976..37023)
                     /locus_tag="MRET_1638"
                     /codon_start=1
                     /product="scaffold protein involved in the formation of
                     early endocytic sites"
                     /protein_id="XP_027484310.1"
                     /db_xref="GeneID:38738404"
                     /translation="MSNMVASALNLTPAERQSFAQLYSMADSTNAGVVTGDAAVKFFE
                     GFKLPTLTLGQIWSIADSGNNGFLTFNSFAVAMRLTARAQRGESVNEQAVHIPGEPPV
                     HENVLMPSNAIDSSPVSLISPEDKARFMRIFAMVGPTNGVLNGDQVKDVFLKSKLPYS
                     KLGEIWNLADTKQRGVLDLTDFIIGMHYIQGTMNGTITTLPTVLPNGMYESASDHSSV
                     PSTPLQPQRTGTDQHIMPSPVPASALAPPSASMPAAAPPRASTLSSGPAPERSTTMPA
                     TALSSSGPLSDGWAITPADKTRYDGFFDSLDTERAGYVDGSVVVPFFLQSGLDESTLA
                     HVWDLTDMNQSGTLTRDEFAVAMHLINDRISGKELPQELPASLVPPSMRSQTGTKQTE
                     TQRDLFSLLDTDVPSSRLDVGSPFDDAAVAAAPAPSNTKTPELPKTSSVNPDAAAAGA
                     GLATVASANAGTSAVTDGLGGKPREVPQAFDDDFDAPLSALSRDTKAEETSKALESSN
                     KDLEDVKARRAAAESTLSSHSTTIGELEAQLARARNAFASEQMALKEVEDKVQVQNAE
                     ITSLRQDVIREESELSAIRTQRDELEQKLLQDRESAHELRRQLAELETETSRLRESHG
                     VLEQQQRKEADAAAALNKQLSSARDEHESLSRSMSPNAGAPPTTRARNPFEALYNEGD
                     HAYTEEPVRFDSQYGFDAFTAAGAGVAAGATLGGTASQGKEAVPATEENEHEKGPEAP
                     DAMRHDTAPDTNIPREDVDDMDVPGGFPSQAHTEPSAHATSAVSSAPGKPVQVIDLPA
                     PEPHSPNTSGTAAMPSNDVMKSSIPPSSASTVTLPASSEPQTPSLQTSQQKDDFELAF
                     SHMSFANVVQHQTEPAASGVAPASLGKNLGVSSRSPVTGGVPAYLQQSTKLTAGAAQQ
                     PMSGGVPVLAPTAGATPQSTAAPVSTPQDAFEDNFSPNKPLSPPQPTQARAPTPPVPG
                     DIGPVRQLCQMGFSRSQVVKALERSNYRTERALERLLSQQQAP"
     gene            complement(<37182..>38885)
                     /locus_tag="MRET_1639"
                     /db_xref="GeneID:38738405"
     mRNA            complement(join(<37182..37311,37348..>38885))
                     /locus_tag="MRET_1639"
                     /product="oxidoreductase"
                     /transcript_id="XM_027628266.1"
                     /db_xref="GeneID:38738405"
     CDS             complement(join(37182..37311,37348..38885))
                     /locus_tag="MRET_1639"
                     /codon_start=1
                     /product="oxidoreductase"
                     /protein_id="XP_027484309.1"
                     /db_xref="GeneID:38738405"
                     /translation="MSDQRKERIFVGLACDMPVGSITEVPLDGALDPPVNALVANVHG
                     TYYATTSKCTHYGLALSKGILTSEGRLYCPFHGACFKVTTGDIEDAPALEPLKTFEVQ
                     RDNDDKVYILVDYEALKRSPWESCKKETHENKSGLHTVFVGGGAVTLHAVQEMRRNGY
                     KGSITVLTAEPYPTIDRTKLSKAYAPELKHALVRDEFFWRETLNVDLRLSSYVYDIDT
                     KMKRLSIRGGNTILYDNLVLATGSVPRRLPIEGANAKGVYVLRTHSDAKALTESLRKH
                     PSPQLVIIGTGFIGLEMGIALAKHAKVTLLGQTHVPLEGPLGRSVGGGLQTAIMNERP
                     LRFLNAVDLVRIETDMNNSVRGVTVQPRARGSPELFLAADVVLMSTGAKPATDFLRNS
                     PSFPALRPDGSVEVDAALRVVGLQNVFAGGDIAAYPWDNGVVRIEHWNVACNHGRDIG
                     RTIASGRLHPHRHIPVFWSGLTSPLRYAGVSLGYNQMHVDGEPDEAEFIAYYAKDDRV
                     IGVATMWRDPMMVQALSLMKAGKMPRLSDIVAGLDIMTLTTTPTRKM"
     gene            complement(<39033..>39942)
                     /locus_tag="MRET_1640"
                     /db_xref="GeneID:38738406"
     mRNA            complement(join(<39033..39106,39134..39362,39400..>39942))
                     /locus_tag="MRET_1640"
                     /product="20S proteasome subunit beta 2"
                     /transcript_id="XM_027628267.1"
                     /db_xref="GeneID:38738406"
     CDS             complement(join(39033..39106,39134..39362,39400..39942))
                     /locus_tag="MRET_1640"
                     /codon_start=1
                     /product="20S proteasome subunit beta 2"
                     /protein_id="XP_027484359.1"
                     /db_xref="GeneID:38738406"
                     /translation="MSEHRGSGFDFSGHLRNHALGTQGHSIPRATSTGTTIVGLIYKD
                     GVVLGADTRATEGPIVADKNCEKIHYITDSIRCCGAGTAADTEFVTNMISSNMQLHAL
                     HTRKRPRVLAALTMLKQRLFQYQGYIGAALVLGGYDSTGPQLFTIAPHGSTDKLPYVT
                     MGSGSLAAMSVFESAWKPDMQEQEAIDLVVAAIESGIFNDLGSGSNVDVCVIREKETK
                     MLRNYRKPNERAQKEQSYKFARGTTAFTKEEIYNMIVKEDVLGLDNTTPDATATTEAM
                     DTDAS"
     gene            <40075..>44626
                     /locus_tag="MRET_1641"
                     /note="MRES_06585"
                     /db_xref="GeneID:38738407"
     mRNA            join(<40075..40173,40201..40263,40292..>44626)
                     /locus_tag="MRET_1641"
                     /product="SH3-binding, glutamic acid-rich protein"
                     /transcript_id="XM_027628268.1"
                     /db_xref="GeneID:38738407"
     CDS             join(40075..40173,40201..40263,40292..44626)
                     /locus_tag="MRET_1641"
                     /codon_start=1
                     /product="SH3-binding, glutamic acid-rich protein"
                     /protein_id="XP_027484360.1"
                     /db_xref="GeneID:38738407"
                     /translation="MSADVELFSTSILGNPVTRSRHDRYVTVLKAFKIPFVCYDLASD
                     ECAKKRWRSKSKNPQIPGILVQNEWRGTYDEFEEAVELGDLDAFLRIDPNVRSASSVP
                     SQPKISLQSDTRDGKSGSTQIPTYTTSANERRVLQDDDDVLSFLPQGTTVTDAEVDAL
                     LKELEKPLPRTTKRSYFPSSRARNDPLPLPTMPKDRPQAPGEPAKYDPDAMLSRNLVS
                     EAAKAIGVSPTPRKFAPRMRLNKRSTEEIMKERRARLEKTENDRKNDELFDTLGLSNM
                     KISDEEAEAFLTKGIIPSPQKQTRSSHGGNANDHFGGDESLQDKNTHAFVQNKNVSAA
                     LEDPALKEPLAVEQGIDGSTFGLNTEPETLEESKLLSPDINKFEEAQIESNARGSGQE
                     TSHEDGSQAAAKSKMELVEEKDNKLDSRETLTDDHEFAPIEATIPNNSPKEAQPREEA
                     KSQLVEELEALNEANMRDSSFVSEVSLCDKKDNMDVSSKNEVPANSCENDTLDAEQTM
                     SVPFLDGSSSPETDSTKLNQSASMSDENRKDPGSLSPYIKEESADLVPESNLHDDTEL
                     SGSTKEAALFAEDANEQEYHNDEKCHSESEKNVAFETKKDEPADTLNRFNEPKASNQD
                     NSLNRVHPETNVSQESENLEFIKSESSDQEDKGTLISEVQTELNQPEDETRISDARPT
                     NADPFAENGAMETSLHTKEPGCANDNATSPTRELHKALSNEATTETCSETDPQRLDEN
                     PKCTVSNLQSVDFASKEPTRESENFGRTVQEQTELRDVELTKTMRSENAEKKASLDDK
                     MHDVQASDALGKEPLETAALNASHSPIPDVSYESDVTICHERDEILHANAQQVHSVDS
                     CLNSSSRRNGSCTPIHADDNFSGRHAFSSSQDAISSVPDLSTSEEYIPSTMEHGSNPS
                     NIVTPAKGSLSPSKDASSTLENVLNSSQEASSSQDILLATEALSTEDSLPMEAGMASK
                     LSNFVAEGDQHGTENASCSIFKKSTLEASPSSMNSLPIQNNHIMQDEERLNEDISNAR
                     PTDTALEHVNNDDIKTKHSVSSDKSMHLASATVPSLVAGKKNLDEQKADVTASTPTTM
                     DLPRDHPDFHVNDGDPSMDRPSKNLQELSATDTESLKEIDPSMKSQPPHASDELSYKE
                     FSKEEKTDTLSQMKGLSSDTAERSSSVQQSSASNPATPRESPLDVRPQRPTKASPVSP
                     VANLDNDKDTRSPLFDEDGNTTMLIHTAGADEKDSDESKEILSKEDAKDAMNQSEPSA
                     TLPSNDEHTPDAARVSGLHTIPDQDADACNSQVSTELIQPCRRNASGSIGETSHGSDS
                     EYESEGDVPDLWIASARFPPTQDFSRQDTSLEQSKKRNDSSVEDVSIAPVLDSSTPTD
                     PICDADFSVRPASNEQDLSSTSNNLAASITDPHSLLPENSTPEENDIRSTSVVTTLSA
                     DRKSPSLPRCPQDDRDVARRTVSEAPRYVDNIKSTSKDKNDSPRRTLSDIMHEADQIL
                     QEWK"
     gene            complement(<44632..>46155)
                     /locus_tag="MRET_1642"
                     /note="MRES_06590"
                     /db_xref="GeneID:38738408"
     mRNA            complement(<44632..>46155)
                     /locus_tag="MRET_1642"
                     /product="splicing factor 3B subunit 2"
                     /transcript_id="XM_027628269.1"
                     /db_xref="GeneID:38738408"
     CDS             complement(44632..46155)
                     /locus_tag="MRET_1642"
                     /codon_start=1
                     /product="splicing factor 3B subunit 2"
                     /protein_id="XP_027484361.1"
                     /db_xref="GeneID:38738408"
                     /translation="MASSAAAPPVINAVLTKNAKRRAKKKLQRSQSEIPQKSSVSKES
                     YESSPQARVEDEAALPSYIEAPPDPVAAPLPDMDDEMFASFSSVLERFQPQETDAPNP
                     KGQVLYSDDDMYSDDEQPRLPQSTMSRKKLRELQRMSVAELKQLVHHPEAVEWADVAS
                     PDPRLLIHLKSYRNAVPVPSHWGHKREYLSHRRGTEKPPYELPSYIAETGIATLRNAV
                     TSAEANKTLKAKTRERVQPKMARMDIDYQRLHDAFFRFQTKPPMTQYGETYFEGRDGG
                     SRARHRRPGDLSEALREALSIPPLAPLPWLIAMQRHGPPPSYPHMRIPGLNAPIPEGA
                     QWGFHPGGWGRPPIDEKGQPIYGDVFGENKQEHQDLFELDIPQRELWGEIAVDEEDYD
                     EDSDEDEEQDENEEGTDEDMDEDEDEDEPAVTEADHFVPTSGLETPSGIQSVLAGLET
                     PAHIELRKSVPTPSQPNGPPPSLYQILPEREAGAQGHGFMGSDHVYDMNASRPHNST"
     gene            <46381..>49422
                     /locus_tag="MRET_1643"
                     /note="MRES_06595"
                     /db_xref="GeneID:38738409"
     mRNA            <46381..>49422
                     /locus_tag="MRET_1643"
                     /product="translation initiation factor 3 subunit A"
                     /transcript_id="XM_027628270.1"
                     /db_xref="GeneID:38738409"
     CDS             46381..49422
                     /locus_tag="MRET_1643"
                     /codon_start=1
                     /product="translation initiation factor 3 subunit A"
                     /protein_id="XP_027484362.1"
                     /db_xref="GeneID:38738409"
                     /translation="MPPVVKPEAVLKRSEELINVGQASSALQALQEFTFSRRFKQGPS
                     SSMEPLMDRFMELCVDQRRGRAAKDALMQYKNAFQNTDPQSICNVTRHFLEHADSKVA
                     EARSRADAAAEELDVDDLEESETPESILLGSVSQDQDRDRTDRTLVTPWLKFLWEAYR
                     TALDILKNNTRLEMAYQQIADQALHFCLQHQRKTEFRRLCEVLRQHLQSVARSAHHTN
                     AIDFSDADTLQRHLDTRFTQLNSAVELELWQEAFRSVEDVHNLLMLAKKAPKPAMMAN
                     YYEKLSRIFIVSDNHLFHAAAWNRYYALARMTAHSDKENARMASFVLLSALAVPVITS
                     SAPGSGNMSKGRTDFLQADSETRQRTGRLNALLGLNKTPTRAGLLREALNRNVLRHVR
                     PELRELYHMLEVQFHPLSICAKIEPILSQIAQDPDMANYVKPLHSVVLTRLFQQLSQV
                     YDSVKLDQVMQLVSAFKEPYSYTPMDIEMFCLHACKRGHVSLRIDHMSRAITFQDDVF
                     AADVHPALSNAGETDSVRLQSMPSELVRTQLARLAESLDRTLRVVDREGLAKEHAARE
                     QAMQRAIATAEEEHQATLKRKSMIERRKELLRDMMRRKEEEEAQLRSDRLRQHAEAEQ
                     RRFAEEARRRELDHVRKEMEAAKLEEARKMAQSLKERGGLKLSEEEFASLDTEKLVKL
                     QVEQIEKEKKDLNERLRTIQRRMDHIERAYRHEERPLLAADYERQMSADRENHKLAHE
                     ARVAAARERYQTDLAMKATLSSVMPDYSMLRSKVLEKRRAEYEKRRAEAQKLIEHEKE
                     RRRAQVIEERQEASRRAAEQEELARQREQEEKARLERQRADAEREAQLEAQKRAEIEE
                     RQSLLRRQTDMHSSQEARTYGRLPPESAAPPTSRAETADTWRRGPPASSTGSVDPLFA
                     NRRYRPGDLARSRAAAGGAQPSQPPPSQAPSAFSRTGGAGGMGGGSGRYVPGAFSRMR
                     QGAGGAAQSAPPPARNAGQNDTDGFTTVKPRTGAYRPPGAR"
     gene            <49851..>51272
                     /locus_tag="MRET_1644"
                     /db_xref="GeneID:38738410"
     mRNA            <49851..>51272
                     /locus_tag="MRET_1644"
                     /product="solute carrier family 41"
                     /transcript_id="XM_027628271.1"
                     /db_xref="GeneID:38738410"
     CDS             49851..51272
                     /locus_tag="MRET_1644"
                     /codon_start=1
                     /product="solute carrier family 41"
                     /protein_id="XP_027484363.1"
                     /db_xref="GeneID:38738410"
                     /translation="MPWRKAWGLTRETLPVMLCALAGLLLSGMELDHMTTWKTFSKVD
                     KFLILVPIMLNLKGNLEMNLSLRMATAANIGEIDNCRTRQLIVSGNMWLLQVQALIVA
                     SVAGILSFGLGAKESHGDQPDLTMRGPVHSGKPILDKTARLRDGYFEFALVLAVSQLA
                     ASMSSAVQGSFICALVVWARKSGFDPDNMVIPIAGSLGDLCTLTLLGLIGAGLLYFEG
                     TGIATLLFLGLITLCVVFMLATLRNVYVRELLACGWAPLFVATGLSSLAGVILEKNAS
                     QYPGYPLLAPIVAGMPSIAAAVHTSRLTSSLHAHTFRANTRPAHPSYMPLQEQVIEDS
                     TSPPQRLDPASPFHLVWWKQFGSQLVDSLQPQIDEWTTPITIILNVVLIQAIFMLILR
                     GIGSLQFGVMFYMCVIVLVSILSVFALFFAHTLCLFLWYWDYDPDTTCMPFTTAIVDV
                     CAQLILLLAYKMAQTLGDRIIAL"
     gene            complement(<51259..>52983)
                     /locus_tag="MRET_1645"
                     /db_xref="GeneID:38738411"
     mRNA            complement(<51259..>52983)
                     /locus_tag="MRET_1645"
                     /product="mitochondrial chaperone BCS1"
                     /transcript_id="XM_027628272.1"
                     /db_xref="GeneID:38738411"
     CDS             complement(51259..52983)
                     /locus_tag="MRET_1645"
                     /codon_start=1
                     /product="mitochondrial chaperone BCS1"
                     /protein_id="XP_027484364.1"
                     /db_xref="GeneID:38738411"
                     /translation="MSMALSSLASQAQPTSHSPDVPDTFLGSILHGNPIFSAGFGLMV
                     MGGALAYGRSALRWGASAAQRRMLVSLEIPSKDRAHPWFLHWMGAQAAAQALRRKANH
                     GHLPRESILEFLGLTRPRVYSDENTNNPLRAATGEVVSPVRIVSRELAVDTQYDETTT
                     PGVPGGSDRGQATFSLVPGPGTHWFRYKGVWMRLQRERNGKLVDLSTGAPWETVTLTT
                     LSSYEHLFSQLLLEARQLALSSTYGKTIIYTSWGVEWRPFGHPRRVRELGSVVLPEGK
                     KEEIVNDVHRFLSRGTWYAKRGIPYRRGYLLHGAPGSGKTSFITALAGSLDFNICLLN
                     LAERGMTDDKLNYLMSNAPERSILLLEDIDAAFLGRGPHSPERHADGYQPNVTFSGLL
                     NALDGVASGESRIIFMTTNHLERLDPALIRPGRVDMICELGDADAKQVRELLTHFYQS
                     DLVDMRVDAIRRANGINPEEMTRAMQPPDMSAPYYQKAIREAAQELSVVADTLVTYVD
                     EVTKRRRHALGLDASGYDPGSNRTLDRRAARGGVSMAELQGLFIRYPDDPHVAVDAWA
                     VEQGLKEL"
     gene            complement(<53049..>59588)
                     /locus_tag="MRET_1646"
                     /note="MRES_06600"
                     /db_xref="GeneID:38738412"
     mRNA            complement(<53049..>59588)
                     /locus_tag="MRET_1646"
                     /product="voltage-dependent calcium channel"
                     /transcript_id="XM_027628273.1"
                     /db_xref="GeneID:38738412"
     CDS             complement(53049..59588)
                     /locus_tag="MRET_1646"
                     /codon_start=1
                     /product="voltage-dependent calcium channel"
                     /protein_id="XP_027484714.1"
                     /db_xref="GeneID:38738412"
                     /translation="MPGFPISPGRPADLGISLGTDDRHVGPDRPGSGLSHTESVDVTQ
                     PRAWANTSTDSLNMYHFPPDGDYFENASHNTEGQDTFVGNDARAWASTSTLPLDDDKS
                     SLDIGLGDVFDTFHLSRSEINSESARISEGPNRWREYLPIEGLGESPPVNELPNGDEE
                     NMPSEKPKALKFVDMLQKVKESSKITLNQARKRRERRRERVDNNDDWLPMREPSNMSD
                     DKEPSLSPLPVHMCLRGKSLTIFGPRHPWRVYLAKILSSWWIEPLLLLLIFINVVVLI
                     VSSSRDIRFETRTRNVFSRAEEILLLVVFIAYTIEMIARIIVSGLVINPPSLDENVMR
                     EGGPEEELEYSNTYDVLYNMYLDALQSAHRFLHPYSKVERERAEAKLASIHPAEGMAP
                     LDDMFISKVENGLDLNNGHQRWWDVLYYNIVSICLHLSRTITTDPKQLCNHAYLRQSW
                     NRVDALAILCYWVAVGLEISGVEVTEKHHIFVFRALSVLRCARLLGLWEGTETILRSL
                     KRVAPLLLRVLCFLVFAMVLFAVIGIQSFHGSYLRRCVWLGDYNNSPGVNYTLSQICG
                     GSVDPNDRSKTISHLNDHGAYDPARKPNGFICPYGQVCMEQDMNPFNNVQSFDDVFHS
                     LLQVAVIVSLNGWSDTMYDMVDADYYTAIIFFIIGIILLNFWLANLFVAVISHSFASL
                     SAQTERSAFAARDFRQEQEGVQEASQEPRRRRNRLFTWYKRIRKYTQYIWLSLIIVGL
                     AVQGSKASYEFEDQKKWREDVERYLVIPFDLEILVRFIFESMEGGPGQFFQGKRNVLD
                     LFLAIITTIIQIPVVNNSSWYPWLTFFQLLRFYRVIAAIPRMKSLLLRVVGSMSALFN
                     TIAFLVMTIFLAALMSVQLFRGDIEQSDDGTESDTFTWKQLFNGFLGVYQIFSSEGWK
                     DLMFNVISSTRQYKQGVIAGMFIVGWFLFANLILLQLFVAVINENFRVAEGDKYKKQM
                     ENYLRRTEPPQESLVARLMQRLSPFRVPHEHNTLSHRLEGPVLDDARQHADTSKANYV
                     EERPLRSMFMQLVTPDHAGLAFGTLRRVLRLDKPHEHARLEALRRQSSGGKQSQTMDE
                     LEDMINNQQDIRALGSEHVRIMRTDLGLVNQEEGQEFLKDYVTRNELDPRIRMARLMA
                     EHPSYDRSWFIFSNRNPIRRFCQSLTRTSHGERVFGRPMSKFRNHIFQAIVFGAIIGS
                     VVLAGIATPAYRKKYMAEHRSVFYAWYAVIEVSLSLIFVLEFFIKTIADGFIFTPNAY
                     LYNMWNLLDLFVLISLLINVISELIVPGGVSHFTRALKAFRALRLINVSSLMRDTFHA
                     VMIAGAGYILDASILALLYIIPYAVWGQNLFAGLMYSCTDTSDSIVTKLDCHGEYRSQ
                     PLNWSYLAPRAWTNPTEGSMYSFDDFKSALLILFEIVSLEGWIDVMQRAMSIRGRDMQ
                     PRADAAQHNAIFFLVYNLIGAVSVLTLFVSVIIENFQRYSGAAYLTTEQRQWLDMKRQ
                     LQRQGPSKRPRIPSSNPFIRWCFQVSTRKRGWWSRFMGLLYFIVLILLMTQSAHDTWT
                     TERGRAIAYVVLGFVFVCDIIIRLLGLGFTSFRRSYWNWYDVIIMGGVIGTSLSHVLM
                     PSASHAHAQLQKLFVTAITLKLIQRSDSLDLLFKTAVGSVPAIIALFLLWLTMFLVWG
                     IMLVEVFGLTKWGINESHAKNLSSLWQTLIFLSMTSTGEGWNQYMHDYAVQPPMCTPS
                     KNYLESDCGSIAWSYFLFISWNIISMFIFLNMFTGTVVENFSYVYHLQGSSALSRDQM
                     RIYKDIWSQFDPQGHGYISQQHIIPFLSRLTGMFEVRLYPSDLSVSSLLDHSRVSSPM
                     YKKSASTSSLRLGRRSPRSSRSPRSPRSPRSPRTPQSPRSPNLAHSDMLEPVNATDGM
                     ISFHDASSTEDVQSTSRIVSGIDLDALSEALDSANVQELRMRRQRLNRMYYEAILADK
                     GKGVSFSTMLFILAYYKMCGSPVNMEVSEFIERRELMNKIDSRINLERVRGLLRGVYL
                     RRRFLAVRAERERQSVMHLFSSDQSRGFPSITVERPISEAHQHDRQRPNIRVETNLSD
                     SSPLYGDALHMPSPRSPSGYVSSDDGDSGNASDVQVSPLSVAVPRRRLSFQNYDENPF
                     EDARSHNANISSSHLHAPLEMDTWTQIMHRLSTSTHDDSEDHMHHNT"
     gene            complement(<59755..>61180)
                     /locus_tag="MRET_1647"
                     /note="MRES_06605"
                     /db_xref="GeneID:38738413"
     mRNA            complement(join(<59755..60711,60738..60920,60959..>61180))
                     /locus_tag="MRET_1647"
                     /product="tubulin gamma"
                     /transcript_id="XM_027628274.1"
                     /db_xref="GeneID:38738413"
     CDS             complement(join(59755..60711,60738..60920,60959..61180))
                     /locus_tag="MRET_1647"
                     /codon_start=1
                     /product="tubulin gamma"
                     /protein_id="XP_027484365.1"
                     /db_xref="GeneID:38738413"
                     /translation="MPRELITIQTGQCGNQIGSQFWEQLCREHGISRDGTLEEFATEG
                     QAGDRKDVFFYQADDEHYIPRAILVDLEPRVINNIMTGPYKSLYNPENVYRNEAGGGA
                     GNNWAQGYAAGEKAADELIEMVDREADGSESLEGFFLLHSIAGGTGSGMGSFLLERLN
                     DAFPKKLIQTYSVFPNSEETSDVVVQPYNSVLTLKRLVNNADSVVVLDNAALSRIASD
                     RLHLQNPSYHQTNQLVSTVMSTSTTTLRYPGYMNNDLCGILASLIPSPRAHFLMTSYT
                     PFTSDNVDRGKATMKTTVLDVMRRLLQPKNRMVSITGASKTSCYMSVLNIIQGDVDPR
                     DVHKSLLRIRERHLASFVPWGPASIQVALSRRSPYVASSHRVSGLMLANHTGIASMFK
                     RTADQYDRLRKRNAFLDMYKREAMFSSDLSEFDEARETVTELMSEYRAAEKDDYITGA
                     AVP"
     gene            <61416..>62354
                     /locus_tag="MRET_1648"
                     /note="MRES_06610"
                     /db_xref="GeneID:38738414"
     mRNA            <61416..>62354
                     /locus_tag="MRET_1648"
                     /product="rRNA 2'-O-methyltransferase fibrillarin"
                     /transcript_id="XM_027628275.1"
                     /db_xref="GeneID:38738414"
     CDS             61416..62354
                     /locus_tag="MRET_1648"
                     /codon_start=1
                     /product="rRNA 2'-O-methyltransferase fibrillarin"
                     /protein_id="XP_027484260.1"
                     /db_xref="GeneID:38738414"
                     /translation="MAFGARGGRGGAPGRGRGGPPGRGGMRGGARGGRGGARGGGRGG
                     GRGGRGGARGGRGGAKGGRGGAKGGSNVIVKPHRHEGVFVAEGKEHLLVTKNLVPGES
                     VYGEKRIAVETPGSGEDGTAITNKTEYRVWNPFRSKLAAGILGGLDNIHIKPGVKVLY
                     LGAASGTSVSHVADVVGPEGIVYAVEFSHRSGRDLINMAKKRTNVIPIIEDARHPAKY
                     RMLVGSVDTIFADVAQPDQARIVAFNAEYFLKNGGHAVISIKASCIDSTAQPEAVFAE
                     EVNKLKKSSFRPREQLTLEPYERDHAMLVAQYQRHK"
     gene            complement(62514..62611)
                     /locus_tag="MRET_t0024"
                     /db_xref="GeneID:38741218"
     tRNA            complement(62514..62611)
                     /locus_tag="MRET_t0024"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:38741218"
     gene            complement(<62801..>63817)
                     /locus_tag="MRET_1649"
                     /note="MRES_06615"
                     /db_xref="GeneID:38738415"
     mRNA            complement(<62801..>63817)
                     /locus_tag="MRET_1649"
                     /product="cytochrome-b5 reductase"
                     /transcript_id="XM_027628276.1"
                     /db_xref="GeneID:38738415"
     CDS             complement(62801..63817)
                     /locus_tag="MRET_1649"
                     /codon_start=1
                     /product="cytochrome-b5 reductase"
                     /protein_id="XP_027484261.1"
                     /db_xref="GeneID:38738415"
                     /translation="MFRAAARTTNLARTSLRQSLFSAKQVRNYSVRHNAQQASSNMGL
                     YLSLGGLAGIATWYGMGGFNGDIRSKLQKINADSEDVALSNEEFRALKLKEVRPYNHD
                     SAFYVFELPDNKRSGMFTASALVIRGAGDDPKNKEGKPVIRPYTPVNPPSDKGEIVLL
                     IKHYPGGQMTQYLKGLKAGDEMCFKGPIPKHPYKSNQFEEIGMIAAGTGITPMWQLIQ
                     EIAANPSDKTKVTLLYGNKTEADILLREKFDELSKDSRFNIVYFLDENAKSVKSEKGY
                     ITKDHVKKYLPDAEKGGKAKIFVCGPPPMVGAIAGPKQGFQQGELKGVLSELGYKAEQ
                     VFKF"
     gene            <63963..>65798
                     /locus_tag="MRET_1650"
                     /note="MRES_06620"
                     /db_xref="GeneID:38738416"
     mRNA            <63963..>65798
                     /locus_tag="MRET_1650"
                     /product="putative ATPase of the ABC class"
                     /transcript_id="XM_027628277.1"
                     /db_xref="GeneID:38738416"
     CDS             63963..65798
                     /locus_tag="MRET_1650"
                     /codon_start=1
                     /product="putative ATPase of the ABC class"
                     /protein_id="XP_027484791.1"
                     /db_xref="GeneID:38738416"
                     /translation="MSSRGGRGRGGYYRELYGSRGRGSKSNGTFAKNSDVYSQKKTRT
                     VRGTSEDLARSLHNLHMRPYPAYHDIEGMWAFPAFTFYLDHAQADPYAAPSKARVRIS
                     HENAGFPSSVLEPRIRRTALADYILRRLHRVCQERKYDQKLKGGGWAGAKGGQLEVDA
                     PGQHVLERTAVIVDKDGIEMRFLVGLPAQGRSILGHLAAAVICEHVPEMVECGLLYAS
                     YDTRALERHVLVIEDQHVLRTKLKDHGLVAFVPNGAKLARASGDSDLPMTSCVPFQSP
                     PSVQVSIDIPNRGSIQGMGLKRGSLNVCIGGGFHGKSTFLSAMALGSYNFVPDDGREF
                     VCTCEDVASVRSEDGRSVGKVDISPFISNLPNAADTTMFSTTNASGSTSCAASLMESL
                     ELGADLLVLDEDTTASNFLVRDYAMQLLVPNEPITPLVTRARALVDTTGASILLVCGS
                     SSSFLYEADVVLQMDRYVMKDVTERAKQLCKSINVNSVPTSDSSSFPTLCKRTVGFPL
                     PQVRTTTQHRHLIQFGDHALDLSSTPQLVHKSQTRAIETLLRRWMSASPASLRTIVDQ
                     LYDDMEKSGLDALQERSADGFLARPRRLDIGVALNRLRSAVWYLE"
     gene            complement(<65839..>69321)
                     /locus_tag="MRET_1651"
                     /note="MRES_06625"
                     /db_xref="GeneID:38738417"
     mRNA            complement(<65839..>69321)
                     /locus_tag="MRET_1651"
                     /product="chitin synthase"
                     /transcript_id="XM_027628278.1"
                     /db_xref="GeneID:38738417"
     CDS             complement(65839..69321)
                     /locus_tag="MRET_1651"
                     /codon_start=1
                     /product="chitin synthase"
                     /protein_id="XP_027484790.1"
                     /db_xref="GeneID:38738417"
                     /translation="MLNQLNRRRDTAKSFIRRPSTVSEDETSVDVSSVAPPPLQSSTA
                     IYRGRSLYRPERGHARAPLLNPEGEPDDPFSVSHKPRWWRMWWHYLALICTFWAPAPL
                     LSLIGLHTAAVRQAWREKITLVLLSCSLGGIIAFITVGLQRTLCGDQAEGVFVNVKRA
                     SGYVGVLGEAYSTANSKFPEAFIYDQIREHSGLDVSQFFEFSEDAFPACKNINTTVAK
                     PLDCADADGKKIRCLDKLRVDNLESDLGLKKVNQHIGYDWEDLVNGTGKLLAIDGYVL
                     NFNAYLATYTKPIPNDPVDKVIRNFFSPSSNYTDMSDATRLFTIDKLARDAIPCLKQR
                     YQAGRVNYKTTGCFMADLILYISLIVILGLVFARTIMAVWYAFVGSRRLASTPPPPGK
                     FSATGMRRPRPKSHVAMPDGATHENSMGVAPWAQKGIVTPTPASSKNLPNNNVSLMTP
                     ASMTPEDIGNDPYIVCLVTCYSEGLDGISATLSSLSATEYPTNRKLIFVVADGMITGK
                     GESMSTPDVCVSLMTPDMRFGTPTPMKYRSVSSGKKAQNMALVYAGHYQDPSGGESVP
                     MVVVVKCGMPEEAAGQKAGNRGKRDSQMVLMSFFQHVTYNDPMSPLDYDLFRKIHALM
                     GVTPDFFEMVLMVDADTKVHPPALRYLANAMLNDHRIMGACGETRIQNKLQSWVTAIQ
                     VFEYFISHHQVKAFEAVFGGVTCLPGCFSMYRIKARKPGFDDWIPVIVKQDIIREYSQ
                     TIVTTLHQKNLLLLGEDRFLSTLMLRTFPHRRMVFVPHAVCHTEVPHTLRMLLSQRRR
                     WINSTVHNLMELLLVRDLCGTFCFSMQFVVLMDLIGTLVLPVAISLTYYLIIMSAKDP
                     PKDFTSAIPLMMLLVVLFLPGFIIAMVRFSPSHVIWLVIYLIFLPVWNFLLPAYSFWH
                     FDDFSWGETRRIEGETKSGAHETSEEGYHAALEVPMRLWTEWETSRIRKQERNARRRQ
                     EMEHQFGGGFHNDVDPRHDAGLRLADLDRPCSPMSQETSEDQWGDHIDGYDENAPLPD
                     LMHSARPLSMIAAQGGGTVQDDDLENILQGGWDDDGSISWEKRRPPPLISAANDSIVS
                     FQGESDPLAGLTPVRSSVDLGASLPSLAPFDDGFNSHEMTPAASSAVEERRTHVRNRS
                     SGPSRPLSKVRFFH"
     gene            <69710..>71170
                     /locus_tag="MRET_1652"
                     /db_xref="GeneID:38738418"
     mRNA            <69710..>71170
                     /locus_tag="MRET_1652"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628279.1"
                     /db_xref="GeneID:38738418"
     CDS             69710..71170
                     /locus_tag="MRET_1652"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484221.1"
                     /db_xref="GeneID:38738418"
                     /translation="MALPTPYCTKEPERPCSSNEIPYAGVVARDKLAHDVYQSVLRTR
                     RCDWIELMNCAPMASQYHLSAYSVLKFGVSGAPYAYLPLTLQQPRLAETVLERQRKNE
                     THAWRVKLHLNAGLGLKDSSNAIHLVDKLTDGTNERIYQDLQVAMADKSLAESQDSAC
                     VIKTSNSHPISLSPIIPVHLLPYISADVLSHLPPCFKMPETHDKSQDPVHISLKTTVR
                     REDLDVYLEKSLQDTEGYALGQIRGEHLVRMPRSVPLDSMLNENGAPLEQFSSHSPTS
                     EGPLIGNLLLSSCPGKKVRLDEPFQGRSPICRDLKIDLDRIRQMGVRAIVCCLDDEEL
                     NMLGAPCHEYREQAQSQGFDLICLPMAEGFAPINMTRLDMIMSMLILNYTLRGTSILV
                     HCRGGVGRAGLVACIWLLKMNLVSLGSEDTPKLCPCSNTSSQVLDTVLKLIDTVRKRR
                     SLRAIETAEQARFLMEYVRFIFGQERARFCLETAMP"
     gene            complement(<71207..>72508)
                     /locus_tag="MRET_1653"
                     /db_xref="GeneID:38738419"
     mRNA            complement(join(<71207..71260,71289..72387,72411..>72508))
                     /locus_tag="MRET_1653"
                     /product="solute carrier family 35, member F5"
                     /transcript_id="XM_027628280.1"
                     /db_xref="GeneID:38738419"
     CDS             complement(join(71207..71260,71289..72387,72411..72508))
                     /locus_tag="MRET_1653"
                     /codon_start=1
                     /product="solute carrier family 35, member F5"
                     /protein_id="XP_027484220.1"
                     /db_xref="GeneID:38738419"
                     /translation="MAPSTKEYAIGALLIILVDVLWTSSNYLANTVLTRGYDKPFALT
                     YLSTASFTVYLIPFCIIIQHRKQTVQPSTNSWWYKLGFRLPTPHDVSSRVGRSSNTDI
                     TPPKKLPRASSIDGRLPAVSIPIRTQRRSIQWNTETQALIENDPLSTDPGRLVSQAPV
                     LVDASELPSLSIFETACLAMEFSVIWFIANWTFVAALAFTSVASGTTLGSTSGLFTLI
                     LGSLCGIDTFSFWKLFAVVLSFTGVTLVTFVDHDKSNTPMSLSKPLWGDVLALVSALC
                     YAGYVTFLKLRIGSEDRISMPLFLGCVGAFNLVAFWPVGLLLHFAGIELLSWPNDGLT
                     MAGLFFNMCITVVSDFAYLVAILKSSPLLTTIGLSLTIPMAVCIDAIQNAMSLPLQSI
                     IGSILVLTSFGGIAWEENQANVNV"
     gene            <72663..>74492
                     /locus_tag="MRET_1654"
                     /note="MRES_06630"
                     /db_xref="GeneID:38738420"
     mRNA            <72663..>74492
                     /locus_tag="MRET_1654"
                     /product="chromatin structure-remodeling complex subunit
                     RSC1/2"
                     /transcript_id="XM_027628281.1"
                     /db_xref="GeneID:38738420"
     CDS             72663..74492
                     /locus_tag="MRET_1654"
                     /codon_start=1
                     /product="chromatin structure-remodeling complex subunit
                     RSC1/2"
                     /protein_id="XP_027484219.1"
                     /db_xref="GeneID:38738420"
                     /translation="MASESEQAWLELCIGSGEPTNVQTPLSAKSNDDVSDYGWLYCRA
                     KDLEHMHRMYAHILHFLRDVEVRNIHSDVSEEDGLRVLSDPLEECPDPAENPEYYDQI
                     LRPTCLQTITHRLVHCEYASPALFEQDMLQLFENARTWYGLGSEGYAEMVTLLRLYNQ
                     LTPSQGRLTDALGVRQTKSRMTDVEVVDMLRSKAVSRQCFASTEYGPGREPPKDVTAQ
                     DITLMEHVPYKGRFYHVGDWVHVMNPVDPARPIVGQIFRLYKQQKKPGVFFTACWYYR
                     PEQTWHIKSRRFFPNEVFQTGVYGEHALEDILEDVLVLWLPVYLRARPSAHYWRMDAP
                     LYVVESKYDVELHTFHKIEKWEYYVPSAVRSKATPMDIFSHPAEAPPKKPSALTNGHD
                     IPGGMLLDETDAGLERDEWPNLFEEAVPVSIPSFSAVSSESPVVPPPVAVSQADKLRA
                     YAVFHAAASDISRRVRPAAYSKLQRALEARPLATHAELAAMAIEVGGAVPPELITQLR
                     DAAIAAGVLSATPTASNTSAFERNLPTAAAVYAAHKQGADFEMLPPETRNLFRQDEQG
                     NVIWYAAPPVPGWHRTSAVLDGTTPLPLPSEAYLNFSSKYSRI"
     gene            complement(<74536..>75552)
                     /locus_tag="MRET_1655"
                     /note="MRES_06635"
                     /db_xref="GeneID:38738421"
     mRNA            complement(<74536..>75552)
                     /locus_tag="MRET_1655"
                     /product="casein kinase II subunit alpha"
                     /transcript_id="XM_027628282.1"
                     /db_xref="GeneID:38738421"
     CDS             complement(74536..75552)
                     /locus_tag="MRET_1655"
                     /codon_start=1
                     /product="casein kinase II subunit alpha"
                     /protein_id="XP_027484218.1"
                     /db_xref="GeneID:38738421"
                     /translation="MASMSVSRVYADANESRGREWWDYDNLALQWGTQDHFEILQKVG
                     RGKYSEVFEGVNMSTSTYDKCIIKVLKPVKKKKIKREIKILQNLMGGPNVVQLIDVVR
                     DPQSKTPSIITEYIDNTDFKVLYPTFSDYDVRYYIFELLKALDFCHSRGIMHRDVKPH
                     NVMIDHEKRKLRLIDWGLAEFYHPHTEYNVRVASRYFKGPELLVDFQEYDYSLDMWSL
                     GCMFASMIFRKEPFFHGHDNYDQLVKICKVLGTDDFQVYLDKYKIELDSHYDVILGRY
                     PRKPWSRFVTPENQHFVSDEAIDFLDKLLRYDHQERLTAQEAQNHPYFDPVRALLMEK
                     RPDM"
     gene            complement(<75739..>77058)
                     /locus_tag="MRET_1656"
                     /note="MRES_06640"
                     /db_xref="GeneID:38738422"
     mRNA            complement(<75739..>77058)
                     /locus_tag="MRET_1656"
                     /product="tryptophanyl-tRNA synthetase"
                     /transcript_id="XM_027628283.1"
                     /db_xref="GeneID:38738422"
     CDS             complement(75739..77058)
                     /locus_tag="MRET_1656"
                     /codon_start=1
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="XP_027484787.1"
                     /db_xref="GeneID:38738422"
                     /translation="MASLAPELEKASISTELSSANDAAVEQKVTPWDVEGGYVDGKQV
                     SIDYDKLIKDFGTKRIDDALLKRFETLTGHRPHPLLRRGSFFSHRELDMILTRYEQQK
                     PFYLYTGRGPSSASMHLGHLIPFLFTKWLQDVFDVPLVIQLTDDEKFLFKYDLKIDQV
                     QKFAFENARDIIACGFKLEKTFIFSDLNYVGGPFYHNVVRIARYITVNQAKGTFGFND
                     SDSVGKMHFVSIQAAPSFSNSFPQIFGSRSDVPCLIPCAIDQDPYFRQTRDVAVRLKY
                     PKPSLIHSKFFPALQGAQTKMSASKETSSIFMHDTPNQIKNKINKYAISGGQETLEEQ
                     RRLGGNPDVDVSFQYLTFFVDDDDEIEKIAVDYRAGRLLTGELKKRCIQELQRVVGEF
                     QERKSKVTDEMILQFMDGTRKIDSTPPVPHSAASSEPAPAECTPSAS"
     gene            <77203..>77522
                     /locus_tag="MRET_1657"
                     /note="MRES_06645"
                     /db_xref="GeneID:38738423"
     mRNA            join(<77203..77467,77497..>77522)
                     /locus_tag="MRET_1657"
                     /product="U6 snRNA-associated Sm-like protein LSm2"
                     /transcript_id="XM_027628284.1"
                     /db_xref="GeneID:38738423"
     CDS             join(77203..77467,77497..77522)
                     /locus_tag="MRET_1657"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm2"
                     /protein_id="XP_027484786.1"
                     /db_xref="GeneID:38738423"
                     /translation="MLMFSAFKTLTGQTVTVELKNDLAIQGTLKSVDQFLNFKLDDIK
                     VLDEARYPHMMAVKSTFIRGSVVRSVHIPAAAVDTQLLEDATRRESESQSKH"
     gene            complement(<77565..>79367)
                     /locus_tag="MRET_1658"
                     /note="MRES_06650"
                     /db_xref="GeneID:38738424"
     mRNA            complement(join(<77565..79127,79153..79263,79293..>79367))
                     /locus_tag="MRET_1658"
                     /product="avl9 protein"
                     /transcript_id="XM_027628285.1"
                     /db_xref="GeneID:38738424"
     CDS             complement(join(77565..79127,79153..79263,79293..79367))
                     /locus_tag="MRET_1658"
                     /codon_start=1
                     /product="avl9 protein"
                     /protein_id="XP_027484783.1"
                     /db_xref="GeneID:38738424"
                     /translation="MASAGQDNDANFDNSIILGVVVVDFNHLVGPQIEYAYPRELESN
                     EELGTQLPFMALPDGSHMSDEDYSYFHLLCRSLRPSTIFGISCNRQIQADDLINKGSD
                     VKRSMVQKAIVILAMQPIFGPLRTKLGMVTRAFFAQRDLNNVKLLEEFYETLESGVHR
                     SPAKDKSISSDEDGNTLYMGTSIRECVHKWRFRTLMLLKLILLQKRIMVYGYPVEHLC
                     TLQYSLVSLIPALLPHLQDAAAPELNTLSRDRVKAESLRMSDRDSLLAYMGLPLPLFS
                     HDAFFQPYCPLQQIDNLRCKTWLIGTTNQIFKHQKTSQPDVIVDLYKMQLSFLDPTLH
                     NLVSLTPADRKWMDDVINVVQSTWNSADPAQPVQMQYKGSDDYLRARFEEYVFGLLST
                     AKYCELHPSAGEASSLLSFGSDFVEAFRQTSVFQTWHQFTDETLCELIPGQHPCSGKT
                     TVLSDVAIRLQAGINDLNLEENLGPTRERIGAAWQAGSASLLRAAHTWRQDLGRMTAS
                     YSRNDTESGESTPKLSNALSAWQATSSQGAAALSQFGSYLSSKQREWYGSFTKSSDKN
                     DDSMAAENKESPQKHT"
     gene            <79512..>80112
                     /locus_tag="MRET_1659"
                     /db_xref="GeneID:38738425"
     mRNA            join(<79512..79681,79705..79777,79807..79956,
                     79984..>80112)
                     /locus_tag="MRET_1659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628286.1"
                     /db_xref="GeneID:38738425"
     CDS             join(79512..79681,79705..79777,79807..79956,79984..80112)
                     /locus_tag="MRET_1659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484777.1"
                     /db_xref="GeneID:38738425"
                     /translation="MVSLEYDTTSYSMEELNATRSFDEEEATTGKGSASVVALSTVAQ
                     TRGSGADTECSVRIPRVFNGYETCEFSTHFPEQWSNYVDSLTYVSMIVALNETLRQAA
                     NPVYGLIDNILAQLTFQLWPFLMGTYYTRSMKKFNLQIQDFERLILHPMGLVLIPLEE
                     TAYLYIDCVPHPR"
     gene            80221..80318
                     /locus_tag="MRET_t0025"
                     /db_xref="GeneID:38741219"
     tRNA            80221..80318
                     /locus_tag="MRET_t0025"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:38741219"
     gene            complement(<80478..>81276)
                     /locus_tag="MRET_1660"
                     /note="MRES_06655"
                     /db_xref="GeneID:38738426"
     mRNA            complement(join(<80478..80524,80568..80665,80712..80851,
                     80888..81154,81205..>81276))
                     /locus_tag="MRET_1660"
                     /product="DNA-directed RNA polymerases I, II, and III
                     subunit RPABC1"
                     /transcript_id="XM_027628287.1"
                     /db_xref="GeneID:38738426"
     CDS             complement(join(80478..80524,80568..80665,80712..80851,
                     80888..81154,81205..81276))
                     /locus_tag="MRET_1660"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases I, II, and III
                     subunit RPABC1"
                     /protein_id="XP_027484154.1"
                     /db_xref="GeneID:38738426"
                     /translation="MNDDREVARLWRINRTIHELVADRGYEVSEEELSVDLDTFKAEV
                     SSNGIVDRNRMNFFTQHKDKPEERLFVFYSMERNVGVKTMRQFINILEEKNITRGIII
                     WSDKMTSAAKKVIDAMRLQLVLEDFEEAFLLVNITHHQLVPKHEVLTPEEKTELLHRY
                     RLKESQLPRIQQSDPVARYFGLSRGQVVKITRPSETSGRYCSYRICM"
     gene            complement(<81546..>84851)
                     /locus_tag="MRET_1661"
                     /note="MRES_06660"
                     /db_xref="GeneID:38738427"
     mRNA            complement(<81546..>84851)
                     /locus_tag="MRET_1661"
                     /product="KH domain protein"
                     /transcript_id="XM_027628288.1"
                     /db_xref="GeneID:38738427"
     CDS             complement(81546..84851)
                     /locus_tag="MRET_1661"
                     /codon_start=1
                     /product="KH domain protein"
                     /protein_id="XP_027484155.1"
                     /db_xref="GeneID:38738427"
                     /translation="MMDMHFIAFSVPRDATSTSHKHTEASETSGSVLPPDARAVGSRP
                     GVAMPIPLSLAPGSQRPSASTSTPSVELTDTTSDPFGVSSALSTPSSSLGPRQAAYSS
                     AVHNACAHAMSIHGCVIHAASTVPPLNGDTDGVTSNSAVRIAPVSASPKSTQSPKAPL
                     SLGTSAASSDTLIQPSPTPILDPALPRFSISMCGTETQVNDARGLLIQTLPFTWRLEI
                     FLESSDIMQPGRDVVQPAIRSRLDQIMQESGTLLQIEPVDAASADGKPATDTQSQVSL
                     VISGGIEPIEYARVQVLIMLDELNNLYIDTIDMDSKTLHVNAGRKRSTIQSIERESGA
                     NIYIPSPFFGVLQSAVPPKVQERRHTVYVTGPPQAVSRAREMLQALSKKSRNQVKRQV
                     TLMPRKLDWLLLERLEALREVMLDNSTFLELPLIGSQRGQVTVHGTSRVDVERSIRIL
                     MQLVSPCYVASLWLLSSVLDSLGLSKGDTRAMATLLSSASAASGAEVCFQGNCVEIYG
                     TDAEVRSCLSFFLRQSAIKHYTSEVRFQLELATDHREFISGKKNGKINKIMEGCGVRI
                     RFEPFNDYNFLIEVHGREPEATLQGLGQLQEELPAEMSFYVPEAYHKRIIGVGGKNIQ
                     RIMKKFGVYVKFSNAEEFAALGGYIDNDDNVIARTPSKNAPNLENLKNSVMELVGPKD
                     KDFVTEVVSVPRKYHRILLSEKSEVLDDIGHRTRCSIRFARKESALDKVFVVGPESQT
                     VAAVQMLLQHVPLEADYFVSHSNELSKLLESPEYEALVERLQKEMNVSLSLAKSKNTL
                     AESSFSLRLNRSDMEMLPLAKNALEELCTKHHVMLHTTCSPIDDVPYSFIPPFSTSHL
                     SPPRAMADSNVDPTMPSSVGMRYDDAPPRPSASNKNLKALFEQSTMPPSMPFEGASAN
                     TPLVSPFYTPGYTDSSALSAQVWGAPIPSLQDMGGHASKSNVFGAFSPAPIPFSFSPT
                     ESMVKGPEMSRASVGAPFPSAQNHLLNPDGMSSSLSSGMDVNTFASHPLSRTSMGMLG
                     TDMDDGIDGFHPLSDPTPRSNLSMRSVPPSTSSMPRGSSMHMPRTSSSQGAANDTMDE
                     VSRVLAQIAFDKQ"
     gene            <85403..>88408
                     /locus_tag="MRET_1662"
                     /note="MRES_06665"
                     /db_xref="GeneID:38738428"
     mRNA            <85403..>88408
                     /locus_tag="MRET_1662"
                     /product="RhoGAP"
                     /transcript_id="XM_027628289.1"
                     /db_xref="GeneID:38738428"
     CDS             85403..88408
                     /locus_tag="MRET_1662"
                     /codon_start=1
                     /product="RhoGAP"
                     /protein_id="XP_027484152.1"
                     /db_xref="GeneID:38738428"
                     /translation="MTEGQVANRTKEMDDPIMAVLCETCQAEITDEEAADGVVHMAGA
                     YWHMECFTCITCGRPVPFEQDNVLLVGSQPMCGSCTFNCISCGSPITDEVVLCGQDPY
                     HTACFRCGACDKKMDTQSFSTVDGQVRCENCQDKSDALLAENKPPLVHAEVEQNKQAS
                     PFHIDSAYHQETPYEAPKNTTELASTDATASQTLGDSQKHERLSDAIQSEILQVYYSS
                     HNDGPTPPQEEIIQRKTTSNASVSSTVQDLWTRVHSVTESDILRSLSMHDSEFEALIS
                     TPEFAARRSSIFGPRSPYASGSISNSIKRSPVLDDNASSTSWSATHPEHAAALLDEIS
                     QLQMQRHMALAELLSVQSAQQQHQSSDDKSVQNRVNMVLTSLLAHLDTIKGEYRRELE
                     SLLLMQHSVRQELKPMMQVRNTLMQESQSLAERIDEMTEHLSLLESQKDSETMKDRMP
                     PHEEIMPDAASDAPESLEETRSNAPAISRELASGNASSLSSSHADQSEHVPPNTTLEK
                     ELPAQDQAEDAASSSVLVPRNDPVSPSNQPDMSISLEDTASLSSTGPSNIPSTVTTND
                     PVAVTPAPPTRAVPPVPKVEKVPSSSPVLIPSATVPRNESSSSFSSQGLPSSSHSSSD
                     RLDGIESTRSIPAPTPSIQAPTNNSSSPTTSLDRRDASLPPLPSPRKFRWIRPRIPNV
                     SDLNAFGETLLLPAHELTRPLRLSSSPGGMSNGSKMSHSFERPSEYKPAPTSPAAATS
                     PPEQMPSTSTSHSSATPTLAPPVSALFTLSLTQDGPPLPARSKSHVTYAPQEPNVSTS
                     LPPKVSMMGRPLCEQAELDGSSVPLVVRRCLEAIEVHGLSDEGLYRKSGSTQQQRHIV
                     QLFDNGASFDLCDEDQFNDISAITGVLKSYLRQLPEPLVPYSMHDKYIYIMETPDALS
                     IPAMRLLLEQLPKPHYDTLQRLCTHLKVVHDHSHQTRMSARNLAIVFGPTIMHAREPS
                     VELIETPIYARAVEFLIEHEAALFSNPHT"
     gene            complement(<88422..>89254)
                     /locus_tag="MRET_1663"
                     /db_xref="GeneID:38738429"
     mRNA            complement(join(<88422..89137,89164..>89254))
                     /locus_tag="MRET_1663"
                     /product="protein involved in microtubule-related
                     processes"
                     /transcript_id="XM_027628290.1"
                     /db_xref="GeneID:38738429"
     CDS             complement(join(88422..89137,89164..89254))
                     /locus_tag="MRET_1663"
                     /codon_start=1
                     /product="protein involved in microtubule-related
                     processes"
                     /protein_id="XP_027484153.1"
                     /db_xref="GeneID:38738429"
                     /translation="MTQELVDAWCRDIEQRRLVMEAHDAYKNWEQMMAVVCERSPVQI
                     LCLGIGSASVPAARDQWALLQDMRQHISKRCGTQPLVVVFDPQFDDMDVALVQRQQAQ
                     LPQENNCGAYQLSEPTLVYMPHCPKELYEALLRANWKKEALDHIILCGNELSLYSTDM
                     TAYPCLERIAPYTHAYPVPSLPASTAGALDASMQVFFSPWQDMPDSKPAQTWTYQPVR
                     RKARARRARSSLVREPMRMEEDAFWSLPQARLEYGPEVLTTPVMNTTKIV"
     gene            <89302..>90420
                     /locus_tag="MRET_1664"
                     /note="MRES_06670"
                     /db_xref="GeneID:38738430"
     mRNA            <89302..>90420
                     /locus_tag="MRET_1664"
                     /product="DUF6 domain protein"
                     /transcript_id="XM_027628291.1"
                     /db_xref="GeneID:38738430"
     CDS             89302..90420
                     /locus_tag="MRET_1664"
                     /codon_start=1
                     /product="DUF6 domain protein"
                     /protein_id="XP_027484464.1"
                     /db_xref="GeneID:38738430"
                     /translation="MWDRLPGGPASIAVFLCILVSYTTQTEAIQYIQHTLGYKKPLLL
                     LYVTHSSFMFLLPIHLALIHVCTSHSVPHCCAMLKRDTKKQLSLAFGSEKSSLAANIT
                     RLSCVLFILTVALTIPSVSWFLAVPLTSMANITSIYNTFSLWALVFSVYFLKEPCSYL
                     QVIAVLLGLVGVVLSAYGGATQPAIIAGLQGGRVISYALLGDVLALLGAISMAAYEIF
                     YKRLAMIPQDELRGSFQPLSSDELSEHAPQDEIEGELPFGLHPIMMMTGIGAMTLCLF
                     WIPLLFSHLFGIERIEWPTSGTTLLWILLSILCGTLFNGCFAILLSLWGPVLASMSCL
                     LTTVLVQLTDVLLGIPFSWISMVGNLIITVSFACLLPW"
     gene            complement(<90386..>92034)
                     /locus_tag="MRET_1665"
                     /note="MRES_06675"
                     /db_xref="GeneID:38738431"
     mRNA            complement(join(<90386..90458,90491..90582,90610..>92034))
                     /locus_tag="MRET_1665"
                     /product="tRNA (uracil-5-)-methyltransferase"
                     /transcript_id="XM_027628292.1"
                     /db_xref="GeneID:38738431"
     CDS             complement(join(90386..90458,90491..90582,90610..92034))
                     /locus_tag="MRET_1665"
                     /codon_start=1
                     /product="tRNA (uracil-5-)-methyltransferase"
                     /protein_id="XP_027484465.1"
                     /db_xref="GeneID:38738431"
                     /translation="MQRVSSTTLTAARVTMMQAKKAHSPPSPTDSLPSKKARTVALKR
                     DRKRVHNLQKAYQKQVLKHGDPPILFDILEMLGKPRVDEILARNEEFERVPPFGEEVV
                     VKIDRLSSHGDGLALTPQGDRLLVVPFALPGEVVRVYPYASDRFVFKSRIVEILERNA
                     SMRKESLVQCRYFGQCGGCQYQMIPYEQQLELKREVVRRAFMHYSKLDSSLVPEVLPT
                     MPSPERMHYRTKLTPHFDLPASLRRAYGKEVPAEPVDVAIGFDNPSTGRVMDIEECPI
                     GTPVLNEAMKRERQRVRESIRSFKNGATLLLRDSLKSFDSEESVAVTDHKATVYERVG
                     STKFSTPAGAFFQNNRSIIPLVMDYVRSQLPASDKPRYLVDTYCGSGLFALSLAPLFD
                     KVAGVEISASSIECANENARQNHIFNADFLAGEAENIFSKISFPRAQTTVVIDPPRRG
                     CDQAFIDQLVALRPRNIIYVSCNVHTQARDTGMLLRACPSYQIQSVRGFDFFPQTHHV
                     ESICVMQDTEFTTAGDTQSLQ"
     gene            <92135..>93846
                     /locus_tag="MRET_1666"
                     /db_xref="GeneID:38738432"
     mRNA            join(<92135..92237,92264..92278,92333..92344,92372..93235,
                     93260..93276,93302..93537,93563..93768,93797..>93846)
                     /locus_tag="MRET_1666"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628293.1"
                     /db_xref="GeneID:38738432"
     CDS             join(92135..92237,92264..92278,92333..92344,92372..93235,
                     93260..93276,93302..93537,93563..93768,93797..93846)
                     /locus_tag="MRET_1666"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484462.1"
                     /db_xref="GeneID:38738432"
                     /translation="MSDGKGIGQVIVLSGGSGYNNLVGATPSAIYVMPVSDNGGSSSE
                     IIRVMGGPSIGDIRSRLARLAAIAASKNHRASQLGNAESREAMSDLLSYRLPLHGSHK
                     EIKQEWMDILEGKHRLWRGIDPEKRECVRGFLVYFQSEVLHRAHRNFNFRGGSIGNFF
                     LASMQRFFRSIQSAIFLFSSISEIPHAMKSCDVLPAINTNKTTTIAAELADGSILVGQ
                     CEISHPSYEVIRRSRMSTHTRPLRRLSELQDSVFGFGPQGTEEQLQQLRMRSLGSMSD
                     ARTSSSALSLEDSDDSADDQLLDDEPLEMPELFESVGNISYVPKEDAMPLPAPIERVF
                     YVNSYRNEVFPLPNPSYLVGLQRSRVLIYSCGSLWTSIIPCLILRGVPHAIARSPSLK
                     YKILLLNSKHDRETHRMTGIGFVNAILRSLKKIHEIDMAGEENAFAVTDIITHVIYVR
                     QGDVWPCIDELGEIGIQCYGVDCADIREPFITEAQLRQALQDIAGNTDPA"
     gene            <94380..>94963
                     /locus_tag="MRET_1667"
                     /db_xref="GeneID:38738433"
     mRNA            join(<94380..94551,94587..>94963)
                     /locus_tag="MRET_1667"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628294.1"
                     /db_xref="GeneID:38738433"
     CDS             join(94380..94551,94587..94963)
                     /locus_tag="MRET_1667"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484463.1"
                     /db_xref="GeneID:38738433"
                     /translation="MDAAFTLALRLRSISTQIYGWKPDRHSLPLESRVAQIEHALGEA
                     VVPHVSLQRLLNQNECIQKLLKELPKNDLDADTQLALVLDNAASMQNFVRVMEACREL
                     DEHGATGSGQLQEHEPLRERLQACLEQQHSLETQFMEAQARTTSLLQRYDLYVDQLSS
                     IFVALDAKIQQIEKAKLGHARN"
     gene            complement(<94983..>95661)
                     /locus_tag="MRET_1668"
                     /db_xref="GeneID:38738434"
     mRNA            complement(join(<94983..95386,95424..>95661))
                     /locus_tag="MRET_1668"
                     /product="GINS complex subunit 2"
                     /transcript_id="XM_027628295.1"
                     /db_xref="GeneID:38738434"
     CDS             complement(join(94983..95386,95424..95661))
                     /locus_tag="MRET_1668"
                     /codon_start=1
                     /product="GINS complex subunit 2"
                     /protein_id="XP_027484476.1"
                     /db_xref="GeneID:38738434"
                     /translation="MALPTPTRYGILPTEMEYVASSETIVDILPLISLDRVRLLSGTY
                     GPFEPPARAQVPLWLAILLRKKRKCVIVPPEWLSVETLAEFLRQETVTLPFSPLPLHY
                     VAIAHLLLEHAAEDIPDASRVRALLKDLRDARQSKILAGLGMINPTHLEMTNISSMEI
                     CELRPLFVTALSQLHALHGSSNDANTEDMPSQTSESVAPTLDDNDENISVRRA"
     gene            <95780..>96637
                     /locus_tag="MRET_1669"
                     /db_xref="GeneID:38738435"
     mRNA            <95780..>96637
                     /locus_tag="MRET_1669"
                     /product="golgi membrane protein involved in vesicular
                     trafficking and spindle migration"
                     /transcript_id="XM_027628296.1"
                     /db_xref="GeneID:38738435"
     CDS             95780..96637
                     /locus_tag="MRET_1669"
                     /codon_start=1
                     /product="golgi membrane protein involved in vesicular
                     trafficking and spindle migration"
                     /protein_id="XP_027484100.1"
                     /db_xref="GeneID:38738435"
                     /translation="MHVAHILHHIKWRFASLTPLQRVCVVLIVATQVLIFAMVTYYGG
                     DQILHSLARLAAWISHSKLGILILYISMTVCALPPMHGFTTCITLFGMAFASTDAHAT
                     ISEQVYTLLYAWFLATIGLVLSACISMMVLRRVLHHLHGQWQMLARLREDRRFQALQR
                     AITEHGLVMATLARFCPLPFCYTNLLLASLDSLSFGTFALSTFITAPRLIFPLFMGAK
                     IYELSDRDMRDSLDPMSQRMNAAFIFVSMLFAVASSWFIWHRTRRALHLDQLPSDEEE
                     PSLSLDDVL"
     gene            complement(<96640..>97287)
                     /locus_tag="MRET_1670"
                     /note="MRES_06680"
                     /db_xref="GeneID:38738436"
     mRNA            complement(<96640..>97287)
                     /locus_tag="MRET_1670"
                     /product="cytochrome c heme-lyase"
                     /transcript_id="XM_027628297.1"
                     /db_xref="GeneID:38738436"
     CDS             complement(96640..97287)
                     /locus_tag="MRET_1670"
                     /codon_start=1
                     /product="cytochrome c heme-lyase"
                     /protein_id="XP_027484094.1"
                     /db_xref="GeneID:38738436"
                     /translation="MAKSQASFPKRGAKRALSNEREVSSIPRYYLDQNNSDAPESAHA
                     SADAVSNGDNEKHWVYPSPQQFYNAVRRKNHNARVEDMDVVVPIHNAVNEEAWRRITE
                     WEDAWKSDADAPRPQLVNFVGRPRDITWRAWFRGLAGYEMPFDRHDWVIVRPRSDDDQ
                     TPQTMRYIIDFYAGRAPSSSSTNSPVSFYLDVRPAPSSMEGIAMRLHRWWMDMKV"
     gene            <97448..>99429
                     /locus_tag="MRET_1671"
                     /note="MRES_06685"
                     /db_xref="GeneID:38738437"
     mRNA            join(<97448..97624,97663..>99429)
                     /locus_tag="MRET_1671"
                     /product="DNA-directed RNA polymerase III subunit RPC3"
                     /transcript_id="XM_027628298.1"
                     /db_xref="GeneID:38738437"
     CDS             join(97448..97624,97663..99429)
                     /locus_tag="MRET_1671"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC3"
                     /protein_id="XP_027484093.1"
                     /db_xref="GeneID:38738437"
                     /translation="MVCRRLVALVSCVDMSFFYHSSWVCFHVRYLTAMSSVSVREQSH
                     LCLHIIREHFGPIVESVAHVLLRRGRLTVPELVRYLNASPVSIPGHLTPKRSELTSKA
                     SSRLFPLRVVQQALIVLIQHHCVLHSKPTGDALSGEEFFEINQEEVLCRLRFGTYLSL
                     AHAWGGDDAQDVVRVLLYHGQMRVADILSALTHSDETQVPDANRIARLRVLLVSMLQD
                     SVVRPSTPIQHVSPLDRQLTLELSLRKTQRGVPTAKSLREIKAKVESIINEEDYRDWE
                     GSSIGDTDGLRLGLVRKASSDQNRDKRQKRRSNTDVSVSRDDIDIDSNVWLRVHYDFF
                     HIRLRNDIIVRATTSRYNSMTGEIMRYMLETDRPGTAPCEKDERSRPISVSSLAHRIP
                     KDTRIQRGFDKRSIMAQYDTKRSATPSTSELLAEYVAVLTCNDNISSSVHSTRFLAPC
                     GSGSVSGATTGTRVASTFTVEYVNIIRQLQLDMVRDVVVDRFGPIAGRIFSILVEKGK
                     LEEKHISKIGLISMGETRDICSRLFAASILSLQEVPKSNERNPQRTFFLWYVDAVHCK
                     SWLQDQLHRTLIQLSRRRLYEQSQKTSLLRKSERTDVREDANSLLTDWERNELASLRA
                     VEEAITVAEARVVRDTFVLQHFS"
     gene            <99585..>101090
                     /locus_tag="MRET_1672"
                     /db_xref="GeneID:38738438"
     mRNA            <99585..>101090
                     /locus_tag="MRET_1672"
                     /product="cell wall protein"
                     /transcript_id="XM_027628299.1"
                     /db_xref="GeneID:38738438"
     CDS             99585..101090
                     /locus_tag="MRET_1672"
                     /codon_start=1
                     /product="cell wall protein"
                     /protein_id="XP_027484186.1"
                     /db_xref="GeneID:38738438"
                     /translation="MDSDLDNALIQSEALYCLRREQLVNLCKRRGIKARGKAPELADL
                     LRQSIQVHQASSPKPMSPALAELPHSSPRASSPSIKSPPMPSQSPVLPPHTEQSSPLL
                     HQTVMNRTTSRLSTHSRSSHVSSIMASPPVDSPSSPVGITTPRVSGRGYARCASPQPS
                     LPDMLPMQMICEIPNQGTDVGIDSNSATEKESPDRTNTSEDALDWLISAINDQPNASE
                     GNAPEVGASARPKSKHVSMDDDSRTTKKERPASAMELRRQDPASPRPTSPQPRPTTSL
                     DDTRAMSHAHAHSAASSISTPLTDIPAFQAVSDSRDESSALTSIVPASLRSCSPVPSS
                     NENRQYGLLSHDNSHHDKAKAPSALTSAANLENVKDVSKTQFHKVSKMARRMRSILES
                     TSPAQATNLNEFLHSKSTKRAKYAQAEYEGVADPVLLRQALYSSSRMPTTTVPVIHTS
                     RAEADENKPPMAIERARSLRTTRKFDATRRSVQRSAQAAPMDKLRLVNALR"
     gene            complement(<101195..>103066)
                     /locus_tag="MRET_1673"
                     /db_xref="GeneID:38738439"
     mRNA            complement(<101195..>103066)
                     /locus_tag="MRET_1673"
                     /product="heat shock transcription factor"
                     /transcript_id="XM_027628300.1"
                     /db_xref="GeneID:38738439"
     CDS             complement(101195..103066)
                     /locus_tag="MRET_1673"
                     /codon_start=1
                     /product="heat shock transcription factor"
                     /protein_id="XP_027484185.1"
                     /db_xref="GeneID:38738439"
                     /translation="MPNTTLQSKSSTETPQPAAMNRNNPAFLNKLRSMVDDPNTDELI
                     RWSPAGDTFLVPNHVRFGEEVLPRFFKHNNFSSFVRQLNMYGFHKVPHLQQGALKSDQ
                     PSQNELWEFSNQCFHRDHPDLLSKVQRKRSGKERDHHHSNSIDETNRVLNSMSGALTR
                     GDYDMRGDSHEVSNFVGSVQMSNLLGAIQGLKNNQRTLIEELSKLQHSSQALWQQSLE
                     NRQQVRRQQDTINRILRFLASVFGSSNVGDILSNPSSADYHNFGMPSDGSATSHDFSA
                     QGDAFSQNAPRGPVRPQKRARLLISDTPYADPMAEDKDASNLDTEELTPVSAEQRFTE
                     AASDTDGGSPKLGMTPTSPSSYTPDMILNGNSTDSDAWQSDQTLRNFLPESNDSSAWL
                     ANILASQGQGSNASNLDVSRLDPQLLRSLQHTINQQSTPKMPSSSKTNAPGLVSSNTR
                     SGMSTSITPYGSLMANMPPAWRQPIPQMNEKDNLVPEEQLFHNVERLNQEAKNNMDQT
                     NQLQNQIQTLVKNLRLEPNQARNMIENESFDSKNNTLSDSRNPGWVVPSSILGATYPS
                     SPANLVNGVSASAQNDFDLDSFLNQFVDPVNQQSPSFDQANSLMTEESPDAPGSKNN"
     gene            <103393..>104226
                     /locus_tag="MRET_1674"
                     /db_xref="GeneID:38738440"
     mRNA            join(<103393..103625,103669..103756,103795..>104226)
                     /locus_tag="MRET_1674"
                     /product="transcription initiation factor TFIID
                     TATA-box-binding protein"
                     /transcript_id="XM_027628301.1"
                     /db_xref="GeneID:38738440"
     CDS             join(103393..103625,103669..103756,103795..104226)
                     /locus_tag="MRET_1674"
                     /codon_start=1
                     /product="transcription initiation factor TFIID
                     TATA-box-binding protein"
                     /protein_id="XP_027484096.1"
                     /db_xref="GeneID:38738440"
                     /translation="MSSSGPLQLPQAQAKSTSQALPQQKPLSLPTQSKGIDSTSSNGS
                     KEDGKPDVKDTPSVPPSITEQTLSSMHGIVPTLQNIVATVNLEARLDLKTIALHARNA
                     EYNPKRFAAVIMRIREPKTTALIFASGKMVITGAKSEDDSRLASRKYARIIQKLGFEA
                     RFSEFKIQNIVGSCDVRFPIRLEGLAYSHGVYSSYEPELFPGLIYRMVKPKVVLLIFV
                     SGKIVLTGAKVREEIYTAFNLILPVLSEFRKP"
     gene            <104460..>105875
                     /locus_tag="MRET_1675"
                     /note="MRES_06690"
                     /db_xref="GeneID:38738441"
     mRNA            <104460..>105875
                     /locus_tag="MRET_1675"
                     /product="YidC/Oxa1 family membrane protein insertase"
                     /transcript_id="XM_027628302.1"
                     /db_xref="GeneID:38738441"
     CDS             104460..105875
                     /locus_tag="MRET_1675"
                     /codon_start=1
                     /product="YidC/Oxa1 family membrane protein insertase"
                     /protein_id="XP_027484095.1"
                     /db_xref="GeneID:38738441"
                     /translation="MAMHRLSNMMYRVTVRQGLTMLSHGRTKTAAVPLFCASMTMNGT
                     SSRAFSLWGAKTTNEDARKAIFEHGEALASSVKSASHDVQQNLADVGPSIHDRIAHAE
                     NAISSAVGHESEAISQAAETASTELKALGLGGYSPSGLLQQLLDAVQYYTDLPWWATI
                     IAVTCGIRLAIAPLIVYVQGNSIRLSNIQPQMQDMIKDMEYAKSTGNQQEMQSAAMKV
                     RKLLSDNNCSPFKSLLLPLVQMPVFLSFYFALDRLAKAPLPALTTGGVAWFPDLTVAD
                     PYYALPAISTIMTLLVLETGAETGTTAMNQSQQARIVKYILRGVTVLAAWFISSFPSA
                     LLLYWSTTNTFSLAQLLLLRTKFMKRLLRLPTKIEHPVKPHVKQKSFMENIRSSMNNA
                     RTNSGGNASSRRPEPAPLYRKSDNTSQNLNQSRSRALDALMADATKSKQQPSNVANEL
                     NHAEKQSRLAAARERRLRQRS"
     gene            <106072..>108335
                     /locus_tag="MRET_1676"
                     /note="MRES_06695"
                     /db_xref="GeneID:38738442"
     mRNA            join(<106072..106120,106153..>108335)
                     /locus_tag="MRET_1676"
                     /product="auxiliary protein of DNA polymerase delta"
                     /transcript_id="XM_027628303.1"
                     /db_xref="GeneID:38738442"
     CDS             join(106072..106120,106153..108335)
                     /locus_tag="MRET_1676"
                     /codon_start=1
                     /product="auxiliary protein of DNA polymerase delta"
                     /protein_id="XP_027484098.1"
                     /db_xref="GeneID:38738442"
                     /translation="MAEPVLQDGPIASYIDSTLGLNSSSASPNTTPVTRKSWTHAWHR
                     FCKSVLPHEASISEAISEAEKAAYEPDEGVDEFAEKLKYTIVSSYLLGSTLSISMYDH
                     RHEALAQPKSWIPSAEKIYFANIPPACHEVSVRIVGSLSVMPMVVIILILCAYFHARL
                     PLSYCILLSIGLDALVSFSGASDLLSWSPKMISCVVSTPPANHLPFLALNVPNPVWVV
                     DERIYLQVNILQQIQEFVKAAQTMDYSINDALAAIQEVELVSRGYRLSSPLAPISRLE
                     AADGLQSLKNFEYSQRSRFPLRLLALRKDMVDALEEVAYHCNAALRRLEKHIEFSDVP
                     LSRGLATVRQNPLKDVATVMSFPIPSSLSSSASDTPARQLRRKSLLNESNGQQCSNTI
                     SSPSLLKNDKFNGSPAPKFKHQESERYDRLSLLSVRSHFESMHSTRQSLLYALLGLDW
                     DRIHIDSTCETLDTFWRREVLDEVLSALTNLFWQMSSYMKKQVQKHFHVVEPNSEASS
                     TTPPLESHASLGDHLTEMGRTLRAIQCKLHVCCEELHLPTPTLHGVQNEIPPCSQNKD
                     IMRSIFDSVREDLLSLSSDWEAGQNIFYGAAPKDFSHNTNTISSSSESSSFTEDKEEG
                     GSIPSSPSAMHENVEYLSGAQGPQIFHDLLLDSTSPSHLPTPMGQEEVFEGDTSSVPA
                     LFPKSQMTRAERIRLKNERRANLNVNTDIFQPQVMVHELKGVLERRSISMPISTRSES
                     GVM"
     gene            <108476..>110761
                     /locus_tag="MRET_1677"
                     /note="MRES_06700"
                     /db_xref="GeneID:38738443"
     mRNA            <108476..>110761
                     /locus_tag="MRET_1677"
                     /product="chromatin structure-remodeling complex subunit
                     RSC9"
                     /transcript_id="XM_027628304.1"
                     /db_xref="GeneID:38738443"
     CDS             108476..110761
                     /locus_tag="MRET_1677"
                     /codon_start=1
                     /product="chromatin structure-remodeling complex subunit
                     RSC9"
                     /protein_id="XP_027484097.1"
                     /db_xref="GeneID:38738443"
                     /translation="MATSYDVLRSQMLATRAGQPASLNAIPDACLEPGPMNRLCLSLR
                     SGIPSQVDWALRRLAMYTSEASDKLILTNYPGLAEALADFLRRLFLATHGASRSEWDV
                     MQRPQNLNGLIVDQGTGGDDDGGFAGIAMASVRLTHKPPSPVAATEPFQPFKYIRDAA
                     LLRRTLESVLILRNLALSQSNLPSIAQVPHFLNHLYGALVLDTKGVAMEQCADIRINL
                     LDILENLAPHLTLSDWVRRRFVLNTEKDTTPHFVEDRLFVILYDWINTTQDRALLLGS
                     LRCIRAFASNAQNSQVLVEVDMALHPTSLGLVKRCLLLLPLTQDPELLEAVLDLLYQL
                     LTIDDNALMLGLDNVPTHAIVHFLARNLSLGKSVWERDSPMISNQHAWWASLVPNTQR
                     IRQNREWERREKMSPMERQRWKVLPSDIRSQIETLPEPERGTQWMKTLFEYDAQGEVT
                     QMDFWIAYRDQFTPIANAGGAPLQPAANLIRNVSQTFPGAAAMVISGVAGAQSRFVIR
                     GIAPRIRESLAGPSCPWVGCPTPQAHTWANVREHLVSHVAHSSDGLCRCQGCSFAASP
                     NDEASQRAELHLHVRTHLPPVHEQDIIYAPSATPALGTHERPGVITFDVERTPSIPTA
                     LAGQPPLPCGIAFLSVLILRYVIRISSIILRRDGYGCPDYTYGGAVASSKQPSERDAM
                     FGFPFVSLTDDIQAQNDSAANMEDRYAQSAIRLMQAATSIEDVLVETSLRNDILCRLA
                     NDTLVAIRPVADDNATASKDY"
     gene            complement(<110755..>112031)
                     /locus_tag="MRET_1678"
                     /note="MRES_06705"
                     /db_xref="GeneID:38738444"
     mRNA            complement(join(<110755..110781,110964..>112031))
                     /locus_tag="MRET_1678"
                     /product="sorting nexin-1/2"
                     /transcript_id="XM_027628305.1"
                     /db_xref="GeneID:38738444"
     CDS             complement(join(110755..110781,110964..112031))
                     /locus_tag="MRET_1678"
                     /codon_start=1
                     /product="sorting nexin-1/2"
                     /protein_id="XP_027484167.1"
                     /db_xref="GeneID:38738444"
                     /translation="MTAHVVYTVRVQTNAPWLSRPEYSVLRRYNDFRWLHAAMVHNHP
                     GVVVPPIPEKVKVGRFAPELVEFRRRSLERALLKMLQHPILQQDDDLALFLESGNLTA
                     DIHQRDLRKGPVVTPEYKTYFGWSHAFHHYRFQEPDEWFTSQLNYLSQFETRMKEICD
                     ALTTLSHKRAELADAYLQLYHSLVALSSSGMSRSVSTCFAILADMKKRSAQACTQLAD
                     YEANVFGLALYEYERLVGSIRKAFQSREEVWQAWQCADDELSRVRSKYAKSNETHIDT
                     QNHALTHTQLAYAALSTRFEEVTRLSKLEVERFECGKAQEIRTAFEEYVRVFSAIQRD
                     ILDEWEHCGSIVQRIITKNQSKATGKETTQ"
     gene            complement(<112228..>113291)
                     /locus_tag="MRET_1679"
                     /db_xref="GeneID:38738445"
     mRNA            complement(join(<112228..112235,112265..>113291))
                     /locus_tag="MRET_1679"
                     /product="S-adenosylmethionine synthetase"
                     /transcript_id="XM_027628306.1"
                     /db_xref="GeneID:38738445"
     CDS             complement(join(112228..112235,112265..113291))
                     /locus_tag="MRET_1679"
                     /codon_start=1
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="XP_027484166.1"
                     /db_xref="GeneID:38738445"
                     /translation="MKLLVTGASGLLGRAVMQECTRAGHEVIGLAFSRVSGALVKLDL
                     TDAEAIHGLIQRERPDVVINLAAERRPDVVERDPVAVKRLNVDAPAILAQACATLDPP
                     AYLLNISTDYVFDGRNPPYFVDSPTHPLNAYGMSKREGEIAVLDAALAGHATNLRLPV
                     LYGETLYNEESAVNVLLNSIRSNEKRIKMDAHAVRYPTNVSDVARVIEQLSSLYKKQL
                     HSSAMPETLHFSAQEAMTKYDMCLVLSRLWNLVCQEEVSSVEHLDPQYEADANAGTKR
                     PGHCKLDISTTNELGIDTSCVPFDEWWRNYLEHCDRPAPLHGESKLDNDFSSAKEAIP
                     TEEDAEKQEI"
     gene            complement(<113370..>114128)
                     /locus_tag="MRET_1680"
                     /db_xref="GeneID:38738446"
     mRNA            complement(<113370..>114128)
                     /locus_tag="MRET_1680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628307.1"
                     /db_xref="GeneID:38738446"
     CDS             complement(113370..114128)
                     /locus_tag="MRET_1680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484142.1"
                     /db_xref="GeneID:38738446"
                     /translation="MRAPITLRYVLASSLCFIYFVYAIWNCARVIKGYKLGKIPWYVP
                     ACAGGISALGLLSMSLPNKEKDWINSVYATQSIGFLLTIELVDKMIDDWFFHTRMTPT
                     KPTRLKKMLTLILACTLVAIYVNPRNIIIPIVLCMSSFYCSERLSGRIGNLINSMDSQ
                     DSRTRSSASSYAVRDALETMARILANFTTLLSASAGAFMAVHVLALHKPKLADLDFQY
                     LGFFLSNFLGPIPITHVLSLSSTLGHLEALRNYA"
     gene            <114266..>116323
                     /locus_tag="MRET_1681"
                     /note="MRES_06710"
                     /db_xref="GeneID:38738447"
     mRNA            <114266..>116323
                     /locus_tag="MRET_1681"
                     /product="anaphase-promoting complex subunit 2"
                     /transcript_id="XM_027628308.1"
                     /db_xref="GeneID:38738447"
     CDS             114266..116323
                     /locus_tag="MRET_1681"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit 2"
                     /protein_id="XP_027484143.1"
                     /db_xref="GeneID:38738447"
                     /translation="MDAAWEEALRVCKKTINEGEGAEQASIWTTIIAAFDPREPWAAP
                     ERDQPFVREALASLRYSQERLAAWYVDAYMSAFHQLCMEVLAPLISDEHATAHLPFAV
                     DTCFEWIVSRQTLALEAGILPHDTCTAILFSHCKTVISAAMQPGMHKVIENYFQSALH
                     VEESTNVVPDSTCAQVCTQLRILGLDAVVQSALTETASHILEHATQQAVTRSGSLQEA
                     VYPALHALLCDELMPALSSMLNARPKEPVSMSPTLYNAWDISVSMMYDDTPELDEDHE
                     SLYLRLEYSLAKMVGKHRLTQLYALVGMFPQSRAAMEDMVMWLAKTDERIELAQSFTQ
                     ALQTRLLHPDMDTHAILAYYINIVFALRMVDTSGVVLSRVLPPVQHYLRTRHDTIRVI
                     VHALLGDDAEFELLRSELVQLQPENDAPSSAWDMDAEDEQYTRLEHWVDPTWAPRPVD
                     AGPAFRLMRSNDVVGLLAQIFHDRQGFLHALEQHTAQRLVRTVDYDTSRVQHNIAIFK
                     RRLGEQSLHHCDVMLADVATSRALDSAFHTQENVAEYVHPMVVSRQFWPDLDTRTWTW
                     PTRLAQSLQQFSAFYTRQNPTKCVRWLPHLGTVDVDIELQNNERVSMRVSPLQLAVLE
                     LVSENETPGVVTAEDLAQVLELQHAALALEALRFWVAQGVLREWPSAGSFELCDNLPV
                     SHA"
     gene            complement(<116291..>119422)
                     /locus_tag="MRET_1682"
                     /note="MRES_06715"
                     /db_xref="GeneID:38738448"
     mRNA            complement(<116291..>119422)
                     /locus_tag="MRET_1682"
                     /product="Sec7 domain protein"
                     /transcript_id="XM_027628309.1"
                     /db_xref="GeneID:38738448"
     CDS             complement(116291..119422)
                     /locus_tag="MRET_1682"
                     /codon_start=1
                     /product="Sec7 domain protein"
                     /protein_id="XP_027484144.1"
                     /db_xref="GeneID:38738448"
                     /translation="MRDDAAQHASVENQGASARLDAIAKLRRAASQREVRQAKPPPTT
                     ATTAATHAGTADSVSSNAEAQLVERNAARPDGQFPLLSLEQLRQRLVQERKPTGMSRS
                     ASTSAASQVARAYTMQKLLGASTPISYNDMFAFVRNASQMRDAPSSSKDRPLPDRALE
                     TPRRTTLIRSVSARDHSRVHAYKQAARAPLPSPTTAQAVSSPTWDDRSSVAHDSSSTS
                     SWRLSLYDYDSTSPVVSQTSALAPVSSTPSIPTTASVSAEPPIKTAEAPSHLPAKPQQ
                     SEPRELDKSAHLFMTRNRSHSSSSATVTRVTAHTPHVDTQLPRSVKNSSDIPRETVPA
                     NPMPKTPASTYPSPVSVSFSHEPAPASAPVFTMAGHVDDAQKPLPHLPSAMSQMLEES
                     LGLGRPSSSPSVDAAHAAEASSHVRSNSTSAATTDTRKDSKVARIFGSIRRKSSRRGL
                     GSLRRPSKASNDSASTSSPVASHTLMASVILQKEVQDAWLHDTVITIPTTPAALMRWN
                     QKLPRPVRHVLAPFPAQVPLEVALDPPRRLVRILPLLQSAGDEYVKLRYLFLFQDTAV
                     LAKPMIAPMQGESLSDLIIRKLGSAPDLSESCTPITVLGLRDLYVDDSRQGKLSELAM
                     LVQRREAQLYAHPFETLHVLRMEAQLPGSEAYAHAQLLYAGASLDRMAVAQYLYAHRD
                     VMKHYVMMHCVTGAPIELALRSLLSSVLWPQDFGTFEALLSAFAVHWHKANASEHQMT
                     AECVADLTLAILGLNDALHGATGLFTYPPHAISLEEFVKLFRARNTQHMVSDRMLSDA
                     YVAIKTSPLTPAVPRHAWRAVSYDARALSEPLRPGVPSLRVRVSLDQPDPDVRICLVG
                     RGLYMDPPVLTFTHAAHSEFTVLATAPGTYDLLFLRTGQHAPMYISGRHHGTQRALPL
                     HLTLSCEDATTTTPGRRTVSLVHLAPGAPRRALTFCMTHQAMAEQVLRCLRTQVEQAR
                     EEARHQSQTERDVHALSQLVLESALFSLPASDDTHRLGRSGTMTGASIVRMARENSLL
                     SHVLCMRDRQIVT"
     gene            <119675..>121369
                     /locus_tag="MRET_1683"
                     /note="MRES_06720"
                     /db_xref="GeneID:38738449"
     mRNA            <119675..>121369
                     /locus_tag="MRET_1683"
                     /product="protein STE50"
                     /transcript_id="XM_027628310.1"
                     /db_xref="GeneID:38738449"
     CDS             119675..121369
                     /locus_tag="MRET_1683"
                     /codon_start=1
                     /product="protein STE50"
                     /protein_id="XP_027484145.1"
                     /db_xref="GeneID:38738449"
                     /translation="MESDVRHWTLSDVSLWLQSMDMACYAEAFESNRIDGEALVLMDE
                     AALKDIGVASIGHRVSLLDAIYQMKIAQNIPFEPGDWVPQELEPPTYQDMTQLLRERD
                     ERIYALESHVSYLDTALMQLHEQIAVISKTLGVPHTARVQQSQPPLTHAASTSTEAQD
                     DRDGQARALQATAPLPWSESAQDDRTLAPVLEAIGALLRQRGMERAPNEAQQRFHPVT
                     LNDPCSTLLPLALRLYGIHEDWHNVVLFATSSTTEYCIAYDEKPLRILQTMQEKSPDA
                     ALVARYVADIESPVQVAYRKFHDRQQQKQLGMEMKHPALRQRAGVPGLPVAKDARLIS
                     TRHLLTWPGGAEAHSHAHTRGPAADLAFKHISYAVAIYPYVSERDDEFDFQLGDTFIV
                     LSKSQGWWALRRDSAADGHGDVYVLDRARPSIEVWTGWAPTGCLLEIVQPMATILHSQ
                     SCYRMPDSQDTWQQIMMYAPLPLLYVPMSGSAATLLTDVPARDHSFSAGDRVRVFKRY
                     HSWSYCIAESMPPYRGWVPSWLLSRRMNTPIPPSRALSSGSAPGPNARATESAARP"
     gene            <121429..>122868
                     /locus_tag="MRET_1684"
                     /note="MRES_06725"
                     /db_xref="GeneID:38738450"
     mRNA            <121429..>122868
                     /locus_tag="MRET_1684"
                     /product="integral membrane protein"
                     /transcript_id="XM_027628311.1"
                     /db_xref="GeneID:38738450"
     CDS             121429..122868
                     /locus_tag="MRET_1684"
                     /codon_start=1
                     /product="integral membrane protein"
                     /protein_id="XP_027484138.1"
                     /db_xref="GeneID:38738450"
                     /translation="MRGTLLCWASVIAQAAAHGNHAHVPTKQQASEPVDGWLWLHIAM
                     EAGAWAVLFPLAMVLGLVRHRFHVPLSIAAVVISLTGFIFGQHHGGRQFKHTVHGTFA
                     GVLFFLLLAQAACGVYLRLHLAWSRERYVRPVVLVIHGVLGRAFPVVGWAQMVFGIAT
                     LQSWCEGGHLNQCLAHYIMGSAFTAYSVILLIMMKCAVEWLRRRGCAQEYLDSWVIFI
                     WGMINTFTEHQGGPWTHKDLQHTLMGVVWWAGGAAGVWLSRKGQRSVLPAVIIMLTGW
                     AMSGHKQAVAISTHIHALFGYALMAGGVCRIIEICFVLRDAPSGTVDRPTVPGAWFPV
                     SVFQYLPPFLLVAGGIMFMSATDEEMRWADAKGIDYVTWGLIDFSVAFLLFLWFNILI
                     DTYVGYGGRYGLSGERPKEPQHFFSYSNIEQGLSTNNDVVAMESFDVPEHAPSQPSQQ
                     PPPPPRLYAPPPTTHILEDQDPFDDTEIS"
     gene            complement(<122912..>124852)
                     /locus_tag="MRET_1685"
                     /note="MRES_06730"
                     /db_xref="GeneID:38738451"
     mRNA            complement(<122912..>124852)
                     /locus_tag="MRET_1685"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628312.1"
                     /db_xref="GeneID:38738451"
     CDS             complement(122912..124852)
                     /locus_tag="MRET_1685"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484139.1"
                     /db_xref="GeneID:38738451"
                     /translation="MVELEEVQDSNAQITERFPPGMVAVFAGATRGIGKATMLEFAKH
                     MRQPRIYLLARSEDTTQPVLDELHEVNPDGEYYYVEADLSLINMVDAACRRVRENEKA
                     INVLFMSQGTLDFTSRTREGLRTMWALSYFSRMRLISNLLDHLRRGESLRRVVCVMAG
                     SREGPIDPNDVSGRKVPIRQARGHLSSCITFGLEHFAEMAPEVSFIHDHPGSVPTKPT
                     RALPPGMASFAVSLSMASGRKISLEESAERHLFLTTSSRYPPISVEDRPLARGVPLSA
                     GLRVALSSTARVAGGVYTVNSDCVSADYNTLELLRTMREQNIPAALWEWTQEEIDRVE
                     VIIPDPPTPKEQPKPLAMEPEEMLFLPRPMPDGTYPLPDPVSATRPPVTTPEPPEPLD
                     QPAPELVQDQAAMFLPQVRPDGTYPLPDRVRPTRLTTPEPPEPLAQPHPEMLPNAHAM
                     FLPEVLPDGTYPLPAKVRPTRLPIPSPEPEPELKPEPKPEPAPERSATSESHEAARAS
                     QDESRRRSFLPMFVKRLQPKPFRPFKRQGRTDGADDTSMAETVPERVSQSASEAVPET
                     AAPGTSSHSVVPLSAPVLRPEVNEAQTAKAAEHAQPNTVVSHPATALNHASASGFEPS
                     VNATQAAPQSPTAQDIIQSYQS"
     gene            <125345..>125938
                     /locus_tag="MRET_1686"
                     /note="MRES_06735"
                     /db_xref="GeneID:38738452"
     mRNA            <125345..>125938
                     /locus_tag="MRET_1686"
                     /product="mitochondrial intermembrane space import and
                     assembly protein 40"
                     /transcript_id="XM_027628313.1"
                     /db_xref="GeneID:38738452"
     CDS             125345..125938
                     /locus_tag="MRET_1686"
                     /codon_start=1
                     /product="mitochondrial intermembrane space import and
                     assembly protein 40"
                     /protein_id="XP_027484140.1"
                     /db_xref="GeneID:38738452"
                     /translation="MLGRMASRAFARVLHASWTRASVPVVGAVSFAILGLSQPISLQD
                     RLLSYEERIKLSNTFKPHPKRLTRVHESNEESEKEEVAQEKPAQEEPAQDESSEEAGH
                     LDMEEGVESAFDERTGEINWDCPCLGGMADGPCGEEFKKAFSCFVFSEAEPKGIDCIE
                     HFKHMQDCFRQHPDVYADEIEADEAAAADASSVQDKE"
     gene            complement(<125941..>126996)
                     /locus_tag="MRET_1687"
                     /db_xref="GeneID:38738453"
     mRNA            complement(join(<125941..126534,126562..126787,
                     126815..>126996))
                     /locus_tag="MRET_1687"
                     /product="peroxin-7"
                     /transcript_id="XM_027628314.1"
                     /db_xref="GeneID:38738453"
     CDS             complement(join(125941..126534,126562..126787,
                     126815..126996))
                     /locus_tag="MRET_1687"
                     /codon_start=1
                     /product="peroxin-7"
                     /protein_id="XP_027484141.1"
                     /db_xref="GeneID:38738453"
                     /translation="MEGPGRVPSARRYPTPGFAGYNVTWSPFYPDRFAVASSANYGLV
                     GNGRLHVFGSTPLPLKIFDTQDGIFDVAWSELHENQAVTACGDGSIKLWDVTLDDHPI
                     RNWHEHSREVFSVDWNNIQKELFASASWDGSVKIWTPERPASIQTIMAHRACVYRCAW
                     SPHAPSVLATASADGTASIFDLRTGPRPISTMSAGGEVLAVDWNKYRPMTLATGGTDR
                     AVKIWEAQASGPGGLVPEKCVCFGHQYAIRGVAWSPHQSNVVASASYDMTARIWNIDD
                     AAVSAQVPMVNVPRQVYTGHREFVVSVAWSLFEPGMVATSSWDMETHLWPGIIPNTA"
     gene            <127744..>129873
                     /locus_tag="MRET_1688"
                     /note="MRES_06740"
                     /db_xref="GeneID:38738454"
     mRNA            <127744..>129873
                     /locus_tag="MRET_1688"
                     /product="MFS phosphate transporter"
                     /transcript_id="XM_027628315.1"
                     /db_xref="GeneID:38738454"
     CDS             127744..129873
                     /locus_tag="MRET_1688"
                     /codon_start=1
                     /product="MFS phosphate transporter"
                     /protein_id="XP_027484146.1"
                     /db_xref="GeneID:38738454"
                     /translation="MSSNNQEFTNQYINHNSEPLGVNSNTEMPTEPSTNFSDATRYVP
                     EADASKAEPEPVPHAAMSTEAESAFNDILFPPDSYENGTYWADLPVGERFRFVNRQSN
                     SICREELCHIGRMIKKDPLSVVSSYFGTYVVNGMGMFVEGYTLFSVGNIKPLFQNTDA
                     ALPGQPNVPAKTSKFYQCWKEKSICDEDWQSAIDYLEIVGIITGQILVGVEGDWVGRK
                     FGMVQDALIMTLGSVMLTCMWGITMNGWVICYAWSLFIYGIGVGGEYPMTSTRAMEGN
                     SNRFASITGDRLHRGRNVLLAFLMQGWGQFVNQSLLIILLLIFNNTLQTPIKPDAAQF
                     TFRVSFGFIAAVTLYLAYYRYYRIEYAEGALRDAKARLNTSGYDITSLKLALHHYWHR
                     LFASTMGWFCNDFFFYGNKIFSNQFIDIITGKAKGDSYNPHSFGTKWLYNLINVGVQM
                     PGYYMAAILVDHKFYGRKWMQAISFMATFALFCGATFAYNSLTDPNDMGKVKAFQFIF
                     FFSSFWNQFGYNSTTFLVAAEIFPASIRATCHGVGAACGKLGALVPTIIYNYVEDHTK
                     FYIVTWFGLAGLIVTLIFLPDTTGLDLREQERYWEYVMSGNQQDYHGVAIHPRHISLY
                     ERVVLKRHLPYNPQLDAQQKIGEFRTVYDSTMAMNSYAEEDLSAHQRDFLASEFGHKY
                     VKDFRLAHPNPESHVFDSKLESLEKQL"
     gene            <130172..>134827
                     /locus_tag="MRET_1689"
                     /note="MRES_06745"
                     /db_xref="GeneID:38738455"
     mRNA            <130172..>134827
                     /locus_tag="MRET_1689"
                     /product="cation-transporting P-type ATPase 13A3/4/5"
                     /transcript_id="XM_027628316.1"
                     /db_xref="GeneID:38738455"
     CDS             130172..134827
                     /locus_tag="MRET_1689"
                     /codon_start=1
                     /product="cation-transporting P-type ATPase 13A3/4/5"
                     /protein_id="XP_027484147.1"
                     /db_xref="GeneID:38738455"
                     /translation="MTTRGTTSRPHDPELADEEYQAPFSNHIPEVRGQSEDSHHASSF
                     VDAGSVRSTSLFGEQELQEAEQWASQSMKSRTDMIGRSVKKRRDSQVGSYEDPNTIFD
                     GPSAEFVPSSVTSMHHNMARPSLHPHSRRRSQRFHSRISRSGRASSSIQSHSRESRDH
                     SPSSVHTLDSHGNSSISYRKRAYPRRAYRVSEDGASSSVPGSSSLIGSLFATFRVDQA
                     EAEADANADNGRWLDQESDMVDEEALDLDDYDDENEALISDASDRSSADSQPHGSPQN
                     RFIPNVFGVPEPFVDYRAEGLEDGRQDVPFDDPTMPPKPVHLMDYPEAVNEARDGHVH
                     TDAVGNTHAEGYTESPWLDKTCRTKQQIYLADEDTLIRISGYRTRRGHYIMYMAACIF
                     SLGIIGLLSLWFPRWRLRYVYQEADFADAEFVVVENQWGDISKEAFMSVPFARPLKSV
                     FPPTSRDPPCTYAEAQSMLHDDVPDESSCGHDGEEIVDLLMFEYRYTRFLLHPPTGRF
                     RTIREWRDSKWTSTDLMRQGISTELERERRVFFGLNVIDIAEKSSLDLLISEVLHPFY
                     IFQIVSILLWSLDDYYYYAFCIATISIGSIVSTLFETKKTIARMREMNRFVCSVRVLR
                     DSQWRYLDSSDLMPGDVFDAAEQSLTTVPADCILLSGDAIVNESMLTGESVPISKQPL
                     TEQQVPSIQSTRTDLANHLAKHFLFSGTKIIRTRPAIGSLDPEDISAKAMVVRTGFHT
                     TKGSLVRGMLFPKPMGFKFYRDSFRFIGFLAAIAFVGLCFNTANFIQIGISWRTLAIR
                     VLDLVTVVVPPALPATMSIGTAFAIARLRKLGVFCISPTRVNMGGKVNVVCFDKTGTL
                     TEDGLDVLGTRTVDVHMGQFSELHQTSNELHTASSDPSGRLSLLYALATCHSLKIVHG
                     EVIGDPLDVKMFEYTDWTIDEGEETDLRTLALGQDRSPSLVQTVVRPRDSPPFDANDT
                     IGHANQNVLELGVIRTFEFVSALRRMSVIVKQLHSSSMEVFVKGAPEALIDICDRATL
                     PQDFDDLLAYYTHHGFRVIACAGKSLPGLSWVEAQRLPREKAESGLSFLGLIVFENKL
                     KPGSLPAVATLRNANIGCKMVTGDNPRTAVSVARECGILGQSSTVFLPSFAHGSPDEP
                     NDVILSWCSTDDESMKLNPDTLKPINPDPMHIDLGEHNILEYELVITGDVFRWMIDYA
                     PIEIVRRMLIKGTIFARMSPDEKHDLVDRLQELGYTVGMCGDGANDCGALKAADIGIS
                     LSEAEASVAAPFTSTRPDISCVIEVIKEGRASLVTSFSCFKYMALYSLIQFTSITILY
                     NLASSLGDFQFLFIDLFIILPVAVAMARTWPYPTLHTKRPTANLLSKKVLLSMLAQVI
                     LCSGFQVFVFCLTRRQPWYRPPQVNPDELNVVNAENSALFLVSSFQYITVAAVFSVGP
                     PFRQPIYTNPMLLTSLTVLTCMSMYFLFMRGGFFFELLGLVEFPPSFHWKLFAIVVAN
                     TAACFVFESHLMGPTLNVIKFVQRMLFHRGRKHDKTRKHGQKTYKAVLMSLNDPSEA"
     gene            complement(<134849..>135805)
                     /locus_tag="MRET_1690"
                     /note="MRES_06750"
                     /db_xref="GeneID:38738456"
     mRNA            complement(<134849..>135805)
                     /locus_tag="MRET_1690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628317.1"
                     /db_xref="GeneID:38738456"
     CDS             complement(134849..135805)
                     /locus_tag="MRET_1690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484086.1"
                     /db_xref="GeneID:38738456"
                     /translation="MSDALLSFEEIRDKLHARGYSKHHISEEGLSSRDKQTLLEVLRA
                     LLAEHDEEVQLREKLLVRNRELEQTLERNKRSRKQDENFSNERDAKLHNAQMQLQSAQ
                     AALNEEQVAHRITRDQLTRTRKQMNQIKTAASQYRTSAERQVDRLRERATALTKSGLK
                     ALVPDIRIASPSFLTQSSSESGDLQEKSLEETEKRNAALLETCHALKRLALDALIVLY
                     QADIRLKKILDVESRDSALRSSRRGFLPQTSLEDLELHEIFPPLRPLVTDDTEETHPA
                     RRHLARLADNLQSHVAGLSQWAALQHVEQDQHAKRRRTDPSK"
     gene            135915..136004
                     /locus_tag="MRET_t0026"
                     /db_xref="GeneID:38741220"
     tRNA            135915..136004
                     /locus_tag="MRET_t0026"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:38741220"
     gene            complement(<136111..>136410)
                     /locus_tag="MRET_1691"
                     /db_xref="GeneID:38738457"
     mRNA            complement(join(<136111..136144,136175..>136410))
                     /locus_tag="MRET_1691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628318.1"
                     /db_xref="GeneID:38738457"
     CDS             complement(join(136111..136144,136175..136410))
                     /locus_tag="MRET_1691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484085.1"
                     /db_xref="GeneID:38738457"
                     /translation="MPLVHWDDDVRVPLTLYRQDSSNNTLSPTQPSIDETALDQSTTS
                     HTSHLDQIRDAAHYNSLITWMRQSFPEKWDAGTGVWQAPRGREHT"
     gene            <136576..>138849
                     /locus_tag="MRET_1692"
                     /note="MRES_06755"
                     /db_xref="GeneID:38738458"
     mRNA            <136576..>138849
                     /locus_tag="MRET_1692"
                     /product="pericentrin-AKAP-450 domain of centrosomal
                     targeting protein"
                     /transcript_id="XM_027628319.1"
                     /db_xref="GeneID:38738458"
     CDS             136576..138849
                     /locus_tag="MRET_1692"
                     /codon_start=1
                     /product="pericentrin-AKAP-450 domain of centrosomal
                     targeting protein"
                     /protein_id="XP_027484084.1"
                     /db_xref="GeneID:38738458"
                     /translation="MDITFDLSSKLENRIDHELFQDDSEDFPIPGMSRRASMTQSMSE
                     MSGLMQPPTPNIHDLSDQKLDTSLSRRKEIQENQFDNLNEQLLDQSDSMEAPPLPAPK
                     PDVSASHDLANENEEGQHTSLDTISFESPPLNGLESDHSSSSISMPPSPSESCAQNAS
                     SSNASFRRNQKTGSIPGSPVVVNNTIQTATTPLQPPAPGRTAFTAATTAIQTSFREES
                     MTSRLSGASTHSEQHHEPTSTSSSSTDEPSIAQLVASTSNMPHEHIDPKRLMAYQHQM
                     NERLTQENEILKVQCEELMKIMQKHDKQKEEDDRAQLVKQIEGLNAVIESQQTDMARI
                     KEEASHDTPSEYDPLLTKIRCALTQGNAEVMHSCIKELQEAVPGMDTSVDPDMLRPSE
                     SLLLSRSSSSWRHSTPHRSHAMESLCRSVASMSVVQDASRVTTDLKQMQQTVRTLTQE
                     LHETRTQLEAALTQSTDANASKLRIEARLASAVDELADVKESLDKRHKQCQELESLQQ
                     SLPRPDTSLDQSLQKARADLAAAHALQQQAQQQQTLLQEHLRLAGERYDRACAEADSA
                     RHARMECETQIDEQLLQLHSLQNLLAEQHAELGQLRGEKDHMWMERREIMEQLNVFEQ
                     RLRDVRTETEQYGSDLRALQQKEDMLAMRARQMDEECARLVRKYMADVLSEWQPRLDG
                     LKEQCRALIFQKAYLSRALHSQTWLADRVRLHMHILAPTLRRYVPGYEPWPPRKRRSW
                     RAAVRAVQFVIRLRHVD"
     gene            complement(<138846..>140435)
                     /locus_tag="MRET_1693"
                     /note="MRES_06760"
                     /db_xref="GeneID:38738459"
     mRNA            complement(<138846..>140435)
                     /locus_tag="MRET_1693"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628320.1"
                     /db_xref="GeneID:38738459"
     CDS             complement(138846..140435)
                     /locus_tag="MRET_1693"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484083.1"
                     /db_xref="GeneID:38738459"
                     /translation="MGRSKRENVDDTDHAEKRRRGKARQGGDVSTLLHQHDLRALRVQ
                     DMPWSVQQPDQYATAGYEGDAPAVKDLAAYMISSVHLPRASQLLHVAWVPRLSPWSAS
                     PEYHECSYPLHATPLRFSVASHEREESLSIQPYESARITDPAHPSRPIHLLDAVGHVY
                     DLAWAPFVDTDWLAVACTKTRGKGDDEGMLQFWKHTDDVNMAFTIKLDDTPLRVGWRP
                     GVTAPNTLGTLAVSMKKGHVLVLDIPCTEAKCIQLTPRMILQVPGTSCFSVAWGGDAR
                     LASGCTNGHIAVWDVDASEKPLIDAPVHDTLVSAVSWQMLPPFNTSGSPDLAARPQIL
                     LSVGWDGSEHVTDVLDPYATARFAHSREPRYAAVWAPWNGAWIVDMGDHQFGSVSLRT
                     HDVGKHHVVGFHHGRILALDASAFHPFIASGSADGSVHISNALQVSKRKAIEPGGRLM
                     HKRFRLVRRDESSFSLRHGYYPEGILPTAQGAKQAVLSVDRWDPAVGVTSVAWCPNAS
                     RALLLASGTGIGLVRIECVES"
     gene            complement(<140523..>140990)
                     /locus_tag="MRET_1694"
                     /note="MRES_06765"
                     /db_xref="GeneID:38738460"
     mRNA            complement(<140523..>140990)
                     /locus_tag="MRET_1694"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628321.1"
                     /db_xref="GeneID:38738460"
     CDS             complement(140523..140990)
                     /locus_tag="MRET_1694"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484090.1"
                     /db_xref="GeneID:38738460"
                     /translation="MQFSIKALIGALAALAAVNGAAISLPADEAPEPSESLEARKIVT
                     IPIPLPIGFSKSTSTFTTYSSLPSGVKNTCPPIKTVTDLKKTTITVHGTPPPGVKNGQ
                     TRTHDLNARGDGIKTLGTVSFPLSTSISVSCPSQTVFTAHNTLVETLYLAPQQ"
     gene            complement(<141253..>143341)
                     /locus_tag="MRET_1695"
                     /note="MRES_06770"
                     /db_xref="GeneID:38738461"
     mRNA            complement(join(<141253..141409,141435..>143341))
                     /locus_tag="MRET_1695"
                     /product="ATP-dependent DNA helicase 2 subunit 2"
                     /transcript_id="XM_027628322.1"
                     /db_xref="GeneID:38738461"
     CDS             complement(join(141253..141409,141435..143341))
                     /locus_tag="MRET_1695"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase 2 subunit 2"
                     /protein_id="XP_027484089.1"
                     /db_xref="GeneID:38738461"
                     /translation="MTWDADLHPRTLVAFVVDVSERMSIKENGRTYLEQCQHFVSLRI
                     LEIMLRGLSTIKVCVCTYGDYHDEEDGFAGLRILCRTARPTTDMLRAVHDLRPATSTA
                     AYEPTLALSSTLDMMATKDHGEPSWAKVVYFATRPGLPENRADVEVFRTQLIDTRVHL
                     RVLAYGPSSDVYSLKNAFWQRLIQDVPGSTIVSPEEAMSQAEAPTLQIPSSHPINTTL
                     SFGDIHASDKTSLHFPVQIIKATAQQRMHAPRRILKDATEDRDIDTKRVMYRADEVLR
                     AGNDLSQIAPLPDECQAHVQRAYKLGASIVPQEETPPAISTTAGLEILHFVNASTYRR
                     EYHVGETYMVLAHPKSRRAQLSLSSLVHAASIRGVYALCRFVARTHSDPKLCLLAPMI
                     ENEYDAFYMVHVPFRDDVKRSAFPPLDRVTTSTGESLYEHPTIPTKEQQSRMDTFVDL
                     MDLMDMDDHPDGWYAPSLCYHPAIHALKHAIKWRFMFPNQPLPPLHPKLQEFLHIPSS
                     VEDRARDTRTACAAAFQVHAPQKHPATEAASETPAKQVKEDNSETETDTETEPDTTMN
                     TNAEPIPLDQILPTFEARIKTSAVSETCQDMSRTLLTLVSRRVETNHIMEAMHVFRRS
                     AAELDESLTYNTFLRTLHSRARTQHPVLWKALRHRMDLGLITHDEDASRRSTETDATA
                     RAFVA"
     gene            complement(<143374..>144672)
                     /locus_tag="MRET_1696"
                     /note="MRES_06775"
                     /db_xref="GeneID:38738462"
     mRNA            complement(<143374..>144672)
                     /locus_tag="MRET_1696"
                     /product="beta-1,4-mannosyltransferase"
                     /transcript_id="XM_027628323.1"
                     /db_xref="GeneID:38738462"
     CDS             complement(143374..144672)
                     /locus_tag="MRET_1696"
                     /codon_start=1
                     /product="beta-1,4-mannosyltransferase"
                     /protein_id="XP_027484088.1"
                     /db_xref="GeneID:38738462"
                     /translation="MLGLPWGVLLGVLLWVACIRVRAIHQRTAMVVVLGDVGRSPRMC
                     YHIASLVRHGWTVYVAGHFDTQLPRYLCTPQVHRVPLWSPPSFFSKLPRAIFVLVAAV
                     KVPMQTLSLWLALVARTPKPAVVLVQTPPAIPTLMVVQCACLLTRSRLFLDWHNLAYT
                     LLALRLGPHSPLVRVSETLERLFGRHADAHLFVTQAMLRHLAKRWHLRGAMAVLHDRP
                     PAHFHRLSEADAKAFFDRVGPMLCAGDRGGAALAVTSTSWTPDENMHLLLEAASMYEE
                     RACTMPLRSLVIVITGKGPLREIFERTIRQRTQAWKHVRISTAWLSADDYPRLLGAAD
                     VGISLHSSSSGLDLPMKVVDMLGCGLRVCALSFACLDELIQPGVNGDVFSDAQGLASC
                     LERLANAPSDALHTPFLGAEPRSWDALWDQVVVPLLPSNT"
     gene            <144795..>147872
                     /locus_tag="MRET_1697"
                     /note="MRES_06780"
                     /db_xref="GeneID:38738463"
     mRNA            <144795..>147872
                     /locus_tag="MRET_1697"
                     /product="ubiquitin conjugation factor E4 B"
                     /transcript_id="XM_027628324.1"
                     /db_xref="GeneID:38738463"
     CDS             144795..147872
                     /locus_tag="MRET_1697"
                     /codon_start=1
                     /product="ubiquitin conjugation factor E4 B"
                     /protein_id="XP_027484087.1"
                     /db_xref="GeneID:38738463"
                     /translation="MATWDAWAQEAIAHVFGATLRPGEANEHLVYVPELRDELEAERG
                     ESEPMATWDMSDRLLIARLSLADARDTSWDYIIGAWTRCVREEQRIQASSLSFKSRAL
                     EGLQHARSLLTSYAGLLLDMPDMFPRSTKHGSELGPEAMVPTLLNLAALDDDAPVPTL
                     FDWDAVPPSLAASFVHDVITRFAPDDALDTVLGQSLHALTQCVIRPPGAPADESNQQT
                     AVANDIHAVLAQMLGVPNPQAQASEFSPPREGMTIAQLDWRPIQMALAAAVEHKTLAA
                     ALPFFASFHPDTTAAHMERDSLLGPLLRLSCFPDAYPSIAHDTFTDARSRSPMELESS
                     MSSLRMSLHVVQKANFHIFNALVRAGAEPRERVLAFWGDICHLNAKRGAMQVRSREVA
                     TDAFMMNVFDVLLRFSEPFAEPTCGKIDRIDPLYLQSQRRWDTSTLTRILASEAEGVQ
                     WIQHTPAPHAQRPANFVTEVFFITLRLVNVALGKVLRRVEHREKEMDRLQKRVAELEE
                     SRSTWDNAPYPTGIEQVLQRARAQSDKLYSEVLAAQTQLLEPEFVQRALSFTSFSMTW
                     LVRLADPRQAHPHTTVSLPLPKEVPEIFRMLPEHMFEDACDTVLFYSRRKPDVLDGPA
                     RESITTFCTVFLSSGWYVRNPFLKAKLAEMLSYNVMPYGALSMGVLGDAINNQPLAIA
                     HLVPALMTFWIEAESTGSHTQFYDKFNIRYHLGHVFKAIWDNVDHKKQLHTQARENQA
                     EFAVFINRLMNDVTFLLDDALEKLTELHMKQAEMDDHSAWHQRPAQERQEFESIVRTI
                     QAQIRSDLGLGHEFLRLFIMFTKETSASFMMPEIVDRLAAMLDYNLDVLVGPRCQDLK
                     VKDPKAVGFDPRSLLSEILSVILNLAPHEEFAAAMARDGRSYSREIFSKAASIAQRHM
                     LKSPVDIDALAQLVDRVEKIKAQEAMEEEDLGEVPDDFLDPLLATIMRDPVRLPASRA
                     VIDRSTIKAHLLSDGTDPFNRMPLKLEDVIPADDVREQIEAWIKARRASSSPT"
     gene            <147966..>148862
                     /locus_tag="MRET_1698"
                     /note="MRES_06785"
                     /db_xref="GeneID:38738464"
     mRNA            <147966..>148862
                     /locus_tag="MRET_1698"
                     /product="translation initiation factor 2 subunit 1"
                     /transcript_id="XM_027628325.1"
                     /db_xref="GeneID:38738464"
     CDS             147966..148862
                     /locus_tag="MRET_1698"
                     /codon_start=1
                     /product="translation initiation factor 2 subunit 1"
                     /protein_id="XP_027484092.1"
                     /db_xref="GeneID:38738464"
                     /translation="MRFYEKQLPDTDEIVMCQVRQIAEMGAYVNLLEYDNAEGMILLS
                     ELSRRRIRSIQKLIRVGRNEVVVVLRVDKEKGYIDLSKRRVSPEDVIKCEERYSKSRA
                     VNSIVSHVAHKLDYPVEQIYEKVLWPLDHSYGHSYDAFKLAVTESAKVFEGIDIEPHV
                     LRELEANIARRLTPQPVKIRADVEVSCFGYEGIDAVKAALRAGEAVSTENIPIKIKLV
                     APPLYVLVTHSTDKVGGVALMEQALEKIQETIEKSEGKVTVKMKPKAVSAVEDEELAQ
                     LMAKVERENTEVQGDDDSEDDE"
     gene            <149034..>150668
                     /locus_tag="MRET_1699"
                     /db_xref="GeneID:38738465"
     mRNA            <149034..>150668
                     /locus_tag="MRET_1699"
                     /product="T-complex protein 1 subunit epsilon"
                     /transcript_id="XM_027628326.1"
                     /db_xref="GeneID:38738465"
     CDS             149034..150668
                     /locus_tag="MRET_1699"
                     /codon_start=1
                     /product="T-complex protein 1 subunit epsilon"
                     /protein_id="XP_027484091.1"
                     /db_xref="GeneID:38738465"
                     /translation="MAEPQVAYAQDEYGNPFIVVREQGKKTRAQGTQAIKDHIQAART
                     VANILRTSLGPRGLDKILISPDGDIQVTNDGATIMSNMELEHQIAKLLVQLSKSQDDE
                     IGDGTTSVVVMAGALLEQSEALIDRGIHPIRIADGFERACEVAVRALEKASDKVEFDR
                     DHIDELLKVAQTSLGSKIVSKSSSKFARIATEAVLSVADLERRDVDFDLIKVDGKVGG
                     SLDDSVLVKGVVIDKDFSHPQMPREIRDARIAILTCPLEPPRPKTKHKLDISSVEEYR
                     RLEEYERTTFQSMIQKIKDCGANLVICQWGFDDEANHLLLQYGLPAVRWVGGPEMELI
                     AIATNGRIVPRFEDLTPDKLGHAGLVREMSFGTTRDRMLVIEECANTRAVTAFLRGSN
                     KMVIDEAKRALHDAMCVVRSLVRDNRVVYGGGAAEVCASIAVAQSADEIASMEQYATR
                     AFSAALDVIPLALAENSGLAPIESLAMVKSKQVTESDARYGIDCMGRGNNNMKECHVF
                     DPLVSKRQQLLLATQLVRAVLKIDDVIEQHALEAEM"
     gene            <150741..>152651
                     /locus_tag="MRET_1700"
                     /note="MRES_06790"
                     /db_xref="GeneID:38738466"
     mRNA            <150741..>152651
                     /locus_tag="MRET_1700"
                     /product="peptidyl-prolyl isomerase domain and WD repeat
                     protein 1"
                     /transcript_id="XM_027628327.1"
                     /db_xref="GeneID:38738466"
     CDS             150741..152651
                     /locus_tag="MRET_1700"
                     /codon_start=1
                     /product="peptidyl-prolyl isomerase domain and WD repeat
                     protein 1"
                     /protein_id="XP_027484482.1"
                     /db_xref="GeneID:38738466"
                     /translation="MSKEEQKRAAEDASSSDDDVGPLPGPAGGDSTKRRKTLQYEKLY
                     LDQLPRADRYVKSLMHRDTINFVQVTPHTDFVITTSVDGHVKFWKKQSSSIEFVKHYN
                     AHLSMIVAVATSADGAYFASAAADGSIKVFDVINFDLIHMFQVPYTPRACAWVHRRGS
                     VDTVLAVAEEHSSHIHFYDGRDSDGTPLFSSTKVHKNPCHILAYNEPYDCIVSADTSG
                     MVEYWQPREPYVMPQGLFSLKSNTDLFEFKRTKSVPATLTFSPDFQRFATTSTCDRQV
                     RVFDFQHGKLLRKYDESLAAVQEMQQANTTIYQLDDMEFGRRLAVERDIDASTLPGLG
                     DAVANAIGAGTANAVFDQSGNFIMYGTMLGIKMVNLKTNKVARLLGKEETMRFMNVSL
                     YQGVPIKKFTTNIALAVSNNPLAKPDEQDPTLFCTAFKRARFYMFTKNEPDTDPTSKL
                     AGQDRDIFNEKPTREEQAIASENPGAKKKHVITSAILHTTAGDVHLQLYPQLVPKTVE
                     NFVGLAKKGYYNGVIFHRVIKKFMIQTGDPLGDGTGGESLWGGEFEDEFVKELRHDRP
                     YTLSMANAGRNTNASQFFITTVPTPWLDNKHTIFGRATGGLDVIHKIENASINKFDKP
                     KEDIQIFSISLH"
     gene            <152805..>154538
                     /locus_tag="MRET_1701"
                     /note="MRES_06795"
                     /db_xref="GeneID:38738467"
     mRNA            <152805..>154538
                     /locus_tag="MRET_1701"
                     /product="mitochondrial carrier protein"
                     /transcript_id="XM_027628328.1"
                     /db_xref="GeneID:38738467"
     CDS             152805..154538
                     /locus_tag="MRET_1701"
                     /codon_start=1
                     /product="mitochondrial carrier protein"
                     /protein_id="XP_027484481.1"
                     /db_xref="GeneID:38738467"
                     /translation="MELWHPALLGHRSVPTLWASAPKSERSERALGDVNQVPTSVQVY
                     NACIYKKLRQCSDNCGLGLDHPTNHRIVLGDRGTSLRKYASWRIELEQAIDKKIMSAT
                     DVSKILWEAQMAHMEQRYVLCAVLLRRASELESAEACAMLAKMFGFGVQQAGTHLFER
                     DSLRGIAWGIRALQLVVLDMERNVTSNSALQIMYQTLKWLCILVCSIESLQALRVMDS
                     YADVSMALLLLFPRSCELLHPEARVKDTIPAELTRESIWSALRDVLCKVKATESMNRE
                     EEPGDSVSVEHDLTHIHLFTLFLESFLLMRKAVMEKEAAFMQETYEAWTEYLAETRSN
                     SQEFTQFRNVASEVQQWAAPDAERSLNHTLSEAEMSAMFQRISSVFPFTCAKSKEPHI
                     SVTQMNEHRLKHQRSRRDLRASWNIPLRKPMSYPQPYSQIKPPSALSAPSTDHAMRHN
                     TQRFFGSTSTKLRDVSNVMNRRILSADHACMMDSEPDDEAPYWSRMGDKVGKVRRRPS
                     SVLSVTPSLMFPSKAPVDTNAPGVSEADTKQEHIYATSSTVGSTSDADRLRSRLRRQS
                     SRASLHAAIQS"
     gene            154595..154686
                     /locus_tag="MRET_t0027"
                     /db_xref="GeneID:38741221"
     tRNA            154595..154686
                     /locus_tag="MRET_t0027"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:38741221"
     gene            complement(<154775..>155323)
                     /locus_tag="MRET_1702"
                     /db_xref="GeneID:38738468"
     mRNA            complement(<154775..>155323)
                     /locus_tag="MRET_1702"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628329.1"
                     /db_xref="GeneID:38738468"
     CDS             complement(154775..155323)
                     /locus_tag="MRET_1702"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484484.1"
                     /db_xref="GeneID:38738468"
                     /translation="MDQTLPYDPPPSTTNVSQKDTNRDTDTSKRGIGVTKFESYNEGP
                     SEKETRETTSCGLKVPQEDRTKKEPIKKRPSHLGSMVRKKRKSHLADLSAAATAQPVK
                     LNTLEKSKLDWEAYKGNIKQTENQDTMSTEEREELEAQTKGGGSGLGDVKGFLHRKEF
                     LDRVHDRLDTQEYEAFHAKNNP"
     gene            <155521..>157149
                     /locus_tag="MRET_1703"
                     /db_xref="GeneID:38738469"
     mRNA            <155521..>157149
                     /locus_tag="MRET_1703"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628330.1"
                     /db_xref="GeneID:38738469"
     CDS             155521..157149
                     /locus_tag="MRET_1703"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484483.1"
                     /db_xref="GeneID:38738469"
                     /translation="MLCPNTMPHDRECEPPHVSESYAGSCASTNQTSTITAVSAIPNS
                     IPSTASRNLPPSECVSGLVTDTITSTEDATSQLPALSQSSSSERQLDSCTTQNTRRPN
                     AEHNNEASPTSVHRSLYPIIDSVQSDIHESLSSLNTAEYSASGHEINDTTSAGANQDQ
                     NEEHQRRHSEPPSPNGTTDPQRDDHADSPSEAHTNARPSSRFFMYIPEQASPFPFPLL
                     SDVGSNLVWPIIDCIERTRNQDTGEESTRLVHVLGMPFHLTFTMRPSDPNDVPDSNKA
                     RAYVESLERVDAELRSRMAHFSITSASVESSNDASMQHVSGCGVCLEPYPIEDKPAWF
                     TEGTNEPDETVVAIPCHGFHTIHASCLVEWLSSKAPSQWSCPYCRAPLRSNAKHNPPP
                     MTLREYVKQKEREHGWRCDAPTCFPCYSDGEKHESPLIKLMPCRHEIHLDCLCTNMRI
                     EMAYSGARSYTDCEEDTDDDDTNDSMTEERESAPHLDANVHLASDLTQNCTENDTIGK
                     WLTCSVCRRDAWALLPRRQRPRRSLHRSLHGLVS"
     gene            <157352..>160540
                     /locus_tag="MRET_1704"
                     /note="MRES_06800"
                     /db_xref="GeneID:38738470"
     mRNA            <157352..>160540
                     /locus_tag="MRET_1704"
                     /product="Ca2+:H+ antiporter"
                     /transcript_id="XM_027628331.1"
                     /db_xref="GeneID:38738470"
     CDS             157352..160540
                     /locus_tag="MRET_1704"
                     /codon_start=1
                     /product="Ca2+:H+ antiporter"
                     /protein_id="XP_027484478.1"
                     /db_xref="GeneID:38738470"
                     /translation="MSRLPPELSVPKSPAQSSSPQFQPNQSNSFMSRRNTVTPIAPLR
                     GQATDSPDASFPTEDSMPINEDRGEALIRQRIRERKRDKRTKQRDNSDADASRSLISD
                     STEKPQSQSVSNPPMSASFRDSGKGVHGHAHFDDTKRMSMDEQAVSDNDPTPQALSDL
                     YGVEAQDSTLGDFDENQDDQNGDELDYTVKDRQDAINIEHPFGLPIWKPALYKKSRSI
                     QRTADKALKCTPGLQTRNSAALGNILWLVFVGIWISCLCFFCAALLYCVPRGGAMYGH
                     KLYGLGTYILWPFGNYVEVECSHASGHRHGPCRLPAVHEHEVKDEEDENLEHVDTPYP
                     GTETDPLVQPGSSALYGGVQNDEEDGQLSEDERISLELKLYHYVFDKNGNDVGASKRI
                     GGILAYALVYGLVIFPALGIVCLLCWALVVTIPMAKLTWTLIKNLASQPLALHFRSPF
                     QIDTRTLKVKDSDQAQFQNVLHPGHMAPLLKRKHRKKGTSKRRSVILVCLYEAMGKEY
                     FKYTVGGVNIMFVNTIPLIFLTQIMFYVIRPYAMSHNITSGVLAMLSNDSIIFIMSLA
                     SVLPLSYFIGMAVASISTQSSIGMGAVINATFGSIIELILYSIALTEAKASLVEGSII
                     GSILAGVLLMPGLSMCSGATRRKEQTFNSRSAGVTSTMLIMAIIGILTPTMFYQIYGK
                     FELVCTGCPDDASNAEDRFRCDKCSYEHISPLDDSFFQTNVKGLIYSCAAILLLAYGI
                     GLWFSLRTHASHIWNSTPSTIHPEHLPPPLHRASVYKRLFPKNYEPRLPLHHQNEAGP
                     STRDVDSQVSSTSATPSLHNESTSSHTQKQNKSKPQEDMLLDAAARMYQYLFNRHKSG
                     QPYETIAEEQEGQEDGQGGHDAPSWSRSVSLSVLLGCTVMYAIIAEIIVDLVDVVIEG
                     SGLSPKFIGVTLFALVPNTTEFMNAMSFAINGNIALSLEIGSAYALQVCLIQIPVLVG
                     FSAFYNSSYAKSGIDMAARSFTLIFPRWDVIAIILSVFLLTYTYNEARSNYHRGSILI
                     LAYLVFIAGFFFAPTIDLDDPTQQPQTRVFTV"
     gene            160668..160858
                     /locus_tag="MRET_nc0002"
                     /db_xref="GeneID:38741158"
     ncRNA           160668..160858
                     /ncRNA_class="snRNA"
                     /locus_tag="MRET_nc0002"
                     /product="U2 small nuclear RNA"
                     /transcript_id="XR_003525359.1"
                     /db_xref="GeneID:38741158"
     gene            <161029..>162123
                     /locus_tag="MRET_1705"
                     /note="MRES_06805"
                     /db_xref="GeneID:38738471"
     mRNA            <161029..>162123
                     /locus_tag="MRET_1705"
                     /product="aspartate-semialdehyde dehydrogenase"
                     /transcript_id="XM_027628332.1"
                     /db_xref="GeneID:38738471"
     CDS             161029..162123
                     /locus_tag="MRET_1705"
                     /codon_start=1
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="XP_027484477.1"
                     /db_xref="GeneID:38738471"
                     /translation="MTDAKIKVGVLGATGTVGQRFILQLSSHPVFELAALGASSSSAG
                     KSYHDAVAGRWKQIHPIPSQVRNMPVHECEPGAFSECSVVFSGLDSGPAGPVEAAFRE
                     ANLRVFSNAKNYRRDPLCPLIVPLVNPSHFDIVPHQRASLSLDRGFIVTNANCSTTGV
                     IVPLKALEDAFGPLDIVMVQTMQAISGAGYPGVSSLDMLDNIVPYISGEEEKIEWETS
                     KILGGLKQNNTAFDLHESSPMRISAQCNRVPVVDGHLSCVSVSFKKQPAPSPEQVAEA
                     LRSYTCEAQKLGCHSAPTQAITVHDELDRPQPRLDREWQNGAGVNVGRIRACPVLDVK
                     FVTLVNNVMLGAATSSVLNAEIAHKKGLLS"
     gene            complement(<162141..>163967)
                     /locus_tag="MRET_1706"
                     /db_xref="GeneID:38738472"
     mRNA            complement(<162141..>163967)
                     /locus_tag="MRET_1706"
                     /product="dihydroxy-acid dehydratase"
                     /transcript_id="XM_027628333.1"
                     /db_xref="GeneID:38738472"
     CDS             complement(162141..163967)
                     /locus_tag="MRET_1706"
                     /codon_start=1
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="XP_027484480.1"
                     /db_xref="GeneID:38738472"
                     /translation="MRRQWWANVARSMARCPARGMSTSCACAAAKERPQPGDLNHYSR
                     IITQPKDQGASQAMLYATHGIESDSDLKRAMVGVASVWYEGNPCNAHLLGVGQRIRQS
                     LDNAGVTGYQFGTVGVSDGISMGTSAMSYSLPSRDLIADSVESCMGGHWLDGCVVVPG
                     CDKNMPGVLMALGRLNRPGIMVYGGTIRPGHCESMSGTLDIVSAFQSYGQYLASGSSP
                     SAEKVRYDTVRHACPGPGACGGMYTANTMASCAEVLGMTLPGSSSFPAEYDEKKAECD
                     SIGQAMRTLLEKNIRPRDIMTRSAFEDAITLTMVLGGSTNAVLHLLAMAKSVGVDLTI
                     DDFQRISDATPFLANLKPSGTYVMEDVHRVLGGIPSVVHYLIENKLIKGEHLTVTGLT
                     LRENCERWVAERGPMPKNQDVLRPIDQPIKSTGHIRVLYGNLAPGGAVAKITGKEGLH
                     FTGKARVFDTEDDMVHAVEQGSIKKGEKTVIILRYKGPKGGPGMPEMLKPTSLIMGAG
                     LGHDVACLTDGRFSGGSHGFVIGHVVPEAQEGGPIVLVQDGDVITIDAERNTINMTSV
                     TDEELEQRRAAWKPRPLKVTQGGLYKYTRLVSDASQGCVTDA"
     gene            complement(<164028..>166955)
                     /locus_tag="MRET_1707"
                     /note="MRES_06810"
                     /db_xref="GeneID:38738473"
     mRNA            complement(<164028..>166955)
                     /locus_tag="MRET_1707"
                     /product="phosphatidylserine decarboxylase"
                     /transcript_id="XM_027628334.1"
                     /db_xref="GeneID:38738473"
     CDS             complement(164028..166955)
                     /locus_tag="MRET_1707"
                     /codon_start=1
                     /product="phosphatidylserine decarboxylase"
                     /protein_id="XP_027484479.1"
                     /db_xref="GeneID:38738473"
                     /translation="MPNESRQAFGVERVPLHDSLNKSPEEDDDLVGLRVDLLRLRTQD
                     TMPASVDVILSIRGSFEGNQPSYYVAQHETELDYDFGHESKLVELPPSCCATREANTV
                     HSGMLHRSKRMILGFGRRRTRGVSGEVPTTSQGSIRPQRMRSHSSPAPPSMEVTHQMG
                     IEFRVLLDDGKKQICVGECMYSVTEVSDQALWLPIITKQGHLHSGLQVTLSLLNENQW
                     HQYKLERSLITAPADEPVGMVEEDEHFVNEVIFDRVDEDEDEDEGSAMDEPPIEQLQR
                     SRHFGMRRHTRRLHTQAPQETTALSDTDTLPHGALSSQLVRRKHRRRLGLARRQQRHY
                     SAIHTAGQLGLDTHGVQGIITMEVVSARDLPRWRNMTYTSFDMDPFVVVSFHRKVFRT
                     RVCRHTLNPEWREKLYVHVHSRETSYNVRFAVYDWDNMSSNDYVGEVSLEIRMLMEAA
                     EKGSGKVALDLPLEREGHDEDAKFGVGKPRPTLQLEAAYQSYSALRRQFWREMLRLYD
                     TNESGSIDMDELHTMLMSLGSSLTPTTLAGFFERFGKNPYVDGLTLDEGVRALEEELE
                     KSWAHRCDPETADDTDDAVDVERVIQLRECPWCHMPYLSHANESDVVTHLALCSSQEG
                     RAVDDFMVSNFVTATQARRKWYTNMFKTMSQGVYQIGANSANILVQDRLTGQLVEEKM
                     QVYVRLGIRLLYQGAKSRMEGARARRILRNMTIKQGAKYDQPSSVRAIKPFVMFHNID
                     EHEMVDALDSFTTFNEFFCRRIDMSLRPLAEPDNSACLVSCADCRLMAFENVDQATKL
                     WIKGRHFSIARLLGSNISHEQFALLIFRLAPQDYHRFHAPVDGVVGPPKWLEGEYYTV
                     NPMAIRSAIDVYGENTRVVIPITTHDFGTVYLVAIGAMMVGSIVMTAQQGQHVQRNDE
                     LGYFKFGGSTLVLLVDAARVQWDDDLLVNSDACIETLVRVGMRMGHARTLPDSVGEET
                     RPR"
     gene            167121..167202
                     /locus_tag="MRET_t0028"
                     /db_xref="GeneID:38741222"
     tRNA            167121..167202
                     /locus_tag="MRET_t0028"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:38741222"
     gene            complement(<167348..>167744)
                     /locus_tag="MRET_1708"
                     /db_xref="GeneID:38738474"
     mRNA            complement(join(<167348..167431,167457..>167744))
                     /locus_tag="MRET_1708"
                     /product="TRIAP1/MDM35 family protein"
                     /transcript_id="XM_027628335.1"
                     /db_xref="GeneID:38738474"
     CDS             complement(join(167348..167431,167457..167744))
                     /locus_tag="MRET_1708"
                     /codon_start=1
                     /product="TRIAP1/MDM35 family protein"
                     /protein_id="XP_027484486.1"
                     /db_xref="GeneID:38738474"
                     /translation="MSNERVDHGTPKLGQMNSMSPECTPLKHKYDDCFHTWFKDYLDM
                     SSSANVEPSSPPKQHPWPSRVKQAPSSDLTSLRKRYETDCGKLFEEYQACIKRSIKDK
                     GLHEAIEKARNENPFPRHHNC"
     gene            167954..168062
                     /locus_tag="MRET_nc0003"
                     /db_xref="GeneID:38741159"
     ncRNA           167954..168062
                     /ncRNA_class="snoRNA"
                     /locus_tag="MRET_nc0003"
                     /product="small nucleolar RNA snR60/Z15"
                     /transcript_id="XR_003525360.1"
                     /db_xref="GeneID:38741159"
     gene            <168382..>168942
                     /locus_tag="MRET_1709"
                     /note="MRES_06815"
                     /db_xref="GeneID:38738475"
     mRNA            join(<168382..168478,168527..168663,168704..168714,
                     168820..168830,168875..>168942)
                     /locus_tag="MRET_1709"
                     /product="cytochrome c"
                     /transcript_id="XM_027628336.1"
                     /db_xref="GeneID:38738475"
     CDS             join(168382..168478,168527..168663,168704..168714,
                     168820..168830,168875..168942)
                     /locus_tag="MRET_1709"
                     /codon_start=1
                     /product="cytochrome c"
                     /protein_id="XP_027484485.1"
                     /db_xref="GeneID:38738475"
                     /translation="MPFAEGDAKKGAGLFKTRCAQCHTVEEGGPNKVGPNLHGIFGRK
                     TGQAPGFSYTAANVNKGITWNEETLFEYLENPKKYIPGTKMAFNGLKKDKDRNDLVTY
                     LREAC"
     gene            <169458..>170918
                     /locus_tag="MRET_1710"
                     /note="MRES_06820"
                     /db_xref="GeneID:38738476"
     mRNA            <169458..>170918
                     /locus_tag="MRET_1710"
                     /product="GATA zinc finger"
                     /transcript_id="XM_027628337.1"
                     /db_xref="GeneID:38738476"
     CDS             169458..170918
                     /locus_tag="MRET_1710"
                     /codon_start=1
                     /product="GATA zinc finger"
                     /protein_id="XP_027484524.1"
                     /db_xref="GeneID:38738476"
                     /translation="MAISTSLSHSKDLYQLDSKLYKPRLPRTTEIMPNFPPNDIASSY
                     RGTNASIGIVSEDRPGPAGALDKSSAADAPAVNMYRSTAIMPSRTPSMSGSLASPSPP
                     PPAPTPAPVPSHVPDIPDQAPVPVSRPGRSTEAPPSYASCTASRNYASVLPWSVPTPS
                     SSTSSEANAVYALERLHAAALALYNHVGEQLSVQHSMMRQEDVHTLLPLVSDINQEVR
                     TLMSAYDYRAGRDVVDMAPYYPWMPNSSTSPYYSPVVSDERDSKLMRMDDDPLGTVRR
                     RNIGQRNKAGSKYAARPDARVTSSTDDLIFAARLHGAHSSYAASANAYGKAATHEPSQ
                     PPAHMPKYRKRSRAPAPGVCHSCGHSDTPEWRRGPEGARTLCNACGLHFAKLVRRRTL
                     EYANAAPGTPIPPVTIAELRQSTNVDVRSSSVAPMNDERVRIGSIKGSAVCSYDETAP
                     SDPSRTPHTSHERALADAPHDPPSTMHTVSSETAEQ"
     gene            complement(<171118..>171732)
                     /locus_tag="MRET_1711"
                     /note="MRES_06825"
                     /db_xref="GeneID:38738477"
     mRNA            complement(<171118..>171732)
                     /locus_tag="MRET_1711"
                     /product="large subunit ribosomal protein L15e"
                     /transcript_id="XM_027628338.1"
                     /db_xref="GeneID:38738477"
     CDS             complement(171118..171732)
                     /locus_tag="MRET_1711"
                     /codon_start=1
                     /product="large subunit ribosomal protein L15e"
                     /protein_id="XP_027484525.1"
                     /db_xref="GeneID:38738477"
                     /translation="MGAYKYLEELYKKKQSDVLRFLLRVRCWEYRQLNVVHRASGPAR
                     PDKAHRLGYKAKQGYVIYRVRVRRGDRKKHAHKGATYGKPVRQGVNKLKPQRSLRALA
                     EERVGRKVSNLRVLNSYWLNQDGVYKYFEVICVDPQHKAIRRDPRINWIVNPVHKHRE
                     CRGLTGAGKKSRGIGKGHGFHNTIGGGRNAAYRRREILHLRRYR"
     gene            <172067..>173011
                     /locus_tag="MRET_1712"
                     /note="MRES_06830"
                     /db_xref="GeneID:38738478"
     mRNA            join(<172067..172069,172112..>173011)
                     /locus_tag="MRET_1712"
                     /product="large subunit ribosomal protein L5e"
                     /transcript_id="XM_027628339.1"
                     /db_xref="GeneID:38738478"
     CDS             join(172067..172069,172112..173011)
                     /locus_tag="MRET_1712"
                     /codon_start=1
                     /product="large subunit ribosomal protein L5e"
                     /protein_id="XP_027484522.1"
                     /db_xref="GeneID:38738478"
                     /translation="MAFHKTVKSDSYFSRYQTKYRRRREGRTDYYARKRMISQFKNKY
                     NAPKYRLVVRFSNRFVTCQIVYAKIQGDYVFAHASSRELPRYGIKHGLANWTAAYATG
                     LLVARRALKKLGLDEKYQGQEEPDGELVHTEPLGDDEPRPFKCYLDVGLKRTSTGSRV
                     FGAMKGASDGGIFIPHNARRFPGYDVEAKELDAEVLRNYIYGGHIAEFMESLEEEDDE
                     RFKKHFSSYLNDDIGSEDIEEIYEKAYEAIREDPDFKPTEKSKDWAAESKKFRQPKLT
                     YEQRKERVQKKIAAFQDAFNLDDE"
     gene            <173201..>174685
                     /locus_tag="MRET_1713"
                     /note="MRES_06835"
                     /db_xref="GeneID:38738479"
     mRNA            <173201..>174685
                     /locus_tag="MRET_1713"
                     /product="repressible acid phosphatase"
                     /transcript_id="XM_027628340.1"
                     /db_xref="GeneID:38738479"
     CDS             173201..174685
                     /locus_tag="MRET_1713"
                     /codon_start=1
                     /product="repressible acid phosphatase"
                     /protein_id="XP_027484523.1"
                     /db_xref="GeneID:38738479"
                     /translation="MTTMGPLGAYNATVPQMASFAASAHVARNDSRHFHVPFRSQYDR
                     LGENRASEAIEVHWLPKNASHDHASSSDIFRNLGQISPYQPADDLFPETAKHQAIPEQ
                     CRLVQAHLLHRHGARYPTHGSDKGPGRFGARLAKANGTFQASGDLAFLGNWTYGLGLE
                     DLVNYGAKGMFDAGSHDYYDYAGLLDHKLLVRTTTQNRMLESARYWALGFFGWDAPNR
                     MHFQVIDEAEHKNNTLSPKYACKNAHEKRFKLGDDLSASWRAVFLPPIAARLQSHVQG
                     FEFSLDDVFDMMSACAYETVALGTSEFCRLFTKAEWENFEYAKDLEVQGSDGFMGPMA
                     RALGVGWVTEFLYRLEQKPFAGPFTSQNATLVTNSKHFPVHDKLYVDFSHDRVMTSIL
                     TALNMTQIGDKLDPKRPDPNRRYRASRVTPFGARFAFEVIDCGDESPWVRAKINEAIV
                     PLNQHQGCTKPRPDGLCPLTQFVQHVRHAIESIDFDRACNEYDS"
     gene            <174850..>176466
                     /locus_tag="MRET_1714"
                     /note="MRES_06840"
                     /db_xref="GeneID:38738480"
     mRNA            <174850..>176466
                     /locus_tag="MRET_1714"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628341.1"
                     /db_xref="GeneID:38738480"
     CDS             174850..176466
                     /locus_tag="MRET_1714"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484520.1"
                     /db_xref="GeneID:38738480"
                     /translation="MQAFLSVLALSTLCASRLATAKDKEEANWGNVTGTSPVTFPQNV
                     GFGGEQKSGGSPFNAMVDTLGSDHDDVVEMRWKPKDAEKDHSSWEDLWYNLGEFAPYH
                     AAKRVFPDMVSHSTVPKHCTIKQAHVLHRHGAKFPDKGHKNGPGNFGKIVSDQRKQGK
                     LNVSGDLSFLEDFDYDLGQKILTHQGSEQMFRSGVKHYYDYAQLLDKYHKKPVFRTSS
                     HSRVVDSARYFGLGFFGWDASNHYNLEVLTETDYQNNTLAPKNACRNADNDDFMYDEY
                     LSSQWQNIYLEAPRKRLQENFHSYNLTKTDVYNMMLSCPYLTSGIGFSQFCHLFTKEE
                     WENFAYDQDLQLVGKHGFQNPTARAVGVPYVQELVSRLQKHKFTGPVTAQNMTITSNE
                     TYFPLDQPLYIDFSHHSVMFSVVTALNLTQFKEEFNPTKPNPKRKLRSGDVTPMGMRL
                     AWEVLDCEDEDMYIRLKLNDVVYPLDESNGCEKRKDGLCKLDTYASYLDKHAYEASKF
                     DLACFGKNGTDFVLTGPVQDGTIPQHAIKK"
     gene            complement(<176541..>178082)
                     /locus_tag="MRET_1715"
                     /note="MRES_06845"
                     /db_xref="GeneID:38738481"
     mRNA            complement(<176541..>178082)
                     /locus_tag="MRET_1715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628342.1"
                     /db_xref="GeneID:38738481"
     CDS             complement(176541..178082)
                     /locus_tag="MRET_1715"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484521.1"
                     /db_xref="GeneID:38738481"
                     /translation="MIGIALVAAALSTVVNAWGDQTINWKNTTGTSSETFPTDVGVLG
                     DTATGQSPFNAQYDRFSSDKVEFVYAIDMRHKPKNANQDQASTDDIYKNLGTYTPWRP
                     ADGLFPETEAHRMVPEHCEVKQVHILHRNGATYPEDAPNEGLPKLMKKLVKGIHDNKI
                     HPKNELSFLYNWDYKLGQALLVHQGAQELFDSGVKHYYDYAKLLTDHKKPVVRTTSHS
                     SMLDSARYWTLGFFGWDAPDKVNLEVLLDADHQNNTLEPSKACQNAYKLTKGDDLVNE
                     WQNIYLQDARNRLQSSLDGYSLSVSDVSQFMSLCAYETVGFGFSNFCHLFTKEEWEGF
                     QYQSDLQQQGNEGFMSPTAKARGLGWVQEFLRRVTKKPFKGPVASKNMTIDNNETYFP
                     LNQPVYADFTRDSVITNILTAFGFTQFAKPLKGNKLDSSRTFRSSKVVPFASRIVFEI
                     LDCHKGEGKGEYVRVKVNDAVLPLGHDQGCKESKDGLCQLHDFVQHVESCVDTYDFDG
                     ACCNN"
     gene            <178710..>179051
                     /locus_tag="MRET_1716"
                     /note="MRES_06850"
                     /db_xref="GeneID:38738482"
     mRNA            join(<178710..178756,178784..178895,178921..178983,
                     179013..>179051)
                     /locus_tag="MRET_1716"
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 4"
                     /transcript_id="XM_027628343.1"
                     /db_xref="GeneID:38738482"
     CDS             join(178710..178756,178784..178895,178921..178983,
                     179013..179051)
                     /locus_tag="MRET_1716"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 4"
                     /protein_id="XP_027484518.1"
                     /db_xref="GeneID:38738482"
                     /translation="MVSPNTARKGIQWSKIMPVEVYPIVAVSVLAVGGATWYLTRLAR
                     SPDVIWDKKNNPTPWNNVEPGTQYKLLNITGEFDKKYKRDRL"
     gene            complement(<179111..>180552)
                     /locus_tag="MRET_1717"
                     /note="MRES_06855"
                     /db_xref="GeneID:38738483"
     mRNA            complement(join(<179111..179152,179195..179207,
                     179272..179500,179529..>180552))
                     /locus_tag="MRET_1717"
                     /product="delta14-sterol reductase"
                     /transcript_id="XM_027628344.1"
                     /db_xref="GeneID:38738483"
     CDS             complement(join(179111..179152,179195..179207,
                     179272..179500,179529..180552))
                     /locus_tag="MRET_1717"
                     /codon_start=1
                     /product="delta14-sterol reductase"
                     /protein_id="XP_027484519.1"
                     /db_xref="GeneID:38738483"
                     /translation="MSNKKDSAQADVLAPRSRELEFGGVLGALFITVTVPLTMYYLTF
                     GCSPEMGCSLPLSASNAQALWTYARQQLVASFQDRMGWNLYYAWYMYCVVAWFVVDGK
                     WVEGLPLRTGEKLRYKINALKTGAIALGFAMTIIFIKGPASFTLLYDHFPGLLSAALV
                     NSILQAVYVYAASFHGKKLLALGGNSGNPIFDWFIGRELNPRIGEFDIKTFNELRPGL
                     ILWALLDISCVCHQYTKFGWVSDSIVLVTLFHIWYIADSLINESTILTQMDITTDGFG
                     FMLSVGDLAWLPFTYCLQARFLAFHPIHLGWLGVLAILAVQFTGYYIFRVANLEKNEF
                     RHGRNPKGLQYMTTSSGRKLLTSGWWGRSRHPNYLGDWIMGWAWCLPCGFSTPIPYFY
                     VIYFAVLLWHRQLRDDDACRKKYGADWDVYCRRVPYRIIPYVY"
     gene            <180614..>182278
                     /locus_tag="MRET_1718"
                     /note="MRES_06860"
                     /db_xref="GeneID:38738484"
     mRNA            <180614..>182278
                     /locus_tag="MRET_1718"
                     /product="prenylcysteine oxidase/farnesylcysteine lyase"
                     /transcript_id="XM_027628345.1"
                     /db_xref="GeneID:38738484"
     CDS             180614..182278
                     /locus_tag="MRET_1718"
                     /codon_start=1
                     /product="prenylcysteine oxidase/farnesylcysteine lyase"
                     /protein_id="XP_027484526.1"
                     /db_xref="GeneID:38738484"
                     /translation="MVGLRSPVWLWATAVLCQAGYILSWQQEPFIVASSNISECPSYS
                     RPELRVAIIGAGASGTTAAYLLSKAQERLHEVHMQGLPGCEGAVWPERVQTTVYERDR
                     VGGRVHHVHPLDDLQQAPVEMGASILSSANQHILYATDKFGIKRVPPEQIHGGGYGLW
                     NGKEVLIDQFSDTKWDQLRLYWRYGRSLSIAFQLMQRALTSFLQLYSPMFLQERSSPT
                     SKSGFPWSSVKGLAHSLGLQDPSTVSTKNYYMSHKVSAAFVDEVINGVTRANYAQHVE
                     HIHALAGMVSMAATNAFSMEGGNTQIFERMLAASGATVHTGIAGQVTGLMRMQGASSQ
                     WWVGTRDGRGSVFDAVIIATPWQSAHITLLNTEHTVPMFDMQQVHVTLVATDAPRPSQ
                     AYFGYAGTSQVPRTILTTQAPDGSVPEFLSLSYLREMHHVRHAGTTWDKLYLVKLFSL
                     APLSPQQLERILSGRIVWTRHHAWSAYPQLTPPSKWPSFHVAQNLYNINAMERWVSTV
                     ETSTIAAKNTVASLLQNWLGAGFVLGQNCTWESASVAAHWDTWGCT"
     gene            complement(<182317..>182781)
                     /locus_tag="MRET_1719"
                     /note="MRES_06865"
                     /db_xref="GeneID:38738485"
     mRNA            complement(join(<182317..182733,182779..>182781))
                     /locus_tag="MRET_1719"
                     /product="cofilin"
                     /transcript_id="XM_027628346.1"
                     /db_xref="GeneID:38738485"
     CDS             complement(join(182317..182733,182779..182781))
                     /locus_tag="MRET_1719"
                     /codon_start=1
                     /product="cofilin"
                     /protein_id="XP_027484527.1"
                     /db_xref="GeneID:38738485"
                     /translation="MSSGVKVSQECLEQFQSLKLGRKTKYIIYTLSPDNTEIVVSKTS
                     DSSNYDDFLAELPPAECRYAIYDFEFQKGDEGKRNKICFFTWSPDESKVKQKMLYASS
                     KEALRKALVGIATEIQGTDLSEVSYEAVLEKVMRSTF"
     gene            complement(183051..183150)
                     /locus_tag="MRET_t0029"
                     /db_xref="GeneID:38741223"
     tRNA            complement(183051..183150)
                     /locus_tag="MRET_t0029"
                     /product="tRNA-His"
                     /db_xref="GeneID:38741223"
     gene            complement(183214..183313)
                     /locus_tag="MRET_t0030"
                     /db_xref="GeneID:38741224"
     tRNA            complement(183214..183313)
                     /locus_tag="MRET_t0030"
                     /product="tRNA-His"
                     /db_xref="GeneID:38741224"
     gene            <183581..>184371
                     /locus_tag="MRET_1720"
                     /note="MRES_06870"
                     /db_xref="GeneID:38738486"
     mRNA            join(<183581..183661,183812..183826,183877..>184371)
                     /locus_tag="MRET_1720"
                     /product="Ras, member A"
                     /transcript_id="XM_027628347.1"
                     /db_xref="GeneID:38738486"
     CDS             join(183581..183661,183812..183826,183877..184371)
                     /locus_tag="MRET_1720"
                     /codon_start=1
                     /product="Ras, member A"
                     /protein_id="XP_027484103.1"
                     /db_xref="GeneID:38738486"
                     /translation="MTELRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVA
                     DVEVDGRHVELALWDTAGQEDYDRLRPLSYPDSHVILICFAIDSPDSLDNVQEKWISE
                     VLHFCQNLPIILVGCKKDLRRDPKIIEELRKTSQRPVTPEEGMAVASKIGAVRYLECS
                     AKTGEGVREVFEHATRAALIQKPRGGRSGKSKCLVL"
     gene            <184691..>186349
                     /locus_tag="MRET_1721"
                     /note="MRES_06875"
                     /db_xref="GeneID:38738487"
     mRNA            <184691..>186349
                     /locus_tag="MRET_1721"
                     /product="guanosine-diphosphatase"
                     /transcript_id="XM_027628348.1"
                     /db_xref="GeneID:38738487"
     CDS             184691..186349
                     /locus_tag="MRET_1721"
                     /codon_start=1
                     /product="guanosine-diphosphatase"
                     /protein_id="XP_027484102.1"
                     /db_xref="GeneID:38738487"
                     /translation="MSNSPFLWAPRIVRTRKPIVLLCITILILLVLVPFNLHSNVSTI
                     FKDTAAELRDSQKWHIPPFPGLSMYRPAPTSTRIPPQLHHDPSLTSRCSNATPVYDPN
                     GRRRPVVQYAIMIDAGSTGSRIHVYKFNYCKASPELEFEHFDHIEPGLSSYKADAQGA
                     AHSLRPLLDKALDIVPQPLQACTPLQLKATAGLRLLGPEQSGAIIQAVRHMIESSYPF
                     PIADLVDNHDKATKNGIEIMDGRDEGVFAWITVNYLMNLIGSGGNKKTAAVMDLGGGS
                     TQIVFQPQLQASSPMHPGEHVYELKNFENSSFTLYQKSYLGYGLKQARESINSLTAFL
                     HLSTNPQAAQHAGDVSAWDKFSPQTMFVPSPCYAAGAQKTAKVSLGKFKTSDITMVGT
                     SGGFRACQRLVEVTMNKDAECHIAPCSFAGVYQPSLSHAFKNSDIVALSYFYDRIAPL
                     GLGPTFTIRELEQLAERACSLPSQWSLFKSPSFSAETVAELQQRPDYCLDLTYMHTLL
                     RLGYELDDSRKITLAKKLGDFELGWALGAQLAVLQQGVLCKASM"
     gene            complement(<186362..>187192)
                     /locus_tag="MRET_1722"
                     /note="MRES_06880"
                     /db_xref="GeneID:38738488"
     mRNA            complement(<186362..>187192)
                     /locus_tag="MRET_1722"
                     /product="derlin"
                     /transcript_id="XM_027628349.1"
                     /db_xref="GeneID:38738488"
     CDS             complement(186362..187192)
                     /locus_tag="MRET_1722"
                     /codon_start=1
                     /product="derlin"
                     /protein_id="XP_027484586.1"
                     /db_xref="GeneID:38738488"
                     /translation="MDLVQSMPPVTRVMIIGMALMGLSCSTNMVSPYDLALLWPWILK
                     RWQWWRIMSAFLFPGLGLQMLYNGVFFLEMSRTIESSVFLGDTAEYVWSLMGISSFIL
                     AFNYPLSSPFLFQPLSSALTALFSIHLPHINLSLLGMFSMPGKYVALGSLGISLIAGG
                     VPECLQCFTGIAAGYLWHVLKNPLRPDQDRRHHRILSFIGKYISPRLQVPTALRQMMA
                     RTSPIRRTSFGTVYPSRRSTTSTTSSRTKPAREQTRPDRAAILAATEARLRATAQNEK
                     "
     gene            <187274..>188194
                     /locus_tag="MRET_1723"
                     /note="MRES_06885"
                     /db_xref="GeneID:38738489"
     mRNA            <187274..>188194
                     /locus_tag="MRET_1723"
                     /product="m7GpppX diphosphatase"
                     /transcript_id="XM_027628350.1"
                     /db_xref="GeneID:38738489"
     CDS             187274..188194
                     /locus_tag="MRET_1723"
                     /codon_start=1
                     /product="m7GpppX diphosphatase"
                     /protein_id="XP_027484585.1"
                     /db_xref="GeneID:38738489"
                     /translation="MSDFVLDRVLYEDPRAKTANLLGTCTTNDVLERALLLLEKTHYT
                     PTFLSSLRLSTTFPRRETIGRNDIYTWMFGWDRDGHDAPTKMTLICPATDDLIAKYSA
                     PHRRMMIETPHMYQAVTRPWIESLPASKTTWVQNILQGISETESVLYSDPDPKTGFVI
                     LPDMKWDRRTLSSLYLMAIVRDGSLVTLRDLTKQHVPLLRKIQQAGQKVAHEVYGLSE
                     STDSTSPLRCFVHYMPTYFHLHVHMLSANFVSHPGSLVGQAHLLDDVIDLLELGVDFR
                     QRTLSYALAEGHALLRRWQEEGYAQFDAIM"
     gene            188222..188306
                     /locus_tag="MRET_t0031"
                     /db_xref="GeneID:38741225"
     tRNA            188222..188306
                     /locus_tag="MRET_t0031"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:38741225"
     gene            complement(<188418..>188945)
                     /locus_tag="MRET_1724"
                     /note="MRES_06890"
                     /db_xref="GeneID:38738490"
     mRNA            complement(<188418..>188945)
                     /locus_tag="MRET_1724"
                     /product="N-terminal domain of NEFA-interacting nuclear
                     protein NIP30"
                     /transcript_id="XM_027628351.1"
                     /db_xref="GeneID:38738490"
     CDS             complement(188418..188945)
                     /locus_tag="MRET_1724"
                     /codon_start=1
                     /product="N-terminal domain of NEFA-interacting nuclear
                     protein NIP30"
                     /protein_id="XP_027484588.1"
                     /db_xref="GeneID:38738490"
                     /translation="MSQAPPHFVSQADLTDAQKRREREIQEAYARIGEEPPPKPAEEA
                     YDPRPLYERLREARALQDERIEEMFKLRNQFRGLDESESQFLADIELARKHREQEKRQ
                     QDAKELDEFRRATESKSSAPPPLPERTALPTIPKAKPRAGSKRKREQASALGIVPRKS
                     TQPSASASCKNDPSS"
     gene            <188997..>192062
                     /locus_tag="MRET_1725"
                     /note="MRES_06895"
                     /db_xref="GeneID:38738491"
     mRNA            <188997..>192062
                     /locus_tag="MRET_1725"
                     /product="tubulin-specific chaperone D"
                     /transcript_id="XM_027628352.1"
                     /db_xref="GeneID:38738491"
     CDS             188997..192062
                     /locus_tag="MRET_1725"
                     /codon_start=1
                     /product="tubulin-specific chaperone D"
                     /protein_id="XP_027484587.1"
                     /db_xref="GeneID:38738491"
                     /translation="MSADEPDELLCEGAELVRFEQYDAFMEKQHAMLACVGVHDEDGA
                     CAYLPALEAELQRYQEQAYVLDPFLERLVTPVAQTMRAQVLESGCMCMAPVARLLYMY
                     TKVRGYKVVSRFFPHQVREMPLLLDALERFESPTWECLYVLLLWLSSVVLVPFPLDRG
                     TPSPSERIHRLCARFLSRPGKERDAASIVLGRLYAREECELFFSAFLQDAEQATASLV
                     PTGVLQTLCAFVKQADASLIRAHYDAMLRVIAHLRTVDTRNMLVDRYAIKLEGRLAMH
                     DPRDAHVDTLLHALAHADSRVRYSAAKGTARVASRLPHAWRAQILEALLTMLSEHILS
                     HTMPDGLHEARAFSEQTAETLRCVDLHGVSEYTWHGVFLALAECIRRAAVPIDVRMVY
                     WTLTGLVFDVRRATGSTGTSVRDACCYVLWSLARTRDAPHVLAVPIAQRLIIAATLDR
                     DVAVRRAASAAFQEWVGRATVPHGIDILRTADFAAVGTRRHAYLTCAPFVAQFDTYRP
                     GLVAYAERSLLSHWDAAVRILGAQALARMLAGRDARPVLLRLCPRSASHDTDVAHGAL
                     VALAHLVRDHPALAQEACRAALSTSPSVWRAPGGASILASACHVVSLCLAPTDTAPLR
                     SLWNEAVLRPEVEVQDMVVASIRALKDHVIVHDLVRTWLDTWPSLSPDTQCVAAKAMG
                     VVDVYADERCERLCDVLRSGAVEARCAAARSLSTLPTHRVVPALRAGLHDMTTDARGD
                     VGSWVRVACIESLGALECDADTLVDMAGLLMERIDTVRVKAADVLSRMNASWRDAIGD
                     PSLLRDASYAFPHLMPLLDEPAYRFSLLRSLVRTIGSRSDMALRVAGQALVQWAKQAS
                     SDKVQDVGVMLHRQANTHARDNRTFVPVLQTVQLLLDWDVRLDVPLLARFVRLASHHV
                     DKVHSVPRILAAMRICVHASQVPGAVPDAAAYLIPFLTHRYPAVRIHTSEQLFLLVQE
                     LSMEHDTTEIEAALLDTPWATAPPTDLGAASTHIVHCIYDILAAKHRAP"
     gene            complement(<192064..>192483)
                     /locus_tag="MRET_1726"
                     /note="MRES_06900"
                     /db_xref="GeneID:38738492"
     mRNA            complement(<192064..>192483)
                     /locus_tag="MRET_1726"
                     /product="osomolarity two-component system, phosphorelay
                     intermediate protein YPD1"
                     /transcript_id="XM_027628353.1"
                     /db_xref="GeneID:38738492"
     CDS             complement(192064..192483)
                     /locus_tag="MRET_1726"
                     /codon_start=1
                     /product="osomolarity two-component system, phosphorelay
                     intermediate protein YPD1"
                     /protein_id="XP_027484420.1"
                     /db_xref="GeneID:38738492"
                     /translation="MSAATDDVSKLPRDVIDVDVFEQLLDMDEDGREFSQSLVWNYFE
                     QAEQTFVKMEEALAAKSLDDMSTLGHFLKGSSAAVGVIKVRDSCEYIQHYGKCHDTDG
                     VTELQPDDVLNRLRQVMDNVKEQYEEARSVLRTFFGV"
     gene            <192655..>194238
                     /locus_tag="MRET_1727"
                     /note="MRES_06905"
                     /db_xref="GeneID:38738493"
     mRNA            <192655..>194238
                     /locus_tag="MRET_1727"
                     /product="ubiquitin carboxyl-terminal hydrolase MINDY-1/2"
                     /transcript_id="XM_027628354.1"
                     /db_xref="GeneID:38738493"
     CDS             192655..194238
                     /locus_tag="MRET_1727"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase MINDY-1/2"
                     /protein_id="XP_027484419.1"
                     /db_xref="GeneID:38738493"
                     /translation="MSTDPSQSHNPFLASLATPQPPQERKSNAIDDLLGLDLGSPQPA
                     ELASPTQASSLTKQPAMTPFVDTNVPHGPNILTSSPVSMHPSKNPFLAAPSAESTTTR
                     APPASEPGAPVLGAPIAASPLGAAEPFNYLTTTATSPVAMPPIGSDRTADQSTTAATH
                     AQEQIDADAQLAQSLAAADIHNDTQWSVKDIVWRGRDAKIIMQNENGPCSLIALTNVL
                     LLQNRVQITPPDRPAVSYAYVSDMLADYLLEIHADPTQLSRVLNVLPKLMQGFQIDVF
                     FDQPTHFGSDTGADTSAELLLFRLAQVPLLHGWLPDPSDTSLYRSMQQVRSYNGATTA
                     LANEEAQSVRDSSTKEVREFLHAYPTQLTPWGLHAVSNAIPPGGLAVLFRNSHLSVVY
                     RRREDEGVSSMPALYMLVTDAAFQMDDRTVWESLEDTNGHHTRFFDAQFEQVARSERA
                     WGVTPNGVGSGTNADYALAVRLQREERERARAAQRARQHHRELSLGRRPAEGDTGGAS
                     TQRRLSKMLPKMLRKGFKK"
     gene            <194340..>195476
                     /locus_tag="MRET_1728"
                     /note="MRES_06910"
                     /db_xref="GeneID:38738494"
     mRNA            <194340..>195476
                     /locus_tag="MRET_1728"
                     /product="proliferation-associated protein 1"
                     /transcript_id="XM_027628355.1"
                     /db_xref="GeneID:38738494"
     CDS             194340..195476
                     /locus_tag="MRET_1728"
                     /codon_start=1
                     /product="proliferation-associated protein 1"
                     /protein_id="XP_027484637.1"
                     /db_xref="GeneID:38738494"
                     /translation="MTDAQENFDVILTKYKTAGEIAAKAMRTLVDAAQEGKTVLELMQ
                     LGDEAVEQGTAAVFKDKKMSKGLAFPTTVSINHVVCNYAPLPSDEASKTQLKNGDVVK
                     FQLGAQIDGYPAVLGETVVVGASAQNPVTGRAADVIKAAHTAADVAIRLMRPGMLNHD
                     VGKQIEQSIKDFDVRGVDGMQTNQFSKDNISGKKKLAFGGDGSSRPDACKLEENEVYG
                     VDIVVSTSADGKSKSDDAFTSIFCKTNATYLLKMATSRKVFSEIQKKAGAFPFNLRAL
                     EDEKRARMGVQECSNHGLVTPFQVLVDANASAITAQVFFTVAVSGKGAIRLTPAPTWF
                     DAEKVKSEKEVTNEEIKALLATSVRQTKKKTKKTTDGSSAPAAA"
     gene            complement(<195547..>199665)
                     /locus_tag="MRET_1729"
                     /note="MRES_06915"
                     /db_xref="GeneID:38738495"
     mRNA            complement(<195547..>199665)
                     /locus_tag="MRET_1729"
                     /product="map microtubule affinity-regulating kinase"
                     /transcript_id="XM_027628356.1"
                     /db_xref="GeneID:38738495"
     CDS             complement(195547..199665)
                     /locus_tag="MRET_1729"
                     /codon_start=1
                     /product="map microtubule affinity-regulating kinase"
                     /protein_id="XP_027484099.1"
                     /db_xref="GeneID:38738495"
                     /translation="MAAPPERTTTRHKKPLAGEVKQDGASIGSEAKTRSTPRSRHSRS
                     YVAAQQAHAARRDREEWLRTRGAGSNVLLWFEELKKRRSNKVNRFGWTAADVVPPVEN
                     ILKRTAEPCEVTGMDCLLDWGICDYTIMPKTLGRGRFSTVYLAIKNGQRYAIKHTPLF
                     PHHELVATRLLREPTLLAEIPPHPNLVTVVETIRTPGHFYLVEEYLDGYVTLESLIST
                     YNQDNPSGPHKLPEDVAYKILAQLVMALHAIHTPLRVCHRDVKPENVLVHPDTLQLKL
                     LDFGLATHFSRSHAKLTTCCGSPAFHCPEIVAALSHPLGTVTYWGPEVDAWTCGITLL
                     RCLSGIRYPLGTSHTSPASMGVRAQRVISSLPPSQLRDDVAGLLDLQAEARMRHFDQL
                     AERVEAEAGMPSERQRRELKCTSFVPAPPQHAMVLPLVLTSEALTHAMADMPLGMDLS
                     HFSMITLLNTSLQPSQRVLSFIRYCFRCAGILYHTVGVAYQQDEPGIMRLGTAAPSAF
                     DAVRSCAFQCVVELIQDEEPGMLTQMMQSFFSLFGRQATTEELVKLPQRAIDPDAKHD
                     SEPPSSGPSGKQGPLCMLVCYVVVTFPDSGTDTPKYPEFETPAPEMIAEALQNRFAPI
                     KKETALTRQGTAEEPNLRIDTRVERLPPPQIVKTSPQYRTRSRSRARSLQSRAPRGVH
                     VYVSDARAVPYIRGALSNGGVLRSESLASSTSSRVQSPSARWSGSETPVPDTSLMPAT
                     ADAMGPHELDTSLDAIEGTCRSLLVRRVMPGRADTDHEHAQRLYMLVSRLYRRLERSL
                     QGTHSDALRIQMSERNFRALDVLGPTLALVGEHDTVPRDAHTNTGSVALAVLELFSAC
                     SSAKEMCLGFQEQIERLSLAWRSRDDVPVSDADRDAVTMLARDAPMLVQAVIGQLQRL
                     ANVLPAIRTRRPKATVESVLGLVYPTLYRDVLCDALGMIAESDTHEELATQAAIVLCE
                     LVLSLRPHAQSMEEPPDLGGMLTDALYELLRFLPRATREAPDVSPRITVWNIVRKTYE
                     QLGVDLGCCALGTPDTNRAALAVPSARHAFVLFVHQLAYESFMSRMRGRSRRRLRIAT
                     QKSTTLAEPQRWAPDTAREMLVRLAGVLPGTLMPGLGPLDVPIASRTMMCVHDTLFCE
                     CLVLFLDWIEHALPPDVMSDDDITYTVRALALVATYATQAADVRPRSFDVMRRLVRDH
                     SSDDVTLRIVRECMSPTAPVPLRGATVHLLRDIIARRLDKVEHVHGHDALLDDGRLWR
                     VWNDELLVVPSSLPPPPKDGGHATPHLDELAAYLVQHQTYLQECLSLFYFVTVRDAAH
                     NVTGVHDEREYERLYRRFVQPLASWVESWRPHVPEGELSLRLSLLETAISRI"
     gene            complement(<199879..>200348)
                     /locus_tag="MRET_1730"
                     /db_xref="GeneID:38738496"
     mRNA            complement(join(<199879..200119,200146..>200348))
                     /locus_tag="MRET_1730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628357.1"
                     /db_xref="GeneID:38738496"
     CDS             complement(join(199879..200119,200146..200348))
                     /locus_tag="MRET_1730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484643.1"
                     /db_xref="GeneID:38738496"
                     /translation="MFPSRVVPSGSSRKDTRVCQRCERPGHAIYECRNPRPYKKRPTR
                     TQVLMNPSLAVPRPLEKAPEPVRGHGVADQILAERENDRKVRSPSVTLSDDNDSHGTQ
                     SASCSTCSSPHHPSSCSTCSSKHDATPLRRTPSPEPIRRTYHMDQ"
     gene            <200499..>202898
                     /locus_tag="MRET_1731"
                     /note="MRES_06920"
                     /db_xref="GeneID:38738497"
     mRNA            <200499..>202898
                     /locus_tag="MRET_1731"
                     /product="ATP-dependent Clp protease ATP-binding subunit
                     ClpB"
                     /transcript_id="XM_027628358.1"
                     /db_xref="GeneID:38738497"
     CDS             200499..202898
                     /locus_tag="MRET_1731"
                     /codon_start=1
                     /product="ATP-dependent Clp protease ATP-binding subunit
                     ClpB"
                     /protein_id="XP_027484644.1"
                     /db_xref="GeneID:38738497"
                     /translation="MSTLQKLRRVPLACHNHVRMVSGMRLATTSRVARSSTLPRNLSP
                     RLLHTSAARMNSPPGGGGGFPGMRMNMQGQDAKPGETLAQYSQDLTKLAREGKLDPVI
                     GRDGEIRRSIQVLSRRTKCNPVLVGPAGVGKTAIMEGLAQRIVNKEVPESLHDKRVCA
                     LDLGALLAGASFRGAFEERFKALLSDIEAEQGKIIVFIDELHMLLNLGKAEGSVDAAN
                     MMKPMLARGTLQCAGATTYDEYRKYIEKDPALARRFQSVTVDEPSPEATVAILRGLRS
                     RYEVHHGVGVSDGALVTAATYASRYLSERKLPDSAIDLLDEAMSALRLQQESKPEVIE
                     TLDRDILTLQIELESIRHESDPLSLERKKVVEQELQEKRNENAALTSAWMEERSKLDR
                     VKTLKEEIEQARIEQDQATRAGNFQRVAELQYGRIPELEAQLPKEEEAGNDAAQKNML
                     HERVTSDDIAAVVAKMTGVPVRNLLRGERERLLGIEDSLRRRIVGQEEALDAIGEAVR
                     LSRAGLHSSKRPLASFLFLGGTGVGKTEAAKGLAHFLFDSEKLVQINCSELSEAHSVS
                     KLVGAPPGYIGHEDGGQLTEKVRRHPYSVVLFDEIEKANRSIHTLLLQVLDEGRLQDS
                     QGRIVDFRQSIIILTSNVGADVLYVPGATDETGHVTDDSRTKVMKEVQHAFPPELLNR
                     LDEQIIFNNLAPESLHGIVQIRLREIDERLREKRITLRVDDAAQAWLAKKGYDPAYGA
                     RPLGRLIQKRLLNPLASNMIKGKVQDGDTVEVHVSDTGDELTLNVIAGPEHQQQESSS
                     T"
     gene            complement(<202904..>203932)
                     /locus_tag="MRET_1732"
                     /note="MRES_06925"
                     /db_xref="GeneID:38738498"
     mRNA            complement(<202904..>203932)
                     /locus_tag="MRET_1732"
                     /product="protein BCP1"
                     /transcript_id="XM_027628359.1"
                     /db_xref="GeneID:38738498"
     CDS             complement(202904..203932)
                     /locus_tag="MRET_1732"
                     /codon_start=1
                     /product="protein BCP1"
                     /protein_id="XP_027484719.1"
                     /db_xref="GeneID:38738498"
                     /translation="MAGCQTASHAGITAADPFFGRATHSCNSMGSKPVEKHDQNAAEN
                     MSEEDMEMINVDFDFAAPSESDVPALKRLLQQQWYTHAPQLQLHSVAEHIVHLGMNVG
                     IGTVVKVDDLEQIHDPYALMSCMDLGTSSPATDEVRNYFISQLSRAASAKPLLDLVQA
                     ATESKPILYIIHERMINLPPQLMPPLLRMLLAEVKETLEESSKPAPTHVLFFSRAFSA
                     DALDEGRGDDDDDEPTGLAGARKRKAGGLHARPEDAANAALGKQISNKKRSGQSDFDD
                     GLGSFHPEDELIREFASHSYTYRFPPPRDAEASFEPPLFGRLIAVPYAKMSSLLDRLH
                     QEWPEPTQ"
     gene            <204157..>205869
                     /locus_tag="MRET_1733"
                     /note="MRES_06930"
                     /db_xref="GeneID:38738499"
     mRNA            <204157..>205869
                     /locus_tag="MRET_1733"
                     /product="carboxy-terminal domain RNA polymerase II
                     polypeptide A small phosphatase"
                     /transcript_id="XM_027628360.1"
                     /db_xref="GeneID:38738499"
     CDS             204157..205869
                     /locus_tag="MRET_1733"
                     /codon_start=1
                     /product="carboxy-terminal domain RNA polymerase II
                     polypeptide A small phosphatase"
                     /protein_id="XP_027484720.1"
                     /db_xref="GeneID:38738499"
                     /translation="MSDYIPKAHPNGPRPPSMYQSSHSVGDAAAVPRPVSTRSIRPAR
                     PVSGVTQQNAMLGSPINSSPSSSSTTPLSLYPSHEPPVPSSEGVYQRDTAPSIVGQGV
                     GTALATRATSTPQFSSTGMQYNSLPTNVDASVPNARIGALPPVTSPQRTLAPQPLDAP
                     YNAHVPTLRGPQPLMPESTYRQAESPRPRTSLSPATSAPPPPKPTPPPPKTQENRPRG
                     LKKLLAMMTCSSSTVETALDAHQGSTSPSKPSASPSQTRTSIPPVNEPIPTIQEELPR
                     SSSRPYSGFRPRTSMTTEVAEPLADINNTHTLLRVPTSTNRHSLATSTSSSHSSDEED
                     MMQDVITQVSPNAPIAMGMSDPELEQEIFAVEQRLIQQGGTGVPLDEHGQPCPLLSQI
                     SNQDATRKCLVLDLDETLVHSSFKMVPNADFVVPVEIEGIMHNVYVIKRPGVDEFLRL
                     MGQIYEVVIFTASLNKYADPVIDILDIHRVVRHRLFRESCYNHYGSYVKDLSQLGRPL
                     HDTIILDNSPASYIFHPTNAVPVSSWFNDPHDTELTDLCPFLEDLCYVDDVRIVLDGF
                     IDTA"
     gene            <206010..>206699
                     /locus_tag="MRET_1734"
                     /db_xref="GeneID:38738500"
     mRNA            <206010..>206699
                     /locus_tag="MRET_1734"
                     /product="p-loop containing nucleoside triphosphate
                     hydrolase protein"
                     /transcript_id="XM_027628361.1"
                     /db_xref="GeneID:38738500"
     CDS             206010..206699
                     /locus_tag="MRET_1734"
                     /codon_start=1
                     /product="p-loop containing nucleoside triphosphate
                     hydrolase protein"
                     /protein_id="XP_027484639.1"
                     /db_xref="GeneID:38738500"
                     /translation="MQDAMIDRLSQLILERRDCMDPSRRLLVGIAGIPGSGKSSLAHH
                     ISGRIESLRGPCCVTIGMDGWHFPRAVLDKMDNQEEAYKRRGAAFTFDAEAFVSFAQR
                     LRQEGMNELSAPSFSHAEKDPVPNDINIRQSHTIVLIEGLYCCLNLEPWRRATECWDL
                     RWFVDTSPSVARERLIRRHVESRICNDAASAAQRADTNDLPNGDWILAHIYEPVSYWH
                     IPSWDALPTKA"
     gene            complement(<206696..>207269)
                     /locus_tag="MRET_1735"
                     /note="MRES_06935"
                     /db_xref="GeneID:38738501"
     mRNA            complement(join(<206696..206959,206991..207026,
                     207063..>207269))
                     /locus_tag="MRET_1735"
                     /product="mitochondrial intermembrane space protein"
                     /transcript_id="XM_027628362.1"
                     /db_xref="GeneID:38738501"
     CDS             complement(join(206696..206959,206991..207026,
                     207063..207269))
                     /locus_tag="MRET_1735"
                     /codon_start=1
                     /product="mitochondrial intermembrane space protein"
                     /protein_id="XP_027484640.1"
                     /db_xref="GeneID:38738501"
                     /translation="MPRSSRSSGPTRPAARPAAPSGSRGMHTMSAAPTKPRYAPPPAA
                     QHQPQQHHQQHAPPMTSQGPGLFGQMASTAAGVAVGSTVGHGISNFLFGGRSAEPAPA
                     ANVPSDYAQAPPATQYTDSFAEQNTGVNCDAQSKQFVECLEKTNDMNACSYYLDQLKA
                     CQAIAKGY"
     gene            <207428..>210625
                     /locus_tag="MRET_1736"
                     /note="MRES_06940"
                     /db_xref="GeneID:38738502"
     mRNA            <207428..>210625
                     /locus_tag="MRET_1736"
                     /product="ribosome biogenesis protein BMS1"
                     /transcript_id="XM_027628363.1"
                     /db_xref="GeneID:38738502"
     CDS             207428..210625
                     /locus_tag="MRET_1736"
                     /codon_start=1
                     /product="ribosome biogenesis protein BMS1"
                     /protein_id="XP_027484641.1"
                     /db_xref="GeneID:38738502"
                     /translation="MADATQVHRAHHAAQAGPKAEKAKAKGRERHAGGFNPKAFIAAH
                     PFAADKHIRRKAELDQQRLHVPLVDRTPAKEPPPVIVAIVGPQGVGKTTLMRSLIRRY
                     TKHTVAHISGPVTVVSSKTRRITFIECNNDINSMIDIGKIADLVLLMIDGSFGFEMET
                     MEFLNVLQAHGFPKVMGVLTHLDLIKKVRTLRATKKRLKHRFWTEIYQGAKLFYLSGI
                     INGRYPDSEIQNLSRFISVMKFRPLIFRNQHPYFLADRMEELTPRELVKSDPKMDRTI
                     TVYGYLRGTNLRDKQPIHIPGVGDFTIKSVERLADPCPLPTQESERRRRLSEKHKLIH
                     APMSDVGGVMFDKDAVYINVPGHFSKRDDNIVGEGERMIMSLQDSQTTLGERAAEGEL
                     RLFDDSTAPVYVNHGRRRAAFEETDDDHIMNNESEDESEEDENENAFGRELDLDDEQT
                     EEVAYADSDSDLGDEAGPAPWKSNLAKQAEETVLANRRRRRDLMHLIYETDQSPEDIT
                     SGAEITPKTEQVSQSEEDFFHVVSSEAPVSSADVPEESRPLTQLEAFEQWEDENRLDS
                     IRHLFITGEDDVDETVPPIQDGDDEKSDEEANVQSNEDAKTQELAAKKAALKRKFDEQ
                     YDDDEDENEDDWYTEQKKELAKQVEMNEAEFANDDEETRVKIEGFRPGTYVRVEIDHV
                     PCEFVDHFNPAYPIIVGGLLANETALAFLQVRIKKHRWHKRILKTNDPLIFSLGWRRF
                     QSMPIYTLDDGTRNRMLKYTPEHMHCLASFYGPASLPNTGFCAFNTLSSETPNFRISA
                     TGVVLNVDAGSGASHQIVKKLKLTGTPAKVFKNTAFIKDMFSTPLEVAKFEGAQLKTV
                     SGIRGHVKKALARPEGQFRATFEDKILMSDIVFLRAWYNVVPRPFYNPVTSLLMRGDT
                     EREWQGMRLTGAVRRDEGIKTPLRVNSTYKPVERPEVRKFNPLRVPKALQAALPYSSK
                     PHITKAQRRPTYLQKRAVVMEKDERDAVALLQQMQALQHAKQQKRMQKQNERQEERKK
                     VMAKQGALDAQKHKERMKHIYKIEGQREAKRAKSS"
     gene            complement(<210639..>215129)
                     /locus_tag="MRET_1737"
                     /note="MRES_06945"
                     /db_xref="GeneID:38738503"
     mRNA            complement(<210639..>215129)
                     /locus_tag="MRET_1737"
                     /product="cohesin loading factor subunit SCC2"
                     /transcript_id="XM_027628364.1"
                     /db_xref="GeneID:38738503"
     CDS             complement(210639..215129)
                     /locus_tag="MRET_1737"
                     /codon_start=1
                     /product="cohesin loading factor subunit SCC2"
                     /protein_id="XP_027484642.1"
                     /db_xref="GeneID:38738503"
                     /translation="MAPVPGALKSAVSPPALRAVASSDHAEYPQFSADAYEALADDMP
                     SRFRPELMQYAKKHALEEHDQDTPQKNVRTSNDSFTNENDSGWDFDDSQLYSGESLLL
                     TSDAPPSSPVPASDAIRTPSTSAQLLTQFLEALEYDAMECDTEKPRGTLVRRVEAEVV
                     LQPSSITQLYGLLRQCTRDTEKALSAGVTLSDGIPRTLLDVDAQLLSGMLSKLETTMG
                     DSQTVLSPDMEYANLEKSLQDSISLLLSAKCCLLTFSVDQLPKYLVSEELLERCLDIL
                     KLSLETLVLPLVEACASITPSGIAHDLLRGSVPSSLTSALDSHMHHVCSALTLLEPLF
                     SLTSITIPEALMIRCVYIALSPLFTQDRVIPAKHASDLTYTHAHALRPLRLSCFHILR
                     NLFAFYPQQRAWIVGEILVSILRLPDLRQRKRHFRLANNQKIYVITALLLQLIQASSY
                     ELPASHELSLAWFFDAETRAQHEKPPCQSHQEHVHALASTIAAFLIQKSGEAKMAKNT
                     ADVSYAAIVYAILEDLLTLVPLPDWPAAPVLLSCFMRLFVNVLNEPKSTMDAKTMALD
                     HLGLTAAYIYSTKEQPRPKHAHLRLNPMSVLSEHCDVDALHEWKLAYFGVIQRVQKDS
                     KDKATLIHTRSFHRAQYLFDLALAMRLSDEKDHGARFETAITQCVQQVDRIEGVPPID
                     SYLYAQYILQGTTFIKYAYLLKPLVQAARSPVLTIRLRALRGLANVVGSNSNLLDDSS
                     ILDTVVMHLSDTSANVREVCVSILAAYLEDKPAQVPTYLAMLSDRVMDTAVSVRKRVI
                     RFLRDAYLLHLDYDTKLMTLFRMLQCVHDIDPTAQVLAMECLEYVLFNEQVGEKPTEM
                     ARLLADLCIKIRERPSPLEEFLRRLGRDHANPALSDTFGELVDELISGLFVDNMDAIT
                     MRDRLRVVHVLCYTHPSVLTVNRAKQLLPYVDGAESFEELAVMEELLRIFSTCLCHMP
                     RTARAFAVSLEAVLTRLLSRCTISPGSSTLEALIQCFCCVIQYQTKNYVLLQKTYHSC
                     LGKFFSVQPKEIDANASLVLCITALLCAYGPWQSAQQSNSLDEVFGHLMRLHASSEAK
                     SLIPILTALGYILSAYPAKFLDPTLTSTLDTILQQGTPHERYLVLRAFFAFLENDAGK
                     EPQLSSTDMLSNLTGKAYSDAGLASGLIQRFADPVLHGVLEVESPPIQRMASDILRIA
                     VLQGLSHPMQVVPTLVALETSQDSVLRSRAAHLHRHLYSKHASLLVSRYNECIRASFQ
                     FQCSLTQHPRGYQQDAQVHALFQTWYDILGENRSMRLAFLRTLTRLLSMSAECTDADV
                     DFGLFVADNLALLEYRVVEEPLLVIHELKVLHAVMGGHMTSLIERKLRTDENQRTPSP
                     LTDEECEDIPKPKSDLSSAASSFLALSKSVCIARMIPALRQHIKRMYKLSERKCASYE
                     PGKRTTMGDRITVRASSDPNRCLFDFDLSLPQTYSEAREYLEEFVDERDDAGTDSELE
                     YE"
     gene            <215237..>217372
                     /locus_tag="MRET_1738"
                     /db_xref="GeneID:38738504"
     mRNA            <215237..>217372
                     /locus_tag="MRET_1738"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628365.1"
                     /db_xref="GeneID:38738504"
     CDS             215237..217372
                     /locus_tag="MRET_1738"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484716.1"
                     /db_xref="GeneID:38738504"
                     /translation="MDHEPDVHRRDNENGVSEGPFEDVIQIHDNEDPCEEAELDDDYD
                     RELDEFNHGMVRVWDEDSDNDDDGQARTNQPGSIVPPLQLTGERRRRKREFPSMSNWW
                     RTLLIGSAEPGTLSTGHVAMNMFSSSLHPGVLLAIPVYFSKTDVVPGMLILTLVALLS
                     IFGGGLWVSLGRYVGGSTIESITSKAFGMNTRWKKNIGHALSSIALVVYCTGAAVIAY
                     HAMTDLLIQVFMHYTIRGQIFHDRAFVTLAVGGFLTLPLLLTTTPKRNMFQIQSWTVL
                     LFYPAIIGILLMRINEWTITGLRKGSRNLSGEESMVLVPQPYLPDNSWPWASTAMLPL
                     LVLSASPVQVLAHSRSLRRKTAYDSNVMAFFFAQLCQVILMLLVTYVLGVDVGLVGTS
                     KLSAGLHANFFNAFPLDDNYINAARGLFILLLAAHLTVCLASARSCWSRFFKLLNLHP
                     LRNMTPPTPHIIRQQANAQTRPSAPQMFSPAWLPSSWHSPLVRQMNNVPQDVQAWQRG
                     KSLQDKLAAIILWSITAFPAYFSGVGGVFRRNEKEGEELRFLRSLEYIGILGAVVGFI
                     LPALNWLVLFKIRRPRAILLLQSNSMRRRISRFLLSPLSTLIGKTSYASEDTEPLLSE
                     NSENPPLDDHGHPCHPMSISIPNHTNEHSSNNCDDATLILLARKECELQRKSRRRRRW
                     QEFLVVLFLVPFGLLLIAAAFIELLQGGY"
     gene            complement(<217437..>218447)
                     /locus_tag="MRET_1739"
                     /db_xref="GeneID:38738505"
     mRNA            complement(<217437..>218447)
                     /locus_tag="MRET_1739"
                     /product="membrane associated DnaJ chaperone"
                     /transcript_id="XM_027628366.1"
                     /db_xref="GeneID:38738505"
     CDS             complement(217437..218447)
                     /locus_tag="MRET_1739"
                     /codon_start=1
                     /product="membrane associated DnaJ chaperone"
                     /protein_id="XP_027484717.1"
                     /db_xref="GeneID:38738505"
                     /translation="MYGVLQVLGTQALIFGGWSIIDAIGTKIILEALYKIPIARFQLK
                     RPPPRTLAAKSHFETARILVALAYFLYCAGRIVLYMEPSVYKALEIDVTASDTAIKRR
                     FRELAKMYHPDKVGEEHADVFRLLHEKYSLISDPDTRLLYNMFGPRIALWERLSTQTE
                     YIHNGFKELVYQHISMLLQQGLGLVLHLNRWTSRSMNVGSMWALLLQSCVFIFQMRML
                     TDERWSTWLGYATGLAVFQAVSMITNMLFPCILLLQQCNISFDQLLTAGSWKHFRFAR
                     DPQPVLIESPDMLAKAHMLHTLRREPETLSEAREQINILVAAVKQLDESTKKISATES
                     DS"
     gene            <218625..>220907
                     /locus_tag="MRET_1740"
                     /note="MRES_06950"
                     /db_xref="GeneID:38738506"
     mRNA            <218625..>220907
                     /locus_tag="MRET_1740"
                     /product="OPT oligopeptide transporter protein"
                     /transcript_id="XM_027628367.1"
                     /db_xref="GeneID:38738506"
     CDS             218625..220907
                     /locus_tag="MRET_1740"
                     /codon_start=1
                     /product="OPT oligopeptide transporter protein"
                     /protein_id="XP_027484161.1"
                     /db_xref="GeneID:38738506"
                     /translation="MHNRRISEAVRTRDQNAVQEELERINEPRDNVELRLLDEERYDI
                     GHDKHDRFGMNEEDDSHHLVRQVVPETDDPFLPSLTLRAVLLGSIFTILGAGMSQLFF
                     YKSNAPSFSTYFVILVTLPLGRWLARLLPDREVNLLGWRFRLNPGPFSVKEHVLIAVT
                     VSSGATSAYASDIINIQELFFGQHMSVIPSLTLLITTQVIGFGFAGLVYNLLVRPPSM
                     VFPSALVTVSLFNTLHDDVSLKTQKRMRFFLITFAAIFVYQFIPTTLFPTLSSIAVLC
                     YFHRSRITQILSSGYKGFGIANLSFDWNVLGNSGPLYTPWWASLNFYSGLILMMYVVM
                     PLLYFTNFWNAKSFPSVLSSALYNTSYQTFDVNAVLHPDNTLNESAWATYKPMLLTPF
                     FAISYGISFAMLTSTITHVLLWHGKEIKKALWDPLYSDIHNQLMKEYPLVPQSWYIIT
                     LLLSLGSAVILVSTTPLQFPVWGLLLSVGMSLFFLIPIGILKAVSDTGVGLNVITEFV
                     AGYLIPGKPIGNVCWKCYGYMSCAQALDMIGDLKLAHYMKINPKHMFLAQLLGTVIGS
                     IVNYMVVCVVLAPENGYRAFLDGSASDPTGQWDGRKVQIFRSASIIWGAVGPQRFFAG
                     NYLYLYWGFALGVVLPLIPWLLHRYHVRHALKKSKDTIYSRIVIPILLHGAIAPPATP
                     TNIMLGGFVCAFLSQKWMRERYPHWFRKYNYVLSAALDAGSSVNALTVFLLSITLFRW
                     YGTPHFFQSSDTDVEHCKVD"
     gene            <221021..>222004
                     /locus_tag="MRET_1741"
                     /db_xref="GeneID:38738507"
     mRNA            <221021..>222004
                     /locus_tag="MRET_1741"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628368.1"
                     /db_xref="GeneID:38738507"
     CDS             221021..222004
                     /locus_tag="MRET_1741"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484158.1"
                     /db_xref="GeneID:38738507"
                     /translation="MFVRIQNTWSIRDAAAENRFQVRDDAKVDDNGRGFHLPFLTFAV
                     IAIAVVIGLLGMVILRIFVLQRRYSTNMPQETVSSAVYNIPTENPPPIYEHKVLTASD
                     TNTKLSWNDLQPISVAFDRTITSNVRLDACGKSDTSQVQGLKPPNASVQTTFIVGLPT
                     PAQTVFPPWLRRRSSNIHKKGMETELSRRRSRMSLKKDAAGDADDLSQKPQYAPSIHS
                     NLSQKEQGDARREAYFLNLGSSNGDSGLGHSQSVRLNLSHANQTILNRHDTTIDNDEE
                     VIGAIALGTMSMQVKEPMENKDDSCVPLTKDTLSGILHHAKKVRDNFASKV"
     gene            complement(<222090..>223255)
                     /locus_tag="MRET_1742"
                     /db_xref="GeneID:38738508"
     mRNA            complement(join(<222090..222235,222262..222442,
                     222467..>223255))
                     /locus_tag="MRET_1742"
                     /product="phosphatidyl synthase"
                     /transcript_id="XM_027628369.1"
                     /db_xref="GeneID:38738508"
     CDS             complement(join(222090..222235,222262..222442,
                     222467..223255))
                     /locus_tag="MRET_1742"
                     /codon_start=1
                     /product="phosphatidyl synthase"
                     /protein_id="XP_027484165.1"
                     /db_xref="GeneID:38738508"
                     /translation="MLFSGLLRRTMSIAPRMAARSWRLSSSRGYSSLAIAFDIDGVLK
                     QGPKVLPEAIRTIRMLEGDNPWNRKVPYLFITNSGGKSEAVRAKDLSNDFQTHVTSDQ
                     VVQAHTVMRSLTEKYRDSPILMLGGPDYPPGSSRGVLESYGFRQVYTAHDLHAYATSS
                     FPYARPGKDQEPALRRVDFSKVQFEAIFVFHDSREWGRDIQYAVDLMRADRGVFGTVL
                     TNEEIRRRSPMPIYFSHADLLWGNDFSVARLGQGAFRVALEAVFKRVTNGIELNAHVF
                     GKPEVSTYNYANSLLQGLLQASLKDARARITPQNVWMIGDNPFSDILGANNYGWSSAL
                     VRTGVYRDVEGPPAHTPTILSDNVEQAVQSIMQRTWS"
     gene            <223504..>223824
                     /locus_tag="MRET_1743"
                     /db_xref="GeneID:38738509"
     mRNA            join(<223504..223591,223617..223730,223769..>223824)
                     /locus_tag="MRET_1743"
                     /product="integral membrane protein required for ER to
                     golgi transport"
                     /transcript_id="XM_027628370.1"
                     /db_xref="GeneID:38738509"
     CDS             join(223504..223591,223617..223730,223769..223824)
                     /locus_tag="MRET_1743"
                     /codon_start=1
                     /product="integral membrane protein required for ER to
                     golgi transport"
                     /protein_id="XP_027484163.1"
                     /db_xref="GeneID:38738509"
                     /translation="MLGLGTIFYVALLLVNSIAILNEERFLSRIGWSTNPRSLSSLDA
                     GDGDSGVKQRLIHLISAVRVLLRIPLIIINVLVIIYELILG"
     gene            <223976..>226915
                     /locus_tag="MRET_1744"
                     /note="MRES_06955"
                     /db_xref="GeneID:38738510"
     mRNA            <223976..>226915
                     /locus_tag="MRET_1744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628371.1"
                     /db_xref="GeneID:38738510"
     CDS             223976..226915
                     /locus_tag="MRET_1744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484314.1"
                     /db_xref="GeneID:38738510"
                     /translation="MSDGGVGPSALWPSVSTHSQDVLFKHQKKEERRMRRRMQLAAAL
                     IEADNELIQHRLMLLSQQNEMPPEYHDSIMLPKYATESALFRDSQSSDSIRPVYTYPL
                     ASVQELSRNFVGLSAKWDEDELSDYVSASDNQKNGDAVKLDLHPNTFGSPMIDVLHHA
                     NMTMENGQEPEPSLSLSNESEKATLKTSHSMPQLSDPGLDSRADFLLHRIQQMKEHPE
                     STPNLDVSMSSNEDSSMSRSMEKSSDILNVAMASYAGSNEDAQINALGIELGSDNRDL
                     PSFRQRVLKRQISVRRPSGRRHSLSVSGWPGEMHSVADEAGILYGQALPDIHSPATAR
                     DSEQTEGEYQLHAPFHSENDYPVSTRWSHRLNPFKTATKKRFTLPSVHTSISPSGESS
                     TYPHLAGLSPVPDEVNVTHSIPSTKDDDMIGVSLHSPLPTDPVSERAPSSATTIRPSQ
                     LFEHVPVTPDLAVAPGMSHTSASFYVTDEGVGTQRRSAIPSYICIPMPLSSLSIDYRS
                     LDNFFTPHGSFVMDGGVIVPSIKNDVGTFAPVEIPAHLGRRALHPSTALFRNVLVNRD
                     EDREGWGWEHFTNASKYFADLAADDDDSDDELPLMDVRIHKRDEALAEKRCRRERLRR
                     KREKRERQRLHALAKNKRFLATKHGSSPISDDETFLNAADEDIDDDDTIIDDEADGEI
                     PWNDDRRPAGRLYGTNLIDKATRHELDRQQAAKHYGHHSAINDHIFNDDTRERMQRLF
                     GQQTLWEDEKRRYETPKNDQHATMDAVMEPGIASAIVYPTSEEIRELEDTQEVHDDDK
                     ADAWLDDSSDEDKGSHSTVPSTEKMSRTSRFELSQPQWIPKGDDDMPLISLQHVNDTP
                     SSDEDLEPLGKKHPQAEIIAEKEAMLRRLQEENSQIRMMLLHSTMQMPPVPYMPWMMP
                     PVPGSMTDTHSMLVGADAGDDVPAAYMYDPNIHAYGPSPLPERLSMENSQAATWNPNR
                     DTLLLDS"
     gene            <227324..>227930
                     /locus_tag="MRET_1745"
                     /db_xref="GeneID:38738511"
     mRNA            join(<227324..227388,227412..227515,227544..227789,
                     227818..>227930)
                     /locus_tag="MRET_1745"
                     /product="acyl-coenzyme A thioesterase 13"
                     /transcript_id="XM_027628372.1"
                     /db_xref="GeneID:38738511"
     CDS             join(227324..227388,227412..227515,227544..227789,
                     227818..227930)
                     /locus_tag="MRET_1745"
                     /codon_start=1
                     /product="acyl-coenzyme A thioesterase 13"
                     /protein_id="XP_027484313.1"
                     /db_xref="GeneID:38738511"
                     /translation="MFNSAVLRTPCLRFVRRVHKWMLDVEGHDYRTTSPLSVVSARPG
                     YMDARFSVKPEHLNRAGSMHGGVVMTLIDSGGSLAVATNGYRNTGVSTDINATFARPA
                     GKAGDVIRVTSEIISMGKTLAYTRTELRDVDSNELLAYGSHTKYIRMGSKATDNVMFD
                     KTGENVVSGKMPEGA"
     gene            complement(<227933..>232134)
                     /locus_tag="MRET_1746"
                     /note="MRES_06960"
                     /db_xref="GeneID:38738512"
     mRNA            complement(join(<227933..230373,230406..>232134))
                     /locus_tag="MRET_1746"
                     /product="ATP-dependent RNA helicase DHX37/DHR1"
                     /transcript_id="XM_027628373.1"
                     /db_xref="GeneID:38738512"
     CDS             complement(join(227933..230373,230406..232134))
                     /locus_tag="MRET_1746"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DHX37/DHR1"
                     /protein_id="XP_027484316.1"
                     /db_xref="GeneID:38738512"
                     /translation="MRPKPRERFNAKARKSQVGGSSHKGKKSRRERQIIEADSNAQII
                     DEATRDALAEQDRQRRQLLREGGNDETMKISSKKRKRLDKFIQAKLRKEEKARVLEKL
                     AKSSAEIGDRTELVSAATLGTGHVTKEAERVKKIMNGPDARKKSRPAVLTIEEDDQDN
                     DLDAKDDKNPSELAREHVLPDMDDRQHRILEALKKFEPKQEAACAKNTVPVVVGSALA
                     KDANNVPIQPVMRKRQRKGNVNGRSNLPIVARVMRGKHEMEETNDTDSSFDTEDDDTD
                     SPQEESEQDEDLDIPMNVFDVDQLVAERRAQEQDNESIATDDLESEEADTDADEETVL
                     LEAMRLRGMLPTKEGTIPDHFLSKMQAPKNLKEKYVELHEKTNDTDEIGEVSGKSEES
                     SEEAYSSESDEDSLESFSSKDLQERSSKRRGIGESSRSRGFKEWANEALQLARPKGKD
                     DDERPLEPVGGFVDRVRDLGPQDGKIRGPLGQDLSDVRSAFTQQYFDEEAFFRGLGEK
                     APLRHVAVKRPSDLQEARLQLPVVSEEDAVLRTIFENPVTVLCGETGSGKTTQVPQFL
                     YEAGFGSKGSANPGMIGITQPRRVAAVSMARRVAHELQLSNNHVSHQIRYDATTSPHT
                     QIKFMTDGVLLRELAQDLTLAKYSIVIVDEAHERSVNTDVLIGMLSRVVKLREKRWID
                     AKEKGMDAPRPLRLVIMSATLRVNDFTKNSMLFSTPPPVVHIGARQHPVTIHFNRRTV
                     QDYVTEAIKKTSKIHTRLPPGGILLFMTGQQEVQTVCRKLSQRYGADALSKYTIEAVK
                     PAMSTRIAEPEAEEMDLGTAEDLDVDDDLDNEVQEDEEALDSDDESLPLAESDTPMHI
                     LPLYSLLPSSEQQRVFEDPPENTRLVVVATNVAETSITIPNIKYVVDCGRAKERQIDP
                     RSQVQSYDISWISKASAAQRAGRAGRTGPGHCYRLYSSALYEELFHDFSVPEILRTPV
                     DGLVLQMKAMNIDNVANFPFPTPPNRSALIGSERMLVHLGALENSDAVSGSKRVVHTS
                     VTSLGKVMALFPVAPRYAKLIAQGHQHDCMAYVIAIVAAMSVGDIFEREDSLALKMTA
                     ENQAQAKELRRAMRSAYFKALQVFDALGDGQSDVFRLLSVVGAYSHEALRGSSVAFCR
                     DNFVRQKAMEEIHKLRAQLSNVVQANLSGLSERQLRQLQNPSLPAPNAVQIKVLRQLL
                     ASIYIDRVAVRADIVGAPEAELAPAAQGTKMASTRRVPYVALGVPGPVYIHTSSTFYH
                     RPPPEWLVFGEVYQSAPKDASLDNEEEKPRTIFLKMLTKINPAWIHTLGRSLCTFSQT
                     TEEPGTSALSDSIKALKRGERSSLQRHVVITPRYGGSLQDGGAAGGQGWELPAFTAKQ
                     VLVNGRWSLQT"
     gene            complement(<232259..>233389)
                     /locus_tag="MRET_1747"
                     /note="MRES_06965"
                     /db_xref="GeneID:38738513"
     mRNA            complement(join(<232259..232290,232319..232441,
                     232480..>233389))
                     /locus_tag="MRET_1747"
                     /product="V-type H+-transporting ATPase subunit d"
                     /transcript_id="XM_027628374.1"
                     /db_xref="GeneID:38738513"
     CDS             complement(join(232259..232290,232319..232441,
                     232480..233389))
                     /locus_tag="MRET_1747"
                     /codon_start=1
                     /product="V-type H+-transporting ATPase subunit d"
                     /protein_id="XP_027484315.1"
                     /db_xref="GeneID:38738513"
                     /translation="MEGLTFNINGGYLEGVVRGYKNSMLTPTNYQALTQCENLEDLRM
                     QLSATDYGNFLANEPSPLATSAIAHRATLKLVSEFEYLRDNATAPLSKFLDYLTYSYM
                     IDNVILLITGTLHGRDTHELLDRCHPLGWFDTLPALCVATNVEELYRTVLVETPLSLY
                     FRDCFSSSDLDDLNIEIIRNKLYKAYLEDFANFCQSIGGPTAESMGELLAFEADRRTI
                     NITINSFGTLLSKTERARLFPNMGKLFPGGNNALAKADELDQVKGIVESVPEYRRLFD
                     DNSIAGIGSADITFETIEDKMFEYEVELNRQLTMTQFQYGIFYSWLKLKEQEIRSICW
                     ISECIAQNARDRIHDFVPPV"
     gene            <233555..>236156
                     /locus_tag="MRET_1748"
                     /note="MRES_06970"
                     /db_xref="GeneID:38738514"
     mRNA            join(<233555..235034,235186..>236156)
                     /locus_tag="MRET_1748"
                     /product="histone deacetylase HOS3"
                     /transcript_id="XM_027628375.1"
                     /db_xref="GeneID:38738514"
     CDS             join(233555..235034,235186..236156)
                     /locus_tag="MRET_1748"
                     /codon_start=1
                     /product="histone deacetylase HOS3"
                     /protein_id="XP_027484115.1"
                     /db_xref="GeneID:38738514"
                     /translation="MVLIVKLPARRPPKDSGSAPPIQDDSVDTGQVRNPPDGIIRERA
                     SAEAKTSELYRSSAHALSTSENITTEWVPVASKLDVLLAPSVLKHRYVRGVDKSNIVE
                     RPQRIRAVLLGIAGVYGVSEKLAACSRTHPEHLATMLSNMTMEERESPLRMFKTSRIL
                     QMDEPEASLADIHAYANEPAMYSTQTEYQLKSEEEPPTSHLARLSILAAKAPHDPPGA
                     LPRSHSANADLSDATSSDGEGDERMHPSEIPEMLPQGDLYLCGPHAQGVSDTSDGGSR
                     EAICHALGACVEAVDRVVTGAKADPSVLTSEQIFPTKAGLADIPPVQTKAHIPAKRAF
                     VLSRPPGHHCCGAEPSGFCWVNNVMVAAAHAYRSHAIDRVVILDIDLHHGNGTQALAW
                     RRNSDAAAADAQRHAKLQSMLRNMQRSGTGSSRQAAKAAEAARTPWEKMLYEESLVGP
                     RAQRVFYGSLHDIESFPCENGDPDLIRNASVCLAGAHGQWIWNVHLETHRDDAEFVRL
                     YETKYTQLFEQARRFIHETQAHAQRTLIMISCGFDGCTYEYPGMQRHGKHVPPQFYAR
                     FAKDSASLADEVADGKLISVLEGGYSDRALTSGALAHIGGLSEMPWSTDTWTRTQAPW
                     SLDNVSHLQKMSKRVLQRAHRSELASVSRRSTAAQPAWVVRASEHFASFQRVCGTNAQ
                     PLEFSSLPSTPRKSLTRGLDLDLATPTRVTPGGHILRDRTIRRTRSHAAMLAHPTPVR
                     SRSHARASAKPMPNAPALPATPRKGEDPANLVPGALPVESAGPTTPIVQSSSIKDEDS
                     SALLDLMDRLHLQEHQAF"
     gene            complement(<236177..>238033)
                     /locus_tag="MRET_1749"
                     /note="MRES_06975"
                     /db_xref="GeneID:38738515"
     mRNA            complement(<236177..>238033)
                     /locus_tag="MRET_1749"
                     /product="RIO kinase 1"
                     /transcript_id="XM_027628376.1"
                     /db_xref="GeneID:38738515"
     CDS             complement(236177..238033)
                     /locus_tag="MRET_1749"
                     /codon_start=1
                     /product="RIO kinase 1"
                     /protein_id="XP_027484104.1"
                     /db_xref="GeneID:38738515"
                     /translation="MSDLEVDQDEIEERSSLYDTSDDELLEEVDTAPGAVEDADWETA
                     RGDFTKQYNRARQMASALQTSSKDTSSALPAVNRARLRQKAAPVPGESISTASEEIAA
                     HPSKSAAQIAALSKFAARIHIEDAYDPSRVAGGSVDGTVPRKTNKLEINRRKDKADRA
                     TLQQVLDPRTLLILSKMIRREIISEVNGCISTGKEASVYYAVRPPASPEQGPGSAAIK
                     IYKTSILVFKDRDRYVSGEFRFRHGYSRHNPRKMVRLWAEKEMRNLKRLVNAGIRAPP
                     PIELRDHVLVMEFLGDKDGWSSPRLKDAESLISPEDWPRLYCELLSTMRLMYHRCRLV
                     HADLSEYNILYHEGHLWIIDVSQSVEHDHLHAFDFLREDIAHVDAYFSKHGVETLGLR
                     QTFHFVVKEAARSRGGGVAGLEKLEHGDEQIDAAVLDIKKKHVQANETEESLMKELSR
                     LLDDTRQTAMTTDAESSRAGLSIVGSLVNQMDEEQKNETEESVFRQSYLPRKLDEIYD
                     PERDAAMVRSGQVSSLIYSSVTGLNDLYDTEADPDQATPDYEAAEPDTEDATEDDSDS
                     SKELDPEQRQNQEREERKNHKKQVKEANRERRKTKMPKAEKKRRMKKTTRKK"
     gene            complement(<238149..>241070)
                     /locus_tag="MRET_1750"
                     /note="MRES_06980"
                     /db_xref="GeneID:38738516"
     mRNA            complement(<238149..>241070)
                     /locus_tag="MRET_1750"
                     /product="RhoGAP and Fes CIP4 domain protein"
                     /transcript_id="XM_027628377.1"
                     /db_xref="GeneID:38738516"
     CDS             complement(238149..241070)
                     /locus_tag="MRET_1750"
                     /codon_start=1
                     /product="RhoGAP and Fes CIP4 domain protein"
                     /protein_id="XP_027484355.1"
                     /db_xref="GeneID:38738516"
                     /translation="MTNEAATTMPRLGISYPPSFSSSFWTYPDYRKGAVVLYSRLQEG
                     LDENETVLMHMQHRVNAEYAYARSLAQGQNVICSSDLLFPGAADRSRSRYDNYSSLTA
                     QAMRETSNLVSSHVAAQHFQVAKELDEIALESFSAWVVAHTERVHGSWRAVDDALAAL
                     EAQSLDATKKQSAYETRCQYADEAEDDVRFAPKPHVFGAQKESDSAQEDECNKKSDDP
                     QSQAARTPSATSNSESKKVSQEVLLTVEDGLEKDAEKSKASNQVPLEQKEADAQKLKR
                     RETIRQQFGFKERKRPNTHEQHDLVHPSSERPPQEQQQQHHSRLSSYWNLTKERVQES
                     PALAQVRAAMTGLSEPRHIRLRREADLAEKAYRESVMLHDKLRCEAEEVLFREYKRVQ
                     KWEYDRAIALQRVLALWQKIVGRITSKSDASMIMSINPASHIQQLVFDFRTGPFRPAA
                     MVFKPYYHDDMRFQAGTINGGFGMDLITAAKSVALQSHKSALSGQGISLAMPNIPPVL
                     HVLLSALQRSYAESSRWVPPNSALSDAKVNAEKRRIWLYDVPLTKMHELRRELSQFYN
                     SNQSENANESSALDQMLDAVDAPVLAATVKLWLLELHSPLLTFSLWDKIVALYEANHV
                     RISSLSEESNNDALNAIDETHLRGLSEILGHLPKLHLTCLDSLVSHLYKLLKLTSTED
                     DDDMYLAKLGLSMGRCVLRPDSTLSSLVFSDVPALLFRDLVKNYETLLPPIMQHKVKE
                     SDSKGLSPYKVLTLQRHRPALVDERIKRSSLPGLGLPKEALQRRATQLESRHMSTPYV
                     RTLVDTTTANEKATVSRSATLSHMQLISGPLHDTAYISSKQEIKGNVVPAISNRSPEE
                     APKTDVLSSASVHANRSKETDNIDTIQRKDEYNQNATDVSSAVPELHLQSMPDAKEVD
                     IPRSPMDLEQERKSPSGSPSHGRFSSDASPNATPTTSQTPLRARPGGVRGPRGPRKAS
                     K"
     gene            <241223..>241910
                     /locus_tag="MRET_1751"
                     /note="MRES_06985"
                     /db_xref="GeneID:38738517"
     mRNA            join(<241223..241289,241318..241490,241517..241847,
                     241876..>241910)
                     /locus_tag="MRET_1751"
                     /product="U2 small nuclear ribonucleoprotein B''"
                     /transcript_id="XM_027628378.1"
                     /db_xref="GeneID:38738517"
     CDS             join(241223..241289,241318..241490,241517..241847,
                     241876..241910)
                     /locus_tag="MRET_1751"
                     /codon_start=1
                     /product="U2 small nuclear ribonucleoprotein B''"
                     /protein_id="XP_027484356.1"
                     /db_xref="GeneID:38738517"
                     /translation="MSTATPNTSLYIKNINTKVKKPELRRQLYSLFGSYGKVLDVVAT
                     RADGMRGQAFIVFRDLQSATAALRALDGFEFYEKPLVLEYARTRSKATIVAEHGQEAL
                     LRPDLIYKNADGTMISDRVTFSNAQGDAQGLERKRARDGSANATGAHASMPSPTFEST
                     ERPTKAPRTDQAPTTTTDTEEKEESDDDDDAMEIGNSDDDQ"
     gene            complement(<242168..>242787)
                     /locus_tag="MRET_1752"
                     /db_xref="GeneID:38738518"
     mRNA            complement(join(<242168..242583,242674..242735,
                     242780..>242787))
                     /locus_tag="MRET_1752"
                     /product="small subunit ribosomal protein S19e"
                     /transcript_id="XM_027628379.1"
                     /db_xref="GeneID:38738518"
     CDS             complement(join(242168..242583,242674..242735,
                     242780..242787))
                     /locus_tag="MRET_1752"
                     /codon_start=1
                     /product="small subunit ribosomal protein S19e"
                     /protein_id="XP_027484353.1"
                     /db_xref="GeneID:38738518"
                     /translation="MPNVKDVDAAQFINAYAQHLKRSGKIEMPTWVDIVKTGAFKEQA
                     PYDPDWWYVRAATLARHVYLHKSVGVGALCKLHGGPKNRGFRPSHHSRASASVQRKVL
                     QSLEAIGVVEISSKGGRIISQDGMRDLDRIAVAVLESQREDEEDEDEDEDEDEDEEDD
                     E"
     gene            complement(<242939..>246403)
                     /locus_tag="MRET_1753"
                     /note="MRES_06990"
                     /db_xref="GeneID:38738519"
     mRNA            complement(join(<242939..242960,243003..243085,
                     243129..246356,246398..>246403))
                     /locus_tag="MRET_1753"
                     /product="classical protein kinase C alpha type"
                     /transcript_id="XM_027628380.1"
                     /db_xref="GeneID:38738519"
     CDS             complement(join(242939..242960,243003..243085,
                     243129..246356,246398..246403))
                     /locus_tag="MRET_1753"
                     /codon_start=1
                     /product="classical protein kinase C alpha type"
                     /protein_id="XP_027484354.1"
                     /db_xref="GeneID:38738519"
                     /translation="MPDSVPTKIADLESRIQKQHRIIEGFQNLRSATPNQDVIKQADS
                     NIRDAQRTIHYLQDSLMSLQRRASIDAINTERKPSLSGTIPATPTTSAHLDSLNDPTM
                     SPSQVVDEYAQTTFDAPSFAPFPIDSSAAYRSGSYSMDHGISPLNDMNLLSREPTVAR
                     RNYSPLDLMRYDTPLTSAKVQRMLNQLEYKLQLERQFKQGYDKIARLYEAEGDRRSQD
                     DAASRRSESAGKLVLIQQALNRYQQLDMRDAEEVQQENPYAARRARKPQSGTLSISIK
                     RAKEIDHAAISNSTRLMRESYVAIKVEETERVQTPSSRTDTWNVKYELPLENTNEVEL
                     VIFDQVGSSVPVPVGLLWLRISDIIEQLRRIKTGQVLPDNAQSSPAAGGGEWVTAERM
                     ASLHSSNTMNQTVMQQAKETGMEGWFTVEPTGAIYLRLDFTKQNVTKRPYDTGLGRHG
                     AMRKRPEEVSVVNGHKFIPRQFYQVIRCALCGELLLNAAGSQCQDCNYTCHKKCAQKV
                     VTKCISKTSDLSARDEVELKHRIPHRFEPFTNLGTNWCCHCGSMLPLGRRVGRKCSEC
                     DITCHADCMHLVPDFCGMSMEMANQMLSNIATIKKNRFSSSLPDSAAPKRSSVLSTDT
                     LRPSAQQASMGQLTPGMQQLMVTPSSSRPSVSMQGSTQHSPARSPLPSPQQSPKPSPV
                     HPIRQNLASMRQPSIDLNGVALTSPPSSLQPMSQPFKDSARIPPKSVNRVPVPTPSPS
                     HASPLPPRPSLPQVAVVPPQLPSGPEQASSLEFPPSSMRNVTLDDFNFLAVLGKGNFG
                     KVMLAEEKQTGVLYAIKVLKKEFIIENDEIDSTRSEKRVFLTVARERHPFLLNLHSCF
                     QTETRVYFVMEYVGGGDLMLHIQRQQFNLHRAKFYAAEVLLALEYFHKHGIIYRDLKL
                     DNIMLTLDGHVKIADYGLCKENMWYGNTTSTFCGTPEFMAPEILLEQRYGRAVDWWAF
                     GILLYEMLLGQAPFRGDDEDEIFDAILEDDPLYPIQMPRDSVSLLQRLLTRDPSRRLG
                     AGPNDADDVKAHPFFRDVNWDDLINKRVPPPFCPTLRHASDTEWFDTEFTREKPTLTP
                     VHSIFSPEDQAEFRDFSWTSPHFV"
     gene            <246642..>247525
                     /locus_tag="MRET_1754"
                     /db_xref="GeneID:38738520"
     mRNA            join(<246642..246872,246899..>247525)
                     /locus_tag="MRET_1754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628381.1"
                     /db_xref="GeneID:38738520"
     CDS             join(246642..246872,246899..247525)
                     /locus_tag="MRET_1754"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484311.1"
                     /db_xref="GeneID:38738520"
                     /translation="MTRRAKVVVQTRTHELECEVLLRTCGPRARAALQCDGRKLQIQC
                     ACSVRHTGGQMRLLASGLHQSGMRPAVAAFMRKNAEVFNVRSVEYTGVTRDNALRYAC
                     VLRPIPRGTTAPKYIYLHLLWHWRDESIVQALCAPVMGMPLLHALHQALYESMVRVIA
                     PHAEHINGAYAHHVCQMTPLIHCVAQSIAGITHPASTADPAREIARVLNLADRSILPP
                     STFPMPCTTLEHDPAPQDLPNLSTDTTYILSPPRALSINGDSSDARWDDDHDMWATPC
                     ASPIDSINI"
     gene            complement(<247530..>252662)
                     /locus_tag="MRET_1755"
                     /note="MRES_06995"
                     /db_xref="GeneID:38738521"
     mRNA            complement(<247530..>252662)
                     /locus_tag="MRET_1755"
                     /product="senataxin"
                     /transcript_id="XM_027628382.1"
                     /db_xref="GeneID:38738521"
     CDS             complement(247530..252662)
                     /locus_tag="MRET_1755"
                     /codon_start=1
                     /product="senataxin"
                     /protein_id="XP_027484312.1"
                     /db_xref="GeneID:38738521"
                     /translation="MAWLEARHVHDPGQPLYEALEQYVPEANMAWPLARSMYAALACE
                     QAEPKATSYTLDGVVAMLKTSRGQDKLAWTIAQSVYDGSPSHVETLAPLALESLSASE
                     APLEQVLSVLTLLCQSEAMSPLWDRYRPMRVITDVLEHGACDRMPLPCIFAFLVRFLD
                     AMRSPVSYDETLKLIMQHLLEYRQHAHHDESVRSSALALGALLLEVRLNKAIEAALAH
                     PTPETCIQGDASLSLVLNLYAVTLMTGSMRTPRLVRPLGLALVYDVVRTVNACLYISC
                     TSQYIASSRKQHGQDKGFAQLLEDVGDMPLPVVSDHVWKQVSLALGSDESHLVPRVLR
                     AYFLHALSIIAPFYPAPVLETHIPKPSENPPSKSYDTLCSRISALVTQTQHTMTMVVD
                     ALTTALEQNTLAEMPSVCISVLPSLSASPSKELAHGAHAILRSLSDASYTRFESMHML
                     WLDAREPAVYGARHFVSLFLHAAHHLSWSLSLARASVSMLDDMLHVLCDRNMGVLLPY
                     IPWDAGSGADVLHVWTGISECIAAMFGRIPEWSRTADRQEMLQWIAHVPMLASYMVQS
                     ADLASRSNELQPYTDQVYGALAWPLDCAIGWLRLNHGELLQQLSDYIRRTVHVFKKQQ
                     CVMPGPVVKHAVEFLGQQLAVTNAQQRKTLLSTPQMELLLDEFIALSRAPGPPAPKKQ
                     KLQQQTLSFAPRPLDAPKKKPIVVDLTRDSPKTAAPKPKSTGKLAQLRNEFQLTRAVA
                     RKPQAPLRQFEPDEPRAPLATSSVTGAVKTLPPVKRPPPPEDSSSSSESEEEEEGLAA
                     LASPRKPKAHEVRRSVKPMVDPALQEAMRKAEDEQRRRRLAKAPALTPMHECILSWDM
                     QAKGGLPPTRLDGMPFSIDAARSPLTDTASYMNRFCTLLTLEAWAQFQQACGDVRDAV
                     SVPLQYTRQSRVDNFVHLEWSTQTAVPVGTYFNETDIVYLELPSRAIRLTANVLFSKR
                     ASTTGPATINLGVQCVCAKAQHAMPFMHEAGWKVTKLLTLTTLRREFAALCSVPDLAM
                     TQDVLHARVAQVPDVSKADEVKAMQTYQLNAPQARAVVAAMRTLGFSLIRGPPGTGKT
                     KTIRALVASFLSRRAGTTIGAKKASAPQARMLLCAPSNAAIDELVIRIKNGVEIDGKR
                     ILPRLVRLGRDEAVHPNVRDVTLDALVEKAGGNAGPSRAMDELQQVEQAWQRKRTQLE
                     SASASQQARALQAELNELTDRRFELREQVASLRSRNKMGALRPGAEHHMARMSILDDA
                     EIVCTTLAGAGHEMLYRYTFDTVVIDEAAQTVEPSTLIPLRYECMRCIMVGDPKQLPP
                     TVLSQEAQRLEYDQSLFVRMFNAAPERVHLLSIQYRMHPDISLFPSTAFYDKQLVDGP
                     RMTELTAQPWHGTALFGPFRFFDVRTPEEPGRSHSLQNPSEAQVAMQVYEALCACAGS
                     SLQDRIGFVSMYKAQVELLKSLFIKRYGRSTAHEVEFSSVDGFQGQEKDIIVISCVRS
                     NRDGNMGFLTDYRRLNVALTRARSNMIVIGNADMLCKDKIWRTMITEARSYGFVVPVD
                     SKTFDNPQRPAPKFVASKPKVTTEAPSPPKPLPAPKTDTAKASSTPVSTPKMSKQAAP
                     IKVTKAPTPISAPTNPKKPNQMTEGVRAPPRVVPSASLLAPPKRKHKTGKWTQIVERN
                     KASKPETPMPAPKSDRRPPPSHDGPSWLRSARPHTLQKRNPP"
     gene            <252764..>253308
                     /locus_tag="MRET_1756"
                     /note="MRES_07000"
                     /db_xref="GeneID:38738522"
     mRNA            join(<252764..253000,253027..>253308)
                     /locus_tag="MRET_1756"
                     /product="tetratricopeptide repeat domain protein"
                     /transcript_id="XM_027628383.1"
                     /db_xref="GeneID:38738522"
     CDS             join(252764..253000,253027..253308)
                     /locus_tag="MRET_1756"
                     /codon_start=1
                     /product="tetratricopeptide repeat domain protein"
                     /protein_id="XP_027484357.1"
                     /db_xref="GeneID:38738522"
                     /translation="MSGAHGDVATKMAQGLAYKDQGNEAFMKGDHVGALKAYHYATLY
                     LAGLDVNVLQQLGPVPDRARGTREDQKQLSLVRSNMAACYLAQERYDRAVQVCDQALA
                     SDPANAKAIFRKAQALRRQGALYQARDWLDAEGVRAYTHSPDFDAERARIAASIAARE
                     RASHARLRGFLT"
     gene            <253348..>256542
                     /locus_tag="MRET_1757"
                     /note="MRES_07005"
                     /db_xref="GeneID:38738523"
     mRNA            <253348..>256542
                     /locus_tag="MRET_1757"
                     /product="DNA damage-binding protein 1"
                     /transcript_id="XM_027628384.1"
                     /db_xref="GeneID:38738523"
     CDS             253348..256542
                     /locus_tag="MRET_1757"
                     /codon_start=1
                     /product="DNA damage-binding protein 1"
                     /protein_id="XP_027484358.1"
                     /db_xref="GeneID:38738523"
                     /translation="MYWLCPSHAPSAAVAGRIVYGWWDHEALLCVAYHSQLTFYALVG
                     AAPFSRVAEVPLRARILAVEVSHGQADVLYVLTDHPHPRLVAFRPGDAYGVRTVRVWP
                     LDQPLRPASDIGVTLALEKAHGRSSGRWVLTHTHTGYVHLAKLGTDIAFHARLTHATL
                     VHATFLERTSAHAPVMLACLSISSSLYTKDTPVLTFHTIHTSRRALEQVPWAPMSSKP
                     HDRKVPRLDVPGTWHVPVRDRDVMSAHYVLAMPAAAGGGVLLFCSHAIYLVPRPQPPR
                     PSPPLSSALRRVDLDRPVYVMSATYLPMHHDRVRVLFGTEDGRVKLLQVVRRTSWDQA
                     DLHVMDLGMAPVATAPQGVSSLAEDYVFLASNTGDSLVWHVQDDVKEVYRWPSLAPII
                     DFVKDDASFVDRVITASGAGPTASIRAVTRRARTRCLLSKPMVLLDVRALDPHTTLLV
                     HPSHSAIVRDARLIGTLHEQIVHASQDLVVTESGMYTYDPKRTLWEAPAPVLACSRSD
                     HLIVVGLATLALMVLSRLDDGRWTVVHTLHTHAPVSSLDIADVLVASFWDRSLCLYSV
                     PDMKLLAHHTTSSLVCSALWHRFVPDGPAYLVLGCNDGHILVHDAHYTSIHSRRMGTH
                     PVRLARVPLSALDSPMTGVVAFGRHAYFLYLKESVLCGSAWSVDHVTGLACTASTPTL
                     ELACATKHGLEVHVIDALDQIDIQTKAMPQPVTTLQSMDSHLVVTTCLAESESGTLRV
                     LAPDTLEDVCALPLDARPTCACIAELHDSLYVVVGLAAGASDGKIAAYLWSDGKLHAA
                     WSKHVGDHVCALTTVSGYVAAAIGHEVHTYAMEPHALTFRRPWDCAFVSSCLASQGST
                     LVVGDAMHSLTVLTVAEDGRLSESARDLHPYWTSAVCVLDEEQQRYLGTDVAMNLFVA
                     ERAKGTEPESPWSHVMRHAAACHVDDLVNAIHTLPGGRVMYATASGALGTLVHVPEPV
                     ARVLLCVQDAMIEVVPAPGDIPWESWRTSRTDTRTEPPHHILDADVLRFFVSDPSVRS
                     PCLDKAGSLAQARDIPMAEMAKERILQTLHALLS"
     gene            complement(<256524..>258815)
                     /locus_tag="MRET_1758"
                     /note="MRES_07010"
                     /db_xref="GeneID:38738524"
     mRNA            complement(<256524..>258815)
                     /locus_tag="MRET_1758"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628385.1"
                     /db_xref="GeneID:38738524"
     CDS             complement(256524..258815)
                     /locus_tag="MRET_1758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484305.1"
                     /db_xref="GeneID:38738524"
                     /translation="MQDDVVTPTLALAEAREICIDIAALFAGSIFELALPPASLASES
                     HPCIYYDERVRVQLVMRLPSLPTLLPGPREGLGNVDRLDNNSSLSIPPLLSTLLSYLH
                     ISLRGTMPSGATDAADAPLASLFVHSWQRSPVPTDFCLRRSSLLRAPKADMPDIEPLR
                     DASFVPGISYDLEKKGWTVRWWSDVSVPYTTMDVSVSKIQMEAVVQLRLDLARLSAEA
                     QAPPPQMPFHYASNHMHPFSYSDDPYLIDVDLLSDLADQVKVLNESPQQRLDELSKRL
                     TMLPLSMLAPGSLSTNITSPWGVSQFITEKQKELREQEAAARASDADIALAPLAPSSA
                     PTSSLRECPRRSSTPSALLAQDSPHDFEAPATVDLATLASYGPVALTKVTTHTASVCA
                     SITVRMRTLSRSWPTVENTRAVMVCVELEALPMPSPFLLHAIHIDIGERSDLVRDVGF
                     MPYQDTIEAIIKPLPGDASALPVRIGRFSQHNLLYTVQLVPREPHMDPQTLGHLLTTW
                     DPRRCARVTLLGTPDRGALTAPYSTCVSQWNGSMDVSLALLDLQRRSFADYVMHTSMQ
                     IPPLPPAREERVCQVGDPAMSPHTLHQTRRALPVRLEETSAFSPYYERRPAEAEAPRR
                     ALGWGESHAQHGGFDPTRVDTFDSCVLATVEARHVLRSADAHYIDVYVTLTNVSSDRV
                     LDLEVSWLAEHHGAALVPDTDCVRLGILQPGKSRRADLCLHVLSAGFHRLGHIRVCDT
                     GTNIACVLQHVGSMCVEFQDSKA"
     gene            complement(<259022..>259897)
                     /locus_tag="MRET_1759"
                     /note="MRES_07015"
                     /db_xref="GeneID:38738525"
     mRNA            complement(<259022..>259897)
                     /locus_tag="MRET_1759"
                     /product="voltage-dependent anion channel protein 2"
                     /transcript_id="XM_027628386.1"
                     /db_xref="GeneID:38738525"
     CDS             complement(259022..259897)
                     /locus_tag="MRET_1759"
                     /codon_start=1
                     /product="voltage-dependent anion channel protein 2"
                     /protein_id="XP_027484308.1"
                     /db_xref="GeneID:38738525"
                     /translation="MSIPVPPSWKDLGKAASDILGKDYPIHGSTLEVKTRTPSGVTFR
                     VLGLHDNKSSNISGDLEASWQDRKKGLAFTQAWSTANVLRNHIESENHLAKGLKLEVI
                     STLVPEKQAKNALVALTYRTPGLHTRQFLDVFKGPLATADAVVGRDGFLFGAEAAYNA
                     KDKKLARYNLAAGYHAPEYAITLHALGNLSTYSASYYHRVNQDIEASARATYDSKASS
                     NVNLEVGTKTYLDNAAFIKAKINNSGILALGYAQALRPGIKATFGLALDTIKLSSGST
                     DASAHKLGAALTFEA"
     gene            <260277..>260777
                     /locus_tag="MRET_1760"
                     /db_xref="GeneID:38738526"
     mRNA            join(<260277..260312,260364..>260777)
                     /locus_tag="MRET_1760"
                     /product="mRNA stabilization protein"
                     /transcript_id="XM_027628387.1"
                     /db_xref="GeneID:38738526"
     CDS             join(260277..260312,260364..260777)
                     /locus_tag="MRET_1760"
                     /codon_start=1
                     /product="mRNA stabilization protein"
                     /protein_id="XP_027484407.1"
                     /db_xref="GeneID:38738526"
                     /translation="MLPHQQNKIDISSLTEEEQKVFRLYGKLPTRKDLLANKLKERKY
                     FDSGDYALSKAGRAPKQSVGTTIPNPEMVPHATNPVQIPGAPLYGTPNAPGSPGATYM
                     PAPTSPSGSRSSFPMATGVMAGSPIRESTAPFGHERAPEASNDVMLE"
     gene            <260837..>261509
                     /locus_tag="MRET_1761"
                     /note="MRES_07020"
                     /db_xref="GeneID:38738527"
     mRNA            join(<260837..261289,261317..261392,261421..>261509)
                     /locus_tag="MRET_1761"
                     /product="subunit 21 of mediator complex"
                     /transcript_id="XM_027628388.1"
                     /db_xref="GeneID:38738527"
     CDS             join(260837..261289,261317..261392,261421..261509)
                     /locus_tag="MRET_1761"
                     /codon_start=1
                     /product="subunit 21 of mediator complex"
                     /protein_id="XP_027484406.1"
                     /db_xref="GeneID:38738527"
                     /translation="MHSVPLFIIQRFTALECFLSTSTSIHVTSVIEMTFHVARPDRAS
                     PGRQQAVHVLHTVKHASTMSAITELEDSLDMLLKVMASAIAYLSRKAAHTQVNPTVPL
                     TTLGNTDAPSFEALQGTRAELVQDIVSQAQDVQLRISHLPTTMLSEDEHACEIRALET
                     ELQEANREYIQSLDEARALSSKLDALLDRLTEERHAARELLSHDV"
     gene            <261593..>264448
                     /locus_tag="MRET_1762"
                     /note="MRES_07025"
                     /db_xref="GeneID:38738528"
     mRNA            <261593..>264448
                     /locus_tag="MRET_1762"
                     /product="helix-loop-helix DNA-binding domain protein"
                     /transcript_id="XM_027628389.1"
                     /db_xref="GeneID:38738528"
     CDS             261593..264448
                     /locus_tag="MRET_1762"
                     /codon_start=1
                     /product="helix-loop-helix DNA-binding domain protein"
                     /protein_id="XP_027484405.1"
                     /db_xref="GeneID:38738528"
                     /translation="MMEEESAEPAPVAFRATSDDMNEWKDLDSTLGVPKPWSMVDVPD
                     LFLTNLIHDVDHTFADDSLTEFSSTMNHSGSDSESSSDAFKDFMMRQSSPESLSNTPP
                     LVHSCGDGGVDGTTTSPPDFPLDTQDMAPLTNQQLASIFGFPPTSSCNQEPVQGISPS
                     SVQQSPPVSMHKPEIPVQTTSPVSESQASSGSPTQESILASLHMQPGSNSNAMTALNR
                     LRAVTHECEQKKQENKQQQVKSSLSSATTPQSSSSSNVPSDGSEMWTRKNAHNAIERR
                     YRSNINDRIAGLRDVVPALREMQSRGPRRKRRRGKAEEVELVDGIRAATKLSKATILS
                     KATEYICYLKSREVRLSREVAGLHMLLRSLEGGDELMSQWNAEMERLHAMYPPMDAVY
                     PDGPAPPLSPSEDAEEGDLVDESDDADDSESVSSGGEPMRTKAARYMLGAFLIPSLLG
                     RSDWGTEAPDATPQAHVMGVCHQLWKRSLGSSDTVHPYNHVPLSDLVWELLRGCALLG
                     LIVVVLMSVGAHIRRWCRRLELKQSSRLQYVAGAEALLRTPVEQAQVAEPMQPAHAKR
                     MYAQLSELLHVPRTYMALSWRIAWTCLCLITTLFPGVTAWIRYASADPTVSLLYRRAH
                     MRRAELELTLGGDIQPSLAQRLYTLVVLQFAACIYCATVDESLLLALMYCDLAQRTRI
                     PLLMRHGAYLWRKTGARLVDAPNSDETSQRMLAELLSVPVPQALAYARSNATEASVIV
                     SPLANMLEALRQEALLSYWTTIITSMMRTASSAEKRWSPHVLDVIQDSASLRGIQQQL
                     HALSRDGASSAALHEQMLVAQGMLELAAGQLTRAQMHARSLKQHQPSSLAAQQFLALW
                     KDTPLVASAPRGPVDMLASVVIGWFVLLRKYHLHGGTHEVSDQVAACTSTLQELASQC
                     LWTFVSPPEKGGHVYLQPEQAPCLVHALDLLMDQLSP"
     gene            complement(<264458..>266302)
                     /locus_tag="MRET_1763"
                     /note="MRES_07030"
                     /db_xref="GeneID:38738529"
     mRNA            complement(<264458..>266302)
                     /locus_tag="MRET_1763"
                     /product="ATP-dependent DNA helicase Q1"
                     /transcript_id="XM_027628390.1"
                     /db_xref="GeneID:38738529"
     CDS             complement(264458..266302)
                     /locus_tag="MRET_1763"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase Q1"
                     /protein_id="XP_027484404.1"
                     /db_xref="GeneID:38738529"
                     /translation="MHHADDDDVCVVDIQTASSLLDLDAHAKYQVERVDAELALVREQ
                     LTVLHKREKALLSERAHILAEQREVNALDTKPTNYTHSDFLWSSELLRTAQRVFGIEA
                     FRSCQEGVCNAVMDRRDVMVVMPTGAGKSLCYQLPALLSEGLVIVISPLIALMTDQVY
                     HLRERGVLCALLSSSMSSADTQDILQRIRTLAPDMPRLLYVTPERIVKSKTLLSVLQR
                     AYEAGRLERIVVDEAHCCSMMGHDYRPDYHKLSICRKLFPTTPVMGLTATLGSAALRD
                     VLNILGMRETTTIPERALPRRTVYFRAPLRRANLQYSVRMRPSSAQAAQRLIASYILD
                     HHEGHSGIVYCLSRKDTHTMADALAQHSSGRIRTGVYHSDLDEAEKHRVHAQWRTGAI
                     QVVCATIAFGMGIDKGDVRFVVHACISKSLEGYYQETGRAGRDGAPSDCVLLYRAAAD
                     MSRVSGMTASEVGAQAKLHAMLRYAQSELCRQSILATYFDEPRTEPCGVCDRCQSPPP
                     RHADVSVWAAHAVQVVSDVYARGSRITLAALADAVYAAAKSDAALSRVDCECLVVQLV
                     LDGYLSERFQATAYTVNMYVVPGPRASHKGPVSMVLHEPVTSHKRRRS"
     gene            <266338..>267429
                     /locus_tag="MRET_1764"
                     /note="MRES_07035"
                     /db_xref="GeneID:38738530"
     mRNA            <266338..>267429
                     /locus_tag="MRET_1764"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628391.1"
                     /db_xref="GeneID:38738530"
     CDS             266338..267429
                     /locus_tag="MRET_1764"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484403.1"
                     /db_xref="GeneID:38738530"
                     /translation="MDDGAWLNWPSDVWDDEDTSHRRRAREERMRNAFLQARATYDAK
                     RDTDEWFMEGLSYDALPHTHLDAKTQQRIQMCIEYMYYKQRYAEAFAWSVCLLRRMHV
                     LGTSVVWTDGLPSFPTELPHDKTSWSMAHSAVARETLDTALRCVLHFHTSDHGDIDCL
                     VAAALDRVQLDPAAYQGMALDEQKRKECAWTTAPGLAMTLGDVCMHMQYTRCALESYA
                     LVMGMRGAQWYVCKAVAQALSRIAEPTKKAQNTLLMLAQATSVCALQSCPPSRRTSMA
                     HEIVSGQLVGSSQPVHGDSDGTDCGLSEAAMTGILWALQKRGGPALLASRLPTFMAMA
                     QQYLRDTSTPWMACHDESLEKTWSSARAL"
     gene            <267475..>268710
                     /locus_tag="MRET_1765"
                     /note="MRES_07040"
                     /db_xref="GeneID:38738531"
     mRNA            <267475..>268710
                     /locus_tag="MRET_1765"
                     /product="N6-L-threonylcarbamoyladenine synthase"
                     /transcript_id="XM_027628392.1"
                     /db_xref="GeneID:38738531"
     CDS             267475..268710
                     /locus_tag="MRET_1765"
                     /codon_start=1
                     /product="N6-L-threonylcarbamoyladenine synthase"
                     /protein_id="XP_027484402.1"
                     /db_xref="GeneID:38738531"
                     /translation="MPRHEPLSTLTRPYLALGLEGSANKLGAGIIRHMPLTGHDGPAA
                     ALNQARVDILSNVRHTYVTPPGEGFQPSDTAKHHKHWILRVVSEAVRASGIDSLADID
                     CICFTKGPGMGAPLQAVSLVARTLSLMYNKPLVGVNHCVGHIEMGRTITGAQNPVVLY
                     VSGGNTQVIAYSAQRYRIFGETLDIAVGNCLDRFARVIGLPNDPSPGYNIEQEAKKGR
                     RLYSLPYGTKGMDVSLAGMLSATEAYTKDPRFRPTQYACTTDAPVDALANGRVWAGSS
                     SHAIEKDMPAPLATTEDNTDPDVITPADLCFSLQEHMFAMLVEITERAMAHIGSKDVL
                     IVGGVGCNARLQEMMGIMAEERGGSVFATDERFCIDNGIMIAHAGLLAFRMGQTVPLE
                     KSTTTQRYRTDTPHISWRA"
     gene            complement(<268714..>270120)
                     /locus_tag="MRET_1766"
                     /note="MRES_07045"
                     /db_xref="GeneID:38738532"
     mRNA            complement(<268714..>270120)
                     /locus_tag="MRET_1766"
                     /product="prolyl-tRNA synthetase"
                     /transcript_id="XM_027628393.1"
                     /db_xref="GeneID:38738532"
     CDS             complement(268714..270120)
                     /locus_tag="MRET_1766"
                     /codon_start=1
                     /product="prolyl-tRNA synthetase"
                     /protein_id="XP_027484563.1"
                     /db_xref="GeneID:38738532"
                     /translation="MRGTFVPRHVHHAFKSGRYTPVRLSKLFVPTVPADALAAGDTLE
                     SVRRLLRGGYVRQSASGTYSYLPIGMRMLKKVTHIIEEEMDAVDASQVEMPQLLSPAL
                     WHKTGRFEAMGHELYRLKDRRGSDMILAPTHEEEVTKLVGMEIESAKSLPVRVYQIGR
                     KFRDEPRPRAGLLRTKEFLMKDLYSFDLSVQEAQATYEEVRQAYGRVFERIFHWDHIS
                     EPTWMQANADSGAMGGTFSHEFHVLDPAGEDTLLACDDCTYASNVECAVSHDSIQHDR
                     NVQAGDTCHACGSGQLHEHRAIEVGHTFLLGTRYSEALGYGVVPPQQQNREPLQMGCY
                     GIGVTRILGALAQRAAREFDLQQVPDGKRRAGFVWPNELAPFHALVLPSTPRHMEAAQ
                     RLCLQLDQGLSLDGEACQIPLWDVALDDRTDKSLGSRLFDADLMGSPWVFVLGKHFEK
                     ERKVEVRRVGRPVQYITY"
     gene            <270392..>271587
                     /locus_tag="MRET_1767"
                     /note="MRES_07050"
                     /db_xref="GeneID:38738533"
     mRNA            join(<270392..271277,271312..271374,271403..>271587)
                     /locus_tag="MRET_1767"
                     /product="glycoside hydrolase family 16 protein"
                     /transcript_id="XM_027628394.1"
                     /db_xref="GeneID:38738533"
     CDS             join(270392..271277,271312..271374,271403..271587)
                     /locus_tag="MRET_1767"
                     /codon_start=1
                     /product="glycoside hydrolase family 16 protein"
                     /protein_id="XP_027484401.1"
                     /db_xref="GeneID:38738533"
                     /translation="MLVVLAIVFGCVAQSLALNYSICREWSGHDFYDQFFWFNYDDPT
                     HGLVDYVDQHTSRETNLSYVDPSTGRFVMKVDMGDPVPLHGNWSNMVRRSNRIHSKEW
                     FEDGFYIIKATRMPTGCGVWPAFWTSTGDQWPEGGEIDIIEGVNGKGPNLSSLHTAKN
                     CSIDARFNSSQLGNLERTDCAFQPGCASKYNDRLSFGHAFNNNGGGYFALMRDTRVNG
                     SGIGVYFWPNNVKPVDIPDQVAAPPHKAPGTLDSDKMQNWGKPQAFFGYNDGSNTQCD
                     LAKHFGKHQIIFDTTLCGTWTNNHKKDTSGCLVSCVDFLLNHGPEYADARWEIDYVRL
                     YANKCDKTHDDDDGAVSMVASTKTMKYCIILGMMLVTIVTGSL"
     gene            complement(<271594..>272403)
                     /locus_tag="MRET_1768"
                     /note="MRES_07055"
                     /db_xref="GeneID:38738534"
     mRNA            complement(<271594..>272403)
                     /locus_tag="MRET_1768"
                     /product="hypothetical protein"
                     /transcript_id="XM_027628395.1"
                     /db_xref="GeneID:38738534"
     CDS             complement(271594..272403)
                     /locus_tag="MRET_1768"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027484400.1"
                     /db_xref="GeneID:38738534"
                     /translation="MKILAVPVARHRNPARLPYITYLPKLTRPFPGIATTSSQRMMQF
                     VSNVWTQWGRPDTKSLLDWKNRVYSMGERIMDSIEYEEWALKGIDQVLGPSIQRLLSR
                     SHQTAPDAHTHVSVLYPPSLISRPSVLESLQRMSTHRAPLHNRQFLYNMVAIPVTAPL
                     FLVPAIPNVVTYYFIWRAWSHWRAYQALQSLQSLIRHDLVKFEPDEQLDALFQHSRPP
                     PSDLSTDCAWLLDQSCMNRIVDDYILPAQAYVDLRRASKQAIHDIIRSGAT"
     gene            complement(<272552..>273706)
                     /locus_tag="MRET_1769"
                     /note="MRES_07060"
                     /db_xref="GeneID:38738535"
     mRNA            complement(<272552..>273706)
                     /locus_tag="MRET_1769"
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 9"
                     /transcript_id="XM_027628396.1"
                     /db_xref="GeneID:38738535"
     CDS             complement(272552..273706)
                     /locus_tag="MRET_1769"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 9"
                     /protein_id="XP_027484399.1"
                     /db_xref="GeneID:38738535"
                     /translation="MSLPRSVLCASRDSVKPLHAFARAYSQDLSIKHRTGMPQVGAGP
                     YGFGRSSVSGSIATVFGCTGFLGRYVVSKLAKAGTQVVVPYRDEDEKRHLRVLGDLGQ
                     IVPLEWDIRNEKQIEECLRHSDTVFNLVGRSYDTKNFSMNEVHVDGARRIAEIAAAHG
                     VARFIQMSHLMADVNSESEFMRTKALGEDAVRRAFPSSTIVRASSIYGHEDRFLNKMA
                     SWPITWKLNNGKTIMRPVHSLDVAEALSVIAREDQISMGETFELYGPKAYSIREMLQI
                     VEDLTYQKIVSPEINIPRFAFSALAKLGEKIAWWPMFNADEVTRRFIDEVPRGGMKGF
                     ADLGIEPDVMEDVAIMFLRRFRSHLRYEQPIDNARSGAVKLRKRPFRIVQ"
     gene            complement(<273809..>275653)
                     /locus_tag="MRET_1770"
                     /note="MRES_07065"
                     /db_xref="GeneID:38738536"
     mRNA            complement(<273809..>275653)
                     /locus_tag="MRET_1770"
                     /product="WD repeat protein 22"
                     /transcript_id="XM_027628397.1"
                     /db_xref="GeneID:38738536"
     CDS             complement(273809..275653)
                     /locus_tag="MRET_1770"
                     /codon_start=1
                     /product="WD repeat protein 22"
                     /protein_id="XP_027484430.1"
                     /db_xref="GeneID:38738536"
                     /translation="MPSKRRTRSPSVDALDRLDSARMRLQRASTSIHARTQAMHLRQS
                     ILRDAIETSKFSYLHEVKGHRSCINALAFSRGSGQWMASGGDDMRIHIRDLYDYHDSR
                     SSAPEASTYRTRARLLGHTSNIFSLAWSENNTHLFSGGNDQMVHCFDLNYDAAPIDTF
                     QLRAERRMPDMSFSEHDTGIREVSAHPTHPSLVMTSSDGGQVFVVDVRLPTPHVAQAF
                     LFPGQVASAQWNPRDSHAFAATCSHDPHAAAALYDVRHASHLVSSSDALVRYVSQLRA
                     KLPAGLAMARPDPTGAQFDPTGRYLVTDMSLFHPTLYAVDSPLPLATMSSVAAHPHTH
                     PCTKPDTTVYRPNAGYRNSCTVKRGSFGFEAQAGALYYTAGSDDFRGYGWRIPHIQDM
                     LDARASMPYNDWIMHETAGSNEVWFRYALHASDDMVRPLEIAQPVFTLEGSNSIVNST
                     LCHPTMPMIATAGIERLVRLHYATPMSSDHLHPAWPTLRPNTRQRPPLTDMTALLRAI
                     QRRPHIPSDSDTETEEQAAVSPASHAPTSAELADREAISLFDELLREEEDRSLFSHQD
                     IDTENDTDIDPDMQSIWDSESDMHVDLDALAFLLGPDEDSIETNEEDA"
     gene            <275769..>276414
                     /locus_tag="MRET_1771"
                     /note="MRES_07070"
                     /db_xref="GeneID:38738537"
     mRNA            join(<275769..275946,275972..276108,276136..>276414)
                     /locus_tag="MRET_1771"
                     /product="adaptin ear-binding coat-associated protein 1/2"
                     /transcript_id="XM_027628398.1"
                     /db_xref="GeneID:38738537"
     CDS             join(275769..275946,275972..276108,276136..276414)
                     /locus_tag="MRET_1771"
                     /codon_start=1
                     /product="adaptin ear-binding coat-associated protein 1/2"
                     /protein_id="XP_027484431.1"
                     /db_xref="GeneID:38738537"
                     /translation="MSTLFVVRQCHVYRVPPRTSAAGYRAAEWGDTSQPLWTGRMRVL
                     EHADTCEIRLEDGQTGDLFAMCPYDITGKSVEAVLDSSRYFVLRVEHDDGETKRHAYI
                     GLGFVERSESFDFTVALQDWTRRRKSEQAGPSRDESAGPSPHLPAGPRQDFSLSKGET
                     LHIPMPSHALPLSAPAASTGFVLPPPPPPSSSHRTRS"
     gene            complement(<276432..>276713)
                     /locus_tag="MRET_1772"
                     /db_xref="GeneID:38738538"
     mRNA            complement(join(<276432..276554,276579..>276713))
                     /locus_tag="MRET_1772"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628399.1"
                     /db_xref="GeneID:38738538"
     CDS             complement(join(276432..276554,276579..276713))
                     /locus_tag="MRET_1772"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484432.1"
                     /db_xref="GeneID:38738538"
                     /translation="MTQGFKPLKRPTPAKGKSSTQAKPKVGKRIAPKKQSALSEAIQK
                     RKNTASSTSRIEKEMAGRAQKGPLTIMRSLAKEANEEQKKK"
     gene            <276526..>278064
                     /locus_tag="MRET_1773"
                     /note="MRES_07075"
                     /db_xref="GeneID:38738539"
     mRNA            <276526..>278064
                     /locus_tag="MRET_1773"
                     /product="oxidoreductase, short chain dehydrogenase
                     reductase family"
                     /transcript_id="XM_027628400.1"
                     /db_xref="GeneID:38738539"
     CDS             276526..278064
                     /locus_tag="MRET_1773"
                     /codon_start=1
                     /product="oxidoreductase, short chain dehydrogenase
                     reductase family"
                     /protein_id="XP_027484433.1"
                     /db_xref="GeneID:38738539"
                     /translation="MREVDEAVFFSSQCVERTRFWMASERADCFFGAMRLPTLGLACV
                     DDLPLAGVGRLSGLKPWVMAAPGTNGPKTRHLFFWPRFSTHFGMFHLLQAGLERVLAP
                     DHYGTLIGGFVLLLLIHTWAKGPSLLAREERLEAQEQRAHERHPDAQPSTPPRLRDMA
                     GRVVLIGTGGMTPIGVVVIAMLANQGAHVVVLVPDLAADDVVQMILLLRESTRNENIF
                     AESCDIADMHSISSFSQRWFEGKRTYGLAGTPTSETHRLDAVVFLPTQQGTTPIGVSR
                     DESYTYHVLGPFHLLSTLLPSLQRQPPSRDVRIVSAISPWYAAGLGRFGTIQQPYTKP
                     IFEPWTFLGASAMHELILAREWQRKLDAMAASDARPPTKLPGIDDQVPRLPRSHISSV
                     LVCPGFDLASQLSAFFSTAQVSSTAHAIALWVVWLLVYPLLWVVGRPTHMAAEAVVWA
                     ICTRLAKESSTGGIRPGQLYREGRLLVPEEPRSCRGASGAAALWTSTEAAVQARLTAA
                     PKTH"
     gene            complement(<278039..>280297)
                     /locus_tag="MRET_1774"
                     /note="MRES_07080"
                     /db_xref="GeneID:38738540"
     mRNA            complement(<278039..>280297)
                     /locus_tag="MRET_1774"
                     /product="ribonuclease P/MRP protein subunit POP1"
                     /transcript_id="XM_027628401.1"
                     /db_xref="GeneID:38738540"
     CDS             complement(278039..280297)
                     /locus_tag="MRET_1774"
                     /codon_start=1
                     /product="ribonuclease P/MRP protein subunit POP1"
                     /protein_id="XP_027484434.1"
                     /db_xref="GeneID:38738540"
                     /translation="MKRAADGPSSVPGDAKRARHAHAMVVVPPRPISTHLDIDELIAA
                     RKSDILALHRAMNQARAATNTRAWQLLPRHLRRRAASHNVLRLPRRLRNKARAELRAS
                     NTAAMTRSEMRRRMPERTLHAYVRRRASLKARAARAGRRWLETHLWHAKRFRMSGEKG
                     TSDGGAGRFGFCLAESPHHKSFRTTWRQTAQATVHDASYTSVYYVCARARRVADATSR
                     LQLFLARAGAEHGWETSWTSGAQLCHTILLAKQAICPVQVLWIPRVVGRTRRACLLFV
                     HPAASKDVRRALQKAHDALQCRRTGPIPQRWDRHVDIQAHQVDMAPSPAVAAGVWHSD
                     ASQRPPATPHARGTTLATTDGWNIFDLMGHRSAHILRRVLHPAESAVPAQSAMLRAAL
                     ESPTLLPPHTVLTCDVTDPRLDAPNVPPAPPIASLCDDDVPRYTDARFFSCRHALPAT
                     TASIDRRRARGDTRAHGTQDTLTMMLIQRSIEPSPGPGHMFGYTLLVPRGWGAIYLHA
                     LARASALVVGQEQLRELYLNLGLPLFPYDWVGHPAYMALAEAGRARRAAQWHARPPAK
                     RVRLDDEGLAYAFGGAALWTTLGRAEPTRPVILPAPTRIPRSPRIRPMVLVLLVACRR
                     GAFDENATMHVPEADLLPQWRAALDPPTSRKTIARQELQTLEATPVARSSAVGAVTTG
                     HYALATGHGRAIGAMDLEAWLELERRRVPPPPPTWGRWKRNRVPLERLVLVRPAMTET
                     PVRAASVSLVRL"
     gene            <280404..>281483
                     /locus_tag="MRET_1775"
                     /note="MRES_07085"
                     /db_xref="GeneID:38738541"
     mRNA            <280404..>281483
                     /locus_tag="MRET_1775"
                     /product="hypothetical protein"
                     /transcript_id="XM_027628402.1"
                     /db_xref="GeneID:38738541"
     CDS             280404..281483
                     /locus_tag="MRET_1775"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027484435.1"
                     /db_xref="GeneID:38738541"
                     /translation="MWKNLFAKSSSKDRQHQQPPQQREHSAPVHHAQQRHAARQDVGM
                     PGSSLPMYAQPTKKHKVQPPSCTTIDVAGTPVNVYGLSELSRGSNGAAPEVCITFHMH
                     GRTGSARREHDLVRELWQNAVGEREGLQGAHRVRDLIIVSLDQRNHGHRTTNELGQRT
                     WKEGNPTHGIDQYAMYHGTAMDVSYLMDLLPAYLFPNGERIVSLFAVTGKSMGGHAAW
                     HVLAHDPRVRVGVPFIGMPDYEKLLAQRTKTSNVNDGPPQVPDTLRALIRRIDPAKQP
                     YREASPSNPFFGKKICICCGEDDKLVRFSFSEEFIRGLVVAPPNSEEARRSLEVFVQP
                     NTGHKVTSEMLALGGRWLAQWALAY"
     gene            complement(<281502..>283076)
                     /locus_tag="MRET_1776"
                     /note="MRES_07090"
                     /db_xref="GeneID:38738542"
     mRNA            complement(<281502..>283076)
                     /locus_tag="MRET_1776"
                     /product="serine carboxypeptidase"
                     /transcript_id="XM_027628403.1"
                     /db_xref="GeneID:38738542"
     CDS             complement(281502..283076)
                     /locus_tag="MRET_1776"
                     /codon_start=1
                     /product="serine carboxypeptidase"
                     /protein_id="XP_027484436.1"
                     /db_xref="GeneID:38738542"
                     /translation="MGPLFWLGCLAWLLVQVMCAKVEVHHGHGVIKNTYAVHGTTSHR
                     WAWWTEHTMLQPLDHYDNSTQATFEQRYFVFMDQYRAGAQKRRKLNGKDVVPVFVYDG
                     GEDSISSFPHVLPYTIFPAIWNATGGIGIALEHRYYGQSKPRLSELGHSDHWGTDQLQ
                     WLTLRQSLADSARFLRQVQLEGVPRDAELRFIYYGSSYAGARAAFMRTLYPDLVFGAI
                     SSSGVVHAIDALPQYSDAIVQGTPPTCIAAIDTAIRALDALLTTDDGRLHALLYVANV
                     SRKGSVRDVANAFASVLGLFQGQSWIVPKAMNPWHAFCARLTDPAQAEQLRRAFPDQI
                     RTLADVPMELLMYAYALRSMDRSTGFTNIDGDMQCFREDHGTLTSSKAWTYQTCTEFG
                     FFQVASSSGPRLMSLLLSHDYFTKPCREGFVQGVHAIPSAPNTTAVNAFGGLDLSMDR
                     LAFLDFEYDPWLPVTVHGGAERRDTLQRPYKWVANCWHACDMMAYPQSLDSEPRRIQA
                     LHHDMLAFISAWLTST"
     gene            <283460..>286447
                     /locus_tag="MRET_1777"
                     /note="MRES_07095"
                     /db_xref="GeneID:38738543"
     mRNA            join(<283460..284941,285008..>286447)
                     /locus_tag="MRET_1777"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628404.1"
                     /db_xref="GeneID:38738543"
     CDS             join(283460..284941,285008..286447)
                     /locus_tag="MRET_1777"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484437.1"
                     /db_xref="GeneID:38738543"
                     /translation="MSELVPRSHAKHGRFPKPSFGRSNKQHHSLFRPMNDHRMKEHTR
                     HEEDQTLAAAREAVANAGIVPAQHQPKSTRAQDLSRRANSEGASMKRKPRQFTNLPVE
                     TMLGEVPHAPASVFAQGGPATVPFTYHEPKNFIPKQSRSEIAREEAVRIHALRFRREQ
                     LNADAIREREARKLAAQMDEEPHVVSESRGKSIFIEDGVPPPLPEKDLANDEPSRSYL
                     TPRIRDTAAMPSLLSSEQTNSVVYNPKPLSYLSGSTLLTSSAPVQPSEPKDTTSSVGE
                     NLTPAQFAEMTMADFSTVRAGSTLPDYLSKRPEVPTLEEDRDQEDAKAAVPVSETLDN
                     LRPSDTDVSGRHVPEIPESDVTLLPDISTVSDAARAKEDNMAELARKEADLARQEAIL
                     ARLEAQKAREEAERVRREAEQIRREAEAARAAAVEAREIEVKLVEEARRAENARKAEE
                     AKRAEEARKEEARKAEEAKKEEARKAEEAKKEEARKAEEAKKEEVRKAEEAKKEEARK
                     AEEAKKEEARKAEEAKKEEARKVEAKSAASVQTPSTSKAADDLPPYASPHRITHLPAY
                     LRNGITNMMRAHPAKPSSSPATTTKLTSAQSFSSLPKSPVDSGKVAAVPPKTSIPAPA
                     EAATSTRNKVDQEPSSKQKDAPISAKNEPTKAANASAPVQRVFPQLEIVHVHPKGGSR
                     PAPKTTVLPSKPSKDEPSVTAKSFNAEKAPTSTPSFSSLPKGELSSRYGLFIVGDAEG
                     KPELAKPAKSHGDLSNEPSAPSAPVLDEELSKKTPIKPVAREANAPLNLHSGSKLAPA
                     IQNIGYLKTKDSAPATEKTSISNNQQSRNSGVDSKQEPAPASSNVVPREVNQSTQENL
                     AQPTSKAVDNLEPAQAAAEPKPDATAQSAPSTEQPSATVSDKPDLPSSKPKEESEPKL
                     EKESTEKAVNNKAEETETKAEQELKEDAAEPTEDQPGAKTDNRAQRRKAQKEAKKAKK
                     T"
     gene            complement(<286611..>286929)
                     /locus_tag="MRET_1778"
                     /db_xref="GeneID:38738544"
     mRNA            complement(join(<286611..286844,286871..286888,
                     286915..>286929))
                     /locus_tag="MRET_1778"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628405.1"
                     /db_xref="GeneID:38738544"
     CDS             complement(join(286611..286844,286871..286888,
                     286915..286929))
                     /locus_tag="MRET_1778"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484438.1"
                     /db_xref="GeneID:38738544"
                     /translation="MGRSAKFYKKNPSKTRSSAAVRAKESKPEADTKSQFVNAHATPS
                     RKGGGMRFKARRTADGPLPAESGIDYVGLWAGDRHSVKDARNKK"
     gene            <287034..>289787
                     /locus_tag="MRET_1779"
                     /note="MRES_07100"
                     /db_xref="GeneID:38738545"
     mRNA            <287034..>289787
                     /locus_tag="MRET_1779"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628406.1"
                     /db_xref="GeneID:38738545"
     CDS             287034..289787
                     /locus_tag="MRET_1779"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484439.1"
                     /db_xref="GeneID:38738545"
                     /translation="MLWPRLLVAKSIRRSIFRTKIPATWIALRTFGRTRTSYLPAVAA
                     LPATPETYLALRASPHELHTLPAISIEALIYEAGQAGLSGLIGTMISDVMEYRAADAG
                     SDRQQRLLLALLTMSSMYQKKVPMAPDIVVDLAAQYIQAAGVTNLSPSIAAHIMRHCF
                     AIRRKDGVPCRLIHSLFYHLAHTAEYPLLEEGLQVIECMLRYEWIDPSMIMDFVVKTA
                     EVDGDRLGKHTLEQARADGFAWQRWAQDAGGFVAVSELRHGKGDEVRDYAFRITIWSL
                     ACRAWIRLNRSTRFRESFLSLYHEYLAATKAVTMGATSQAAPCVSMLRALLQAHLVNL
                     AGTRRANAFRAALATLKQVPKELVAQVSPRVIQSLCNTALDLVDVTTAASILKWYILC
                     LRHINDDERRLVRFLRDMHPAILVPILTHLAESVDRSAAAKWADWLVGMEEDPYMDTF
                     PEAFRARWLMCLCSLDLLEQARALYRRWTGASGSPLEPKVRAAYQSRHTSMNFSGNAV
                     YRQIHHAFGSQAPHESAEVVHPATDNIIHRNGACMLALVRKFGHGTQWKSAPDTQFAR
                     AVRDDFLVHVYGSHMPPSHYELTALLQACMLLREHQVAMRVLRTMESFGYELDAKDMA
                     VLLGGMMDVNPSAAVMIMKHLSAPLSRNPHLYAAVLSRCVSSSHFELADQVYDMACQH
                     YLGSKVARLAPGTLLACSRDRSPTLVNRAITMMRDGWKPKGKLLNWIVRTVVRGMSLR
                     DARLSVSRHGISHDYDVEAGVRLYVHIASKHGCADIPTARLILYHIFLLTTRPSTPHT
                     SAAWQSLWSARVDAVLCAVFSTMRADIPYFPKPESERWKNSFPIPLSFIHEALRAYTS
                     LQDHAGTQELLAWLHLHGLSTSLMRNMSSDKELRGLPQVQADTIRRQKPWWFSAETSS
                     TVA"
     gene            <289876..>290476
                     /locus_tag="MRET_1780"
                     /db_xref="GeneID:38738546"
     mRNA            join(<289876..289974,290008..290154,290181..290349,
                     290376..>290476)
                     /locus_tag="MRET_1780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628407.1"
                     /db_xref="GeneID:38738546"
     CDS             join(289876..289974,290008..290154,290181..290349,
                     290376..290476)
                     /locus_tag="MRET_1780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484457.1"
                     /db_xref="GeneID:38738546"
                     /translation="MSSVRWTRLAQRRLYTSAPSRLVGTPPITQVSSRPFAGGLLGFL
                     TGLSITSLAGLYWIQYEYKSASINVVNSSERLSDMAHNVTHYLERIALLEQRLNMLEK
                     TLAPRDEVQKAWESHRNLYTDMFEETHAIRERLWKLEHDMFATRTRSRVSPTWDQPSY
                     EIPPMPPVRLV"
     gene            <290586..>292193
                     /locus_tag="MRET_1781"
                     /note="MRES_07105"
                     /db_xref="GeneID:38738547"
     mRNA            join(<290586..290858,290888..291274,291300..>292193)
                     /locus_tag="MRET_1781"
                     /product="tyrosyl-DNA phosphodiesterase 1"
                     /transcript_id="XM_027628408.1"
                     /db_xref="GeneID:38738547"
     CDS             join(290586..290858,290888..291274,291300..292193)
                     /locus_tag="MRET_1781"
                     /codon_start=1
                     /product="tyrosyl-DNA phosphodiesterase 1"
                     /protein_id="XP_027484078.1"
                     /db_xref="GeneID:38738547"
                     /translation="MSPEAHAENAVQNPLLALVPDRKQLEHERLQRVAARERQHSKRK
                     RSRSASYDASASVDTEEQFTKQARITAPSQRYTPVSSADRFWNGAIKATHNRYSRAAR
                     AGTRLEQVLLPATSTDACGLQRVMMASYDVDIEWLESIFPPDIPITYIGNPPPAHHGG
                     VPAGLYRSDLHGNWEMAVPFRPHARALQHMKFLLLFFDTHVRVVISTGNLTPLDWSRY
                     ENMMYIQDFPSTTQAHVCTCGAGYSSYGFLAQLERVLSSLSIPPNHAAMQKLHEYSFQ
                     GARAHIVASWPIQSVARGWSNMEEAGLSRLGHVARALCPTIEPSLRMEAQGSSLASYD
                     RRWLEQFYLLACGYPTSILPLTSKRTENPSPEFVQAVGIQDWPPIQILFPTQSYVVHK
                     SVEGRQGGGCFFGKPDDFHRRQLRGLFAQPISERGHLLIHAKSILVTNDTYSNGYVYL
                     GSHNFTRAAWGTVSGTPEHPTQSLSNWELGVVLPLSHKDAWDAILYQRPAQPYGAHDA
                     PWDANSLAA"
     gene            <292282..>293114
                     /locus_tag="MRET_1782"
                     /db_xref="GeneID:38738548"
     mRNA            join(<292282..292289,292317..292419,292446..>293114)
                     /locus_tag="MRET_1782"
                     /product="transcription initiation factor TFIIE subunit
                     beta"
                     /transcript_id="XM_027628409.1"
                     /db_xref="GeneID:38738548"
     CDS             join(292282..292289,292317..292419,292446..293114)
                     /locus_tag="MRET_1782"
                     /codon_start=1
                     /product="transcription initiation factor TFIIE subunit
                     beta"
                     /protein_id="XP_027484227.1"
                     /db_xref="GeneID:38738548"
                     /translation="MSTNLALAEGEVYSQPTNTGVGQHENTQLVAAIDALKRTTHPVR
                     IEDFALVHGLNALLDQNSSLFQRFKQHPKVRYDEKTDLWSYKPDYEVHSSADIIALLR
                     KKYYHPFALTPESSAAGMRISELRESYPPAREAVEELVNEKPVENRQVLVLRGKRDGS
                     IRHVFWNPIQGDIVKPIDDEFKQLWHSLPAPNVVDLASDLESEGLSATSTLETVPQAN
                     TPSTTAQRGKKGKRGSAPRKFKLQNTHLKGVDLSKDFIKPN"
     gene            complement(<293147..>294618)
                     /locus_tag="MRET_1783"
                     /note="MRES_07110"
                     /db_xref="GeneID:38738549"
     mRNA            complement(join(<293147..293178,293208..>294618))
                     /locus_tag="MRET_1783"
                     /product="mitogen-activated protein kinase"
                     /transcript_id="XM_027628410.1"
                     /db_xref="GeneID:38738549"
     CDS             complement(join(293147..293178,293208..294618))
                     /locus_tag="MRET_1783"
                     /codon_start=1
                     /product="mitogen-activated protein kinase"
                     /protein_id="XP_027484226.1"
                     /db_xref="GeneID:38738549"
                     /translation="MSGTMDKLPHRVEETVLKQTFWIDPAYKVTKGLGQGAYGSVASA
                     VHIASGESIAIKKVSNVFTKRILTKRALRELKLLRHFRGHKNITCLYDLDITNPSAFN
                     EVYLYEELMEADLHAIIRSGQPLTDAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLL
                     VNADCELKICDFGLARGFDPDQNTVMSGQQEFMTEYVATRWYRAPEIMLSHQNYNTAI
                     DLWSVGCILAELLGRRPIFKGSDYVDQLNQILYYIGTPSETMLRRVASPRAQQYIRSL
                     PFKAPVPFEQLYPQATPLAIDMLRRLLSFDPSQRITCDEALEHPYLAVWHDPNDEPVC
                     ANKFDFSFEQVDDIEGMKKLILQEVISFRREVRIQAQQRQAILMQQQQQQQQQQQQML
                     QQHQPSQMSPTAVAAQQSAQATRRRDEHFPTSPRDVVQRSAGDHHTYNILGEPMSSDG
                     TPKDAGDVAVAERDAIMDPYDAFNSQIGPE"
     gene            <295152..>296935
                     /locus_tag="MRET_1784"
                     /note="MRES_07115"
                     /db_xref="GeneID:38738550"
     mRNA            join(<295152..295274,295313..295407,295441..>296935)
                     /locus_tag="MRET_1784"
                     /product="PHD finger domain protein"
                     /transcript_id="XM_027628411.1"
                     /db_xref="GeneID:38738550"
     CDS             join(295152..295274,295313..295407,295441..296935)
                     /locus_tag="MRET_1784"
                     /codon_start=1
                     /product="PHD finger domain protein"
                     /protein_id="XP_027484223.1"
                     /db_xref="GeneID:38738550"
                     /translation="MASDIPSATVLAVRRSWKFAAICQFLFTFDVALALDGFHTQRLE
                     TALDLGQMGYISWLCTRLLSFLTQNRRLTESDWEDAFRYQWSIRASSSEPAPLGTLED
                     PVSWDQLDIINKLTCLHSLCEWQLEIPERLRAKNDSEEEAVTWRVMPVGWDRHGNTYW
                     LFDDNRLWIQRLPIQRSKSKQKRAHSTKNTSTSKKARAMPPPPPPAGRRSSRLSSIKK
                     DSIGPQDLFDSDSELSPPPDDDDDTSDTKDAHEPWFEFETICITRHEWQAFVDRFAKS
                     KHPDERNMYNYISKEILPPILEVIHAEEKRLAIEAALSNRKRSSRIALRDSEREQRER
                     EEAELREQKARAAAAVQAERERVMREAVEQQTQKSREDRLRERSERLLARERMIHERM
                     AQEESRKTADAWRLRCEICTMDEMNPAESRPVVACEKCGNWQHASCWEEEDRRHNVQP
                     RNWDDTTFVCRHCDSPSTPDKAPTLAVSTEMHDESLTSTPGPVPPVQPALLQRDSTQA
                     TTMSPLHFSATNTTLQRITSPTLKPQLSPPGSFPLRTQHLRSPLSQPVEPDSNPPAIS
                     LDSP"
     gene            <297169..>298116
                     /locus_tag="MRET_1785"
                     /note="MRES_07120"
                     /db_xref="GeneID:38738551"
     mRNA            <297169..>298116
                     /locus_tag="MRET_1785"
                     /product="casein kinase II subunit beta"
                     /transcript_id="XM_027628412.1"
                     /db_xref="GeneID:38738551"
     CDS             297169..298116
                     /locus_tag="MRET_1785"
                     /codon_start=1
                     /product="casein kinase II subunit beta"
                     /protein_id="XP_027484222.1"
                     /db_xref="GeneID:38738551"
                     /translation="MTTDIPSSHNMASEAVPEAEQVSRAMSLSNSGKMDELSEMGDEE
                     GVYESETPSESGTEGLTWISWFCSLAGHQYFAEVSEEFIEDEFNLTGLNFLVPFYREA
                     LEMILDIEPQDSLKIPDISIVESSAELLYGLIHQRYIITRQGMQQMVEKFEQGHFGIC
                     PRIFCNSQFTLPCGRSDLPGLDTVKLFCPNCLDIYTPPSSRFHGIDGAFFGTTFPHLL
                     LLSYRDLAPSILAPPEPPAQDSLNETSTPMDESHSPSPSPATNAIKTLSVDRLGRKIP
                     QTGIYIPRIYGFRVSKFAPSGPRMQWMRMRPTSLSELNT"
     gene            <298287..>303257
                     /locus_tag="MRET_1786"
                     /note="MRES_07125"
                     /db_xref="GeneID:38738552"
     mRNA            <298287..>303257
                     /locus_tag="MRET_1786"
                     /product="nucleoporin NUP159"
                     /transcript_id="XM_027628413.1"
                     /db_xref="GeneID:38738552"
     CDS             298287..303257
                     /locus_tag="MRET_1786"
                     /codon_start=1
                     /product="nucleoporin NUP159"
                     /protein_id="XP_027484225.1"
                     /db_xref="GeneID:38738552"
                     /translation="MNIHREEAGEESAPYLCLRQLSKDVNIRLSEPLTGDGSSSASVP
                     TNMFCVASSQRLAAASTRNGINIYDLHVLRNTFTQAERNASPSPPVLCTLPLQPGTGD
                     VLFVMFGNSDSLLLAATSHGLILIWETMSLRSSPPAPRTVAPPRHDASRVHMIAPNPG
                     DKSSLCAVVYGMDLLSHENGSAHMLDLLKGEWVNILPAHNVTSVSWSARGKQLVLGVK
                     TGEIIQFTPEGDVKAVLPPPESDRPLYVEDVQWLENHVFLVTYNTCSSTPEPEPIHEN
                     EVYVLYRDAKSNSLTFAAFPYDVSPPFGDRTRWGYRYTCMLRDWSPMKHFVFMTCSAS
                     TDVGVLGFKDGWKALVLEETSRPVLPFLSGDDFCDSSPMALALDLTAEDPVPDPNAAE
                     KGEDPSATLPATPILYIYTNDGVLLGYHVIYTETDKPYPGMITGQGAISHSPNASTNV
                     SASIPPAFAESVHGSTTPNRTPTFGSTSAFGAVSQPAFGSTSAFGQQSSFGSAFSNGS
                     PFSKFSASGATAFGGGNALGQKQMPASGQSTQPPSGPAPGQSSEPAFGSTSAFGQLQK
                     PTFGAASTFARAQKPITGSNSAFGQFSQQGTASGLGPTAFSALSNKQNAFGSVSSQGS
                     VFGSGGSFDTGKPAFASVTPAPKALPKSEEPVDEDAPKDSTFSFGGLSDMLSKSNTPM
                     SSQPSANLNLSHQAKFPSEISQNSEPSKATPSVLSESSSKASQNDSDNLEKAESQNFE
                     NLESAIVDAKQDEAHEGNFASLHDTPTVQKSEQADKVTFDLFKGKQENQTSSFNESGE
                     GIKETEISPIKAAGNNLDASLSTLAKPSEEKPKEPAFSIAKPSDEKPKESTSFFAQPT
                     EKPKESAFSFSKPFEEKPKESAFSFAKPTAEKPKESAFTFNKPSEEKAKQTAFSFNKP
                     FEEKPKESAFSFNKPSEEKPKVPAFSFAKPPEEKPKESAFSFAKLSEEKAKEPAFSFA
                     KPTAENLKESAFSFAKPVEEKPKESAFFFNKPSDEKPKEPAFSFNKPSEEKPKVPAFS
                     FNKPFEEKPKEAAFSFNKPSEEKPKESAFSFNKPSEEKPKESAFSFTKPSDEKPKEPA
                     FSFAKPVEEKPKESAFSFNKPSDEKPKEPAFSFAKPVEEKPKESAFSFAKPPEEKLEK
                     NKTTGSDTEVFSHKASPERLIESQKLSKGSEFGTNHAAEPSSNALVDNELPAIGVSLA
                     ESVPQIDLTQVADPNVPKEDDELKQEFVKIYAILEEELRTLRRQTKQSTDFFTRLRIP
                     STSPKSVADLSNADAWVFGDVQSLSSLTSEFLQAVIESEDQVAETRKHIASIESVQLK
                     SEVKREEIARFLRARQDPDFAKMVRVRHLGPEQLENQTRLRRSSHLVRERLSELGEYF
                     NGLQKSTLNAKQGQTTLRAPTLDTIYRSADNIGRLVSARIRELDKMGQDVDAAVPRST
                     VRARTPHSPARPLDNMADLDTALPEVSEITGINQAGMMHDICDAIWESKKTPVVTRAS
                     QTKFISSVPYQMSPIVLHCSQAPTCQKVPVQESDKGKQSETLVMTEPSTKNFLATATP
                     NGIHAHSPMQPRQKVTSAFQRLSTLPTLTSHSNPTSSAQYTTFEGLVGPQPTASSETR
                     DLTLEEFIAQDEEDNGDYTEEESYEDFDDDLEDEEEEEEANESDAS"
     gene            complement(<303270..>304916)
                     /locus_tag="MRET_1787"
                     /db_xref="GeneID:38738553"
     mRNA            complement(<303270..>304916)
                     /locus_tag="MRET_1787"
                     /product="tRNA-specific adenosine deaminase 3"
                     /transcript_id="XM_027628414.1"
                     /db_xref="GeneID:38738553"
     CDS             complement(303270..304916)
                     /locus_tag="MRET_1787"
                     /codon_start=1
                     /product="tRNA-specific adenosine deaminase 3"
                     /protein_id="XP_027484224.1"
                     /db_xref="GeneID:38738553"
                     /translation="MVDHAIRMPTECTPYFNTFGLRICETGTAGRSVFASQPIESNTI
                     IEISPVLLFNPEEYEAHGRHTILDSYTFVWERNTSGNTMALALGLGSLFNHHPTSANV
                     SYELDKTTRSIRYRTVRQIHKGEELCICYGVGRMWWESPEEERVTTPVSETHELSLFG
                     NMDLDAETVDCLRAPVDSSYHAPLWRVTAAPNPKTMPLVTTLAWAMDVPARSCSQVAQ
                     SLKMMVKNGILRSGDLYPWYSIRHLRGFRKASEVQKIPDELTDPTSTNLSVLLCLEKA
                     HSHTELASILSTHLDTALTESVQLYRVRVPTGPAPNVERLSEWSAVWPSVFLPPGAGF
                     ASKSGLPGSDAARSVVPVDREADSAYWRDSALVNRVRHNFQRCLHTAQKARASGELGV
                     GVYVTSLDENNQGISVDAHDTRTSEAHPLRHAVVNAIRHVADIRARSRSEQHESVNGQ
                     DYLLTGLDLFITHEPCVYCCMALIHSRVHAVYFLYPSPYSGGFCGAPANGHAQCEGSE
                     DGGPFSIHEQSGLNHKYDVWRWIDPNAFDRLVDPHIALDV"
     gene            complement(<305056..>307418)
                     /locus_tag="MRET_1788"
                     /note="MRES_07130"
                     /db_xref="GeneID:38738554"
     mRNA            complement(join(<305056..307169,307204..307285,
                     307320..>307418))
                     /locus_tag="MRET_1788"
                     /product="Na+/H+ antiporter"
                     /transcript_id="XM_027628415.1"
                     /db_xref="GeneID:38738554"
     CDS             complement(join(305056..307169,307204..307285,
                     307320..307418))
                     /locus_tag="MRET_1788"
                     /codon_start=1
                     /product="Na+/H+ antiporter"
                     /protein_id="XP_027484066.1"
                     /db_xref="GeneID:38738554"
                     /translation="MGELLEGQEHHFNPVNISAPHIIYVALGFFIVLFGIFSMLVKER
                     LYMGEAPLALVFGIIIGPSAANIFHPNDWGSEHNPAPGSTTTNTITLEIMRVCIALSV
                     FSVGVELPKKYVWNHWRTIFMLLGPVMLWGWLITGLLIWALIPGIDFLAALMIASCVS
                     PTDPILAQAVVGGPWAEKHVPAHIRHMLQCESGCNDGAAFPFLFLAYFLTVNRGQVGF
                     PVAKWFYQTMAWEIVCGTIIGALIGYIARKLIRFSEKHKLVDRESFVAQYLSLAVASM
                     GLNVLIGSDDLLAAFACGTAFAWDGWFQKQTADSNFSSIVDLVFNIATFVYIGAEMPW
                     KEFVDGSINLSVGRLIGLSILVLLLKRLPIVLLTWKFIPDIKTFHEAVFTGYFGPMGV
                     GAIFMCTYGRILLPDDAPIPPQTPNDVLVHTIQPIVFFFVLSSVIVHGFSIPFFAFGK
                     RAHVNLNRTLTMNTSVFPNSEPSWVNRVRRWNTMFTTPETTDLDQEPSSVVQAMQEGY
                     KRQQLYGTTENDDAEETEPQSEKDKSNGKERVRTRVDFGRAETIDDAEDAAFTDGDDW
                     DGEDTVETRRYRKRLEKERLAQAAEGQDITDVHDVGGEDLEKQLAFKDDEDDPEYPRV
                     KEWIEGHNIVLEVIEKPLDEPKTIVIPLDQETYDEVEKEQSPLRSFIYKYEDKIAHAF
                     EQDQDTKLSELNLAQLYSRKLLAKISSFAQERRKGSMPENIATTSSATNIPVASNGDT
                     IRVAKEPSRNFDVIAVRPDGTILE"
     gene            307572..307676
                     /locus_tag="MRET_t0032"
                     /db_xref="GeneID:38741226"
     tRNA            307572..307676
                     /locus_tag="MRET_t0032"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:38741226"
     gene            307751..307855
                     /locus_tag="MRET_t0033"
                     /db_xref="GeneID:38741227"
     tRNA            307751..307855
                     /locus_tag="MRET_t0033"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:38741227"
     gene            complement(<307953..>309423)
                     /locus_tag="MRET_1789"
                     /db_xref="GeneID:38738555"
     mRNA            complement(join(<307953..308042,308135..308194,
                     308233..>309423))
                     /locus_tag="MRET_1789"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628416.1"
                     /db_xref="GeneID:38738555"
     CDS             complement(join(307953..308042,308135..308194,
                     308233..309423))
                     /locus_tag="MRET_1789"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484065.1"
                     /db_xref="GeneID:38738555"
                     /translation="MSCDTSIDDDALLSGLPSWNEKVKYTNRSAMPEQMEPALPDMTI
                     ESTTRQKTIPSITKITAEDDKRMALRMAALKTLKTRSKKKLAREIPQANAVDEARPMN
                     DAESIHSSTSLKEDGDSDATNIIKSDEKTAMNMNVETLKQSTQPVIQRTFDYTDIDAP
                     RAQSRGSLDYIPIENEETSNEAQSSRKRISYADEFSAHPVAPSGDDGGPAWLNRVYDA
                     SSKSASSPFKGKPQHFHMEKSGSQMFSKIREQGPAGRFIDEPWRPIIIEWSDDDDENL
                     NEDESDYGKRKLESSIPNTAELESLKAFATSELSSPRTPHSSRTENRNKSSTLSLKEH
                     EIQNMMAKIKELESRKCHVGYDDNHSTAGNDFKSTLRKRSTVDFESSITDQTQEHMEM
                     QESRKRARTEPASSAMSWIKTSIANFGSWVARRLSYSSEPPNEDVADTRNETDN"
     gene            <309605..>310138
                     /locus_tag="MRET_1790"
                     /note="MRES_07135"
                     /db_xref="GeneID:38738556"
     mRNA            join(<309605..309718,309761..>310138)
                     /locus_tag="MRET_1790"
                     /product="mitochondrial import receptor subunit TOM22"
                     /transcript_id="XM_027628417.1"
                     /db_xref="GeneID:38738556"
     CDS             join(309605..309718,309761..310138)
                     /locus_tag="MRET_1790"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit TOM22"
                     /protein_id="XP_027484272.1"
                     /db_xref="GeneID:38738556"
                     /translation="MVRIEEVQDETEKLRQQGLATEKDDDDEWEAIDADTDDDDDLSD
                     DEDVDERGVILANESLWDRISALRDIISPTTRAKLSKMWQTTSAYGFFGGWIAGKLIW
                     IGVTSALVVGLPFALAVEDESRFAVQEKEIAAQQQGAGVPTNPLSPPGVSGQPEGLRP
                     PGF"
     gene            complement(<310498..>313354)
                     /locus_tag="MRET_1791"
                     /note="MRES_07140"
                     /db_xref="GeneID:38738557"
     mRNA            complement(join(<310498..313088,313216..>313354))
                     /locus_tag="MRET_1791"
                     /product="enhancer of polycomb-like protein"
                     /transcript_id="XM_027628418.1"
                     /db_xref="GeneID:38738557"
     CDS             complement(join(310498..313088,313216..313354))
                     /locus_tag="MRET_1791"
                     /codon_start=1
                     /product="enhancer of polycomb-like protein"
                     /protein_id="XP_027484273.1"
                     /db_xref="GeneID:38738557"
                     /translation="MTAQVSTVTATTPRGSGMGHASSSPFTSVHMTSSRMRNKKLSYK
                     QKIAVHRGAFQNDAANAFVSAIAPEFESSDNQQDSNFGVDSHEITEYHLQAALSSTQV
                     DNVGNAPTKKYHIPTPQSVEVLSQAQYHEQYPTNVYFDPVTYVRFSDTVEACNRGSPY
                     CMDEDDKGWLDKHNEKVQSNLEKALKDSKAEPTEAEAARVEALVRKEAPEYCSISEDE
                     FETIMYVFERTTCERHPLLELDMSKLPPLSELLPQFEPNSSCSALALPELPALPNDLS
                     SCVPAPAEKNNSSKNTPKPGSGEPVWSAKNPFRYLHLLKPGAHAVYPWWKLRRQAREG
                     RPIVPSLNFDESNENDPYVCFRRREVKSARKTRKTDTLQLEKLVRLEVEMRQAASLFF
                     MIAQRERLKELSVKQAKACWNTAQELLAFKRSWDITGPSKGKEDESLLFGIQPDPLEP
                     VPSTTASQHTQLLKKKRKADEAASSTSSTVLKLRRPKTEPEYTHSTTKAGIENVNSST
                     GVSSIMDRMLAVQQYIDHECTLRQQADAGMEDLTDSAFQPSVAPPPIRAFRPIQSDNN
                     DTHFWSNHPFARPGRQSCFRRRVGRGGRVFLDRRPIAVSPAPANIGAWPRQRQNGFPL
                     ATFGFDRSSDSMKRMDGFNRIHAGFDTFRSYAPVVQSSRVAPMLLPTPDLSWDPLNSK
                     DPREPLTHDPDLKFRRVNKTGVYHVEPQNTESASTASDSTDRTQSSDEMGDGQSTQAT
                     DIDQEESKPMDEDKSPELKSQSTLATREEAVESVEEQMERAQKLAERWRYDEDGGRYA
                     GLGLLGLGGMEGDEEAVLDDFDQRFIRFRMSLLDEANLLKLSTDWTHMRQALIAASSN
                     LHTRPSFSVADAQKNAAGGAASVTVANETSNTKPVVSSTTKDGSNSSKPSNEK"
     gene            complement(<313734..>314563)
                     /locus_tag="MRET_1792"
                     /db_xref="GeneID:38738558"
     mRNA            complement(join(<313734..313808,313844..>314563))
                     /locus_tag="MRET_1792"
                     /product="rRNA-processing protein"
                     /transcript_id="XM_027628419.1"
                     /db_xref="GeneID:38738558"
     CDS             complement(join(313734..313808,313844..314563))
                     /locus_tag="MRET_1792"
                     /codon_start=1
                     /product="rRNA-processing protein"
                     /protein_id="XP_027484270.1"
                     /db_xref="GeneID:38738558"
                     /translation="MWENEEAALIEASRKAYQENSNLDDPSHNLRESFADGTELIRLD
                     DDETIMVPRIAKEDSANTSRLTKKRAKKHGNRLAVLPDTHEDSLSALEVTGGTPVAKK
                     PSKRELDAYRRRSAGSEWFGMPAFPGSLSKNASKDSRIEGGKSSYTGGDARAATEKEM
                     RQQLTAIRLRNALDPKRFYRGSGGTGSDRSIPKYAQLGKVVGGGLEPTSVLTKTQRAN
                     SVVGELMRDSGAVSYSKRKFGELQEKRMAHSNHSRGKPHRGKRRRS"
     gene            <314706..>316697
                     /locus_tag="MRET_1793"
                     /note="MRES_07145"
                     /db_xref="GeneID:38738559"
     mRNA            <314706..>316697
                     /locus_tag="MRET_1793"
                     /product="U3 small nucleolar RNA-associated protein 3"
                     /transcript_id="XM_027628420.1"
                     /db_xref="GeneID:38738559"
     CDS             314706..316697
                     /locus_tag="MRET_1793"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 3"
                     /protein_id="XP_027484271.1"
                     /db_xref="GeneID:38738559"
                     /translation="MGKGRGRRAGGLRGASSKDAMQMHEDVLQDDVDAFHASRDKILL
                     DEEQDQDDDEYDLAGDHQEVLGFEPDTDEADRENEEEEWKNENDEDDEEDDGDLDRYQ
                     NMILPASLDEDSLFRRAARDEAHHEQEEASDDEDQDGGLGWGRNKYSYYSGNTLEGFD
                     SDSDMDEDKAHELETNEAIRLQRQSRAEMKDDDFGLDAIHAEEAQIAADEQSEAARTK
                     RRRELDAAEADDADELASKTNDELVSLLEHRSPIVLALIEEFRDSLHQLKEESATVEA
                     ITEEGETQLAEIAHLYIQSLSNYTMLLSFFFQLASSPRMLTHPESLLTHPVMARLTQF
                     KHAMLEMKNLGLFEPREETVNESVDRVMGAPTTEDAEYEELGDLEPNELQELLADARD
                     EPRSKETSKKKKKSKSQQSVEEPAPNVLADVARVKASDAEPRPKTHSLPSLPEYDDAY
                     GEPTLMHSVERQDKAQRQRAVQFQASALDTKQANKKAAHLEGDADIPYRDKRQIRDAV
                     AAAKSNRLSKSQEPIAEDETAWGDQDWVDDDAEDKDGAEYYDLVSSRKRARKAAQKEE
                     HDQQRLASRVYDDETLAPGDHRAIDYAIDKNKGLTANRPKSIRNPRVKRRMRYDRAKK
                     RLSSTRAVYKGGQSALQGGYGGEASGISTHVVKSRKLGS"
     gene            complement(<316706..>317995)
                     /locus_tag="MRET_1794"
                     /note="MRES_07150"
                     /db_xref="GeneID:38738560"
     mRNA            complement(<316706..>317995)
                     /locus_tag="MRET_1794"
                     /product="actin related protein 2/3 complex, subunit
                     1A/1B"
                     /transcript_id="XM_027628421.1"
                     /db_xref="GeneID:38738560"
     CDS             complement(316706..317995)
                     /locus_tag="MRET_1794"
                     /codon_start=1
                     /product="actin related protein 2/3 complex, subunit
                     1A/1B"
                     /protein_id="XP_027484268.1"
                     /db_xref="GeneID:38738560"
                     /translation="MVNQVHQLSYSPLTAHAFNADRSKVAVSPNSSEICIFASTPQGW
                     VLEHSLTGHDKVVTGLDWAPNTNRIVSCSQDRNAYVWTLSGATWKPTLVLLRLHRGAT
                     AVRWSPREDKFAVASSARIISVCSFEEDNDWWVAKHIKRPLRSTVTSIDWHPNNVLLA
                     AGCADFHARVFSAYIKGVDTKPPPSVWGERLPFGTVCGEFPTPSAGWVHGVAFSPSGD
                     ALAFVGHDASLTIVYPSASQDSPPTMHVIRLPSLPYVSVMFISESALVAAGHDCQPMV
                     FEGSAENGWRITRSLDTVGTAASKPKPPPPPPKKPGLGGAPAPSSAGVGRLNNEAFAR
                     FREADTRGTSAMPSAQSTETPHSFGAVAGASIADDGELHTTHQNTITDIRIYSGQRGQ
                     VETISTSGVDGRLCTFETGKGSTAIAPILRGIASMRM"
     gene            <318169..>318859
                     /locus_tag="MRET_1795"
                     /db_xref="GeneID:38738561"
     mRNA            join(<318169..318330,318360..318416,318443..318579,
                     318611..318776,318803..>318859)
                     /locus_tag="MRET_1795"
                     /product="phosphate transporter (Pho88)"
                     /transcript_id="XM_027628422.1"
                     /db_xref="GeneID:38738561"
     CDS             join(318169..318330,318360..318416,318443..318579,
                     318611..318776,318803..318859)
                     /locus_tag="MRET_1795"
                     /codon_start=1
                     /product="phosphate transporter (Pho88)"
                     /protein_id="XP_027484269.1"
                     /db_xref="GeneID:38738561"
                     /translation="MNAAVTNMAVMFGAMQVAKRIPFDENPEYVRYAQLVYVTSQLLC
                     LAVFYYCSIQIKRKNDLTVLKYVNAKNPMSQDPGELVTTTHRDYDLSEISKSMRGILM
                     GSLMVGLMHLYFGYTNPLVIQSILPLKNAMESNMAKIWIWGMPATGDLKRPFKPPAGL
                     FGGMQQQNGPQTDKASIKEAEKVAASIRAKDE"
     gene            <318996..>319943
                     /locus_tag="MRET_1796"
                     /note="MRES_07155"
                     /db_xref="GeneID:38738562"
     mRNA            <318996..>319943
                     /locus_tag="MRET_1796"
                     /product="lipid intermediate transporter"
                     /transcript_id="XM_027628423.1"
                     /db_xref="GeneID:38738562"
     CDS             318996..319943
                     /locus_tag="MRET_1796"
                     /codon_start=1
                     /product="lipid intermediate transporter"
                     /protein_id="XP_027484266.1"
                     /db_xref="GeneID:38738562"
                     /translation="MPVCVQCGKPVPATVSTFGSGHVVLARCMHCERIVDPYLEYGLA
                     VLVVDLILAKPRVYRHILYNVSTHSFMPSRPYGPPSSAPSVVPLYIHTRRFVALVLME
                     GYLAWFSLCVRPCAQQNIQLWPSNAQNMSQYLLSSASYGAIRVCFYTLLHMLSLHVSL
                     VVGCTAVQWAWRAHSKSTMYWDMYALHLPSVAMLYASLSTVFLLALRVVWAPKAPSHT
                     YPTASTTMMPTYIWQNLSAYLPQAGHDGMTEWTIRNMMGGMSAGVALAAVLPMKPTAG
                     ALVVLLSFGIQSLVRERLHMPWDTSPLAKETLSHFCKAS"
     gene            complement(<319948..>322270)
                     /locus_tag="MRET_1797"
                     /note="MRES_07160"
                     /db_xref="GeneID:38738563"
     mRNA            complement(join(<319948..322119,322148..322193,
                     322221..>322270))
                     /locus_tag="MRET_1797"
                     /product="cullin 1"
                     /transcript_id="XM_027628424.1"
                     /db_xref="GeneID:38738563"
     CDS             complement(join(319948..322119,322148..322193,
                     322221..322270))
                     /locus_tag="MRET_1797"
                     /codon_start=1
                     /product="cullin 1"
                     /protein_id="XP_027484267.1"
                     /db_xref="GeneID:38738563"
                     /translation="MMGAARTEGSALPSPTDLAETWKFLRSGVDDMMRRFTEGMSYER
                     YMQLYTATYNYCIYTGYSGSIGSTTGAQLVGGELHNCVSTYFQQHAQELYAKLGGLAG
                     EELLRSYAEEWERYTTGANFVNRLLVYLNRHWVKHEREEGHTDVFTVYTLALKQWKLH
                     IFDLIQRDNALINAVMDQIERQRRGDMVSTTQLKSILNSCVSLGIDETDLLRQNLDVY
                     QQVFQGVFLEATSAFYRTESANSLAHHSVTEYMKEAESRLEEEENRVELYMHESTRVP
                     LLELCRSELITAHREVLWNEFEKLLVNDMVDDLARTYKLLAQVQHGLDPLRQRFEAYF
                     ISRGLDSIGREMDGNLEMVDPATYVSAIIRVYQDGERMIAKAFQSDSGFHASLDKACR
                     SYINKNQLTSISPSRGPELLAKFVDSVLKKNTRNTDETSIEESLDHAMTVFKYIEDRD
                     YFQKFYIKFLSKRIVSFSTVSMDAEESMIARLKEACGFEYTSRIQRMFTEASLTKELN
                     DRFHDWRSQQHFDTGMPFYAFVLTSGIWPLQTIATDFIVPAELKQTYQDFMDFYQRAH
                     AHRQLSWLWHLSTNEIRATFDSRKYIFTTSTYQAAILLLFNTQSVLTYDEIAAATGLD
                     KNALNAALFPMTKFKLLLQLDDSYSLNTDFKAKKVRVNLHVPVRSEQKVESAEVAQTV
                     HEDRKMLIQAVIVRIMKARKTYRHNLLLNEVIMQLQSRFQPKVPDIKKAIDTLIEKEY
                     LQRVENEKDVYSYVA"
     gene            <322424..>322728
                     /locus_tag="MRET_1798"
                     /db_xref="GeneID:38738564"
     mRNA            join(<322424..322467,322497..322617,322644..322675,
                     322701..>322728)
                     /locus_tag="MRET_1798"
                     /product="elongation factor-2 kinase"
                     /transcript_id="XM_027628425.1"
                     /db_xref="GeneID:38738564"
     CDS             join(322424..322467,322497..322617,322644..322675,
                     322701..322728)
                     /locus_tag="MRET_1798"
                     /codon_start=1
                     /product="elongation factor-2 kinase"
                     /protein_id="XP_027484264.1"
                     /db_xref="GeneID:38738564"
                     /translation="MERGSGSGTNRGVLGMFGAAAGAEGVPSWMSHGTDSSLASSSVA
                     AESGRALDLVFIIDATGSMGSYINVRKGDC"
     gene            <322756..>324089
                     /locus_tag="MRET_1799"
                     /note="MRES_07165"
                     /db_xref="GeneID:38738565"
     mRNA            join(<322756..322770,322801..322903,322930..>324089)
                     /locus_tag="MRET_1799"
                     /product="Elongation factor-2 kinase"
                     /transcript_id="XM_027628426.1"
                     /db_xref="GeneID:38738565"
     CDS             join(322756..322770,322801..322903,322930..324089)
                     /locus_tag="MRET_1799"
                     /codon_start=1
                     /product="Elongation factor-2 kinase"
                     /protein_id="XP_027484265.1"
                     /db_xref="GeneID:38738565"
                     /translation="MICDQITQSEYLTAEGALRLGLIAYRDHPPQDHVYIVKNFGFTT
                     SVLQMKENLNSLFAAGGGDGPEATTAALKAATDLDWRPSASKMAILITDAPPHGIGEY
                     GDGFPNGSPDGQDPIVLARKMSAMGIPLFVVACEPALSGYQHAVDFYHGLVSITGGMT
                     VPLTTASLLSHVVIAAAGEVMDLDRLHRELGDSVLERMKGLSLHLDEQETNDPSSAMM
                     RLVDQVSSELHEKLLLRNENTKQLIIESIYRESEESAHNIRVWSQAPDVFSARPHIRK
                     VIGSRLSQKFLDMRRASHAGKAWHPVPRIMPAASSIHTTPTPSRNMLQDFQAFEANPE
                     LRMQTSGTPHQARLNDQSYRTSSMDMDDDDDGDGYGDDAFMTDDDVLASEAAADNEIR
                     FEGDDGQTLALRHDAISWSQARRLAMQSLSRAP"
     gene            <324154..>327450
                     /locus_tag="MRET_1800"
                     /note="MRES_07170"
                     /db_xref="GeneID:38738566"
     mRNA            <324154..>327450
                     /locus_tag="MRET_1800"
                     /product="U4/U6 snRNA-associated-splicing factor PRP24"
                     /transcript_id="XM_027628427.1"
                     /db_xref="GeneID:38738566"
     CDS             324154..327450
                     /locus_tag="MRET_1800"
                     /codon_start=1
                     /product="U4/U6 snRNA-associated-splicing factor PRP24"
                     /protein_id="XP_027484629.1"
                     /db_xref="GeneID:38738566"
                     /translation="MGEAMETESITPQPTLDPWEYDAWIRSIERKMLGCENASERPAY
                     IPDLLRAMQESLHVMALRPRDWHIYLSVHMMQGELDVHQICALHQRSVRDTFDMSLFV
                     RCASFWLCAWMCHTRSFISLELSGTPTDADGAPYNVTQLVEAWTGLSSPNVLPCGMYD
                     PAHFGMTLDLDEHQVRDSLRELYSQCAWHLSESCLIWDLYMAFEQALLESDPSDARVQ
                     MVKQAFIARLQVPHQGVETTFQRLSSFVSTYLPASEYEPVMSSANRAYAETMDLWRLR
                     ESFEERIAMSNDLHAHWYPYLAWQTHRIKQMRTAKDKSHLSTEEELGFTLYRRAIHRF
                     GSYPTARNAEESASHANVPPTPDIEKRWKQAQGRKSHKLLETERERARVEVRPLVAVS
                     EGLWLDFLALLSTPTLNLDAFLVLCSQAVSVLPLSGRLWAVYLRAITRCQRPKSHMLA
                     LYEKAAHSRGVALLGGASLLSLLQARIDCERAYAAMELAHAQKKSPDQVLVVTEMDHF
                     MHVYELFLHSISAMQRLPASEQDASVALERCAVDWIERAARALAQTAGLEASAGLYPL
                     ADDVWTHALEQHPMHATAYLEAAQYFQRRDDDKRARQTYKAAMAKQGLDNKASIVAAW
                     VAFEHARGSPADIEQAEAKAKVEQDRLWRQWYRYQAQEPAAAPESAPESEVPKRKSTH
                     EEHEEEAAPPKRQDAHSVQPARDREFSSVLVSGMPPDVSEGDVRAFFRDCGIIFDMIG
                     PRSLDDATSAALIEFTDRDSAGAARTRDKKLMGHSEISVVLSYQCTLYVTNFPPDASD
                     ALVRERFSKYGPIFDVRWPSRRFIQSRRFCYIQFATADAARAALAEHGALWHADHALQ
                     VFLSNPQHKKQRSDANANEKELYVVGLPRSATVEQVRQFFLPHTHVEDVRMPLRPDGK
                     ARGIAFIQCRTPLDARRAMQATNSTKFHGRLIAVTMADAGRSSKNSSAPEADRRARTI
                     HVAGLPPDAQEALIQQAIEMAIGPETVRRVFWTPGRPPNSQGLCDSMVEMVDEEAAGR
                     AVLSADVTYGTMPLALSMYQQQVTSSTSAATSMRDRRRGALGFARVHSSESTDTTPKG
                     QDAFRQMLHP"
     gene            complement(<327452..>328273)
                     /locus_tag="MRET_1801"
                     /note="MRES_07175"
                     /db_xref="GeneID:38738567"
     mRNA            complement(<327452..>328273)
                     /locus_tag="MRET_1801"
                     /product="DUF2373 domain protein"
                     /transcript_id="XM_027628428.1"
                     /db_xref="GeneID:38738567"
     CDS             complement(327452..328273)
                     /locus_tag="MRET_1801"
                     /codon_start=1
                     /product="DUF2373 domain protein"
                     /protein_id="XP_027484630.1"
                     /db_xref="GeneID:38738567"
                     /translation="MAKRLRKRTSKKARPSQAIEQDDDRGREHVNEKTALEQPEIRKE
                     SSVQASEPSREPQQEAEPQHGTISQDTPIHESSDASKKRKRSRKRKRSNVPHPGPDPE
                     GMEELSEPAKKAIAYTQQYLCDKDAWKFSKQRQNWLLRHMMWSPQLYEIGQELSGASQ
                     AHVEESMRPLIPPTLPLPDPGSWISDEHVSVVAAYLASIMGLAKQRMVESLQAAAQAT
                     AAPSLDMAPPAEGDQEVGETQEAASRISSLVASWQELRKVRASQFLEWIQALDQA"
     gene            complement(<328307..>330556)
                     /locus_tag="MRET_1802"
                     /note="MRES_07180"
                     /db_xref="GeneID:38738568"
     mRNA            complement(<328307..>330556)
                     /locus_tag="MRET_1802"
                     /product="ATP-dependent RNA helicase DHX33"
                     /transcript_id="XM_027628429.1"
                     /db_xref="GeneID:38738568"
     CDS             complement(328307..330556)
                     /locus_tag="MRET_1802"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DHX33"
                     /protein_id="XP_027484627.1"
                     /db_xref="GeneID:38738568"
                     /translation="MNKAENATNMLPIWAGKDKILERIRENDTVVLIGETGSGKTTQL
                     PQFFWQEKFIVPDVPLMVGITQPRRVAATSLARRVASEMGCADPSTIKPRSNDTDNSA
                     YVGYTVRFDDRTTRQTRIKFLTDGMLIREALGSHTSKSSAPRKKSAHTSLLKKYRIIV
                     IDEAHERSLRTDMVLGLMKRIQSERKKLITEGHTDLCPLKIVIMSATIDASVFARFFA
                     DPLRDVPILYVAGRQHSVRMYHTQESCQDWTDAAVRTVMQIHVSKPLGDILVFATGQE
                     EIESMAQSLQMFGAQLEPWSKEVGFDDVPALLIRPLYAALGPNASAAVFATTPKNTRK
                     VVLATNIAETSITIPGVRYVIDSGLVKEKIFSPLTSIETLQVLPISQSSSLQRAGRAG
                     REAPGECYRLYTREAFQALETMPVAEIHRTELSGAVLQLYAMHLDPFTFDWIDPPNQA
                     LLQEAVLHLAELGAIQSPKDGIQLTPLGHQLASLPVTPSYARLLLAAAERGPHVASQA
                     CDLVSILSADRGIFVETSHPDKREQAEMAWEVFYDATGDHATMLNAFRAYLAVFNHAM
                     TTHASPAAARQEIRMWCQSHYVHERTMKNILAIRKQLSRICAQHGIECHAGAPKKRLS
                     VSSTESESSEEEDRDALVVTKGGSEPLTDMKENYYELMQCLGLGRLSHTALRQPDGSF
                     RRVAGGQTFKLHPSCVLHPSRHGSRGTSSDNVQVIVFEELVLTSQTFARNVSRMQPDW
                     LQSWLAHKS"
     gene            <330706..>333816
                     /locus_tag="MRET_1803"
                     /note="MRES_07185"
                     /db_xref="GeneID:38738569"
     mRNA            <330706..>333816
                     /locus_tag="MRET_1803"
                     /product="ubiquitin-protein ligase E3 C"
                     /transcript_id="XM_027628430.1"
                     /db_xref="GeneID:38738569"
     CDS             330706..333816
                     /locus_tag="MRET_1803"
                     /codon_start=1
                     /product="ubiquitin-protein ligase E3 C"
                     /protein_id="XP_027484628.1"
                     /db_xref="GeneID:38738569"
                     /translation="MEFNFTGSSKPRRTINLSGEVQKPVSALAADARSQREDRRRQKL
                     RASAATRIQAAYRAYATSKAMRNTFAAEFDRLWQNSQRTPSDWVQLTRCLVMAHSRQP
                     SKLHAHRMAAWANDVCGASLWTKPELHACNVLFFMVARRMIFALQYTPDLDVSDARAM
                     ILFLLWLQSDSYTTEEQRRAALYMLRFGLHSAIRQCILTFPKEATEECVALSLRPLVL
                     FPEPTTEFAETLDESASASPRSIFIRSFVSDILTLPHLFYRVPISSVSLFASSFPLLD
                     IMIHVQALGAYYDVVSGDSVLAHNPIHSPFLLGNILTIASRRINTMQSGTDVCHYLHM
                     LATLQNALPTTTFDDHDSTVDPKTKKQIDNLISDQHIRSVLATSTRFAHSTRPALCTF
                     LIATLCAWPVSVRDTLLISLLYAYDKEGSTRSMQIGSLVRELWRGWIRSSFLTRKMAV
                     KEQSSSTNVVAMRDALTNTAYAQDWTLFLTMCIVYGRCLVILGDDEFYPRESMDASMP
                     TRNPLTMDELVVLSGLLRNLVFFMHWDNVGMTGDSEYITGTRMRVDQVRELCTRLLQQ
                     LHTRDSRHRFVPESHWHMLNENDLTSFIQAVVLEERELAVSQDQDRENHRAPLSAFSQ
                     RKRDFMTPRLKVLNNIPFVIPFDVRVEIFRQFVRNDIQRLGISRDMFAPTRRHRATIR
                     RGHVAEDGIAQLNGLGSNLKEPLEIMFVDQWGMPEAGIDGSGLFKEFLVSMIQEVFDT
                     DRGLWCSNEIHELYPNPHSYAHASEQLIWYLFMGRILGKALYEGILVDVKFADFFLSK
                     WLGQQSYIDDLASLESLDSELYRGLIALKNYSGNVESDFALNFTVADDEFGIRTSREL
                     VPGGTDIPVTRENRLSYIYLITRYRLSTQIEDQSRAFLQGLTELINPRWLRLFNTEEL
                     RVLVTGADTPIDVEDLRRNTVYGGYHEKDMAVQYFWEALSSLDQASLKAFLRFVTSSP
                     NPPLLGFSELNPKFAIRHAGDDITRLPTASTCVNLLKLPAYNSTAQCLEKVKYAIYSG
                     AGFDLS"
     gene            <334093..>336356
                     /locus_tag="MRET_1804"
                     /note="MRES_07190"
                     /db_xref="GeneID:38738570"
     mRNA            join(<334093..334204,334237..>336356)
                     /locus_tag="MRET_1804"
                     /product="hypothetical protein"
                     /transcript_id="XM_027628431.1"
                     /db_xref="GeneID:38738570"
     CDS             join(334093..334204,334237..336356)
                     /locus_tag="MRET_1804"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027484633.1"
                     /db_xref="GeneID:38738570"
                     /translation="MLKKNLDTCIEPMFALSPGRLDKVDTDDAFEMACVLKTFTNCKY
                     MLENGERYENLSWRLWARHLHKIRISEPITQIDVLETKTSGFNAVPAPLSEPELSTDE
                     SVSSEDEDVCKAGKNTMIPCADNAFSILTRSGCTQTEEGTELERLAYDVNCCWDSSSL
                     SHTHDLSYCAQLSDGEETIQETESRGTGTPISTTGTITPHIRSRANSTCLSPLSQNFG
                     SKLNEAHDTIASQNNRASALTSGKLYDGGKRISSRGMPSANDPIQERSVNTNASQREK
                     NSSSATKLQQLAPPQLRSRRQRSLKSMDNIPGLRQSKSAIAKAGCANIFLNNTNTDVK
                     SEKPKKKGKIVFMVGGDSEEDETPQDDDDAWSSEEEDDTSRVKNSSETEFARKAEEEE
                     REREDMFKKRPIRSVSLADLPHATSSMVPPLEATATRGLLSTILKPSDPDSTLSARTR
                     TPANKTSHSALADQNDMNDSVGHTSMPTCVPRAPSYQNICLGHSSKDTMNRSKSVLAL
                     PLLNLTSLHSCTSSGRPPSSPVTATPSESSRTMTKQGNGEAGATSGPQRAKSNLALTR
                     LSAIAQRGSSETDHKKISSLVRSYSAIGNLMTPITRSESPQCMSTADEENDDGLSLGV
                     RADDYQAPRVKRVPQPSMESGPMDKTLSPKRMSQVLPQVANNPQQALLHDELSQSVRD
                     NLIWQRESRERMLGLKDRCMKSKAESSTNATAHPQRRSTSVLHLEHFRPHDDEGSFHH
                     KGW"
     gene            complement(<336404..>338578)
                     /locus_tag="MRET_1805"
                     /note="MRES_07195"
                     /db_xref="GeneID:38738571"
     mRNA            complement(<336404..>338578)
                     /locus_tag="MRET_1805"
                     /product="mitochondrial Rho GTPase 1"
                     /transcript_id="XM_027628432.1"
                     /db_xref="GeneID:38738571"
     CDS             complement(336404..338578)
                     /locus_tag="MRET_1805"
                     /codon_start=1
                     /product="mitochondrial Rho GTPase 1"
                     /protein_id="XP_027484634.1"
                     /db_xref="GeneID:38738571"
                     /translation="MLHSAHAEIRIVLVGDVGVGKSSLIMALLKEGFVEDVQTVVPEV
                     TLPSEASPAGVTTKILDTGSGFAYQERLETELRRANVVVLVYSVTDQESFERITSYWL
                     PMMRSLGINVPVILVGNKVDHRPSDIEEDALEDEIAPVMAEFKEVETCIECSASLSLN
                     VGEIFFYAQKAVLYPTAPLYDSRSHTLKPACIDALRNIFHLCDADKDGVLSDEEINNF
                     QYECFDAPLQLQELLGIKQLVMEGSTPYDSAHLRNDGLTLAGFLYLHTLFIQRGRLET
                     TWTVLWSFGYGMDLTLSNTYVYPRFDVPSGMNVELSPLGYQFFTEVFKAHDKDHDGAL
                     NPHELEQLFQTAPGGQHPWGSLNFPSGTVTDESGAVTLQGWLAQWSMTTLLEPRTTLA
                     YLAYLGYPLFAHGIRAHGTPSSSGMSTPSCASAAPASYAWLDGTAVGVLSGSQARFVP
                     TTSALKLVRPRRPSERRRSNTEQCSVFLALVLGAHGSGKTALLRNLVGKPFQGKYTPT
                     HRLQRAVAAVEQGGAERYLVLQEYGAHNEAEALRKPSKLNNVNVIVFVYDSSDTNSFS
                     YISNLRQQYPYLASFPTLFVATKSDLDLARQRHEVQPDMYCRKLGLNIPHLGAGPLNV
                     SAYLDEMAQLYNILLSIAMDSRGAVPAHSGSLSPVRFRWRIMALWFAAATGSTALLWA
                     MCRMLSPRTGSSLVGSSRVPWNLWWKGTSSGASSSATLRMDL"
     gene            <340098..>342599
                     /locus_tag="MRET_1806"
                     /db_xref="GeneID:38738572"
     mRNA            join(<340098..340223,340254..>342599)
                     /locus_tag="MRET_1806"
                     /product="HD family hydrolase"
                     /transcript_id="XM_027628433.1"
                     /db_xref="GeneID:38738572"
     CDS             join(340098..340223,340254..342599)
                     /locus_tag="MRET_1806"
                     /codon_start=1
                     /product="HD family hydrolase"
                     /protein_id="XP_027484631.1"
                     /db_xref="GeneID:38738572"
                     /translation="MPSQSVWACPCLNVRLHGIALNEKAETSPTKVLLDQKNGLRLSI
                     PPLVSRESVSLRGVTLSHTESDVAIRCNLCHELVYTMQESSTPPAFKKEEGAKVERMQ
                     KNFIPKNHQVFLTRECISGNLIDERKQDSSYSRVFHVVLPRSDDCRQSQPITFPYIKD
                     SKDVVSFFTPIPRTSFDNTELLTTSNASTESVDEHAWQLLEHARLKIAADMAFILRKK
                     QEEWFETVQRTRMDLHILAKSIYANKTNKTESTASFSEKKADSGLFSKRFVGEVNDAH
                     SSKSELGASLARFDSATLSAPLRKPLTFEELEPVTSATRESQLPRSPPPDLCKQALEK
                     ENVPEEEDFKFTNEDQIFQTDEDIKTGNPNPVTNRRNSGSKLSVMNEHQNRTEKVSEL
                     LSSGIATSFSAMTLAERKPNNIALPLDNSPTGKSVYDVQRYETVGPQQFGRSNRPNFM
                     RQSHEHDEELVLAGAALANAPSHRDKHFALMFKNTHKHAPLKDTKTLALSLPSLAMIP
                     VHNNKDKEIMESIDHEPKTSLPCNENRMVPSLLQALREKNSPSSSSAKRTVGFNVTSS
                     RSSAQTKKPSRASNMAITEDLPPVPLAPSRSLQFEPLEEAAPHALSTILDSPTPDDAE
                     LTKVLYFMHHLQNLKICKRTGWYHHRVPEPESISDHMYRMAIMAILLKEDKVDVKKCV
                     MMALIHDLAEARVGDLTPHCKVDKDEKTRRELDAIQFLTYDLLGDTDASNTIFQLWFE
                     YEERQSLESKLVKDLDCFELCLQAYEYEKTHNIEDLQQFWNGAAPKIQHPQIKRWLTA
                     LLQKRRTLWKGRGIDYDKAYVAANA"
     gene            <342697..>344577
                     /locus_tag="MRET_1807"
                     /db_xref="GeneID:38738573"
     mRNA            <342697..>344577
                     /locus_tag="MRET_1807"
                     /product="sentrin-specific protease 7"
                     /transcript_id="XM_027628434.1"
                     /db_xref="GeneID:38738573"
     CDS             342697..344577
                     /locus_tag="MRET_1807"
                     /codon_start=1
                     /product="sentrin-specific protease 7"
                     /protein_id="XP_027484632.1"
                     /db_xref="GeneID:38738573"
                     /translation="MERKNLHSDRRAAYVQQSMVANSSGSEEAQKKPARPSRSPLTAS
                     PYRLPISPASFYKSPTQSGKEKRTNNEFSESQSAKWRRLMHSADDSHDEIDFLTPRPG
                     LHERMRGKLPKRAPTIQKTDSVVSICVKLRALFVSNSYGSTSSGLELVCFQSHMALLH
                     DLTECAKVSLRDIQAIQLGGTEHALLALHVSTKGTSARSIASLCGEIHLDTHALLVFV
                     QPNDPKWPALYERLNSCFSAEILNERACCSLYNDAIRSNTKPFHISGMSQSRQAPRKP
                     TPIVIGEKREITSSMAPAVEDSSFVHQTRARVRSEQSLKEAKQTKPILRYPTSGPFAV
                     TLLQCDLERLKEGEYLNDTMIEFGLRYLLERIKQNNPSLVQQIHVFNTFFYHKLTESR
                     DRSKTYEHLRKWTNKVNIFDKMYVVVPINEHLHWYMAIIVNPKAIINERPVSLAGSPI
                     RRSSRTSTEDPAASGVSGSSGPQLGSCSVNHASEHGDKVGQNPSDFKEEQSYVMVLDS
                     LGITHGPVKTALRDYLRLEARDKGHVRPDVDLKRLGDPLHVDVRVPDQPNFSDCGIYL
                     LHYFDRFFSDPVLFTEISLAARRNSKTEVPIHDAWRSEEVTSKRTWWASIVTDLAKDY
                     SS"
     gene            complement(<345466..>346547)
                     /locus_tag="MRET_1808"
                     /note="MRES_07200"
                     /db_xref="GeneID:38738574"
     mRNA            complement(join(<345466..346371,346413..>346547))
                     /locus_tag="MRET_1808"
                     /product="malate dehydrogenase"
                     /transcript_id="XM_027628435.1"
                     /db_xref="GeneID:38738574"
     CDS             complement(join(345466..346371,346413..346547))
                     /locus_tag="MRET_1808"
                     /codon_start=1
                     /product="malate dehydrogenase"
                     /protein_id="XP_027484635.1"
                     /db_xref="GeneID:38738574"
                     /translation="MFARSALRAPTQAIRTPASSRLFSQTATANRKVAVLGASGGIGQ
                     PLSLLLKLNQNVTDLRLYDIRLAPGVAADIAHINTPSTCTGYAQENLEQALDGAEVIL
                     IPAGVPRKPGMTRDDLFNTNASIVRDLAKAAAKVSPKAHMLIISNPVNSTVPIVAEVF
                     KRAGVYDPKRVFGVTSLDIVRASTFLSGIAGSKPADTNVPVIGGHSGVTIVPLLSQAQ
                     QGSAVSAGEQYEKLIHRIQFGGDEVVKAKDGAGSATLSMAYAGAVFADGILRAMNGEK
                     GVKQCAFVESPLFKDQVSFFASPVELGPEGVQNIPALPQITAEEQKLLDNCLVDLAKN
                     ISKGVNWAAENP"
     gene            <346727..>348529
                     /locus_tag="MRET_1809"
                     /note="MRES_07205"
                     /db_xref="GeneID:38738575"
     mRNA            <346727..>348529
                     /locus_tag="MRET_1809"
                     /product="malate dehydrogenase"
                     /transcript_id="XM_027628436.1"
                     /db_xref="GeneID:38738575"
     CDS             346727..348529
                     /locus_tag="MRET_1809"
                     /codon_start=1
                     /product="malate dehydrogenase"
                     /protein_id="XP_027484636.1"
                     /db_xref="GeneID:38738575"
                     /translation="MASTATLNRLKKGLSLNTRFRLSSRIMSQPRRVHTEHDSVQYAI
                     KQNEHGGAARLRDLYSNKGTGFTMDERKKFGLKGLLPPTVHTLEEQFKRIKHQIDLKE
                     TNFAKHIELANVRQRNERLFYYYIMSDLMKNIPLVYTPTVGEACQKFSMMFRRPEGLT
                     LSIEDKGSVEECIGNWPRPSDAPRVAVITDGSRILGLGDLGWNGLGIAIGKLSLYVAG
                     AGVHPQSTMPIVVDVGTDNEELRNHPLYLGLRRPRPSTEELVEFVDEIMMKLNARYPN
                     LIIQFEDWSSEHAFLFLERYKNKYPMFNDDIQGTGSVILAGLVNAARMVSKKTGKDLT
                     DHRILMAGAGSASIGVAKQLMSFFTLNGLSEEEARLRIWTTDSKGLVTMNRGDKIAPY
                     KEYFARTDNGDVQVKDFMDVIDYVKPTVILGFCTVHGYFNEGVLRKMAEINEHPIIFP
                     LSNPTSKSECTFEEALTHTDGRCVFAAGSPFPDVTFQGRTRVADQGNNFYIFPALGLA
                     GALVQAKHINDNVITEAAIALADSLNKEESDADRLYPRLERVREISNYIAFRCIKILI
                     RDGLCRDNGLTASMNDDELYKWIAARMWLPDYSH"
     gene            <348634..>349317
                     /locus_tag="MRET_1810"
                     /db_xref="GeneID:38738576"
     mRNA            <348634..>349317
                     /locus_tag="MRET_1810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628437.1"
                     /db_xref="GeneID:38738576"
     CDS             348634..349317
                     /locus_tag="MRET_1810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484576.1"
                     /db_xref="GeneID:38738576"
                     /translation="MSRTLRRHRWAAPALATGSIIALGALAWSWASKSNSKEDSPSRT
                     RRAVKPVLCISFAYDDAWSEQLKHAPEIIDNFLRSLESKFNVYVIVHAPDGVSPPLHS
                     ERILLYSKAQGRAMLARALLPQCHVECVFTEKHGKVAWDVNDDMTAYLARLNQLAQVV
                     DKMVVVVIPCASAKVSSSPIMLADLQRAFKKHAISQHTCIQWLYTSSWDAWDDVKRLL
                     DDLREQTWI"
     gene            complement(<349318..>352272)
                     /locus_tag="MRET_1811"
                     /db_xref="GeneID:38738577"
     mRNA            complement(<349318..>352272)
                     /locus_tag="MRET_1811"
                     /product="DEAD/DEAH box helicase"
                     /transcript_id="XM_027628438.1"
                     /db_xref="GeneID:38738577"
     CDS             complement(349318..352272)
                     /locus_tag="MRET_1811"
                     /codon_start=1
                     /product="DEAD/DEAH box helicase"
                     /protein_id="XP_027484575.1"
                     /db_xref="GeneID:38738577"
                     /translation="MTKRPLETSDLAKIKALCPQLVHFGYVQSLRLQEAQSSKRRRRE
                     DAYQPQRPMDDYILTFEFLDRDNSSDKATSRRYVASSKPRQEAAQELISRRTNTFARA
                     MQGWVDQHCQNDPVECLHSKSQSFMPTPPKKNIPPTCTRSSIKSILETISHVSWWRDQ
                     IVPGGRRTFPAKLAQFAQTEPPLDQEMMDALQDTHGIQQLYSHQAAALTHIQRGKHVV
                     VSTSTSSGKSLVYQVPIAHALAQDPNATALCIFPTKALTQDQLSSLSRLLRHHNGIKD
                     AEAYTYDGDTPADERGSIRTRARVLFTNPDMLHQAILPHEEKWRRFLKGLRVVVLDEL
                     HVYTGIFGTHTSLILRRLRRLCAALGNELLQFVSCSATISEPKEHLKQLLGMDVGEIE
                     EVGNDGAPCGPKEWVLWNPPLIDPHDPSHGRMSAYNEVSQLFRHLLSNGVRTIVFAKV
                     RRTCEIITRKVRDDFLHDGRPDLAHRVHAYRSGYAPSDRRQLEYDMAHGHVMGLIATS
                     ALELGVDIGVLDAVILFGVPYSSASMRQQAGRAGRRQKESLVILLGEPFPVDQYYMRN
                     PELVFQPPMTKLWIEPSNELILEAHIRCAAFEMPFSPSDSRFFGEAGWTIAQRVCFSD
                     KAGYYQVQDTESPALSIPIRGARQDTYQYIDVMIGQLLEEVEIERVYFEAYEGAVFIH
                     QGITYICQSVHHDMRVVYLARTQVQYYTRPRDLTDIDPCEVWRMRTLKHNDMYAYYGR
                     VDVIFRVWGYFKVDWRANILDTVDIDAEPFVRPTHGVWIDVPWHIVEKLTEHDILAPA
                     AIHAAEHAILNLTSLFVASSADDVRTECKISLRELSGHKTQRLRPSRLIFYDKPGQNA
                     GVCAQVFEHLSSLLQMALHEMESCECTDGCPECIEAPTCRHGNLVSSKRGALAVLRSL
                     LHRPLFDNEDTLPTRQSDLEALSHTLCEPEPVPRRKGTQIEHIIEEPRGEHDKRPNCM
                     DHVGSSLFFEDV"
     gene            <352570..>355332
                     /locus_tag="MRET_1812"
                     /note="MRES_07210"
                     /db_xref="GeneID:38738578"
     mRNA            <352570..>355332
                     /locus_tag="MRET_1812"
                     /product="pre-mRNA-processing factor 6"
                     /transcript_id="XM_027628439.1"
                     /db_xref="GeneID:38738578"
     CDS             352570..355332
                     /locus_tag="MRET_1812"
                     /codon_start=1
                     /product="pre-mRNA-processing factor 6"
                     /protein_id="XP_027484578.1"
                     /db_xref="GeneID:38738578"
                     /translation="MAMNRPDKLAFLSMQAPAGYVAGLGRGATGFTTRSDIGPAREGP
                     SAETVAAARARRGEEEEDDDDERFQDPEEEGGLFATAVYEKDDEEADRIWESVDRHMD
                     ERRRKQRLSQEAAEREELRQSQPKIQAQFSDLKRNLASVTESEWANLPEPGNLTGKRR
                     KAASLRESRDNRTTAVPDSVLVSARDRNQIQNTAADVDGTVSSLTDIGEARNKVFSHQ
                     LDQASTQSQIAASGTSSTIDPTGYLTELSGVSVKSSVEIGDIKKARSLLDSVIKTNPK
                     HAPGWIAAARLEEVAGRMSIARKVIAQGCEQCPRSEDVWLESARLTTPNNAKVILAQA
                     IQFQSQSVNIWLRAMSLENDLESKKRVARKALEHIPNSVKLWKELVNLEETPEDARVL
                     LAGAVEAVPMSVELWLALARLSSETDAKSVLNRARRTIPTSHEIWIAAARLLEENGEE
                     AERIYKTMSTAVLSLNRAGAILSRDQWLREAEQVDKEGSPTTCAAIVRATVHLDIDAE
                     DRRRVWSEDADSCLDHGRVSTARAILACALDEFPDSLELWQQAARLERLHGSHVSLTD
                     LLERGVAQCPTAEFLWLMYADDRRRDGDLHGARQVLTRASDANLGSESISLAAAKLES
                     ETGDMASATNILARARKEVRTERIWSASVDMAWRQGAFDEALALVQQGLRIFASSEAL
                     HMTHGRLHEARLDVSAAREAYAAGRRACASSVALWLLSSRLEESAGVLIRARALLEKA
                     RQLHPTSDELWMESAAVEIRAGSVAQAKTLLSRGLQVCPSSGRLLSASIWLEPRPARK
                     GRAAEALRRSMDSPYVICTVARLFWDEGRYPQARDWFTKTIQAARSWGDGWAWWYAFE
                     GTQPDGATQRAHLLDKIELAEPRDGDVWKALLTKPAHAGQSARALLPIAAEEVMHQPT
                     YMSTTN"
     gene            complement(<355319..>356941)
                     /locus_tag="MRET_1813"
                     /note="MRES_07215"
                     /db_xref="GeneID:38738579"
     mRNA            complement(<355319..>356941)
                     /locus_tag="MRET_1813"
                     /product="DNA binding transcription factor"
                     /transcript_id="XM_027628440.1"
                     /db_xref="GeneID:38738579"
     CDS             complement(355319..356941)
                     /locus_tag="MRET_1813"
                     /codon_start=1
                     /product="DNA binding transcription factor"
                     /protein_id="XP_027484577.1"
                     /db_xref="GeneID:38738579"
                     /translation="MNFAARRPMPIPNGHAPVMEKNSSQSPVDLPTPPDDVTLSENAS
                     IVRNDIMYGTRKNPLLYTPAYRAELPRYTPMSYPNTRSYGVGLSSAFQLSAERQNVSP
                     AATEDASFDNDMSVDDVFAVSNKADHRRSRATHVQGLGIDDVSPGLVPLLENDDVVPS
                     IDQSMARSMPDSLALSPSSRRSSSLVRTPSTSSRRVPYNVPSRSPGSLNGPLSQAYAM
                     SMKPSSSSRSMRRPSWSPYSRPLMITRMGTSMPATSYAMYSTYDDDETDDEMTGVDDD
                     GTDDETDMIPASKFRQNTRLFGQPTMHSSSSSLARSLPISHVPSFLPRSAPDDTSRSQ
                     VHMAAAALDRLSMTSTSYDDDKQRALRVPTVDETDQVAAIRDRLGGAANCSAFISKLW
                     HLMINPDLYGKYIYWSEAGDAIIINSEPDVAAEFAAEILPKLFKHGNNASFVRQLNLY
                     GFQRVSSSRLLDAAEMRAVAARTGTSGHYGTSAPFNTAMELYGVHSSFAHPRFRRGQE
                     AWLVSMKPRSSKKPKKNSAGPTDETKSQSSLS"
     gene            complement(<357513..>358477)
                     /locus_tag="MRET_1814"
                     /note="MRES_07220"
                     /db_xref="GeneID:38738580"
     mRNA            complement(join(<357513..358289,358316..>358477))
                     /locus_tag="MRET_1814"
                     /product="protein SCO1/2"
                     /transcript_id="XM_027628441.1"
                     /db_xref="GeneID:38738580"
     CDS             complement(join(357513..358289,358316..358477))
                     /locus_tag="MRET_1814"
                     /codon_start=1
                     /product="protein SCO1/2"
                     /protein_id="XP_027484580.1"
                     /db_xref="GeneID:38738580"
                     /translation="MFSFRHGMLRAFPSRARPLAIPWTRVGPVRMLSVPPQQEKPKGA
                     KTPIQRASIGPFNVPAAVLFVATGIGLYYYFKHEKAKLEENKKRKLENQAVGRPRIGG
                     PFSLVSSTGHPFTHEDLLGSFSLIYFGFTNCPDICPEELDKMSTVVDEVAKTHGPVIN
                     PVFITCDPARDRVPLVAEYIADFHPRMIGLTGTYDEIKQACKAYRVYFSTPPGADPTS
                     DYLVDHSIFFYLMDPEGKFVDAFGKSSTKDEVLGKVLDYIQRWKNTGIPLSEANAKEK
                     AATDGRPTSNERSLFEQPSSEPSIPPAVLTTEARMV"
     gene            <358589..>360655
                     /locus_tag="MRET_1815"
                     /note="MRES_07225"
                     /db_xref="GeneID:38738581"
     mRNA            <358589..>360655
                     /locus_tag="MRET_1815"
                     /product="nulp1-pending protein"
                     /transcript_id="XM_027628442.1"
                     /db_xref="GeneID:38738581"
     CDS             358589..360655
                     /locus_tag="MRET_1815"
                     /codon_start=1
                     /product="nulp1-pending protein"
                     /protein_id="XP_027484579.1"
                     /db_xref="GeneID:38738581"
                     /translation="MSRRLHRRQQRQLEELGELQHALSGKEDANSEQGNNLHESRSTA
                     SSAFAALSLEEPVDHGQENADDFDDGDKTVMHTQSSRNKSKKNNKKKKKGSGQPHSTH
                     VDDISLEEMSDVIAKSTKQFKVTLNTAPDSGVADTACKHAPSLVLRALLALDASHLDP
                     AHELRRQFGASAIKAYEREKGSTTTSSRTGARSRDNRGAHFNSNMRVRTVLTTPKPTW
                     PDLNRSFVGMSMSADERDQGVRVYSWEHSRAYKQAQFQFSQAVASFDTQSLVALLRVF
                     PWHVDTLLQLSAVSRYQGDLGQASDFIDRALFAMERSAASTFVSGLTSQTGPPMCDFL
                     RAENRAFWLAIHRNIDLYGRKGTWRTALEWCKLLFALDTSDPHGILLWMDFLAIKSRQ
                     EKWLLELTDVLHELHGILDWSVGLSYARTLALRAIGASQADQALASAIIRHPHAAILL
                     ADKLQVDVPPDVVRAFPMHGAYTSTHPALNELLAHLYVHRSLSVWKEAHTLAWFREVA
                     TQTWPSLDASAYRESLPESSTQMGVYRHLVVADLPEAQQRQLLRYVPPEVRNPPGGID
                     TFDPLPPSNGSRFDEAYYGSVLPAMTQRGGGPHTGLWELLQRLQNLGVHDVQELLEHV
                     DDRTRDMLMQVVEPVSADEAEDEAATSMNDIDGVDDEISEDDAGHASGDQPSLLQRAW
                     NALWGT"
     gene            complement(<360662..>361825)
                     /locus_tag="MRET_1816"
                     /note="MRES_07230"
                     /db_xref="GeneID:38738582"
     mRNA            complement(<360662..>361825)
                     /locus_tag="MRET_1816"
                     /product="protoporphyrin/coproporphyrin ferrochelatase"
                     /transcript_id="XM_027628443.1"
                     /db_xref="GeneID:38738582"
     CDS             complement(360662..361825)
                     /locus_tag="MRET_1816"
                     /codon_start=1
                     /product="protoporphyrin/coproporphyrin ferrochelatase"
                     /protein_id="XP_027484582.1"
                     /db_xref="GeneID:38738582"
                     /translation="MRWMKGWRSFSTSRASWQSRPPTAVVMMNMGGPSTLDEVQPFLT
                     RLFLDRDLMRLPFQSHLAPMIAKRRSPKVRDQYEKIGGGSPILRWTRTQGEAMSRMLD
                     ELSPSTAPHKAYVAFRYASPLTDECMDELAADGVKRAVAFSQYPQYSCSTTGSSLNEL
                     YREIQRRKARHAPEGQIEWSVIDRWPIQSGLVQALANRIHQALSSLPAEVAHKTPIMF
                     SAHSLPMQVVSGRGDPYPPEVAATVASVMQRLGWSNPYRVTWQSKVGPAAWLGPQTSD
                     TLHGWAKQGHKHVVVVPVAFTSDHIETLFELDMELQEDAKEAGVELVRSPSLNDEPVF
                     LRALADMVSEHLASDARGTQPWAQGKASHQMSLRCPGCPSPECGQQKAFFCTD"
     gene            <362077..>365322
                     /locus_tag="MRET_1817"
                     /note="MRES_07235"
                     /db_xref="GeneID:38738583"
     mRNA            <362077..>365322
                     /locus_tag="MRET_1817"
                     /product="exportin-T"
                     /transcript_id="XM_027628444.1"
                     /db_xref="GeneID:38738583"
     CDS             362077..365322
                     /locus_tag="MRET_1817"
                     /codon_start=1
                     /product="exportin-T"
                     /protein_id="XP_027484581.1"
                     /db_xref="GeneID:38738583"
                     /translation="MAAATQEEQLVKAVEIASNAAAMPDADLVAQALAYLEQLKQATQ
                     ESWSIGWAIWTARTDDGSAPKYDHAPRLFGLNLVDDFLDKRIQGVPEAAEVLTLLQES
                     ALAYLQSEFVSGQGEQGIPFMKNKLAQTLSLLIVQTYSLTSSYTFLTAMLSMCTAHPM
                     ADDKGMNVVSADLAMRVLHDMSLSLGSDVTLRSVRGKERLQRDAIVRDEIRAHHAASL
                     AELLWRVIQDSLHALQQGADGSASPRHLNAVTAGPLASLAMAVVGDYASWIDIGLVVT
                     METVQILYSALDAPHMPLRYATADTLCEIVSKGMKPVDKLSLIEGLSLDAVLTQLEST
                     TRGQGEAQTELREHLARLVNALCTELCKIAEDVAGAEAETREAAHSKLLTFLQLVLAF
                     LADEYDEPVEQVLPCLHLVLSLYKKTKRQNETLGLPALGAPSSEFVSQLITLSVQKLK
                     FDADIDWQDSSLVGGAADGDAEESEDDDEQLVRFYELRKQLQVILGAIAAIDESLVSS
                     TIHALVVNTLAAVGSPIDLPWEQAEVCLYAAFSCGEVLSSVRGNKIGLGAHSYVQIPV
                     EPGKSRNVRQALSVYQALPPNTLGEILQHLFRSQIGEHPHPVVQLQYFECVVRYATSF
                     VLWPDLLPKALEAFLGPRGLCNPHHGMRRRINYLFYRFVRDTRTAIPSEIVPRLLESM
                     PLAVTATLPEVPADEDPLARATEKASAFDSQLYLFDTSGLLIAQLGHMPDTQVMLFKL
                     ITQPLAEQLQQSVQAADPSNLQLVLQVHHLILALSTITKGFPDYDANRAHEPAWIEEL
                     KPLTEQILMALTALNRFMIVREAARGAFARIVASAGPAVLPYIPTLIHALVHHVTEAE
                     LVDLLNFFGLITNKYKDNVRSVMDNVFGVLVSRIFSFLHQGVQGTDDLVRRSDTERAY
                     FGLVHALLQAGMDDVLVSEKNQAQLEAVLQSHVYYVTHGEPVTQRAAISVLSQLVQLW
                     ARPNEKAIMGFEQFVYDAILPLVFQVPAKPSFDSSDAQSQLVLSELAGLLKSLYTARG
                     DEFLQYLSTVYLPSVQCPPELALELTKSVQSLEVKPLKRFLDTFIAQSRGA"
     gene            complement(<365428..>366093)
                     /locus_tag="MRET_1818"
                     /db_xref="GeneID:38738584"
     mRNA            complement(<365428..>366093)
                     /locus_tag="MRET_1818"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628445.1"
                     /db_xref="GeneID:38738584"
     CDS             complement(365428..366093)
                     /locus_tag="MRET_1818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484584.1"
                     /db_xref="GeneID:38738584"
                     /translation="MLRRDAILERGVWHFKGGKPVVHADVLASARCTWRAWSLPWLSR
                     HATSCWDYVLVHSDVPFHFYAHLYAIKPHCFTAHACLELHTSTKLELHNVSGTDMPWH
                     LHATGIERGCKVKWLIHLCADEKQARLCYRVLQNCVQRLSRLVYETQCGETTRLYKDA
                     RHSPYKGQAEWLLHSDRPVLIESSPRHASRLPPLQMPVSPTWTPRALSRSIEPLTPPL
                     RFA"
     gene            complement(<366217..>367293)
                     /locus_tag="MRET_1819"
                     /note="MRES_07240"
                     /db_xref="GeneID:38738585"
     mRNA            complement(<366217..>367293)
                     /locus_tag="MRET_1819"
                     /product="capping protein (actin filament) muscle Z-line,
                     alpha"
                     /transcript_id="XM_027628446.1"
                     /db_xref="GeneID:38738585"
     CDS             complement(366217..367293)
                     /locus_tag="MRET_1819"
                     /codon_start=1
                     /product="capping protein (actin filament) muscle Z-line,
                     alpha"
                     /protein_id="XP_027484583.1"
                     /db_xref="GeneID:38738585"
                     /translation="MSCSQDAVQACVNMLLQTPPGQENQVFNDIKGILAGTVSSDHVK
                     DHARPVLLQYAHEQLLPVSIDLDGKSDYAIVCEAAKLDGKYYHPRLSCTFVYDPSQAS
                     ADQVTPIPRPTSEAETLRAAVDEELSKYMHRHFHAGVCSTFLPSSHLSARQATSETAS
                     TPDADVQGRKESSVSSVHETETEQEEETNDETSQHCSTDQEFKSEVLPSPLTECASSK
                     EAPEPVSIPTLTLHIVGNKYNLRNFWSGRWRSTYVFDLSTKAFTRADIRVHTHYFENG
                     NVQMQTQYSDTMPAFQSTGSIAADVIRAIEAHEQHYQTKLFETTDLLREDAFKALRRT
                     LPITREKVDWDKAVSYKIGAELTK"
     gene            <367467..>368135
                     /locus_tag="MRET_1820"
                     /db_xref="GeneID:38738586"
     mRNA            join(<367467..368071,368102..>368135)
                     /locus_tag="MRET_1820"
                     /product="derlin"
                     /transcript_id="XM_027628447.1"
                     /db_xref="GeneID:38738586"
     CDS             join(367467..368071,368102..368135)
                     /locus_tag="MRET_1820"
                     /codon_start=1
                     /product="derlin"
                     /protein_id="XP_027484557.1"
                     /db_xref="GeneID:38738586"
                     /translation="MDLQNLPAFTSVWIAGALCLTMLEHLGFVSEHQLFFSTYYVFRK
                     HQYWRIVTSFMYFGKIGLIFAIRILELIRFASDLEAHTFGPTRRAQYAWFLLCSSLSL
                     LLVGSLLSIRFMSYPLSWILTYIWSRKSRHMHVTFLGVLTITAPYYPFIELLFTLVQS
                     NVEFKDIMVGLLLGHLYYFLEELWPREMPSHGYHWIGTPQRWVELFEAPVAQ"
     gene            <368288..>370468
                     /locus_tag="MRET_1821"
                     /note="MRES_07245"
                     /db_xref="GeneID:38738587"
     mRNA            <368288..>370468
                     /locus_tag="MRET_1821"
                     /product="mitochondrial mRNA processing protein PET127"
                     /transcript_id="XM_027628448.1"
                     /db_xref="GeneID:38738587"
     CDS             368288..370468
                     /locus_tag="MRET_1821"
                     /codon_start=1
                     /product="mitochondrial mRNA processing protein PET127"
                     /protein_id="XP_027484596.1"
                     /db_xref="GeneID:38738587"
                     /translation="MLILERARLTRPWSIVAFAAHTPFYLPHHHGISMAKRNRYKSTR
                     ASKLSRTSSRSSQKTTKDEQDTPKIPRKANVSYSKSKKQEKSALEDVQLPDISPVSAE
                     NSGLMTAVSIDKDATSSDNRSRQTTFLYGEEAKKARLVRFEQYEKERDISYRFGRLYD
                     TDTAVEPVKPLRNMHVAKLEHGLDRVLFNPGVHWLRDQRTGTFNYTPEIQRVLDVDLF
                     DYTTLPPYVTSSRDKELLYITKRQKKKYCGSTSSLTGLLSHCYFLLSRWKEPNLTGFS
                     PSFQNLLTGFSEGSKMPVSIMLRYQTDGFYAIDADKNSDGEMDNTNYLLTTLGKSLEK
                     FLTSSPDEYAQHKRVNSWKLGAEVREQQEAYHYAQSPKFLLRSQLDCYDERLPKRTFD
                     LKTRAVVSIRNDRANYAEGCGYQIRFARGLWESFEREYWDMVRAAFLKYNFQARIGHM
                     DGIFVAYHNTSEIFGFQYIDLEEMNLRLFGSNEMGDKAYHMSIGLLERILDVATENFP
                     NETLSITMETRPGTGNMYVIVESTETSRILQLDVVLDRYLNNALVRGPVDFVQFCGPM
                     TEAELEDMHCGRSKSKLSDVQWYVDYCITPRHDFPEKKTRQNLQEIRNRQRLMRTMTM
                     PNVEMLDEREKERLYVLSKQPGALERFLHERENGQAIGMPLAPGQKTTRELIQREGLL
                     NIESQGHSQPTTAVRWLRYLDPMTKRVRELSREGHRRLKQQLSK"
     gene            complement(<370702..>371415)
                     /locus_tag="MRET_1822"
                     /note="MRES_07250"
                     /db_xref="GeneID:38738588"
     mRNA            complement(<370702..>371415)
                     /locus_tag="MRET_1822"
                     /product="large subunit ribosomal protein L6e"
                     /transcript_id="XM_027628449.1"
                     /db_xref="GeneID:38738588"
     CDS             complement(370702..371415)
                     /locus_tag="MRET_1822"
                     /codon_start=1
                     /product="large subunit ribosomal protein L6e"
                     /protein_id="XP_027484761.1"
                     /db_xref="GeneID:38738588"
                     /translation="MARNSTVSPYVGRLGRSQLFSKKGGYKHTGRKPAAPVQEEPVTT
                     KEKVVGGAKNAGKRVLPVNKAPRFYPADDVRAKKVSRKTPKPTKLRDSITPGTVLILL
                     AGRFRGKRVVFLKQLESGLLLVTGPFKLNGVPIRRVNQAYVIATSTKLDISNVQIDDK
                     LNDAYFRREKAAKVKAEASFFADPANKAPLAESKVADQKALDKDVLASIQNADPVMAK
                     YLSTTFSLSKGDRPHALRF"
     gene            <371814..>373451
                     /locus_tag="MRET_1823"
                     /note="MRES_07255"
                     /db_xref="GeneID:38738589"
     mRNA            <371814..>373451
                     /locus_tag="MRET_1823"
                     /product="folylpolyglutamate synthase"
                     /transcript_id="XM_027628450.1"
                     /db_xref="GeneID:38738589"
     CDS             371814..373451
                     /locus_tag="MRET_1823"
                     /codon_start=1
                     /product="folylpolyglutamate synthase"
                     /protein_id="XP_027484762.1"
                     /db_xref="GeneID:38738589"
                     /translation="MQRGATRLWQTRWQIPRLYTTMPSATRNYAAAIDALNSLQSNSA
                     TIEAIRRSGKTVNELNEPEMTEYLQRIGHRRDELDRLNVIHITGTKGKGSTAAFCDAL
                     LQKARPPGAGKIGLYTSPHMVAARERIRIDGVPISEADFAKFFWEVWDRLEQNPHRAL
                     ETTPLRPVYFRFMTILAFHVFISLEVSATLLEVGIGGMYDSTNIVQHPVVTGVTALGL
                     DHTAILGHTLEEVAWQKAGIFKPGVPALSVEQPENAQAVLQKYAKQVQASSFQVVPVN
                     RDLLHVKLGLPGDHQYSNASLALELIRTFVLSDIGKHRFPGASEKLGCTGASVPDLAR
                     VALSSAFWPGRCQVVPAKEAFHATYYLDGAHTVESVRVCVQWFVRETAQNKQPKVLVF
                     NCTNGRSAYFLLGSMLEELKKCQVDAQTFFRRVFFCTNNTYADGGSASDLMSRSVDPK
                     DIENMSVQRELLSSWCQLQGLEQDGVLSAHNANVRVDVVPSIEHVMAAVRDYGACASN
                     TIPDVFVAGSLHLVGGFMSHLQARHMLNERLQSTHVA"
     gene            <373521..>374912
                     /locus_tag="MRET_1824"
                     /db_xref="GeneID:38738590"
     mRNA            <373521..>374912
                     /locus_tag="MRET_1824"
                     /product="mitochondrial translocator assembly and
                     maintenance protein 41"
                     /transcript_id="XM_027628451.1"
                     /db_xref="GeneID:38738590"
     CDS             373521..374912
                     /locus_tag="MRET_1824"
                     /codon_start=1
                     /product="mitochondrial translocator assembly and
                     maintenance protein 41"
                     /protein_id="XP_027484763.1"
                     /db_xref="GeneID:38738590"
                     /translation="MTLMRMVPRWGRLPAGVYRVKPMRSFYHRNASHIESEFVTPNAR
                     QFPASFVVPTAMPDMSQRTAEEAEHRKHILAILHGMNLPIMQYAFAYGSGVFSQAPLS
                     RRDGGAPPMIDMVVAVKDPVHWHAANMLRNKSHYPWWTRWFGLWAIRAAQKMGAGLWY
                     VPYVKVNNEIIKYGVISIEDLCKDLLYWNTLYVGGRMHKPIACLFDATNNRVPNAQQA
                     NLTSALRASLLLLPASFSEMELYRMLASLSYMGDFRMKVPGGENRNKVENIVKHQLPW
                     FRIMYSTLLTRLRFVHVNHNEESFTMHQDKRPATLALVAINLPQTLRLRLVQHFQRQP
                     HLHPVFHKCKDMDPEELMPATSANIRKLRDNPETRKKLYEDDDCEEADEWPYSTRFWL
                     AVVQQPSFEDALREQIVQIVSEPTRIQSLKGLYTAGIGRSLRYLWSKMSKYSQSRKRV
                     YGSGDKDKGRHSG"
     gene            <375063..>375516
                     /locus_tag="MRET_1825"
                     /note="MRES_07260"
                     /db_xref="GeneID:38738591"
     mRNA            join(<375063..375224,375251..375363,375390..>375516)
                     /locus_tag="MRET_1825"
                     /product="vesicle transport protein"
                     /transcript_id="XM_027628452.1"
                     /db_xref="GeneID:38738591"
     CDS             join(375063..375224,375251..375363,375390..375516)
                     /locus_tag="MRET_1825"
                     /codon_start=1
                     /product="vesicle transport protein"
                     /protein_id="XP_027484764.1"
                     /db_xref="GeneID:38738591"
                     /translation="MTSVEAKETQEKQVNAVPESKEPAPSATTEASEKAPAKQAEDEE
                     EYNEDEDEDFVVDEDDEEDDDEEEEEDDDEDDDDYEDDEEGGAGEKAGESSAGKRKAE
                     DDDEDDDDDDDDDDEEKDDDKKEPAKVARTE"
     gene            complement(<375559..>379176)
                     /locus_tag="MRET_1826"
                     /note="MRES_07265"
                     /db_xref="GeneID:38738592"
     mRNA            complement(<375559..>379176)
                     /locus_tag="MRET_1826"
                     /product="GPI inositol-deacylase"
                     /transcript_id="XM_027628453.1"
                     /db_xref="GeneID:38738592"
     CDS             complement(375559..379176)
                     /locus_tag="MRET_1826"
                     /codon_start=1
                     /product="GPI inositol-deacylase"
                     /protein_id="XP_027484571.1"
                     /db_xref="GeneID:38738592"
                     /translation="MNGAPSRAVGLLRPALFMAVLTGCICVCLLSFAFLPHMLHMRME
                     CRMSRMYPAYEDHSEQLRDYTRSSSPVMKKYSLREYREMNAYMLNPLYDRPLSPIPVL
                     FIPGNAGSFAQVRSMASSAFYQYWNRWFEVPSDDMQDVPGPTAWFSIDFNEDFSAFHG
                     KTLEDQAYYVNEVVRYLRAMYSRQGNMSVGIVGHSMGGIVARLALTLPNAEPSSIDTI
                     VTLSTPHAFPPVPFERSMEQVYTRINAYKNDTMPLIVSIAGGILDTQLSSDASSLSLF
                     EDGKAPERSLSTFTTALASLWSSVDHLAIVWCDQLRARIARSFLRDYAYFGSDFAHRT
                     RHSIRDQRREFWRFMLGLSDDAASPRTQHLALDTSSSGPAAKVATTTRFLASDSHYLK
                     PLVFMDTSDIQVDILDVAIPPGPRQKYDGNITDADEALAFELITNLSLGQMNDLSSNS
                     PGGAEIVVLLCTHAVATPLERCHPALMNGAQPLPFSPVPETTVNTAFPNAKIQYDAPS
                     ATLMRMHFPAAFLQKHEISAVRVEYIKQANSLPSREGVPTILSYGWTEDKPLNLHGAP
                     GWLRSRTWALPGINVTSLISSFVEHGPLWEWNFPDMDSSLLAYTVTLVPAPCAHRLDP
                     PPPRMAPMVRFLSASTGDARIFPSLHTRARNDLRVALHGTAPFMREPTHRGTRMQLWL
                     LDDYRHTSYNGTFDVNCPLPYTHVRASVHWRASMALFVLRYRMALLTWPLGILALARA
                     LQPTAPPLDALLFLMRGRGLLMLILGPLALHVCVFFGASLGAPRHTLGIGITSMSFWW
                     LGPMLSVLATSLALLVYLVTEAAMHVLYLAVRRFVPRLLPSNSTLVPSWPTRDAWITW
                     LRQRSTWGTGLALLGLFVTLPYQVLILLCVMLHIGTTCRSYMVYRESGALQFSEHAWL
                     MQFLLWLVPLQAPMLVVWVRNVHAGIVMGLARIESNVLIVAPLLWLIYLEWLPSVWHR
                     PSTFYFTQAHYAVYGSMALCTLIYGIRYSYAILDAFLVTVVFELVNRIVPLYQARPPP
                     ETISMRDVSMLAVPPSITDSLWEEYLATLEAYLHVHAQVENTLKDGFFQLTRAKMTMS
                     GTFGQRTGRDVYNEHMSAQVRFAQEDTDTAPASSSSGLRRRHGQESIPVSSGASHDSD
                     PVAQFSGLPPPALRAAQRSFQRAVTLLVDTNTSQAAIHTVYHLKKKLEALENDILQRR
                     S"
     gene            <379299..>380180
                     /locus_tag="MRET_1827"
                     /note="MRES_07270"
                     /db_xref="GeneID:38738593"
     mRNA            <379299..>380180
                     /locus_tag="MRET_1827"
                     /product="SH3 domain YSC84-like protein 1"
                     /transcript_id="XM_027628454.1"
                     /db_xref="GeneID:38738593"
     CDS             379299..380180
                     /locus_tag="MRET_1827"
                     /codon_start=1
                     /product="SH3 domain YSC84-like protein 1"
                     /protein_id="XP_027484572.1"
                     /db_xref="GeneID:38738593"
                     /translation="MSYMDRFKTAALKAKNQASMYAQRGYAQLESHAKNVHAGFSLPA
                     ECERAAKILEGFLADPNNPESALNSIPKAVLLQAKGLAIFTVFKSGFVWSGKAGSGVV
                     VARLPDGSWSAPSCVVTAGVGFGFQIGADFTEYVIVMNSEEAVRSFGMAGNLSFGGNL
                     ATAVGPIGTGAAVSASLVHTAPMFTYSRSKGLYGGVSLEGTGLLERKEANAQFYGQPI
                     PAMDLLMGKVPAPEAASVMYEVIEAAEQVDETGLPQQAYVPQEHFGESATLSPTGQAA
                     PAATEKPADAHEEDTKA"
     gene            complement(<380205..>381563)
                     /locus_tag="MRET_1828"
                     /note="MRES_07275"
                     /db_xref="GeneID:38738594"
     mRNA            complement(join(<380205..380637,380663..380901,
                     380956..381098,381125..>381563))
                     /locus_tag="MRET_1828"
                     /product="calcineurin-binding protein"
                     /transcript_id="XM_027628455.1"
                     /db_xref="GeneID:38738594"
     CDS             complement(join(380205..380637,380663..380901,
                     380956..381098,381125..381563))
                     /locus_tag="MRET_1828"
                     /codon_start=1
                     /product="calcineurin-binding protein"
                     /protein_id="XP_027484734.1"
                     /db_xref="GeneID:38738594"
                     /translation="MPLVAVSEPPRVAAADEPDAYESTPKSLEEIPSRLVLHVDPVHL
                     CMRPVPPVLQERDIDTLASVGTLWLTEQRFTFLPRQGKGFQVDYPSIALHAVSRSVPE
                     YATHDDFGTEMCLYCQLDDHPERDEEEEDEVVREMWILTHDAASLNTLYESLSHCASL
                     YPSLPGGADAHPLAGLAAMSGEASNEEEKNDEGRAQTCPSSNTLMFVNFPPAFFTSEA
                     TVSLFVDVLRAYGPLVAWSPMPAFRQARAVMERPSDTLRIKQALDYQELAHDDEQSFV
                     LRVYYDHDTPLTLLPTGEYAVTQAVDIPRPFLEPPAPEKEFLLSPPGSPPVGWEQQKE
                     DRPNTQALSDDLIKALHKLSMEQETPKAENAGTSTLFQGSHHAVPGVVLHATESATSS
                     SSRPSGIERVKATKDSMRPTSRPPI"
     gene            <381753..>382220
                     /locus_tag="MRET_1829"
                     /note="MRES_07280"
                     /db_xref="GeneID:38738595"
     mRNA            join(<381753..381980,382067..382125,382166..>382220)
                     /locus_tag="MRET_1829"
                     /product="large subunit ribosomal protein L36e"
                     /transcript_id="XM_027628456.1"
                     /db_xref="GeneID:38738595"
     CDS             join(381753..381980,382067..382125,382166..382220)
                     /locus_tag="MRET_1829"
                     /codon_start=1
                     /product="large subunit ribosomal protein L36e"
                     /protein_id="XP_027484745.1"
                     /db_xref="GeneID:38738595"
                     /translation="MGSSSNPAHKAGVPRTDIVWGINRGHPTNRRILAPRRVHQKGVA
                     SERVKTIRSVIREVTGFAPYERRAMELIRNSRDKRARKFIKRRIGTIGRAKRKMDILT
                     TAIAEQRRTGH"
     gene            <382612..>384009
                     /locus_tag="MRET_1830"
                     /note="MRES_07285"
                     /db_xref="GeneID:38738596"
     mRNA            <382612..>384009
                     /locus_tag="MRET_1830"
                     /product="translation initiation factor 3 subunit E"
                     /transcript_id="XM_027628457.1"
                     /db_xref="GeneID:38738596"
     CDS             382612..384009
                     /locus_tag="MRET_1830"
                     /codon_start=1
                     /product="translation initiation factor 3 subunit E"
                     /protein_id="XP_027484704.1"
                     /db_xref="GeneID:38738596"
                     /translation="MAEYDLTQTLVAHLDPHLVLPLLSHLRTLDLFDAKDVVKAQYEV
                     SKKTNMTDYALQLYKEAYPGEAEPKEITERAREMEAKNEKLSKEAEHVLKVIEDPVVA
                     GSLKQDKAQNFEWLKQQYQLTEEQIHVLYEYGRFRFACGKYSEASSYLYHYSVLSPDT
                     GKVYESVLWGKLASNTLTGEWERALDDLRVLRDHIDGQRASTSSSSACDEQQLSHEHI
                     LQKRVWLLHWSLFVFFNHPSGRVKLVEMFLSQSYLNAIQMSCWWLLRYLVVALIVTRR
                     QCTRGYVVEGGSYSHTSKLQTHAALQELSKVIQMEAYRLRPDPFVDFFRQLYVELDFD
                     RAQEELAKAQRVAHGDFFLHDTADTFMEQARLLVSEVYCRIHQKVDIGDLSKRLVLSK
                     EEGEQWVAKLLNETKMNATIEDGVLNINQPRPVVYQSVIDKASSLTGHTTSLMQAIER
                     LTQQPVETEEAAEAK"
     gene            complement(<384021..>385445)
                     /locus_tag="MRET_1831"
                     /note="MRES_07290"
                     /db_xref="GeneID:38738597"
     mRNA            complement(<384021..>385445)
                     /locus_tag="MRET_1831"
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 7"
                     /transcript_id="XM_027628458.1"
                     /db_xref="GeneID:38738597"
     CDS             complement(384021..385445)
                     /locus_tag="MRET_1831"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 7"
                     /protein_id="XP_027484703.1"
                     /db_xref="GeneID:38738597"
                     /translation="MFWQRCAVRAAPRATWTMRHLSTNASTHQGMLKRVLVDAIKARG
                     PLTIPAYMQACLTNPDYGYYATKDQASPSILGSRGDFITSPEISQVFGELLAVYFVSR
                     WQAAGAPSRVRLIELGPGRGTLLCDMLRTFSAFPEMMSALRSVELVESSPLFIEHQES
                     GLSATLGRMGRSLANADTPIEKLSPKEVRVEWFASHEQVSVAPDAWTIVVAHEFFDAL
                     PIHIFEKHVNGWREVMVDVDDGHRPVSVVKASDLNRKAPEPGLRFVLSPGPTAWTQLL
                     ASNSERFKMMQPGQRVEVSPAGWTVARRLGEWVSGYPALRPEHATSQRPPADTREQRG
                     KRSLGGCGLVIDYGGMRFFSESFRAFRSHKLVDPLEMPGQSDLTANVDFSFLMHALHT
                     TDAFTYGPLSQRDFLTALGLSLRLKKLVESNAPDRRVDIERAAQRLIEVNGMGTQYQI
                     LGISSPARAHGDESVEPEEVYPFL"
     gene            <385628..>386942
                     /locus_tag="MRET_1832"
                     /note="MRES_07295"
                     /db_xref="GeneID:38738598"
     mRNA            join(<385628..385643,385669..>386942)
                     /locus_tag="MRET_1832"
                     /product="DNA-directed RNA polymerase I subunit RPA49"
                     /transcript_id="XM_027628459.1"
                     /db_xref="GeneID:38738598"
     CDS             join(385628..385643,385669..386942)
                     /locus_tag="MRET_1832"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I subunit RPA49"
                     /protein_id="XP_027484702.1"
                     /db_xref="GeneID:38738598"
                     /translation="MGPALLSLSDFAPQKHTRFALYRAPSNDAGDGTSSEATLDDRLL
                     LEGSTDVMQYTSTNWGWGASAQAAADLRRETRGYTGDYLIGAYDKEKKQVTFRVAPLF
                     TLNRSVKSLAHLSASATEHGAQDNMDYTRARRDLGEAFGNKKQKQAARNLDRMKVNTE
                     NMDGILEHVASGIDVSASSLPTDLELNATLNTSRALPQAHLDASEPADVYPLASLVPP
                     TVLNALHTRHLLKCSSQSDLAKALRLTSSPWLLPRMWQIVQTAQNDAGMSRAMELVRV
                     GYYVAILLAFRKHARGLSRGDDGMSQVAHKMRLPEHEKDIVMEHLVSQYAEQARSSHR
                     YAMTAIGDTRLFASIIVLALHLEEFSLASDVLAQELCVTTQRVNEILRSLGCTSSQST
                     KHGVDGDGAASQQQQRKWHLRLPLSFPNQRKRGPARR"
     gene            <387333..>388136
                     /locus_tag="MRET_1833"
                     /db_xref="GeneID:38738599"
     mRNA            <387333..>388136
                     /locus_tag="MRET_1833"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628460.1"
                     /db_xref="GeneID:38738599"
     CDS             387333..388136
                     /locus_tag="MRET_1833"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484701.1"
                     /db_xref="GeneID:38738599"
                     /translation="MQQHVWSLTSLQMHGIESLDTYGLAPLRQETQFGYLQIHTDGAL
                     TSAWKPSNVRTFWHVLPRHQVAILTSSPYAKVTYDNLSHAPIPKDARHILHLTTRWLH
                     RVHAHTPVVKWYDARRTESLQQMQGVTYSRVMGILYSAPRNYAADYELRLHCCRSTEQ
                     ECISVRISRQYDQVIVQQHTYTLHSHQQATTTVSISKAQSMTSVPCVRWAVHQALAMH
                     AMADALRAQITPRAQYTASPVSPLDQLRRAELHARERTWYERSNAPWPF"
     gene            <388667..>389383
                     /locus_tag="MRET_1834"
                     /note="MRES_07300"
                     /db_xref="GeneID:38738600"
     mRNA            join(<388667..388721,388769..388861,388891..388983,
                     389012..389228,389258..389315,389354..>389383)
                     /locus_tag="MRET_1834"
                     /product="ADP-ribosylation factor 1"
                     /transcript_id="XM_027628461.1"
                     /db_xref="GeneID:38738600"
     CDS             join(388667..388721,388769..388861,388891..388983,
                     389012..389228,389258..389315,389354..389383)
                     /locus_tag="MRET_1834"
                     /codon_start=1
                     /product="ADP-ribosylation factor 1"
                     /protein_id="XP_027484700.1"
                     /db_xref="GeneID:38738600"
                     /translation="MGLSVSRLLSGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVT
                     TIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRERIPE
                     AREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRQWFIQATCA
                     TSGDGLYEGLEWLSTNLKRRA"
     gene            <389629..>390510
                     /locus_tag="MRET_1835"
                     /note="MRES_07305"
                     /db_xref="GeneID:38738601"
     mRNA            <389629..>390510
                     /locus_tag="MRET_1835"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628462.1"
                     /db_xref="GeneID:38738601"
     CDS             389629..390510
                     /locus_tag="MRET_1835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484699.1"
                     /db_xref="GeneID:38738601"
                     /translation="MHQDASSSQRSKDASRKKQVLLSASAATFVLGAVGAAAYAFRKR
                     PFPAASHVELHTPPQQATKSMRAVAPVHTEESSMPDKSAWAIFRDMHMALFSSSKRAR
                     PVKPIPVSQIRPTGSPLSALSRAPSTQERSAALPALNKTRIAPPPEDTEGQGDDGPML
                     AIFAFSTATVIVGASALVATLLVRYGLGIRSIEEFADKMHDILPSLNRDARLARYLPA
                     VPPRPPAEPDMPSVDVPASELEHKLEHTEDAQDWLRYAVMQLESELAAHEAAKRERRH
                     QRLICTNGATGAAARDA"
     gene            complement(<390482..>391417)
                     /locus_tag="MRET_1836"
                     /note="MRES_07310"
                     /db_xref="GeneID:38738602"
     mRNA            complement(<390482..>391417)
                     /locus_tag="MRET_1836"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628463.1"
                     /db_xref="GeneID:38738602"
     CDS             complement(390482..391417)
                     /locus_tag="MRET_1836"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484698.1"
                     /db_xref="GeneID:38738602"
                     /translation="MPQVTLHFPAVYPIVGMYRLAHDELLWRPMWNACYARVTQAGAT
                     TILWSFVSLPGQRLVSGLILGHMGRACGAKWMYELIEAGGRQVGIPMLSFGSMTTLLL
                     VLNQVNIVFDMFLGKQMRAFRDTAYRKTVESRGKSSDFWTPYTEEYERPPDPQDGVQK
                     LTIKKRLSDMVLRKVSLLLFGSIPIFGVILSAAYGALGFAREMHQPFFEVKHMQDEQI
                     TLWITERRIDYMLFGFFALLLERIPFFGLIFSVSNQIGAAMWAHDLEKRQHRFQRGEL
                     QPIPAEQGPADSASAPTGYMPASPEPVRRRVPPPP"
     gene            complement(<391485..>392225)
                     /locus_tag="MRET_1837"
                     /note="MRES_07315"
                     /db_xref="GeneID:38738603"
     mRNA            complement(join(<391485..391573,391598..391977,
                     392002..>392225))
                     /locus_tag="MRET_1837"
                     /product="thioredoxin-like protein"
                     /transcript_id="XM_027628464.1"
                     /db_xref="GeneID:38738603"
     CDS             complement(join(391485..391573,391598..391977,
                     392002..392225))
                     /locus_tag="MRET_1837"
                     /codon_start=1
                     /product="thioredoxin-like protein"
                     /protein_id="XP_027484697.1"
                     /db_xref="GeneID:38738603"
                     /translation="MSAWQDAPDLGAYTAQADSDEEVLAELEREVEALNEADADDAER
                     VAGKGRGSDDRDLSQVFEEYRAQRLAEMQAQIAARIGADTSDPNRGKYVQVEDEKALL
                     SSSVREPKVVIHFAKKEFRRCHILDRHLEHLARQHPGTLFLKTYVEHAPFLVQKLDIR
                     VLPCLMAFVQGVCKDKMIGFQEFGNSDTFTTAALEWRLGQTGVILPQQKPSKPILGFG
                     VPTAAPEPDDWD"
     gene            <392261..>393076
                     /locus_tag="MRET_1838"
                     /note="MRES_07320"
                     /db_xref="GeneID:38738604"
     mRNA            join(<392261..392836,392861..>393076)
                     /locus_tag="MRET_1838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628465.1"
                     /db_xref="GeneID:38738604"
     CDS             join(392261..392836,392861..393076)
                     /locus_tag="MRET_1838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484706.1"
                     /db_xref="GeneID:38738604"
                     /translation="MNAAEVQRQHTQVSAMGHMEPLHVGSLLDALARMVHTPAEAFVE
                     RDTLLHRCDDEAAQALETSDTRWNNVRRARYQIRLSVRTEHGMTQLVLPQPPVPPGAA
                     PSVAVRTVVIVDVLTPAPDMPPTPLETTTIFAMPIEELAEHAQHRAGWDELVALLQWA
                     PERQVMRYGLRYVLPSDHPLVLHELRIFRATDWSIDASNRPIEWTPSSQIHVRVVSTL
                     RSDVGPGIPKSQQDETARALEYAIQYTKHLQKSLDAIVPLDRDAS"
     gene            complement(<393073..>394131)
                     /locus_tag="MRET_1839"
                     /note="MRES_07325"
                     /db_xref="GeneID:38738605"
     mRNA            complement(<393073..>394131)
                     /locus_tag="MRET_1839"
                     /product="tRNA pseudouridine55 synthase"
                     /transcript_id="XM_027628466.1"
                     /db_xref="GeneID:38738605"
     CDS             complement(393073..394131)
                     /locus_tag="MRET_1839"
                     /codon_start=1
                     /product="tRNA pseudouridine55 synthase"
                     /protein_id="XP_027484705.1"
                     /db_xref="GeneID:38738605"
                     /translation="MPLGCVRRSLTRMPSESDRPLSCLFGIIKPSGPTSMDLLDRLKP
                     LLASSDLFYAAHTPRRVKPARRLKPWERELVAKCGRLPPKMGQGGTLDPLAEGVLVIG
                     LHHGTKQLQQFLHCTKEYETTGLLGTATTSYDAKEPIMSYAPHSHVTEDMVRDKLRLF
                     RGQVQQLPPLYSALRMDGKRLFEYAREGIPLPRPIEPRNVCIDELELVQWHPPSAHTY
                     APPTTRVSDDDKALFTRVRAMAGAQALDTTNQDTACIAAPEDREETSPPAAFTLRMTV
                     SSGTYVRSIVHDLGTACGSAAHVVRLVRTRQGPFHLGNSIPWEVFERGLAELGHEKVE
                     GGLREWEQRILQHMQLCD"
     gene            <394166..>395242
                     /locus_tag="MRET_1840"
                     /note="MRES_07330"
                     /db_xref="GeneID:38738606"
     mRNA            <394166..>395242
                     /locus_tag="MRET_1840"
                     /product="methionyl-tRNA formyltransferase"
                     /transcript_id="XM_027628467.1"
                     /db_xref="GeneID:38738606"
     CDS             394166..395242
                     /locus_tag="MRET_1840"
                     /codon_start=1
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="XP_027484664.1"
                     /db_xref="GeneID:38738606"
                     /translation="MIWRRAGSLSRRPWGRRGYATVPPAPYDVLFCGSDAFACEAVAA
                     IAHRPDLYRSLHVLTPPDVQHAWGAKRMRVSPVKQFAILHNIPQTAVPPEGIDAYEPP
                     SLIRDSHAPLLVTASFGHRIPTHLLSHFPSPSLTLNLHPSMLPDLRGAAPLQWAIARQ
                     YTHTGMSVQQLHPTHFDRGGLLKQVRVPIPSHATYPALATALAPHAAELLVDVIAQLP
                     SYAANVQAQDPDRATRAPKLAPRFSHIRWDSWDAATLDARMRAFGYAQPLTTTLVPAS
                     SQFAPVSCAIHEGHIMPSESISLDRPGHAVFLPQEQTLALQTLSGVYGATRIQTRGKP
                     VRSAADWWRGFRDRADAHGHIHFE"
     gene            complement(<395230..>396326)
                     /locus_tag="MRET_1841"
                     /note="MRES_07335"
                     /db_xref="GeneID:38738607"
     mRNA            complement(join(<395230..396260,396287..>396326))
                     /locus_tag="MRET_1841"
                     /product="DUF500 domain protein"
                     /transcript_id="XM_027628468.1"
                     /db_xref="GeneID:38738607"
     CDS             complement(join(395230..396260,396287..396326))
                     /locus_tag="MRET_1841"
                     /codon_start=1
                     /product="DUF500 domain protein"
                     /protein_id="XP_027484665.1"
                     /db_xref="GeneID:38738607"
                     /translation="MSWDNWKEKAWSTAKKIETKAWRTVDPIGHWTNKQIGRLGLEAF
                     YPTQLDGEIDKAARIVTNFTSKGEAAVPSDQDGEYKDGQVNDEYAARKTQKVLYNIPA
                     PVLRGAKGVAIFTVFRSGLGISGAGGSGIVMSRYENGDWGAPSGILVHTVGWGLMVGV
                     DVYDVVLVLRTQEAVNAFKYPKISIGGELSVAAGPVGNGAIVDSGLEASPCLSYVKSK
                     GLYAGAQLDGSIFLTRSDENARYYNYPGIPIETILDNKLPKHQIPYTCKSVWQALYVA
                     EGRPDYMGTDAIPEGPSPGNYEATDEEKAALAKEQDGTSTSSAPILPPPRRVSKAAEA
                     EKDREPAARQPPPPPYDASHSK"
     gene            <396392..>397249
                     /locus_tag="MRET_1842"
                     /note="MRES_07340"
                     /db_xref="GeneID:38738608"
     mRNA            <396392..>397249
                     /locus_tag="MRET_1842"
                     /product="S-formylglutathione hydrolase"
                     /transcript_id="XM_027628469.1"
                     /db_xref="GeneID:38738608"
     CDS             396392..397249
                     /locus_tag="MRET_1842"
                     /codon_start=1
                     /product="S-formylglutathione hydrolase"
                     /protein_id="XP_027484657.1"
                     /db_xref="GeneID:38738608"
                     /translation="MSLSIVSQNKVFSGLLTKYSFLSSVLGGLEAKMNVFVPKEASAS
                     NKVPVLYYLSGLTCTEDNAAQKGHLFEAASQKQIAIVFPDTSPRGANIPGENDSWDFG
                     TGAGFYVNATREPWSKHYNMYDHVLKEIPDVIAKNEIPIDVSRASILGHSMGGHGALV
                     LYLREQGTFRSASAFAPICHPTNCDTGKKMIQGYLAGGIDEGKQYDASILLSQQDKTR
                     PLQILVDCGLADNFYQQQQLQPEALVDAAFKSGVDTSRIQLRLHEGYDHSCTYEQTNM
                     RLLCEHLCC"
     gene            complement(<397287..>398303)
                     /locus_tag="MRET_1843"
                     /note="MRES_07345"
                     /db_xref="GeneID:38738609"
     mRNA            complement(<397287..>398303)
                     /locus_tag="MRET_1843"
                     /product="DnaJ domain protein"
                     /transcript_id="XM_027628470.1"
                     /db_xref="GeneID:38738609"
     CDS             complement(397287..398303)
                     /locus_tag="MRET_1843"
                     /codon_start=1
                     /product="DnaJ domain protein"
                     /protein_id="XP_027484661.1"
                     /db_xref="GeneID:38738609"
                     /translation="MRVLLFLAVLVVCLVGTKAANDWSHTDIEMFEIQAALEKAEGEG
                     VNFYSFLGLTPSASMSDIRKAYRQRSLEWHPDKNPNAAEVHQRFERLGRIHSILRDER
                     RDRYNHFLSFGFPKWRGTGYYYSRYRPGLPLILSVLLLLSVGVQLAVKKSQWRKSQRR
                     YENLCRSALAAAWGPAFQTPLAPSSKPRPAEKKVRVPMHGYFDMPPAPREADITAGTV
                     NWDREADKVREALHAPSPETDDEVPLIELVVFGDGSLALYEAATRELIPLEPVLDSDM
                     PTLMSTWPFQLWKKLAGSREVAPEAVPEQATEPIAEPTAEPTTNTSAISKKEAKRRKR
                     AGKT"
     gene            <398444..>399414
                     /locus_tag="MRET_1844"
                     /db_xref="GeneID:38738610"
     mRNA            join(<398444..398941,398968..>399414)
                     /locus_tag="MRET_1844"
                     /product="prenyl protein peptidase"
                     /transcript_id="XM_027628471.1"
                     /db_xref="GeneID:38738610"
     CDS             join(398444..398941,398968..399414)
                     /locus_tag="MRET_1844"
                     /codon_start=1
                     /product="prenyl protein peptidase"
                     /protein_id="XP_027484460.1"
                     /db_xref="GeneID:38738610"
                     /translation="MHTASALACSSYATIYVGSLYVLPRIFAWLRRKPCAKHRRRDDP
                     PVIKQRLVSVCVATVIDLLVTASLIGRTTVLPVKQPFRALHILSLMGLPFPHPTFLTS
                     RYLPLEPSFPSFVTRLGWIGIKALALTACMYLGTFFTNILDKRTRSKRASSPDTALAR
                     WRNYVLGPGTEELVFRSCMLATMKSFHPHASPTWLMLTTPLYFGIAHLHHAWEMYQAG
                     GYTKRARTNALLTSALQFAYTTVFGWYANFLFMRTGTVWAPFLAHVLCNMMGLPRLAP
                     FPHANSAQKAACACAHLAGLGAFMYALWPCTSTRMLAT"
     gene            complement(<399461..>399816)
                     /locus_tag="MRET_1845"
                     /note="MRES_07350"
                     /db_xref="GeneID:38738611"
     mRNA            complement(join(<399461..399747,399786..>399816))
                     /locus_tag="MRET_1845"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628472.1"
                     /db_xref="GeneID:38738611"
     CDS             complement(join(399461..399747,399786..399816))
                     /locus_tag="MRET_1845"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484461.1"
                     /db_xref="GeneID:38738611"
                     /translation="MSNYLDQAKNAASQTGDKVNEYAGQAQEQVGKHSEGIYGQAKEQ
                     AGNLSEQAQKYASQAREQAGNLGEQAQQYASQAREQAGNLGEQAQQYASQAKEQLSNW
                     GSK"
     gene            <400511..>401683
                     /locus_tag="MRET_1846"
                     /note="MRES_07355"
                     /db_xref="GeneID:38738612"
     mRNA            <400511..>401683
                     /locus_tag="MRET_1846"
                     /product="3'(2'), 5'-bisphosphate nucleotidase"
                     /transcript_id="XM_027628473.1"
                     /db_xref="GeneID:38738612"
     CDS             400511..401683
                     /locus_tag="MRET_1846"
                     /codon_start=1
                     /product="3'(2'), 5'-bisphosphate nucleotidase"
                     /protein_id="XP_027484458.1"
                     /db_xref="GeneID:38738612"
                     /translation="MLSWFTRALRVGVKPAYQSTLRIQRISTMGAYMADERAVAMAAV
                     RTACAITTKVFKTLTSDESVTKKDKSPVTIGDFSAQAAVNYILKKHFPQDSIVAEETS
                     TDLQGDAGKSIRDKVSHLVNEALQASGDIQQPLSDDDILSSIDQGAFEGGSDARFWTL
                     DPIDGTKGFLRGGQYAVCLALIVNGHIELGVMGCPNLPRDVSQPKPKDGDIRHSSMEG
                     LGVLFVAARGHGAFVAPINDTEAPLEPIHMRDLEGDFTRATFCESVEAGHSSLGTNAR
                     IAQILGMGDQHVRMDSQAKYASISRGDGDVYLRLPVGDGSYQEKIWDHASGSLLVAEA
                     GGTVSDLAGRPLNFGLGRVLSANKGVVACQSNMHAKVIEAVASALKEEGRSGLLSV"
     gene            <401735..>402673
                     /locus_tag="MRET_1847"
                     /note="MRES_07360"
                     /db_xref="GeneID:38738613"
     mRNA            join(<401735..401943,401968..>402673)
                     /locus_tag="MRET_1847"
                     /product="nicotinate-nucleotide pyrophosphorylase
                     (carboxylating)"
                     /transcript_id="XM_027628474.1"
                     /db_xref="GeneID:38738613"
     CDS             join(401735..401943,401968..402673)
                     /locus_tag="MRET_1847"
                     /codon_start=1
                     /product="nicotinate-nucleotide pyrophosphorylase
                     (carboxylating)"
                     /protein_id="XP_027484459.1"
                     /db_xref="GeneID:38738613"
                     /translation="MATQAKYAHLLPPSWKHVVQDWLREDCPAFDWGGYVVGDAFRTA
                     TLWCKQEGVLAGVPFVDAIFEQLQCDVRWLFEEGRYLTASDNVDDVAYGTVKIAVAQV
                     SGPVRNLLLGERVALNTLARCSGIATASRDLLDASRAAGFEGIVAGTRKTTPGFRLVE
                     KYGMIVGGVDAHRYDLSSMVMLKDNHVWSTGSITSAVTTARRAAGFSIRIDVEVPSYR
                     EAREAICAGADVVMLDNMAGDELVQTAQRLKEELGKDYHFLLESSGGITLANLSTGQR
                     VNHAIDIISTSSIHQSTRHIDFSLKVDH"
     gene            complement(<402670..>406974)
                     /locus_tag="MRET_1848"
                     /note="MRES_07365"
                     /db_xref="GeneID:38738614"
     mRNA            complement(<402670..>406974)
                     /locus_tag="MRET_1848"
                     /product="AAA domain (dynein-related subfamily)"
                     /transcript_id="XM_027628475.1"
                     /db_xref="GeneID:38738614"
     CDS             complement(402670..406974)
                     /locus_tag="MRET_1848"
                     /codon_start=1
                     /product="AAA domain (dynein-related subfamily)"
                     /protein_id="XP_027484624.1"
                     /db_xref="GeneID:38738614"
                     /translation="MVRDAPRRRVQLVTRHFQAGVRAPAKSLTPATELGTFRLGPHVA
                     IPVHAADAPERVPPTRLMLDTEDPIVLEHLEFLGKKWQLRQDVFLSSPPGPYARRLCQ
                     TFAALIQVPVEYVSLHRDIGEAELLQQRSLEAGGNLRYDDGPVVRAMKHGRLLILDGI
                     ERAERGVMPILNNILENREQNLADGTQLVPAERIAADDAGHGHARFVPVHPDFRVFCL
                     GVPVPPYRGHPLDPPFRSRFQARWVEGAVFGPALRAATSSQGSSLLERWGEWLALLRL
                     HHEASQEEGILPATELLPHVPTTAMPLLRDIASVYPPTTALPPAHGRPEAGARVAESS
                     LAMLSTAYPAILTFDAKKRQSLHDMLARVALHGGVGGPATFRAGRGLVGYTIERVVRV
                     SATSARLTFRHDGGDVHVEVPCGPRPLVPLDTLDQEHVSLTPRVKSLLTTMLQLHSLG
                     RDICMVPATLDAESRSQASSSKSTCIHLFAALLGYRVETIWLWKDVSGTELLMRRATT
                     PSGATIWEPAPLTLSALRGSLVHLAGVHVLGPTLESLSRLTQDREMELWDGTRLTTEA
                     DVPLSNELADGHVCRMAPNVRIIATAPQIGDWLSEGVANMFATLAAPPMTADEERAVV
                     QQQSGVSDTALDPVWAFVHKYRTQASDANVGLHKARRFGTRQLIRIARRLARWPDDDV
                     YRLLFRNQLCDFLPRTVRDIVHHMLLDVGIAPHGSEGAFQYKPPLRLSAPVVEAGTLA
                     FFDESGKPVLRVPRYDWRTKDPEGASLIPNAHGSFFHNTQQTGLMHSIVQDLETLDEH
                     LLLMGAQGTGKNKIMDQVLELLDRPREYIQMNRDSTVGELLQRAYLEDGQLKYADSPL
                     VRAIRCGRVMVVDEVDKCSASVSAVFKSLAERGELTLPDGRRVVPQGSVADPTAITVH
                     PDFRLVLLANRPGWPFLGNAFTEVIGEGFSSYAVSNPDAESEVQLLCRMAPNLDPKLI
                     RSLVLSFHGLREAFDQDLISHPYSLRELIHIVRHLSRYEGENLGDVMLNALAFDLHRP
                     ESLRLIARVFADHGLKLGGITLEQVQQRLEKQARAKQLRVEYKPKGDTSLDKPKKGKD
                     DPNNDPHVGGNTWRGGTGGRDTAGLGGRGGFERLYKGHKIHQIPKELKEEVPDHIRAE
                     ARKMAEQALADKLAEDRLDRDEAQFMRRIKANVEGQVLHLANVLNGLTANEHERRWLV
                     RQQEGQLDERRLTEGLVGERAIFKRRSEAPPEVGAPQMKPKRIRIVLDASASMYHMQF
                     DGRLSRELETCLMIMEAMQRVDPTRFEFDIVAHSGDQVVIPLVKLGATPKNDGDRFRI
                     LRDIVAYTQYCMSGDHTVECITQSIKDVRDREADDYFVIALSDANLSRYGITPEILGR
                     ALKRDEKVKAAVIFIDRGGVEAGSVARALPGRAFVAEDTKDIPRVLSDILTSLIQS"
     gene            <407163..>411740
                     /locus_tag="MRET_1849"
                     /note="MRES_07370"
                     /db_xref="GeneID:38738615"
     mRNA            <407163..>411740
                     /locus_tag="MRET_1849"
                     /product="regulatory associated protein of mTOR"
                     /transcript_id="XM_027628476.1"
                     /db_xref="GeneID:38738615"
     CDS             407163..411740
                     /locus_tag="MRET_1849"
                     /codon_start=1
                     /product="regulatory associated protein of mTOR"
                     /protein_id="XP_027484240.1"
                     /db_xref="GeneID:38738615"
                     /translation="MVETPPHDPLTEANVQKLEAATMPVRVRSAARDGDEQEADEAAG
                     PRHGALLQPEAEDWVVLELPYMTHWSNKRHATNGIPRPRRAEDLPDWRMRERLRTVTA
                     ALVMCLNIGVDPPDVSKTNPCSKLICWMDPESLDPTKALPAIGRNLQVQFETLSMKTR
                     YKQYLDPIVEETKRFCTNLRRTAKDERVLFYYNGYGVPKPTPGGEIWVFNKAYTQYIP
                     LTLYDLQTWLGHPCIYVWDTSAAGHIVANFRRLAELRAEDEVKLAAAEGREPPPIPSS
                     DGIFTDAAGEPQFPLRDSIHLAACGPDEVLPMNPDLPADLFTCCLTSPIEISLRWFVL
                     QNPLPSPLNVDMVMNIPGQLQDRRTPLGELNWTLTAVTDTIAWTVLPRALFRRFFRDD
                     LMVAALLRNYLLAERIMRFYHCTPVSHPRLPPTHNHPLWDSWDLAVDQCLSQLPTLLA
                     KEQARAEAENHGTPMPPHLAAFEYQHSTFFSEQLKAFEVWLSQGDVSRRPPRWRVQRH
                     SVVRLYGDDSAHPLDAGGDVNDDTDPDVRVQHDPPSQLPIVLQVLLSQVHRLRALILL
                     SQFLDLGPWAVNLALSIGIFPYVLKLLQSPAADLKPVLIYIWARILAVDQSCQVDLLR
                     DNGYMYFASVLSPFQPNHVPGAAHGGQTLPIPNVSEHCAMCAFILAVFCRDFPLGQDA
                     CLETDVMDACLEHLEDDDYLLRQWSALCLAQLWDNNDVGKARAIAKDAHGKLCCLLSD
                     ASPEVRASILYALGVLLGTSGSMTIDVAHPTAAEQHRRRERTHGTARPPCVCTGALTG
                     LTPVRQRNLEVGIAVAILASGSDCSPLVRRELVIVLSALVHYYHGFFVLAAYLYYMRE
                     SSVHDSSDAPNMSTKTEERIAQEETLLAAVFEGVLQRGHAVEPSDIAHVPAFVTLFVA
                     LLDLSVDPHPHVANLAGTVVDQIMSALLEHGSLHAANSVMRHQSLEQLSRPHAFPTAE
                     GPTRAPVAAANPPREGPVRRTSASALSRTIRAISSMTGSPAPTYAPTHAEPTQPGMAA
                     PKQPPHSRNTCAYLPPYDHATPQPVVADATASSRREVRIEDVLAECIASDLHRLNVRR
                     HDDGLTTAWLGRVRERLPLKSSFFEWCSEYFTEPQMKSTEADEPGSSQYNRHMWRRQR
                     CERHIAEAMEQVDDAGDVRWSKRVAVLTMPAPVRMFMFHEYDPHLVGVTEQDTLCVWD
                     WEDHRLLSSFRHGPQPHGPITSLAFINEEVEALLLTASADGNVHLFRRYDRAVPELVS
                     AFRALPDLLRSRYPSGVRVNWQQVNGRLLTAGDSRLVRLWDAHRELCIADVPTHVNAC
                     ATSLTSDADIGHLFMVGFGDGSLGVYDQRHPPASSLVQLWDEHHAWVQNVHLQKHGRR
                     ELVSASVDGALRVWDIRARASILQSRVPTDHASLSDMAVHDRIPVLATTSSPHTAGPT
                     IVHTTQLYSLHDLSPMGRPFYRALHSTAFSSSSMTVSASAAHAIRPVYERLAPLSPYS
                     PSTSTVAFHPHSPVMAFGGPDHIVEIRRYSQ"
     gene            complement(<411732..>414920)
                     /locus_tag="MRET_1850"
                     /note="MRES_07375"
                     /db_xref="GeneID:38738616"
     mRNA            complement(<411732..>414920)
                     /locus_tag="MRET_1850"
                     /product="importin-9"
                     /transcript_id="XM_027628477.1"
                     /db_xref="GeneID:38738616"
     CDS             complement(411732..414920)
                     /locus_tag="MRET_1850"
                     /codon_start=1
                     /product="importin-9"
                     /protein_id="XP_027484188.1"
                     /db_xref="GeneID:38738616"
                     /translation="MDTLVARLQDTLSSDQATRDAAEQYLAHETLPKSGTDDVLGVQL
                     AQILSEASLSLFVRQAAAIALKKYVRKRWSIFFDTFTQDMVVNGIVQTVDATPVEAKE
                     HIRTSLLACLCDAEPKVRSQASDILSLISSCDFPDHFPQLLPTLQGYLHSYTEQDAHA
                     AYKVHGAMKFLLDLVHVELDENQLLMVAQQLVPLLQGIVSSSSDWITPHTRARCINVF
                     HQCLISLYMAKDTYVDTVHMVTTHYLPPWLQGMQVLMSPDFFNSANWQEPVTWEMLGL
                     RHEIVAFLGTASHFRNIFQEYAPTLLRLVIAQLQAMVPLFIECHMLDNISFPSSVEAD
                     ADVACSVSMLAESCFTFLTRQSRAAAMRDVCVQGGVGGDGAATDTLHTLLVLMRTYAQ
                     VTNEDVETWEADLNAYVEQDDAENVLAGLRPAISDLLENMLDSFPLPVLRQLRVCVDG
                     ISTAQAHAKDAWWVPIEAQLWLIGASHEAVDDILLDRDDADLLSIPRMLELLVLPHLS
                     MQAPIYLCGRCFVFASQYVQALPQDVARRIFVAAVDVVRMPDASLPLKLSAVRAICNI
                     KMDRAEATGSDDAAVLEHFTTLLPVATHSTLVLLLDTLEAFIPRDKSSSLSLDVLQRM
                     TEAILLSWRHHMSDPAIELSISYVLESLLKCPVPGCPAQTLYMSMQAFAPCLSVDVEL
                     GVAPSAAAMIRSVFRVADAEMLRDVVSFAFPAVASYMLVGEDVEALQSLMQSLAILCE
                     KCPHDILGWHDEHDTPSLQILLRIIERLLCMDEQVCGQAFGKFLVALFAQAGSMLAPV
                     MPALLHALVAKLAQATMPDCTLTLLYALAYLMAHHAEAVVAQLAATELEGGESALVTF
                     VRRWLADVLYTTTPDMLQEHMTALMQLFQHWTPSLQHLFVDGDVLPAPDHVIMTRSRT
                     KAYQQYEQIPASTKVLKLLLQEYATSRKLLDEAHARDVQAKAPLEEQLDHDEWSDEDD
                     VDLGLDINWADFQDEEEEGDVMDEADVREALRAVGIADVPSGIRTRRDVDRVRRTHCL
                     AQFLRSLDARVPYVGEAVSHLNATERACLSSL"
     gene            <415454..>416908
                     /locus_tag="MRET_1851"
                     /note="MRES_07380"
                     /db_xref="GeneID:38738617"
     mRNA            <415454..>416908
                     /locus_tag="MRET_1851"
                     /product="zinc finger protein, C3H1 type"
                     /transcript_id="XM_027628478.1"
                     /db_xref="GeneID:38738617"
     CDS             415454..416908
                     /locus_tag="MRET_1851"
                     /codon_start=1
                     /product="zinc finger protein, C3H1 type"
                     /protein_id="XP_027484187.1"
                     /db_xref="GeneID:38738617"
                     /translation="MSFNIFQACEHGDVNAVRTLLDEQPDLVHAVDASNNTPLTQALQ
                     RGNVDIVRELITRHADPRKAQVTVAQTEQNAEAFALVREASLRADTMIANQSKPSAEA
                     PASSENNNAPPANLPPPEIARMIPCKFFPNCRYGERCIFQHPVSVPLNAQDGTFLPTP
                     PGMFFAAPNGMPLQPPPNLYGVPAPYMDMSHPMFQVPFGPNGVPMYPAPINAMPGATE
                     TNGVADSVKHSFQDAEAQSQSQPDDQAMGGTTDTATQTIQSNKKAGKTTRHDSTQRGR
                     PNGVRPSCAFFARSACRYSNECRFPHVLPDGTDARNIPSDQDARLNKNTARRTNQSSD
                     RRNSDGEGSSSGSMTPQTKKGNNARRPSNANHVRGKGSRRSTAQPSQASRKTPAQRVP
                     NSDEFPALPGGTPSEPTAVQNKSYKANFSAILSAPAPPKPAKAPSTDNQSKPSPSQTT
                     AEEPEMEQNNGTNPTISTRDFAAVAAAQPNAVTA"
     gene            <417261..>418599
                     /locus_tag="MRET_1852"
                     /db_xref="GeneID:38738618"
     mRNA            join(<417261..417601,417627..>418599)
                     /locus_tag="MRET_1852"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628479.1"
                     /db_xref="GeneID:38738618"
     CDS             join(417261..417601,417627..418599)
                     /locus_tag="MRET_1852"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484190.1"
                     /db_xref="GeneID:38738618"
                     /translation="MTCRPHLILPLGIPHLRNTRQSQSGSMPSLDTHNNNLRNANAAT
                     ETFSGHTRRLSRCKSDSEMIRQVYRSNACLSTRLIAARSLSSKCTSPEENLCLDKSTP
                     HTWSTFTMFVAGLPRGIPPSASLQRSLVQFLSQWAPVESVKLITYSSNGQLKCVFADF
                     ANEDDATKALKGVQTSIFYHMHLRLEPARGDRTLRFTMYDANMPYINVSYIWIQTNTS
                     KMARMYQPKRAQDFPHAALTKKLLFDLASLFGGIDLVKEKTTERKPCFDVVFQHRDAA
                     YSALRQLSAHAPMSNLCVRWCMSDIAHAYGPMPDNCVAEETQHTYVHQSLPYLNYHGP
                     VWTPIYPEASSGGVLTLSNKQNMVPKSSIDQKQTSGLPHKLDCILHSSNPFTVHVSTL
                     GSKTSVTKLCDIFGQFGPLHMVTIMAKGQASVTYGSSSVFTDCQF"
     gene            complement(<418700..>419083)
                     /locus_tag="MRET_1853"
                     /note="MRES_07385"
                     /db_xref="GeneID:38738619"
     mRNA            complement(join(<418700..418723,418751..>419083))
                     /locus_tag="MRET_1853"
                     /product="BolA-like protein 3"
                     /transcript_id="XM_027628480.1"
                     /db_xref="GeneID:38738619"
     CDS             complement(join(418700..418723,418751..419083))
                     /locus_tag="MRET_1853"
                     /codon_start=1
                     /product="BolA-like protein 3"
                     /protein_id="XP_027484189.1"
                     /db_xref="GeneID:38738619"
                     /translation="MNLLRVTQAAGLPHQRMVMAQRSINQLRHISQTSARHDASTPAE
                     KQDKIIRTLTEKFTPSDLQVQDISGGCGSFFAIMLKSKEFKGKSTIQAHRMVNKEIKD
                     VIQDIHGLQLKTIADN"
     gene            complement(<419202..>420431)
                     /locus_tag="MRET_1854"
                     /db_xref="GeneID:38738620"
     mRNA            complement(<419202..>420431)
                     /locus_tag="MRET_1854"
                     /product="cell division cycle 2-like protein"
                     /transcript_id="XM_027628481.1"
                     /db_xref="GeneID:38738620"
     CDS             complement(419202..420431)
                     /locus_tag="MRET_1854"
                     /codon_start=1
                     /product="cell division cycle 2-like protein"
                     /protein_id="XP_027484184.1"
                     /db_xref="GeneID:38738620"
                     /translation="MDDDAHAQSDKEQSAVKRKKQRLDIHEAKVRESARISLENKRRS
                     TSSQIQHEERYERSSRHLAAPARSDHPCIEGCGSVSSYEVLNRIEEGSYGVVSRARHK
                     ETGEIVALKQLKLDKEVYGFPITSLREIRTLFQARHPHIVEIKEIVVGDTLSQVYLVM
                     EFVENDLKTILSTMRTRFLPSEIKTLMRQILSAVASMHSHWIVHRDLKTSNLLMTNRG
                     RMKIADFGLARMFGDPLREMTSLVVTLWYRAPELLLGTKIYDTAVDMWSVGCIFAELL
                     LKEPLFPGKNETDQLSRIIRLLGLPTESTWPGYTKFAKAHLKHSVHIQNNIRHHFRHF
                     SKATIDLLKSMLCYDPSKRISADEALEHPYFHEPPVPAHPDTFGSFPSSAAGEKQRRK
                     SPPAPHGAHTHTAHPLV"
     gene            complement(<420511..>421941)
                     /locus_tag="MRET_1855"
                     /note="MRES_07390"
                     /db_xref="GeneID:38738621"
     mRNA            complement(<420511..>421941)
                     /locus_tag="MRET_1855"
                     /product="sterol-4alpha-carboxylate 3-dehydrogenase
                     (decarboxylating)"
                     /transcript_id="XM_027628482.1"
                     /db_xref="GeneID:38738621"
     CDS             complement(420511..421941)
                     /locus_tag="MRET_1855"
                     /codon_start=1
                     /product="sterol-4alpha-carboxylate 3-dehydrogenase
                     (decarboxylating)"
                     /protein_id="XP_027484183.1"
                     /db_xref="GeneID:38738621"
                     /translation="MSNSAPTHELHFVIGGAGFLGSHILEALVARGETAVASFDIREP
                     TERVPNVHYYEGDLTQAESLTKAITDAQEDTRTAGIEGRSVAVYHTASPVAGLGPDVY
                     EKVNVLGTEVVIEVCKEPKNGVAKLIFTSSAGVVFNGYDLKFIDERVGYPETPLDAYN
                     DTKARAEKLVLEANHHENGLKTVALRPAGIFGPRDRQALPGFFKVLENKRTRWQIGKN
                     LNLFDWTYVGNVAHAHLLASDCLGVKGPEPRPESKFLTSELSDEHLPLKMGASDLEDA
                     RDVPTSLQRQDVSKPAEDYCRNVKPLIDLSGVDAVNQRPVFRNRFDQFFHHAYPNVAC
                     GGNPMPKLSSYAKSELYADGEAFFITNGQPIPFWDFPRALWYHYNGHVDKPEHIIVLS
                     LMFALFLAFLAEIFSKLTGRPVQFTRYRVTYTACDRYYNIEKARRILGYEPIYGLEDS
                     IKRSVKWWKTLHPPTKSIPGETAKTK"
     gene            <422103..>422704
                     /locus_tag="MRET_1856"
                     /note="MRES_07395"
                     /db_xref="GeneID:38738622"
     mRNA            join(<422103..422107,422139..422199,422227..422379,
                     422406..422473,422500..>422704)
                     /locus_tag="MRET_1856"
                     /product="zinc finger protein"
                     /transcript_id="XM_027628483.1"
                     /db_xref="GeneID:38738622"
     CDS             join(422103..422107,422139..422199,422227..422379,
                     422406..422473,422500..422704)
                     /locus_tag="MRET_1856"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_027484713.1"
                     /db_xref="GeneID:38738622"
                     /translation="MCKHILNAQVAIRAPCCRKFFDCPQCHAETQSHPLVKTMELAFL
                     CKNCRRAFRKDMAQYEQEDEYCPHCDNHYVIEAKTPQLMLSVEGEDGRVDASIMRDDR
                     VREREAFGSDGTKIDQGGYQAAALAFQRKLAEGGAGSAGPSYAGAHMPNLADFDDDEL
                     DWD"
     gene            complement(<422819..>423228)
                     /locus_tag="MRET_1857"
                     /note="MRES_07400"
                     /db_xref="GeneID:38738623"
     mRNA            complement(join(<422819..422865,422896..422914,
                     422949..423021,423050..>423228))
                     /locus_tag="MRET_1857"
                     /product="diazepam-binding inhibitor (GABA receptor
                     modulator, acyl-CoA-binding protein)"
                     /transcript_id="XM_027628484.1"
                     /db_xref="GeneID:38738623"
     CDS             complement(join(422819..422865,422896..422914,
                     422949..423021,423050..423228))
                     /locus_tag="MRET_1857"
                     /codon_start=1
                     /product="diazepam-binding inhibitor (GABA receptor
                     modulator, acyl-CoA-binding protein)"
                     /protein_id="XP_027484137.1"
                     /db_xref="GeneID:38738623"
                     /translation="MSDAQFQKAVEVIRTMPKNSSIKVTQTQQLKFYSLFKQANDGDC
                     NTQRPGMLDFAGRAKWDAWNSLKGKSKEDAKKEYVEAFLEVFEPAKDDAEVSKYLEAV
                     KNA"
     gene            <423442..>424368
                     /locus_tag="MRET_1858"
                     /note="MRES_07405"
                     /db_xref="GeneID:38738624"
     mRNA            <423442..>424368
                     /locus_tag="MRET_1858"
                     /product="oligosaccharyltransferase complex subunit delta
                     (ribophorin II)"
                     /transcript_id="XM_027628485.1"
                     /db_xref="GeneID:38738624"
     CDS             423442..424368
                     /locus_tag="MRET_1858"
                     /codon_start=1
                     /product="oligosaccharyltransferase complex subunit delta
                     (ribophorin II)"
                     /protein_id="XP_027484171.1"
                     /db_xref="GeneID:38738624"
                     /translation="MMLVAHSLWLLCAVMAMSVAALSYDTKDLRLSVTSFDGGSRLKK
                     SFASARDLPAEPETLTMEPDDVIKLAFFASLSSGEKATGESLPHQAWVVMDDEDASRT
                     SIWPLQVRGSSSSASWSLRVDRLSPNLKRKMVEAGPNHPFRLTLILASFAKDPQSTID
                     PLTLPLLDVQFSQSMLSRFESQKVPSARYEAELADGFHPQPFHQHTFQVEPWQTMPPK
                     AVSLGYALIVLAAPWSILLALWRPLFSKTVTLSRSASTLLACVWITEVLAFLHWVSVP
                     VWVVFPAAGATLVAAMLGGRSALSQSWIRTSA"
     gene            <424488..>426242
                     /locus_tag="MRET_1859"
                     /note="MRES_07410"
                     /db_xref="GeneID:38738625"
     mRNA            <424488..>426242
                     /locus_tag="MRET_1859"
                     /product="transcriptional activator SPT8"
                     /transcript_id="XM_027628486.1"
                     /db_xref="GeneID:38738625"
     CDS             424488..426242
                     /locus_tag="MRET_1859"
                     /codon_start=1
                     /product="transcriptional activator SPT8"
                     /protein_id="XP_027484170.1"
                     /db_xref="GeneID:38738625"
                     /translation="MDQPPDSHGSDQEGKNDAISAYPEMHTMEEYIQAVKSRHAHFHP
                     SEEARHTRKGYVIDPVGAALHGAHIHAMSISKDSSILLSGGSDGYIRWYDLPASMNGN
                     NMLTQNLRNSFVEGVTKVGVLMTWWGHSHLERGADPDTSAAEAPLSAVHSLACQREAL
                     WGVSGGESGTINLWGLRHGAGSIRHVLHKHTDAVSALQLDPSEEHLISGGWDRGVYQW
                     DLNTGQIVRSFDGHTGQVSNIAFRPLYVPGEQPIPDAALYPSAPEAMDVDAIDDDLEQ
                     ELNRTLSEQAPDDAQHDTDAEGDNDSLFGGERDGPTSDSHAPDQDAEGDTDNDDADEK
                     PFAGRHDTPRLADTKSTGASISLPGQPSKSEPTSDVRAPEPKSHLPKPLFGSMNTSWH
                     YDADLRDFSQDILLTSTLSGQVMLWDRRVDTKSKHGVRALGLPHGTPPWCTGTCWNHT
                     GDKIYVGRRNELVEEWDVRMLPDITSNPGSRSQNGAAPAYLRALRLPRGSGPVSSVAV
                     MPNNRHIVCGSFDNVRLWDLEATGQVPFKIVAGHHGGMISHILMDPCARFLMTGSGDR
                     GWFASSTETLLMHEISAL"
     gene            complement(<426237..>427205)
                     /locus_tag="MRET_1860"
                     /note="MRES_07415"
                     /db_xref="GeneID:38738626"
     mRNA            complement(<426237..>427205)
                     /locus_tag="MRET_1860"
                     /product="tRNAThr (cytosine32-N3)-methyltransferase"
                     /transcript_id="XM_027628487.1"
                     /db_xref="GeneID:38738626"
     CDS             complement(426237..427205)
                     /locus_tag="MRET_1860"
                     /codon_start=1
                     /product="tRNAThr (cytosine32-N3)-methyltransferase"
                     /protein_id="XP_027484503.1"
                     /db_xref="GeneID:38738626"
                     /translation="MHPIKATSSVVPVDDTACDHTFGSRTLNEDDDVWSHNAWDHVVP
                     PQEHSNMVEELLAKQAASRVSHEDAAVYHANPAAYWDTFYSRHENRFFKDRKWLRLEF
                     PELIQATQPDAPPTTIVEMGCGAGNTVFPLLSMNQNPALRLVACDYAPQAVQVVRNHP
                     LYQNQQTCEAHVYDLSAGARGEVERLPPNVQPGSVDVVVLVFVLSALHPDEWKAAAEN
                     VYRMLKPSGLVLLRDYGRHDLPQLRFKKNRMLEDNFYVRGDGTRVYFFTPEELLHIFD
                     AAPRGTHTHERFATQQMAIDRRLLVNRKERKQMYRVWMQAKFQKAS"
     gene            <427313..>428455
                     /locus_tag="MRET_1861"
                     /note="MRES_07420"
                     /db_xref="GeneID:38738627"
     mRNA            <427313..>428455
                     /locus_tag="MRET_1861"
                     /product="threonine aldolase"
                     /transcript_id="XM_027628488.1"
                     /db_xref="GeneID:38738627"
     CDS             427313..428455
                     /locus_tag="MRET_1861"
                     /codon_start=1
                     /product="threonine aldolase"
                     /protein_id="XP_027484505.1"
                     /db_xref="GeneID:38738627"
                     /translation="MYRSLFSAPVPRYHADESDPVETAPMIDAPPMPTDDERQRAYAQ
                     VSWNVISDTVTLPSALMRTSMASAVCGDEGYRTDQPTLRLEDAVAQLTGKEAALFLPS
                     GTQANQLALHVHTRPTLVPVSILCDVRSHIHTSEMGGIAYHSRATTVPVIPHNTHHLT
                     LEDIAPFCESQDPYMPTHVHVISLENTLQGTIFPQSEIERISAFAHERGIIMHLDGAR
                     LWNAWAETGISLADLCRPFDTVSLCLSKGIGAPVGSILVGPTDTLFAVRLHRKLFGGM
                     MRQTGVLAAAAHAALHENMPRLRQTHSLARRVAARLQDCGVTITLPVETNMVFFDVTS
                     AGIDGETLRQRAAALDPPIQMGTHRIVIHYLTHHDLPERLACLFAT"
     gene            complement(<428452..>431379)
                     /locus_tag="MRET_1862"
                     /note="MRES_07425"
                     /db_xref="GeneID:38738628"
     mRNA            complement(<428452..>431379)
                     /locus_tag="MRET_1862"
                     /product="26S proteasome regulatory subunit N2"
                     /transcript_id="XM_027628489.1"
                     /db_xref="GeneID:38738628"
     CDS             complement(428452..431379)
                     /locus_tag="MRET_1862"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit N2"
                     /protein_id="XP_027484513.1"
                     /db_xref="GeneID:38738628"
                     /translation="MAAPLTSVAGMMALLDEKDVKLQEYALQKLNTLVDRFWAELADS
                     LARLEELYEDEAFQQRHLAALVVSKIYFYLGEFDEALSFALGAESLFDVDQRNEYVET
                     LVSKAIDQYVVQRSTPGSPEINANITSIINKMITRCIEDRQYHQVLGIALEAQRLDVI
                     EHVFSTTQDKTLLTYVLEMAMGVVNAVEVRRQVLQLLVKLFLSLDEPDYFSTAQCYVY
                     LNEPQPTSELLRTLLQRSDKDDRAVLVAYQTAFDLVESATQDFLHHVRSELEKMKFDQ
                     EAPKQQVISILSGTETIRLYRDFLHDANNADLMILKNTKDALDAHYSAYHSAVSLSNA
                     FMLAGTGSDQFLRENLDWLAKASNWSKFTATAALGVLHRGSLTEGLDILRPYLPPENN
                     APSSSVYSEGGSLFALGLIHTNHGEPILELLTKTLRTNTAEVVQHGAALGLGAAGMAT
                     ENEEVYEELRTVLFSDSAVSGEAAGYAMGLVYLGTGSAQATEEMLQYAQETQHEKIIR
                     GLAIGIALLHYGRESAASETIDALLTHKDATLRYGGVYTMALAYAGTGHHASVSRLLH
                     LAVSDGSDDVRRASVIAIGFLFFRSPEHVPELVELLSESYNPHLRYGAAMALGLACAG
                     TGLDSAIDLLEPLTKDTVDYVRQAACMALAMILIQQNEQLNPRVQVARTTFDKIISDR
                     HEEAMAKFGASIAQGLIDAGGRNATIGLRGRGGSSNTSAIVGMALFTQYWYWFPMAHF
                     ASLAFTPTAMIGVTKSLELPALEFVSHAPPSLFAYPPHLQGPSEKKPEKVETAVLSTT
                     AKSQARQRTKEKKKAAADSMDTDEALKPEEEEPVQDKPQETAKEQPKEEHLPNGSRVT
                     PFQLKYVTLPPEARYTALRPLAKQTLHDLSSARELDMSATASRGGILMLYDRDPSAPF
                     VPAKPKPKEDEAMDHEAAAKALAATSDDDNNKAQTSVKRDDDNEKQEAPSTQDVEMDE
                     QAH"
     gene            <431521..>431936
                     /locus_tag="MRET_1863"
                     /note="MRES_07430"
                     /db_xref="GeneID:38738629"
     mRNA            join(<431521..431548,431577..431667,431692..431824,
                     431853..>431936)
                     /locus_tag="MRET_1863"
                     /product="prefoldin subunit 2"
                     /transcript_id="XM_027628490.1"
                     /db_xref="GeneID:38738629"
     CDS             join(431521..431548,431577..431667,431692..431824,
                     431853..431936)
                     /locus_tag="MRET_1863"
                     /codon_start=1
                     /product="prefoldin subunit 2"
                     /protein_id="XP_027484517.1"
                     /db_xref="GeneID:38738629"
                     /translation="MSAPGGIDGEKTAKIQQRRNELQTIVEKIGEIESDADEHRLVVK
                     TLAEVYEREPERTCFRLVGGVLVERTVKDVLSTLQTTMDGLTKVLLELVKQYKLKEKE
                     LLDFQRDIE"
     gene            complement(<431998..>432290)
                     /locus_tag="MRET_1864"
                     /db_xref="GeneID:38738630"
     mRNA            complement(join(<431998..432027,432056..432225,
                     432257..>432290))
                     /locus_tag="MRET_1864"
                     /product="NADH-ubiquinone oxidoreductase 12 kda subunit"
                     /transcript_id="XM_027628491.1"
                     /db_xref="GeneID:38738630"
     CDS             complement(join(431998..432027,432056..432225,
                     432257..432290))
                     /locus_tag="MRET_1864"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase 12 kda subunit"
                     /protein_id="XP_027484499.1"
                     /db_xref="GeneID:38738630"
                     /translation="MSLNLTPESTAATRQKNEEAIREEWIKVMQVRLVHDELQKCHRA
                     EGENHYQVCGPIARVYKDLLKEAKVKGYRSIDA"
     gene            <432408..>433361
                     /locus_tag="MRET_1865"
                     /note="MRES_07440"
                     /db_xref="GeneID:38738631"
     mRNA            <432408..>433361
                     /locus_tag="MRET_1865"
                     /product="tRNA (guanine-N7-)-methyltransferase"
                     /transcript_id="XM_027628492.1"
                     /db_xref="GeneID:38738631"
     CDS             432408..433361
                     /locus_tag="MRET_1865"
                     /codon_start=1
                     /product="tRNA (guanine-N7-)-methyltransferase"
                     /protein_id="XP_027484500.1"
                     /db_xref="GeneID:38738631"
                     /translation="MGKRKRSGRDASPSVLRQQEATHPNVISGRVVIPQKRWYRQRAH
                     ANPFSDHSLMYPAQPSDMDWSIHFPEMCARDAPVQKKVEFADVGCGFGGLLMRLAPLF
                     PDTLMLGMEIRAQVTQYVHDKIHALRLAHKQAKTMSEEGKLELEAEVQPAADAQDEDS
                     EERRQNEYLVKQAGHVAGGYQNIGVIRTNAMKFLPNFFEQGQLTKIFFLFPDPHFKAR
                     KHKARIISPTLLAEYAYVLRPGGIVYTVTDVRDLHEWMVKHLTDFPLFERIPDDALKQ
                     DPCVDAVMYSTEEGRKVERNEGDKFFAAFVRRDDPPVGEES"
     gene            complement(<433390..>434322)
                     /locus_tag="MRET_1866"
                     /note="MRES_07445"
                     /db_xref="GeneID:38738632"
     mRNA            complement(join(<433390..434181,434209..>434322))
                     /locus_tag="MRET_1866"
                     /product="translation initiation factor 3 subunit F"
                     /transcript_id="XM_027628493.1"
                     /db_xref="GeneID:38738632"
     CDS             complement(join(433390..434181,434209..434322))
                     /locus_tag="MRET_1866"
                     /codon_start=1
                     /product="translation initiation factor 3 subunit F"
                     /protein_id="XP_027484501.1"
                     /db_xref="GeneID:38738632"
                     /translation="MTAGLDTFAAPSALHLNFPPAASGVFHSRSIACVKVHPVALFSI
                     LDHFLRRDASQPRVVGTLLGTRSESEVEIRNAFAVPHSESQDPWQIHLDAEHHRRMLD
                     LHLRVRPEEVVIGWYSTNTELNSNSALIQDHYSRETAPHQAIHLTLNTNVADEFQGLG
                     VQCYVSSLLGATVKPEDCAFLSLPTKLLSSTPEQTALRHLSSSSSQNLTDLDALRASL
                     QEVHAKLDRVLTYVRQVLAGEIEGDKAVGRYLSDTIGVVPAGLDEPVLESLFQTHLQD
                     VFMVSYLSKIVSTQAEMSSRLSLLT"
     gene            <434447..>434663
                     /locus_tag="MRET_1867"
                     /db_xref="GeneID:38738633"
     mRNA            join(<434447..434470,434501..434613,434642..>434663)
                     /locus_tag="MRET_1867"
                     /product="mitochondrial import receptor subunit TOM7"
                     /transcript_id="XM_027628494.1"
                     /db_xref="GeneID:38738633"
     CDS             join(434447..434470,434501..434613,434642..434663)
                     /locus_tag="MRET_1867"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit TOM7"
                     /protein_id="XP_027484502.1"
                     /db_xref="GeneID:38738633"
                     /translation="MALSEDTKERIVRLVDITKTIVHYGWVPFVIYVGFMSSQPRPNL
                     LKILSPLS"
     gene            complement(<434631..>435361)
                     /locus_tag="MRET_1868"
                     /note="MRES_07450"
                     /db_xref="GeneID:38738634"
     mRNA            complement(join(<434631..434925,434952..>435361))
                     /locus_tag="MRET_1868"
                     /product="N-alpha-acetyltransferase 40"
                     /transcript_id="XM_027628495.1"
                     /db_xref="GeneID:38738634"
     CDS             complement(join(434631..434925,434952..435361))
                     /locus_tag="MRET_1868"
                     /codon_start=1
                     /product="N-alpha-acetyltransferase 40"
                     /protein_id="XP_027484262.1"
                     /db_xref="GeneID:38738634"
                     /translation="MAAAQRLVRQAQQLRSAQLQACVSASPSTRMIVATASELSRDMH
                     ERIFAILEANMRGMYEGLDGWDASFKRMELHHPKSRYLLALHGDDVHHRRSRRIHGRA
                     RGPVLQGFVMWRYDTDDTTPDDPFSEGIVAPVAYCYELQVADAWQGRGIGAHLLQTLE
                     RLAWHAHMRKTMLTVFYINQRARSFYASHGYVTDATSPSNDDGERHHYVILCKPHPDL
                     VDKRVELRQRAENSDA"
     gene            <435455..>436927
                     /locus_tag="MRET_1869"
                     /note="MRES_07455"
                     /db_xref="GeneID:38738635"
     mRNA            <435455..>436927
                     /locus_tag="MRET_1869"
                     /product="calcium/calmodulin-dependent protein kinase
                     kinase 2"
                     /transcript_id="XM_027628496.1"
                     /db_xref="GeneID:38738635"
     CDS             435455..436927
                     /locus_tag="MRET_1869"
                     /codon_start=1
                     /product="calcium/calmodulin-dependent protein kinase
                     kinase 2"
                     /protein_id="XP_027484263.1"
                     /db_xref="GeneID:38738635"
                     /translation="MPVASIPHGQREEPDSAVRRSLPPPPVSLVPSTPMTPRKVSHHR
                     RHSSSSSGLRQVRESLHAMSVQLSDGSRKINQYRFLRCLGHGTFATVHLGEFTNEEGQ
                     LQLVAIKEFDKRRLRKKRHHDLPLHMRRNMRAMDAEDPLYLVRTEVAILKKMSHPHVV
                     QLYEALDDPENDKLFLVFEYCAGGPLCHIEPGRQGERLAEDKARLYFRQILSGLEYMH
                     ANGIMHRDIKPDNILMSNELVCKISDFGVSKMIWESGSDLVHQSVGTPAFMSPELCHI
                     GAVESHGYSDDVWALGITLYALLMGRLPFYRDDLFELYEAIQHDELCLKDCRASPACQ
                     DLLRSMLDKAEPNRICVPDMFKHPWVTDHGRDPMPPLTLTDDKAIDQVTEEDLHDAVF
                     RISSMFAVACAVSKFKRAGSRHSSTSTLDGTESSEPTPLDSRKLSMDTPPLSDTSGAA
                     AIPLVLSPVATMDAFHDSDCQEPEIYVSSPKAKHTNEQIP"
     gene            complement(<436947..>437465)
                     /locus_tag="MRET_1870"
                     /note="MRES_07460"
                     /db_xref="GeneID:38738636"
     mRNA            complement(join(<436947..436967,437002..437297,
                     437327..>437465))
                     /locus_tag="MRET_1870"
                     /product="putative transcription factor"
                     /transcript_id="XM_027628497.1"
                     /db_xref="GeneID:38738636"
     CDS             complement(join(436947..436967,437002..437297,
                     437327..437465))
                     /locus_tag="MRET_1870"
                     /codon_start=1
                     /product="putative transcription factor"
                     /protein_id="XP_027484553.1"
                     /db_xref="GeneID:38738636"
                     /translation="MSAWDQTVVIGRKARPGGSGGGGGPRGPTALERAKQVGAVTAND
                     RKVAAGHNKGHQGTDHQRIAKLDRSDDVAPPPRVPPSVGKIIGQTRQAKSMTQKDLAV
                     RINEKPSVIQEYESGKAIPHAQILSKMERVLGVKLRGKDIGNPLGGPKK"
     gene            complement(<437577..>438680)
                     /locus_tag="MRET_1871"
                     /db_xref="GeneID:38738637"
     mRNA            complement(<437577..>438680)
                     /locus_tag="MRET_1871"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628498.1"
                     /db_xref="GeneID:38738637"
     CDS             complement(437577..438680)
                     /locus_tag="MRET_1871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484550.1"
                     /db_xref="GeneID:38738637"
                     /translation="MCKRDGVRTPGGHGASRRRNSKNRLKYSPDPLCLLQSPSRGVDD
                     PVNLLQRDVQDQYWESIVRKIQEHADVYQDDELNLPCNNDEHGVRCRNNSLQELLLGI
                     RKLREGLVASHRMDHLTVQVYELTVFLSILCENQAQLASTVSRLVQEIYPAIPIGTAI
                     TEVQRLYIGRARTALKRYEGQTRDMIMCVWMLEPIYTRRPGHWQEYLERRMYIFQHAS
                     VKPNMSLTFAHRVFHALRRGMYQDLQQALCADEFAPCIWPRLLVLSLVPMVRLQHARV
                     LRKAYLQVPLSKEAVAMIQHTQNTGSVRNQASVEWLESIMLCQDQEPQEKARAILSCL
                     GTVLGYDTWDTTLEHLASRVRHSDGAYALAWRA"
     gene            complement(<438754..>439340)
                     /locus_tag="MRET_1872"
                     /note="MRES_07465"
                     /db_xref="GeneID:38738638"
     mRNA            complement(join(<438754..439089,439118..439139,
                     439168..>439340))
                     /locus_tag="MRET_1872"
                     /product="cell growth-regulating nucleolar protein"
                     /transcript_id="XM_027628499.1"
                     /db_xref="GeneID:38738638"
     CDS             complement(join(438754..439089,439118..439139,
                     439168..439340))
                     /locus_tag="MRET_1872"
                     /codon_start=1
                     /product="cell growth-regulating nucleolar protein"
                     /protein_id="XP_027484549.1"
                     /db_xref="GeneID:38738638"
                     /translation="MVSFVCDGCGDVVKKPKLQQHYNRCFSPVTCLDCSTQFGSPKEA
                     HSSCMTEDEKYQKSLFKGKKNQKNSQANPQPSQKPEHPVKRAAEDPQDSFDKRAKAEM
                     PMEQDTSSKSASKELSPALLKATVVHLAKANKAISLSDIIKYLTKEKGMNKKDVKNYM
                     LKKACIYLEQDRLIFA"
     gene            <440069..>441568
                     /locus_tag="MRET_1873"
                     /db_xref="GeneID:38738639"
     mRNA            <440069..>441568
                     /locus_tag="MRET_1873"
                     /product="G1 S-specific cyclin"
                     /transcript_id="XM_027628500.1"
                     /db_xref="GeneID:38738639"
     CDS             440069..441568
                     /locus_tag="MRET_1873"
                     /codon_start=1
                     /product="G1 S-specific cyclin"
                     /protein_id="XP_027484545.1"
                     /db_xref="GeneID:38738639"
                     /translation="MTQGLAGFSRFYSHSNRYSFYGRPLTSQGPVTSSTQQLPPNSTS
                     TATRVSSIPPGVTTTAASRTRQRHSTLMPIHSSQQMAPARTGTIRSRRQQPVPSDNIL
                     FEVEYQQEALEYMHVLEKHTMANVELMNMQPELHWFMRPYLVDFLIEIHQSFRLRPET
                     LYLTMNLVDRYVSRRIVYKRHYQLVGCAALLIAAKFEDAKDRVPTVQELSQMCCNAYD
                     PSAFTQMEGHVLSTLGWQLGHPTAESWLRYEYSCAPPSSPATHNVARFLLEVTLFHES
                     FLTLPPSSLAAGAMLFARHICRDSRPQPQPLDVLVTNVMTRIHNFIADHLNELSSILI
                     KKYSYSYYTEASTVVLDWFRKHLELKKAMEAIASPMHVEVCSSDDENESNRSNESVTS
                     IFSTPSRSITRDEDDDDNSMPLTPLSLHTAQDPSVYAVNMKNPVHVSRFAPSTAGPTG
                     RPVSTTITTNEKASVVTASWMSLAQLRPVAKHPKTARVEMESTIPESST"
     gene            complement(<441823..>442256)
                     /locus_tag="MRET_1874"
                     /db_xref="GeneID:38738640"
     mRNA            complement(join(<441823..441880,441979..>442256))
                     /locus_tag="MRET_1874"
                     /product="large subunit ribosomal protein L30e"
                     /transcript_id="XM_027628501.1"
                     /db_xref="GeneID:38738640"
     CDS             complement(join(441823..441880,441979..442256))
                     /locus_tag="MRET_1874"
                     /codon_start=1
                     /product="large subunit ribosomal protein L30e"
                     /protein_id="XP_027484573.1"
                     /db_xref="GeneID:38738640"
                     /translation="MAPQTKTKKSSQDNINSKLQLVMKSGKVSLGLKSALKNMRSGKA
                     KLVLISANTPPLRKSEIEYYAMLSKTGVHHYQGSNIALGTAAGKLFRVGVLTVLDAGD
                     SDLLSTMSA"
     gene            <442706..>443111
                     /locus_tag="MRET_1875"
                     /db_xref="GeneID:38738641"
     mRNA            join(<442706..442743,442837..442898,442942..>443111)
                     /locus_tag="MRET_1875"
                     /product="large subunit ribosomal protein L37e"
                     /transcript_id="XM_027628502.1"
                     /db_xref="GeneID:38738641"
     CDS             join(442706..442743,442837..442898,442942..443111)
                     /locus_tag="MRET_1875"
                     /codon_start=1
                     /product="large subunit ribosomal protein L37e"
                     /protein_id="XP_027484721.1"
                     /db_xref="GeneID:38738641"
                     /translation="MTKGTTSMGKRQHTKTHTLCRRCNRRSFHRQHKTCAACGYPSAK
                     TRNYQWGQKAIRRKTTGSGRMRYLKTVPRRAKNGFRTGTATPASA"
     gene            complement(<443595..>444283)
                     /locus_tag="MRET_1876"
                     /note="MRES_07470"
                     /db_xref="GeneID:38738642"
     mRNA            complement(join(<443595..443646,443687..443766,
                     443807..444145,444176..>444283))
                     /locus_tag="MRET_1876"
                     /product="large subunit ribosomal protein L9e"
                     /transcript_id="XM_027628503.1"
                     /db_xref="GeneID:38738642"
     CDS             complement(join(443595..443646,443687..443766,
                     443807..444145,444176..444283))
                     /locus_tag="MRET_1876"
                     /codon_start=1
                     /product="large subunit ribosomal protein L9e"
                     /protein_id="XP_027484715.1"
                     /db_xref="GeneID:38738642"
                     /translation="MLTIYKDLDLEIPANVTVELESRIVKVKGPRGELQKNLRHMAMD
                     LRLVKSPKGTKLKFVVWHASRKHLACLRTAKAAVANMIKGVTLGFQYKMRAVYAHFPI
                     NLILAGDSKSVEIRNFLGEKRVRRVEMADGVTIKDDKNQKDQVLVEGNDIDAVSQSAA
                     MLHGVTLVRNKDIRKFLDGIYCTDKTTVVQEL"
     gene            <444672..>446370
                     /locus_tag="MRET_1877"
                     /note="MRES_07475"
                     /db_xref="GeneID:38738643"
     mRNA            join(<444672..444992,445033..>446370)
                     /locus_tag="MRET_1877"
                     /product="pre-mRNA cleavage complex 2 protein Pcf11"
                     /transcript_id="XM_027628504.1"
                     /db_xref="GeneID:38738643"
     CDS             join(444672..444992,445033..446370)
                     /locus_tag="MRET_1877"
                     /codon_start=1
                     /product="pre-mRNA cleavage complex 2 protein Pcf11"
                     /protein_id="XP_027484555.1"
                     /db_xref="GeneID:38738643"
                     /translation="MYPRTYGYGQVRPEGYGYAGAFGPYSYGAYPQAPAMPQPNGVSA
                     YGMPVLPPDLSNPAVFESMYKSHLAQLTFNSKPIITNLTLIAQEHVHRMSTVVAKLVD
                     AHIMMAPPPLRLPALYLLDSICKNIGSPYTELWAPRASTLFMESYRVVDQPTRRRMEE
                     LLATWREAGPGGRPMLGDASQQAIERSLYGSQGAPVKAANAPNKSQVIADIERRMALC
                     TKDLANEPHNTRAREQNDVLRQLKEQVNGSDVSAELLGHIQKQLDEMSSASVPTVPAP
                     APTSAPAAPSASELIANLMKAGLLPSSATTTAAPTSVPSTQSQDKAYTDYIMSLDLRM
                     VTVNLSRPAPELEILMQEHLPHPCRQCANRYPEGEAGQHSLDDHLDWHFTQNRRARAS
                     IVRGQSRAWFDPASRWIRSGIDDVMPGASGAPGWEGEDAEFEQALRDKIANAYVPVPD
                     GSELASHTCRICKEPFQSEWSEDLEEWIWRNAVLIEGNHYHASCFYSAKSMSEVVHAA
                     RSTTNVKQGEEDDEDVQRKRKASSSPPLPPHKKPLAMLKEEPPP"
     gene            complement(<446390..>448471)
                     /locus_tag="MRET_1878"
                     /note="MRES_07480"
                     /db_xref="GeneID:38738644"
     mRNA            complement(<446390..>448471)
                     /locus_tag="MRET_1878"
                     /product="conserved oligomeric golgi complex subunit 3"
                     /transcript_id="XM_027628505.1"
                     /db_xref="GeneID:38738644"
     CDS             complement(446390..448471)
                     /locus_tag="MRET_1878"
                     /codon_start=1
                     /product="conserved oligomeric golgi complex subunit 3"
                     /protein_id="XP_027484789.1"
                     /db_xref="GeneID:38738644"
                     /translation="MASKAASHSLEEWFSDYAPLTDAQRLSVSELSAFISDDAESFAA
                     NTIARDDADLEPDSTPQSSLFCWMASKARGRELASRTNYEPMIEALRTSMKEVGALMD
                     GVCKAQDCMSQLRTGLTYVQDNSSELMKHASTMVQEQTNLEHLHEQIMQRLQNFSVLS
                     QTAPMLSDTADIQSPEFFGAVEHLCLALQSMDAHMNYKDAHVYRIRIENAFVRAMTLV
                     KLAFQRAGTKLVQDAPLDEIDARDPSSHDVQRVMYASFHVLHEKFHVHLETLAQQAPS
                     SEDVREMQREYDQLWMQWRVSLVQEYFSRTLKQLQDVDPLPQRLESAVDVAQALYVYE
                     KKLYLYVFSRKATEAVSHIMENTGDQLARWLSSRINASATMDELMHLCTTTSKYPDSA
                     WWEPVVRDLSVRLEKCALLQIKDKVAAFKPSADDLDYRARLSFEDQNQRDTWYAPVQM
                     VYDMLHLLHAHMSPKNFIHVSLRAIEVSEVKVQEASHSMQDGKFGGDDGDVLDALLFA
                     WRHFSVLRELLSLAEKRCESKTTFSTGLSLAMQSVWTVASVATVSSDFDALRDKCTHL
                     DMLMERTVQDAGTFLCASLTLPLQIYEQQTAKSPSKALAAWHTFQQSLDVNLDLGKGK
                     IHAYVPVNDLSTLIQATLTPLHTAYNAFITGLPLLSGSDPDDVAAAQQLRSLPTADKL
                     QAQLAQRFKSL"
     gene            <448547..>449536
                     /locus_tag="MRET_1879"
                     /note="MRES_07485"
                     /db_xref="GeneID:38738645"
     mRNA            <448547..>449536
                     /locus_tag="MRET_1879"
                     /product="NADPH2:quinone reductase"
                     /transcript_id="XM_027628506.1"
                     /db_xref="GeneID:38738645"
     CDS             448547..449536
                     /locus_tag="MRET_1879"
                     /codon_start=1
                     /product="NADPH2:quinone reductase"
                     /protein_id="XP_027484788.1"
                     /db_xref="GeneID:38738645"
                     /translation="MKAIRIHQTGDLSVIQCDNVSAPKEIGPEDVLIKPEIAGVNCID
                     TYFRSGHFHVQLPFTLGQECGGKVARIGESVKDIQPGDYVVALAGSSFAERVVAPRSK
                     VTKLPKELDTRTAVAAWLQGLTAVTLTHAAYQIKRGDYVLVHAAAGGTGLMLVQVAKA
                     LGAHVIGTTSTTEKAERAKTLGAEHVLLYKDDIVGRVNELTSGKGVNVVYDSVGKSTL
                     DQSLEVLAQHGSLILFGESSGAPDPLPVHLLRPKNIKFMCFALYGYLNTQEEYEHFSG
                     ILLDLLVSDKVHANVWREYLLSAEGVQQAQQELMSRTTTGKLLIRIPPSPDEA"
     gene            complement(<449538..>451300)
                     /locus_tag="MRET_1880"
                     /note="MRES_07490"
                     /db_xref="GeneID:38738646"
     mRNA            complement(join(<449538..449627,449657..>451300))
                     /locus_tag="MRET_1880"
                     /product="aspartate kinase"
                     /transcript_id="XM_027628507.1"
                     /db_xref="GeneID:38738646"
     CDS             complement(join(449538..449627,449657..451300))
                     /locus_tag="MRET_1880"
                     /codon_start=1
                     /product="aspartate kinase"
                     /protein_id="XP_027484279.1"
                     /db_xref="GeneID:38738646"
                     /translation="MTAASSQVSSKDVKWIVQKYGGTSIGKFLPTIVDSITPSYLKTN
                     RVVIVCSARSGKTKALGTTNLLLQACNEAMRSIQGNNTLDSSRSSLSSSFQADSMGPL
                     SSLQMGLSRPEFVPEFQATVERIKEDHFEAARESVRNTRLRQQLEQDIADDCMCLNQF
                     LQAAMILHEVSPRSRDVIMGMGERLACRLVVATLLDRGIQAELVTLESIVDELDEEIM
                     RPPSLAYEASNFLEQAFYDRLSTVLAERILKCEGVPVVTGYFGNVPGSLLSQVGRGYT
                     DLCAALCAVGLKANELQIWKEVDGVFTADPRKVPTARLVPAITPEEAAELTYYGSEVI
                     HPFTMEQAIKKSVPIRIKNVDNPTGCGTVIFPDHITPSVDDDIKHDPFMDGHVEQPEP
                     PLSGISTPVHRSQKVVRKMPTAVTIKDNILVLNVHSNRKTISHGFFAGIFGTLNRYGV
                     VVDLISTSEVHVSMAMTAELRPRTLERLSAELEHIGTVSILRNMVILSLVGKEMRQMV
                     GVAGSMFSTLAEGNVNIEMISQGANEINISCVIHEKSALKALNLIHYSILEGSPKPCN
                     MEGGTFGRSFF"
     gene            <451554..>454535
                     /locus_tag="MRET_1881"
                     /note="MRES_07495"
                     /db_xref="GeneID:38738647"
     mRNA            <451554..>454535
                     /locus_tag="MRET_1881"
                     /product="exportin-2 (importin alpha re-exporter)"
                     /transcript_id="XM_027628508.1"
                     /db_xref="GeneID:38738647"
     CDS             451554..454535
                     /locus_tag="MRET_1881"
                     /codon_start=1
                     /product="exportin-2 (importin alpha re-exporter)"
                     /protein_id="XP_027484668.1"
                     /db_xref="GeneID:38738647"
                     /translation="MDPTDPNQLASLASLFQQTLNPEQRKPAEDQIGQLQAQPRFGFL
                     LLALVQSESTSTAIRLASAIQFKNLCKTRWNVDAETEDPVFSAISDDEKQAIRQQLVP
                     VLVSLASASTPSQAILSQMNESVALVASSDFPEAWPALIDELVSQLSTDNHHVLLSVL
                     ATSHAIFKQWRSQFRSDALYSEINLVLGKMANPLLELLQRMHGMLLDPSTPSMTMQPL
                     ALCLMLLLQLFYDLSAQDLPPQFEDAIPMLSPMFTSLLSFSRPELIGDEEDVAPSPLV
                     KIRSSVCEIFELYAKRYLDVLPQLPEYVQAVWDMLSTYGPSEKYDVIVSKAIGFLSAV
                     VRMGNQRELFQSDSTLEQFCTAIILPNIQLRDIDEEIFEDNPMEYIRRDLEQSIEIDT
                     RRRAACEFVRALLEQFSTQITTICSRHIQMYLAEYQASPAQNWKRKDAAIYLLTSIAA
                     QSSTMQHGVSSTNALVDVVQFFSEHVLEDLQPDNSIARAQPILQVDAIKYLYTFRNQL
                     TKEQLLSVLPLLVHHLSSSNYVTCTYAAISIERILFIRTQGQRLMVSSDIAPLSQRML
                     EALFATVEQHETPEKVAENDHVMKCVMRVLLTSKNAVEPYSGEVLSHLASIVQLTSRN
                     PSNPRFTQFLFESVSALVRLAGSSTLAQLATMEERLFPVCTDILQGDVAEYIPYVFQI
                     LAQLLEAHAALSTERALPNAYASLLPPLLMPALWEKKSHVPALVRLIKAYLLQAPMYL
                     VQNGHIESCLGIYQKLISSRLNDTYGFDLLRAMLTHLPSEVLSPYMQPVLTLMLVRLQ
                     SSKTEKFSQQFAYFFGCFCGTQKPGYPELVIQAFDTVQGGLFGQLVENVVAPDLTKLT
                     AKQRFDTAAGLIRLLTDSDIMASTYSAAWPVLMTNILPLLSQSTPAADEAVDEDAELD
                     EQGFQASFSQLAAAGSIRDASSPNTVAWAGSDLWAYLLRQLAGMNARRPGTLNLLLQR
                     MPNEAQLQLNEALQKGGIIIA"
     gene            complement(<454620..>458177)
                     /locus_tag="MRET_1882"
                     /note="MRES_07500"
                     /db_xref="GeneID:38738648"
     mRNA            complement(<454620..>458177)
                     /locus_tag="MRET_1882"
                     /product="protein SSD1"
                     /transcript_id="XM_027628509.1"
                     /db_xref="GeneID:38738648"
     CDS             complement(454620..458177)
                     /locus_tag="MRET_1882"
                     /codon_start=1
                     /product="protein SSD1"
                     /protein_id="XP_027484277.1"
                     /db_xref="GeneID:38738648"
                     /translation="MASSSDGAASAPNVQETGADGSYDRMGRIERLPSAQEQLLRTQL
                     QQLGLEADDDAPLLNKDRNADMVAPVHPWPSSNTWGHDALDSFGAALAASARTWPSSA
                     PSPPHPTPFSFHHQSNDLGQNLRFPSSRPNYMSASEEVEQQRQAIQHQIEQLQRQHEQ
                     LQFHQQMLQPGMSLSSDLPQTRHPVRNMSMENRYHPTPMSGTWAPIGNESISLRSNFT
                     FPPRSQSESPMPPQQSHAMIPPSAYNDRTPSSLHTGYTRQASQQLTSDLSPKFLMAGG
                     GLINLNTLDLSATWNEYDDKHSNSPPQERAAQRHARSSSASSAALHSPAMDTLLTGLP
                     QAQAQLAALRRSRHHIGPNMHNRSMSHGRSASIGSNASGAPRRALFGSYLPQNSLPLL
                     LLAGKLVVGVLRINKRNRSDAWVTTEVFGQDIFISGSKDRNRALEGDIVAVELLNAKE
                     VWQTKRDKADKKKRKEEFSQGVPASGISTHPAGRRTDKARDDIEVEGAQLKLVEDEEE
                     SETGPPPLAGHVVAIVERMPGQIFPGTLALLRPSSAATKEKQQAERGECDSPPIGAAG
                     LSRPKIIWFRPSDKRVPLIAIPSDQAPEDFWDEKKQESFAHCLFFACIKRWPITSLHP
                     FGSLVDRVGPIGSLDAESQALLRSYCHDIVTPFSDMALRNVPTIESWSIPHNEYEARR
                     SFSAFTLNGRGPRQMAFSVDLHGSNSFTIGVHVADITYFLQANSALDREARRRGASVH
                     LVQESFEMLPPDLLRIAALHVNSDALAKSVVFTFQSDRVVDIWIGRSIVHVKHMTSHA
                     ELDRVLLGEATSFPVAPDALCAVLDKAQQLRLERLARGGLSLPRTWLEFDLDAKQHPT
                     DVHCCTDAESLSHLLVDEFCVRANTAVAHRLAAALEDNALLERQDVPTERAWNLLARG
                     LQALGLPAESLSSMTLASALNILPASSRSVANALTQRALSDSKLYTPALVDATKFMHY
                     AIGEPVYTQFVSPLQRYSDVCVHRQLDMVLDGTLHAEHQGTDTLSKLAHQCTVKNRAV
                     RAAEMQSAHLYLCQWLKDTSELRPGELEARRALVMSVNASSMDILVPSFTLEKRVHLD
                     CLPVENIHWDPVTYSVTLTWLSGVDSMAWLGEAIDDAQCTKLSSTRKETRDTNAPSPK
                     AISSRQQRITSMTELDVYVLSDMEKSPPIIKVVVLNPCA"
     gene            complement(<458347..>459933)
                     /locus_tag="MRET_1883"
                     /note="MRES_07505"
                     /db_xref="GeneID:38738649"
     mRNA            complement(<458347..>459933)
                     /locus_tag="MRET_1883"
                     /product="ATP-dependent RNA helicase DBP3"
                     /transcript_id="XM_027628510.1"
                     /db_xref="GeneID:38738649"
     CDS             complement(458347..459933)
                     /locus_tag="MRET_1883"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DBP3"
                     /protein_id="XP_027484278.1"
                     /db_xref="GeneID:38738649"
                     /translation="MSKDEVKLKRKERESDSKDHKKEKRERKDKKEKKDKKEKKEKKE
                     KNDKAKEPIPEIGSETKEPSTPKPVSSGASAVSTREFMESNNITIEMAEESNDKPPRP
                     MLSFDELHGKIDAKLKDRLDMEGFEKPTLIQSCCWPVLLEGRDMVGVAETGSGKTLAF
                     GIPALEYVIQQSPSKKGKAKIQVLVIAPTRELAIQTRDNLARVAEPLGYGVFCLYGGV
                     SKGEQLRQMKEYVLPVHIVVGTPGRVLDLAREGSLDLGRVSYLTLDEADRMLDKGFEP
                     DIRAIIGMTRSHEEGRHTNMFSATWPPAVRGLAETFMRLPVRVTVGSDVLSANRRVSQ
                     TVEVLDDGRMKERRLNSFLRSIDAQKTNEKILIFALYKKEAQRVENTLRRWGYRVSGI
                     HGDLSQHDRIANLEAFRSASTPLLVATDVAARGLDIPNVEYVINYTFPLTIEDYIHRI
                     GRTGRGGKSGKALTFFTDEDKAHAGELIRVLKDAEQPVPKEMDRFPTTIKRKTHSSYG
                     DHYKELVPGKAKKITFDDDD"
     gene            <460057..>461298
                     /locus_tag="MRET_1884"
                     /note="MRES_07510"
                     /db_xref="GeneID:38738650"
     mRNA            <460057..>461298
                     /locus_tag="MRET_1884"
                     /product="WD repeat protein JIP5"
                     /transcript_id="XM_027628511.1"
                     /db_xref="GeneID:38738650"
     CDS             460057..461298
                     /locus_tag="MRET_1884"
                     /codon_start=1
                     /product="WD repeat protein JIP5"
                     /protein_id="XP_027484282.1"
                     /db_xref="GeneID:38738650"
                     /translation="MDIKLSSDALDVCFHPNESTNQIVVGLISGKVQLYDYTDMLKND
                     ISDESGKSKAYKRLWSVRPSHKSCRGVAFDASGSNIFCIFKDKSIIALDPSSGHVKAR
                     WSSAHESAPSRILSINESLLATGDDDGVVRLWNPNDVPKKDAKPKPIQSYEHHSDWIT
                     DMLWCTHLDAPRTKTKDMDEGAKRKRNSDGERSRLVVTSGDGTLSVIDVHGGKKGVEV
                     SEDQEDELLSIAPIKDGKKLVVGTQLGILSLWAPDRGMLDHVDRFPGHPSSVDAMCTL
                     DHDTVLTGSSDGLIRVIQLFPHKLLGVVGDHNGMPIECIVRKGALVASIGHGNECKLT
                     NLAPLFEEGDIEPDDDDTDPEVMLASENAEPISRSVDASDNSSNEAEAPLAKRRDVKS
                     TPLSKSDKEPDGHASFFADLQ"
     gene            complement(<461340..>462581)
                     /locus_tag="MRET_1885"
                     /note="MRES_07515"
                     /db_xref="GeneID:38738651"
     mRNA            complement(<461340..>462581)
                     /locus_tag="MRET_1885"
                     /product="branched-chain amino acid aminotransferase"
                     /transcript_id="XM_027628512.1"
                     /db_xref="GeneID:38738651"
     CDS             complement(461340..462581)
                     /locus_tag="MRET_1885"
                     /codon_start=1
                     /product="branched-chain amino acid aminotransferase"
                     /protein_id="XP_027484283.1"
                     /db_xref="GeneID:38738651"
                     /translation="MRILVPSLRSLLQKAVIVRPTHQFSAFRHFSFSIAMNSQPAPLD
                     ASRVVIKKSESPKECPAPQNLVFGKTFTDHMLKVSWNKQTGWAEPSIEPYAPLSLEPS
                     AVVLHYAPTLFEGMKAYRDDQGQVRLFRPEKNMERMNRSAKRICLPSFEGEECLKLIK
                     KLIQIDSRWVPSEPGYSLYIRPTLIGTQSSIGISEPTDALLFVILSPVGPYYSSGVKP
                     IALEANPQYVRAWPGGTGDAKLGANYGPSMMPQKEAAARGYSQILWLFGEEDYVTEVG
                     TMNMFAVLKKDDGAWEVVTPPLNGLILPGVTRLSILELLRAHQKGEIQLDNVPKIEVN
                     ERDITMKEVVEASNSGKLVEMFGAGTAAVVTPVDRIGYKGKDIHVPVTSSGFGTVTEA
                     VLNKIMAIQWGKEPHAWSVPI"
     gene            complement(<462686..>464080)
                     /locus_tag="MRET_1886"
                     /db_xref="GeneID:38738652"
     mRNA            complement(<462686..>464080)
                     /locus_tag="MRET_1886"
                     /product="alpha/beta-hydrolase"
                     /transcript_id="XM_027628513.1"
                     /db_xref="GeneID:38738652"
     CDS             complement(462686..464080)
                     /locus_tag="MRET_1886"
                     /codon_start=1
                     /product="alpha/beta-hydrolase"
                     /protein_id="XP_027484280.1"
                     /db_xref="GeneID:38738652"
                     /translation="MNTSGRATGSKIGAPSRLNNVKNKNLSPKIQCMSLIFVLALTGA
                     AFLAIPMILAAGVIPVIFPVSILLLPVLIIVIVYGLAWSAYLVVAQSDRPPYAMIGPP
                     SLSKYIPFVPFSPLRCLKVAKIVCEFIWLGVRSMGSFWYWYSLYKMQKKSPEYETVLY
                     SLPFSHNCLDIYPPDVGVVSQNAIVLMIVPTSFFPSFISCNRKLYMPMALRMRKLGYC
                     VVVPDISYYPACQIPQSVIDLRLALSWVGAHIFSYKGDPSRIYVMGMGISSELVALTL
                     VQEAAVMSRVVRRQDDENKDPSSEEEFDRLKFNKLMEIYAPQVRLPSLAGVVLAAGMS
                     DVIKCYLHNVEMGTEHLGMLRRWAGPRQYQCIIHSPTHLLNNTKDKFDPAFLPPNFLL
                     IHGGRDKFVPISQAALLQSLLMEVGVKNVELFACRDLGHYDTLKMLLAYPSTHSDSCR
                     YDTPMMKTLCSFLV"
     gene            <464312..>464777
                     /locus_tag="MRET_1887"
                     /db_xref="GeneID:38738653"
     mRNA            join(<464312..464344,464395..464423,464669..>464777)
                     /locus_tag="MRET_1887"
                     /product="small subunit ribosomal protein S29e"
                     /transcript_id="XM_027628514.1"
                     /db_xref="GeneID:38738653"
     CDS             join(464312..464344,464395..464423,464669..464777)
                     /locus_tag="MRET_1887"
                     /codon_start=1
                     /product="small subunit ribosomal protein S29e"
                     /protein_id="XP_027484281.1"
                     /db_xref="GeneID:38738653"
                     /translation="MAHQNVWYSRPRNFGKGSRQCRVCGNQGGLIRKYGLNICRQCFR
                     EKSADIGFHKYR"
     gene            complement(<464956..>465696)
                     /locus_tag="MRET_1888"
                     /db_xref="GeneID:38738654"
     mRNA            complement(<464956..>465696)
                     /locus_tag="MRET_1888"
                     /product="N-terminal acetyltransferase 2"
                     /transcript_id="XM_027628515.1"
                     /db_xref="GeneID:38738654"
     CDS             complement(464956..465696)
                     /locus_tag="MRET_1888"
                     /codon_start=1
                     /product="N-terminal acetyltransferase 2"
                     /protein_id="XP_027484275.1"
                     /db_xref="GeneID:38738654"
                     /translation="MLGAPTMFRAAVMSASRGSGPCMHPFQSVRVPMLHLTCRLMVGS
                     RSNVRMLQPQAPCARSYSTMPQPQPSPDKNISHASRLGDQRQEESKHEKKAPRKSIFQ
                     RFRTIMKEYGWWALGVYTFISGIDLSLTFAAIHFFGGEHVEEIEALLFKYIGPIVKKL
                     KKEDDQPKENAMVTYIKSWFSSEENAYEVEHLIARLSGEFVLAFTIHKTLMLPFRSGL
                     TVLVTPSFVRWLIKKGWARPLKSSSMNL"
     gene            complement(<465814..>470745)
                     /locus_tag="MRET_1889"
                     /note="MRES_07520"
                     /db_xref="GeneID:38738655"
     mRNA            complement(<465814..>470745)
                     /locus_tag="MRET_1889"
                     /product="ATP-dependent bile acid permease"
                     /transcript_id="XM_027628516.1"
                     /db_xref="GeneID:38738655"
     CDS             complement(465814..470745)
                     /locus_tag="MRET_1889"
                     /codon_start=1
                     /product="ATP-dependent bile acid permease"
                     /protein_id="XP_027484276.1"
                     /db_xref="GeneID:38738655"
                     /translation="MLDATDPIMGNFSSWCWNHPLGPLDWNPCFRIGVLNTFIPLALI
                     AVSVAIWLASSTQDMSRVQAEAAEEVAHLSLESSNFYGATMDSRRSHRSPAPATASEK
                     VVQTENAVVIDEALTIKDELYTYTQAEVNEVKSRQKSLCELVGSGLLVVSYLVGISTT
                     SADWEPYWLALWTYFFVISLVSFYQHRSFFLQKLLVTTVASLVTLCNLRTSILISGAK
                     GLTPMTAIQAALAIFLLGCNWLSSFTQPLSSEMDALYETMHKRKLYTDVRTAMPTPPL
                     AAQHNAEDIERITPSYSKGNETLYPPPEQHASLLSRALFMFAFPTIWKHYFKPITLPD
                     VPQLMPIDRSASVISMFRIHNGPETKRSLWARLMRHFAPRYAYQGLFAFFATLLSIAP
                     IVFLSHLLDFFTIRTSKGTEGAPWHMGVLYASGMFFSQVLLSICQSQALMTGRHICVQ
                     IRAALTFEVLSKMIRRGMSIKKPDELSEPTKRDESEDDSAPTTDGAVMNLVSVDVNKL
                     SEMAAYMHFIFPQQPLTLILGMIYIVLLLGWSAVVGLFLLVVAVPIQAYISRLLVSIG
                     HRMLRATDERLNLASEVLACIKTVKFFAWEASFEKRMNDTRSKELALLRLQYVFLMLN
                     NVTFIATPMLVTMATFGVHTLLFKQPLTAQKAFTALALFNTLRGPLSEFPVMIQWMLS
                     SLVSARRINNFLNEPETNKYEQLLSDETFDPMPNLRNCPNSIGFSHAYFTYDTEPEKT
                     KVENRFVLKDLSCQFPVGKISIILGPVGSGKSSVLLALLGEMQRIKGTTSIPCPLARS
                     LLEPDPLTSLTESTAYCAQSPWLLGTTIKQNILFGTEYNEERYNEVLRACALEPDLDI
                     LEYHDETEVGEKGTALSGGQKARISLARAFYSHARHILIDDALSAVDAHTSAWLCEQC
                     FQGPLAKGRTIILVTHAVTLMLPTASYAVVMNNGEVSAQGAPLELKERGQILEPVEVK
                     GNGKKILQAPLDENKEKERKKKIEHQRANKATADKNEEKIGREQSSLNVYWLYMKSVA
                     PSPHIAILAWILLSIMYVSIRAIDVGSGAWLRDWASSYDNAVQTTYQLMRSWSTLAWR
                     APAETLPADQTWYYLKGYTYIVLVYILVNLLANALQFDTSIRASRRLYNAMSKALLHA
                     KPLFFDKTPFGRIMNRLSRDMEDVDQELSPILQMTVENLISLVAIISVICWATPRFLF
                     VVVFVMALYYMIGTLYLASSRDLKRIESIQRSPLYTVVGETIAGTVTIRAYGDSERIL
                     RQSLVLIDKWNRAFLLLWYENRWLSICCDLSGAGVTLIAALFLLNNGADAALAGFTLS
                     YAITLVEVVLWLVRLYTNVEIHMNSVERIGEYINVESEDQGGEEPPAHWPSSTGMIHV
                     RDLSVRYGPEHPLALSRVTFDIQPGHKIGIVGRTGSGKSTLSLAFFRFLEAENGSITI
                     DGIDISHITLESLRRRLTIIPQDSQLFRGTIRSNLDPFGVCDDGDMWFALQRCQLAAT
                     GSSPRVPGAGSVVKSLDDPVEQGGSNFSAGQRQLLSLARGMLKMRESRILILDESTAN
                     LDAESDALIQRTIREQMAPGATILTVAHRLKTIIDYDKVLVLGKGRVLEYDSPHALLS
                     SNDSVFYELCEQSGELELLKSMAADHARLSSHA"
     gene            <470894..>473692
                     /locus_tag="MRET_1890"
                     /note="MRES_07525"
                     /db_xref="GeneID:38738656"
     mRNA            <470894..>473692
                     /locus_tag="MRET_1890"
                     /product="DNA mismatch repair protein"
                     /transcript_id="XM_027628517.1"
                     /db_xref="GeneID:38738656"
     CDS             470894..473692
                     /locus_tag="MRET_1890"
                     /codon_start=1
                     /product="DNA mismatch repair protein"
                     /protein_id="XP_027484162.1"
                     /db_xref="GeneID:38738656"
                     /translation="MLARRAHVWKTLCMLRCFHVCTSTQKFVQKSIKDLPIRLSSKAL
                     TNPVPISPNVSNEWPPLALGVMENMRSFPQCILLTRVGGFYESYFEQAPKVSRMLSIK
                     LASRKWAGQSIPMAGFPIHQLEKYLKVLVQDHGVLVAICEEFKTSSSNAPFERRVTRV
                     VSPGTLIDERFLDPFHNNFILAVSPPFNASSYGLAWLDVSTADFGTAVHYDAKALRDA
                     IVRIKPREVVLVSDAFDRSHPVYEATDRVKAALACIPAPETSQIKTELIDATKAHMYE
                     AENNAIQVLTSYLQTRLLDHMSDMSVNQSPLRASTDCTMRLDASTLSALEIRETQDQS
                     TRGSLSSIVRRTVTQGGARLCVQWLTNPSMSLQLIRARHVLVELFLQNAFIRQDLRSL
                     MRIGAGDILRTLQRISLRRNDEQDLLEIRDFIRTGEDIIKILMPLDSQELQEMLQRFT
                     PLSDLGERLERAIDERVMEKRLQQREALFHSQDPSYAGGPTLTSDAPPLPKRTKRASA
                     STELILTENMWGDDIEHLIRPDSSPLLQALTNEYDALRLKARKLENALRKEHSEAVTL
                     KFLMGQGHVVHFPSVKGEVDDSLSLAYKTKTTRTFYHAEWTRIGMKLQKLREQLSEYE
                     SRMLEALRLEVLEHTAALRRNARLIDQLDVLLGFAQVAQELNLVRPIMDDSTSFDIQG
                     GRHLSVEMGLLERERLFTKNDLKIGEGTRLHLITGPNMGGKSTFLRQNAVIAVLAQAG
                     SFVPAEKARLGLVDAIFSRVGAKDDLFHSRSTFMVEMTETAELLHRATPRSFVIADEI
                     GRGTNTSVGLSVAFSVLYTLVMRIQCRSLFATHYYELADILSENVSNEVEIQALCRAI
                     EFYCTRLEKQGDAMSFSHRVRPGVNRVSHGLDIARLADMPHDTIRIAEHMHTWLVQHG
                     QAHLQTKGLLQDILKSKP"
     gene            complement(<473689..>474438)
                     /locus_tag="MRET_1891"
                     /db_xref="GeneID:38738657"
     mRNA            complement(<473689..>474438)
                     /locus_tag="MRET_1891"
                     /product="proteasome assembly chaperone 2"
                     /transcript_id="XM_027628518.1"
                     /db_xref="GeneID:38738657"
     CDS             complement(473689..474438)
                     /locus_tag="MRET_1891"
                     /codon_start=1
                     /product="proteasome assembly chaperone 2"
                     /protein_id="XP_027484231.1"
                     /db_xref="GeneID:38738657"
                     /translation="MTEDEFFISAISNEPEFRGQTLILPAISIGSVPQLALDLLIHAP
                     TLACRRVGYLDGSQCVPFISPPEPSLPAHEVFTALDVYESSKGLTLVQQRSPVIKASR
                     ALFTRRLMHWIQEAGFSDVLIISSMDAAMRVDTEFSTPILYKRPSEAQITHLSSAISQ
                     LYPPFQPPAYNGPGIPPMPGSGITRMYLEHAPKCTTALIMFCSEGDNREDAHELVRHI
                     SAICHLGLQRCTEPPSWTFMYGSAPADLLYG"
     gene            complement(<474486..>479105)
                     /locus_tag="MRET_1892"
                     /db_xref="GeneID:38738658"
     mRNA            complement(<474486..>479105)
                     /locus_tag="MRET_1892"
                     /product="ATP-dependent bile acid permease"
                     /transcript_id="XM_027628519.1"
                     /db_xref="GeneID:38738658"
     CDS             complement(474486..479105)
                     /locus_tag="MRET_1892"
                     /codon_start=1
                     /product="ATP-dependent bile acid permease"
                     /protein_id="XP_027484233.1"
                     /db_xref="GeneID:38738658"
                     /translation="MDCVAAPWDGSDWRPCFRAMVLDTTLPVLVLAVCTFMLFAWLHR
                     RRHKPRAPPAAPRHTPTERVLEAETAVILEEANSLARDDQAYRDSLRAPSYLRTDMVV
                     CACLALGQILLFRHTNKIWHIYTLYAFLLCVYAWYTRQSLFFYKLGLVVPYAIVTCFH
                     LRSLWLQGTLHSEWYQALGILVALLSLLLRRRLDTIPAKMAFLATNDESERGTVRISE
                     ALPPSEAYASLLGRITYLFITPFLWRQYFAPTTFDAIPQLPLKYRAAVIVSHVRLNAN
                     KMHTSLLYRLWLALGSTTTRQITLSFFRACFRIVPIACLSQLLDFASRRDDAKARGEE
                     PPPLHIGLFWTGALFSAQLIEFLLEMNVYHAGRTQSIELRSFLSTELFSKILRRDVLG
                     AKAPESSARMSDGHIASLLAVDMFKIDSFMAFVHQPVVEYPLTILFCSLYLFHLLGPS
                     ALVGLSVLIVTAPLQTQLSKFMVRVQDSILQATDARLDLVNEVFLCIKTVKFFAWEKP
                     FLDRLYASRAKELVMLARNNLISVTYNFIFVGMPMMVTIATFGTYTYVFGHPLTAKTA
                     FTALSIFTSLRLPLSDLPEMIVLMLGAIVSVRRIDAFLKTQDTSKYEQLQATNEDVHP
                     ATSYLGFHNATFAYNPQDPHSFRLSRLNCRFPIGKLSVVLGPVGSGKTCLLLSLMGEV
                     HRLEGTTFTPCPANRSMLRSDPQMNLTESVAYCTQNAWLLGTTVRENILFGTEYNEER
                     YREVLYACALEPDLDILEHHDETEVGEKGTSLSGGQKARIALARSFYSYARHILIDDA
                     LSAVDAQTAEHLYHHCFHGPLAKDRTIVLVTHSVSLVLPTAVYAVVMDNGRISAEGKP
                     MDLIQTGRINSTLQDPVPVAPFFQAENSASSEQEAKWKAVNKRRARKNKFANAESIDR
                     KARGMELYVLYMKSAAQHTSIAVGLWLLLLCMYVIVRTSDIMSNAWLKKWASTYETDV
                     SAFDYLVQMLHIFHEEPAPGMDRTKYYLFHYILLVFLFILVSTLRDLLQYYISLRASR
                     LLYSRVLHGLLYACPRFFDVTPIGRIMNRLSKDVETVDQDMAPSLRMMIEAVVTLAAI
                     LGIICWATPSFLYMAGFVLILYYVIASLYLGSSRELKRIESVERSPLFTLLGETLAGT
                     ITIRAFGDSERVIRRCLHVVDRTHRAFLYLWYENRWLSMCVDFMGAIVTCITATLLVT
                     TGADAALTGFTLAYAVLIVQTVLRIVRRYTTTEINLNSVERLQEYLDVPSESQGGEEP
                     PAHWPSSTGMIHVRDLSVRYGPEHPLALSRVTFDIQPGHKIGIVGRTGSGKSTLSLAF
                     FRFLEAENGSITIDGIDISHITLESLRRRLTIIPQDSQLFRGTIRSNLDPFGVCDDGD
                     MWFALQRCQLAATGSSPRVPGAGSVVKSLDDPVEQGGSNFSAGQRQLLSLARGMLKMR
                     ESRILILDESTANLDAESDALIQRTIREQMAPGATILTVAHRLKTIIDYDKVLVLGKG
                     RVLEYDSPSRLLANPDSTFHMLCERTGDLAQLKAAADQALATSTL"
     gene            complement(<479217..>485024)
                     /locus_tag="MRET_1893"
                     /note="MRES_07530"
                     /db_xref="GeneID:38738659"
     mRNA            complement(<479217..>485024)
                     /locus_tag="MRET_1893"
                     /product="CCR4-NOT transcription complex subunit 1"
                     /transcript_id="XM_027628520.1"
                     /db_xref="GeneID:38738659"
     CDS             complement(479217..485024)
                     /locus_tag="MRET_1893"
                     /codon_start=1
                     /product="CCR4-NOT transcription complex subunit 1"
                     /protein_id="XP_027484232.1"
                     /db_xref="GeneID:38738659"
                     /translation="MSISTTVPGFDGIQVPLPMDLSGSSALFDAFLAHISDHASQEAT
                     PTQLTPLLVSILKADARVPFTLDHTQRQQLMGRLSDAFGETAALALGQALSQLPSKPL
                     AEQLMDLGDALVTSSNLHALIKHSGFSRPKESDVSDLLAQLLSFTTRSMTFATNFSLL
                     SKSLAATDSALDWRAIMRGLDAMDSRVFLPCEKLGTALGDWIRGTPNPIESVNSLWGV
                     WTNRTRQLQILYSLLLLSEHFSMKDVTARQIVSPSDFVDAPPTIQAQAKVASESVWNS
                     LDLIETLMELANSVTGAENSSEVGRPVTAILERAIQTNAECVLLGLVVLPPSMNAVHT
                     ELVTKLLAMFLVGYSAHQLVFWHLWHTQPALLMDAFKRLYAESPLHMTRIVEVAQELG
                     MINQLVSQQPWAFALDAAALAARRDALQLEPWLEESISAAPADAHLITATLDFLEIKI
                     KEDLMRRDPQAEPTFVPLHVQQVAVFLRVLRGFGDSMSLPEIDHFKIVRNMCLQLHPR
                     LMKLTPGPSSEPGLTVTTFSKDIHREADTWYRQMYEEKVSVDDIVSLLRRCKHSDDER
                     DHQLFACMVHTLFDEHRWFELYYPPRELLMTAAVFGALVQYQLIESIPLGIAIRYVVD
                     ALQASPDSTLFHFGIQALLRFQKRLAEWPQLCQVLLSLPTLTQTHPELIVVVNQALAA
                     AKSGKVQPPDDSVFTAIQPDALPADMQRKPDEVQSDQLLFLINNMSLANVHEKLSGAR
                     ELVLPDILHWLARYLVLERVSLEPNNHDLYLMFLTGLEQPRVFVYVLYETLTKLKALL
                     DAEKTTQSTSERTVLKNLASWLGLTTLAQERPILHRNLAFKDLLLQGYESGRLIVAIP
                     FVCKVLEHCSSTRAFQPPNPWLMAILRLLVELYQFANLKLNLKFEIEVLCKSLHVDLQ
                     KLEPSQLLPGRRPEPPSGPSTAAVAGKRAASGDHNTIVPGMEQLSVNEPVAYHDMFVT
                     MLQNMAQYIVISPQIVPYANSAAWKRVMYVALERAIQEIITPVVERSVTIASISTREL
                     VSKDFAMEPDEQKLRSAAHLMAQNMAGSLALVTCKEPLRLSILAHARTLFAAGGVSEQ
                     ALPEQALLLLVQDNLDLACVVIEKTAMEKALAKVDEGLANAYRTRRDFKMHGHGAIFW
                     DKASLSHYSTTLPDLMRIAPPGLQPAQLRVYEQLAMTPNVPRQEDDLEMDDVPAVAGL
                     NSMGMGSGFLMPTQALERFVLMAAELERFFAEVSETPQTLSTLPSTHFVRQVLPHLNE
                     LILQSTHRDETVLLIAQKTVQLLYKTGTDLAREVWVAVLEQLCEQSSRVAREVTAWLM
                     YAEDERKFHVPVTLALVRANLISLVEQDQQLAKLLIRTQCRSSVVDYSAQLVRHCLQE
                     GLATRAQFSTLLSALAQAVQYGRGTPAAQRLLDDLDELAVSESSVPLRDQLAYSFARW
                     VRVFQQSSNPEKSFIEYIMQLQSRHVLKGEEVSSLFFRMCTEVSVAHYTKQHAVGGTR
                     ASGIFSPIDTFAQLIVYLIKYHADPSGTNDERAKVHYLTKILSIIVLVLAQSHEEMGA
                     HFQQRPFFRLFSSMLHGLRAAESSLQGAYNGALLAIANALYTLQPAFFPGFAFSWVAL
                     VSHRLFLPQLLRGPTSSRAAFHRLMIAQLRFLSPLLRQNTLHDTTRLLYSSTLRLVLV
                     LLHDFPEYLAEYHQSLCDVIPSICIQLRNLVLCAYPRPLRMPDPFGAGLRLVTWPDPK
                     FMPTMHYDAQAIVRALSPTPDVLERLDELVHTGQAPTGTGRMLADAFASPNAPDTGRY
                     NEILINAAVLYVAHTTLQSTKNHLLANRSVHDPLVELYHAVLPEIEPEGRYLMLSAAA
                     SQLRYPSHHTAYFHALFVVLYTREEAFVREQILRVLLERVIVHRPHPWGLLYTFAQLL
                     RTHSVPLPQAPPEIHAILEHMSKMLAPERAVSASA"
     gene            complement(<485578..>488745)
                     /locus_tag="MRET_1894"
                     /db_xref="GeneID:38738660"
     mRNA            complement(<485578..>488745)
                     /locus_tag="MRET_1894"
                     /product="protein involved in GPI anchor synthesis"
                     /transcript_id="XM_027628521.1"
                     /db_xref="GeneID:38738660"
     CDS             complement(485578..488745)
                     /locus_tag="MRET_1894"
                     /codon_start=1
                     /product="protein involved in GPI anchor synthesis"
                     /protein_id="XP_027484235.1"
                     /db_xref="GeneID:38738660"
                     /translation="MAKGNIVTSRSLWRLEFFVVSLLFHLIFTWSIFDVYFHSPVVYP
                     SRRFDAANAVPDAPWTGDAPADRLVLIVADGLRADTLFQRHATASLPSWAQHAVQGDQ
                     LVYNGTYPDAFKRTKTVDGQVSGPLYAYAAPYLRSIARGPGVFGVSHTRVPTESRPGH
                     VALIAGMYEDMSAVSKGWKINPLAFDSLLNQSSHSYAYGSPDIVPMFVLGTSPDKVDW
                     QVYNEEAEDFTKDAVELDTWVLNRMRDVFSRAQRDPKADARLRQPKTLFFLHLLGLDT
                     TGHTYRPMSPEYVGNTIVVDEIVRQVSHLFEDFYGDNKTAFLVTADHGMSRKGNHGDG
                     DPDNTRTPLVAWGAGVPKARHLPQRRFVYTDYDKHWGLDFLARSDVEQADLTPLMASW
                     LGLPVPANSEGRLPLDLLNASPAYRARAALATAKQVLEVYRVKYVDRASRMLHFQPFQ
                     PLQSRGDTLPGAARVADAEQAVRDGEFDVAMEESEALIHDALLGAKYLHRYDAPILST
                     IVVCGYLGLFMYGLTFLAWYAQDQPLLSLRPCNVRIMSMPPLILALLWGKFALDHAPW
                     MYFVYSGAVGAIWTLFACRVHILAHVLRHAQSMWTYVKGVSYAVISLILLELAVYGYL
                     HRLVWAAILLFLGFSLPFASPMSFKEGHQVLVLLGAVLCGANGWFMSLPTEKDESVPL
                     ILGGGTLLLVLGSLVYLLPRTFLMPPDYLGRDRNAYAMMHARTVDELKEISAQKNEEE
                     PDADVFWPRTRQALLMELVCLVISMLVTRSSAHSLNTKQGLPFVNQAVAWVVMLGSMS
                     APLVLGFQRPRGKLAQPVRERLVLLIFAFAPVFVLLSLRDEVLFYAVYTLLVLAWGHM
                     EAELARDRIVIERITSGTRSAVTVQEPQRPRNMILDDIRVGIVYLVLLHVGFFGTGNV
                     ASISSFYLSPVYRLVPVFSPFLMAALLVLKLIVPFIILSCVLAAVCMQPLETRALAPV
                     SSRVPIVASGLGLRDVHIPLVVAALAGDVLALNFFFAIRDEGSWLEIGQSITHFVMAN
                     LLQMYMLAIATLSALLLGVSRVSNT"
     gene            complement(<488857..>489961)
                     /locus_tag="MRET_1895"
                     /note="MRES_07535"
                     /db_xref="GeneID:38738661"
     mRNA            complement(join(<488857..489355,489384..>489961))
                     /locus_tag="MRET_1895"
                     /product="calcium/calmodulin-dependent protein kinase I"
                     /transcript_id="XM_027628522.1"
                     /db_xref="GeneID:38738661"
     CDS             complement(join(488857..489355,489384..489961))
                     /locus_tag="MRET_1895"
                     /codon_start=1
                     /product="calcium/calmodulin-dependent protein kinase I"
                     /protein_id="XP_027484234.1"
                     /db_xref="GeneID:38738661"
                     /translation="MSQEQHQQPVTVPCAYKTGRTLGQGTYAVVKEAVHIETGKFYAC
                     KVISKQLMRGREHMVRNEIMSLKRVSQENSGVVSLVDYFETMNNLYLVTDLCQGGELF
                     DRICERGSYYEKDAAHIIRTVLKAVEFLHDRDIVHRDLKPENLLFRDRSEHSDLLIAD
                     FGLSRVIDHDKMTALSTTCGTPGYMAPEIFRKTGHGKPVDMWAMGVITYFLLCGYTPF
                     DHDSQKDEVQRILTADFRFEPAIYWQGVSQQARDFICRLLTVDPEQRMTAKQALAHPW
                     LADVNAEAENAQRDLLPDIKNAFNAKRTFRKAVNGIRMINRLRSETQEHQTARQELEQ
                     RHQLAHEESENLDQVWNSCTERAP"
     gene            <490159..>491864
                     /locus_tag="MRET_1896"
                     /note="MRES_07540"
                     /db_xref="GeneID:38738662"
     mRNA            join(<490159..491549,491576..>491864)
                     /locus_tag="MRET_1896"
                     /product="histone-lysine N-methyltransferase, H3 lysine-79
                     specific"
                     /transcript_id="XM_027628523.1"
                     /db_xref="GeneID:38738662"
     CDS             join(490159..491549,491576..491864)
                     /locus_tag="MRET_1896"
                     /codon_start=1
                     /product="histone-lysine N-methyltransferase, H3 lysine-79
                     specific"
                     /protein_id="XP_027484164.1"
                     /db_xref="GeneID:38738662"
                     /translation="MDFFGQRSKAHSASNKKPTVVTTTTTKKKVAPQAPSRAPTVKKH
                     NALPEAIQQRIQREHQTAAAEAAPPSNTSSRPKKRVKKASQPDATTSRTMLGDDDADD
                     TALDRITQGSRSTRSVFSYHVPRDIVSDDAYSPLSEDTRAKATRCITSRALVEASSCR
                     YEPYFDGLDDHPVVVLEYPACDASEEFLLLVPVDSDEYDPISDLLCCVGAMAANYIPP
                     EMREEFGTLESLETSSSAGMPLSRVSMASLSKLDSSHVTDHHDKDSLPPQEEETILRA
                     FTKARNRRHGPLFLRTLERFNAKIRELRQRGVIAAQLHSLGQSHGVPEHVWRTIQEQV
                     YARVVSPHVDKLKQYEAFSDNVYGEMLPPFLSEIARIAQLGPSSVFIDLGSGIGNLLI
                     QASLQTGCEAYGCEYMPIPSDLAEQQIIEASHRWRMWHVRGGPRVESWQGDFTTLDRV
                     GQVLRRADVVLVNNYAFRPQTNDTLSLQFLDLKDGTKIFSLRPFVSPDFRLTERTLSS
                     PQAILRMEQHKYTGGCVSWTAGGGVYYVHTVDRQLVQDFVAQQPSAGAITS"
     gene            complement(<491851..>492350)
                     /locus_tag="MRET_1897"
                     /db_xref="GeneID:38738663"
     mRNA            complement(join(<491851..491867,491893..492126,
                     492152..492170,492201..492214,492240..492293,
                     492317..>492350))
                     /locus_tag="MRET_1897"
                     /product="methylated-DNA-protein-cysteine
                     methyltransferase related protein"
                     /transcript_id="XM_027628524.1"
                     /db_xref="GeneID:38738663"
     CDS             complement(join(491851..491867,491893..492126,
                     492152..492170,492201..492214,492240..492293,
                     492317..492350))
                     /locus_tag="MRET_1897"
                     /codon_start=1
                     /product="methylated-DNA-protein-cysteine
                     methyltransferase related protein"
                     /protein_id="XP_027484236.1"
                     /db_xref="GeneID:38738663"
                     /translation="MSLAVSAGEFHAMTYECVTRIPYGHVTSYGHIAKLIGYPQHSRM
                     VGAALKFLQNDRVPWHRVVRADGSIAERGDGGAGASRQAQRLMSEGVPVSEIPLGSAV
                     TQWRVQSMASNSGYGWFPTTL"
     gene            complement(<492398..>493264)
                     /locus_tag="MRET_1898"
                     /note="MRES_07545"
                     /db_xref="GeneID:38738664"
     mRNA            complement(<492398..>493264)
                     /locus_tag="MRET_1898"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628525.1"
                     /db_xref="GeneID:38738664"
     CDS             complement(492398..493264)
                     /locus_tag="MRET_1898"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484230.1"
                     /db_xref="GeneID:38738664"
                     /translation="MAEEPMSAAAALLAVTEDERLIHPRDTKVDQFAQNIEDRVSNLV
                     GGVSTWFSGINTQTQNAVLKAQDHVDKNGGVLSTARSHLARLESQFQSQSDRAREKSR
                     AVVPDETLYELDTSNHEASLEEEPTSAAASANSSSSLPSTGVWDLLRKVTAHPHVERL
                     QSAWTGANQDTRAQWNNTLKEAESLARTYVKSSGEAMQLAGRDLHSKLQSMIASVPSD
                     VSVAEEAPGAKGSTRRGHMDDDEESFRWDDDDDDVSQPTTSEPYKGNAPLTKAIKASN
                     ESQTDEADSDWE"
     gene            <493392..>494759
                     /locus_tag="MRET_1899"
                     /note="MRES_07550"
                     /db_xref="GeneID:38738665"
     mRNA            <493392..>494759
                     /locus_tag="MRET_1899"
                     /product="phenylalanyl-tRNA synthetase alpha chain"
                     /transcript_id="XM_027628526.1"
                     /db_xref="GeneID:38738665"
     CDS             493392..494759
                     /locus_tag="MRET_1899"
                     /codon_start=1
                     /product="phenylalanyl-tRNA synthetase alpha chain"
                     /protein_id="XP_027484229.1"
                     /db_xref="GeneID:38738665"
                     /translation="MLSFQHPRALRALGRPLACYTRTIHASSRACSQDPSSLVVHGVT
                     YATDDYTNIPSSIMSRVFPSPQLPYREHHPLKILREEIERVFGQKYSAIRAPSPVVTT
                     KLNFDDLGFPANHPGRKPSDTYYVNRATCLRTHTSAHEVSTFRHGYKRWLLTADVFRR
                     DEIDSSHYPVFHQMEGASVWGLDEFGSNGIVERECAAMEEKLRASGMEIHDDVNIAEA
                     DGWQDTHLRKHPEAANLALRHLKASLNTLVFALFKKRWAEEAQSGEPLRVRWIPATFP
                     FTAPSFEVEVWFRGKWLEILGTGIVKQRTLDEAGIPDNVGWAFGLGLERIAMVLFSIP
                     DIRLFWSQDPRFLNQFMGHDPKNVTFKPYSKYPPCYKDVSFWMPPTFHENDMFETVRD
                     RAGDLVEDVVCIDDFVHPKTKRHSRCYRINYRSMDHNLENDQVNILHADVLEALVQRC
                     QVEIR"
     gene            <494848..>496068
                     /locus_tag="MRET_1900"
                     /note="MRES_07555"
                     /db_xref="GeneID:38738666"
     mRNA            <494848..>496068
                     /locus_tag="MRET_1900"
                     /product="abhydrolase domain protein 12"
                     /transcript_id="XM_027628527.1"
                     /db_xref="GeneID:38738666"
     CDS             494848..496068
                     /locus_tag="MRET_1900"
                     /codon_start=1
                     /product="abhydrolase domain protein 12"
                     /protein_id="XP_027484708.1"
                     /db_xref="GeneID:38738666"
                     /translation="MSTVSFLIKAHLYAVLACVLYLLACLSMSHPVLQRQYLFLHNVR
                     FPMFAKYSEPHLYGSLVGQTRNLYIPSTDNVTLGAWHYLPKAFYDAHVNELQNTQAEA
                     LNALFDEALRTYPTYVFLHGNGLNRAASFRVRTCTDIAQELNANVFAIDYRGYGDSTG
                     YPTEQGVVDDAYSAVQYVRQRSRSATADSGPGIAIVGQSLGTGIGAQTALRMYREGQH
                     LDALILLAAFKELRPMVTEFSLGGVIPLLRPLEWLPIKDFLLDTFLQYRFHSLEALTE
                     ILNGTNDPKSVNQPVIIIMHALDDAVINVSHSEAMFTRALNITGATNTMSGYHIWSSS
                     LPDFGYVRSIMSKTARPPEHRGVVPNSRFVLPRSALFTFVELEKGGHDHLLRGNVDAL
                     RLMMPTYMLGDDVK"
     gene            complement(<496091..>496876)
                     /locus_tag="MRET_1901"
                     /db_xref="GeneID:38738667"
     mRNA            complement(<496091..>496876)
                     /locus_tag="MRET_1901"
                     /product="dehydrodolichyl diphosphate syntase complex
                     subunit NUS1"
                     /transcript_id="XM_027628528.1"
                     /db_xref="GeneID:38738667"
     CDS             complement(496091..496876)
                     /locus_tag="MRET_1901"
                     /codon_start=1
                     /product="dehydrodolichyl diphosphate syntase complex
                     subunit NUS1"
                     /protein_id="XP_027484707.1"
                     /db_xref="GeneID:38738667"
                     /translation="MVHFVHALVYALCHTIYTIYYYLKLCLNTISHASWATSDVLPAY
                     NDNLRAPPHLAVIFAWSSFEPCKVYNALQDVRRLAAWCAAAGTRELTVYDEDGYLAQA
                     LSKTADPKVHEQAPTLLVDIHFGAETAKDFRQKNPIAMRCPLSPTFHGPRLKMHVNIL
                     TEKDDKPVLARALESTRESGFTTSEVSRQLLRIGPMQSMPDMLVVCDERAGPPCLHGF
                     PCWMVRITTIQPLPTWSLLGRWTPRHFIDTLKIYTSAEQRYGA"
     gene            <497103..>499256
                     /locus_tag="MRET_1902"
                     /db_xref="GeneID:38738668"
     mRNA            <497103..>499256
                     /locus_tag="MRET_1902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628529.1"
                     /db_xref="GeneID:38738668"
     CDS             497103..499256
                     /locus_tag="MRET_1902"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484331.1"
                     /db_xref="GeneID:38738668"
                     /translation="MSTSRTFPADIVQRICEIVYLDSVPLCSLRLLDPPTIPSAAFDG
                     QNVSTSIYETQRVLYVLCLVNQTFYRYAKPLISRRIQFTLPYRFMLLVDDALSSRQAT
                     LSNIRLMDFSSFRATGLGRTVGESTERRFVTPERLYTLIHASAGLVAFGSSETMDSAL
                     SLQVLEALLLRDGGPSRPSRVRDVSTERGTGPVHNALQSLDLCGCISPRFLEAMRAFV
                     HKYLESVPASRPMYDLLEEEDDDDDDLNVERRGRSRSIAHSKRTSRDISSRVRTRTFP
                     SMQRLGLKGVSLPRDLLAPFVLAFPNLRLLDLSETRVDAPILDALGQSTIRLESLSLS
                     RCRAITSESLVKLLVHSPTTFHLTELAIQGTLLFPTPVSPEDLCFIFSNAPCMRSGAL
                     RYLDLGGCALTNESLSLMPPQHALLDLGLGAIPDITLGAVCSFLLRTAPNVQILDLSH
                     SCTAHGPVHAVHLYHDLLAPCTQRPPALEIAEQLRALGIKKDNSEPWHPPTNLRVLEL
                     GSAALGTIRGGVGSWKVIWGAGRRGWVVDTAAGPHPQAFDIPLQDEDSDDTDRGRDRT
                     MKQPMDLRRSGSQLGRTVSGISPGEEHQHHRPVRRINHTISNAPHMPNIITVPSTPFE
                     TRSRSLSLSTSREPPRARTTRSSGMEPPKVEFQVLRNLPADHPRHRVLDYLSSQSGSV
                     QGFIGWHSHKMEVLLGYGLLGREIGTYAWFAYQAS"
     gene            complement(<499264..>500925)
                     /locus_tag="MRET_1903"
                     /note="MRES_07560"
                     /db_xref="GeneID:38738669"
     mRNA            complement(<499264..>500925)
                     /locus_tag="MRET_1903"
                     /product="GTP cyclohydrolase II"
                     /transcript_id="XM_027628530.1"
                     /db_xref="GeneID:38738669"
     CDS             complement(499264..500925)
                     /locus_tag="MRET_1903"
                     /codon_start=1
                     /product="GTP cyclohydrolase II"
                     /protein_id="XP_027484330.1"
                     /db_xref="GeneID:38738669"
                     /translation="MVDDTACHRVDTNNSKPLKAPKPSEYAQSLKKHGLSLRNFDTDA
                     ALRSPPIDFVTGASLHSGPQLTHVHHKLNDSDGTRKLNASVASGDQSNGVDRHQNEMH
                     PVKVPATTLSTSSVASHSSQDENKCPDVMFIQQNLQNVKLPENEQEVYDSNAISNAIV
                     TPIIRREPELLRSQSSIPPLEVRCYGRTRVPTPHGEVFCHLYRNNYDNKEHMALVIDP
                     SQNNLSIQARQKQGLLSSPRHLRSRSLDAIWHEDETTIERLVRGAYVNRLSDTYQVPS
                     EPILMQSTDALDPNTPSPLVRIHSECYTGETIGSQRCDCGEQLDEALRIISTSMTHSS
                     SGIPVPPRGVVVYMRQEGRGIGLLDKLLAYNLQDMGHDTVSANILLGHLPDARRYDIS
                     SAILRDLGIDQCRLLTNNPEKIQSLEAEGIRVTERVSMIPRIWKLSHHTHASHKPRRH
                     RRGEPTNRVDDMLGRSDVHSLTNSTMSQGSTSNEMLDTTQSGDVLESDDSASSHDSLA
                     QRSLGVTLVGGSTTRGNDLERYLRTKIERMGHLLSEPVHSTKPIH"
     gene            <501119..>502681
                     /locus_tag="MRET_1904"
                     /note="MRES_07565"
                     /db_xref="GeneID:38738670"
     mRNA            <501119..>502681
                     /locus_tag="MRET_1904"
                     /product="protein AATF/BFR2"
                     /transcript_id="XM_027628531.1"
                     /db_xref="GeneID:38738670"
     CDS             501119..502681
                     /locus_tag="MRET_1904"
                     /codon_start=1
                     /product="protein AATF/BFR2"
                     /protein_id="XP_027484712.1"
                     /db_xref="GeneID:38738670"
                     /translation="MARLDVNALLNVAPESFDPEDEYRNDVDGSDEEPRENDENMSEK
                     AARQHYVDVGPSQMRRKARLTESDVLDKPQYQSVKASRAEMFGDDMDGSNGEEVDDDD
                     DEKNLDDDEELYDNSQEDAEGEDTEEEENDDDDDENQDISITMDGDQVEEEDEQDEED
                     VQEENSVLHSASKDGSKRFKHQHVDAAATFAMQEQESLSLMEQIREKRAQDAKKGQDV
                     RKQIKNWEKTLRLRISFQKILTTVSRLPPSVLLSEYFEETPNARDEIDAAAAELEDIA
                     TQMLELRLYLWKQNFSSMSADLSKHVRVDASASKALEDLEHVLEPHINTLLTRWSNKI
                     SSAPHSRNSSSSSRLQLRAMNQNVVDQIRQALAGDGMDRLVQRTQVWRADDMDRLGVI
                     ATASQESRPTDTEVFDDSDFYAQLLRDLIDNAGIMETGASNAASDALMSRKRKRNVDV
                     RASKGRRLRYEVMEKVQNFMPPIPRVTWDDAQTERLFSQLASTTTASSDTKEPESDEP
                     TWSENDGFRLLG"
     gene            complement(<502718..>504392)
                     /locus_tag="MRET_1905"
                     /note="MRES_07570"
                     /db_xref="GeneID:38738671"
     mRNA            complement(join(<502718..503686,503727..>504392))
                     /locus_tag="MRET_1905"
                     /product="U4/U6 small nuclear ribonucleoprotein PRP3"
                     /transcript_id="XM_027628532.1"
                     /db_xref="GeneID:38738671"
     CDS             complement(join(502718..503686,503727..504392))
                     /locus_tag="MRET_1905"
                     /codon_start=1
                     /product="U4/U6 small nuclear ribonucleoprotein PRP3"
                     /protein_id="XP_027484711.1"
                     /db_xref="GeneID:38738671"
                     /translation="MPHKRPHSASGGSGVPTHEKRARSHASGPSSDLSKSIEEARKRA
                     MAAFQRTGLPSAPSAPPPRPRAPTSSPSAVQHNLEDKKQTGEQESKPVGIHPLLLGDA
                     ARIQEKFRSLAPKFASIQANKRQIPGKPPPSSSFSSILDAKPIPVKPKNPYLPSEVDR
                     VEGPKPKSMHRALQFHRPGKYILEAEQIRRDEKMNALKERIQATAQKVGLQDELLGDE
                     RVLRRPEPPQAEWWDMALLPTKSYDDVPISIQPINDLPPDANTVEHKDSPIDHLVQHP
                     IPIPPPTENIKVQPHGVILTKQEMKKMRRQRRAAEQQDKRDRIKMGLLPPDPPKVKLA
                     NLMRVLGNEAIADPTKVEARVRREVAARQELHERTNAERMLTDEERRDRRAYKTKVEE
                     AKGMWCQVYRIEKLVSPSHRFKVRKNAQQHHLSGIIVTNPHFSLVIVEGAAKALKAYK
                     RLMLVRINWKEFGQANREDNAPEEEEGRMEPEVDLSSNKCDLIFEGPVRERTFSPGSV
                     RMVDCPTDFKVKELLGPKLAGYWDVAKRSAIAEQDV"
     gene            <504593..>506227
                     /locus_tag="MRET_1906"
                     /note="MRES_07575"
                     /db_xref="GeneID:38738672"
     mRNA            <504593..>506227
                     /locus_tag="MRET_1906"
                     /product="importin subunit alpha"
                     /transcript_id="XM_027628533.1"
                     /db_xref="GeneID:38738672"
     CDS             504593..506227
                     /locus_tag="MRET_1906"
                     /codon_start=1
                     /product="importin subunit alpha"
                     /protein_id="XP_027484710.1"
                     /db_xref="GeneID:38738672"
                     /translation="MSAFRDSSRRQDTYKAKGAFKQDELRRRREEAQVEIRRQKREES
                     MAKRRNLNMHQISDAPDSEEEEEVMDDLDMKITSELPAMVQGVQSDNLDQQLEATTKF
                     RKLLSKEKNPPIDRVIACGVVPRFVEFLRSPHSMIQFEAAWALTNIASGTSEHTQVVI
                     NCGAVPIFIDLLLSPVLDVREQAVWALGNIAGDSTKCRDFVLQHGGMQALLQLLSEDH
                     KVSMLRNATWTLSNFCRGKNPQPAWEYVAPALPTLTKLVYAMDDEILIDACWAISYLS
                     DGANEKIQAVIESGVCRRLVDLLMHPSAAVQTPALRSVGNIVTGDDMQTQVIIASGAL
                     TPLLALLSSPKDGIKKEACWTISNITAGSPSQVQAVIDANIIPPLVHILSHADFKTKK
                     EACWAISNATSGGLQQPQQVRYLVSQGCIKPLCDLLKCMDNKIIQVALDGLENILKIG
                     EQDKEALGPGATNQYAMYIEECGGMVAIHALQNHENFDIYKKCFYIMDKYFPDDEEDQ
                     DTGIEAPQVNDTGAFAFPSSVAAPQTGFQFGPAQNM"
     gene            complement(<506379..>507713)
                     /locus_tag="MRET_1907"
                     /note="MRES_07580"
                     /db_xref="GeneID:38738673"
     mRNA            complement(<506379..>507713)
                     /locus_tag="MRET_1907"
                     /product="ankyrin repeat domain protein"
                     /transcript_id="XM_027628534.1"
                     /db_xref="GeneID:38738673"
     CDS             complement(506379..507713)
                     /locus_tag="MRET_1907"
                     /codon_start=1
                     /product="ankyrin repeat domain protein"
                     /protein_id="XP_027484709.1"
                     /db_xref="GeneID:38738673"
                     /translation="MRRNSVRPSGNNLAGPSPSLPSCSSPDVPTHLREPPLQSLGLHR
                     AAGAGDVSLVLFALENGQQVNQTIHGISPLHVAACMGFVPVINVLLAYGADVNILKGK
                     DKVAGPGVEGSTPLHFAAANGHLHAVRALLQHGARPQPLDRDMQTPESLASLNQHLQC
                     TTLLKQWIQLYGKEGRIDPAATKSAFLWNDQSLLELTRESVQSRSPHLETDVLPSRES
                     AMPGSSQSSPVHYDFKRRTSIPTLIEKASNPAISIRNALFPSSPSTPRLDELSPSFRI
                     PRISSRASLTNLFGRRGNTQTFDEHVQSDGDPGHASYASSSRLDSFSSRNRSYPKSST
                     SAPTPPPSIPMLSSFGSPSNKQRYRLDQPASDQHSRSHFSMALASSHLRRLRSNSAST
                     SAQEAERVCYNRARAHSEAAAQEPKRESLPGAWTDRSSIRSRDDDRQSDSSL"
     gene            complement(<507911..>512194)
                     /locus_tag="MRET_1908"
                     /note="MRES_07585"
                     /db_xref="GeneID:38738674"
     mRNA            complement(<507911..>512194)
                     /locus_tag="MRET_1908"
                     /product="lipid-binding protein"
                     /transcript_id="XM_027628535.1"
                     /db_xref="GeneID:38738674"
     CDS             complement(507911..512194)
                     /locus_tag="MRET_1908"
                     /codon_start=1
                     /product="lipid-binding protein"
                     /protein_id="XP_027484322.1"
                     /db_xref="GeneID:38738674"
                     /translation="MVNNLFTRDKKEDVPDAKDLQNNLKDNLEAEGANVDVFSENASP
                     EEKARAALKAQNEVKPRGQFAEHMEQQKLAEAVKLNRSVPSDMNGVRIRPNVSLKDVD
                     EASRQQGQLGDGVLVPGALPAGAPSLSIPEWYKVGWIANSRYLQGLQPGEIDVQLDRL
                     RDTALVNTLFSDLYYGYLWFDGAAIVGAVALTYIFTSMGGGISLAIIVAAVASTYYTT
                     SIRRTRQRCRDDVVRELARHRMASENESAGWVNHFLSRFWLIYEPVLSATIIQQVDTV
                     LRDNCPPFLDSLSLTTFTLGTKAPLVDSVRTLVDTEDDVIIMDWKFSFTPNDVQDMPV
                     HKASTRINPKIVLTVRVGKGMVGAGMPILLENMSFVGMMRIRLKLISSFPHVQTVDLS
                     FIQPPSFDYELKPIGGSQFGLDVSALPGLSGFIQNQVHSALSPMMYSPNQFTLNLEDM
                     LSGTPLDATCGVLQVTIWHAQNLERLQIDGGVPRAYVSISLNGGPEIDRTRTREAHPS
                     PRFRETKYILLKNLEGLLTMSPMEDNGVLPPSRLGVTRFDLSTLNTNPSPGRMNKAIM
                     YSDAPVGALSYSLDYYPIMKPEVGPNGQLLPLPEVAAGVMRLTMHQARKLVKPEVLVS
                     QQLSVKARLLLNKKVIKETGVIKNTNDPVFDDVTEFLVIERFGSVITVELVDSNKLTM
                     DQVVASMSVKVDDLISATKRKQDWFPFPGQNEARMRMSAQFKPILMSGSINGSNSYRP
                     AIGILKFWLRGARDVKNVEALSGGKSDPYVMLSVNNMPVHGSAVMDDNLNPDWHQILY
                     APVHALAEVVRVELFDYQNSTADRSLGYCNVPVGVHADYDTEDDAFQYRSTGRKAYRE
                     PLKQPNGTTKGVLDFDVDFIPAMHVEGASFVEQNKRLEAQRYREAGVQQNVGIGSPLD
                     SPDAKLEAGAASHAGDANLRDEDDKDEDQGLVLTKEQLLSCPSGVLVFNIISGNIRRQ
                     RAQLEVIFDDSYWPAHTTERRKNYEWDEVGEAVIRELDVSNVWFRLRTGRRDSDIFAE
                     YTCSTRSLLERTLEEPAKIVLVPTEGNGSIDQTMLLNAPGAMLEKGMGASNAILDKGK
                     SFYRDDHSKMSGKVSDMSQNVAASGMDSSSKVASGEGIPMPAGGGEILISCRYIPMNI
                     HLEPVESVVNQGALTIELLHCSNLQSADAGGKSDPYVLFQDNGVTLARSKTVKRNLNP
                     KFNEVLPEVLIKSRLTHEYCFNVRDWDQVSASDPLGVAYVNLAELEPFETHERTYQLT
                     GKGALPESTITVRLTFHPRYLNNIVGKYGNMVGNMAQGVIGGIGSLGKGVATGGMSFG
                     QQLMSKVGLRTHHDKEPSSEEVAQQYAQQSASKQSAMQGADAPDKGGASQRELPMKDP
                     MNTSHFEVDNSNAYQFHPATDASSIHTSADRTSLSSRRRGIAHLFKKRS"
     gene            complement(<512418..>513215)
                     /locus_tag="MRET_1909"
                     /note="MRES_07590"
                     /db_xref="GeneID:38738675"
     mRNA            complement(<512418..>513215)
                     /locus_tag="MRET_1909"
                     /product="template-activating factor I"
                     /transcript_id="XM_027628536.1"
                     /db_xref="GeneID:38738675"
     CDS             complement(512418..513215)
                     /locus_tag="MRET_1909"
                     /codon_start=1
                     /product="template-activating factor I"
                     /protein_id="XP_027484321.1"
                     /db_xref="GeneID:38738675"
                     /translation="MTRQPEMGMIPNAVQGEIKALEKELDAAEVEMAKYMHKLHAPIL
                     KKRADVLAKIDGFWPQALTNCVSTNVYIDDDDHALLDHVTKIEVDRDLEDPRAAKIEF
                     HFSPNDFINDTVLIKEFKLLPEASEFTSQFDFASDTVPVKTPISWKSDEVNLSKKKPT
                     VGNINADKEDEEDEENEEDEDDFEPGSFFSSFFDNENPQVAGSIGRAIVEDLYPNAVH
                     HFEVPALFDEEDEDEEDEEDDEEDEDDGDREIDLEEEEKRPSKKQRK"
     gene            <513415..>516555
                     /locus_tag="MRET_1910"
                     /note="MRES_07595"
                     /db_xref="GeneID:38738676"
     mRNA            <513415..>516555
                     /locus_tag="MRET_1910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628537.1"
                     /db_xref="GeneID:38738676"
     CDS             513415..516555
                     /locus_tag="MRET_1910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484771.1"
                     /db_xref="GeneID:38738676"
                     /translation="MNAYASPEMRSRRYGTSQDNSASNARLQRISADQLSSSLAEPPP
                     DVFPPATQTKSETLLSALQNLKSNGGALYGENDDEWTDSEPDALPSNASEPKSMKERC
                     FLTEYHQRELQQQGLLEGMQADSSIMRKIPVPTVSDEEDVEAPKNVFTEQRIRTAMQK
                     NLDETVLPHNEADLKGEVPVADAAATALERLVNPTEDEAKPVRRKKVKKSTPKNDGEP
                     KKKKKKERSVTKDAKKPIKKTSQNASREGHDLEPIADLLHEPVADPVPAVSQEEQVLE
                     PDVTTSVTYFSADVPKPTMGETNSPTVTESQPADIPSRTPPNAVAERAPPNDASQMFA
                     MGYAAARTERGKMHLFNYNATRLAVSTYILYWGMFATLRKLWRWENPWVTGCMAMLYL
                     VVWWRGDLLAVFFLAACLYVATFRIWQVPGSEQVGEASRATSAPSSLTRPGTDSQSLL
                     MLAPSHETLQQVGDQVLVVAHGLADVQERVKNLMMWRNPIMTMRYLGWLILFGLLSVQ
                     ATTWMMMRLPGALIFVLLFILAPMIEYGHWHRTLELLCGITGVSVPDPAMPYPVTRTL
                     LDSILVGVPTDEEYLHEKLAQTHWEAERELRRLGQWIDANRIVDEKDDELTNRHPSSY
                     AGRSESSSLPRERHPSTMAPRLEKSDPEPLNNVIHDRAELESLSDYGSQLELTAKIDN
                     VDGESTTIMAHDNVQPYVMAHTPWNTQLESEHVPPPQAETPTQLTRADVGLDMTAPGP
                     VSVQESSRASPHPLTASSPPPMGPSLPVMSTSDAPVAARVESRAASIPLPVPPSMLTS
                     PPRTSGPPISRHASYSTLRESVMSSPFMPGQSETVPSFERQHKHTALMSPPVPTQAMY
                     TVSSPTPSGLRVPPAMSSPPQRPHSLTDGLYLAVFRKRLGHMIVLPTRVVFLMTYGPH
                     RRTTPPPGLSVEEEEDLVRSVHGRPFYPMLAPDEIVAMVEDEMAGRGQTEFTIAAVPL
                     ARIPQRYDILFEVPIERIRGLKKLRKSTPVLEECTEGLEMVLGEHERGIGLPAVIDRD
                     LACQRILALGPQRWAW"
     gene            complement(<516568..>518784)
                     /locus_tag="MRET_1911"
                     /note="MRES_07600"
                     /db_xref="GeneID:38738677"
     mRNA            complement(<516568..>518784)
                     /locus_tag="MRET_1911"
                     /product="E3 ubiquitin-protein ligase HECTD2"
                     /transcript_id="XM_027628538.1"
                     /db_xref="GeneID:38738677"
     CDS             complement(516568..518784)
                     /locus_tag="MRET_1911"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase HECTD2"
                     /protein_id="XP_027484599.1"
                     /db_xref="GeneID:38738677"
                     /translation="MTPPTSAWGRRPRPSSAAGPSSSAFPDLAASQQVSQTRRSRAAR
                     AAWSDAPASSFNPYPSRVEEMNARASQWRRTGQAPHSDLVPELVLDRHDSLESHTSRQ
                     AYASIVVRDKTAPAGASSGGAWASMFHARRTGTAASRTILQSIRAAELRQHRPPPLFN
                     DTLDPANDNIHRAIHTFTSRDTDDERHEAQIALAACLFDVAASCPSAPDVLAALEGSA
                     HVSRTCTEALASSVDASISPYVRVYDRERLTRIVDALTEALSWHVGAHGADTVPESLV
                     YALSCLYDANAHRPDPLARSRFYVAATELPSIVPAYAAWLQGASNICALPWSLTLGAK
                     AQILAWEAQSAMREASSEAWSQSAASWPECGTWPIQVSRATIVEDSFKAFSLASPGML
                     HRPLRVTFRDEPAQDAGGLRKEWLQVLCDTLQQQAPWFDLSQANEPQMHGLLYLHHTC
                     TDKEIHAAELLGMAVGLALFHQVTVPLRFAPALYVMLLAMAQGHAPPCTLDTLAQLKP
                     DLAQGLERLLHADAAEVEGMHLAWHIDTPHGPHDLRPRGSETGPVQASERDAYVARLC
                     AYTLLESVQAPLEALAHGFASVVAPASDRSPLALLTPHELATQLCGREEHTLDVEALR
                     AHTDLVGFPDRDAAGAQRIFANLEAFWHVWSTLAPDEQHALLGFITGCARVPALGVRS
                     LGLRIQHIELDPMQAARVPWSSTCTSTLFLPVYASTSELHAKIRIVVRHCTGFGLA"
     gene            <518850..>519779
                     /locus_tag="MRET_1912"
                     /note="MRES_07605"
                     /db_xref="GeneID:38738678"
     mRNA            <518850..>519779
                     /locus_tag="MRET_1912"
                     /product="essential RNA-binding component of cleavage and
                     polyadenylation factor"
                     /transcript_id="XM_027628539.1"
                     /db_xref="GeneID:38738678"
     CDS             518850..519779
                     /locus_tag="MRET_1912"
                     /codon_start=1
                     /product="essential RNA-binding component of cleavage and
                     polyadenylation factor"
                     /protein_id="XP_027484772.1"
                     /db_xref="GeneID:38738678"
                     /translation="MTNVLALPVEYVPSHATTSLFSSFRQRRPPSDDDWAHNEFDFEP
                     FVKNDLQIKLETDDQTCPRFQRGRGTCHLGGACTLRHCLTPSPPIPTNQTRDVSRRTV
                     CKHWLRGLCKKGDMCDYLHEYDLRRMPECRFFATFGFCNSTEDCLYVHIEPSVKRRRC
                     ERYERGFCELGPQCPKKHVRRTACPYYLAGFCPLGTECNMGHIKPFVPSPESRATTPL
                     LTHRPLTMMEAFGGAPGIQELPTDRHTGRAMIPAKDWAAAAELRKSTASQDMNARKLN
                     DVLCYKCGEYNHFANACPNSARLGLRDRGWRPM"
     gene            complement(<519785..>520366)
                     /locus_tag="MRET_1913"
                     /note="MRES_07610"
                     /db_xref="GeneID:38738679"
     mRNA            complement(<519785..>520366)
                     /locus_tag="MRET_1913"
                     /product="thioesterase"
                     /transcript_id="XM_027628540.1"
                     /db_xref="GeneID:38738679"
     CDS             complement(519785..520366)
                     /locus_tag="MRET_1913"
                     /codon_start=1
                     /product="thioesterase"
                     /protein_id="XP_027484773.1"
                     /db_xref="GeneID:38738679"
                     /translation="MAAASSTPAPLMTLDAACELAQKILDMLRDQNKTWDANLFRGAE
                     CFVSYAERDGVVYRQDQRSSTERPMRAEASKICLRMKVNGQLGNQFGTMHGGCLATIV
                     DTCSSFLTLLHSSGVAGEPWSMMGVTQALIVQYLKPTRVGKWIEVETTMRSISKTLCL
                     LHVNIYELDGRDGQRTAHTVTGSHNKMDIRPKL"
     gene            complement(<520407..>522430)
                     /locus_tag="MRET_1914"
                     /note="MRES_07615"
                     /db_xref="GeneID:38738680"
     mRNA            complement(join(<520407..522082,522108..522264,
                     522290..>522430))
                     /locus_tag="MRET_1914"
                     /product="anaphase-promoting complex subunit 5"
                     /transcript_id="XM_027628541.1"
                     /db_xref="GeneID:38738680"
     CDS             complement(join(520407..522082,522108..522264,
                     522290..522430))
                     /locus_tag="MRET_1914"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit 5"
                     /protein_id="XP_027484767.1"
                     /db_xref="GeneID:38738680"
                     /translation="MAGQPYLLQGHTVALLLIIAFFCLKRIPEEDRARRVVLLYVVRA
                     MENIDAPPANLDIMRHRLRIALSPFSKTYHELDAHIKAQFDMLESVDGLMQLFGEQLN
                     DCMHMIGDPNPGSQAEFSLLHRRSYVGLYVRRASFQFAMMLEHERMQLLQLCRAWRDG
                     DAHAVVDRWRTSAQAHAYYMWRESARRGEYVILKENLHAFFNYTLPGCDRDLHQHALL
                     NLAHFHTQTQGYQAARTVLDEAILLARTVGDTECIRACDHLLDQLSYLDPRPHQAGLL
                     TQQDAQESLQCGAYAPLALWKADMDRQQGRPLLDIIQRIYDTTWKPRPPIPTTQPEWE
                     PRPSIERCAACPSAILARTWLQLGVPLVAEVYMAHVRRLGSFRPEHWDELVVDTAITR
                     AFRETERGMYDQGVSALLEPSVLRQVTSLALHQRWQDAIWQILYTRARRQSHTSMLRR
                     IKALSPHVGEWYTPLPSPTQRSACDWLEEAQNMIQARQPHQGLEALMRALAASEARQL
                     YPLRRTCLAVLADVMVLSLGMPSEARALLDEILPQALADENGERRAYVHLVEAKYFIS
                     TKDLYQARMSLRRAALDYERTETWKDLASCLYMEARVAHALHDADHDDVQARYERAQA
                     QYDAALVAPCPSTLDAWVQLVRRLGAFSRRRDT"
     gene            <522509..>523153
                     /locus_tag="MRET_1915"
                     /note="MRES_07620"
                     /db_xref="GeneID:38738681"
     mRNA            <522509..>523153
                     /locus_tag="MRET_1915"
                     /product="phosphatase with a broad substrate specificity"
                     /transcript_id="XM_027628542.1"
                     /db_xref="GeneID:38738681"
     CDS             522509..523153
                     /locus_tag="MRET_1915"
                     /codon_start=1
                     /product="phosphatase with a broad substrate specificity"
                     /protein_id="XP_027484768.1"
                     /db_xref="GeneID:38738681"
                     /translation="MSHSRILIVRHGETNENVQGIVQGQLDTMLNEIGYEQAHKTGMA
                     LRHEPLSRIITSPLKRTLHTAEAIASFHPGIQVELDARLKERYFGEIEGRAFESPAHW
                     PAHAEGMEPRDQLRDRLASMWEDLKRDAQARPSIIVLVSHGGAISSLIHHVIVRSGDA
                     VFAPSITPHRCWNCSISDIHLPADAPGVIVRWADVSHLEDAAHKVVNVDENFTA"
     gene            complement(<523167..>524249)
                     /locus_tag="MRET_1916"
                     /note="MRES_07625"
                     /db_xref="GeneID:38738682"
     mRNA            complement(join(<523167..524182,524216..>524249))
                     /locus_tag="MRET_1916"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628543.1"
                     /db_xref="GeneID:38738682"
     CDS             complement(join(523167..524182,524216..524249))
                     /locus_tag="MRET_1916"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484769.1"
                     /db_xref="GeneID:38738682"
                     /translation="MIQTQSFLHREGRAPLLTSVRGASLETAEDDDDDDNEGQEVPQE
                     LVNEQVIHAGFLLKRSEKRKTWKRRWVVLRASQLALYRNEKEYLLLNVLNVSQMQAFT
                     AMEMKRVDFVICIMAPERTWYFRACDQQDMTAWLDALALARGKVSGDAVVSSNVQDTS
                     AAALLPPPIVEPTPVTAHAFSSSDDENDADEEPVHWAPHDTMPTAPPPEDGSRVIAQG
                     YLLKLGSRRKQWRKRWFVLTFDTLCYARTHMDVRPHRTIPTTAIFDAMESTMPSSCAP
                     MLSLSPGSIARLGFGAEVRSRSPLEPQSRAPSYYFQIVTATRTFQLCVPTEEDEIRWL
                     SALQTLLNRQRRSAK"
     gene            <524500..>524946
                     /locus_tag="MRET_1917"
                     /note="MRES_07630"
                     /db_xref="GeneID:38738683"
     mRNA            join(<524500..524632,524663..524682,524722..>524946)
                     /locus_tag="MRET_1917"
                     /product="NADH-ubiquinone oxidoreductase"
                     /transcript_id="XM_027628544.1"
                     /db_xref="GeneID:38738683"
     CDS             join(524500..524632,524663..524682,524722..524946)
                     /locus_tag="MRET_1917"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase"
                     /protein_id="XP_027484770.1"
                     /db_xref="GeneID:38738683"
                     /translation="MLGRASLLMSGAVTQRAVVRSISPVKECRRFASGGHGPSYNEPS
                     GYLFGEKPPAPGTKRVKDAWEMPWYLGMYGGAAVFALVMYFKPDRSVRTWAAPEAEKR
                     LDEAGIEWRYKPSPNSGYPNGIP"
     gene            complement(<524998..>526219)
                     /locus_tag="MRET_1918"
                     /db_xref="GeneID:38738684"
     mRNA            complement(join(<524998..525045,525113..>526219))
                     /locus_tag="MRET_1918"
                     /product="cation efflux family protein"
                     /transcript_id="XM_027628545.1"
                     /db_xref="GeneID:38738684"
     CDS             complement(join(524998..525045,525113..526219))
                     /locus_tag="MRET_1918"
                     /codon_start=1
                     /product="cation efflux family protein"
                     /protein_id="XP_027484765.1"
                     /db_xref="GeneID:38738684"
                     /translation="MESAASHAPTFMSDSDTTIYEDQPWFLDKPAHQHHGHHNEHGHD
                     HKHGTDWSDILDGGRNVTRIAILSLSLNMVVMLLKCAAGTYLHSLSLMAEASHAVSDS
                     LSDLLTLVCMYKARQRPSAKFPLGYGKLEPLGSCLSSLMLLLTSLGIGAQALFQFIET
                     VFPSYLAWANHILSWIPVLHEHHHHHSRDIENEHGKSLYGLALVVFSMLAKEAMYHIM
                     RKTARVAQSSVLEASALHQRMESLGSAMSLVTIMFSSFGYEWLDSLCGIIRALYNGMD
                     SWHLTLTSLGQLCDCSANPETIKEVQEQMECAVIQAQHLPELPTFTWNNVIVVSHGSG
                     LSMYVTLLLPSHTTLKRALAAEAWVQEYFHTHYTKIQILRIKMDIREKME"
     gene            complement(<526513..>527204)
                     /locus_tag="MRET_1919"
                     /db_xref="GeneID:38738685"
     mRNA            complement(join(<526513..527017,527049..527102,
                     527155..>527204))
                     /locus_tag="MRET_1919"
                     /product="essential protein that forms a complex with
                     Rli1p and Yae1p"
                     /transcript_id="XM_027628546.1"
                     /db_xref="GeneID:38738685"
     CDS             complement(join(526513..527017,527049..527102,
                     527155..527204))
                     /locus_tag="MRET_1919"
                     /codon_start=1
                     /product="essential protein that forms a complex with
                     Rli1p and Yae1p"
                     /protein_id="XP_027484766.1"
                     /db_xref="GeneID:38738685"
                     /translation="MSDAGVMAPCSAQDENKQIVLEQFNLDDVTQLEDLPLAKGRQQG
                     YEKGRIFGKMEGRALGREKGFDLWNELGYYKGVISMYKRMIQSQTSTIDDATRKKQRQ
                     WQQLESFEALWSLIPQYNDSSGHNPPPHQDDTQADTYNFGKLVERVRARYRLVCKALG
                     FDPPHSISPHMNTSGTSLTPNLPPQNMVRVAGQLVDQKHLHY"
     gene            complement(<527273..>528934)
                     /locus_tag="MRET_1920"
                     /db_xref="GeneID:38738686"
     mRNA            complement(<527273..>528934)
                     /locus_tag="MRET_1920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628547.1"
                     /db_xref="GeneID:38738686"
     CDS             complement(527273..528934)
                     /locus_tag="MRET_1920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484593.1"
                     /db_xref="GeneID:38738686"
                     /translation="MSGRFSHPLTEYPMSMYVTESFSGTDAPDPHAPASIGMDGRTAT
                     KKPTTLKGTYPLSGWNAARSTSAARTNTYPFIGKDQRDWNNASMYATQGNSVARHGSE
                     FPVGMDMLGATHDARTSAGASNWEWSAAPMVPRMPFPSEVVDESRYSSVPSTMHLGWA
                     PNVKPMPGVSHGLDTLPMRSIPAPYSSSYGLHGRKDTFANERPTQEITTLFLAGFPDD
                     ITEREFANMFLFAKGFEASMLKHPTTNGAQKPEESADSRRANEKLRTAGSEKEMRESE
                     SQTSRNKQIIGFAKFSTREEALQARDVLNGFRIDSDRGCILKAELAKKNLHTKRSVPF
                     VVSKHTHPVLSTRAMSMYDMQNVSQDGPMSAPAMLNSVRGMSVPRPLQSLDVYMNDPR
                     TTWNESLGSPQRAAYGTPEISPNNALGDVTRVNSPINDMVVRLESFSRNIPTYAGSNP
                     SAEDRRSDSPSAPCSSLGNADVGFQGADVMSSSLELPPRLQTRVSDDAISRAEQQFQH
                     LSMSRSTCSPLLNASQGVYEPHASASNSTPPVSLATDPLPSEASF"
     gene            complement(<529387..>530354)
                     /locus_tag="MRET_1921"
                     /db_xref="GeneID:38738687"
     mRNA            complement(join(<529387..529419,529468..529875,
                     529908..>530354))
                     /locus_tag="MRET_1921"
                     /product="HUS1 checkpoint protein"
                     /transcript_id="XM_027628548.1"
                     /db_xref="GeneID:38738687"
     CDS             complement(join(529387..529419,529468..529875,
                     529908..530354))
                     /locus_tag="MRET_1921"
                     /codon_start=1
                     /product="HUS1 checkpoint protein"
                     /protein_id="XP_027484592.1"
                     /db_xref="GeneID:38738687"
                     /translation="MRLRAYVNNVSLLSGLAQTSASVASPCYLHFTPTTLRLISPAGQ
                     YGVQIWATLDVEAVFSNYRIESHHDNEIIIEVSADSLARVLRSASGALEVMLRLGKRE
                     KDPLLSWSIVMTSQSGTRLDVMQEIVVRILRQSEYSLISEPLCPKPDVYIVTPPLSEM
                     RLVNDQMRSLSSHVVLAANHDGTLKLALADDDVIGSAYWTRLEHPNVQGDMEQDLLTE
                     SSRKKFHEVHMHTKALQGVLSCSMLAKSTVACFCSGYCVVFYVYLAGQSRQTRPMQRT
                     GNNDRGVLNFVVAGLAHDE"
     gene            <530529..>531879
                     /locus_tag="MRET_1922"
                     /note="MRES_07635"
                     /db_xref="GeneID:38738688"
     mRNA            join(<530529..530551,530592..>531879)
                     /locus_tag="MRET_1922"
                     /product="oxidative stress survival svf1-like protein"
                     /transcript_id="XM_027628549.1"
                     /db_xref="GeneID:38738688"
     CDS             join(530529..530551,530592..531879)
                     /locus_tag="MRET_1922"
                     /codon_start=1
                     /product="oxidative stress survival svf1-like protein"
                     /protein_id="XP_027484443.1"
                     /db_xref="GeneID:38738688"
                     /translation="MSGWGSWLTGSQPADAKPADGACPKENFFPVTDKYDQTQLLGEL
                     APTDLHWTCPSGLSTETSTWYTTLENGAFFMNQIIYSPVGLFQPQVQMTFRYYDPNTG
                     ENVWKSKNVDSFQVLPNNKHSCKSSAFTIDFKDESNGSQSYNVSATLDNDVQLMYSMT
                     RPSEAKGWKLGQGPKGGFSYFGENENSPDGYVVHRFWPYTKTSGMLVINGRAMEANGQ
                     GMFVQAIQGMRPNLVATRWNFGNFQSKENHGTSAIVMEFTTTSGYGKVDASSQTRVPQ
                     TVTIGSVVCGGKLVSVVGATRASNASEVPATRVQHESCARDELTGYDVPQVMKFVLQG
                     PAVVGVDKPSADTVVQASMEVSLGSPSATKGLIEKVDVLAEIPYMVRKLVNYVAGAKP
                     YIYQTLNPTQLKLELPESVAQAIGTDSSIEVPGVLFEEHTFISE"
     gene            complement(<531945..>532349)
                     /locus_tag="MRET_1923"
                     /note="MRES_07640"
                     /db_xref="GeneID:38738689"
     mRNA            complement(join(<531945..532041,532076..532192,
                     532228..532310,532347..>532349))
                     /locus_tag="MRET_1923"
                     /product="protein transport protein SEC61 subunit beta"
                     /transcript_id="XM_027628550.1"
                     /db_xref="GeneID:38738689"
     CDS             complement(join(531945..532041,532076..532192,
                     532228..532310,532347..532349))
                     /locus_tag="MRET_1923"
                     /codon_start=1
                     /product="protein transport protein SEC61 subunit beta"
                     /protein_id="XP_027484594.1"
                     /db_xref="GeneID:38738689"
                     /translation="MSEKKQGTHTPLTQAQLAALASRNSSAMRRKAAVQAANKPHSTR
                     EAGAGGSTNTMMRINTEDSKGLSVDPVIVLVLSVAFVLSVVLLHILGKVARYFIK"
     gene            <532505..>532778
                     /locus_tag="MRET_1924"
                     /db_xref="GeneID:38738690"
     mRNA            join(<532505..532672,532707..>532778)
                     /locus_tag="MRET_1924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628551.1"
                     /db_xref="GeneID:38738690"
     CDS             join(532505..532672,532707..532778)
                     /locus_tag="MRET_1924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484454.1"
                     /db_xref="GeneID:38738690"
                     /translation="MKFEQLKVRPKKLARKAPCAAEFASVLACWASSQDLRSQSECAE
                     VTKLLRDCMTTAQQGPRKQAKPTINYHLARFSKHV"
     gene            <532965..>533585
                     /locus_tag="MRET_1925"
                     /note="MRES_07645"
                     /db_xref="GeneID:38738691"
     mRNA            <532965..>533585
                     /locus_tag="MRET_1925"
                     /product="acetyltransferase (GNAT) family"
                     /transcript_id="XM_027628552.1"
                     /db_xref="GeneID:38738691"
     CDS             532965..533585
                     /locus_tag="MRET_1925"
                     /codon_start=1
                     /product="acetyltransferase (GNAT) family"
                     /protein_id="XP_027484589.1"
                     /db_xref="GeneID:38738691"
                     /translation="MSVRTILADTPELLRRAYDLRLEVFTGEQGYDPEVDSYDRVAVP
                     MLLQHEGTQDVVGVIRILPAPLPKIKHEFYARSELVSDALPGTGRSEADMKASFLEHQ
                     VVQEDERGVRWYSGAKIGRLAVKRDFRGQGYGRIILRDAEEWVRRTVQESQTASGRFG
                     VAFQLSSQEPVRGFYEAEGYRIVGDVYLEEGQPHIHCEKRVLVGEV"
     gene            complement(<533595..>535958)
                     /locus_tag="MRET_1926"
                     /note="MRES_07650"
                     /db_xref="GeneID:38738692"
     mRNA            complement(<533595..>535958)
                     /locus_tag="MRET_1926"
                     /product="PPR repeat containing protein"
                     /transcript_id="XM_027628553.1"
                     /db_xref="GeneID:38738692"
     CDS             complement(533595..535958)
                     /locus_tag="MRET_1926"
                     /codon_start=1
                     /product="PPR repeat containing protein"
                     /protein_id="XP_027484591.1"
                     /db_xref="GeneID:38738692"
                     /translation="MLRRCVQSAGRWRLMPLLRPITHVAHVPEMGMLRSGFETRDLEQ
                     VWEAWASLRTQQQLHLLRRNDFADLLALVRANLVHTPIGTRRKAAWKERCIEWGLHAA
                     ERRDLFGVLGWMRIELLCDDADGAIQLFDAYFDARKRARVPANDSVHILDAGQAKEPV
                     RDTLEMLILAHAMKHDLAGLVRTMQSFDVGTHTELFFDMAHARRQYTKLLRLLHGTDT
                     TATELAAQVYERAFDWISHAELARGLLGGCGGRAGPNRIARLLGSLLARGDVTNAWRL
                     YSTAKAAGIASTAEASGWLAVEQLAQPGQLGAWTDSAWVVCLGGFLSAGRLDLAAHVW
                     RDIVGMRQRMPEAWPPMAVWNAMLDGYARSGRYDLASKTWRVLCGKARPEHLPLALET
                     SQMLPVPSHGPDAVCYTTMIAATFRERRADEGMNLYHALRAKQARQELHVPVETYNAV
                     LHGLCLTHHLDKAYALLRSMGQNGVPSPSITTINVLLRAQARQKQLHAMADTLRCIAP
                     LGLHPDVVTFTTVLDALLRTSTSPAMAQQAVQQVMQLMQSMDVQPNSVTLTSMIKACL
                     HTKDDVPPRIGVALQLMHTMCTNLKVAPTAITFETLILGLVPFSSRLDREAYELPPSL
                     SQPWPPLWPNEAPPQEPLPAVTRLVLLLWHMMVQQHITPTPDTYRSLVRLLMAPQAPM
                     FCFRRGVCITDALLHAHGALLRHAQAPAGVMPPASPPALASWTAVLKALMRPNPAVDA
                     EVRRQVLEAVLQHFRTSPHGAKMYLNTSQDRHAHLARIVQLAEHSIE"
     gene            <536080..>538128
                     /locus_tag="MRET_1927"
                     /note="MRES_07655"
                     /db_xref="GeneID:38738693"
     mRNA            <536080..>538128
                     /locus_tag="MRET_1927"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628554.1"
                     /db_xref="GeneID:38738693"
     CDS             536080..538128
                     /locus_tag="MRET_1927"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484590.1"
                     /db_xref="GeneID:38738693"
                     /translation="MPERDAVPLLEEGHALGDDEHVSMLEEDAQYVMSPRPTRYLYAP
                     MSYEQAMTPQRPMWHPLYWYAFAKEHWHIVDSLRPPERFYSAISRVGTTLRVLWPQNR
                     MHQTILIVIALWIMLSYTSWAVSESLPRRKVDISAKLDYATRLSEELESSILEPRPGD
                     GHEAERPEWRRLRCFSTRRPLRFSDAIACQEHWNFTMPAFPHVDSLTSTDHAYLHINP
                     VINEAQGWYPSKRQEASSDDFANRPSPRAPADIYVVSRDVSESDPLRDKILVDVIATH
                     DKNAWPLLTHAYVAKMSHSLFSEGLAIVTHQRPHGLYSHPNHDPLRFDILVSIPSHQP
                     IAGLSIDMREGNIDVLTETAFANAKRIRHLAYHRPKTLLEWMYQSFKDMELTAAELKA
                     AFRIRDQEHFFGSLTLHTQYGHIYVNGHIRSTSEIIAKVMHGVIDSAAQLYANFIYMT
                     TEKGRISLLERASAHASKLLHLSTSDGFIESKPGSIMYGTKAVVTANNGSVTGPALWH
                     ANFSLAMSAPHGHIDAAVAVQKPALVDVPYDDFLRTEQGRRVEAQFAAHGNVSIKYVE
                     QTPGVPLKSTASSEVGHVNVVHDSNYEGKLRVQGAQVHLSSSQMPLGRHLAPVDDHRS
                     ESPAWLASHVVWDEQARGPAPKMDPSTPVHLEPGKSPLDYGAESHATSKEGTASIFVT
                     "
     gene            complement(<538143..>539234)
                     /locus_tag="MRET_1928"
                     /note="MRES_07660"
                     /db_xref="GeneID:38738694"
     mRNA            complement(<538143..>539234)
                     /locus_tag="MRET_1928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628555.1"
                     /db_xref="GeneID:38738694"
     CDS             complement(538143..539234)
                     /locus_tag="MRET_1928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484366.1"
                     /db_xref="GeneID:38738694"
                     /translation="MSSSSRNVTAWDLAAMRVSRLQASDGMQALSRPSSVKSTYGVRP
                     LPINLGSMDDLGLPSSLAPENASVPSHGMPSRSRRDPLDLFDTSFVLKQDTLSPLPHH
                     WEGLSDATIRLRRQQRVVDKSVERSSPYVPASDAGPMRARIPIMQREFERANAAYQRS
                     LFSTRSQSPSKDVSLNDAHDPAERVRQALPHRILWTDKNELAWKQDRYGWPFSPKREE
                     CIPDSLLLEALHYYAAQFFHTNDVLSPALAAATPSDSPAGVCEQIRDQHAADEPDMEP
                     GSELWEYWARHSLGCGRTMLSRLDGSALVALACLVQAYTQKLLPKHVPSSPKEELDDA
                     WLNERPHKRQKRQERRAQVREFFHTRTCT"
     gene            complement(<539276..>540058)
                     /locus_tag="MRET_1929"
                     /db_xref="GeneID:38738695"
     mRNA            complement(<539276..>540058)
                     /locus_tag="MRET_1929"
                     /product="phosphomannomutase"
                     /transcript_id="XM_027628556.1"
                     /db_xref="GeneID:38738695"
     CDS             complement(539276..540058)
                     /locus_tag="MRET_1929"
                     /codon_start=1
                     /product="phosphomannomutase"
                     /protein_id="XP_027484595.1"
                     /db_xref="GeneID:38738695"
                     /translation="MSNVPSFAERKQPGVLCLFDVDGTLTPARQQVSDEMLDVLKALR
                     EHVAIGFVGGSDLSKIREQLQLAGHEDIVHQFDYGFAENGLTAYRLGSQLPSQSFINW
                     LGEEKYKKFVKFVLAYISQLDIPVMRGTFVEFRKGMVNISPIGRNASVAERHEFEAYD
                     KEHQIRAKFVEALKNEFPDYGLCYSIGGQISFDVFPAGWDKTFSLNHVKKDDWKEIHF
                     FGDKTFEGGNDFEIFTHDEVQGHSVTKPEDTMAQLRELFLHL"
     gene            complement(<540187..>540970)
                     /locus_tag="MRET_1930"
                     /db_xref="GeneID:38738696"
     mRNA            complement(join(<540187..540691,540716..540904,
                     540933..>540970))
                     /locus_tag="MRET_1930"
                     /product="protein CWC21"
                     /transcript_id="XM_027628557.1"
                     /db_xref="GeneID:38738696"
     CDS             complement(join(540187..540691,540716..540904,
                     540933..540970))
                     /locus_tag="MRET_1930"
                     /codon_start=1
                     /product="protein CWC21"
                     /protein_id="XP_027484651.1"
                     /db_xref="GeneID:38738696"
                     /translation="MYNGIGLQTARGSGTNGYVQRNLSYIRPRDSAPTQRLEEVSKPR
                     STQPDAAILDHERRRKIEIQCIELQDELEEKGLPDDEIQARVASLRRGLRARLERAPK
                     QYFSHTHEETKQLRPSDTHNRGAAKEIEAQTMQRALKIRPDYEEGQAFDPVWQERRKW
                     ERIEQYERRREVASGSESASSRISRWDREERPSPGSSYREHSPPKRSHVSYDDVYDAP
                     PADVSSRTPSPPPTTERPLDVHPVT"
     gene            <541148..>542074
                     /locus_tag="MRET_1931"
                     /note="MRES_07665"
                     /db_xref="GeneID:38738697"
     mRNA            <541148..>542074
                     /locus_tag="MRET_1931"
                     /product="CCR4-NOT transcription complex subunit 9"
                     /transcript_id="XM_027628558.1"
                     /db_xref="GeneID:38738697"
     CDS             541148..542074
                     /locus_tag="MRET_1931"
                     /codon_start=1
                     /product="CCR4-NOT transcription complex subunit 9"
                     /protein_id="XP_027484652.1"
                     /db_xref="GeneID:38738697"
                     /translation="MGDAQVPVNAVPSTDAMTAVDLHHLITQFCQRPDPADMMAPNAH
                     ALPGSSAQREHALLELSKKREQYEDLALVLWNSFGVMPSLLQEIISVYPLLSPPVLTA
                     HASNRVCNVLALLQCVASHNDTRGPFLQAHIPLFLYPFLNTTSKSRPFEYLRLTSLGV
                     IGALVKQNDKSDVITFLLSTEIIPLCLRIMETGSELSKTVAIFIVQKILLDDLGLNYI
                     CQTYERFYAVGTVLSNMVAQIVESQAIRLLKHVVRCYLRLSDNPRAREALRSCLPTPL
                     RDATFSQLLKNDHITKRCLATLLLNLSDRPEQ"
     gene            complement(<542242..>543864)
                     /locus_tag="MRET_1932"
                     /note="MRES_07670"
                     /db_xref="GeneID:38738698"
     mRNA            complement(<542242..>543864)
                     /locus_tag="MRET_1932"
                     /product="double-strand break repair protein MRE11"
                     /transcript_id="XM_027628559.1"
                     /db_xref="GeneID:38738698"
     CDS             complement(542242..543864)
                     /locus_tag="MRET_1932"
                     /codon_start=1
                     /product="double-strand break repair protein MRE11"
                     /protein_id="XP_027484649.1"
                     /db_xref="GeneID:38738698"
                     /translation="MTSHGEDPDEVRFLLASDTHIGFMERDPVRGSDSINTFEEILTI
                     ARQHRVDFILHGGDLFHENKPSRPTMFKTMALLREYTLGDDPVSIELLSDPYSDSRPG
                     TKFPSVNYEDENFNVSIPFFSIHGNHDDPQGLGEEGSLSALDILSAAGLLNYFGRMTL
                     PGSNASRKRPSSTSSPLLALRPVLLRKGNTHIALYGMGNMKDERISHELMEKHVCMYR
                     PAEATSEWFQVLALHQNRASHNPKAYVPEHILDNSFHLIVWGHEHEQRISPEAVSEKN
                     YHISQPGSSIATSLSPGELSPKSVAIVHVKHKDFKLEPIPLQTVRPFVMKDIFLPVEA
                     RKEGVDITDRMSVTKLLRSHVESLISTASLQWSERFALIPETERPPPMLPLVRLRVTY
                     DTHLPLGNIVRFGQEFTGRVANPNDVLQLKLIKQRQTQVSRPILSAAHLDQDMLPAEK
                     LERVNLSSLVMENVRAQHFDLLNASQLQKSVMGYVEKDERDAIESFLNTSLQAVEQRL
                     ARQQMQESQLQSELERICAQQSCVDQPERTVG"
     gene            complement(<543917..>544564)
                     /locus_tag="MRET_1933"
                     /db_xref="GeneID:38738699"
     mRNA            complement(<543917..>544564)
                     /locus_tag="MRET_1933"
                     /product="phosphatidylglycerol phosphatidylinositol
                     transfer protein"
                     /transcript_id="XM_027628560.1"
                     /db_xref="GeneID:38738699"
     CDS             complement(543917..544564)
                     /locus_tag="MRET_1933"
                     /codon_start=1
                     /product="phosphatidylglycerol phosphatidylinositol
                     transfer protein"
                     /protein_id="XP_027484650.1"
                     /db_xref="GeneID:38738699"
                     /translation="MWFHGTAFLGYVAATALVRALPYEPNREPMDLVDIMEHEATAKG
                     IPLTKDLYPKPASGRSWEWEWCNDVDARQYLMELEAVELSPDPPILGTNLTFHGTGSL
                     NGPITNGSYVDVSAYLGFLRVYAERMDLCEVLDKNNVQVRCPMEPGLYDITHVVEIPS
                     GRVPPIPFRFKITGMSQDNKQIACIHGKIRFYNSLSAWTRWFQVAWQFLVSSMYI"
     gene            <544660..>546216
                     /locus_tag="MRET_1934"
                     /note="MRES_07675"
                     /db_xref="GeneID:38738700"
     mRNA            <544660..>546216
                     /locus_tag="MRET_1934"
                     /product="RIO kinase 2"
                     /transcript_id="XM_027628561.1"
                     /db_xref="GeneID:38738700"
     CDS             544660..546216
                     /locus_tag="MRET_1934"
                     /codon_start=1
                     /product="RIO kinase 2"
                     /protein_id="XP_027484647.1"
                     /db_xref="GeneID:38738700"
                     /translation="MKLDATDVRYITPDEFRVLTAVEMGSKNHEVVPTHLIAQISSLR
                     HTGISKLLSGLLKRRLVARVRNNVYDGFRLTYGGYDYLAVRALSKRKSVYGIGNQIGI
                     GKESDIYIVSTEEGECRVLKIHRLGRISFRNIKEKRDYMGKRKSASWMYMSRLAAEKE
                     YAFMQILHQHGFPVPTPVDQNRHTLLMSYEDAYPLRQISVLPLDQIRRLYSALMALIV
                     RLARAGLIHGDFNEFNLLVREIRNEEEDDSVSAESDTPATDDRSEGVEEHGKGFTRIV
                     KTDSASEEESGEEDEEEDDTSPLNQVVELGEGVQVEPILIDFPQMVSTDHPNADMLFD
                     RDVNCVRRFFRKRFRFESEEFPTFAEVMETVRRDESERLDVLSRASGFNKSLDQDDLL
                     ASHYERMHIQDDAKEEEDEDDEDEEGDDEEGDDGERVSEESELEKGGADVERVERARH
                     DTSAARPAKHSHDVSYVASRTAASRAHAQRQSSKHHGRKAQSTKTGRRHGGGKAKYSS
                     ARTIQDSFAF"
     gene            <546277..>547407
                     /locus_tag="MRET_1935"
                     /db_xref="GeneID:38738701"
     mRNA            <546277..>547407
                     /locus_tag="MRET_1935"
                     /product="palmitoyltransferase ZDHHC9/14/18"
                     /transcript_id="XM_027628562.1"
                     /db_xref="GeneID:38738701"
     CDS             546277..547407
                     /locus_tag="MRET_1935"
                     /codon_start=1
                     /product="palmitoyltransferase ZDHHC9/14/18"
                     /protein_id="XP_027484648.1"
                     /db_xref="GeneID:38738701"
                     /translation="MTPRHLVSGAGNALSLCRNRIIVSKDAPWAFFITGGLLTAGPAC
                     WLAWEAPYLSSAVSVAPVVLFVYFWLSSLVSMVKAALMNPGILPRQLDAVPDAAPTDA
                     SFDIERPVDRPQDRLIEMRRVDDGGDGTLGTMTSIPSVWCTTCHMYRPPRTSHCRSCN
                     NCVDTLDHHCIFLNACIGRRNYTTFYAFLVHTALLLLIGMVGCILKLYYIASPKTSKQ
                     GRPQAHPSRGFVHALKTTPESAVFFFLSFVWTIPVMCLWIYHTWLILQNRTTVEQIRL
                     ESTGSMYDVHRSRSGYWADDHACLRAVSRYMIHLRNAMVPKEFSMPMPRALQSNRTRP
                     PRRTRAPFQRRNPIMNALHVLSRPVPPVSTLWYPQRPPSLVQ"
     gene            <547521..>549113
                     /locus_tag="MRET_1936"
                     /note="MRES_07680"
                     /db_xref="GeneID:38738702"
     mRNA            <547521..>549113
                     /locus_tag="MRET_1936"
                     /product="sister chromatid separation protein"
                     /transcript_id="XM_027628563.1"
                     /db_xref="GeneID:38738702"
     CDS             547521..549113
                     /locus_tag="MRET_1936"
                     /codon_start=1
                     /product="sister chromatid separation protein"
                     /protein_id="XP_027484645.1"
                     /db_xref="GeneID:38738702"
                     /translation="MPLDVTRETDASSLRVATLRVILQDYGIVVPGHARKSALVAAFN
                     EHVRPKLPSASQRAGPKPEPSLRIGTPGIRRPSTANACSAANDIRFSDENPFQSSTPR
                     KKRLSQAAPPTTPVATPTPPYTRSPDKVRRMAQSSDRPQWRAAQLAPVWQQIRARWQE
                     TLVRWALWLCLLVWIWYCWQSRLEGFCSTGADLPSWDRPTNVWQALQKTLTPVCTPCP
                     DHGICVGGRLDACDASDYKVEEPMQGHIPLLAQLIPFSWRASQCVPDTHKLLLASELA
                     DAVVDYLAHFHGQVRCKLALPHGQAPLQEPLGRYALPERQVRDALETRTIESVDAATF
                     DFLWHMVMDGLLEHAPGDMQAYTHQTQRWLVSRRKIMPFSCRLRMYVLDWVWRYRMVL
                     LTILVAVVSTCALSRSVQRRRVRRHVVATHAQVVFERLKLQAAQAVSDGTLVRGLPVT
                     HLRDQLLQAELNPRVRRQLWQHVAKVVERNANVRTRQAQWHGEWQRIWEWMGPVHLDE
                     PAMSRTAPSSPGQEDAPPTPQP"
     gene            <549215..>550273
                     /locus_tag="MRET_1937"
                     /note="MRES_07685"
                     /db_xref="GeneID:38738703"
     mRNA            <549215..>550273
                     /locus_tag="MRET_1937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628564.1"
                     /db_xref="GeneID:38738703"
     CDS             549215..550273
                     /locus_tag="MRET_1937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484646.1"
                     /db_xref="GeneID:38738703"
                     /translation="MREHSSPSAKSCRSVRSTASSPGRRPDLLRMVQQPAALSYAATP
                     AVAQAATDLGPRSDTISHTSAAQYTSSQAERSLQASLQHDMRHKWQPPDELEPMPAAH
                     VMPESKEVRHVCFDERALCRQQAQRKWHYEARIAKRPSAQSHTQKRHHMDVFIQQLQS
                     QIECASSLWSSFLPQEAAPNQSRMARAAVAMPQPPPRTWSGAPSWRWVWHVSMELHAP
                     LLTPSLHLRRGVSGQLRGRASSIVACALRSQVDRDASPHANVILRWYPSYVLRAMLRL
                     LSYTPSDDRLLWAVSQPRRISYVVPLTSSFSTLLPPLTEAMVTTCLELALVFTQLYLT
                     ILLAIVQRWLSIFHFFLQ"
     gene            complement(<550247..>551021)
                     /locus_tag="MRET_1938"
                     /note="MRES_07690"
                     /db_xref="GeneID:38738704"
     mRNA            complement(join(<550247..550403,550432..>551021))
                     /locus_tag="MRET_1938"
                     /product="20S proteasome subunit alpha 7"
                     /transcript_id="XM_027628565.1"
                     /db_xref="GeneID:38738704"
     CDS             complement(join(550247..550403,550432..551021))
                     /locus_tag="MRET_1938"
                     /codon_start=1
                     /product="20S proteasome subunit alpha 7"
                     /protein_id="XP_027484654.1"
                     /db_xref="GeneID:38738704"
                     /translation="MASQGTGYDLSASTYSPDGRIFQVEYATKAVENAGTAIGVRTKD
                     GVVLGVENLIPSKLLVPGSNKRIFGVDRHIALTSAGLTADGKHLAARARDEAENYLDT
                     YKEKTSVKTLTERVALYVQAFTLYSSVRPFGASTIIGGVDAVRGPQLFVVEPSGMFWG
                     YHGCAVGKGKQFAKTEIEKLGLETMSMEEAVIEVARIIYKAHDDAKDKEFELELSWVG
                     PDGRHTSVPAALREEAIRRAEQSLEEEMED"
     gene            <551171..>552133
                     /locus_tag="MRET_1939"
                     /note="MRES_07695"
                     /db_xref="GeneID:38738705"
     mRNA            <551171..>552133
                     /locus_tag="MRET_1939"
                     /product="U1 small nuclear ribonucleoprotein 70kDa"
                     /transcript_id="XM_027628566.1"
                     /db_xref="GeneID:38738705"
     CDS             551171..552133
                     /locus_tag="MRET_1939"
                     /codon_start=1
                     /product="U1 small nuclear ribonucleoprotein 70kDa"
                     /protein_id="XP_027484655.1"
                     /db_xref="GeneID:38738705"
                     /translation="MTHLLPPPLLRLFAPRPPLEYAKPLPGDKDPNARPAPRGVQQVE
                     QGKIRPLEGVAAFLERARQEISQHPTDTAEESDAVVTQTEMRREARAKERAETQKRMM
                     DTYRPKEDTHAAGDPFKTLFVARLSYDTTERELAHEFERYGRIEDIHLVRDKHGRSRG
                     YAFLLFDRERDMRTAYSRAEGVHIDGRRVLVDVERGRTVSDWKPKRLGGGLGGQSRKP
                     KQKVVVDLTRGPRGYGGFRGGRGGGFRGRGRGRGGFRGGGGGARDSGRDRSYGGDRFS
                     RPRDHSYRDRDGLHDGSGGSLSYGAPMRTYDDRAPKRMRYDAWP"
     gene            <552212..>554494
                     /locus_tag="MRET_1940"
                     /note="MRES_07700"
                     /db_xref="GeneID:38738706"
     mRNA            <552212..>554494
                     /locus_tag="MRET_1940"
                     /product="dolichol kinase"
                     /transcript_id="XM_027628567.1"
                     /db_xref="GeneID:38738706"
     CDS             552212..554494
                     /locus_tag="MRET_1940"
                     /codon_start=1
                     /product="dolichol kinase"
                     /protein_id="XP_027484497.1"
                     /db_xref="GeneID:38738706"
                     /translation="MGKPDDSDASVASLAGQAGGTCWARASAHLSPNRGPLARVRATA
                     QHSDDDSENDAEVSSDARAPSPNARTCPMSYPLAKPHCDRLAGKVRPAIKSEANASLA
                     RSLCECALFVCGVVAVLIRMVHSVPEIRDKACGVIVLSTFVLVCFACHARRACGIWAT
                     QISCLRKTDPSDPLYALLLPLVSSAQLLDIAPEAMQHGGGALAPPWMQVGRRGTWRAD
                     RVGASPDRIVGRGALLDLHVICSFVFCVHLMASQLARAYAKRRGSHAHEGPTSRLLMC
                     FYTFSLLVAVAGVGVQVLARSSGYGHLVLSHTPTWATFLIAVLYQCLLFLCTRVARQN
                     CTLGELAMIGGVGTALWQETVISTMARLVPSYAQYYFREPSAIVLGQLALVAGMLLIG
                     LVLSPLLVLSRNLAQRPTHRLRWPLKRNLHRRLLALSFFLLSAAMVLCVLSPWLAWQL
                     HRRSAWLYFARFMLQGPHWWSRLALLVYWGLLCNTALLSIQLMVNRMWQYATVGDQVK
                     ASSRALPPSTAPSVQPQRTVPTATERASTLAATQFAERGEREESTSLGPRVAVSVNGR
                     RKFFHALAVLLFVPGIAWDPAFMHVAFSAALALFVLCEYLRYCAVFPLGAMLHFFLSQ
                     FLDSKDCGLVILSHAYLLTGCAAGVWIESQSRITQQLGVLVLGVGDSVASIVGRQYGR
                     IHWPLSSKTVEGTLGFVVSMTASVMVLRMLRLVEAFHTGALCAIMTLLAVIEGVSEQN
                     DNLVLPLSGIFLTSMIPLRR"
     gene            complement(<554514..>555183)
                     /locus_tag="MRET_1941"
                     /note="MRES_07705"
                     /db_xref="GeneID:38738707"
     mRNA            complement(join(<554514..555143,555169..>555183))
                     /locus_tag="MRET_1941"
                     /product="ESCRT-I complex subunit VPS28"
                     /transcript_id="XM_027628568.1"
                     /db_xref="GeneID:38738707"
     CDS             complement(join(554514..555143,555169..555183))
                     /locus_tag="MRET_1941"
                     /codon_start=1
                     /product="ESCRT-I complex subunit VPS28"
                     /protein_id="XP_027484496.1"
                     /db_xref="GeneID:38738707"
                     /translation="MNVYEEQKLYHTSQERERYETMATLYSLITCLDYLERAYVRGAV
                     PDDAYATQCSRLLGQYKTVIKLVTDPTQPPPYVFRDVHDFMRYFHMDHPAAVHRLVLG
                     IPATVEHGESQAPSMSAHVVAETTQNFITLMDALKLQMRAKDQLHPLLSDVLSAYAQT
                     GTEPEPLRAKLLDWLIALNQLSASEELDEAQAREMLFDVEQAYTAWFKGLARGA"
     gene            <555249..>556808
                     /locus_tag="MRET_1942"
                     /note="MRES_07710"
                     /db_xref="GeneID:38738708"
     mRNA            <555249..>556808
                     /locus_tag="MRET_1942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628569.1"
                     /db_xref="GeneID:38738708"
     CDS             555249..556808
                     /locus_tag="MRET_1942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484495.1"
                     /db_xref="GeneID:38738708"
                     /translation="MAEAARPLVLDARHASFTSVVHIHADTSLRISDLKQSISEYVRT
                     RQCSREGWPQASGMRCIHRGGILGNDVSLAALFSEEQPVVVHVVVQPEAWVPFAPTDA
                     PAAPAPPPTPPAQDDSAASPLATLQSLPRAELAPMLSALYMTLASYYAYYEDLCESLA
                     RPCVLARPVPMHDVERVDDPAVRAAAIRMIESHIMHWTPLRAESEKACTEEPRYEHVT
                     LCHLPFLLRTMSPRAPTHLLPLLETRIVTLLMLYAHFHAHDTERRDTPSVHRQSWPVT
                     RRDWLALLGFLLRMAGRTLMFVAFFLPNYLADHLWHVLAALLVFHVAAAMWFVHRRRT
                     QAQAAASSAAPSPPVRAAPSAPLSPTELTLEIPRLPHRMPTVPPTTCRYWMQRMAWFG
                     LEEEEVAMGFEHVPPTEPRRILWEARAWPAQQQRPMPPRPPAPAVVPHVIKALIVFLM
                     TLEPEIDKLRSDAILMRKDAICALARRWKELQEQHKNEAALSGSTPSILLHPYARRVL
                     LEEERRSAQLT"
     gene            complement(<556720..>557778)
                     /locus_tag="MRET_1943"
                     /note="MRES_07715"
                     /db_xref="GeneID:38738709"
     mRNA            complement(<556720..>557778)
                     /locus_tag="MRET_1943"
                     /product="tRNA-dihydrouridine synthase 1"
                     /transcript_id="XM_027628570.1"
                     /db_xref="GeneID:38738709"
     CDS             complement(556720..557778)
                     /locus_tag="MRET_1943"
                     /codon_start=1
                     /product="tRNA-dihydrouridine synthase 1"
                     /protein_id="XP_027484494.1"
                     /db_xref="GeneID:38738709"
                     /translation="MQGGAPRPWYQYVAAPMVDQSDLAFRLTTVQFGATATWTQMYHA
                     QDVLTDVDLYERARRALELGRHAPENHDIVTGKRAPQIVQLAGNDPDDIVRAARQFLP
                     VADGIDVNLGCPQTRAQVGHYGGYLLRRRDWPLVEQIVQALSQACPVPISTKIRLCDA
                     ATDTYELGQRLAHAGSSLITLHARHVAPNRRRAGAAKLEHVRALVKALHDQGLHASQP
                     SGRTRVLSNGHVRTWHDVPANLAYTQADGIMVGEPLLVHPNLFAPHRGPAMSTYLDMC
                     ARYPHDTSLPRIQQHVRYMLRGQTPSRETRALHDAFMAAPDVRAMQSIMSAAPSASLP
                     REAHDVHRDAEESTGCSR"
     gene            <557879..>560527
                     /locus_tag="MRET_1944"
                     /note="MRES_07720"
                     /db_xref="GeneID:38738710"
     mRNA            <557879..>560527
                     /locus_tag="MRET_1944"
                     /product="kinetochore protein Spc7/SPC105"
                     /transcript_id="XM_027628571.1"
                     /db_xref="GeneID:38738710"
     CDS             557879..560527
                     /locus_tag="MRET_1944"
                     /codon_start=1
                     /product="kinetochore protein Spc7/SPC105"
                     /protein_id="XP_027484541.1"
                     /db_xref="GeneID:38738710"
                     /translation="MPALGGRPSLPSALRTDKENTPMSPGRSPDTKRRRTKSLGGMLS
                     PTKAQPASLADATSRPRQPRKSAIRSTPQVFQSPTELGPNPEHQHMRRHDMLDELVDE
                     RLRSPGLPNPFTAMYRASSASPIKAPATDTADRKSRRVTFSAVREQTDFEQDEPTMSI
                     KPAQAQERSTLMDRGSPVPNGTSSDESDVSMSLESDGTMELTAAWQPDPPHDESDMEL
                     TGRYTAASDDVSAELDSTQTMDLTAAYVPEDASQDTTLDSEAERSAMEMTEMWGQFAD
                     EATRQRREASLSPKRSPVRRQTMFLSPDRKARTASAGSTPKARAPTPEPITTPPVSMP
                     STPTRFRQSLRGGVPSPEYKHSPARRTPRVRLSELHTKPRSPFIHSLLKHRSGGRITH
                     MSPRSDSDSEVVSETSFHMQLADFLGVIGLKFHEDMTASRTHAERPGNTEAPAVPAMA
                     VHHAKMAGAAAPMLQALRNACQELKQHVEDGRERLRAMEQDFFARPPAFVQEWGQLDD
                     EDMRRSMKGQLNVHKQAARAAAMHDYYGWRTDMQYDDEIVAMLTQHRDALQADAERVH
                     ARREELEVELLPALRARHSELKRRVQEAHARQQAIRACDPEELRHLHASMDEQDHVLQ
                     TMRAKQRDVADQLSRVRARLDETAVKREQTEELIRAARVVSDQIHGCTSGEAVRLERR
                     IRHLEVLLQWRLSSKTSTLLQLVYARALTVAIELDGRQGGVKRVAISPVCPVEASHMH
                     MAAISVIRTRMASEMPASVPEVLRQVAQLWHTYVKARAQVDRLRLHVPVVVSPSRGDK
                     GPDTALDVMATVLLERAQAKAHVHVDIDLARASPLSPQVHVSLVYGHMDTDTLAHMIQ
                     SALAKDAHSPHALAYAITHAQATMDT"
     gene            <560599..>562248
                     /locus_tag="MRET_1945"
                     /note="MRES_07725"
                     /db_xref="GeneID:38738711"
     mRNA            <560599..>562248
                     /locus_tag="MRET_1945"
                     /product="ATP-dependent RNA helicase DDX52/ROK1"
                     /transcript_id="XM_027628572.1"
                     /db_xref="GeneID:38738711"
     CDS             560599..562248
                     /locus_tag="MRET_1945"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX52/ROK1"
                     /protein_id="XP_027484493.1"
                     /db_xref="GeneID:38738711"
                     /translation="MDLFSTLTAGAARFDKKRFGRDMSLFQSSRRDEQGASQDVAAQR
                     SAGAALPAALDFFGSHEKEREATKPEPARTASRERMPPLSRAELPAFLRTHELKLTGT
                     DVPLPLRTWDDLETRWHLEPWLLENLQKGPWTTPTPIQCGAISVMLERRDLLAGAPTG
                     SGKTLAFLLPTLQLLQKHTKLGFRAVLVSPTRELAQQIYEQLQLLTQGQAFRTCLLTN
                     VTKKTSEALAKKKFDILITTPLRLVHAIQHEEVALHRVEMLVLDEADRLLEQGFLTQT
                     DEILAACTNPNLRKALFSATLPAGVEELARTFMVDECRVLVGQKDSATATIDQRLEFT
                     GSEDGKLHALRALIQAGGMQPPVLLFVQSIQRARELFHELVYDGLHVDVIHSERPKAQ
                     REAVIEAFRRGDIWLLICTELMARGIDFQGVNLVINYDFPQTVQSYIHRIGRTGRAGK
                     QGRAITYFTKDDAPYLKSVVNVMRQSGCDVPEWMTQLPKPSKMLKKKLRSRPVSRQDV
                     RAASGSSSLGRRLANRQRDMVQASKRRKLMHRSHPPTPHPH"
     gene            complement(<562208..>564760)
                     /locus_tag="MRET_1946"
                     /note="MRES_07730"
                     /db_xref="GeneID:38738712"
     mRNA            complement(<562208..>564760)
                     /locus_tag="MRET_1946"
                     /product="nucleolar MIF4G domain protein 1"
                     /transcript_id="XM_027628573.1"
                     /db_xref="GeneID:38738712"
     CDS             complement(562208..564760)
                     /locus_tag="MRET_1946"
                     /codon_start=1
                     /product="nucleolar MIF4G domain protein 1"
                     /protein_id="XP_027484492.1"
                     /db_xref="GeneID:38738712"
                     /translation="MVRGVDRARSTTRLPAALREELGIEDAAQKGRPAKKARLFKVSA
                     RKEARKEQRQAKHASRAPKRRPAPVVPSKGPPTTEEHAKKPLSKVSPPQGAPARLVMD
                     PITGQMRSAPSSSSKPTKLERMMRADDRTSKEPSKQHNISELERQEEDEIAWLEHHLY
                     GKKGPSQKEGDDVDDLLDDLNRFYPGMYEASEGEADEDDLEGSDASEDRRSDEDRPEW
                     EERGLVEDSQEESWDEQDDAKCDVKEEHLSQEDDTAKDMPPPKYVPPALRGKASDPTS
                     LEQQKLRRHINGQLNRLAEGNLDTIVSELDALYQTYSRGDVTAYITEQCLDTITAQMN
                     LSESIIVLYAALLTAMHRIVGAEFAAHVLQVCISRFMTTYGRLLQADSHASTRECVNL
                     VTLLCHLFNVKMLSDVILYDMVRLFLGQSFVHMVPGVADKKPITEMDIELLLRVVQSS
                     GQQLRHADAESLSAIVELTQQCMQGAPVVAESSRARFMLEALIHLKQKGKHLGRDVSA
                     TAESVQRLSKYISSLERKRTLRAHSALQVGLQDLQDATRHGRWWLVGAAWTGKEREPA
                     SVPMSEPEATDSPGHDLSHLARAQGMNTEARRMVFSALMSSLDYQDAAHHVMQLKLND
                     VQRREVIRVLLHCLANERTFNPYYVLVGQQLADDHVGMRVTMQYVLWDYFRELGEKHV
                     GGHKVVREDEEGEEYDVHVGERLRKLLHMARAYGYWIARGALTLLVLKTVDFTALHEA
                     GTLFLQHLLLHTFLMSQTRLPMLTPRARQNLLRAPSQVDRERIEQLLVRGTVGQPRLA
                     QGLFVFCHMHLPRETLATLLGDEAIVRRLEWTVNVARDTLSVGAASADASDA"
     gene            complement(<564801..>566021)
                     /locus_tag="MRET_1947"
                     /note="MRES_07735"
                     /db_xref="GeneID:38738713"
     mRNA            complement(<564801..>566021)
                     /locus_tag="MRET_1947"
                     /product="minor histocompatibility antigen H13"
                     /transcript_id="XM_027628574.1"
                     /db_xref="GeneID:38738713"
     CDS             complement(564801..566021)
                     /locus_tag="MRET_1947"
                     /codon_start=1
                     /product="minor histocompatibility antigen H13"
                     /protein_id="XP_027484491.1"
                     /db_xref="GeneID:38738713"
                     /translation="MGPWAWRLDFQRVHVSTMSSSAFFAYGALLTLASGTVYVGSLAS
                     LRTPEATKALRKEKGLKETDDDEEEVQGVSSEGAWMFPLLGSAVLLSLFLAFKYLDKE
                     MIILIVNIYFAVVGCLAIPPVLLHLCKMAFGSHSLDWCTKRALSFKGHVSWTTPSTKK
                     NLYDTVIKLDSATMGLFVVVVVLMAIYMYTKHWVLANIIAVCFAMQGLSLILLDSFQT
                     GLILLGGLFLYDIFWVFGSSKFAGQSVMVSVATNFDGPIKILAPRNLLEVLSSVQQKG
                     WTAADAFQFSLLGLGDIVVPGAFAALALAFDQHHASTKARSLTFNRFFYKFPKPYFHA
                     CMVGYVLGLFTTMVVMHIFKTGQPALLYLSPSCSLSVLFVAWYRGELLDMWSWVSPAS
                     QGAPKTAPDDKKQA"
     gene            complement(<566039..>566901)
                     /locus_tag="MRET_1948"
                     /db_xref="GeneID:38738714"
     mRNA            complement(join(<566039..566617,566643..566764,
                     566796..>566901))
                     /locus_tag="MRET_1948"
                     /product="ribulose-phosphate 3-epimerase"
                     /transcript_id="XM_027628575.1"
                     /db_xref="GeneID:38738714"
     CDS             complement(join(566039..566617,566643..566764,
                     566796..566901))
                     /locus_tag="MRET_1948"
                     /codon_start=1
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="XP_027484490.1"
                     /db_xref="GeneID:38738714"
                     /translation="MPAVKIAPSVLASDLGNLTHECKRMIQCGADWLHMDIMDGHFVP
                     NIVMGAPIIGSVNKSVPGIFMDCHMMVSEPLKWIKSIAEAGGKSYTFHLEATDDPLEV
                     IRQIKASGMRASIAINPGTPATEISDEVAHAADMILVMTVWPGAGGQKFIAECMPKVA
                     ELRARFPDLDVEVDGGVAPKTIHACADAGANVIVAGTAVFRDPRPDAVIQYLREQCEQ
                     AQARIREERQRIMQGESVPGAGIAHTTAYLSGDTEAWHHPRAFLRHEMAP"
     gene            <566998..>568743
                     /locus_tag="MRET_1949"
                     /note="MRES_07740"
                     /db_xref="GeneID:38738715"
     mRNA            <566998..>568743
                     /locus_tag="MRET_1949"
                     /product="pre-mRNA-processing factor 17"
                     /transcript_id="XM_027628576.1"
                     /db_xref="GeneID:38738715"
     CDS             566998..568743
                     /locus_tag="MRET_1949"
                     /codon_start=1
                     /product="pre-mRNA-processing factor 17"
                     /protein_id="XP_027484489.1"
                     /db_xref="GeneID:38738715"
                     /translation="MDALVAYRSESEGEDDVRPQRVHEELESDSEDERADSNDAFGLH
                     RAQSPERSVAPAPCFQASAAPDVQVAESSVIPHAEPQAAPTITRTLTGTVEATTMSDF
                     DFRNQQRTFDLYGYARNPSEFAATSQAFVGDLSAAKSTGGASFAEMRGSSADARQASR
                     AMRRKRKGRAGDASIADGEGAYLGPWGGWEDEAPKTEFVPAPDVPVGPTDEEIRAAQA
                     AAEKRRKDAAAIERRRQLDMAHGTEKSIFHGHSMYDYQGRTYMHVPTDTDVNLRGEPG
                     DVESFLPEYCIHTFTGHTKGITALRLFPQSGHLLLSASMDTKIKLWDMYHEGHCLRTF
                     LGHSNAVRDITFSNDGRRFLSAGYDEQIKLWDTETGACLAAQSFHGVPVCVRFHPDQQ
                     HVFLAGMDDRRIVQFDLNADQITQEYNEHQGAVNTITFVDMNRRFVSTSDDKSLRAWD
                     YDIPVPIKLVADPLMHSMPSVTLHPSHRWLACQTMNNSISVFSAENFKARKKAFRGHT
                     TAGFACQVGFSPDGRFLSSGDSQGDMVFWDWKSGHQLKRLHTHKDVVIAHEWLPHETS
                     KIVTGSWDGLIKLWT"
     gene            complement(<568773..>569681)
                     /locus_tag="MRET_1950"
                     /note="MRES_07745"
                     /db_xref="GeneID:38738716"
     mRNA            complement(<568773..>569681)
                     /locus_tag="MRET_1950"
                     /product="regulator of ribosome biosynthesis"
                     /transcript_id="XM_027628577.1"
                     /db_xref="GeneID:38738716"
     CDS             complement(568773..569681)
                     /locus_tag="MRET_1950"
                     /codon_start=1
                     /product="regulator of ribosome biosynthesis"
                     /protein_id="XP_027484531.1"
                     /db_xref="GeneID:38738716"
                     /translation="MAAAAVSIHVEQGETPIQLDMGLLASCDANPIDEREYKKNPESV
                     LLSRTRNATQHLVNTLFQLPIERDPSYGPLASLPAFTSLLPREKPLPKPKPLTKWERF
                     ARAKGIVKRKKDRLVFDEERQEWVPRWGYQGKNKELEDQWLVEVPANADDDYRPDKEA
                     ARDREARRKKNEMQHQRNLARSAGPAHADAAPKSQLGSGRALQAARKRAELEATIQRV
                     RGSTASLGRFDKQLEGESKPRGVKRSFQPNELDARQERASNLKLLANIDKGSTESEMN
                     MRKAIKYASQAQGSKALAQKAEKRRK"
     gene            <569803..>571350
                     /locus_tag="MRET_1951"
                     /note="MRES_07750"
                     /db_xref="GeneID:38738717"
     mRNA            <569803..>571350
                     /locus_tag="MRET_1951"
                     /product="interactor of little elongation complex ELL
                     subunit 2"
                     /transcript_id="XM_027628578.1"
                     /db_xref="GeneID:38738717"
     CDS             569803..571350
                     /locus_tag="MRET_1951"
                     /codon_start=1
                     /product="interactor of little elongation complex ELL
                     subunit 2"
                     /protein_id="XP_027484532.1"
                     /db_xref="GeneID:38738717"
                     /translation="MLRDRGRQLLHAIKYAAILLSLLQLLVFLPLSLEHSQETFLTFS
                     ALMAAFYFTITTLRWATLNTSLAPIARFLMLIQNIVIPASLFLCARLYMPDTTHAISP
                     NSVPWLQSATIAKEWLMSRTPLSWHSHTESMMHSDFLHTVLMYIQKHARLVLSHVPGT
                     WYAFLLYMSPVFSLLEGLASLIVVQAVARFSQWLIQDPHGKRTQKMSRSLLIRRLLQL
                     GIEASEAWQLVFLLLTATVYVASAVALVMSFDVVTNGRALTSAAIGASVASTLWISGF
                     ALAFRKANIVETSLIFAYVVFNVYQLSSSLVLGTDPVHLLQSFRGASFAAMSFHGHTG
                     ALQDKLLRALENGLRVLSIALETLPASVIVSLVYRLAIMYLATRVLALLQVRHVQRVH
                     VPKSKQTLTEQAESAKLSELLHKAKEPDSPSEPRHVSDERTQSAPESADEKEDERKPE
                     GKPRPSTVGIVLVRYSRFILITVYSHLLLLDQNHQIYWRILAVSFTLAMWGVELLISK
                     ESNVVFD"
     gene            complement(<571412..>572132)
                     /locus_tag="MRET_1952"
                     /note="MRES_07755"
                     /db_xref="GeneID:38738718"
     mRNA            complement(join(<571412..571478,571504..572074,
                     572105..>572132))
                     /locus_tag="MRET_1952"
                     /product="ADP-ribosylation factor related protein 1"
                     /transcript_id="XM_027628579.1"
                     /db_xref="GeneID:38738718"
     CDS             complement(join(571412..571478,571504..572074,
                     572105..572132))
                     /locus_tag="MRET_1952"
                     /codon_start=1
                     /product="ADP-ribosylation factor related protein 1"
                     /protein_id="XP_027484533.1"
                     /db_xref="GeneID:38738718"
                     /translation="MYHLVSGLYTQFTKKPVYNVLLIGFEGAGKTWLLEQIRHTYLNG
                     RVPSNRIAPTIGQNVLDLPYQKCVLHFWDLGGAYAMRKLWDQYLPDAHAIVWVLDALL
                     WAEDAPVRDETGGTYRESTRKSLFPIAREAAIRGQAVVVLINKMDTLDVQHKQEEAQP
                     GHIREHVESYVLKEWAQFADASDNVVTPWWSFHCVSAMAATGLDEALAAIFSTAKRSI
                     PMQ"
     gene            <572362..>574669
                     /locus_tag="MRET_1953"
                     /note="MRES_07760"
                     /db_xref="GeneID:38738719"
     mRNA            join(<572362..572561,572605..>574669)
                     /locus_tag="MRET_1953"
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1"
                     /transcript_id="XM_027628580.1"
                     /db_xref="GeneID:38738719"
     CDS             join(572362..572561,572605..574669)
                     /locus_tag="MRET_1953"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1"
                     /protein_id="XP_027484534.1"
                     /db_xref="GeneID:38738719"
                     /translation="MLGSLRAATTMPRSRITAGSSSKTSAAILRAAAFSTTTARRQAT
                     PAPEPPKMVKLTVDGKEVEVEQGTALIQACEKAGATIPRFCYHERLNVAGNCRMCLVE
                     SKGAPKPLASCAFPAMPGQQIFTDSPVVAKAREGVMEFLLMNHPLDCPICDWGGECDL
                     QDQSMRYGKDRSRFHETTGKRAVEDKYLGPLVKTVMTRCIQCTRCVRYAHEVAGVQDM
                     GTTGRGNQMQIGMYVEKMFDSEMSGNMVDLCPVGALTSRPNAFQARPWELKKIESVDV
                     LDAVGCNIRVDARELQVMRVLPRTNDDVNEEWINDKTRYACDGLKYQRLTVPLIRQGD
                     RFVPASWPEALEAVADGLKQSGAKGDEIQGVAGALADAESMTVLRDLVHRLGSENLVT
                     DEPVGDRAPVHGVDIRSNFAFNTGIAGLDEADFVILIGTNPRHEASIINTRLRKGYLH
                     NGLDLALIGEKVDLTYDYDHLGTDAKAVEELAAGKGSGAERLKLAKKPLVIVGSGVAD
                     HPDGAAILKNVSKLILNNKDKFLTSEWNGFNFMHRAASRMAAREMGYQGSSSRTSTKP
                     KFMYLLNADDISATKIPQDAFVVYQGHHGDVGAQFADVCLPGLAYTEKSVTYMNTEGR
                     TQLTRTAVSGAGAARDDWKILRALSEVVGSTLPYDDVTAVRDRMHEISPALVRYDACE
                     PTSVEVATVGLEQLASSQAKASGAPLHLPIDNFYQTDPVSRASPTMAKCVQAFVLKTP
                     SFQEKWSTAPSASP"
     gene            <574961..>577330
                     /locus_tag="MRET_1954"
                     /note="MRES_07765"
                     /db_xref="GeneID:38738720"
     mRNA            <574961..>577330
                     /locus_tag="MRET_1954"
                     /product="integral membrane protein"
                     /transcript_id="XM_027628581.1"
                     /db_xref="GeneID:38738720"
     CDS             574961..577330
                     /locus_tag="MRET_1954"
                     /codon_start=1
                     /product="integral membrane protein"
                     /protein_id="XP_027484535.1"
                     /db_xref="GeneID:38738720"
                     /translation="MSSDSFFPPPTVRIQRSTSTNSQAPEGDVRRSKSQGSNERRTGS
                     SRHLIGRPGRKSHGHGDQGHDSISRHPSQRRSSGLFESSNDPELSNLDMNRFLRWSSN
                     SSMDDTFRAESPASTSKDAISRESDLFDHSALRASISTPARIASMPWEMHSDDEHRHD
                     LEAPAHPSDSGRNIPMILVNHADEESGPVPPETPSENDKNKGTEASRSTPLLGNFMPK
                     FSSLWLLGGDSGDRDEQGRDQTNSEAQDTHTESSTKNGDVALHSDELVDYLDVLDPAV
                     GLFNTLQDYGNSAMLPNLPWLYSRRPTLRLNQVFSPEARDEIQSPESPISPESRRGSD
                     AVNSMDSMSPTCKPVSDGNMCTIPMPEMLPATFYSGEEERPTSENSSGNSIDESFKED
                     EHLAEYRNTDDPHTERYWQMDKEERLELEAHVRYLLTRKSKTKRMLRGFWNFVRTPMG
                     FILTTYISLIASWGIVIFLLIVNWVHVEPYHRRRVWIEVCDQVLCALFVLRGVGFMPF
                     RVVDTYRMAHIAHFHFLTYKRRKLLNLPRLKNENELPRYTRERLENATKHDDENPAPS
                     PVEADMELLDPSRDLEAIGVKNAHHVRTKPYHFEQLLQPLPGQPNTVELSIEEIEKAR
                     LTRAPSIQSMVDKETHEVSVLTPSEQAQLQHHQHSFHSSHTFYRYRETATHRPFPLWL
                     MMTIVILLDIYSMLQACLAGTTWGIRYERRPTVLTATIISCSLSCNAIAGILIWQGGN
                     RTRKTEVVKNRVKLAIEEQAIQRMERKRKKQEEPSKRHTLPFVKRSSKD"
     gene            <577447..>579234
                     /locus_tag="MRET_1955"
                     /note="MRES_07770"
                     /db_xref="GeneID:38738721"
     mRNA            <577447..>579234
                     /locus_tag="MRET_1955"
                     /product="uridine kinase"
                     /transcript_id="XM_027628582.1"
                     /db_xref="GeneID:38738721"
     CDS             577447..579234
                     /locus_tag="MRET_1955"
                     /codon_start=1
                     /product="uridine kinase"
                     /protein_id="XP_027484536.1"
                     /db_xref="GeneID:38738721"
                     /translation="MTATGPEMHESVSTPGSELRGTASMLSHVNSSMYRLHGGSAQPR
                     RSYSRTTIMTEAGRQPWYDADGKPIAPYIVGVAGGSASGKTSIAKEVIRLLPNIPWVA
                     IVSQDAFYRPLTPEQIKMAFNQNFDFDHPCAIDQELLVQCVKDLKESRAVQIPVYSFT
                     QHQRTSESTYLYGHAVIVVEGIFVLQDPALRELLDLKIFVQTDPDIMLARRIRRDILD
                     RGRSVEGVLDQYLRFVKPSFDTFVSPSARYADIIVPGLNNKVAIDVISQHIGKHLTRS
                     RSLRLKMDADHTLSSYMSMRMPHHIFPLARVIVGTTAAGTHSHCVEHEPFNTSQPFVA
                     VDQVLPLPPNVCVIKPKAQLQALLTMMHNVETPAGEYAWACKRTGAFVVEEAMKLLPY
                     RARSVETPQGEMHQGLELDVEYICGVSILRSGAMLEHPLRRALPALSLGSLLIQSSDS
                     NYHPLLYSVELPSFVRDRQRAARTWVLLTDAQVGTGAAAFMAVRVLLDHGVPENQILI
                     LTLLSSARGGVWSLYHAFPRIVIITAGVDPGLQRFEWHAPLPDRAPSEDHYPKRKSSD
                     ASEDGHPQDRVAFAIIPGCGQMGDRFWGT"
     gene            <579470..>580843
                     /locus_tag="MRET_1956"
                     /note="MRES_07775"
                     /db_xref="GeneID:38738722"
     mRNA            <579470..>580843
                     /locus_tag="MRET_1956"
                     /product="serine/threonine-protein phosphatase PP1
                     catalytic subunit"
                     /transcript_id="XM_027628583.1"
                     /db_xref="GeneID:38738722"
     CDS             579470..580843
                     /locus_tag="MRET_1956"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase PP1
                     catalytic subunit"
                     /protein_id="XP_027484537.1"
                     /db_xref="GeneID:38738722"
                     /translation="MFRSFGRIVSGVSRRSKTRAPDGTIVEDGSDAQQETTAPHNNLP
                     SEQHDSLETAHGSNSAAHAKEMHTVPSPMPIAGKSGGAAMRSHLAPTSDASGERIIGS
                     PAPGVLASASPISTSVTSSDGVKMFDIDEMISRLIEAGYTSKIPKPALKVPEIMAICQ
                     AAREIFLSQPTLIELSPPVKIVGDTHGQYQDLLRLFEMCGFPPAANYLFLGDYVDRGK
                     QSLETILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRLNIKVWKTFIDVF
                     NTLPIAAIVASKIFCVHGGLSPSLSSMNDIRRIERPTGVPDYGLLNDLLWSDPSDTAL
                     DWEDNERGVSYCFGKAVIQQFLAQYDFDLICRAHMVVEDGYEFWNERTLVTVFSAPNY
                     CGEFDNFGAVMSVSEDLLCAFELLKPLDGAALRKEMNKNKRRSLLQQQQQELGQQGSP
                     SVSSLHA"
     gene            <580915..>581835
                     /locus_tag="MRET_1957"
                     /note="MRES_07780"
                     /db_xref="GeneID:38738723"
     mRNA            <580915..>581835
                     /locus_tag="MRET_1957"
                     /product="CCR4-NOT complex subunit CAF16"
                     /transcript_id="XM_027628584.1"
                     /db_xref="GeneID:38738723"
     CDS             580915..581835
                     /locus_tag="MRET_1957"
                     /codon_start=1
                     /product="CCR4-NOT complex subunit CAF16"
                     /protein_id="XP_027484538.1"
                     /db_xref="GeneID:38738723"
                     /translation="MSASLPAVEVHNLHYHFASSTSSALEGCDLVLERGARCLLIGAN
                     GAGKSTLLRLLAGKRLCEANILVFGQDVFHSPPCGITFLGTEWAMNPVVRGDITVSDF
                     LDSVGGFRFSERRDMLLDLLDVDLSWKMHMISDGERRRVQLCMGLMAPWDLLLLDEVT
                     VDLDVQVRCDLLDFLRKESEMRGATIVYATHIFDGIHDFPTHIVHLQMGRTTSPLPLP
                     WPLHLDANTHPDILTCLPTSIKETIQSSTSTYSPALLPLALAWLREDRVLREQYEQSR
                     GVKRGRIVSGETKDAKKFFSQYDYYSNYTR"
     gene            581936..582040
                     /locus_tag="MRET_t0034"
                     /db_xref="GeneID:38741228"
     tRNA            581936..582040
                     /locus_tag="MRET_t0034"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:38741228"
     gene            <582263..>584101
                     /locus_tag="MRET_1958"
                     /note="MRES_07785"
                     /db_xref="GeneID:38738724"
     mRNA            <582263..>584101
                     /locus_tag="MRET_1958"
                     /product="U3 small nucleolar RNA-associated protein 7"
                     /transcript_id="XM_027628585.1"
                     /db_xref="GeneID:38738724"
     CDS             582263..584101
                     /locus_tag="MRET_1958"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 7"
                     /protein_id="XP_027484539.1"
                     /db_xref="GeneID:38738724"
                     /translation="MAPHEQRQSKHDAEALKHQANSIARATRLPVSLQQSTPAETLGM
                     RPPKSLTKIKDKKLRSELSKQYLSRKRAESHARLADEYLNVTAPGEDAGLIEVDDEME
                     RTARVTQADIKEQVGVDTARKSFELKLAGKDNIGLGPYRCDYTRNGRHLLLGGRKGHL
                     AAFDWQSGKLSCEIQVRETVRDVRWLHNHTFFAAAQKKYTYIYDQNGLEIHRLKDHIE
                     VQRMEFLPYHFLLATIGKPGYLKYQDTSTGMMVASHRTGLGSCATMAQNPLNAVIHLG
                     HANGTVTLWTPNMSTPAVKLLSHRGPVTGLSIDSYRDGREMVTSGLDGGIKVWDMRML
                     GRGPRREWISRRAASDVAYSQRGLLGVAWGAHVSLYHTEAELGHAPPGPYMTHGLPQC
                     APLQLRFCPFEDVLGVGHAQGFTSLLVPGAGEPNFDSSEADPYETKARRREREVHSLL
                     DKIQPDMITLDPDTMGQLDTRASRAQGVAAAPERSGAVPRAADGTPYARLTRMQRLQL
                     SGEAAPDEQVHDSDEEQGPVVPAKGAAAKEKNRARGRNSSMKRYLRKKRQNVVDANTI
                     ALREKYQHEKARRREEHLKRQNQYEPPRKHEPSALDLFARNRGPRS"
     gene            complement(<584115..>586005)
                     /locus_tag="MRET_1959"
                     /note="MRES_07790"
                     /db_xref="GeneID:38738725"
     mRNA            complement(join(<584115..585874,585909..>586005))
                     /locus_tag="MRET_1959"
                     /product="glycosyl transferases group 1"
                     /transcript_id="XM_027628586.1"
                     /db_xref="GeneID:38738725"
     CDS             complement(join(584115..585874,585909..586005))
                     /locus_tag="MRET_1959"
                     /codon_start=1
                     /product="glycosyl transferases group 1"
                     /protein_id="XP_027484540.1"
                     /db_xref="GeneID:38738725"
                     /translation="MVIATSDPILEAVSYPYPMDRKRRKLRVAIVTENFLPKIDGVTR
                     TLGRLLEHLHSEGHEAIVFGPDTGLKEYLGHPVVGTFGIPILVYPGLKLNFARLRFIR
                     RLQQFRPDVVHFVDPIWLGAQMIPLCKRYLPNVPRVSSYHTNLPTYASLFGVGFLEPA
                     MWSLSRYLHSQCDMVFCPSESTRRMLQSRGIQNIEIWGRGVDTDMFTPEARDENLRTG
                     WGCKPKSQELLNTLHDQVVSTIERNKVAEESFIRTPETLPVSELSPPPAYESVCDVPP
                     LPGTNFALPPPVLTRTATAASSSLSSVDNDSKAVVLFVGRISWEKNVRLLIEAFHLLP
                     ASVKSNAKLVIVGDGPARAELTRLCQRYGLDAAFMGHQKGKRLASMYASSSIFGFPSF
                     TETFGQVVLEALASGLPVVGLHAEGTSDLVCHGTTGLLLDTVRATSSHSSQSMPDVPP
                     PSRNRRSSLAERLREGSVPSDAQSLSASSGRAVPLAASNTVKPGLPSPIPSVKEFASM
                     MTPGSQSFYQCAQAYSILLERLIRDRTLRATMGQRAQQYASNRTWWDAMEAPVRGYEQ
                     VIARAGQINLTDAELEALRNAQRKIAPLSGPIVTMTVILYLALFVLLWTYLL"
     gene            <586308..>587894
                     /locus_tag="MRET_1960"
                     /note="MRES_07795"
                     /db_xref="GeneID:38738726"
     mRNA            <586308..>587894
                     /locus_tag="MRET_1960"
                     /product="WD domain, G-beta repeat protein"
                     /transcript_id="XM_027628587.1"
                     /db_xref="GeneID:38738726"
     CDS             586308..587894
                     /locus_tag="MRET_1960"
                     /codon_start=1
                     /product="WD domain, G-beta repeat protein"
                     /protein_id="XP_027484412.1"
                     /db_xref="GeneID:38738726"
                     /translation="MDFTSTYSYASWNSLAFSPGSTFLAYVDSSTRKSVTVRVVGTLQ
                     VVRSWELDEPLDSLEWSLDGLYLLVSAYSTFQGVSYVLPLDPDASVTDNSDDGRGWIA
                     RIEAAQGLVHATWLPIRRIPAIVQFFPFHTAIIYSLADQSCTMLPNTALNRVCALPSE
                     HFGVVQREKECDQVCLYTPHTSDAPSLEQPVQWQLYRAVPTNMSHTSGITWSPDGQFV
                     AVWDHILEYKLSVYTAHGTPQVVLTIQDDDVPSTHVPISAAECRSALTPQETGRARRV
                     SLRASRTSSRRLSSGTTRRLSHALGVRIVAWHPSSEFLAVGGYDDHVHVLSLSDWSLS
                     YSLDVSVTALSCMESLPHIWVEPYRWFDATGGRGIVPMEVSTAADVPTLLNTQTLQTG
                     TNWIAWNNDGSVLACRNEGMPTAVLLYEFFGLHERSVDAHLRLLGIIVLSSPVRDVVW
                     RPEHACSLVLVTGQSSVYCWSMNDTQCCEAVAIPNDKFQASHITCSPDGKTLLLADTH
                     SFCCVVTATEDAGPSGEAAS"
     gene            587945..588029
                     /locus_tag="MRET_t0035"
                     /db_xref="GeneID:38741229"
     tRNA            587945..588029
                     /locus_tag="MRET_t0035"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:38741229"
     gene            <588090..>589376
                     /locus_tag="MRET_1961"
                     /note="MRES_07800"
                     /db_xref="GeneID:38738727"
     mRNA            <588090..>589376
                     /locus_tag="MRET_1961"
                     /product="RNA-binding protein 39"
                     /transcript_id="XM_027628588.1"
                     /db_xref="GeneID:38738727"
     CDS             588090..589376
                     /locus_tag="MRET_1961"
                     /codon_start=1
                     /product="RNA-binding protein 39"
                     /protein_id="XP_027484411.1"
                     /db_xref="GeneID:38738727"
                     /translation="MYADKEEALRRTLASGPMTPEEREKQLQEELRRRAADSRRDTHH
                     QSHDMRRASRRRGEEVEDRYMSQAPRDSGDGRWREEASYRHQRSGGRRPHHGDDARMR
                     RRSRSPVGRGSRAVPFGAEYETKSVFCSELDSRVGQRDLGEFFEDNLGPHSVVDVRLE
                     VEVKTGASRGIGYVELSDAALVPRALELSGKRMFGWPILVQNADAARKNPVVGMYEPP
                     RASVSTTSVPPPAAVPSNTDARLYVGNLHFDIAAPHVRAVFEPFGPLDDVEVYYHPVT
                     GKSKGFAFVQFQEVQDAQQAMEQLNGMDLAGRAMRVGPVNARGSDRRDVGPSHEAAPT
                     AVLLRHMFDPREETEPQWHVDLSEDVRLECTRHGHVDSVFVDKDSHDGEVYVCFHRPE
                     EAQSACASLQGRFFGGKLVEARLIQASLAQAKYAST"
     gene            <589415..>590584
                     /locus_tag="MRET_1962"
                     /note="MRES_07805"
                     /db_xref="GeneID:38738728"
     mRNA            <589415..>590584
                     /locus_tag="MRET_1962"
                     /product="general transcription factor IIIA"
                     /transcript_id="XM_027628589.1"
                     /db_xref="GeneID:38738728"
     CDS             589415..590584
                     /locus_tag="MRET_1962"
                     /codon_start=1
                     /product="general transcription factor IIIA"
                     /protein_id="XP_027484414.1"
                     /db_xref="GeneID:38738728"
                     /translation="MVEAEQGARRVWVCDVDGCGKTYVKQARLLEHQRVHTGERPFVC
                     EHCGASYMRSTHLAAHMRTHMDESMKPLACSHEGCTKRFWTQQHLRRHVLSCHAMETG
                     AHSMRMLDAQAALGEAGVAGLYHCDSPGCDLVFSKRKHLYQHRREAHADPSCSHAPFV
                     CDVCHKHFLTNAKRRHHMRIHEEGRYQCILPHAVAPLPPEHPPHTDTGVSWSFATWTH
                     LQRHMRLCHPPTCPVCGRAFANREKMRRHQHTHALREPLLCPWNGCDKAFQRASSLRV
                     HISRVHHGERPFVCKVCGQSFGYKHLLQRHEHTHTKCEPHQDTSHVGQLKRKRARVLP
                     CPWDKVGSESCPKKFARLYDVRRHLASVHGLSLSDAELCTLMPEEPHAMKRPRVM"
     gene            complement(<590585..>592114)
                     /locus_tag="MRET_1963"
                     /note="MRES_07810"
                     /db_xref="GeneID:38738729"
     mRNA            complement(<590585..>592114)
                     /locus_tag="MRET_1963"
                     /product="guanyl-nucleotide exchange factor"
                     /transcript_id="XM_027628590.1"
                     /db_xref="GeneID:38738729"
     CDS             complement(590585..592114)
                     /locus_tag="MRET_1963"
                     /codon_start=1
                     /product="guanyl-nucleotide exchange factor"
                     /protein_id="XP_027484413.1"
                     /db_xref="GeneID:38738729"
                     /translation="MRNDAVQNDTWLLDPLMTEQVARPPILTHDMSIQPRLNETPDIF
                     SRRLYQYTKGAPALCGTTARLLSLHSTPFLCKALDAYMLRFHFQRYPIDIALRYFLAL
                     EHLPTESQQIDRILMAFARRYAACNPDTTNTDTTYFLSFALLLLHTDLHAQHARPRLS
                     QSAFVSLASPSKMPAVVLECLYDNTSLVEFMFMRGRLSTDSRRAADRERYALYKLIMS
                     GQVLNLQSQQRLMLPLQYASRSWTAQDIQHAKLKAQTILVTVPSRWRKRQAAQYRVQC
                     LLSGAVRLCRVSEDELDDVKNGCWRSWIIMVTSSALFWCKDMPDTTLRLEQVQPLSDA
                     LCVQDALMPHLLRLRIQQRWLMLDAGDQRDAWLDHLNYAASLAMCQDPLDESLCIPVG
                     LTLTCQFVAPSMAEPMAGNVYLMRAQRMLTTRQYVTTLCVRHKALVHAEEESRRYAHH
                     LGMLTPLRKSMRDYIEHAMHAALRSLRATQWELAFVACRLNFLRAEQRLLERHLHHHY
                     V"
     gene            complement(<592210..>593020)
                     /locus_tag="MRET_1964"
                     /db_xref="GeneID:38738730"
     mRNA            complement(join(<592210..592328,592375..>593020))
                     /locus_tag="MRET_1964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628591.1"
                     /db_xref="GeneID:38738730"
     CDS             complement(join(592210..592328,592375..593020))
                     /locus_tag="MRET_1964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484416.1"
                     /db_xref="GeneID:38738730"
                     /translation="MVTVVIEEVGDTDSSMLSVAPSSISESDDPSSLLYLLDTAQEDQ
                     LDALLEDDVFATAMGQRMLAVSGQEVDDSLLSLGQLLLSRPSSSSLQAFRAQHPRRFT
                     PYRQRGETYLLPQLRDWDLSEEHTTYHVLPGGYITAVGYAEEDEDNDKEEEEDKEEED
                     EEEEDEEDLILQDDDDYMDWLGEQLLNRKSGAPMWVIDAVHESPDDETAYTLWEASDG
                     AYSPMWTTRDGSEDGILSPCATSPNERPRKSMRGTW"
     gene            <593066..>594329
                     /locus_tag="MRET_1965"
                     /note="MRES_07815"
                     /db_xref="GeneID:38738731"
     mRNA            join(<593066..594142,594168..>594329)
                     /locus_tag="MRET_1965"
                     /product="tubulin-tyrosine ligase family protein"
                     /transcript_id="XM_027628592.1"
                     /db_xref="GeneID:38738731"
     CDS             join(593066..594142,594168..594329)
                     /locus_tag="MRET_1965"
                     /codon_start=1
                     /product="tubulin-tyrosine ligase family protein"
                     /protein_id="XP_027484415.1"
                     /db_xref="GeneID:38738731"
                     /translation="MPPVLWVSFPGAPYTHQCARRAAEKLLRPAGWEIRDTTSEKRPD
                     TFKLPDGADVYLAGYDVLPFESLLGSQALCSSYVIRKALIRKHHLAHVLHAFSVKNPT
                     RPVPAPRTWTLDLQFADELDELLSDDLYDVREALERNDPACPTSWFILKPGMADQGNG
                     IRLFSSVEQLEHIFQAFEDDDDDEEAGITSQLRHFVIQDYISAPLLVAPDHTARKFHL
                     RVYVICVGGLHVYMHDDMLALFSDTEYAPPTGEMQDLRGHLTNTCYQNGTEKENVYLW
                     RDLVGQPACLASERFTLTQAHIDAVRLSAAATIGAIFEAVGREASFHWQMWPNAFEIF
                     GVDLLVGHDASKPHALCTWLLEINAQPDFAQCGEELERVVEHVFQRALQLRLEPAVWS
                     VGESRDRCTCCFSEPLVKDL"
     gene            complement(<594326..>594883)
                     /locus_tag="MRET_1966"
                     /note="MRES_07820"
                     /db_xref="GeneID:38738732"
     mRNA            complement(<594326..>594883)
                     /locus_tag="MRET_1966"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628593.1"
                     /db_xref="GeneID:38738732"
     CDS             complement(594326..594883)
                     /locus_tag="MRET_1966"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484418.1"
                     /db_xref="GeneID:38738732"
                     /translation="MTSVARSPRKFQASRAIKCEPNAQSSTEMVVQNTPWSASMSNVD
                     GGSRTEVYALVNDRYPGAPGTALAKAEEAEERAKMTKKREQVRKKAANAELEHLGVKN
                     LTKRRRSSSPYASSSPSESGSSVNGDTEEKSFRSGSRHRRASSRNSSPMPLTTEATRL
                     PHHITNAPVHPSPLATHAIAAHDVR"
     gene            complement(<595169..>597142)
                     /locus_tag="MRET_1967"
                     /note="MRES_07825"
                     /db_xref="GeneID:38738733"
     mRNA            complement(<595169..>597142)
                     /locus_tag="MRET_1967"
                     /product="nucleolar protein 9"
                     /transcript_id="XM_027628594.1"
                     /db_xref="GeneID:38738733"
     CDS             complement(595169..597142)
                     /locus_tag="MRET_1967"
                     /codon_start=1
                     /product="nucleolar protein 9"
                     /protein_id="XP_027484417.1"
                     /db_xref="GeneID:38738733"
                     /translation="MGRGATDRRRAPKRSRHAEEEEDAPPEWIASSDANTPFGLVPAD
                     LHSYMKEVNAQLTERMHSGDADDVQLLVQAVLSEMNGHELALATDPTCSLVLENMSSM
                     LQEKPLRVLLDRMTGNFVTLSYHRYGSHVLQALFYAVQRIMNTGTTSDSASTKQGVLR
                     SLPDIMSDMYEEMEPSLVPMLTDVFATHMLRSIVALFAGVSIPSLDDMRSKRSAKYRS
                     KERQKAMVDDSFTTPSNEPMHVPPAFYTLLHRLYTHMRENLTEEDMHRLVPEATAAPT
                     LSLLLRLEAGLADGKGSTVYEKDSMASCILGPLDQRTDFMESALRDAVATHVLQSALQ
                     DISQERLVHFWRTYIHGRVAKLGAHPCANYVVATALQLLPADETLAEAIHELGKAGDQ
                     LVKNQVTGVLQTAVDRSVQVGAYAADVMQAIRAAFRFSEDASKDDVAKFVPAVLSLHT
                     LKAFTHVQDAPQKRKRDDNGERMTTQGSILLQRIAQLPAPHQTWLYESLCTDALGSWC
                     RSSTAAHVVIAALTSKAASFAQRRMLIRAVMPMLIDLCDDAWGSRVADALWLGADGFT
                     KEKMAQLVIGHEKRLLASTYGRFFVRRLRLGVYRKNVDEWKAWAVHEHVPDAATPAAP
                     PANPFAFLRTTHIHRTPRDQADRELERILAQVE"
     gene            <597266..>598543
                     /locus_tag="MRET_1968"
                     /note="MRES_07830"
                     /db_xref="GeneID:38738734"
     mRNA            <597266..>598543
                     /locus_tag="MRET_1968"
                     /product="argininosuccinate synthase"
                     /transcript_id="XM_027628595.1"
                     /db_xref="GeneID:38738734"
     CDS             597266..598543
                     /locus_tag="MRET_1968"
                     /codon_start=1
                     /product="argininosuccinate synthase"
                     /protein_id="XP_027484410.1"
                     /db_xref="GeneID:38738734"
                     /translation="MSSNGRVLLAYSGGLDTSTILAWLIDEGYDVIAYMANVGQEEDF
                     DAVREKALKCGAKDFILDDVRREFVEELIFPAIQANAIYEDVYLLGTSLARPVIARGM
                     IETAEKMQCQFVSHGCTGKGNDQVRFELAFYGLNPDIKVIAPWRIPKFYQRFAGRSDL
                     LEYAASKGIPVTQTKSKPWSTDENLFHISYEAGILEDPNTTPPADMWKLTQAPEQAPN
                     DPEHISIEFTKGIPTRLIVPATGKEYTDACDVFLELNALARKHGIGRVDIVENRFIGV
                     KSRGCYESPGATILRAAHIDLEGLTLDREVRRIRDQIVTTKLSEILYYGFFFSPESQY
                     VRSCIPPSQLTVNGTVKLKLYKGHVSIEGRSSDELLYDEKFSSMDELGGFEPEETSGF
                     ISVQSIRLKRFGLGLAHRGMAGADPKKAYALPQ"
     gene            <598622..>599056
                     /locus_tag="MRET_1969"
                     /db_xref="GeneID:38738735"
     mRNA            join(<598622..598755,598785..598846,598872..>599056)
                     /locus_tag="MRET_1969"
                     /product="BolA-like protein 1"
                     /transcript_id="XM_027628596.1"
                     /db_xref="GeneID:38738735"
     CDS             join(598622..598755,598785..598846,598872..599056)
                     /locus_tag="MRET_1969"
                     /codon_start=1
                     /product="BolA-like protein 1"
                     /protein_id="XP_027484409.1"
                     /db_xref="GeneID:38738735"
                     /translation="MLPGPWRAAVRSVRSYVTQVMSVEESMRHKLTGAFEPVHLYIRN
                     DSSKHAHHAAMVAQGGGSGETHFFVEMVSAAFQGKPPLARHRAVNSLLAPEFDRGLHA
                     LSLRLKTPEEIAREQSGCCGGAGH"
     gene            complement(<599071..>600642)
                     /locus_tag="MRET_1970"
                     /db_xref="GeneID:38738736"
     mRNA            complement(<599071..>600642)
                     /locus_tag="MRET_1970"
                     /product="trehalose 6-phosphate synthase"
                     /transcript_id="XM_027628597.1"
                     /db_xref="GeneID:38738736"
     CDS             complement(599071..600642)
                     /locus_tag="MRET_1970"
                     /codon_start=1
                     /product="trehalose 6-phosphate synthase"
                     /protein_id="XP_027484448.1"
                     /db_xref="GeneID:38738736"
                     /translation="MIERLVVVSNRLPVTIKKDGSVPGGYIFKQSAGGLVSALRGTKK
                     LMSFTWIGWPGVSVPESSIPYIEATLEKNYQCKPVWLPEDVGERHYNGFSNSILWPLF
                     HYHAGEMNFDEENWRAYREANWLFAHAVRSVLRPGDCVWVQDYHLMLLPLMLTTILEH
                     GDIERLVPKECSDMDVTNSLGLVTQATSDAFDPSRASHAQLRRKDIQLGFFLHTPFPS
                     SEVYRILPVRREILLGILYSDLIGFHTYDYVRHFLSSCARILGIPTYPNGADFGGRRI
                     QVRTYPIGIDPHQFETALQQPMVRERIGTLSRRFEGVKIIVGIDRLDYIKGMPQKLQG
                     IETFLEEHPEWIGKVVLIQIAVPSRQDVEEYQNLRATVNEAVGRINGRFGTVESMPIH
                     LLHRSVEFNELCALYAVSDVCLITSTRDGMNLVSYEYVACQQERNGVMILSEFAGAAQ
                     SLNGSLIVNPWDRFAVADAIHTALTMDPETRKANSEKLTSYVEKHTAAWWGRSFIDDL
                     ELAGNAAPATAFKHA"
     gene            complement(<600715..>601479)
                     /locus_tag="MRET_1971"
                     /db_xref="GeneID:38738737"
     mRNA            complement(<600715..>601479)
                     /locus_tag="MRET_1971"
                     /product="universal stress protein"
                     /transcript_id="XM_027628598.1"
                     /db_xref="GeneID:38738737"
     CDS             complement(600715..601479)
                     /locus_tag="MRET_1971"
                     /codon_start=1
                     /product="universal stress protein"
                     /protein_id="XP_027484449.1"
                     /db_xref="GeneID:38738737"
                     /translation="MLLPSATEQARHLRRQRMSLFSRNTSLKDDVWKGYERIVGFDTM
                     PDAEDTASRSSSYTLQVKAKGYTRTKHTRTFMCAVDATESSERALEWMMEHLVDDGDE
                     LIAARVMSLDQDHISQGAIRDGAHSLLSSIVHLNKATHDERKISITVEFVRGSIKPTI
                     LELVSMYRPESLTIGTRGKQVSALEKMLGTTPLGNLSKFLIWKSPVPVIIVRPEDRIQ
                     KHLFKRLADPRRHEYAALMKKDSILPISRAPEAHTA"
     gene            complement(<601526..>603634)
                     /locus_tag="MRET_1972"
                     /note="MRES_07835"
                     /db_xref="GeneID:38738738"
     mRNA            complement(<601526..>603634)
                     /locus_tag="MRET_1972"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628599.1"
                     /db_xref="GeneID:38738738"
     CDS             complement(601526..603634)
                     /locus_tag="MRET_1972"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484446.1"
                     /db_xref="GeneID:38738738"
                     /translation="MAAALSSPSPKASVTQPAHDMQPRSTSEVLLVCVMHDSPRLRAA
                     WDDVFVRTVEPLCHSFARLYSSSCVMVGGVIYRSRSSRDFASPLHPLESLSYIPFVPI
                     RHFLPRVRSALCAECMYTLDQLDGAQLESPLAEALAATIDLLDRQETRPQVIPFARAA
                     MRSKDTQVVARHLMHVVALDTNLVVTPMGQNGPHELPAFSKRLHPHLHAQSRLDMCTY
                     SDLVHDINKRPMSFSTIVYADTAVPAETRASLTQTAHDTLCLSRSADDRVSPSDLLGA
                     QGSIPATISAYISGAEVTRLLRKRSSPDTASEAPNKRSRLPHTPLTPTFKMDQASFNK
                     IIMIQQQQAKMLKNLAQYVALGQTPGSNMPSKALDQFRQRIAAQQLALKHQAERLRAN
                     KPLDLSPIIHALATITADAKEWGIHLGGSNEQAPAAPRASEETARSQLAWQGMMQWNT
                     SSQSSPLCTLVTATCGHAQVKQNLQLPWPSMMTINGFFTIDPARLQQYFTQHRLPCAL
                     LSLCALPSSAPIQNAEYNAANYRSLATMLEQNKRAAYIQHGAPECGIVIVALSSARLP
                     PTQAAHAPRLLAIVFHAPIPFAELGAPTTSSTSNTRGMISVPPSSSTSFPAPFMSNPF
                     PGMAAPTAVPAMPQPMSLPPGSLSPMSAQVMGAPATAMPNSSLMTRNAAPSSMMPSFV
                     GTQDLLSAEQLASSLGLPPM"
     gene            <603769..>604746
                     /locus_tag="MRET_1973"
                     /note="MRES_07840"
                     /db_xref="GeneID:38738739"
     mRNA            <603769..>604746
                     /locus_tag="MRET_1973"
                     /product="17beta-estradiol 17-dehydrogenase"
                     /transcript_id="XM_027628600.1"
                     /db_xref="GeneID:38738739"
     CDS             603769..604746
                     /locus_tag="MRET_1973"
                     /codon_start=1
                     /product="17beta-estradiol 17-dehydrogenase"
                     /protein_id="XP_027484447.1"
                     /db_xref="GeneID:38738739"
                     /translation="MLETLLQAVGAAVVAAALLYLVYVVLQIHILSGRPLTAYGANSK
                     MRGAGSWAVVTGATDGIGREFAMQLAAKGFNIVIVSRSVDKIKYLVKDLERAYPGIKT
                     CYYSMDFLYADAEQYEGLATLIQHLDVAVLVNNVGLSHQMPVSFLEMDEHELASICQV
                     NVMATQHMTRVVAPHLVRRPGRGLILNLGSFSGQWATPLLSVYAGSKAFLIAWSQALG
                     EELRRSKVDVQVLNTFFVVSNMSKVRRASWMVPTPKAYVQSVLSRIGLASGAVGRPFT
                     LTPYPTHAWIDWATQYLVPRWFLLSKAYESSLDTRRRAIRKAERLAKQQ"
     gene            complement(<604747..>606852)
                     /locus_tag="MRET_1974"
                     /note="MRES_07845"
                     /db_xref="GeneID:38738740"
     mRNA            complement(<604747..>606852)
                     /locus_tag="MRET_1974"
                     /product="NAD+ synthase (glutamine-hydrolysing)"
                     /transcript_id="XM_027628601.1"
                     /db_xref="GeneID:38738740"
     CDS             complement(604747..606852)
                     /locus_tag="MRET_1974"
                     /codon_start=1
                     /product="NAD+ synthase (glutamine-hydrolysing)"
                     /protein_id="XP_027484452.1"
                     /db_xref="GeneID:38738740"
                     /translation="MPRLTVSTCSLNQWALDFDGNRDRIVRSIERAKAAGSTLRIGPE
                     LEIPGYGCYDHFLESDTELHSWQVLAEILQSNLTDGILCDVGMPVSHRSVLYNCRIAV
                     MHRRILHIRPKIWLANDGNYREMRFFTPWTRIGETESYDLPDIIRETTGQTHVPIGDA
                     LLQAPDTVLGVELCEELFTGASPHIAHALHGADIILNSSGSHHELRKLHRRIELIREA
                     TLKLGGVYLYANQRGCDGDRMYYDGCALIALNGEIIAQGDQFGLEDVDVVTATVDLDD
                     VRAHRTSKSRGMQAVAPSQWAGHAQPMRISVPSPLTHKLEDRPHARLSMPIEVRYHTP
                     EEEIALGPACWLWDYVRRSRTQGFLLPLSGGMDSCATAVIVHSMCRLVHAACQQGNEQ
                     VITDMHRVSGTPDTWMPASPQALAERLFVTCYMGTTNSSQATRDRAHQLAQAIGSYHY
                     AFDIDTVVSAILRLFSTVTGRSPQFKVHGGSPAENLALQNIQARSRMVLAYLFAQLAP
                     WVQGRSGGLLVLGSANVDESLRGYLTKYDNSSADLNPIGSISKQDLRRFLTYARTAFD
                     LPVLSSFLEAPPTAELEPITADYVQSDEADMGMTYEELSVLGRLRKLQKCGPYSMFVK
                     LLAIWPSLAPDALAAKVKLFFFEYARNRHKMTTLTPAYHAESYSPDDNRFDLRPFLYP
                     VHFAYQFRRIYELIGRLRP"
     gene            complement(<606870..>607970)
                     /locus_tag="MRET_1975"
                     /db_xref="GeneID:38738741"
     mRNA            complement(<606870..>607970)
                     /locus_tag="MRET_1975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628602.1"
                     /db_xref="GeneID:38738741"
     CDS             complement(606870..607970)
                     /locus_tag="MRET_1975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484453.1"
                     /db_xref="GeneID:38738741"
                     /translation="MAPRPLADVWVRFLATPDKLCLDLRSRAHFDAGHIRHAVCIEGL
                     EALRTRFSTLPPRHVPFLVVCHAHEAEQVCSAFVPKERWHIVGVIGVGDAHALTALHP
                     LAYASLADLIRLAASIDAWIEPPTPDIPHLLFTPAPVVSRVVHQLIESRGSDPVTLLD
                     LGCGAGRDVTFALVLAQRTSTRRWYATCVDRWRAALERAAQLLADYALLPPTSSTAVC
                     DAIQAADLLDDGCVRDVQAPKACTPLPLDAWAASSLPRAEYDVVWLIRFWPRACLVTL
                     PSIVAPRGLIVVSHFAHDPDPRIPRRGEPYLREYTSPPIDKRIQRGELRALLDHWDGM
                     YGPHEILDECIERVEDGRPVHSLVLRVHLHRL"
     gene            complement(<608028..>610064)
                     /locus_tag="MRET_1976"
                     /note="MRES_07850"
                     /db_xref="GeneID:38738742"
     mRNA            complement(<608028..>610064)
                     /locus_tag="MRET_1976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628603.1"
                     /db_xref="GeneID:38738742"
     CDS             complement(608028..610064)
                     /locus_tag="MRET_1976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484450.1"
                     /db_xref="GeneID:38738742"
                     /translation="MLSVGSVEPSQHASRDMPAWVWAPASMPPAGSSSHAGGAHGAAA
                     VGSTGHGTDASAANGSAPPSSAPLPSPYWDMGMPMERTAHGQSPSRYMMYRSAAPSDL
                     FPPPASSMMPPMPPPHAMYPPHAVAAPFALPMHPDPAALARSSGAAPSGYPLLSFGAA
                     GGAYPYVDAQSMPMLMQVPPATAATMASQYTASMPGPGTAPPPSVLEARTDALSETWG
                     TLAPTPAATANMEDLLALSRQAQMEADGGPNANVFVCPHCEKRYVGKHARSIWRRHLQ
                     DKHAIPLSVQPRRTRWDRDVNRPRNAAERRERMLESKRRWARKKREQERRSASASRSN
                     SVALSKSEVATNASGTPTPSEPDSEGREPSVKVEEVAPGKTTTQRTALAPFDTNVPMP
                     PRVAEAKSPSTLDGTKLFMPSPLQSTPMRNAFTHPRGLFASPSEARPAPDSVRRLMPF
                     PPPSLTKRTPFSRMEPSPRSTLHAPRQSHFDAPLSPSVRSFRAPRAGGDQFSSPQHLN
                     LTQSLGLAPQSASRGGGATFGSMYAASNMTPMGAGGTPFGRMPMGFTPTINGLLRGGI
                     GDVSGHGFLGGGDLSMFGLTDSPHILRSSVRRSPKRSSGITSSFQSSSERDDDDDDEP
                     ENSMRIISPSVRQRVRGHAKRPSHDTPSKVGTPLRGARGSGRLRSTPRHSTTLR"
     gene            complement(<610176..>610831)
                     /locus_tag="MRET_1977"
                     /db_xref="GeneID:38738743"
     mRNA            complement(join(<610176..610294,610321..>610831))
                     /locus_tag="MRET_1977"
                     /product="hypothetical protein"
                     /transcript_id="XM_027628604.1"
                     /db_xref="GeneID:38738743"
     CDS             complement(join(610176..610294,610321..610831))
                     /locus_tag="MRET_1977"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027484451.1"
                     /db_xref="GeneID:38738743"
                     /translation="MKHGACVIAALVGVVCAATPAPTRTLAVRGDEDKLPAGGLTITE
                     PAQTAQASYYKIAPHETITFGWNFTSLKATPTRLYVVASCSKNGNTYPIAPSPQGIPG
                     DATSVTWYPYGYHIDAQKNGDPDLVVDKYRLMIYDEKGPGGLAKGGEFQPNNMAEFSM
                     YFPMKYTPLSEWTCHACNGASRPSAPAAPAMLGALSALACMAAAGFACL"
     gene            <611133..>615038
                     /locus_tag="MRET_1978"
                     /note="MRES_07855"
                     /db_xref="GeneID:38738744"
     mRNA            <611133..>615038
                     /locus_tag="MRET_1978"
                     /product="cell polarity protein"
                     /transcript_id="XM_027628605.1"
                     /db_xref="GeneID:38738744"
     CDS             611133..615038
                     /locus_tag="MRET_1978"
                     /codon_start=1
                     /product="cell polarity protein"
                     /protein_id="XP_027484444.1"
                     /db_xref="GeneID:38738744"
                     /translation="MVIFGKKRSEKDRAPKHAASGDVSADTTDPHQIQATTMPLGMRP
                     PTRPGGFVTRMVSNSRSHEPHEEDVSSSHIASDAAPRPMVPPPAAPSAAPPPTQPPPR
                     LPASSPPGAPDGSGVMLRPSTEEPRPPIDAPSGSLPVPMRAPPAAPTPSTPERARQPN
                     VVYPWGKKYVTMNPPRFLDESRRPPPGVLSPPPFPRYGHATNQATGANQEVYIFGGLV
                     RDSVKNDMYIMRVEPVQIQRSSGIKMDIALQATLIQTSGHAPLPRVGHAAVLVSNVFI
                     LWGGDTKIHAEDRQDDALYLLNLNNREWTRVAAPGVQGTPGPVGRYGHTLSMMGSNLV
                     VFGGQLDDQYFNELWRFDLNTLKDTPVWELVQPPTGGPPRRAGHSAVVYKDRLYIFGG
                     TDGQFHYNDTWCWDFATMTWSELKCVGYIPMPREGHSACMIDDIMYIFGGRGADGKDL
                     GDLASFKISSHRWFMFAHMGPAPFGRSGHTMVSVQNRILVVGGEAFSGDAQDEPTGLH
                     VLDTSKIKYPVKTERSGSSAPKPSDEHGAPPATPGSTVVPAPPTPSTPGQAPLAERSG
                     PVSEPVPVPEPLPPTAPMTQGTPLSASSQYSPPATAPSVAPVPAGAATVPSPRPPRPA
                     SPVQAPEAPLLSSPDAAAVAATATATTPVVPPGSTPLQSDPADTPQAHFPVHPRQLFR
                     EDDASSGSSSREMWLATTLALAVKQGFVPPARVPGADEALDVERLDTGTEHSAKEALV
                     KSVMSLKLQVTGLRADLQRQLQHEEERVAVQERARVAALQEAAFYRAKLSAHELHDTD
                     ERARLDRQRIFQLEKLVGHVKAEHGELERKVSMLTDQTKLEARLRQLAEDRLAETTRR
                     ALSAEESQLKVYEEYSALQKHMYETEASLRDHAAQISTLTSRFAAQQVERDALDERLG
                     TATRTIDTNRSMLTQFQEALTAAHTRLSDYERQHGEQQRQNETQNQLVLQLRAELQAK
                     AAELDMKSEQLEHHVASVAELESMVQSLQHEAQKHREAATGGLAQLLSMHAPHDASSG
                     ADATRDTTASHHSHMQALQDETQALRQLHEESRASLSAMATTLQQATERSTQLQRTNN
                     QLFSEMSAQRKQLSAALHELSTLRDRAQVSLSEDEQHKRDMEAAHIRNEALRQLLHEH
                     RIDVPDDDTLARPEFMQSRKVLELQRELEVHKRTAELNALDLQRAQEQLHHMSQEWEV
                     RRLQGASSRQELETLRLRAEQAERQLIEATEAHDQRTSQLENDYLTAVQFVRNTENML
                     RRLKDEHNKLRHDNAELRVLAAGQSPHAPLSSTRTFRSP"
     gene            complement(<615041..>616062)
                     /locus_tag="MRET_1979"
                     /note="MRES_07860"
                     /db_xref="GeneID:38738745"
     mRNA            complement(join(<615041..615070,615100..>616062))
                     /locus_tag="MRET_1979"
                     /product="replication factor C subunit 2/4"
                     /transcript_id="XM_027628606.1"
                     /db_xref="GeneID:38738745"
     CDS             complement(join(615041..615070,615100..616062))
                     /locus_tag="MRET_1979"
                     /codon_start=1
                     /product="replication factor C subunit 2/4"
                     /protein_id="XP_027484445.1"
                     /db_xref="GeneID:38738745"
                     /translation="MSTSAGYELPWVEKYRPRYLRDVVGNAATIERLQAIEEHGNCPH
                     LLVSGMPGIGKTTSVHCLAHALLGDAYKEAVLELNASDDRGIDVVRNKIKAFAQKKVS
                     LPPGRHKIIVLDEADSMTPGAQQALRRTMEIYAQTTRFCFACNQSNKIIEPIQSRCAI
                     LRFGRVSDEELLRRLVEICEAEKVQYSDEGLAAIVFTSEGDMRQAVNNLQSTWMGLGF
                     VSPDHVFTVCDQPHPLVVRELLERCQAGDVDAALDKLEHLWSLGYASLDIITTLFRVV
                     RTMDTLPEARQLEYIREIGWTHMRTLEGVATFLQLSALVARLAKCSMDPRCFAT"
     gene            complement(<616126..>616593)
                     /locus_tag="MRET_1980"
                     /db_xref="GeneID:38738746"
     mRNA            complement(<616126..>616593)
                     /locus_tag="MRET_1980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628607.1"
                     /db_xref="GeneID:38738746"
     CDS             complement(616126..616593)
                     /locus_tag="MRET_1980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484396.1"
                     /db_xref="GeneID:38738746"
                     /translation="MPRVPLCLPIVLCLAQGMLCVVAAHTDHAPTFRIRSIPPWHVSP
                     SEARVLPPPVSDVSDARPRGYLAAAVWHCVATSGAIVRFVWAPIVCLWEAFVTVVFLW
                     PYRALATHARTVYELYVVLGVGVCLGIAVGLVGTGWLYMEHVLYRARVRRASG"
     gene            <616656..>617729
                     /locus_tag="MRET_1981"
                     /note="MRES_07865"
                     /db_xref="GeneID:38738747"
     mRNA            <616656..>617729
                     /locus_tag="MRET_1981"
                     /product="adiponectin receptor"
                     /transcript_id="XM_027628608.1"
                     /db_xref="GeneID:38738747"
     CDS             616656..617729
                     /locus_tag="MRET_1981"
                     /codon_start=1
                     /product="adiponectin receptor"
                     /protein_id="XP_027484395.1"
                     /db_xref="GeneID:38738747"
                     /translation="MPSPYVVDHDALPAYAQQTPLIRSGYRRPGDMHVKDDSERPYIH
                     DSWYKCWKSVWLYWHNETINIHTHMWGAVFAIALLALQLADLHHWLPGGPWSLLSLDT
                     LPPPTILEPYPHLGLAIHGRPERMQPSRSDLTALSIFLLAAMTCLGCSATYHTVVCRS
                     NPVAQKFNRLDYVGIVVLIVGSNVPALHFGFHCHPHLRTIYVTLALAWGVLAMYVVTQ
                     PQYTVPKYKPLRAGIFIALGLSAVLPVVHGLWIAGDWHFVSQVLGARHIMYSGAVYIA
                     GALIYVAHIPERWSPYTFDIIGASHQIFHVCVLIGAWLHWLGVRQAYTFWHALETTAA
                     GAFGQEAVCAAVHAAIATGQGAQ"
     gene            complement(<617707..>618465)
                     /locus_tag="MRET_1982"
                     /note="MRES_07870"
                     /db_xref="GeneID:38738748"
     mRNA            complement(<617707..>618465)
                     /locus_tag="MRET_1982"
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /transcript_id="XM_027628609.1"
                     /db_xref="GeneID:38738748"
     CDS             complement(617707..618465)
                     /locus_tag="MRET_1982"
                     /codon_start=1
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="XP_027484394.1"
                     /db_xref="GeneID:38738748"
                     /translation="MSATSDSTRVTTHHQYVTNGMPESALLPTPMPLFHQWFRDAIDA
                     GVPEPEAMTLSTTALPDAPSPAQASSTIDKAHWRVHAPRPSARTVLLKGADERGFYFY
                     SNYASRKGDELAANPWCSLSFYWPPLHRAVRVLGRAERVSRSASQAYFDTRPLGSRIG
                     AWASPQSQVLSSREALDACVAASERKLGMPASEDAHVPVPEHWGGYMVIPDEIEFWVG
                     RTNRLHDRYRYSRDPNTTLPLSDASSWTIERLAP"
     gene            complement(<618484..>619148)
                     /locus_tag="MRET_1983"
                     /db_xref="GeneID:38738749"
     mRNA            complement(join(<618484..618671,618696..618870,
                     618900..>619148))
                     /locus_tag="MRET_1983"
                     /product="mitochondrial protein"
                     /transcript_id="XM_027628610.1"
                     /db_xref="GeneID:38738749"
     CDS             complement(join(618484..618671,618696..618870,
                     618900..619148))
                     /locus_tag="MRET_1983"
                     /codon_start=1
                     /product="mitochondrial protein"
                     /protein_id="XP_027484393.1"
                     /db_xref="GeneID:38738749"
                     /translation="MRLWSAVPRVSVPLGKPAPLLLRRGAHFDSNAFVQRLEHAGITR
                     QQADVLVTALTDVINESIENFAQSLVRRNEAEKHSYTQKVDFAKLKSEIQLLERSDFV
                     LMKSENERLMADTEKIKQRLREEIARTMAGVRLDLNLEKGRIRDESSVHALKIKEVDT
                     RIESEIAGVRTSIQSAKFNVLQYLVGVATGAGALLLAYLRMFR"
     gene            complement(<619253..>620429)
                     /locus_tag="MRET_1984"
                     /note="MRES_07875"
                     /db_xref="GeneID:38738750"
     mRNA            complement(join(<619253..620377,620406..>620429))
                     /locus_tag="MRET_1984"
                     /product="Ras-related GTP-binding protein A/B"
                     /transcript_id="XM_027628611.1"
                     /db_xref="GeneID:38738750"
     CDS             complement(join(619253..620377,620406..620429))
                     /locus_tag="MRET_1984"
                     /codon_start=1
                     /product="Ras-related GTP-binding protein A/B"
                     /protein_id="XP_027484544.1"
                     /db_xref="GeneID:38738750"
                     /translation="MPNSTKRKILLMGKSGTGKTSMRSFIFSSYRSEDTKRLGSTIDV
                     EHSHVRFPGNLVLNLWDCGGQTSYMDSYMNAQRNQVFSSVCALVYVVDVVSTDDEGGG
                     DTSEWETDLRYFRDCLSALQTHTPDAEIFCLLHKMDLIQPERRKSLYMSRVADLRKKA
                     REVLKEAASSPSHRDRSIHLRCYATSIWDATLYKAWSNIVHTIVPDVQYFETHLSELA
                     DMCSASEVVLFEKATFLVMSHYSPSIHDQRQSQQHGSTSYIVRYGDGPDAPETLLSGL
                     SLSMLPAQDKPANADEMTVYDDRFERVSELVKQFKMSCVETQNQLQSFELRTPTFLAC
                     MDALTSTTCLLVIVSDPRVHIRSLKNNIEVCRHQLEPQRILPDASNVP"
     gene            complement(<620516..>621358)
                     /locus_tag="MRET_1985"
                     /db_xref="GeneID:38738751"
     mRNA            complement(<620516..>621358)
                     /locus_tag="MRET_1985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628612.1"
                     /db_xref="GeneID:38738751"
     CDS             complement(620516..621358)
                     /locus_tag="MRET_1985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484543.1"
                     /db_xref="GeneID:38738751"
                     /translation="MSTTFVALTQGPILTFVFRDVVSQYEALARVETFYESEKHAGRY
                     LSWDEARRERVCKGYQAFNLPLASVAAWLLAMRTCVPCEESDNEKPFWYAHCSEQERD
                     VLHRLKEHGVLDEDGTLLSTTPCTYLISATATHTEISLAHERLHALYFLSPSYRALLT
                     SLWDTMPRAIASAIECDLKMRGYKPSVWQDEMGAYLGVRITAKGRRHDPCHEFGNKCA
                     ATCAEIRVLLLQRIPLCWQEDVGIQEDYVTISDSEWTQLISALTPAPCPPAPPTRGGR
                     RRRR"
     gene            <621449..>623230
                     /locus_tag="MRET_1986"
                     /note="MRES_07880"
                     /db_xref="GeneID:38738752"
     mRNA            <621449..>623230
                     /locus_tag="MRET_1986"
                     /product="sphingolipid C9-methyltransferase"
                     /transcript_id="XM_027628613.1"
                     /db_xref="GeneID:38738752"
     CDS             621449..623230
                     /locus_tag="MRET_1986"
                     /codon_start=1
                     /product="sphingolipid C9-methyltransferase"
                     /protein_id="XP_027484398.1"
                     /db_xref="GeneID:38738752"
                     /translation="MDATDIRALADDAVEKLSHTKNEADDLLSKKVSEANESFAPKAV
                     VNESDRLDGTLSSKPVGVVPSPSNMPTHAINSSSTGLDHRADALREEVPGLNLPSKPV
                     QTEPALAPGGKVRLTNSPAIKNAPLPAEGNGSFSNVHLALLILLGPAVLLRLLPFVKA
                     RWFGWTSYLFLVALLGVPIAIAYWTVASMCGPRVNEKVSLPNRPIEDYLDIQDPVLRQ
                     KYSGFTKIPMQIFWEAYFDGKIEVKGELLDVLEYRWDWAAMHFTPELFRYVLFKMLPD
                     VLMHTERQDEEQIRDNYDRGNDFHEWFLGPLMVYTSGVISDPDREETLEELQENKMEL
                     VCSKLALKPTDRVLDIGCGWGTLAAFAAKNYGADVTGVTLAKEQAAFGNERLQKNGIT
                     PDKARILCEDYRDIPVQPGHYNKIVSLEMAEHVGIRHYAKFLRNVYDLLDDDGVMVFQ
                     VAGLRPRWQYWDLIWGLFMNKYIFPGADASCPLNWVIGQLERAGFEVRSCDVAGIHYS
                     ATIDRWLKNWKANEAKVKAKYGERLYRIWHFFLASSILIAREGGSSVFQIVVTKNLNA
                     THRIEGVASHGGMLPRPNRGKWYQSVL"
     gene            complement(<623279..>624628)
                     /locus_tag="MRET_1987"
                     /note="MRES_07885"
                     /db_xref="GeneID:38738753"
     mRNA            complement(<623279..>624628)
                     /locus_tag="MRET_1987"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628614.1"
                     /db_xref="GeneID:38738753"
     CDS             complement(623279..624628)
                     /locus_tag="MRET_1987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484397.1"
                     /db_xref="GeneID:38738753"
                     /translation="MAAPTVSMPLPTVRKESSATITTGYSAVSFVPTEHVQTAVSEMD
                     DHIVIDIIVPPTRYLPPTLTVAQIMKQIQEDLIRELENLGQGLGSSIASVAHPRSMYA
                     EAEQFMRDSTGRLIDPALLPQNRSEFNRARLGIRSLRGESLLTYFPSPAAAEPKLVNQ
                     QVTTCPCVCCRSGCAGADPRTKRLPLLTESLAKDANGSTIVDVPPPQSTARTVLGEPF
                     TEATSLRRDASRPIPAIRSMDNLRDATAMKYNDVKIHANAAPVPTGHSFPAMPTSQYR
                     REWQIPLPSTGSKPSSHLVVRPNSQRHMDSHDQRAQKGMSVFAPLQLSDDLAAALTLN
                     DLGSTDISPELSRHTPPLSSPSSIGSTPRVRGDTSRRQDLSPPDSSIDATATPIAARF
                     SRSLSNLRQKAQRDAEIPPVPQTPATLLHAPKAPTYAAPNSRVRILSGPTQQSYRFH"
     gene            complement(<624843..>625383)
                     /locus_tag="MRET_1988"
                     /db_xref="GeneID:38738754"
     mRNA            complement(join(<624843..625002,625031..>625383))
                     /locus_tag="MRET_1988"
                     /product="peptidyl-prolyl cis-trans isomerase
                     NIMA-interacting 1"
                     /transcript_id="XM_027628615.1"
                     /db_xref="GeneID:38738754"
     CDS             complement(join(624843..625002,625031..625383))
                     /locus_tag="MRET_1988"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase
                     NIMA-interacting 1"
                     /protein_id="XP_027484548.1"
                     /db_xref="GeneID:38738754"
                     /translation="MSSGWEVRFSNSRKLPYFYNAGTHTSMWELPEGVSEEQARALPG
                     GHLLGEASQGNQPAQVRASHLLVKHRDSRRPSSWREANITRSKDEAIAQLRAFQDQLG
                     AQPSVQAFAQLAEQFSDCSSARSGGDLGSFGRGQMQRPFEEAAFGLEVGQMSDIVDTD
                     SGVHLVLRTA"
     gene            complement(<625465..>626874)
                     /locus_tag="MRET_1989"
                     /note="MRES_07890"
                     /db_xref="GeneID:38738755"
     mRNA            complement(<625465..>626874)
                     /locus_tag="MRET_1989"
                     /product="tRNA A64-2'-O-ribosylphosphate transferase"
                     /transcript_id="XM_027628616.1"
                     /db_xref="GeneID:38738755"
     CDS             complement(625465..626874)
                     /locus_tag="MRET_1989"
                     /codon_start=1
                     /product="tRNA A64-2'-O-ribosylphosphate transferase"
                     /protein_id="XP_027484566.1"
                     /db_xref="GeneID:38738755"
                     /translation="MDLARQEEREAYKALRRENKDVWSRLASIAHDAQYVEDVRGACY
                     PLPLVANLRCGAWYTDPAHLVSTAYFKSTDGHMHQWDFSLKRANLHLVHVIQSPDVDS
                     ALTGCLIIDSTRRGKRYPDALSKTVPIWCAVLNRASHRVHATPALIPALQVPLDQISQ
                     SEQAQIEARLDVWVDKLCASDLPVPRLAKPLHPVFVHAPHIPTLSSDVQHHVVLVSVS
                     PSLPPPSFRTMHASYVQGAGDDHEAWAHGLTPRLFWRHKRQLMAPELQRDERIQLVCD
                     IVKTEREQAGQVAWLSSHDTAIQIEGTPIFIQALPATHMFSERDRASYALIIHCAQPD
                     TSPHVLGLGLDASKRGLNAFSAALPRVVDTVTDVLRKEAHGRGVLLCCTDGGQLSGAM
                     VVAILAASFDRHRHFLGVGDDAYARLTQHRRQLSKDDTQRRLQWLTTSWMHASPSRAH
                     LQRVNAYLLGPFRQVRLWT"
     gene            <627013..>630198
                     /locus_tag="MRET_1990"
                     /note="MRES_07895"
                     /db_xref="GeneID:38738756"
     mRNA            <627013..>630198
                     /locus_tag="MRET_1990"
                     /product="glycosyl hydrolase family 88"
                     /transcript_id="XM_027628617.1"
                     /db_xref="GeneID:38738756"
     CDS             627013..630198
                     /locus_tag="MRET_1990"
                     /codon_start=1
                     /product="glycosyl hydrolase family 88"
                     /protein_id="XP_027484487.1"
                     /db_xref="GeneID:38738756"
                     /translation="MSQSMVHVDNTTIVLLVTLLALLLYARFCRQYNQPVLHPLILQR
                     QSEASAVRMPNESASYRNVNAPLGLDLAMRPQRDTPTVATMLARGVEAGVPQVVRRVL
                     DASMSNEEIRLQAAAFMSAVRTILHTDTPVIVVCGFVNSSHALTALLAPALIGGGARV
                     LVLPPGMPPTSLPADVDEKDLAIVCLDAPLLPILAHARLIIANENSDVKGASYMTWDD
                     VMGHATENEAPALPDVSRLTNAELDSLGANTFATFWDGERAWVSVSETSMTSGVTSWL
                     SQFPADAIPQRGDLVLTDLMYARAAPATVYVTLLLSVLFTGTGIAMEPSTELIQNLRV
                     LHPTLLFLSTYGAQCVEQSVWMPSTASPLWSLMRRMNMDLLRNGVLPKDRLLDRLVCK
                     GVRHRVGLDHVRAAIITGDGCAAEQSLVDSLRLYLGVPVMHAYVPRRLESQGMSSMVT
                     APVCTSNMYDLQVFAPQLLRDDSARCLPASVGPPSVSLELKLVQDSPAVKAHAEAIER
                     LRADGCDDPIGEVYVRGYTVSKTGHNDTRISPWHNTGDVALVRTNGTFVVVAPRGANE
                     AGMMPNTITSTDASDTLIRQQTPRRVTRTTVMLTLLLCVSCVDAHGMKRSLHPQDQLM
                     RRGEDHHVNTTMIDQAFSGIMSMQRASWEQGVLQSAVTEYYYPQWSVFKKPGHELYPK
                     PKTLSIKDQPIDLLRLAMSSIDGQDSAGRLASVITGDESTGRGASMDSASCGEGVLVG
                     AWIREGFPNNKPGARGMFGHAAQKQLEYLLHNVTRTPSGALSQRAGSSDPELWSDSAY
                     MGPPFIAFYGLVTNNQTLVQMAFDQLRLQHKALARTEGTGRNLWHHIVRFPNARNKSD
                     TQLIDARVWLTGNGWAAAGMLRVAAIISQSPWTDKMKDQYHQLLDWAEDIVSATYFFV
                     DRGTGLMRNVVDNPKTFYDGSGSALMAYAAFRLGSMDEQRRDQIQWAENAYQTLSRAL
                     DPFSQFTNGIQTVNEMSSGEVGVTSTESLAFLILMSAARRDYYQGNTTGTGGAVDPPA
                     PDSSAASVHVRTTVVACTLIAACMWVMVSSL"
     gene            complement(<630205..>631637)
                     /locus_tag="MRET_1991"
                     /note="MRES_07900"
                     /db_xref="GeneID:38738757"
     mRNA            complement(join(<630205..631377,631410..631439,
                     631479..>631637))
                     /locus_tag="MRET_1991"
                     /product="isocitrate dehydrogenase IDP1"
                     /transcript_id="XM_027628618.1"
                     /db_xref="GeneID:38738757"
     CDS             complement(join(630205..631377,631410..631439,
                     631479..631637))
                     /locus_tag="MRET_1991"
                     /codon_start=1
                     /product="isocitrate dehydrogenase IDP1"
                     /protein_id="XP_027484488.1"
                     /db_xref="GeneID:38738757"
                     /translation="MHCWGQPVRSLFQRSVPALLPTTSRVSQVAKMSSVSKIKVANPV
                     VELDGDEMTRIIWKQIREDLILPFVDVDLKYYDLGIENRDKTDDRVTAESAEAIKKYK
                     VGVKCATITPDEARVKEFNLKKMWLSPNGTIRNILGGTVFREPIILEKIPRPVPGWTK
                     PICIGRHAFGDQYRCQNFVVPGPGKLTISYTPTDPNGDKINIDVFDYPEQGGVAMAMY
                     NTTESITGFAHACFRIAIDKKMPLYMSTKNTILKAYDGKFKDIFQDLFDNQYKPEFDK
                     LGIWYEHRLIDDMVAQAIKGNGGFVWACKNYDGDVQSDILAQGFGSLGMMTSELITPE
                     GDMIESEAAHGTVTRHYREHQKGNETSTNSVASIYAWTRGLIFRGKLDNNQELIKFAR
                     ALEEACVHSIDVDNVMTKDLALSIHGKNLKREHYVNTFEFLDHVKSVLVKKLQEQGLI
                     SHL"
     gene            complement(<631847..>632923)
                     /locus_tag="MRET_1992"
                     /db_xref="GeneID:38738758"
     mRNA            complement(join(<631847..631895,631922..631931,
                     631960..632762,632786..632823,632852..>632923))
                     /locus_tag="MRET_1992"
                     /product="mitochondrial ornithine carrier protein"
                     /transcript_id="XM_027628619.1"
                     /db_xref="GeneID:38738758"
     CDS             complement(join(631847..631895,631922..631931,
                     631960..632762,632786..632823,632852..632923))
                     /locus_tag="MRET_1992"
                     /codon_start=1
                     /product="mitochondrial ornithine carrier protein"
                     /protein_id="XP_027484177.1"
                     /db_xref="GeneID:38738758"
                     /translation="MSAQAESPPTQGLNRATKDILFGSVAGMVSKVFEHPFDLVKVRL
                     QTQPHEKPHYTGALDCFRKTIQHEGFRGLFRGVSMPLWGATLEDAALFFTYNQVQQAL
                     RWSRNLSESASLPMSDLAIAAAASGAMAGLVLTPIELIKCKMQVQMMGAVHQASTPAT
                     TNALGLISNTIRKEGVAGLWHGLSGTLLREVGGGIAWFLTFEFASQEFLRRRHSQAPL
                     TKSDLSSLELATSGALAGICYNVSLFPADSVKSAMQTEHELRAQAGLAKATPTGFLQT
                     LLNIYQTRGIRGLYAGVGVTCLRSAPSSAIVFLVYNKLEQAAERVGW"
     gene            <633088..>634218
                     /locus_tag="MRET_1993"
                     /db_xref="GeneID:38738759"
     mRNA            <633088..>634218
                     /locus_tag="MRET_1993"
                     /product="hypothetical protein"
                     /transcript_id="XM_027628620.1"
                     /db_xref="GeneID:38738759"
     CDS             633088..634218
                     /locus_tag="MRET_1993"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027484180.1"
                     /db_xref="GeneID:38738759"
                     /translation="MLVYTLVALVLCAQAFARTSILLNTRKIGASDPVQITPPDAHRV
                     LSHHLNMRVNVLPDVPMARSGHANLWHHAPAEQVHYDASVLFEPVAPSGGNVIITMYG
                     PDDLHALPDTLTHTHTMESSSLRDSFEALASLYEKTANGAHKAWDAVQHSATSSLERL
                     QAELAHIARLGNDIQALSTARIHSLADVGREYGTHSQTYRDAQRQVKQTLELLVQRVK
                     NMAGAGVAVVYTTDASNHERRADPMAPTSDPLHVFRPPQPVHAAVQSPGMQSSVPVCP
                     ATREELERTTQQCHGRGTPVQSTKGGRLCWRCACSRTTEQGRGRVWAGAACEKQDYSS
                     ETLLFIGTFLVLFVSIVASCALLYREGTHELPGTLSSVSLRS"
     gene            <634282..>635625
                     /locus_tag="MRET_1994"
                     /note="MRES_07905"
                     /db_xref="GeneID:38738760"
     mRNA            <634282..>635625
                     /locus_tag="MRET_1994"
                     /product="acid phosphatase"
                     /transcript_id="XM_027628621.1"
                     /db_xref="GeneID:38738760"
     CDS             634282..635625
                     /locus_tag="MRET_1994"
                     /codon_start=1
                     /product="acid phosphatase"
                     /protein_id="XP_027484554.1"
                     /db_xref="GeneID:38738760"
                     /translation="MDVRTSVASSSSVPLGRGEISSSLGWVPPPEQLDLLQVIYVLRH
                     GERTPVRRRLTSAEPPLPHRWNLCHASQVFGQSVMQHTGSDVGLPHGKPHIPRRIEFT
                     VHNDAPQTGEHGDCLLGELTDKGRKTMQHIGEALRARYFDAEHLLPPNLAKEDARSLY
                     LRSTHMSRTIQSLEELVRGLVGPNAVSTPEILVRNTFDEDLLPNPRKCPKLGVLMQKF
                     ADLAVDVYNPRLAKYDDVVAPLDGGAAPRLNDGPRLSGLFDTMRSATAHGIQLPQSLE
                     NPELQTLMEHAVLDEWFGGYASRDPDERRQYRRMALGTFFESLCDTFARRATLGDADP
                     RRMSILLGHDATLVGMTHMLDVCNHRWPAFGAGLGLELFRDRSSTEPVTAQHMPGYYV
                     RCRYGDEELRLPGCQAPGKHWSGRPELCTLDAFREIVVDRLRHPQGLTIQQECTM"
     gene            complement(<635781..>636599)
                     /locus_tag="MRET_1995"
                     /note="MRES_07910"
                     /db_xref="GeneID:38738761"
     mRNA            complement(<635781..>636599)
                     /locus_tag="MRET_1995"
                     /product="ditrans,polycis-polyprenyl diphosphate synthase"
                     /transcript_id="XM_027628622.1"
                     /db_xref="GeneID:38738761"
     CDS             complement(635781..636599)
                     /locus_tag="MRET_1995"
                     /codon_start=1
                     /product="ditrans,polycis-polyprenyl diphosphate synthase"
                     /protein_id="XP_027484574.1"
                     /db_xref="GeneID:38738761"
                     /translation="METGAQRDERTERYPTVRNYSIIEKSRMIWNWIVDAVLRHALYS
                     LSTGPLPRHIAFIMDGNRRWSRSHGMPVQEGHAKGFETLKRILELCLSLQRIEVVTVY
                     AFAIDNFKRKASEVDALMELARTRLIELYQESEFVARHSIRIRIAGHREYLPPSVQET
                     ARRAEEETCHNTGPILNICFPYSAQAEICYAAQKAAKAGEPIIPDTVASHLMVPANIP
                     VDILVRTSHVSRLSDFLLWQVNEHTQMHFIKQYWPTFGTYDLLSILLEYQRAHM"
     gene            complement(<636666..>637417)
                     /locus_tag="MRET_1996"
                     /note="MRES_07915"
                     /db_xref="GeneID:38738762"
     mRNA            complement(join(<636666..637208,637238..>637417))
                     /locus_tag="MRET_1996"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628623.1"
                     /db_xref="GeneID:38738762"
     CDS             complement(join(636666..637208,637238..637417))
                     /locus_tag="MRET_1996"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484168.1"
                     /db_xref="GeneID:38738762"
                     /translation="MPLNTAQYLTKYGWKGHGSPLDGEGGRGLKKPLLIPKKRSLSGI
                     GQDRDRAVEWWDDVFAASAKALTIGRETGHQAENSTVPRRALSTIAKQEHARRTLMSG
                     FRRGQVLGGTIIEKSSTAEKQDPELASKEKSKKKSKGKERSKSSESRDKSQPKVKREK
                     DKDRSKDQRKKGKGRSKDKHEKDKSESKDKRQSKKNSKSKDKSQSKDKSGNLFPDKLT
                     PQDTPKRKRDESSGGPQKKQRA"
     gene            <637542..>638204
                     /locus_tag="MRET_1997"
                     /db_xref="GeneID:38738763"
     mRNA            <637542..>638204
                     /locus_tag="MRET_1997"
                     /product="coenzyme Q-binding protein COQ10"
                     /transcript_id="XM_027628624.1"
                     /db_xref="GeneID:38738763"
     CDS             637542..638204
                     /locus_tag="MRET_1997"
                     /codon_start=1
                     /product="coenzyme Q-binding protein COQ10"
                     /protein_id="XP_027484169.1"
                     /db_xref="GeneID:38738763"
                     /translation="MWYLRSGASCSSARQTIRAYKNAIYSKAQRPVTHVGQVRTFLNL
                     GNILPTSREPSSPKKVREQVVLPYTPKELYSIVSDVDSYHHFLPYCLGSRVIGPSDSP
                     RAKENRQNASSIVDAELTIGFSAFRESYVSEVSMRPNEWVLAHAKPSPLFQELHTAWH
                     FRPLPAGASIPRTEVTFTLAFAFSSPFYAAVAGQVFEKLSSSMLEAFQQRARSVYGLR
                     RS"
     gene            <638300..>639471
                     /locus_tag="MRET_1998"
                     /note="MRES_07920"
                     /db_xref="GeneID:38738764"
     mRNA            join(<638300..638371,638401..638483,638512..638570,
                     638602..639402,639437..>639471)
                     /locus_tag="MRET_1998"
                     /product="NADPH-dependent medium chain alcohol
                     dehydrogenase"
                     /transcript_id="XM_027628625.1"
                     /db_xref="GeneID:38738764"
     CDS             join(638300..638371,638401..638483,638512..638570,
                     638602..639402,639437..639471)
                     /locus_tag="MRET_1998"
                     /codon_start=1
                     /product="NADPH-dependent medium chain alcohol
                     dehydrogenase"
                     /protein_id="XP_027484440.1"
                     /db_xref="GeneID:38738764"
                     /translation="MPQGYAIFDQAKWSDFQKIDFDLKNPADDDVEVSITHCGICGSD
                     LHTVRGDWGTFCVPAVIPGHEIVGTVTSVGKSVQDIKVGDRVGIGAQVGSCMNCNDCS
                     HDNENYCANYMVDTYNSRWPDGSIAQGGYSTAIRAHQKFVFPIPDGIKSEHAAPMLCA
                     GLTVYSPLYRSKVGPGSRVGVIGVGGLGHFGIMFAQALGAEVFAFSHTASKKEDAHRM
                     GANEFILMDKSDDWLKRLQQAPLDVIINTASSSSVEVAKVVSCLKVGGHIYCLGLPKE
                     GFRLPVMQLCGRGAFIGSSHIGSKKEALDMLRLAAEKKIEPWIEVLPMKECSKAIERV
                     AKGDVRYRFVLEQDL"
     gene            <639648..>640189
                     /locus_tag="MRET_1999"
                     /note="MRES_07925"
                     /db_xref="GeneID:38738765"
     mRNA            join(<639648..639742,639787..639807,639847..639955,
                     640115..640130,640158..>640189)
                     /locus_tag="MRET_1999"
                     /product="ubiquinol-cytochrome-c reductase complex subunit
                     (QCR10)"
                     /transcript_id="XM_027628626.1"
                     /db_xref="GeneID:38738765"
     CDS             join(639648..639742,639787..639807,639847..639955,
                     640115..640130,640158..640189)
                     /locus_tag="MRET_1999"
                     /codon_start=1
                     /product="ubiquinol-cytochrome-c reductase complex subunit
                     (QCR10)"
                     /protein_id="XP_027484441.1"
                     /db_xref="GeneID:38738765"
                     /translation="MFRPTPAVLGAFRATSRVAFNKPAFQPHFGSVNSQYALKWVPSL
                     FFWGATGGMFVTIAMSGVPLFKTDVLLKTPVASFFEDKTPDCDKPF"
     gene            <640588..>641304
                     /locus_tag="MRET_2000"
                     /note="MRES_07930"
                     /db_xref="GeneID:38738766"
     mRNA            <640588..>641304
                     /locus_tag="MRET_2000"
                     /product="carbonic anhydrase"
                     /transcript_id="XM_027628627.1"
                     /db_xref="GeneID:38738766"
     CDS             640588..641304
                     /locus_tag="MRET_2000"
                     /codon_start=1
                     /product="carbonic anhydrase"
                     /protein_id="XP_027484124.1"
                     /db_xref="GeneID:38738766"
                     /translation="MSTSPPFSRALLDSLLDRNALWSQDFISQQPDLANALRQGQHPK
                     VFWIGCSDSRVPESVVCNARPGELFVLRNVANQFHPNDDSAVSALIFAVQALGVEHVI
                     VVGHTSCGGVTAAVNQAIKEQDEDHELPSTSALTRHLTPLTGLARYLRVRVRERNFMS
                     PESMQDHLVPLLTEASVRRQIQNIVEHPVIQDNWNQKVSPLNGKVNPRVTIHGWVHNL
                     STGRLVDLNTSIHPPELHES"
     gene            complement(<641310..>642327)
                     /locus_tag="MRET_2001"
                     /note="MRES_07935"
                     /db_xref="GeneID:38738767"
     mRNA            complement(join(<641310..641462,641490..641778,
                     641807..>642327))
                     /locus_tag="MRET_2001"
                     /product="uracil-DNA glycosylase"
                     /transcript_id="XM_027628628.1"
                     /db_xref="GeneID:38738767"
     CDS             complement(join(641310..641462,641490..641778,
                     641807..642327))
                     /locus_tag="MRET_2001"
                     /codon_start=1
                     /product="uracil-DNA glycosylase"
                     /protein_id="XP_027484123.1"
                     /db_xref="GeneID:38738767"
                     /translation="MSVPKRARSPSVDEFDGLDADDLIRAVQESETPKKARVNETAPT
                     PAPYTQPYSGTAEDPLLLERTTMSKAWFERLEPAMRQESFKKLKAFLDAEKRAGKTIY
                     PPPHLIHSWSRTTPLEQVKVVIVGQDPYHQPGQACGHCFSVPKGKAVPASLQNIYKEL
                     KAEFPNDFVPPRHGCLDGWARQGVLLLNACLTVNAGAAGSHHNHGWEPFTREILKSVL
                     KTSSQSAHSGPLASMFANQGVQKESDGPHKGVVFLAWGLPAAKTLAEAGITEKTPNVL
                     LLKSPHPSPLSAHRGFLGNGHFAKANAWLEERYGKGGGIRWSDL"
     gene            <642438..>643127
                     /locus_tag="MRET_2002"
                     /note="MRES_07940"
                     /db_xref="GeneID:38738768"
     mRNA            <642438..>643127
                     /locus_tag="MRET_2002"
                     /product="ubiquitin carboxyl-terminal hydrolase L3"
                     /transcript_id="XM_027628629.1"
                     /db_xref="GeneID:38738768"
     CDS             642438..643127
                     /locus_tag="MRET_2002"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase L3"
                     /protein_id="XP_027484122.1"
                     /db_xref="GeneID:38738768"
                     /translation="MTTWVPLEANPELFNAWASALGLDTSKYAFYDIFGLDPELLAMV
                     PGPVEAVLLLFPLSPKIEAARQARETCLAQDDLLWFPQTIGNACGTIGLLHAIANSAA
                     SQAVQPDTALAHLLSQARSVPAEARPDVLVQCEALRNAHATTAAQGQTTAPDADDDVD
                     LHFIAFVRSASSGALIELDGRQSRGPIVRLPHIEADELLPKAAAYIQQHYMAADPDQV
                     QFNLIALSASV"
     gene            complement(<643110..>644489)
                     /locus_tag="MRET_2003"
                     /note="MRES_07945"
                     /db_xref="GeneID:38738769"
     mRNA            complement(<643110..>644489)
                     /locus_tag="MRET_2003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628630.1"
                     /db_xref="GeneID:38738769"
     CDS             complement(643110..644489)
                     /locus_tag="MRET_2003"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484121.1"
                     /db_xref="GeneID:38738769"
                     /translation="MAIHAWRMTLRPAARLAVVPRTVRAYATQRTSKMSFVSKLFSDP
                     VIETIVVASRIARILLGSVLVVGGTTLVAWEGMHQYVEHAAMPSRRPRLVDADDKYGF
                     AADAHLDAWTQCEHTDSRLGMFGRHIVRSAWMAQHWGSGITPSVMFGHRSGSMDVQAA
                     TENQGLRMAEQFLHTSLHIAENKHIAVPDEADSGTAPDPAAVRLELWLASVREQLGTP
                     ASLERAINACEKVYDVVPDDILRTHVATRLGTQYTLLGKAGHGVAWLDRAMKLGGTQT
                     STSEAVDALLARRIPVLAPRDERTTLSILQTLSALHAHQPQGLHLALRTQLAALRLAS
                     AAASPTPTSRDGALHRLWVEQKQSVLAMHVAETLYALKPRRSRIIARLWPSLVDAQPS
                     QYGLVGPTLRGPYAQSRTWLTTARDRAAFVCDQLTHPDDAQAQQIQHEAEYVVREATR
                     LLQALDTRT"
     gene            <644556..>645155
                     /locus_tag="MRET_2004"
                     /note="MRES_07950"
                     /db_xref="GeneID:38738770"
     mRNA            <644556..>645155
                     /locus_tag="MRET_2004"
                     /product="PUA domain protein"
                     /transcript_id="XM_027628631.1"
                     /db_xref="GeneID:38738770"
     CDS             644556..645155
                     /locus_tag="MRET_2004"
                     /codon_start=1
                     /product="PUA domain protein"
                     /protein_id="XP_027484120.1"
                     /db_xref="GeneID:38738770"
                     /translation="MSFFRKLDPKTDLGTPSSLKSSVQRGIRTKLLEQYPDTLGADDG
                     ALLESIWPKKESITSAKYKPEHIQILLLRNMPIFFQHYDGPYIPTLHLLHKYPALLPS
                     IQVDRGAIKFLLSGAAVMAPGLTSAGGRLPDPSKGEKPLPKETVVSIKAQGKEFEVAI
                     GVLKVDTEEIRAKGKGIAVDNVHYLGDDLWAICSRGGLQ"
     gene            complement(<645166..>647526)
                     /locus_tag="MRET_2005"
                     /note="MRES_07955"
                     /db_xref="GeneID:38738771"
     mRNA            complement(<645166..>647526)
                     /locus_tag="MRET_2005"
                     /product="prolyl oligopeptidase"
                     /transcript_id="XM_027628632.1"
                     /db_xref="GeneID:38738771"
     CDS             complement(645166..647526)
                     /locus_tag="MRET_2005"
                     /codon_start=1
                     /product="prolyl oligopeptidase"
                     /protein_id="XP_027484119.1"
                     /db_xref="GeneID:38738771"
                     /translation="MLFASRRSLVHLPISRVAPTIMAAHHHWTPSAYPYPSARRSDAS
                     TVYASKAHGHVVVPEPYDWLETPPSQSTETAAWTKAQSEYTARFVAQCKDKPALQERL
                     KLNWDYARTSAPSLKPDGRYYYSYNAGLAPQSQIYRATREQVDTAQKSPSKEPVGELF
                     FDTNVLSSDGTVALKWTSFSHSGKYMAYGISQSGSDWFRIFLRSTEQPMLSRSEGTDV
                     GGDGHMPDVLDHIKFSGITWTHDDRGFFYQRFPATEHEDKGTETDANQDAQLYYHRLG
                     TPQAEDILVVDSDPVTRSSMWHCDVTDDGQWLILANSKDTDNKMRYYAASLADGVSSR
                     MAWIPISSDFAFMLDYIANDNTRFYMLSNKDAPNYRIVSFELDPTKARVVDHVSQLTG
                     GISCFTDIVPEDPQAILTTAAVLDHNNLLAVYSRDVKDELWVFDLTTGDRITRLLPEL
                     VGTIAQLTGRRDHRESFVSSVSFANPGRVDRVSWEGLERTDRAVPPASVTEYATTHVA
                     GIDANDYISTQVFVTSKDGTRIPMFLTHAKDTPLDGSAPALLYFYGGFNIPITPVFSP
                     SMMTWVASYRGVLAFVNARGGGEYGDKWHDAGRLFHKQNVFDDVLAAAKWLHESKYAR
                     KGHITICGGSNGGMGVGAVVNQCTDEHGIGAAIADVGVHDMIKFPLWTIGKAWTADYG
                     NPQEDGAAFDYNMTYSPLHTVRANKTYPTVILACADHDDRVVPAHSFKLAAEMQHTLA
                     NNANPILLRVDLQAGHGEGKSTQKRMEEAAEKYAIVAHVLGLPLTP"
     gene            complement(<647611..>649437)
                     /locus_tag="MRET_2006"
                     /note="MRES_07960"
                     /db_xref="GeneID:38738772"
     mRNA            complement(<647611..>649437)
                     /locus_tag="MRET_2006"
                     /product="large subunit GTPase 1"
                     /transcript_id="XM_027628633.1"
                     /db_xref="GeneID:38738772"
     CDS             complement(647611..649437)
                     /locus_tag="MRET_2006"
                     /codon_start=1
                     /product="large subunit GTPase 1"
                     /protein_id="XP_027484118.1"
                     /db_xref="GeneID:38738772"
                     /translation="MPLAQSKNRVGLGHAIINRRAKESRNPKYSDYHTTDMHIGQAKW
                     TKLQSVTHEGALEEFLNTAAMADADFTAERRTDKIIDTHSRTRHNPYLLTPQQEQEVL
                     QNQHANKDRLRVPRRPEWDAHTTPAQLERMEKDAFLNWRRGLAELQDGIGFVLTPFER
                     NLEVWRQLWRVIERSQLIVQIVDARNPLRFRCEDLEKYVHSMPANPGDMASIPSEERA
                     TYRGPRRTLLLINKADLLDTEQRRQWAEYFQKQGVMFAFFSAHDEVARQLAKLQREAQ
                     FEHSAVEEVTGAVQDTLALDHDPSRILGVLELERLFLQCAPDLALFRRHEPNLPHDGI
                     PEKLTVGFVGYPNVGKSSTINALLGEKKVSVSATPGKTKHFQTIHLSPTTIICDCPGL
                     VFPQFSTSPADLVCDGILPIDQMREYTAPAELVAQRIPEDILSRFYNMDIPTLSAEEG
                     GQGRPTGMELLTAYAMARGLARQGQGNPDESRAARYVLKDYVNARLLYAHPPPGIDPA
                     AFNAAQQNRLREELPERRPEAAPLVTPHMHGGRMAESSSKTASLDQAFFGPSSASGAH
                     VKGRRRMPPVGRLGLESEAPAGLGSKKHHKGHRRRKQRSAQT"
     gene            <649324..>651381
                     /locus_tag="MRET_2007"
                     /note="MRES_07965"
                     /db_xref="GeneID:38738773"
     mRNA            <649324..>651381
                     /locus_tag="MRET_2007"
                     /product="U3 small nucleolar RNA-associated protein 25"
                     /transcript_id="XM_027628634.1"
                     /db_xref="GeneID:38738773"
     CDS             649324..651381
                     /locus_tag="MRET_2007"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 25"
                     /protein_id="XP_027484117.1"
                     /db_xref="GeneID:38738773"
                     /translation="MHICRMIVRVLGIPRLFGAPIDNGMAKSDAVLGLSKRHGGKNQK
                     KRSSYVWRLGQLFFLFTTMSDPLAHVRLMTMLNVKATHPRKEDENMPKKRVRTSVPPH
                     AAPVRNERPETPTKTEPDEPVAPVLVAEDDDEDRADAFQCHFAEVNPENLAWKEPEHI
                     RILGGAVVTRADRSLQERPVSRPHARVWRAFEAKHALSRMQSEVLECIGTYTDFWHSR
                     VAIQDHDLFRQVCAMHAMSHIAKTRQRILKNNEKLAKAAAAHTDDDDELPEFRDQGFT
                     RPKVLLVVPFRHTAKVWVDMLMSYAGCEQVEQKTRFHKEFSLPPGSFDKLADPEFAHR
                     YPDDHRHTFQGNIDDNFKLGIKLTRKTLKLYSPFYESDVIVASPLGLRLLIEKEHEHD
                     YLSSMEVVMVDQMDVMLMQNWDHVRFILACVNQIPKEAHDTDFSRVRPWYLDGHASLL
                     RQTILFSTFDAPEFRQLFHSLRNVGGKVRTTALGPDDVPSMSLVPPGVRQTFFRFECS
                     NPQSEGDQRLTAFKERILSLLKKSAVSASHTMIIVPSYFDFVRLEDDFRRMDPPMSYT
                     TLTEYSTGRDISRAREAFFSGKKSVLLLTERFHFYRRYLIRGAITVVFYAPPEHAVYY
                     PEFIRAPLSVRDASSAAPTDPADLQVWTLFCKYDLLRLERVVGASQARKMLTGTDTSY
                     RFL"
     gene            complement(<651378..>653102)
                     /locus_tag="MRET_2008"
                     /note="MRES_07970"
                     /db_xref="GeneID:38738774"
     mRNA            complement(<651378..>653102)
                     /locus_tag="MRET_2008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628635.1"
                     /db_xref="GeneID:38738774"
     CDS             complement(651378..653102)
                     /locus_tag="MRET_2008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484127.1"
                     /db_xref="GeneID:38738774"
                     /translation="MWQRLQERYGSQSAHGGDGSRVGTDAIALSKKRRAQMRMRADAL
                     AKSAADEEAPSTPHESGLVREEDEAGHGEEEYAEYTGATERIPLGREAERKRAVLRRQ
                     QIRSMIASTQGGDDDGDEDDIAIVVRQPRAQAPVPVSAETLIHDEQEALPDDGYGDDD
                     DREAQDAWERAQMRRMDVDMGDQLEAPPVAARIPLVSAQPTPRSCMARLEALRAQWEH
                     EAVERNDAVRTMEQELGEVQEEERALQSEIVELEAKSVWLTDMNAFTDALASFFDTKT
                     PLLEALEHNVQALLIDRYVTRRRLRTAADAWLSDADKEQFLEGCVQLRKEHALVMSDV
                     ENDAFRDPASELVPRFEAWRTRYLSDYDKAWGGLALANAWEWYARYEMALWDPLWRAA
                     DDDLCLGGPLEGIPGFAWEHAVSAYVGESSAGGDDEMLATMLTRVVVPRLEALAQAYD
                     AYSDMETNAALQVVEQVSYVVEKTPMRSLLSAYRDALDRAVREPVSDVFARLALVRHV
                     LLWCTYYDDAWDHHAYENVARQAVASAWSAIQQTPRMDDVVKAVREVCCVWPTSFLPS
                     ERQAFSVY"
     gene            <653378..>654502
                     /locus_tag="MRET_2009"
                     /note="MRES_07975"
                     /db_xref="GeneID:38738775"
     mRNA            <653378..>654502
                     /locus_tag="MRET_2009"
                     /product="SHO1 osmosensor"
                     /transcript_id="XM_027628636.1"
                     /db_xref="GeneID:38738775"
     CDS             653378..654502
                     /locus_tag="MRET_2009"
                     /codon_start=1
                     /product="SHO1 osmosensor"
                     /protein_id="XP_027484126.1"
                     /db_xref="GeneID:38738775"
                     /translation="MLKLPKLDLMKQCGLAVFGLGALLMICGWFIAFVSLCYGQSESY
                     FDRFDYSHSAWFIIWIQLFLCFAIFGHFFLPFPTDFMVSVFLGACFAITLIVSDAHLY
                     ADSRMNLLEVEANNDRGSMTALTTGFLILALGNLFALCYFAVKFDLEHRPNKQIDDSF
                     GGIKGSGISGPGGIIGSFPGSGLRQRAGFQGENPVDSVGVNSMSYPPQAANSMAPRSP
                     DLGTPNALGSDPLSNGYSRPNDVEIGMPTTGSAVNATSTETPFVQAPRQDASLPLNET
                     AKDDNLAPPILSSNLGPSTAGAAGGAVPAAAAGASGTQSALQRAEALYSYKASEDDPT
                     EISFAKGDVLQIVDSSGKWWQAQRPNGELGIVPSNYLRLI"
     gene            complement(<654785..>655320)
                     /locus_tag="MRET_2010"
                     /note="MRES_07980"
                     /db_xref="GeneID:38738776"
     mRNA            complement(join(<654785..654831,654861..654972,
                     655018..>655320))
                     /locus_tag="MRET_2010"
                     /product="cytochrome c oxidase subunit 5b"
                     /transcript_id="XM_027628637.1"
                     /db_xref="GeneID:38738776"
     CDS             complement(join(654785..654831,654861..654972,
                     655018..655320))
                     /locus_tag="MRET_2010"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 5b"
                     /protein_id="XP_027484193.1"
                     /db_xref="GeneID:38738776"
                     /translation="MSFLRSSITPSLRASLRTASIQRVAMRSIASTPLRFSEHHAPII
                     QGEGTKPGTMGTDESQSTGLERFELMGRLQGVDVFDMSPLDASRPGTMKNPIKVQSMA
                     KEQIVGSTGFPAESHETVWLKLTVDQPIARCPMSGNVYQLEYIGPQDDHHH"
     gene            <655785..>656478
                     /locus_tag="MRET_2011"
                     /db_xref="GeneID:38738777"
     mRNA            join(<655785..656266,656292..>656478)
                     /locus_tag="MRET_2011"
                     /product="cytochrome b561"
                     /transcript_id="XM_027628638.1"
                     /db_xref="GeneID:38738777"
     CDS             join(655785..656266,656292..656478)
                     /locus_tag="MRET_2011"
                     /codon_start=1
                     /product="cytochrome b561"
                     /protein_id="XP_027484194.1"
                     /db_xref="GeneID:38738777"
                     /translation="MPTIGELLWHNNISGARLAQMGAASVVASVCVAVFYVSENWHIP
                     TFAWHPLLVTLGLFFLVQSILILQPTRAQAEKKLGLQWHQILILCAGLPMMTMGAWII
                     WHLHSLPGQKHFISWHGLLGFCIIMLLWLQVLFGASTLYWKNVFYGTESRAKAMWKYH
                     RMSGYTLCALLLVELVLAFWEVQWMKKTGGLPLVAFTTAMVVVTSYGIANRVDLSKWG
                     FGSP"
     gene            complement(<656531..>656968)
                     /locus_tag="MRET_2012"
                     /note="MRES_07985"
                     /db_xref="GeneID:38738778"
     mRNA            complement(<656531..>656968)
                     /locus_tag="MRET_2012"
                     /product="large subunit ribosomal protein L49"
                     /transcript_id="XM_027628639.1"
                     /db_xref="GeneID:38738778"
     CDS             complement(656531..656968)
                     /locus_tag="MRET_2012"
                     /codon_start=1
                     /product="large subunit ribosomal protein L49"
                     /protein_id="XP_027484195.1"
                     /db_xref="GeneID:38738778"
                     /translation="MLMPFATVRAGRSPLARIPQCVAQIRLESTVAEAPVDTSVTSAP
                     MPVRYPYFVSRVGLDGMSLPVYTDIRNGGSRWLTQIRKVEGDASAFCRDLFDEFGWGD
                     PYDKSNPYANNLVRVSKNAGPKTVFLRSNVSREIKAWLESRGF"
     gene            <657099..>657445
                     /locus_tag="MRET_2013"
                     /db_xref="GeneID:38738779"
     mRNA            join(<657099..657195,657236..657333,657422..>657445)
                     /locus_tag="MRET_2013"
                     /product="protein transport protein SEC61 subunit gamma"
                     /transcript_id="XM_027628640.1"
                     /db_xref="GeneID:38738779"
     CDS             join(657099..657195,657236..657333,657422..657445)
                     /locus_tag="MRET_2013"
                     /codon_start=1
                     /product="protein transport protein SEC61 subunit gamma"
                     /protein_id="XP_027484196.1"
                     /db_xref="GeneID:38738779"
                     /translation="MSERMREFVEEPIAFLNEGTQFLNRCTKPDKKEFIQICRAVGLG
                     FVIMGLIGYMVKLIHIPINNILVYVTCL"
     gene            complement(<657785..>658331)
                     /locus_tag="MRET_2014"
                     /db_xref="GeneID:38738780"
     mRNA            complement(join(<657785..658016,658057..658193,
                     658329..>658331))
                     /locus_tag="MRET_2014"
                     /product="large subunit ribosomal protein L35e"
                     /transcript_id="XM_027628641.1"
                     /db_xref="GeneID:38738780"
     CDS             complement(join(657785..658016,658057..658193,
                     658329..658331))
                     /locus_tag="MRET_2014"
                     /codon_start=1
                     /product="large subunit ribosomal protein L35e"
                     /protein_id="XP_027484197.1"
                     /db_xref="GeneID:38738780"
                     /translation="MAKVRTQDLQNKSKVDLLDQVAELRKELLSLRVQKVAGGASSKI
                     ARINTVRKNIARVLTVINLKQRANMREFYKNKKFQPLDLRPKKTRALRRKMTKHELSQ
                     KTERQHKKDVHFGVRRYVLKA"
     gene            complement(<658553..>659653)
                     /locus_tag="MRET_2015"
                     /note="MRES_07990"
                     /db_xref="GeneID:38738781"
     mRNA            complement(<658553..>659653)
                     /locus_tag="MRET_2015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628642.1"
                     /db_xref="GeneID:38738781"
     CDS             complement(658553..659653)
                     /locus_tag="MRET_2015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484198.1"
                     /db_xref="GeneID:38738781"
                     /translation="MTVSMMSQTTDFGPYEKPRMPRMTMALDTSMPQTLERPASFESD
                     SVNDNDDNDTTLRSDSSIDGTPIQLPQRPDVALTRDVHWFSPRQRTKCMSPSHLMPIT
                     NHGLALASVPLHVKEIGPAPRSEDRVRAAQRMFHAVANSTRRSRKLQSNDRTRPSLSA
                     NPRQKRMLHDPSKDPLEFVPTMDGTQHCVIATDRNTFEMVVTPPSPRPDEHEWERGSV
                     VTGVSITSHKMAQSLPPQQPTLTLQPPPFELAPGRALQLARRIKQTGQQAQIHQQARE
                     SEVASVRTSMLHTMRKYAQHRQKVWQCERGAKAAAAHGTSDRYTRTPVAADDIMAYIA
                     RWNRGANSPTYIPPNIRRMAAHQMRCRSTIHT"
     gene            <660245..>660893
                     /locus_tag="MRET_2016"
                     /note="MRES_07995"
                     /db_xref="GeneID:38738782"
     mRNA            join(<660245..660260,660293..660436,660472..>660893)
                     /locus_tag="MRET_2016"
                     /product="Ras-related C3 botulinum toxin substrate 1"
                     /transcript_id="XM_027628643.1"
                     /db_xref="GeneID:38738782"
     CDS             join(660245..660260,660293..660436,660472..660893)
                     /locus_tag="MRET_2016"
                     /codon_start=1
                     /product="Ras-related C3 botulinum toxin substrate 1"
                     /protein_id="XP_027484199.1"
                     /db_xref="GeneID:38738782"
                     /translation="MRNIKCVVVGDGAVGKTCLLISYTTNAFPSEYVPTVFDNYTASV
                     MVDGRPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSIVSPSSFENAKTKWWPEVT
                     HHAPDTPIILVGTKLDLREDPEMNARLRDRRMAPITYSQAVQLAKEIRAVRYLECSAL
                     TQKGLKGVFDEAIRCVLSPAPMKRRKPNNCIVL"
     gene            complement(<661021..>662952)
                     /locus_tag="MRET_2017"
                     /note="MRES_08000"
                     /db_xref="GeneID:38738783"
     mRNA            complement(<661021..>662952)
                     /locus_tag="MRET_2017"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628644.1"
                     /db_xref="GeneID:38738783"
     CDS             complement(661021..662952)
                     /locus_tag="MRET_2017"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484200.1"
                     /db_xref="GeneID:38738783"
                     /translation="MDERAIKAERARKQLYKHREALRRKRESALLDADAHSKETQTER
                     EQPAAPPAPAPLDKTDTAGAEDAVPREASDTADLFSADVSEPRKEADTAALFAVDDAA
                     SRPEAPSDVPATEPAHFASELWSTDAQTDAFDFEPGVETNMEQLAAPSYSTAEPATGL
                     FDATAQPQTTTNLYAPFPQRAKSMDNYAESFEASVFERDEDQAAASLFPSQEPDASGT
                     PATMFDYAPDEVYEPDAVDDVYDYGAYAEEYPQAYVSEHDHPEAYLDDTENPHELPLE
                     EKDAHQTLYPEERETSQGCLDIDTHQAYPEHQDTYEQHFDSYADDEQDAHPEYYEHDT
                     SYDDTLDASVRSIQEVDVLEPIPEIQETRYSLDEAKPPGSDTTEAPAESSELLASQEY
                     DAVDGVQNLSLLNEPPSSENEPLAVEDAADELRAQLTALQADHEALLSAHAALTTEHE
                     QLQRHVSHTLEEQVSQLQRELAASRAMEAEYKKTLSVLEEERRQLQEQLQVAKTSVPD
                     SGRSSRDRMHKRSATTSATAPRLPPLSQQEPHVMLPRRQPTNMPRMRPNPDMTPNQQH
                     RRQMSLSMLRARLAGDADDETFAPSLPTRKLSIVHDEKQASSSVQRSVSMAHTQSHQF
                     SQDDALLFCGSCKGDLLIV"
     gene            <663103..>665079
                     /locus_tag="MRET_2018"
                     /note="MRES_08005"
                     /db_xref="GeneID:38738784"
     mRNA            <663103..>665079
                     /locus_tag="MRET_2018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628645.1"
                     /db_xref="GeneID:38738784"
     CDS             663103..665079
                     /locus_tag="MRET_2018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484191.1"
                     /db_xref="GeneID:38738784"
                     /translation="MGVAYRVQRVVPPVCMRHILMSRSMIPFRPRHFAYSTISMPAVS
                     SRGDASEHADSHSACDHFVRVISSTQRIMPDQLWNIYQQALHERPSQPSDGSIRMPTQ
                     LNDAHHIMMFQALLPTLDEYSQSLRDYQLVSRVRRHAHMSPSSMLTSASTPLDLSSLS
                     TLDPSPHAPRMGGKHAQIFAERMREILLRISPEHRQTKMYNDVLCVLAMGGRYKFLRN
                     LWNDMVEAGKAGHSHVAPNQETCHFMLVALVRNFNLKLQRFKTQYKRELLNATASPQA
                     TAFAAAHVNAATQLAVETVSMVLRSLQKQGTLPRVMTLDLAARLLRITGRLPEFLQLL
                     RTGFGLDMHFPDAQTLSMSEPTTHTLNTTLLGLGELATMPDMAMAFEVLTRPLPQSGR
                     QRVLPNTTSFKLLVQYACMQPPAQLLLNAAMRGSSRPLFSRLSSGPQGLPTIGIRSPE
                     QLQAEMHARRKGTYSLFAHAYIDEALSLYAEQLQRMADHLGVPCPEAVTHDMPKSHAL
                     ANERRKADTEPVKTAEPVPAQSSSRIAVFLPPSVRVTYPLLHPLLQLALKNHATDELT
                     WLHPRADHAYALLEAEHDILQAAQRSIQAPEHMLESLSVHATYIQQLAQRMRWLCDNV
                     IDNCMALCHDKPGAPGGRDTLSKKGLRALRFMTP"
     gene            complement(<665083..>666888)
                     /locus_tag="MRET_2019"
                     /note="MRES_08010"
                     /db_xref="GeneID:38738785"
     mRNA            complement(<665083..>666888)
                     /locus_tag="MRET_2019"
                     /product="nuclear protein localization protein 4"
                     /transcript_id="XM_027628646.1"
                     /db_xref="GeneID:38738785"
     CDS             complement(665083..666888)
                     /locus_tag="MRET_2019"
                     /codon_start=1
                     /product="nuclear protein localization protein 4"
                     /protein_id="XP_027484192.1"
                     /db_xref="GeneID:38738785"
                     /translation="MLIRIRAKDGQFRCEVQPDDDASKLLEQILASTKADAETLTLSD
                     APHSPGRSASELRDQSISSLGLRHGDMLFASYQDKQEEASTSQSSAPVSEDAVDVYWS
                     QQRGLIPRQHDRQFCRHGEKGMCDYCMPIEPYDMTYHAQHGIKHLSFHAYLRQQNIGV
                     PSASTSYVPPLEELSYRVKVPCPSGQHESWPASICTKCQPSAITLQRQKYRMVDHVEF
                     VHSALIDRMLDAWRKTATQRFGYLLGHYEPYDKVPMGIKAVVEAIHEPPQAGETDGIV
                     LGMPWDDEARIQELAEWCGLCVVGMIYTDLEVADPTHSDPTQAGLVSCKRHADSFFLS
                     GQEALFAAQQQSQHKNACRWSQSSLFNSKFVTCVLSGNPMGEIDVSAYQVSEQVMAMV
                     DADMIEASVHPTTIRLKPSDSTRYVPDVFYRYTNKYGIDVKENASPTFPVEYLLVTCT
                     HGFPTEPKPRFLSSAFAIENRPGLEDQTLDGLLAEVRNVTPDTLVSWLSDWHLLAFLG
                     QTGFFSPDDMRVACCVAVTHRGQEALMSSSGWQTLVTIAQESAPQPSPPPPPPAEAEP
                     EALADAPSEGSACPHCTFLNAPGSTDCDVCGLPLH"
     gene            complement(<666981..>668315)
                     /locus_tag="MRET_2020"
                     /note="MRES_08015"
                     /db_xref="GeneID:38738786"
     mRNA            complement(<666981..>668315)
                     /locus_tag="MRET_2020"
                     /product="cardiolipin-specific phospholipase"
                     /transcript_id="XM_027628647.1"
                     /db_xref="GeneID:38738786"
     CDS             complement(666981..668315)
                     /locus_tag="MRET_2020"
                     /codon_start=1
                     /product="cardiolipin-specific phospholipase"
                     /protein_id="XP_027484748.1"
                     /db_xref="GeneID:38738786"
                     /translation="MEAPPDELVPPLPTSIKPIPTTFISSLSAWWGLSRRQTAEAELH
                     LYKASGLFQGAVLGNAAHVTDDGPDGIAQAFYIHPQQENRGPIPRSNAFSTVAKQLAT
                     SEAVKGKVGCIRNIHLHGTKTGTWIWPRYASRYIHMLEIGTPIRKIERPKDEMQIVVV
                     HGYGAGGAYFFRNIRALASIPNSRLYCLDWLGMGCSSRSPYRMRGTAPRTQERVEASE
                     TFFLEALEEWRDKMQIEKMVLVGHSLGGYLSTAYALKHPERVSKLVLVSPAGFPDGTA
                     KEIVGNDPRVRRFGPRTLRFMGWLWDRNVSPFGILRASTVFGPMIMGMYTRRRFQTLT
                     PEELQTLHAYCHGIFTAKSSSEQCLCDILAPGAFARYPLVHRVAPLRMPMVFLYGEHD
                     WMDRAGADQAQAILHEAGNHNVQVHTVSRAGHHLYLDNPAEFGALVQEVLAS"
     gene            <668383..>669283
                     /locus_tag="MRET_2021"
                     /db_xref="GeneID:38738787"
     mRNA            join(<668383..668454,668480..668570,668597..668694,
                     668720..668834,668859..>669283)
                     /locus_tag="MRET_2021"
                     /product="recombination hotspot-binding protein"
                     /transcript_id="XM_027628648.1"
                     /db_xref="GeneID:38738787"
     CDS             join(668383..668454,668480..668570,668597..668694,
                     668720..668834,668859..669283)
                     /locus_tag="MRET_2021"
                     /codon_start=1
                     /product="recombination hotspot-binding protein"
                     /protein_id="XP_027484747.1"
                     /db_xref="GeneID:38738787"
                     /translation="MDGLSHEMLASVVSDIEAERATHDTLRDYARAWDRAQRVSAMHL
                     IQLYTIPLSQFESHMQSVEASFEDIRACIKVLAEHVPPNEFYKWVDVWSWCMKHSVYA
                     VAFTFYIETGRIISKEMVINVLGLNALPSNQMRLTTEEYLHGLISVVNELPRLSIHVV
                     TLGDYDAPIRIASLVKQVHAAFQILNLKNDLLRKRFDTLKYDVKRVEEVVYDIRLRGL
                     GPTESPSGLAAYVSDADAERVYHRLASHPTLDLENQTHTTQTMGMSTN"
     gene            complement(<669284..>670360)
                     /locus_tag="MRET_2022"
                     /note="MRES_08020"
                     /db_xref="GeneID:38738788"
     mRNA            complement(<669284..>670360)
                     /locus_tag="MRET_2022"
                     /product="CCAAT-binding factor complex subunit"
                     /transcript_id="XM_027628649.1"
                     /db_xref="GeneID:38738788"
     CDS             complement(669284..670360)
                     /locus_tag="MRET_2022"
                     /codon_start=1
                     /product="CCAAT-binding factor complex subunit"
                     /protein_id="XP_027484750.1"
                     /db_xref="GeneID:38738788"
                     /translation="MSFYPQDQGMRPAGDAMHIQGPADMARMQDVPAMTMSTQDNVME
                     TSPGKRLGALLQQFSRSPAQFQRYFWRHQMDLVENGFDSDGKAIDFFNLGSTPSGNGS
                     ALPLARIKKVMKNDDEVKMISAEAPILFSRACEIFIADLTCRAFMVAEENKRRTIQRS
                     DIASAISRSELFDFLIDIVPRTEGLRHRSASVPIRNAMPSAALSSPFSGADIAPRLGM
                     NDSAGAHQAAPFLSLRPTQQDVRTRLDPMDPSLGMNPAGQPLKGLPKAPLPSDWYSFP
                     TNPMGDARIHPGTAAGLGMSSTNTAPPSMRSVMGRSTVDAPTFMDANSSLSMPPPPTR
                     GSLLNMMPYPMDEAASKGTTNPNE"
     gene            complement(<670636..>671313)
                     /locus_tag="MRET_2023"
                     /note="MRES_08025"
                     /db_xref="GeneID:38738789"
     mRNA            complement(join(<670636..670686,670726..670744,
                     670777..670826,670855..>671313))
                     /locus_tag="MRET_2023"
                     /product="upstream activation factor subunit UAF30"
                     /transcript_id="XM_027628650.1"
                     /db_xref="GeneID:38738789"
     CDS             complement(join(670636..670686,670726..670744,
                     670777..670826,670855..671313))
                     /locus_tag="MRET_2023"
                     /codon_start=1
                     /product="upstream activation factor subunit UAF30"
                     /protein_id="XP_027484749.1"
                     /db_xref="GeneID:38738789"
                     /translation="MADLEAGQIAQLKPRIFDVLNESDLSNVSAKKIRLALADMPEGS
                     LPEGLDLTAQKKAIDAVIRDCYNELTQKKPAKSTKKAAPSKKRSKSENDDEPKKKRAP
                     NPNNPLSRPLRLSSEMADVCGGSEMPRYEVVKQLWAYIKDRKLQNESNKRQIVCDEKL
                     SGLFGKPTVDSFEMAKLIGRHLEKIEPTNPSS"
     gene            <671427..>671891
                     /locus_tag="MRET_2024"
                     /db_xref="GeneID:38738790"
     mRNA            <671427..>671891
                     /locus_tag="MRET_2024"
                     /product="mitochondrial protein involved in assembly of
                     succinate dehydrogenase"
                     /transcript_id="XM_027628651.1"
                     /db_xref="GeneID:38738790"
     CDS             671427..671891
                     /locus_tag="MRET_2024"
                     /codon_start=1
                     /product="mitochondrial protein involved in assembly of
                     succinate dehydrogenase"
                     /protein_id="XP_027484752.1"
                     /db_xref="GeneID:38738790"
                     /translation="MRASWLLGMRRTLRLGVETASHSPVQMASDMLLPPKQLFRALLR
                     AHRLHLPLEMRSLGDDYVKAEFRRHQHIDNPLHIVGFCSQWKMYLDAILREAQNSNGE
                     VHGKSLDPHLIDRFSDEQLYQLYELKLATNDVFDPKKAQSKPPAPDNSGDTP"
     gene            complement(<671888..>672608)
                     /locus_tag="MRET_2025"
                     /db_xref="GeneID:38738791"
     mRNA            complement(join(<671888..672372,672399..672516,
                     672540..>672608))
                     /locus_tag="MRET_2025"
                     /product="hypothetical protein"
                     /transcript_id="XM_027628652.1"
                     /db_xref="GeneID:38738791"
     CDS             complement(join(671888..672372,672399..672516,
                     672540..672608))
                     /locus_tag="MRET_2025"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027484751.1"
                     /db_xref="GeneID:38738791"
                     /translation="MLCNESTVLRGERVVLVPYRPEHVPTYVEWMKSPVLREQTASEA
                     LSIEEEFDMQRRWHLDQDKLTFIVLTYEHDVPPNANVSTLLQACTMVGDVNAFLSECH
                     DDDNGDAPPTTWAEFNIMIPETRWRRKGLATEALGLLIHYITSDPTPRPPGLDMHPCA
                     AFPLSKTQLIARISHDNGPSHAFFEKHGFVRVKHIEYFGLTEYGVQDATRVVCVPPLE
                     VLAWP"
     gene            complement(<672650..>673528)
                     /locus_tag="MRET_2026"
                     /note="MRES_08030"
                     /db_xref="GeneID:38738792"
     mRNA            complement(join(<672650..672674,672705..673464,
                     673492..>673528))
                     /locus_tag="MRET_2026"
                     /product="prohibitin 1"
                     /transcript_id="XM_027628653.1"
                     /db_xref="GeneID:38738792"
     CDS             complement(join(672650..672674,672705..673464,
                     673492..673528))
                     /locus_tag="MRET_2026"
                     /codon_start=1
                     /product="prohibitin 1"
                     /protein_id="XP_027484754.1"
                     /db_xref="GeneID:38738792"
                     /translation="MNAAANFLSRFAVPLGMSALFVQASMYDVPGGYRAVMFDRFTGV
                     KERATGEGTHFLIPWLQRAILYDVRIKPRTISTTTGSKDLQMVTLSLRVLSRPDVGHL
                     SKIYQSLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREVVSARIREDLLTRAREF
                     NILLEDVSITHLTFGQEFTKAVEQKQIAQQDAERAKFVVEKAEQERQASVIRAEGEAE
                     GASLITKALDKAGDGLLAVRRIETSQQIAKTLSNARNVTYLPSSGNILLGVNGQS"
     gene            complement(<673784..>674384)
                     /locus_tag="MRET_2027"
                     /note="MRES_08035"
                     /db_xref="GeneID:38738793"
     mRNA            complement(join(<673784..673823,673866..674090,
                     674132..674254,674296..>674384))
                     /locus_tag="MRET_2027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628654.1"
                     /db_xref="GeneID:38738793"
     CDS             complement(join(673784..673823,673866..674090,
                     674132..674254,674296..674384))
                     /locus_tag="MRET_2027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484753.1"
                     /db_xref="GeneID:38738793"
                     /translation="MSNNANVQQAKADAHAAVNKTANKAEQAANQAGEKSEHFYDEAK
                     AAADKVGEFISKEAEELEDRAKEARKSLCSSVSSGWKKIHGAWNNFSSNPKYWLSTLS
                     VVNVAVIGAASYFGYQNRNEIQKWDRRLLSAVIVGAATFFGAEGYLVTKNTKKQLK"
     gene            <674645..>674891
                     /locus_tag="MRET_2028"
                     /db_xref="GeneID:38738794"
     mRNA            join(<674645..674756,674782..>674891)
                     /locus_tag="MRET_2028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628655.1"
                     /db_xref="GeneID:38738794"
     CDS             join(674645..674756,674782..674891)
                     /locus_tag="MRET_2028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484755.1"
                     /db_xref="GeneID:38738794"
                     /translation="MPRPKEEVISDFLLGEVEKHKLLKRPCIVGFQGPQGSGKSYTCA
                     RIAEYLGSRDPPVRVEVFSLDGASILLIP"
     gene            <674914..>675567
                     /locus_tag="MRET_2029"
                     /note="MRES_08040"
                     /db_xref="GeneID:38738795"
     mRNA            <674914..>675567
                     /locus_tag="MRET_2029"
                     /product="D-glycerate 3-kinase"
                     /transcript_id="XM_027628656.1"
                     /db_xref="GeneID:38738795"
     CDS             674914..675567
                     /locus_tag="MRET_2029"
                     /codon_start=1
                     /product="D-glycerate 3-kinase"
                     /protein_id="XP_027484528.1"
                     /db_xref="GeneID:38738795"
                     /translation="MTALARQHASFALYQGRGPPGTQDVDVGTHVLQAFRACESVSIP
                     IYDKSAHRGAGDRQRAWRHVQGEVDVVLFEGWCLGFPSMPFSELVRRYDQGRAASPRP
                     EYAAHPLEELQLMNRHLATWEQAWYPLIDAFVQLVPVVADPEASPWSLVYPWRLEAEH
                     AMKQRNGGRGMSDDEVHAFVQRYMPTYELFSRTADTSRWKEHCMMLRIGADRQCIDA"
     gene            complement(<675580..>676028)
                     /locus_tag="MRET_2030"
                     /db_xref="GeneID:38738796"
     mRNA            complement(join(<675580..675954,675981..>676028))
                     /locus_tag="MRET_2030"
                     /product="ssDNA-binding protein essential for
                     mitochondrial genome maintenance"
                     /transcript_id="XM_027628657.1"
                     /db_xref="GeneID:38738796"
     CDS             complement(join(675580..675954,675981..676028))
                     /locus_tag="MRET_2030"
                     /codon_start=1
                     /product="ssDNA-binding protein essential for
                     mitochondrial genome maintenance"
                     /protein_id="XP_027484070.1"
                     /db_xref="GeneID:38738796"
                     /translation="MVRPMFGSLPRVLQARSFSSTPASALSRVTLIGRLVSSPEVRES
                     RNGKEYLRYVLATNDLPGPPNEDGTPAAPTSSFHSIFAFGENTVNRLREVPKGTLMYV
                     EGDFRVVRTPSDEQTPPQEQWLVQHRNYRVLMRPRNTE"
     gene            complement(<676122..>677495)
                     /locus_tag="MRET_2031"
                     /note="MRES_08045"
                     /db_xref="GeneID:38738797"
     mRNA            complement(<676122..>677495)
                     /locus_tag="MRET_2031"
                     /product="sucrase/ferredoxin-like protein"
                     /transcript_id="XM_027628658.1"
                     /db_xref="GeneID:38738797"
     CDS             complement(676122..677495)
                     /locus_tag="MRET_2031"
                     /codon_start=1
                     /product="sucrase/ferredoxin-like protein"
                     /protein_id="XP_027484071.1"
                     /db_xref="GeneID:38738797"
                     /translation="MLWRRLRRLYSSRAWGAFACDTSLALDHRHQIPAAPYDASPLAG
                     TVSRSDAHLILHPAQYARPPTTWPSHVESASALLSELTSRTKPHGSLDGFRVNLSSGD
                     DAALPTADAWDPRRSAATRWPPNHQQEDEQYWMYAYSMPGRLVKWPEPVSLRTLPSGA
                     ELRASLQALWRKAEDQHETHIYVCTHGMRDCRCGVAGPALYDALNEAVEKHDTQCRFE
                     GTQPARRIRVWPISHVGGHKFAACALVYPHGDWYGNLRVSDAPLLVRAALAPPSSRHD
                     LDDLRERLVLWPRWRGRLGMSEAEQRDHIDTWGPPIVHTAHITPQRRAGPSPRDTPHL
                     LPLRFHSHDGQWYDVEGEEGESLMQVARRYDLPGIEATCGGELECATCHAYVCDAQRD
                     DPQARGMTHEAPSWSADEVSQEEDDMLEYAPFRQASSRLTCQVRVTRALSDWMMQDGG
                     RVELNRY"
     gene            <677558..>678602
                     /locus_tag="MRET_2032"
                     /note="MRES_08050"
                     /db_xref="GeneID:38738798"
     mRNA            join(<677558..678521,678583..>678602)
                     /locus_tag="MRET_2032"
                     /product="2-methoxy-6-polyprenyl-1,4-benzoquinol
                     methylase"
                     /transcript_id="XM_027628659.1"
                     /db_xref="GeneID:38738798"
     CDS             join(677558..678521,678583..678602)
                     /locus_tag="MRET_2032"
                     /codon_start=1
                     /product="2-methoxy-6-polyprenyl-1,4-benzoquinol
                     methylase"
                     /protein_id="XP_027484068.1"
                     /db_xref="GeneID:38738798"
                     /translation="MLICAARRSWWGAVRPRMLSTCAIRMEERKTHFGFQTIDETQKQ
                     GMVGGVFSSVASSYDLMNDAMSLGIHRLWKNRFVDMLDPRGGIRCLDVAGGTGDIALR
                     LLDHARTKHLDRETHVTILDINAQMLVEGQKRVKESMYWNTPQVKFQLGNAEALDEVM
                     PVPERKNPVASTRRQPILPPLVSEPIESASVDLYTIAFGIRNCTHIDRVIAEAFRVLK
                     PGGIFACLEFGKVSIPLLAHMYKQYSFQVIPPLGELLVGDRDSYQYLVESIERFPTQA
                     EFARMVAEAGFLLPGTAEASSMGLPPLVGHGAWENLTLGVATIWTGIKPFA"
     gene            complement(<678607..>678993)
                     /locus_tag="MRET_2033"
                     /note="MRES_08055"
                     /db_xref="GeneID:38738799"
     mRNA            complement(join(<678607..678707,678734..678813,
                     678839..678964,678992..>678993))
                     /locus_tag="MRET_2033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628660.1"
                     /db_xref="GeneID:38738799"
     CDS             complement(join(678607..678707,678734..678813,
                     678839..678964,678992..678993))
                     /locus_tag="MRET_2033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484069.1"
                     /db_xref="GeneID:38738799"
                     /translation="MSSESSNLIQRLDKPEHDEVRRLVAQDAESRGGSSNSVFTLDGE
                     RGQPSSRLCRQLPNGQEQCATVSLETRELFQTMQSMGFFCILPHDPTKTFIRCERIPQ
                     "
     gene            <679108..>680595
                     /locus_tag="MRET_2034"
                     /note="MRES_08060"
                     /db_xref="GeneID:38738800"
     mRNA            <679108..>680595
                     /locus_tag="MRET_2034"
                     /product="inositol polyphosphate 5-phosphatase"
                     /transcript_id="XM_027628661.1"
                     /db_xref="GeneID:38738800"
     CDS             679108..680595
                     /locus_tag="MRET_2034"
                     /codon_start=1
                     /product="inositol polyphosphate 5-phosphatase"
                     /protein_id="XP_027484073.1"
                     /db_xref="GeneID:38738800"
                     /translation="MERRSGLRVQLATYNAGQMFDGSGVPDLQEWLVPTVSESRRSGY
                     ATTDAAAATTAMSLGPREAPDIYAVAIQECAPLHKALAGMHTQAVDQIDVAIRRTVRL
                     HQSVVRDDRMYDPLELGGGPENYAKMAEICHGGLILFVYARERPPQRTQGRELSAAHR
                     IKEVRTSFVGTGIGMVMGNKGAVGARVVLSSAVPGGCDEVCTFVCAHLAAHDHNVQRR
                     HAEWRAVCERLVFDPMSVQVLPPLQEPVSQEKPATVDAVDPHAYSLYDTHHLFVLGDL
                     NYRLATGVEGVSPAGRHTAPGTFPPITRGDVLQVARTFESQRWTSLAPYDQLVRERFA
                     PTPRTMHHLHVPDMSVYHIPPTYKYKARGEMEQLSTKRLPGWPDRLLWGSSDASAGNQ
                     AIQCELYRSIMRYTYSDHKPVTAIVQLPPHIHPLSDHMQTPFPLRPQWRTWRSVGLLA
                     DRVVGLVWSGLLFFGHGYLVLAVVELALLGVVGWYYVHGQLVWRL"
     gene            complement(<680592..>681293)
                     /locus_tag="MRET_2035"
                     /note="MRES_08065"
                     /db_xref="GeneID:38738801"
     mRNA            complement(<680592..>681293)
                     /locus_tag="MRET_2035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628662.1"
                     /db_xref="GeneID:38738801"
     CDS             complement(680592..681293)
                     /locus_tag="MRET_2035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484074.1"
                     /db_xref="GeneID:38738801"
                     /translation="MAPAKLAPPGRGDVTLKSASPPLGHLMTLYQRYDSLRNSIALLR
                     EQTLHTPGIEDWPSVQTHYANLLSHTFSIAAALQSPSPTFLSSQLSTLTEFLETEAQD
                     ANLFGDDTKMDALLGGGDAKATCPPMEDKDPQSQLPLLAVHPCQPIPDSKLNWLGTLL
                     STVPETEVAQQEAERLAEYDQTHAAADVAAEREAHDARCLQALRSWYHTLYAPDEDGD
                     TYDFAMRVEDDEPVG"
     gene            <681342..>682563
                     /locus_tag="MRET_2036"
                     /note="MRES_08070"
                     /db_xref="GeneID:38738802"
     mRNA            join(<681342..682279,682308..>682563)
                     /locus_tag="MRET_2036"
                     /product="mitochondrial fission process protein 1"
                     /transcript_id="XM_027628663.1"
                     /db_xref="GeneID:38738802"
     CDS             join(681342..682279,682308..682563)
                     /locus_tag="MRET_2036"
                     /codon_start=1
                     /product="mitochondrial fission process protein 1"
                     /protein_id="XP_027484125.1"
                     /db_xref="GeneID:38738802"
                     /translation="MDDIVDLVQEHHEQSAHVDESLGRYTAYTVRLKTLVSSVSRYIA
                     YSSDVGEAFRPLARPFVVTAAYGISWAYIFTDVGYTCWQAAQDREHDSPLAADLAWIA
                     ARRGTFQTLASIVLPAFTIHSVVKHSAHLFSKFKSPRMRIAGPTAAGLLTVPLLPFLF
                     DHPVETVVERLFDAVEYRIAALRGDPLAKEMLDKGSLLRGYYVPTADNPKELGVSPTL
                     AAQLAILGVGVDLVHMPRMLQLVSRHAQRLQRMPHKPLGSLATLRPLNEKKEQHAWLE
                     TSAQHFARRTLAKAEMDAFLGMHCHTHDERMRFLATRWAVKEAVYKAVYPHLHLYATD
                     ISYTHTFQKPLVALARQRAFRNAHGSCATSVAEALQLHASVSHDADYVVASIVAETMH
                     PPSCE"
     gene            complement(<682594..>682920)
                     /locus_tag="MRET_2037"
                     /note="MRES_08075"
                     /db_xref="GeneID:38738803"
     mRNA            complement(<682594..>682920)
                     /locus_tag="MRET_2037"
                     /product="thioredoxin"
                     /transcript_id="XM_027628664.1"
                     /db_xref="GeneID:38738803"
     CDS             complement(682594..682920)
                     /locus_tag="MRET_2037"
                     /codon_start=1
                     /product="thioredoxin"
                     /protein_id="XP_027484072.1"
                     /db_xref="GeneID:38738803"
                     /translation="MGVQQIKSYDEFKQVTGTDKIIVIDFWATWCGPCKMIGPIFEKI
                     AETPAGEKLGFYKVDVDEQSQIASEVGIRAMPTFAFFKNGEKIETVVGADPSKLQAAI
                     SKFAGV"
     gene            complement(<683098..>684894)
                     /locus_tag="MRET_2038"
                     /note="MRES_08080"
                     /db_xref="GeneID:38738804"
     mRNA            complement(<683098..>684894)
                     /locus_tag="MRET_2038"
                     /product="monooxygenase"
                     /transcript_id="XM_027628665.1"
                     /db_xref="GeneID:38738804"
     CDS             complement(683098..684894)
                     /locus_tag="MRET_2038"
                     /codon_start=1
                     /product="monooxygenase"
                     /protein_id="XP_027484075.1"
                     /db_xref="GeneID:38738804"
                     /translation="MSLYVTPTSLPHGAQLLQDPVNLNGMPTEYHDIVCIGAGFSGIS
                     MACKLKRRYHKMPDMVVLERLGGPSGTWEANQYPGCACDVPSPLYSLSFRQKSDWSGF
                     FPRQPELRAYIHQVMAEYGIEKLFRYYTVGLEARYDADTHLWHVVTATFDPQNPQVAT
                     QYTHYVCKLFIQAVGGLSEPNHCDIPGHEDFQGPIFHSACWDHSVDLKNKHVIVVGNG
                     CSATQFVPEVAKEAKHVTQFVRSKHWYGPSPDFEFAKKDWYRWLLTKFPILLWSQRFL
                     IWLVLESHFSMATNTWYGKLMRRMYEKECRAHVQKLAPPKYHDQLIPRSNELIAACRR
                     RVLDNTYLPSLWRENLDLETSELVRIEQNAVVTKDGRRIPADVIVMGNGFSTKAAGSP
                     LKVRGKTMSIQEHHDKFGFGSPVSYRTAYLTDFPNMCTLVGPNSGTGHMSVLFTSERV
                     QEMLLSVGKDVLESPRPHDDAIAHVPGAPMKEVPGPEIPTFEVKAEALVNERNWIDAK
                     MENLVFVQCDSWYRDSKTGRVTGVYPDWQWKFMLRCWFPVWSDFVFTGSTSGATHPAS
                     SLWQKIGGCLGLGTIPRVASPAAYVTAFAAEK"
     gene            complement(<685049..>686191)
                     /locus_tag="MRET_2039"
                     /db_xref="GeneID:38738805"
     mRNA            complement(<685049..>686191)
                     /locus_tag="MRET_2039"
                     /product="cellular morphogenesis protein"
                     /transcript_id="XM_027628666.1"
                     /db_xref="GeneID:38738805"
     CDS             complement(685049..686191)
                     /locus_tag="MRET_2039"
                     /codon_start=1
                     /product="cellular morphogenesis protein"
                     /protein_id="XP_027484076.1"
                     /db_xref="GeneID:38738805"
                     /translation="MSSPKVTLDDRRIRAKLHQAVKVAHSAAKKARQHELQRHVRRLK
                     QCTEAERSDLEKELYYLKTLDIHALALRALSTKLVKAKILPKQAQGADEERFPLLPFA
                     LEAKVDPATTETLLSFEHKAHEHICNQVLSSKVLASELTACLASLIPLVTQQKAPKTP
                     VTEPVKSDKEARQVEVAPPEDGYESDDGMGNQENVHMRGDMDTLVASGSDTEEDSDDE
                     DTPRKRANTSEEDDEEDAFLPSLHTGFIPGDDWSDAEADYADTGGKGPAKSQRKNRRG
                     QRERRAIWEKKYGRHANHLKLREKEPRKAREHRAPDRPTKRPKPMQASPPRQPRTQDP
                     HPPSLSRVKPAPPPSNAPLHPSWIAKQRAKEAQHAAKPQGTKVVFD"
     gene            <686323..>688269
                     /locus_tag="MRET_2040"
                     /note="MRES_08085"
                     /db_xref="GeneID:38738806"
     mRNA            <686323..>688269
                     /locus_tag="MRET_2040"
                     /product="Pescadillo"
                     /transcript_id="XM_027628667.1"
                     /db_xref="GeneID:38738806"
     CDS             686323..688269
                     /locus_tag="MRET_2040"
                     /codon_start=1
                     /product="Pescadillo"
                     /protein_id="XP_027484335.1"
                     /db_xref="GeneID:38738806"
                     /translation="MAKIKKRGEAGAAKNYITRNQALKKLQITLAEFRRLCILKGIFP
                     RQPRHIKRANKGSTAPTTFYYTKDIAYLQHEPVLQAFREHKAFAKKVNRAIARREWFA
                     AKNLHDNRPQYRLDHIIKERYPTFVDSLRDLDDALSTLFLFANIPSQKTIAPEITTYC
                     ARLCTEWQLYVMRTHCLRKVFLSIKGIYFQAVVHGQEITWLVPYMFTHTIPTDVDFRV
                     MMTFLELYQTLMGFVLYKLYTDENLVYPPKLDESLDDQGAGFGSLMLMAADADMLSGK
                     NNLQSMESTAAAEAEKNAATKNDGKKLSTRDVKRQIARLSHTQENQNEDDVPALDTNV
                     DDEDEEDVNDAFVPQSSKEDADQLTTLQDLQKQAGEDPLPMLFSRYVFYISREVPRTV
                     FEFILRSFGALPNNIGWDAVAGAGSQVSEDDERVTHHILDRPVEGLSLEHPGRRVYVQ
                     PQWIVDCVNARKVLPTDPYRPGQTLPPHLSPFVDDREVARQGGYVPEEAKKQLGLEQD
                     EEAEEDEDDEDEEAAEEEEQPQETASRPALDALLADPTGAGLLEAAELEAEAAGGEDA
                     LLALRDQHAKALKTYKKQQSKRAPQLSEEAEARDMAKTLLSNKQRKLYTRVGQASGKK
                     QEEKLRLEAKKRALSKSKKKPSST"
     gene            <688331..>689161
                     /locus_tag="MRET_2041"
                     /note="MRES_08090"
                     /db_xref="GeneID:38738807"
     mRNA            join(<688331..688427,688458..688630,688655..>689161)
                     /locus_tag="MRET_2041"
                     /product="small nuclear ribonucleoprotein"
                     /transcript_id="XM_027628668.1"
                     /db_xref="GeneID:38738807"
     CDS             join(688331..688427,688458..688630,688655..689161)
                     /locus_tag="MRET_2041"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein"
                     /protein_id="XP_027484334.1"
                     /db_xref="GeneID:38738807"
                     /translation="MSQGAGASASGAPVAPNETLYIQNLNESVAIPVMKQTLEALFTT
                     YGPVLSIVAHKNLRMRGQAFVSFQDVATASKAKHEVNGFPLYGKSMRLSFARTKSDSV
                     VAYLGKASGSAEKDLEEHKKARLAQKPITRRRNSTRQRLFERKKAHEQAVARGEAGLL
                     PARRSTSARTKAHQLPDEYVPPNRILFLQQMPDTVTHAQLMGIFGHLANLYQVRTIPG
                     RTDIAFVEFHDIPSSVAARDATNGYVFPTGEHLKVSFARA"
     gene            <689300..>690838
                     /locus_tag="MRET_2042"
                     /note="MRES_08095"
                     /db_xref="GeneID:38738808"
     mRNA            <689300..>690838
                     /locus_tag="MRET_2042"
                     /product="fumarate hydratase, class II"
                     /transcript_id="XM_027628669.1"
                     /db_xref="GeneID:38738808"
     CDS             689300..690838
                     /locus_tag="MRET_2042"
                     /codon_start=1
                     /product="fumarate hydratase, class II"
                     /protein_id="XP_027484333.1"
                     /db_xref="GeneID:38738808"
                     /translation="MQNMLAARTVVAVPRGTMLRMPARMVGSVRMPVRALSMSHAVAR
                     SDKFRAERDTFGDLQVPADKYWGAQTQRSSMNFKIGGKMERMPEPIISAFGVLKKAAA
                     TVNKEFGLDPKIADAICAAADEVISGKLHEHFPLVVFQTGSGTQSNMNVNEVISNRAI
                     EMLGGELGSKKPVHPNDHVNRSQSSNDTFPTAMHIASVLEITKELLPALRHLHQALQA
                     KQNEFADIIKIGRTHLQDATPLTLGQEFSGYVQQVANSIERVENVLPRLRMLAQGGTA
                     VGTGLNTFKGFDVKVASEISRITGEEFVTAPNKFEALASHDAMVEASGAMNTVAVSFM
                     KIANDIRYLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQCEALTMVAAQVMGNNVAV
                     SVGGSYGQFELNVFKPVIAKNLLSSIRLLADGANSFTDHCVVGIQANKKRIDQLLNES
                     LMLATALNARLGYDNVAKAAKKAHHEGLTLKESTVGLGLLTPEEFDAQVRPELMIGPN
                     DPPK"
     gene            complement(<690807..>692138)
                     /locus_tag="MRET_2043"
                     /note="MRES_08100"
                     /db_xref="GeneID:38738809"
     mRNA            complement(<690807..>692138)
                     /locus_tag="MRET_2043"
                     /product="hypothetical protein"
                     /transcript_id="XM_027628670.1"
                     /db_xref="GeneID:38738809"
     CDS             complement(690807..692138)
                     /locus_tag="MRET_2043"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027484332.1"
                     /db_xref="GeneID:38738809"
                     /translation="MTWTSQGPRSSSTRRMLRAWPGRWRWRRRATTCHFCGCASVLVP
                     PSGDAPDALPASDMRLSSGTPARWFCSACASWNHTDEHGRILDLYERRMWDASVNDVQ
                     FASRDKDPYPASLFCRTCLANQTLVTNLLASYLPEEDEQLDDERMRAYPDYKRSLEER
                     YPLACEACHARAMAHLQQRDQLIQRTSLASWLQRQTSTPTPTPSLWPWHAARLQWCVC
                     HALGVCIPLLAPRLLILTCLAPYPWDPCRPHIHRYRTRDVRIYSHGYGTLTCVSYALW
                     AARVGLYLSGYPVQRVSWAVLQVLVLYMAYRARYIATDAPMSLVSQHATTPSSAPPRD
                     PLAAMSLCEDRVAQAPLDSLLEPSAAADEPEDMDVEPMDVRTLQWGPQRFGGHMSSGL
                     EDLFGHALSLDSDRRAPRRWPWAMGGALTVLGLWLLHRAMAPTWAGRSGQS"
     gene            <692137..>693942
                     /locus_tag="MRET_2044"
                     /note="MRES_08105"
                     /db_xref="GeneID:38738810"
     mRNA            <692137..>693942
                     /locus_tag="MRET_2044"
                     /product="37S ribosomal protein RSM22"
                     /transcript_id="XM_027628671.1"
                     /db_xref="GeneID:38738810"
     CDS             692137..693942
                     /locus_tag="MRET_2044"
                     /codon_start=1
                     /product="37S ribosomal protein RSM22"
                     /protein_id="XP_027484338.1"
                     /db_xref="GeneID:38738810"
                     /translation="MHASLWWRRVATGVAEPRRTPKASELAQAAAMSAAIGHEATEPL
                     DPTLRYAFLRHEEASATRQRLSPAARLGSSKVHGNAIVSMPASLHTRLSAMIRASHKE
                     QLRRDAEHVAQLERRASHDDGTGLALRASQHFVQHLPRQRAVPLYLATQFPARYAVLV
                     RVLDEARRRLAAPHGASAWHPTHVVDYCAHTSEALWAYDHVFGARHLREYVAEARHST
                     LLKALAELQDDDAWSHIRTVFRVRGDKPHVHREAPQDAAAPRRLGLHAYGLSAAASDT
                     AREREVLRMWKSEADVLVLVEEATPRGFACLASARSQLLSLGRASTTPCHIVAPCPHD
                     QACPLLSDAPASRKAPSTCSYTQLFHMPPFMRATTQQHRGDAATSYCYLIVQRGPRPS
                     LDASTAAWTPRVPEPLQPHVPRSVQRLAESARIGVLDALRSGRERDTNETPDATDACT
                     SALEHAGIDEHRVMQTDAYTWPRLLRPPLKKGGHVTMDACCASGDLRRFTLPRSAGRQ
                     AYQDARKVLHGELYAHMHAGSRSSTSVPASASSADEYVRLGPDAQWEAQTHGRVSKRV
                     SSRAPKHRLADLDHATRTTRQPSRSDLDALLALDS"
     gene            <693988..>694758
                     /locus_tag="MRET_2045"
                     /note="MRES_08110"
                     /db_xref="GeneID:38738811"
     mRNA            <693988..>694758
                     /locus_tag="MRET_2045"
                     /product="protein DGCR14"
                     /transcript_id="XM_027628672.1"
                     /db_xref="GeneID:38738811"
     CDS             693988..694758
                     /locus_tag="MRET_2045"
                     /codon_start=1
                     /product="protein DGCR14"
                     /protein_id="XP_027484337.1"
                     /db_xref="GeneID:38738811"
                     /translation="MSLLVPPRAGERTARNQTVLDEETYTRGLSRIIERDFFPDLPRL
                     RAHNAYVHALEEGDVDTIEACAHALVEAEAGEAEAGSSMSIGEYQARYTTEDNASFAQ
                     LLEVDAQRRRAKEARGAATRPPSTQRIEAPTREALPPAPPKRGMMPPPDVPRVRYAKT
                     RLVSLPDSAPSTPSRSVVDDAIQASSTPQIGGYRFVQATPRNVREPSTPTSRRWHDLS
                     PAARTLLQRTSRGAGGLYRSAPSTPRWTPTPSPASRRH"
     gene            complement(<694759..>695775)
                     /locus_tag="MRET_2046"
                     /note="MRES_08115"
                     /db_xref="GeneID:38738812"
     mRNA            complement(<694759..>695775)
                     /locus_tag="MRET_2046"
                     /product="guanine nucleotide-binding protein
                     G(I)/G(S)/G(T) subunit beta-1"
                     /transcript_id="XM_027628673.1"
                     /db_xref="GeneID:38738812"
     CDS             complement(694759..695775)
                     /locus_tag="MRET_2046"
                     /codon_start=1
                     /product="guanine nucleotide-binding protein
                     G(I)/G(S)/G(T) subunit beta-1"
                     /protein_id="XP_027484228.1"
                     /db_xref="GeneID:38738812"
                     /translation="MPWGQDSLSRRDALERAAPKEADTTSVASDVPPIKQLALRRTSV
                     LRSQWSKMVALDWSQDSQHILTASQDGYMIVWNAEEGYKVQAMKLPVLWVLCCAYSPS
                     GRLVASGGLDNACTLYNMAERKKPYDVPMAKRLLRHKDYISACRFASDHELWTASGDG
                     TVMQWDVQSDQVVSTLDAKQGDVLCLQMSPTDPHTLLTGGTSALVHMWDKRTTGIVRT
                     FEGHRADVNALDFFPDGSAFATACEDSLCRLFDVRTGSELLSLDRPPPRSAATAVAFS
                     SSGRLLFSGYDTHKMCVWDTLRGERISMLHAGHTHMAYLGRSPDGRFVASAGWDGKTI
                     VWGI"
     gene            <695881..>697743
                     /locus_tag="MRET_2047"
                     /note="MRES_08120"
                     /db_xref="GeneID:38738813"
     mRNA            <695881..>697743
                     /locus_tag="MRET_2047"
                     /product="solute carrier family 24 (sodium potassium
                     calcium exchanger), member 1"
                     /transcript_id="XM_027628674.1"
                     /db_xref="GeneID:38738813"
     CDS             695881..697743
                     /locus_tag="MRET_2047"
                     /codon_start=1
                     /product="solute carrier family 24 (sodium potassium
                     calcium exchanger), member 1"
                     /protein_id="XP_027484336.1"
                     /db_xref="GeneID:38738813"
                     /translation="MPWDERRSSSPWHARRPRRSAFESFDEAQWLSGVREHLRTALVG
                     PPPPASDMPWIRDRRRPLTLSSSDDEQEPAMEEDPRAKAHLSLTADAMEEVLALGGIV
                     DQDDQGPVHLDGFAEQVWRVDTPSTSQAPSSLLSAFQRDTTGPVDFDALLQFRARMAQ
                     RTSPTPHIQVLDHDAGPPDTLMQAEEDAPMDARPSLPDSFLSHAPQTEPMTQAPHPPS
                     PILVLSDSDHESDHAGSMHPTHDRCVPHETRGALYEESDEDSDENVSEDESEEEEDEI
                     QDESEEESEEESEEKGEEEGEEEGEEEGGEVSEDKEDEVEVDSEDKAGEESEEEGGEE
                     SQANEGGERQDEGEEESEEEGGEEGEEEGGEESQDDLKVNETREEQEGEKRQEEEDES
                     ESGKDQKSPERADENEQEETPIEEPKSQEVHPPSQDRGLPDHPAAAPKDEADQAHDNE
                     YIAENRSGHAVMPTYDLARSVNPSMLLSRTDADTLASPTPRPLPPPSHGPYQRLALSK
                     LTGAPSFIVPSLTCDPHVLEEEGAELGDVLPDGLDMAPLDPDTLPEPVLSTLCRIVGF
                     SMLDDVYVMPSPTSEPAPDAIRKRPRRSSPTAPLQMRLRTPEERRPPRHYSPDL"
     gene            <697767..>698411
                     /locus_tag="MRET_2048"
                     /note="MRES_08125"
                     /db_xref="GeneID:38738814"
     mRNA            <697767..>698411
                     /locus_tag="MRET_2048"
                     /product="thioesterase"
                     /transcript_id="XM_027628675.1"
                     /db_xref="GeneID:38738814"
     CDS             697767..698411
                     /locus_tag="MRET_2048"
                     /codon_start=1
                     /product="thioesterase"
                     /protein_id="XP_027484237.1"
                     /db_xref="GeneID:38738814"
                     /translation="MSVRHILRAGVLPRARGVRMYHPISTEEVLRENAAYEARINEAE
                     DALSRRGFPRTAIFRQPVVWGEHDQYQHVNNAHYIRWFESARMRWMERMSRTLSPEIA
                     SNLVRGRGVGIILASTYCRYRRPVTYPDTVVIGQAALPMKFADRVTVRSQAYSVAQSA
                     IVAEADFECVAYDYDRLCKASLPPEVADALRAWTYTGEDKEPYCQKTSRRRTVS"
     gene            complement(<698441..>700087)
                     /locus_tag="MRET_2049"
                     /note="MRES_08130"
                     /db_xref="GeneID:38738815"
     mRNA            complement(join(<698441..699468,699622..>700087))
                     /locus_tag="MRET_2049"
                     /product="ribosome assembly protein RRB1"
                     /transcript_id="XM_027628676.1"
                     /db_xref="GeneID:38738815"
     CDS             complement(join(698441..699468,699622..700087))
                     /locus_tag="MRET_2049"
                     /codon_start=1
                     /product="ribosome assembly protein RRB1"
                     /protein_id="XP_027484339.1"
                     /db_xref="GeneID:38738815"
                     /translation="MSKRTLAEQPSAPEPERRRVDGAQPMKEEEGMGEFEDPFEDEIE
                     SDGEIVHHEDDDMDEEDDEPETQTKPFMPGTMQLEEGQTLVPDQSAYHMLHRMNVTWP
                     CLSFDFLRDHLGSQRQSMPHTAYVVAGTQADTAKNNEVLVIKASSMHRTQHDDAASDD
                     DDQDDDVDEDAVLEYKTIPHLGGVNRVRAAPTTTPTSDLEPCLDAYPVATWSETGKVH
                     IWDVRPLFNALNVPGTTIDKKKIETPLFTVNTHRTEGFAMDWGGLLGGGASGHAGHLR
                     LLTGDMHSKIFLTTSNNTGFTTHATPFESHTSSVEDLQWSPTEPTVFASCSADRSIRI
                     WDVRIKSHRSALTVDAAHEQDVNVISWNRGTQFLLLSGGDDGALNVWDMRSFKPNQTP
                     SPVAHFDWHRAPISSVEWHPEEDSIFAASGRDDQVTLWDLGVERDDEEDPAQLPKGPN
                     GQPVPSQLLFCHHGASDIKEVHWHPQIPGMLGSTSSDGFHFFKTISV"
     gene            <700206..>702587
                     /locus_tag="MRET_2050"
                     /db_xref="GeneID:38738816"
     mRNA            <700206..>702587
                     /locus_tag="MRET_2050"
                     /product="phosphoribosylamine--glycine
                     ligase/phosphoribosylformylglycinamidine cyclo-ligase"
                     /transcript_id="XM_027628677.1"
                     /db_xref="GeneID:38738816"
     CDS             700206..702587
                     /locus_tag="MRET_2050"
                     /codon_start=1
                     /product="phosphoribosylamine--glycine
                     ligase/phosphoribosylformylglycinamidine cyclo-ligase"
                     /protein_id="XP_027484381.1"
                     /db_xref="GeneID:38738816"
                     /translation="MSAIRALILGAGGREHALALHLLRAERVEHVYVAPGNGGTATLG
                     SRCSNVSTPKASGDFSDIARWAKEQRVTLCIPGPEAPLVAGVERAFRDVGIAVFGPSK
                     EAAQLEGSKAFAKDFMARHQIPTAAYRTFTADQIEECYAFIDELGGAKSVVLKADGLA
                     GGKGVILPETDEEARQSAKDMLVHQMFGNACDFLVVEERLDGSELSVLAFTDGYTVRA
                     LPGCQDHKRIGEGDTGLNTGGMGAYCPTPDGTAPGMEERIRREVLCPTVEGMRRDGMP
                     LVGMLFVGLMLTSKGPKVLEFNVRFGDPETEAVLELLAHPSTLADVMVACAERRLDCV
                     DLSIKAGYAVSVVLASGGYPGKYATGVPIEIPTLPEHVSVYHAGTTRADDGTLLTAGG
                     RVLAVSAVGETLDEALQRVYAGVSSIRFDGMVYRRDIAHRALAGARTKQDMTYASAGV
                     DIDAGNALVERIKPMAKSTQRVGCMGSLGGFGGMFDLRALGLRDPILVSGTDGVGTKL
                     RVALEYGKHDTIGIDLVAMSVNDLLVQGAQPLFFLDYFACSKLRVDLAAAVVQGVADG
                     CRQAECALIGGETAEMPGMYVGDEYDVAGFAVGAVEREALLPRMSRMQAGDVLVGLRS
                     SGLHSNGYSLVRKIVDKAGVSLSSPCPWPDATYATLGEALLAPTRVYVRALAHVLRGE
                     HEVLGLAHITGGGFTENVVRMLPAHLGAAIDVSRWERPPLFAWLQREGHIAAQEMART
                     FNNGIGMVLVVPAAASERTVQALEAAGEAPVVLGAVTAQPGVAYVHLDEWHVA"
     gene            <702606..>706010
                     /locus_tag="MRET_2051"
                     /note="MRES_08135"
                     /db_xref="GeneID:38738817"
     mRNA            <702606..>706010
                     /locus_tag="MRET_2051"
                     /product="transporter"
                     /transcript_id="XM_027628678.1"
                     /db_xref="GeneID:38738817"
     CDS             702606..706010
                     /locus_tag="MRET_2051"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_027484382.1"
                     /db_xref="GeneID:38738817"
                     /translation="MTSRVGATPESVEMHARDKAPSIADTASVQAEAYVVGDTSVIAA
                     AAAMERVGWTVWMLTMSAALCGSLFGYDTGYVSSVLVSLDDFQDFGRLSDGTKQLITS
                     ATSLGALIGALCAMFPSEWLGRKMVIALANAVFIVGAIVQAAAQGSWTLIVGRFIVGI
                     GVGVASMIVPLWIGELAPAHLRGRLVTLNVVFLTMGQLIATGVGAGFESVKGGWRYTV
                     AGGAIPAIISLVSMAWLPESPRYDSQRGKMERATRTFQRIYPHATEGFCRERAEKLAQ
                     DLTQWEARHTRTMAARLRLLVTGPNARALALACGLQALQQLCGFNTLMYYSGSIFQAI
                     GFAKPVAVSLIVSAGNFVATLAALKFIDMIGRRRVLLYSVPVMTGALVFAAICFGFLP
                     VKEDGALSMHIPPGRKVWTYLVIVAILVFVLAYGFGIGNVPWQQGELFAIETRAMGTS
                     IATAVNWSCNLIIGATYLSLVRAATSSGAFGFYAGLCAIGFVFCLCCFPDTRQLSLEE
                     VHVIFRGSWGIRAADELRRAKAHVAHDLRARDADAPHHAHSGTATMTQYERPSVGYVT
                     PRVRADDDMEQPVDALDEYKPAVAQSLPADLRASDGLPRPIADAAAPTNALTRHLGLR
                     GPGLVLSVTCFASLGVFMFGYDQGVMSGILPHPHFRAYFHEPSAAQVGTMVAILEIGA
                     LVTSLLSGVAADRFGRKAVMVWGAVAFSLGGLVQTLATGYHAMIVGRIVSGFGVGFLS
                     MVVPTYQSEISPAENRGKLACIEFTGNIVGYMASVWIDYVCSFLPGPLGWRLPLLVQP
                     VLGCALALGSVCLPESPRWLCDRDCDAEALQVLMDLDGDAKAHHTRAHLEYSEIKSSV
                     LQMRAQGDRSYRTMWRTLRYRTLIGMSSQMLAQLNGINVISYYAPLVFESAGWVGREA
                     LLMTGVNAVMYVLATIPTWFLVDTWGRRPILLSGALLCALTLGACGLLLRAQQPYTPA
                     LVVVCVVLFNAAFGYSWGPIPWAWTPEIMPLAFRAKGASLAAATNWVWNWIVGQLTPV
                     LQERIGWRLYMLHAGFCVASFVVVYFLYPETQGVPLEEMDAIFGDQAIPVPPIDDADD
                     TAADPEAPRLRRSISSHPRFHTSPGRRPWWPWGAASPRGAYEPLST"
     gene            complement(<706017..>706688)
                     /locus_tag="MRET_2052"
                     /db_xref="GeneID:38738818"
     mRNA            complement(<706017..>706688)
                     /locus_tag="MRET_2052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628679.1"
                     /db_xref="GeneID:38738818"
     CDS             complement(706017..706688)
                     /locus_tag="MRET_2052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484383.1"
                     /db_xref="GeneID:38738818"
                     /translation="MKDHLAMSPHASEASSAAGYVTLRAPSPMREPTTLHEILDSMDP
                     SDPLSSVASFPQEAAYDDELPAETTPSGRRRRHILSEQRRRNQSREAFERLSELLGVG
                     RQYGARALGLNAGAGTGVEDEELDDRTDTEEDLMLCCDEEVMMRRKRNALRRARTRQS
                     HGRHTRGKGRGRGGSAGQAGSKSAVLFQVIDLLDWLDGRDAHLERDIHELEMLLGVAQ
                     RPHFG"
     gene            complement(<706714..>708252)
                     /locus_tag="MRET_2053"
                     /note="MRES_08140"
                     /db_xref="GeneID:38738819"
     mRNA            complement(<706714..>708252)
                     /locus_tag="MRET_2053"
                     /product="serine/threonine-protein kinase haspin"
                     /transcript_id="XM_027628680.1"
                     /db_xref="GeneID:38738819"
     CDS             complement(706714..708252)
                     /locus_tag="MRET_2053"
                     /codon_start=1
                     /product="serine/threonine-protein kinase haspin"
                     /protein_id="XP_027484384.1"
                     /db_xref="GeneID:38738819"
                     /translation="MLGSSTRQVHVYGRKGRTRVVQDAPSVLEEQAPPSTPPRKTTLP
                     PTRGLFTGVDFRSTWDAWVHSPRETFASKVSTPWKQWAKGSSHARTPLRPKSANAQAL
                     CDTLEDLSLEDRGVASLLRRVQQSHPLDFEQLLTDLAPTYEKVGEASYSEVYRCASSG
                     AILKVIPLDMGTEHAGIALSSPDSVDREVAMIHALSHASHPCARHFVQLQRAHVVRGA
                     YPSALLRAWDTFKAEQASRSENARPSVLPSTQLYGVIVMNDAGQELEGLSLRGWVERA
                     AVFWQVACAVAFAEHTCSFEHRDLHMGNILVRRDASQPASDVGALSALWRTYAPDRTG
                     VHATIIDYSLSRMELDGQTVAYDFSDASLFAGRGDAQYDVYRHMRRLVSEDWQGHAPM
                     TNVLWLQFVLQRMLAMHAPPDDEPGTAAAHAYDLLVQAEQLAHEAIEHAQRHVPQRRV
                     STRSKRRSIQRSHDAWKVLPDAHRPRITSTWTWLQALLPYVEVSEACADAGWLAERGG
                     AAGS"
     gene            <708371..>709465
                     /locus_tag="MRET_2054"
                     /note="MRES_08145"
                     /db_xref="GeneID:38738820"
     mRNA            <708371..>709465
                     /locus_tag="MRET_2054"
                     /product="large subunit ribosomal protein L1"
                     /transcript_id="XM_027628681.1"
                     /db_xref="GeneID:38738820"
     CDS             708371..709465
                     /locus_tag="MRET_2054"
                     /codon_start=1
                     /product="large subunit ribosomal protein L1"
                     /protein_id="XP_027484377.1"
                     /db_xref="GeneID:38738820"
                     /translation="MTTTTTIRGSRAMVWSVVRSLAGVRPALRVPVCGVRSMHATPAL
                     GNKGRARKSPKTLLRLYAEGQLKGPEARQAAALLAEQNSEKGLRAPQESDENKSSDTL
                     SLSEARRVIRAVEAARPRNAYELHIVTSVPPNQTNAFRGRISYPKDPRIKGETVLVFA
                     EQGSEAADAAQQVASQLEAQGSSMRLVIGGNDMIGDTVAGRVPSFSRVLCTTSLLPSL
                     SRSLARALGPKGLMPSTKRGTVVEDAEEMHAAIDQLVTGVDWRGDRVGVVRAAVGRIS
                     FSEAELRANVQALLDAIIHKAASGLAGTKVSAQVVAGYMRDMTTEQADGQTVQQRSVA
                     AMKRALSIVQQVHLSSTQGPGIRLRLDDVL"
     gene            <709540..>710508
                     /locus_tag="MRET_2055"
                     /note="MRES_08150"
                     /db_xref="GeneID:38738821"
     mRNA            <709540..>710508
                     /locus_tag="MRET_2055"
                     /product="SUR7/PalI family protein"
                     /transcript_id="XM_027628682.1"
                     /db_xref="GeneID:38738821"
     CDS             709540..710508
                     /locus_tag="MRET_2055"
                     /codon_start=1
                     /product="SUR7/PalI family protein"
                     /protein_id="XP_027484378.1"
                     /db_xref="GeneID:38738821"
                     /translation="MRLFVAIGLLAAIAASVLLGLATFGVPVNDSFWLLRVQAPLLDA
                     KLGALGYRVNGHDSRVGVGYHVPDEVGDLSRSVRDFVHTLTLVLVLFPVSFALACLTA
                     LASMVAMIHVRAMSILAAGLAVLGALVATVAFAILICLYYELQHNVPTDELDLTYGQA
                     FVFTVVSAACLYGSAITLALGACCAMRMPRRERSDAVPERMPPAKVSYTRDPSAQPYE
                     RAERVHYASALAPVAGDLPKFPEPDVNESYMEDAPTAGEPTPYDESHELDTWASRVHL
                     LDDSEWHTARHSHYTGDATHDEYADAPTMPLMSRQQADAWFLPTHT"
     gene            complement(<710509..>711975)
                     /locus_tag="MRET_2056"
                     /note="MRES_08155"
                     /db_xref="GeneID:38738822"
     mRNA            complement(<710509..>711975)
                     /locus_tag="MRET_2056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628683.1"
                     /db_xref="GeneID:38738822"
     CDS             complement(710509..711975)
                     /locus_tag="MRET_2056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484379.1"
                     /db_xref="GeneID:38738822"
                     /translation="MSSERVGHDAARPAQPPAPVPPYVYTRPAAPTTYTHPILTVRDV
                     SRPTPPGPSTQPLSTPSSRPPFIVSNALAAASGLHLAPRRAAASAATPAPTAPPAVSA
                     PSEARPVRLPPPKDLVAEDAELAAQRSRTQARLRAHLERDHERTLRPDTTTPFRDADD
                     VVARLLPYHVWQLPERDLLRAMDARISDTPPHGPDAALQFTVPYRARPAPPDTPDAYL
                     TLPAFPSEAYTDSVYVRHAQLQRRFAALQTRASTTHASAPCMSASLEHIERLLYEDEL
                     HAFQDMTAALRKARSDLEELERQHTPSTELPAVRPVPRPEQPRPAAPLSSAAVSHLAG
                     LTPSPYVPPVPPGAASRPPAPPASVPAAESLSRPAIPTQPLPLVVPMTCVPRLTALGI
                     HLVPATHLLPALSLASAGQSMAMNAGLTAPRPVVGVQNEPVLLVGITDAPTPLAPGAS
                     PASRQRLHLSVVLSKLRPEQLSGLAHIMQTLQHEDDPS"
     gene            <712209..>712823
                     /locus_tag="MRET_2057"
                     /note="MRES_08160"
                     /db_xref="GeneID:38738823"
     mRNA            <712209..>712823
                     /locus_tag="MRET_2057"
                     /product="component of the EKC/KEOPS complex"
                     /transcript_id="XM_027628684.1"
                     /db_xref="GeneID:38738823"
     CDS             712209..712823
                     /locus_tag="MRET_2057"
                     /codon_start=1
                     /product="component of the EKC/KEOPS complex"
                     /protein_id="XP_027484380.1"
                     /db_xref="GeneID:38738823"
                     /translation="METVCLPDAFPRAYRCVYMAQFEGVRNGGELRDALIRASKADDD
                     AERRRVDFAFVDARLVQSRQQLMTAIVQAIVGAMRRDPKRPDAEVGLKTPSIHSDLLW
                     TLHSNNNIAEALRRFGVSRTTRTLILVRVAPPLDAGELVQHMTQLVDGTLQTRGLSLP
                     SPALAWSELGTAYKIQDTPAFQHPDTSQVDALICSMVASKYVGA"
     gene            complement(<712824..>713384)
                     /locus_tag="MRET_2058"
                     /note="MRES_08165"
                     /db_xref="GeneID:38738824"
     mRNA            complement(<712824..>713384)
                     /locus_tag="MRET_2058"
                     /product="adenine phosphoribosyltransferase"
                     /transcript_id="XM_027628685.1"
                     /db_xref="GeneID:38738824"
     CDS             complement(712824..713384)
                     /locus_tag="MRET_2058"
                     /codon_start=1
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="XP_027484385.1"
                     /db_xref="GeneID:38738824"
                     /translation="MADIELLKTKFQYHADWPKKGILFCDVLPVLRDPITFEILLTNI
                     MSHVFTQTLPRLAQQGAESRINYVVGLDARGFLLGPVIAQRLGAGFVPVRKQGKLPGA
                     CVQATFEKEYGADVFEMQRDAIPAGANVLVVDDLIATGGSAAAAGSLVRQLQARVVEY
                     VFVVSIPCLKGADKLDAPEYHLVEMD"
     gene            <713511..>714689
                     /locus_tag="MRET_2059"
                     /note="MRES_08170"
                     /db_xref="GeneID:38738825"
     mRNA            <713511..>714689
                     /locus_tag="MRET_2059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628686.1"
                     /db_xref="GeneID:38738825"
     CDS             713511..714689
                     /locus_tag="MRET_2059"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484386.1"
                     /db_xref="GeneID:38738825"
                     /translation="MDAADAPPTPMDAIHPTLSSEPLTGEASTVAHMAPYVTDPAQFL
                     LNMPTDKPFTTHVPASLFDECVAVLKRTVQWRVSSTRYNGALPHGRRYAWRKHYVCDH
                     SGKPRDRRNPNLAPGKRRSRRASIKIGCPASFTATQEVGSDMVVMVCRFQHQGHTVNT
                     REYWANSRIPDNVREWIKERVVEGHDQKEIVQMIHEHQRNAANIPPTSPTFIPPGVQI
                     TRMDVYNIIKRYKNLHASEHGTPTKPSAPPPPPPSASHDATRLPLALETPASASESTL
                     PLSSDTRRPVDAHALGHTAAAAAAASYPLLPAAAADLSPATPEEAVSFAQQWSELVAN
                     LQALQPQMMEYALTAGTTRHPNTTGAWSHAIAQLTQAWYVACHLLERPGLPAPTPPPP
                     "
     gene            <714750..>715241
                     /locus_tag="MRET_2060"
                     /note="MRES_08175"
                     /db_xref="GeneID:38738826"
     mRNA            <714750..>715241
                     /locus_tag="MRET_2060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628687.1"
                     /db_xref="GeneID:38738826"
     CDS             714750..715241
                     /locus_tag="MRET_2060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484318.1"
                     /db_xref="GeneID:38738826"
                     /translation="MSGERRPPSLCDPALLPSIVPRIQTIAQLLLQARDTPLAQDEHD
                     DTHVHSAGADASMTEAPPTSLALGTIANDDDDDGGAWTQMASTGISMHRIPTSILARL
                     AHETAQLPSTFAAAHEAAEAAPGADMSLDDQHALLAKLEAYAQRQRDMQATWQQSLSR
                     IME"
     gene            complement(<715231..>716208)
                     /locus_tag="MRET_2061"
                     /note="MRES_08180"
                     /db_xref="GeneID:38738827"
     mRNA            complement(join(<715231..715285,715311..715416,
                     715440..716097,716122..>716208))
                     /locus_tag="MRET_2061"
                     /product="citrate lyase subunit beta-like protein"
                     /transcript_id="XM_027628688.1"
                     /db_xref="GeneID:38738827"
     CDS             complement(join(715231..715285,715311..715416,
                     715440..716097,716122..716208))
                     /locus_tag="MRET_2061"
                     /codon_start=1
                     /product="citrate lyase subunit beta-like protein"
                     /protein_id="XP_027484247.1"
                     /db_xref="GeneID:38738827"
                     /translation="MRGTRVVSRAAAWRSLLYVPGSSDKMLAKSRSVRADMLVYDLED
                     SVARHRKQAARSMVAEALSSAPPGGPTLGVRINAPSSEPDLARADVDAVLRSERVESL
                     VLPKVESARDLALVASAASPSVPLSLVLSVESASSLLRMPTILEHASLGPHVRVAALL
                     FASEDYCAATGVQRTRDLRSLLYPRAQMATIAKAYGLQAIDMVCIEYKDDAYLREECR
                     DGASLGFDGKQAIHPAQLDAIHAAYSPSKEDVDMARAVLDAYRQGAREGRGAVGLAHH
                     GKEIMIDAPMLLQAQRTLERAGITP"
     gene            <716246..>718828
                     /locus_tag="MRET_2062"
                     /note="MRES_08185"
                     /db_xref="GeneID:38738828"
     mRNA            <716246..>718828
                     /locus_tag="MRET_2062"
                     /product="ATP-binding cassette, subfamily B (MDR/TAP),
                     member 6"
                     /transcript_id="XM_027628689.1"
                     /db_xref="GeneID:38738828"
     CDS             716246..718828
                     /locus_tag="MRET_2062"
                     /codon_start=1
                     /product="ATP-binding cassette, subfamily B (MDR/TAP),
                     member 6"
                     /protein_id="XP_027484249.1"
                     /db_xref="GeneID:38738828"
                     /translation="MTSVLPELQAVQPIAHVVLIMLLTHQRALVHRVRVCLGMDRQVA
                     LEDEADLPRHRLPQPVVGAQHERYVKAVRYVMMTIAGTFLLSGVLVALEAVMPPRVWR
                     PSLPAWHMILVQALGGLVAWGLLTLVVLREEQKQVPLRSCRTRMVATLVLGWAFDGTQ
                     LVWHAALADTAPWTLAQVGIVAVRALLLYPLLLYVALCQRVSYVPQAAPAAPAAPSAS
                     FSSLLSRVRVLFPYLWPSQSPKLQLLALSCVGLLFLGRLVNLLVPMALGRVVEALSTH
                     KDPWLPILFFAALKLFQGTGGLLNVVQNLLWYPISWYSDMHMSRLMFDRVLNLSMSYH
                     TRRKTGELIRTLDRGTALNNFFEYLLFSLTPVFVDIVVAIVYLSMTFGPMIGLILLAI
                     MCVYTYLSVRMTTWRTKLRREVNSRDSACRSITTDVLLNYETVKSYGNEAFESERFAT
                     ALGAYQEAAYQVMLSLHMLNLMQNLILSFGTLFSVLAVAWTVVSGRTSASQFVVFVTY
                     LQQVYAPLNMLGTLYRVVNQNLVDTDKLMELLNEDVDIRDAPGAPEMQVPHGEIEFQD
                     VHFSYDNNEHMALRGMSFKIHAHQRVALVGESGSGKSTVLRLLYRFYDVTRGRILIDG
                     QDLRDVQQQSLRQAIGIVPQEPSLFHTDVRSNIRYGDVHASDEAVETAARAAQIHDRI
                     TEFPQGYDTMVGERGVRLSGGEKQRVAIARTILKNPPILLLDEATSALDSQTERLLQS
                     ALHTLMHGRSSLTIAHRLSTIIHSDLILVADRGQIIEAGTHEELIARGGKYSALWLQQ
                     SKTQAEQDAERSAAHACAPAAPEAPPADAPPAEAAPNAPPAANPSAPMSRSAKRRQQR
                     RRKH"
     gene            complement(<718855..>719998)
                     /locus_tag="MRET_2063"
                     /note="MRES_08190"
                     /db_xref="GeneID:38738829"
     mRNA            complement(join(<718855..719863,719894..719955,
                     719981..>719998))
                     /locus_tag="MRET_2063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628690.1"
                     /db_xref="GeneID:38738829"
     CDS             complement(join(718855..719863,719894..719955,
                     719981..719998))
                     /locus_tag="MRET_2063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484248.1"
                     /db_xref="GeneID:38738829"
                     /translation="MAPILNIHQSNSQSFSIRVRQDESFESMKERVAQRVGTKDVSSI
                     QFKYLHNKEPYKLEDADDYEIFLERHADASDVDVYLDVPYASVDAVPAAPPTSYVAPS
                     ISYAGLAPPKSSSPNVPVLNESTLVTRTPARGKTGSVSIHRVQPAAVPGVEEFVEAGG
                     VSGGGRDSLLYPPVGEPYTPTAGAQPTPRTMPTTYEPRAPSVRTKRTTVSHNTAASAP
                     KHKMAFEEFHSSRGVRLLRGSLGPVNNVPMMLKGGYRHVYVSRGFALDHGFIPADTQP
                     GTYGYNGITNLGKWPVQVGSKAVPLTVMLAEDSYFPVILGRSFMEKRGVRTDPIDMTS
                     VIFMDNGERADVEVVVVRDELGQPVAIP"
     gene            <720229..>720913
                     /locus_tag="MRET_2064"
                     /note="MRES_08195"
                     /db_xref="GeneID:38738830"
     mRNA            join(<720229..720508,720532..720579,720606..>720913)
                     /locus_tag="MRET_2064"
                     /product="ER membrane protein SH3"
                     /transcript_id="XM_027628691.1"
                     /db_xref="GeneID:38738830"
     CDS             join(720229..720508,720532..720579,720606..720913)
                     /locus_tag="MRET_2064"
                     /codon_start=1
                     /product="ER membrane protein SH3"
                     /protein_id="XP_027484244.1"
                     /db_xref="GeneID:38738830"
                     /translation="MIGVTVAALLATSSFVLGMLSIDWRADHLVLWEQSVSREHVLTA
                     LQYYVYTIGARPARYTAVLLVIGTLQVCLLGSKIVMGSENNWLFDGASLFLVCASGVL
                     YMNKIQPYVRALPSVMPPEDSITTAKFQELLILLRELASTHILLSIALIGIILLQCGK
                     YYSVRLQERERNEEVDVRLVRRLRQRQQQERESGAPGRDSEDVLTARAGAH"
     gene            complement(<720910..>722091)
                     /locus_tag="MRET_2065"
                     /note="MRES_08200"
                     /db_xref="GeneID:38738831"
     mRNA            complement(<720910..>722091)
                     /locus_tag="MRET_2065"
                     /product="mitochondrial pyruvate dehydrogenase kinase"
                     /transcript_id="XM_027628692.1"
                     /db_xref="GeneID:38738831"
     CDS             complement(720910..722091)
                     /locus_tag="MRET_2065"
                     /codon_start=1
                     /product="mitochondrial pyruvate dehydrogenase kinase"
                     /protein_id="XP_027484243.1"
                     /db_xref="GeneID:38738831"
                     /translation="MSLRNGTRFAVYGVPMRLLARHLEHTPQPITLPYLLAHGGQPGK
                     PPTPEELLRSAQYTQKELPVRLARRVRQFYSLPFIVGTNPYIQDVARLYASSFQRLCE
                     LPAIHSLEDNDVFTHELRELVHEHADLVPTLARGFMECKMYMDNERISRFLNAALHSR
                     IGIRLIAEQHLALTESAHKARNSDDLASTTTSPTSVGIIDTQMSPVEVIQQSGAYVQA
                     LCEATFEMAPVIQFEGDLDARTVGIPVHLDYVMTELLKNSFRATTEMFLSRHPSGSAE
                     DLPPIIVTLSSGPSQITIRIRDEGGGIPPENMSQIFSYAFTSVPTQSDEAQSGDDAAT
                     HGLSSSMGTLAGLGYGLPLSRLYLNYFGDSDLDIESLYGYGCDTFVKLSRLIGTSNVQ
                     I"
     gene            <722231..>722953
                     /locus_tag="MRET_2066"
                     /note="MRES_08205"
                     /db_xref="GeneID:38738832"
     mRNA            join(<722231..722752,722779..722840,722866..>722953)
                     /locus_tag="MRET_2066"
                     /product="vesicle transport through interaction with
                     t-SNAREs 1"
                     /transcript_id="XM_027628693.1"
                     /db_xref="GeneID:38738832"
     CDS             join(722231..722752,722779..722840,722866..722953)
                     /locus_tag="MRET_2066"
                     /codon_start=1
                     /product="vesicle transport through interaction with
                     t-SNAREs 1"
                     /protein_id="XP_027484246.1"
                     /db_xref="GeneID:38738832"
                     /translation="MTDLFESYASDFAQLQKSIEARLAVDFTSMSADTRRSALRHADA
                     EAEEAGELVMQMELEVQSFPTSVRDRYMKELHALKESLDKLQLDIRAKQGDRTPYGSS
                     GLPLDDHTYTDLEANDEAYQRQRLLQGTQVLERGSERLARSTRLALETEDVGAGILQD
                     LQRQREQIEHSRDTLHGADAHIDRSSRTLQQMIRRAKQQKLVTTSIIVVLVLLILLIL
                     YAKLF"
     gene            <723067..>724785
                     /locus_tag="MRET_2067"
                     /note="MRES_08210"
                     /db_xref="GeneID:38738833"
     mRNA            join(<723067..723477,723505..>724785)
                     /locus_tag="MRET_2067"
                     /product="sensor protein CreC"
                     /transcript_id="XM_027628694.1"
                     /db_xref="GeneID:38738833"
     CDS             join(723067..723477,723505..724785)
                     /locus_tag="MRET_2067"
                     /codon_start=1
                     /product="sensor protein CreC"
                     /protein_id="XP_027484245.1"
                     /db_xref="GeneID:38738833"
                     /translation="MSRTIELRAPEGVYTRRDWTNPLQHRTAGQNDAPTSPTSHESAA
                     TSSRYACMNEVPHMSAAIIRPRHATHADASSSVPGALVSQGLEAEAWGDATPLRSARP
                     KLSLRTLGGSFIVRSNQYQDMSKIVNHRTEPTLFTMINASKTLFWYANVHQKMKEPAG
                     RIMFTHAPLCHDINQHTCRHDRMDVVVGLSSGDIVWMDPIQYRCSRMNKNGMVTSSPV
                     RQIRWVPGHETQFVSAHSDGTVLVWDVERDDPPEGFQKAPSDPAWDPRASIVVEEPQL
                     QTDSPSGGMLKMGRSKDHSPVLYNPLSVWHVSRRAITDMAFSPDGRFLAFTSEDKLLH
                     IVDFSRKTLIHTMASYFGGLTCVCWSQDGRILLTGGQDDLLTIWAAKEGHVVARAQGH
                     HSYVSAVAFDPWCHKGSSYDAYRLISAGEDGNVCFWDFSSWSLHRPRAAPNQRALPLQ
                     TTASQVFVPAQSRAEVPMLHPTASFRMPTSVPCGLRIAPNYLMVLHLDSEMALFSRPR
                     RFTHGHTVDHEPVPTHTTTSSPEEPPAASELPRSPTQRQMFRRTMSPFTLGLRKT"
     gene            complement(<724813..>725264)
                     /locus_tag="MRET_2068"
                     /note="MRES_08215"
                     /db_xref="GeneID:38738834"
     mRNA            complement(join(<724813..725138,725168..>725264))
                     /locus_tag="MRET_2068"
                     /product="IGR motif protein"
                     /transcript_id="XM_027628695.1"
                     /db_xref="GeneID:38738834"
     CDS             complement(join(724813..725138,725168..725264))
                     /locus_tag="MRET_2068"
                     /codon_start=1
                     /product="IGR motif protein"
                     /protein_id="XP_027484242.1"
                     /db_xref="GeneID:38738834"
                     /translation="MLAVLQRTRSAISNIGVRFASTSAQRRVPSPRNKVDSPKAFLEA
                     ISKPRRDLVNNSACVSALGEDWDAMFSMNSEKLKGAGVPVKERKYILWALEKYRQGLE
                     PSEFVRSVKKPKKVRGWGPRVQKGYRVRGELRPGEKKI"
     gene            complement(<725332..>726294)
                     /locus_tag="MRET_2069"
                     /db_xref="GeneID:38738835"
     mRNA            complement(<725332..>726294)
                     /locus_tag="MRET_2069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628696.1"
                     /db_xref="GeneID:38738835"
     CDS             complement(725332..726294)
                     /locus_tag="MRET_2069"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484241.1"
                     /db_xref="GeneID:38738835"
                     /translation="MTQERSDLVFLRSHDIPVYAKFSWADDNLSKRDDIRVPNVASAH
                     KSSEASAPDRITWHRRPTTYTKHVPHLMTDTDENYNEPDSLQKALRESLDDLRGCTFQ
                     ELDEAHQEKIRDRIWHCLRSSDMKGPVYGFQQLRSIQKPTTSQRGEHIIMALLVNVAV
                     LYLHYTLMIGSLILRLFRLSHQEAISTELLPFHLMIIPSDLYRWPLSWMYTMLPFTKP
                     QPTPSIPIRDRVLYMTQEFAAMIRTSVLPRQWQQCKDLMCILLTCLYHVSRHRCTPIY
                     HAANMLKFVYGLGIHKFFYHTLYMLLESLIVAYETLTSPAVAAP"
     gene            <726457..>728640
                     /locus_tag="MRET_2070"
                     /note="MRES_08220"
                     /db_xref="GeneID:38738836"
     mRNA            <726457..>728640
                     /locus_tag="MRET_2070"
                     /product="platelet-activating factor acetylhydrolase"
                     /transcript_id="XM_027628697.1"
                     /db_xref="GeneID:38738836"
     CDS             726457..728640
                     /locus_tag="MRET_2070"
                     /codon_start=1
                     /product="platelet-activating factor acetylhydrolase"
                     /protein_id="XP_027484295.1"
                     /db_xref="GeneID:38738836"
                     /translation="MHLPKANGPFDVGVVDIEVPVREPKDFIPSFLSHVRVNKLSKDG
                     HKLGLKDARKVYANFEKLMKDVPIDMDSKIEAEHDYLHDNGFFLRHATLQFRTILFSL
                     YYPSAKMRPRDAKKHPHARWLGLPLKKTAKMAWEYIGEYGALARVFVPAIVTLARSYL
                     QARVGLPLMEPSHVPSDIGMGADENNMKQMTTKSFPVVVFCHGLAGNRLAYSQFCSEL
                     ASHGFVVAAIEHRDGSGLGSLMWSGANNVEKQGSKQEAKRFEKNVKLGASESLLDYDM
                     SAESSSAATLSLLHEFTKVPYLPFEKVGLRAFTEPQGPKEQGLRQAQLAMRASEIQEV
                     MYVLRRINNGDAEWLAESRTRSLGSLLCGPRTFKRMRQKNIVPRCADFFLSWKDKLDV
                     DFPSLIGHSFGGATLFEYLRLDQNLFKYGIILDPWMDPVRDPRMEEDVRLKLRKPVYV
                     INSEGFSMWPEQFSKLQRCTIDGLAANEHHRGWLLTLTGTNHGDFSDMPFLLPRVFGS
                     AITAHDAIATFASLSMTQIKLIRQDRLASMTRFGSQHDVVEPNDFMRKPSGMRFISDR
                     EVPLDDEFLSRMYGTYVLSKRMRRRPGRSMFWELRGWRNQAERDPLTSIGKKYLREKA
                     KQDKKITKGGPAESEDDSSEFMDRETQHSFVPPFIDPCADPNVWEEHIVDADSLKVFE
                     QWQKDVSIKHRTHRPLSLFTVVLWFWGIRQGLAPPGHLLVHDLKC"
     gene            complement(<728675..>729467)
                     /locus_tag="MRET_2071"
                     /db_xref="GeneID:38738837"
     mRNA            complement(join(<728675..728723,728750..728808,
                     728840..729105,729133..729190,729217..729350,
                     729377..>729467))
                     /locus_tag="MRET_2071"
                     /product="ubiquitin-conjugating enzyme (huntingtin
                     interacting protein 2)"
                     /transcript_id="XM_027628698.1"
                     /db_xref="GeneID:38738837"
     CDS             complement(join(728675..728723,728750..728808,
                     728840..729105,729133..729190,729217..729350,
                     729377..729467))
                     /locus_tag="MRET_2071"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme (huntingtin
                     interacting protein 2)"
                     /protein_id="XP_027484296.1"
                     /db_xref="GeneID:38738837"
                     /translation="MEGARLKRIVREIAACERESDDEISVYPIDESPFHLIGTFPGPI
                     HSPYENGLFKVDIVVPEGYPFHPLQMRFITRVYHPNVSSQSGAICLDILKDQWSPVYT
                     LKSTLMSLRSLLCSPEPNDPQDAEVAKHYTSDFEGYERTARYWTEIFAKRDNEQSSVP
                     PSDADEAQLVGLDPKHVEKFVNMGFAKSRVIEVMRRLNYRGENIQNITDEQVTSLLSE
                     "
     gene            complement(<729546..>731167)
                     /locus_tag="MRET_2072"
                     /note="MRES_08225"
                     /db_xref="GeneID:38738838"
     mRNA            complement(join(<729546..729603,729630..>731167))
                     /locus_tag="MRET_2072"
                     /product="oxalate---CoA ligase"
                     /transcript_id="XM_027628699.1"
                     /db_xref="GeneID:38738838"
     CDS             complement(join(729546..729603,729630..731167))
                     /locus_tag="MRET_2072"
                     /codon_start=1
                     /product="oxalate---CoA ligase"
                     /protein_id="XP_027484293.1"
                     /db_xref="GeneID:38738838"
                     /translation="MSSRTIVPSLFASRESYRRDAEAIELPASAGKPMSISYSELADL
                     VHQVRAQLASWQLPKGTVVCSSLVNSLEFVVVFLATADLGLVAAPLNPNYKESEVTFY
                     LEDTKTPALIVPAGTLSGTDASEGALAAKRAADALSVRVVEIVYGAKTLQLVDANGAS
                     TPSADATEASEDDTALILHTSGTTGRPKAVPLTHKNLLTSMHNIKLTYSLSPSDKTFL
                     VMPLFHVHGLVCGLLASLFSGGSVAIPPRFSASSFWTEFVQTRSNWYTAVPTIHQILL
                     SADKPDPMPRLRFVRSCSSALSPSTLAALEKLVDAPVLEAYAMTEAAHQMTSNPLPPK
                     EHKAGTVGIGHGVEVKILDTSGRELPVGKDGEVCVRGANVTQGYIGNEKANRDNFFRL
                     AFKNCPPEVDGFLRTGDQGHKNDDGYLVLTGRIKELINRSGEKISPLELDNALLALPY
                     VKEAVSFGVPDEMYGELVGAVVVLQGDAPADVSQERIQADLSKSLAKFKIPVRVWITD
                     NIPKTATGKIQRRIVAQHFLSTV"
     gene            <731259..>732182
                     /locus_tag="MRET_2073"
                     /note="MRES_08230"
                     /db_xref="GeneID:38738839"
     mRNA            <731259..>732182
                     /locus_tag="MRET_2073"
                     /product="ATP-dependent NAD(P)H-hydrate dehydratase"
                     /transcript_id="XM_027628700.1"
                     /db_xref="GeneID:38738839"
     CDS             731259..732182
                     /locus_tag="MRET_2073"
                     /codon_start=1
                     /product="ATP-dependent NAD(P)H-hydrate dehydratase"
                     /protein_id="XP_027484294.1"
                     /db_xref="GeneID:38738839"
                     /translation="MPSPRSMLAKVQAIVSPLLPELHKGQAGRVGVLGGCREYTGAPY
                     YASMSSMRLGCDMSFTICAPEAAQAIKGYSPDLIVHPALDASKSMEEVREELKALFAR
                     LHSVVIGPGLGRDASMQSFARVAIEVAREANLYSVIDADGLWLVQNAPAVVQGYQRAI
                     LTPNVVEFGRLCRAMRIDAGEHAAKELSVALGGLTILEKGRTDRIATPRGVVECDLEG
                     GLKRCGGQGDLLSGTLGTFLAWAKRFEERKAQGEALPDFDLDELPMLAAYGASCVTRT
                     ASRRGFARLGRSMLANDLLSEIGPAYGDLFV"
     gene            complement(<732184..>733491)
                     /locus_tag="MRET_2074"
                     /note="MRES_08235"
                     /db_xref="GeneID:38738840"
     mRNA            complement(<732184..>733491)
                     /locus_tag="MRET_2074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628701.1"
                     /db_xref="GeneID:38738840"
     CDS             complement(732184..733491)
                     /locus_tag="MRET_2074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484291.1"
                     /db_xref="GeneID:38738840"
                     /translation="MSTSSATSRRVLRNLDHLWQGTNQKFINKLRPSFAQSTPAYVPP
                     KDRITFWNIVPGDVVKLRSGAIGHDEDGRPIRGEGIVTSIDRTTNRLLLRDIDDNHKM
                     APKNVKHVVPRLIDPEAGEEKGFSGNTTSVPRPVHYSKVMLKVPDTQTYASRIVRSKP
                     FYDRQKGMFVWKRFAIVKATDEESLRTGGALKKIYVPWPKVPERRRPFRTTHADGRVA
                     EEETWVPWVPEDPVLLPMQKPRTTPAREAIAAERRAVWNEKIDRLRAQARDSTFATPP
                     GAKSYAGFAKTVNVRPPPIAQPPSVSELVKMERQRLVEFVHNPETQSHVEQGGQLFAA
                     HDYLDVAPLVGPAAGGEWGALEEASSSSVRDEQGRLVARPSKADVHSMPIELLMGKDL
                     ANETGLKWRMRHWKTKQAERQAQEEALRAEEKELLKELDALRV"
     gene            <733605..>733992
                     /locus_tag="MRET_2075"
                     /db_xref="GeneID:38738841"
     mRNA            join(<733605..733842,733871..>733992)
                     /locus_tag="MRET_2075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628702.1"
                     /db_xref="GeneID:38738841"
     CDS             join(733605..733842,733871..733992)
                     /locus_tag="MRET_2075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484292.1"
                     /db_xref="GeneID:38738841"
                     /translation="MSSLASGVAPASESSGMRQRHAPQGGKVIDRTTKAIQREPEPKS
                     QAFYAPLVDTVWRVYVMASGILGTSVQEPVEILIMLSVYAIVLSGVCLALYHFPNYVQ
                     NASRRVHYYLTGEQPVQ"
     gene            complement(<733996..>734444)
                     /locus_tag="MRET_2076"
                     /note="MRES_08240"
                     /db_xref="GeneID:38738842"
     mRNA            complement(join(<733996..734270,734297..>734444))
                     /locus_tag="MRET_2076"
                     /product="cytidine deaminase"
                     /transcript_id="XM_027628703.1"
                     /db_xref="GeneID:38738842"
     CDS             complement(join(733996..734270,734297..734444))
                     /locus_tag="MRET_2076"
                     /codon_start=1
                     /product="cytidine deaminase"
                     /protein_id="XP_027484289.1"
                     /db_xref="GeneID:38738842"
                     /translation="MTDGTPLLEAASQAKELSYSPYSTFRVGCAALLEDGTIVQGANI
                     ENASYSVAVCAERSTLLRIKLDTRWRGQRILAMAVSSDIPNAPCTPCGVCRQAMREFC
                     EMSMPVYFPTGQWRPGEQVLSLTLEQLLPSSFGPEALC"
     gene            complement(<735277..>737598)
                     /locus_tag="MRET_2077"
                     /note="MRES_08245"
                     /db_xref="GeneID:38738843"
     mRNA            complement(<735277..>737598)
                     /locus_tag="MRET_2077"
                     /product="5-oxoprolinase (ATP-hydrolysing)"
                     /transcript_id="XM_027628704.1"
                     /db_xref="GeneID:38738843"
     CDS             complement(735277..737598)
                     /locus_tag="MRET_2077"
                     /codon_start=1
                     /product="5-oxoprolinase (ATP-hydrolysing)"
                     /protein_id="XP_027484290.1"
                     /db_xref="GeneID:38738843"
                     /translation="MTLGLRIAIDRGGTFTDCLGQLPASGTENAGRDIVIKLLSHDPS
                     NYRDAPTEGIRRILEVATGRKIPRSHKISTEDIDYIRLSTTVATNALLERQGERHALI
                     TTKGFRDIVQIGNQSRPSIFDLAIHKPEVLYEHVVEVDERVTVVGYTSHPNAREHGVQ
                     FSSPSRDAYVTKPWTGPDRPPSAAPPGAPYQAPEIVRGVSGEAVAILQKPDETKVRAQ
                     LEDLFAKGYRSLAIVFMFSYTFPDHEQLVKRIARDIGFPHISCSAELMPMIKMVPRAT
                     SATADAYLTPVLQAYIDGFFSGFDSSLRDGSAGTRVEFMMSDGGLTSVEHFTGLKSII
                     SGPAGGVVGMALTTYDERDGRPCIGFDMGGTSTDVSRYAGRYEHVMETTLDGVTIQSP
                     QLDVNTVASGGSSCLFFRNGLFVVGPDSASAHPGPTCYRKGGPLAITDANLVTGRLAI
                     EMFPRIFGPNENEGLDIHASLQAFEALTTHINAETGRTMSVDEVAQGFIRVANEVMCR
                     PIRSLTQARGFSTSKHVLACFGGAGGQHACSIARALGIKTVVLHKYSSILSAFGMALA
                     DRVFEVQEPSNETWDHTPATLERIQTRADALAKRAQDELLAQGFARDRIHLEVYLHMR
                     YDGTDTALMTLKPADSWNMESVFVDTYRQEFGFVLSNRAILIDDIRVRAVGRTFDSLG
                     PSVLAEHAAQGTRYAHAKALDTASQRPVYFDGEGRLPTPIVRLKDLSAFEYVPGPAIL
                     IDETQTILVEPRCIAHILTQAVLIEIQYDEGRP"
     gene            <737736..>737981
                     /locus_tag="MRET_2078"
                     /db_xref="GeneID:38738844"
     mRNA            <737736..>737981
                     /locus_tag="MRET_2078"
                     /product="cytochrome c oxidase subunit 23"
                     /transcript_id="XM_027628705.1"
                     /db_xref="GeneID:38738844"
     CDS             737736..737981
                     /locus_tag="MRET_2078"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 23"
                     /protein_id="XP_027484287.1"
                     /db_xref="GeneID:38738844"
                     /translation="MPPPPDHLADLDLSVRFPESPEILDDKLPTKFTDPCKQAALQSM
                     RCLERYGHDKLMCHNEFYIYRQCKKEFTRQLRESRRA"
     gene            complement(<737985..>739064)
                     /locus_tag="MRET_2079"
                     /note="MRES_08250"
                     /db_xref="GeneID:38738845"
     mRNA            complement(<737985..>739064)
                     /locus_tag="MRET_2079"
                     /product="WD repeat protein 61"
                     /transcript_id="XM_027628706.1"
                     /db_xref="GeneID:38738845"
     CDS             complement(737985..739064)
                     /locus_tag="MRET_2079"
                     /codon_start=1
                     /product="WD repeat protein 61"
                     /protein_id="XP_027484288.1"
                     /db_xref="GeneID:38738845"
                     /translation="MLQYLEECEIAPPSAGEEHAVWQLVWTKQGIVAGRASGSVDVLD
                     FDKLETKQSCTEEHSLGIVSLSQSADDRYLLTNSMDGAITLWQWTKEGRLEQAAQRAS
                     IKGIPCGPEPNEPYPVQAWVSALHPDAHVFAASGENACVALFSAHPDTFGEQGQRLSF
                     DTSYASYATCLAFNYEGDLLAMGTNTGVVFIWNIHTGEQVACLTEHAQPVRTVTFARP
                     NVSYSDHMFVGSDDRTITVHDVQAIRSHVSETAVAALQGHRGWVLDVQAGGNGRVIAS
                     TCSDHVVRLWDLGTSPIECIMTQTQKTPIWGVAWHPDSMEGTREDMGSSTLMAAGHRF
                     ITGSDDGHVRMYRSAGTGTRADEVI"
     gene            <739160..>740284
                     /locus_tag="MRET_2080"
                     /note="MRES_08255"
                     /db_xref="GeneID:38738846"
     mRNA            <739160..>740284
                     /locus_tag="MRET_2080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628707.1"
                     /db_xref="GeneID:38738846"
     CDS             739160..740284
                     /locus_tag="MRET_2080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484429.1"
                     /db_xref="GeneID:38738846"
                     /translation="MFSAETGARTELQDIPPAPPSSSFARRTTIPMPDVIRRLFKQFP
                     LHVWPPAESGGSWSQVEGASRPATLYIIPPKEPGTWASADPVSLRWQMEFVVRGVPVH
                     CEPLYDAYWSPEHTTPFAQVDTESHGAQLLGESSLQRYMDHHYPLVRAELEEKSVWPD
                     HVQDEVMLWMNLLEQRVMCGLLLACIRSGTYTPPSQSASLLRRWLAPLFPGEMSPEQG
                     AFARLARLSAAGASPSSLAAVFGRDYLSDVRNPLTLVPGYSVDWVGFLSGTSDHTGPD
                     ASEVEQFPASLRVDQDAIQRDAADALNAVAARLADDIGSCDDVWMLGARRPTSLDCLL
                     FAVLHTIRTLPAQQVRFLLAVQERHPSLLTYYERLHKYVP"
     gene            <740358..>741265
                     /locus_tag="MRET_2081"
                     /note="MRES_08260"
                     /db_xref="GeneID:38738847"
     mRNA            join(<740358..741210,741237..>741265)
                     /locus_tag="MRET_2081"
                     /product="solute carrier family 25 (mitochondrial
                     carnitine/acylcarnitine transporter), member 20/29"
                     /transcript_id="XM_027628708.1"
                     /db_xref="GeneID:38738847"
     CDS             join(740358..741210,741237..741265)
                     /locus_tag="MRET_2081"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial
                     carnitine/acylcarnitine transporter), member 20/29"
                     /protein_id="XP_027484428.1"
                     /db_xref="GeneID:38738847"
                     /translation="MPLNDATKDILAGTTGGVAQVLVGQPFDIVKVRVQTAPHGTYSG
                     ILDCVSHILRDEGPLAFYKGTTMPLIGVGACVSIQFGVVQWSKRLFASMNAKQSPTQQ
                     ITPLQQYTAGLLGGVANSWVAGPVEHVRIRMQTQKGHDIRGPFDCVRQIVQKAGVTGV
                     FRGMGPTLLREGHGMGVYFLTYEYIVQQRLKALGISRDQVPISTSMVAGGLSGILLWM
                     MIYPIDVVKSYMQTDAIEPSKRQFRSSLDVVRYINASYGLKGYVRGIEPTLLRAPFVN
                     AATFVAFELAMQKLSLF"
     gene            complement(<741266..>742204)
                     /locus_tag="MRET_2082"
                     /note="MRES_08265"
                     /db_xref="GeneID:38738848"
     mRNA            complement(<741266..>742204)
                     /locus_tag="MRET_2082"
                     /product="coatomer subunit epsilon"
                     /transcript_id="XM_027628709.1"
                     /db_xref="GeneID:38738848"
     CDS             complement(741266..742204)
                     /locus_tag="MRET_2082"
                     /codon_start=1
                     /product="coatomer subunit epsilon"
                     /protein_id="XP_027484101.1"
                     /db_xref="GeneID:38738848"
                     /translation="MDASVIEVQSLYYQNAHAGCVALAQKHAPNGVMDDTSLLILVYA
                     ARAALAMGDIAGARQLLGDDAEQPVAMSVLLLADFYEMKRAGDEAGCGDVVEQLTMLL
                     DVVEPGELSSEIVRYQVGLALYEHGDAQKALETLGVTGAGGSTELECIALGVHILLAI
                     HRIDLAEKEYLLAQQQNDDSILVQYMEAWIGLVRGGRATQQAYYVYDEMSQNSMIAQT
                     PNMAPSLVGKAVAQAAQDHLSNASGTLHEALALDPANTLALANQAVAKSLDSETGVPE
                     ADAAANLYATTEPASALALLWDSKRRELAEAVAALA"
     gene            complement(<742301..>743404)
                     /locus_tag="MRET_2083"
                     /note="MRES_08270"
                     /db_xref="GeneID:38738849"
     mRNA            complement(<742301..>743404)
                     /locus_tag="MRET_2083"
                     /product="cytochrome c peroxidase"
                     /transcript_id="XM_027628710.1"
                     /db_xref="GeneID:38738849"
     CDS             complement(742301..743404)
                     /locus_tag="MRET_2083"
                     /codon_start=1
                     /product="cytochrome c peroxidase"
                     /protein_id="XP_027484427.1"
                     /db_xref="GeneID:38738849"
                     /translation="MTFAMRGLTRLTQCLRSTSAVSVPRTSIRAYSTPASPKGKSNAG
                     VSAIVAALIASAATGAFVMQNDIKDFINGKTSGTKVPTKEDYQQVYNEVAKNLEDASY
                     DDGSYAPVVLRLSWHSSGTYDKNEHNGGSNGATMRFKPEASHGANAGLENARKFHEPI
                     KAKFPWISYSDLWTLGGVAAVQEMGGPKVLWRPGRQDKPVEATPPEGRLPGGPEDRDQ
                     LRKIFYRLGFNDQEIVALAGAHAVGRCHTHHSGYDGPWTFSPTSFTNQYYVMLLEQDW
                     VPKEWDGPFQYVDKESKSLMMLPADYLLVKDGAFNKYVKQYAKDEERFFKDFASAYSR
                     LMELGVPKENFEEAAKKLGIDGPLTFKTLDEQE"
     gene            complement(<743693..>745660)
                     /locus_tag="MRET_2084"
                     /db_xref="GeneID:38738850"
     mRNA            complement(<743693..>745660)
                     /locus_tag="MRET_2084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628711.1"
                     /db_xref="GeneID:38738850"
     CDS             complement(743693..745660)
                     /locus_tag="MRET_2084"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484426.1"
                     /db_xref="GeneID:38738850"
                     /translation="MNSNEVPPRRPTLTLVTQPTTSETHTHVLWKMGQSSLQSTSKDS
                     SNLGKMLKSVPSEAELSRFKTSQPRPPSITCVDDDALLLSSSAILTPRSLLFNHADMH
                     PSDSMVESDTLGSSWSSCSKIICGSYESQESALTSCEEISPEIKAESESNLSSSTVTA
                     EDRLQAVCELLNRQKVDSNSSTRRARSCSDLGPRRDSWETLHPQNSKKEAFIPPRADP
                     SHASVDNVTSQRTSPSLSPSDISTSLSPVPPGLDAKGPDDLSAYVSGIGAPIDPDIEM
                     STFVQLQTFRSHTRSRSVGRFDSRRERSIQQGKTRGDMDERMANMLGLSPRRFTSMTS
                     PRPPLALIRDTEQIPALDDLGSAVCNPGYVLHSKKPDQPSETSPTSHLDDTPPASPIL
                     KTPTEALEPIPDDADLSLDSNSDLVDEQGFELVVPRRKPHRRRHRSIRSHASDSDMNL
                     IDMNAQVEDEDEESRSRGRCTSVKSIEPSGSLDMACSRLGVSHRRSTRRRRNDLSYSA
                     ALQAPSESRGRTKERGRGERVKIVVSSNESSEPEKHAPNILSVDTSLDDLQNSPRSRL
                     LSNSSHLLMLSLEVAMIQHDKIHAPLKPRWGKRRDDDFQPLPRMDARIKQFLTDKKLK
                     HAPSSVKTPSLYHYVDDCGSRLKYNLEASCP"
     gene            complement(<746164..>747513)
                     /locus_tag="MRET_2085"
                     /note="MRES_08275"
                     /db_xref="GeneID:38738851"
     mRNA            complement(<746164..>747513)
                     /locus_tag="MRET_2085"
                     /product="Rab GDP dissociation inhibitor"
                     /transcript_id="XM_027628712.1"
                     /db_xref="GeneID:38738851"
     CDS             complement(746164..747513)
                     /locus_tag="MRET_2085"
                     /codon_start=1
                     /product="Rab GDP dissociation inhibitor"
                     /protein_id="XP_027484425.1"
                     /db_xref="GeneID:38738851"
                     /translation="MDETYDAVILGTGVSECVLSALLSVEGKKVLHIDRNDYYGAECA
                     SLNLTQLYNKFRPGEPVPTDIGRDRDYAVDMIPKFMMANGEIVNMLVHTDVTRYLEFK
                     QISASYVYRDRRIAKVPSTEMEAVRSPLMGLFEKRRAKRFFEFLQKWRDDDPSTHQGI
                     DLDSWPMEKVFAHFGLEAGTRDFIGHAMALNLEDSYMKRPARETYERILLYTSSMARY
                     GKSPYIYPLYGLGELPQGFARLSAIHGGTYMLDKPVDEIVVDDQGRFVGVRSGQETVK
                     ANLVVGDPSYFRQVGGKSLVRDTVKVVRAICILKHPIPNTDNSDSVQLIIPQNQVGRK
                     NDIYIAEVSSAHNICAPGIYVAQVSTIVETDKPELELRPGLDLLGEIHDKFVTVSALE
                     EPIDSGRDNNIYITRSYDPTSHFETVVEDIHDVWRRMTGQPLVLKKRNEEDAAQVQA"
     gene            <747811..>748329
                     /locus_tag="MRET_2086"
                     /note="MRES_08280"
                     /db_xref="GeneID:38738852"
     mRNA            <747811..>748329
                     /locus_tag="MRET_2086"
                     /product="adenylate kinase"
                     /transcript_id="XM_027628713.1"
                     /db_xref="GeneID:38738852"
     CDS             747811..748329
                     /locus_tag="MRET_2086"
                     /codon_start=1
                     /product="adenylate kinase"
                     /protein_id="XP_027484424.1"
                     /db_xref="GeneID:38738852"
                     /translation="MRHINAGPLAIQKHFVASRDAEWDSVEVDEDALLDYLESMSGGV
                     APDPIEEDPEGCAQARDMPLDSDTRGGLVLDWHTCDAWPERWVDLVVVLRCNHELIWK
                     RLEKRHYSEKKIAENNEAEIMGVVEDEARSAYPQEAIIVLPSETSDQLESHAERIVAW
                     IHAWRQQRGLES"
     gene            complement(<748394..>749251)
                     /locus_tag="MRET_2087"
                     /note="MRES_08285"
                     /db_xref="GeneID:38738853"
     mRNA            complement(<748394..>749251)
                     /locus_tag="MRET_2087"
                     /product="large subunit ribosomal protein L22"
                     /transcript_id="XM_027628714.1"
                     /db_xref="GeneID:38738853"
     CDS             complement(748394..749251)
                     /locus_tag="MRET_2087"
                     /codon_start=1
                     /product="large subunit ribosomal protein L22"
                     /protein_id="XP_027484423.1"
                     /db_xref="GeneID:38738853"
                     /translation="MLRLLASAARPAILNKTRLLLPSVRNFASTPSRAGFWDNIVPLL
                     QGNRRERQLQRKQGGLLQEDIDRVRRDQRRDELMASQSSTGDMLIDDAMDAPEFRREE
                     VQRLASEEKRQKRLLRKRWGGTSELGGMEKPEHKFSTAVFRISPRKLNMLANQISGKP
                     IDFAILQMQFSAKRAARRVRATLVMARDHAEAKGLDPRRLLVSEAWVTKGMYHKRLEI
                     KGRGRFGIMTHPQARLSIVLRPGKSHAVREREAIDKARLHARRMGSGGVVRGSPKIVN
                     GFQRPGWAW"
     gene            <749378..>750916
                     /locus_tag="MRET_2088"
                     /note="MRES_08290"
                     /db_xref="GeneID:38738854"
     mRNA            <749378..>750916
                     /locus_tag="MRET_2088"
                     /product="aldehyde dehydrogenase (NAD+)"
                     /transcript_id="XM_027628715.1"
                     /db_xref="GeneID:38738854"
     CDS             749378..750916
                     /locus_tag="MRET_2088"
                     /codon_start=1
                     /product="aldehyde dehydrogenase (NAD+)"
                     /protein_id="XP_027484422.1"
                     /db_xref="GeneID:38738854"
                     /translation="MTLVGTPTLFIDGEWCASSDGGRRPTYNPYDASVIMHVDEATSN
                     DARRAIAAAKAFFSSSDWSRRSYQDRCELLNRMADSLQKNKAELARIETIDTGKTLGE
                     SEIDIDDVTNVFRFYAKEALKLAEDKRVTGPLVPESVKSLVVHEPVGVCVLITPWNYP
                     ILQLCWKLAPALATGNVVIVKPSEVTPLSTIYLVHMMLEVGFPSGSIQLLTASGASIG
                     SVLTESPDVDLVSFTGGLQTGRSIIRSCAETVKRCTVELGGKNPNIVFADCDLDWAID
                     NVTTAVFVHSGQVCSAGARLIVEESMADKLVNGVVERAQRIVMGNGLDAASETGPLVS
                     AEHRAKIEAYVKLAQEEGAVIRCGGVRPDPVEFPHLAQGYFFLPTVLDKCDRTMRVVQ
                     EESFGPILTVERFPDGDEETAIMLANDTKYGLAGGVQSKDQARAERVARRLRHGTVWT
                     NTYGLYTAQSEWGGYGMSGNGRELGSKGLDEYIEVKHIWSESKPAMMDWFKGQGKKHN
                     TARM"
     gene            complement(<750928..>751533)
                     /locus_tag="MRET_2089"
                     /note="MRES_08295"
                     /db_xref="GeneID:38738855"
     mRNA            complement(<750928..>751533)
                     /locus_tag="MRET_2089"
                     /product="peptidyl-prolyl cis-trans isomerase B
                     (cyclophilin B)"
                     /transcript_id="XM_027628716.1"
                     /db_xref="GeneID:38738855"
     CDS             complement(750928..751533)
                     /locus_tag="MRET_2089"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase B
                     (cyclophilin B)"
                     /protein_id="XP_027484421.1"
                     /db_xref="GeneID:38738855"
                     /translation="MQVTLVRLVLAILACVSAAMALSHADAKITHKVFFDVEHGDKSV
                     GRIVIGLYGETVPKTVENFIGLVEREQGRGYKGSIFHRVIKDFMIQGGDYTRGDGRGG
                     MSIWGKSFPDENFELKHEGPGVLSMANAGSDTNGSQFFITTVQTPWLDGRHVVFGRVI
                     DGMDAVKYVESVRTGPMDRPIDEVRIFDAGILPQDESHDEL"
     gene            <751797..>753926
                     /locus_tag="MRET_2090"
                     /note="MRES_08300"
                     /db_xref="GeneID:38738856"
     mRNA            <751797..>753926
                     /locus_tag="MRET_2090"
                     /product="RhoGAP"
                     /transcript_id="XM_027628717.1"
                     /db_xref="GeneID:38738856"
     CDS             751797..753926
                     /locus_tag="MRET_2090"
                     /codon_start=1
                     /product="RhoGAP"
                     /protein_id="XP_027484466.1"
                     /db_xref="GeneID:38738856"
                     /translation="MHAYLRADSYPAQNLGASGWNKSEGSSMTPPDMSMSPSELANVL
                     LEAFNTMMSECESYVKYTEQRFRMEEDHLRHVKIMLERQRDLDMRINSKLAVLPGLLP
                     DPGRLSNLRNTWGDIRLSEMWAVDLRLNLLFECKMRVLQPIVHFHDEQERIRRRVKAN
                     LKMCVDDYDEMLNVTLPRIRRNYERRCEEHEFYRHQQQALEESRQLLASGTIASMNGR
                     SSPELPSVPGWNGDVTASSAPDFSTGNRPFLESLRKRDAWDQAPKRLNALFSRMLDVS
                     DRSPGMEAGILPSNASNGTMTPPKMPSPSAEQANVSNKALQTLAIKQAKARREMNEAD
                     QAYRKAIFDLETLRIRRNKALDAAVKSLLEWRRELSITMQKVTLEHVRRTMAMRSTID
                     SVHQQDEQLALQMLDNFEDEQKVCEKWMPNTRTLIHNERVKYVNYFHGPFNDLIFGTG
                     LVDYAFSHGDYNTPSTMTEKGLILPNVRPPLIVSKCIEFLEQPRCIRTPGLYRVSAKH
                     SRIQELTSIIEQDETSFQFDADREDPILVSSILKLYLRQLPEAVMPMKWDERVRYTHE
                     REEHIKNGFTTFKSRIRRMPPIHQATLRALLMHLSYVAAHSDYNKMNISNLAVVFSPV
                     ILSENAPRDVSLFSNSDEDTTLIDLVTFSSHIFAMPTLYQHPLPSPPSTRTSSHSNHG
                     TQMCPSIGDLDIDVISSNSSMDANHAC"
     gene            <754034..>754610
                     /locus_tag="MRET_2091"
                     /db_xref="GeneID:38738857"
     mRNA            join(<754034..754090,754117..754249,754277..754383,
                     754415..754543,754572..>754610)
                     /locus_tag="MRET_2091"
                     /product="subunit of the heterohexameric cochaperone
                     prefoldin complex"
                     /transcript_id="XM_027628718.1"
                     /db_xref="GeneID:38738857"
     CDS             join(754034..754090,754117..754249,754277..754383,
                     754415..754543,754572..754610)
                     /locus_tag="MRET_2091"
                     /codon_start=1
                     /product="subunit of the heterohexameric cochaperone
                     prefoldin complex"
                     /protein_id="XP_027484467.1"
                     /db_xref="GeneID:38738857"
                     /translation="MAAEGQVQTVDVTSLDVPQLLDVRKQLELELKQFTTMFGQLKIA
                     QARFQSCAESVEAIRPENQGKTTLLPLTASLYVPGKLSDPEKVIVDIGTGYYVEKSRP
                     EARKLYEDKVAYIIKNMEQLQETIHRKQDNLRVVCELLQVKVLQREGAQEAA"
     gene            <754709..>755874
                     /locus_tag="MRET_2092"
                     /db_xref="GeneID:38738858"
     mRNA            join(<754709..754727,754754..>755874)
                     /locus_tag="MRET_2092"
                     /product="peptidyl-prolyl isomerase D"
                     /transcript_id="XM_027628719.1"
                     /db_xref="GeneID:38738858"
     CDS             join(754709..754727,754754..755874)
                     /locus_tag="MRET_2092"
                     /codon_start=1
                     /product="peptidyl-prolyl isomerase D"
                     /protein_id="XP_027484468.1"
                     /db_xref="GeneID:38738858"
                     /translation="MTNPVVYLDIEFVGGAPPSRPGGNRVVLELYQDKVPKTADNFRA
                     LCTGEKGTGKSGVPLSFKGSIFHRVIKNFMIQGGDFTNFNGTGGESIYGEKFEDENLE
                     GKHDRPFLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVLRGKDVVRHIEQSAT
                     GPNDRPQDDIKIADCGEFSAEQLADSSFHYGIEADESGDNYEAYPEDSDLPLEEKPES
                     ALDVAKDLKAIGAKLVGQNKWSLAREKYEKALRYLFVNPYLEDKEKAFVDEYYSLCTP
                     LQLNAALCALKTEPPVADEAEALTTQVIERAGTKEADLAKAHFRRALARSAMKRDDDA
                     KADLSEALKYAPNDAGIQKEAAALEKRRQARLAKQRAAYSKMFSS"
     gene            complement(<755888..>757060)
                     /locus_tag="MRET_2093"
                     /note="MRES_08305"
                     /db_xref="GeneID:38738859"
     mRNA            complement(<755888..>757060)
                     /locus_tag="MRET_2093"
                     /product="alanine-glyoxylate
                     transaminase/serine-glyoxylate
                     transaminase/serine-pyruvate transaminase"
                     /transcript_id="XM_027628720.1"
                     /db_xref="GeneID:38738859"
     CDS             complement(755888..757060)
                     /locus_tag="MRET_2093"
                     /codon_start=1
                     /product="alanine-glyoxylate
                     transaminase/serine-glyoxylate
                     transaminase/serine-pyruvate transaminase"
                     /protein_id="XP_027484469.1"
                     /db_xref="GeneID:38738859"
                     /translation="MSSFKQADHKLLMIPGPIEVSDDVLLANAHPSMAHVSPDFVPVF
                     GESLEMLRKVADAPSSQPFIISGSGTLGWDLAAVNLLEKDDDVLVLTTGYFGDSFAEC
                     IATYGAHPTQVVAPVGSRPSESEIEIALKQKKYKAVTITHVDTSTGILMDVEAVTKIV
                     KRVSPDTLVILDGVCSVGSEEIHMDAWGIDYLLFASQKGIGIPPGLSLSLASPRAMKT
                     FASRTTPPAGFYTSWTKWLPVMKAYEARTPAYFATPPTNLIYALHTSLKTITEGPVSL
                     AQRFEKHREASQRVKKGIENLGLEQLAQPDSRQNGVANGMTAVRYPQGFKASDILPKM
                     AQRGVVFGAGLHKDAKDEYFRIGHMGVSVVDPARRDVDIILQKLEEALAEAGYQKQ"
     gene            <757159..>758364
                     /locus_tag="MRET_2094"
                     /note="MRES_08310"
                     /db_xref="GeneID:38738860"
     mRNA            <757159..>758364
                     /locus_tag="MRET_2094"
                     /product="putative methyltransferase"
                     /transcript_id="XM_027628721.1"
                     /db_xref="GeneID:38738860"
     CDS             757159..758364
                     /locus_tag="MRET_2094"
                     /codon_start=1
                     /product="putative methyltransferase"
                     /protein_id="XP_027484470.1"
                     /db_xref="GeneID:38738860"
                     /translation="MSLMREVREALELPPTSALPRLRTHPAPESILGALRRLDILYGR
                     DATLDVDASLLDELDAARADPAERSYALEWLMRLVESDMTWMEDVNVRRTAVDHAARI
                     LAGSTHALEDGDLVRDFTFPMKEHGELPPAFAADASHSSIHVSIRDASLPPSDAHSAQ
                     GAVEAAAAVGVQTYASSIIMCDLLVRCPSAWYKRLNENLPVPFRVMELGAGTGIVGMV
                     AAHVLSCIKAEKAVVHLTDYHEDVMTNLRHNVEHRLCLPNTCVHVECMPLDWRALYDI
                     VCPQHASGTAVACTPPPPQSYSLLLVADPIYDPKHAAWLVAAIMYLLAQPDTDPDARA
                     HILLPVRTAGRLAGLYATLDVSLQEHGPWQGYRLMSLHQTRLPRRPGLGRQDESEYIW
                     TELAWCAAS"
     gene            complement(<758381..>759310)
                     /locus_tag="MRET_2095"
                     /db_xref="GeneID:38738861"
     mRNA            complement(<758381..>759310)
                     /locus_tag="MRET_2095"
                     /product="actin related protein 2/3 complex, subunit 2"
                     /transcript_id="XM_027628722.1"
                     /db_xref="GeneID:38738861"
     CDS             complement(758381..759310)
                     /locus_tag="MRET_2095"
                     /codon_start=1
                     /product="actin related protein 2/3 complex, subunit 2"
                     /protein_id="XP_027484471.1"
                     /db_xref="GeneID:38738861"
                     /translation="MILLGAENEIIRHVLTSKFSVPGAVDQMFTDFDGVAYHIESSRE
                     GPLTLSMDIRCWPELVQYGARENLRQMYGGWIRETTESDFQITLSFDYASVPPAGPDR
                     DALIHAVSMIKRHAMAAPFERAFHEQSELEQKHEPGAAPLAGQLLALHYRADEAMYIL
                     PAHDRVTVVISTRFEEETDRIFGKVFLQEFVDARRQPSIQNAPQVLYSNRDPPLEVRG
                     AVQASSSDNTGYVTFVLFPRHFQHPDVRSTTITHIQLFRDYLHYHIKCSKAYMHSRMR
                     SRVTEFIKVLNRAKPELAEKERKTASGRTFRRA"
     gene            complement(<759461..>760483)
                     /locus_tag="MRET_2096"
                     /note="MRES_08315"
                     /db_xref="GeneID:38738862"
     mRNA            complement(<759461..>760483)
                     /locus_tag="MRET_2096"
                     /product="ATP-binding protein involved in chromosome
                     partitioning"
                     /transcript_id="XM_027628723.1"
                     /db_xref="GeneID:38738862"
     CDS             complement(759461..760483)
                     /locus_tag="MRET_2096"
                     /codon_start=1
                     /product="ATP-binding protein involved in chromosome
                     partitioning"
                     /protein_id="XP_027484472.1"
                     /db_xref="GeneID:38738862"
                     /translation="MWYRQLCTTARRAHENPLGLPRNNERFPPLMPRRGSGPQPKRPI
                     PNVKRVIAVASGKGGVGKSTVAVNLALGLAATSKDALGRRARIGLLDLDLYGPSIPKL
                     MHLEDLGEPELTQQHALLPLINYSIPCMSMGFLLPPQSSGSNADTPVVWRGLMVMKAV
                     QQLLFDVDWRAGMTPDADPMAPGHDSLDVLVIDMPPGTGDVALSLSQLVLVDGAVIVS
                     TPQEVALVDARKGITMFQKVQVPILGLVLNMSHFLAPDTGKTYPIFGPAHHFEALAQR
                     LDVPILGRIPLEMHLSQGSDHGTPEVLRPNDAPGSAHASLLHMARQTWTQLASADMAR
                     DRLKRA"
     gene            complement(<760568..>762541)
                     /locus_tag="MRET_2097"
                     /note="MRES_08320"
                     /db_xref="GeneID:38738863"
     mRNA            complement(<760568..>762541)
                     /locus_tag="MRET_2097"
                     /product="succinate dehydrogenase (ubiquinone)
                     flavoprotein subunit"
                     /transcript_id="XM_027628724.1"
                     /db_xref="GeneID:38738863"
     CDS             complement(760568..762541)
                     /locus_tag="MRET_2097"
                     /codon_start=1
                     /product="succinate dehydrogenase (ubiquinone)
                     flavoprotein subunit"
                     /protein_id="XP_027484473.1"
                     /db_xref="GeneID:38738863"
                     /translation="MIAGSALLRSVMRTSVPRTHTMPVSVHAHAFHASAQASRVVGTQ
                     PLRAKAMSSAPGVPDLTKGYPVIEHEYDAIVVGAGGAGLRAAFGLAEGGLNTACISKL
                     FPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPNTVL
                     ELEHYGLPFSRTKEGKIYQRAFGGQSLHYGKGGQAYRCAAAADRTGHAMLHTLYGQSL
                     RHNTTYFIEFFALDLIMEDGECVGVTALNLEDGTIHRFRAHRTVLATGGFGKAYFSAT
                     SAHTCTGDGLAMVSRAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGYLLNSEGER
                     FMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEKDHIYLQLSHLPASVLHERLPGI
                     SETASIFAGVDVTKQPIPVLPTVHYTMGGIPTRYTGEVLTQDENGNDKVVPGLYAAGE
                     AACVSVHGANRLGANSLLDIVVFGRACANHIRENLEPGKPHKELKGDNGHQAINDLDA
                     LRTADGPRSTADIRLQMQRVMQSDAAVFRTQNSLEEGVSKINDVVAEFPKVSVKDRGL
                     IWNTDLTETLELRNLLCTATQTMHSAEARKESRGAHAREDFTERDDENWMKHTLSWFD
                     EESGKVNLKYRNVISDTLDQNECKSVPPFKRTY"
     gene            complement(<763074..>763818)
                     /locus_tag="MRET_2098"
                     /db_xref="GeneID:38738864"
     mRNA            complement(join(<763074..763097,763132..763207,
                     763238..763596,763636..>763818))
                     /locus_tag="MRET_2098"
                     /product="altered inheritance of mitochondria protein 13"
                     /transcript_id="XM_027628725.1"
                     /db_xref="GeneID:38738864"
     CDS             complement(join(763074..763097,763132..763207,
                     763238..763596,763636..763818))
                     /locus_tag="MRET_2098"
                     /codon_start=1
                     /product="altered inheritance of mitochondria protein 13"
                     /protein_id="XP_027484474.1"
                     /db_xref="GeneID:38738864"
                     /translation="MWGDARDSTSVGSAASVRGRRDVQCCADLAWCHRDCSDAMGFFS
                     SFQSASKAPGESIDTVEVGRTLLNKLEEAKPDLAAPAPEASRQSVLDENVQKKLKEEL
                     AELRKQEKDVQKQIALALEKENLERESSSWLSKDKGQSSQLLQQELDRVKTQIEKYNR
                     RDMASFPEVVKARQAVVQCYRDHAGRTLDCWKEVEQFKNAFAEAEKELMAAWK"
     gene            complement(<763844..>765061)
                     /locus_tag="MRET_2099"
                     /note="MRES_08325"
                     /db_xref="GeneID:38738865"
     mRNA            complement(<763844..>765061)
                     /locus_tag="MRET_2099"
                     /product="zinc finger protein, C2HC5-type"
                     /transcript_id="XM_027628726.1"
                     /db_xref="GeneID:38738865"
     CDS             complement(763844..765061)
                     /locus_tag="MRET_2099"
                     /codon_start=1
                     /product="zinc finger protein, C2HC5-type"
                     /protein_id="XP_027484475.1"
                     /db_xref="GeneID:38738865"
                     /translation="MSLSPEHALGDMLGLDFTTVSEQIMPYLSSHKSPKALRAYLHEL
                     IGTSSQAHAITDALVASRFPPSPVPRKDDTKKPIRITPASVKSALAEAEERAQPRTLE
                     PTPEIKALDAAFSMLSTEPSSPAASVHAPQKRCMCLCQGRTHPLAEWAPLCFACGLVL
                     CSAIRPVPVSPYSTCPSCQTSPIVPTKHRTRLLNDMVHLREELSQEQAYQEAQRQAER
                     NALRASGRTPEQAFPTLQGMPAPPPSAPPKQRSRTLHLDMKTHKVTVSKPRSRPAALT
                     KPKQDSDDGVQTLAEDGSLLVHDVDDDMFRSRMSSITRKVSPSHERWQDIPTPVTCVY
                     VPASHRDERLKAFESHELTQVPDLDILLQRKPPGSAASLQKQNRKNATDAAISRSQGR
                     KTGKPGRRRRPGP"
     gene            <765113..>766627
                     /locus_tag="MRET_2100"
                     /note="MRES_08330"
                     /db_xref="GeneID:38738866"
     mRNA            <765113..>766627
                     /locus_tag="MRET_2100"
                     /product="F-box and leucine-rich repeat protein 10/11"
                     /transcript_id="XM_027628727.1"
                     /db_xref="GeneID:38738866"
     CDS             765113..766627
                     /locus_tag="MRET_2100"
                     /codon_start=1
                     /product="F-box and leucine-rich repeat protein 10/11"
                     /protein_id="XP_027484054.1"
                     /db_xref="GeneID:38738866"
                     /translation="MKTGAAAPGRGVPHDMRDESCPACAESVSDHQNDVDTWIACSHC
                     GTWYHVVCVRLTNWDDYDKWYCQTCRDSLPLEPKMRAPRRRSHRARPTTDYAAVQEGK
                     PSDPIGRWTSLLAQYKDWPVRVLRVEGSTWTSQWLSTSLEPLISPTLVPAPATQDLDN
                     PASHIPGMRMPPRHTTIRDVAQLVGPDTHVEVIDVRTQMSSRAWTLSMWADYFETPAA
                     KRDKLLNVISLEITGTAMQRMVEAPAMVRENDWVERDWPMHRRPCHADDEARKWPKVQ
                     RYVLMGVQGAFTDFHIDFAGTWVYYHVVWGHKMFLFAPPTSANLASYKAWTLSAQQES
                     EWLGDRLQQLTKVEIRTGETMLIPPGWIHAVYTYQDTLVIGGNFLTDHDVAMHWRIEQ
                     MEGATHVPRKFRFPHLVRLAWYVAYAWHKRLSHGTSAPPPRVMEGIAQLCKRLEQDVA
                     KMETLPSASKGYKAAWDAVPRDVIRDPRALLQEMQAHCKSHNVPHKRQRRHYEG"
     gene            complement(<766630..>768777)
                     /locus_tag="MRET_2101"
                     /note="MRES_08335"
                     /db_xref="GeneID:38738867"
     mRNA            complement(<766630..>768777)
                     /locus_tag="MRET_2101"
                     /product="THO complex subunit 1"
                     /transcript_id="XM_027628728.1"
                     /db_xref="GeneID:38738867"
     CDS             complement(766630..768777)
                     /locus_tag="MRET_2101"
                     /codon_start=1
                     /product="THO complex subunit 1"
                     /protein_id="XP_027484055.1"
                     /db_xref="GeneID:38738867"
                     /translation="MSGVKEAVARVSDALDACIPQMQDSLQRRKEALRVPRLDVHTSQ
                     AELESCMQHDLPQIYERAHKACVDARSDADKPGLWEEVLTSCISSKMHTYIRAYASVE
                     DAVDRLDMALYLARHHMADASLPLSSLEEVLDESTVSACDHLFAYAELRAPVLTQDMV
                     PTSGKGLVLLRIGNKLLRRLSKTHRGHAVLAGRVLLLLSSTFAVNERSGVNLKGEFGP
                     NLLEPPPVATGDAPSSTAPDALMMHPNFYVAFWAMQAYFMNPACLWQQDEVPPGAQAL
                     EALTLLSSDSFTPMKTFQVGIQCVLDVFRWLHKRTDASAKAHTGLFHETEMASAYPQY
                     LTHQDLFVYELQNMAFQRQFLMQCLITFQYLLGQTSASHEHCQAWKNQLLVPPHTLCD
                     ADEQWVRKTWRQVQTLLRDSAKDGKVFLDAALLLLRRESSWIRWKGDGAPSFYHDMFP
                     ADTLQACSDKIATVFSVQEPWYPHAVGTAELSRLWANGLHIPAPSRVEVQDEEGQTKS
                     VTTDGWEDLEFPPNRPSVQALCRMMEHSSDADKKQGLAWRALRCVGREHLHLLACMTS
                     LDDIPSLLQVMDDEKKGVPYESEHMGQEPMADEDIPDEDMPPAHEETHQEPCPEEGPQ
                     EETFDEAPPEAPADGHEDSTQDTLEHADHDQADDDASHQETAPKDVEDAPSSVLSSSS
                     SSPLSSSGDADHGDADATFMTAPAPDVPSSMDI"
     gene            <768914..>769506
                     /locus_tag="MRET_2102"
                     /note="MRES_08340"
                     /db_xref="GeneID:38738868"
     mRNA            join(<768914..768938,768967..769119,769146..769282,
                     769315..>769506)
                     /locus_tag="MRET_2102"
                     /product="RNA-binding protein 8A"
                     /transcript_id="XM_027628729.1"
                     /db_xref="GeneID:38738868"
     CDS             join(768914..768938,768967..769119,769146..769282,
                     769315..769506)
                     /locus_tag="MRET_2102"
                     /codon_start=1
                     /product="RNA-binding protein 8A"
                     /protein_id="XP_027484052.1"
                     /db_xref="GeneID:38738868"
                     /translation="MDDERMDLDPSIRRRGRGFDMNGASEAEGVKSQGFEQLDVDMDQ
                     ADDDAPVAGHGHPAQSMEGWVVVVSNIHEEALEDDVLDVFSEYGKVRDLHLNLDRRTG
                     YVKGYALLQYKTKAEAQRAIDACQQGLTLLEQALDADFAFVQPPAKTDARVPRRTTRD
                     RSLSPMRQ"
     gene            <769796..>770272
                     /locus_tag="MRET_2103"
                     /note="MRES_08345"
                     /db_xref="GeneID:38738869"
     mRNA            <769796..>770272
                     /locus_tag="MRET_2103"
                     /product="small subunit ribosomal protein S27Ae"
                     /transcript_id="XM_027628730.1"
                     /db_xref="GeneID:38738869"
     CDS             769796..770272
                     /locus_tag="MRET_2103"
                     /codon_start=1
                     /product="small subunit ribosomal protein S27Ae"
                     /protein_id="XP_027484053.1"
                     /db_xref="GeneID:38738869"
                     /translation="MQVFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKVYTTPKKIKHKHRKVKMAT
                     LKYYRINDDGSVKQLRRECPSPECGPGIFMAWHHNRQYCGKCHLTYLFQEGTTKPE"
     gene            complement(<770387..>772153)
                     /locus_tag="MRET_2104"
                     /note="MRES_08350"
                     /db_xref="GeneID:38738870"
     mRNA            complement(<770387..>772153)
                     /locus_tag="MRET_2104"
                     /product="dual specificity kinase"
                     /transcript_id="XM_027628731.1"
                     /db_xref="GeneID:38738870"
     CDS             complement(770387..772153)
                     /locus_tag="MRET_2104"
                     /codon_start=1
                     /product="dual specificity kinase"
                     /protein_id="XP_027484050.1"
                     /db_xref="GeneID:38738870"
                     /translation="MATVVPRLKKRRISPHASGDATSPSTSQRGMMDASYMPMSSPMH
                     DVSMYYSVPSSDIHASSYPVASSSDVMLNQPPPSAPSHPRPRMCVHEIINGQEQPVYV
                     VSDDDDDDGPPPASPLQGHAPLTSTRPAINAGSKRKSPVPWEFTEAMPMKRQRRNDVP
                     GAPVDSAAAPLSQLPSLASLASVSAPTAVPVTGPAQMPPPPGMPELATSFETTHPDAW
                     RLRCSGPDMPRANFTAPLDDKDGHIIVREGEFITPRYQIRSLLGQGTFGKVVQCYDRK
                     LGKNVAIKVIRAVQKYRDASQIEIRVLQCLRQHDPLNRYQCVQLLESFDFRNHICIVF
                     DLLDCSVFDFLKNNKFQPFPCRDIWLFAKQLLRSVAYMHRLSLIHTDLKPENVLLVDA
                     SSDVASTSRRSNARKKRVLRSAEIRLIDFGSATFSNEYHSGVVSTRHYRAPEIILGMG
                     WSFPCDVWSLGCILVEFYTGEALFQTHDNLEHLAMMEMVLGKLPDDYRRKAETYKPEY
                     FYHGRLDYPRPDTSKQSRRFVQSMKPLQDIVASPPAYAKHHHAFVSLLRRLLEFDPAK
                     RITVEEALSHPYFQLDPHDFPP"
     gene            <772449..>773450
                     /locus_tag="MRET_2105"
                     /note="MRES_08355"
                     /db_xref="GeneID:38738871"
     mRNA            <772449..>773450
                     /locus_tag="MRET_2105"
                     /product="DUF1713 domain protein"
                     /transcript_id="XM_027628732.1"
                     /db_xref="GeneID:38738871"
     CDS             772449..773450
                     /locus_tag="MRET_2105"
                     /codon_start=1
                     /product="DUF1713 domain protein"
                     /protein_id="XP_027484051.1"
                     /db_xref="GeneID:38738871"
                     /translation="MRRNVLSMRMHHARAAISAAMATRCMAAPHRTAASSAAVAAATQ
                     VRGGVHLAKPVSLPRANPPPTSERSLGLQRLYAQHRPLLEHEQLPARPVRMMQGDVLV
                     IEADDLAQVMPQRSIWRRRARRVDTDTFSHLLDRLSQLSLSSRKSRIARRVRSRGFTP
                     SSPAVLAASQYVERMERDAEIRELVMANAIEQGEDVERAARLGSEAELVVLGEPAGAH
                     KDWAPGVATHLDTHTQPYVPPQSGSAAPTRRVRVRSIDADAAADEDAHLWLMQGLVQT
                     RLRADHEWRTFVASKLGEAPYSVSLDSVRRKRRKKMNKHKYKKLRKRQRAERQRLKK"
     gene            complement(<773486..>774787)
                     /locus_tag="MRET_2106"
                     /note="MRES_08360"
                     /db_xref="GeneID:38738872"
     mRNA            complement(<773486..>774787)
                     /locus_tag="MRET_2106"
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /transcript_id="XM_027628733.1"
                     /db_xref="GeneID:38738872"
     CDS             complement(773486..774787)
                     /locus_tag="MRET_2106"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /protein_id="XP_027484048.1"
                     /db_xref="GeneID:38738872"
                     /translation="MSSLARGMSMPVRVCMHRGMWQHAAISTARAAPAVQPLERLGSV
                     ASVAVHADGTPVAVPAPAEDVRRMRSRRESRWLKKQQKLRVRENRKKNTIAARLGIEE
                     NKVSPYVRTDQQFKMFKPITPSIRWLRYPLNPHLHRGKPVRELTVAQRKSGGRNHHGH
                     ITVRGRGGGHRRRLRLVDFYRWEPGEQKVVRIEYDPGRSAHIALIEHSETKRLSYILA
                     PDGLVAGDTVESYRHMMQHKQQQHSDDTVNLGIFRTQAIRPGNVLPLRMIPIGTTIHA
                     ISLLPLGPAKLVRSAGTFGQLVTFSSLRKNVETDENADLAQQHTHAQVRLSSGEVRMV
                     PIDCCAAIGTVSNKDHQHARLGKAGRSRWLGRRPKVRGVAMNPVDHPHGGGRGKSKSN
                     KHPRSIYGFPLKFQRTRSPNSRNGNRMVVRPRPRRNGKRTG"
     gene            <774841..>775454
                     /locus_tag="MRET_2107"
                     /note="MRES_08365"
                     /db_xref="GeneID:38738873"
     mRNA            join(<774841..775280,775306..775408,775434..>775454)
                     /locus_tag="MRET_2107"
                     /product="S-phase kinase-associated protein 1"
                     /transcript_id="XM_027628734.1"
                     /db_xref="GeneID:38738873"
     CDS             join(774841..775280,775306..775408,775434..775454)
                     /locus_tag="MRET_2107"
                     /codon_start=1
                     /product="S-phase kinase-associated protein 1"
                     /protein_id="XP_027484049.1"
                     /db_xref="GeneID:38738873"
                     /translation="MTSRDEAVARTPRRSSRGVLPPRPRCLGVMVLISTSDNEQFSVD
                     RDVAERSLLIKQLIEDIGESDQAIPLPNVSSSVLTKVLEYCSHHRNDPLSVADEPDEI
                     RRRATDISEWDARFIQVDQEMLFEIILAANYLDIKSLLDIGCKTVANMIKGKQPEEIR
                     KLFNIQNDFTPEEEAQIRRENEWAEDR"
     gene            <775643..>780961
                     /locus_tag="MRET_2108"
                     /note="MRES_08370"
                     /db_xref="GeneID:38738874"
     mRNA            <775643..>780961
                     /locus_tag="MRET_2108"
                     /product="SNF2 chromatin remodeling protein"
                     /transcript_id="XM_027628735.1"
                     /db_xref="GeneID:38738874"
     CDS             775643..780961
                     /locus_tag="MRET_2108"
                     /codon_start=1
                     /product="SNF2 chromatin remodeling protein"
                     /protein_id="XP_027484046.1"
                     /db_xref="GeneID:38738874"
                     /translation="MSGSMPATRLDRLVSLLDIGSSSLIRTTAATQLGQIAALRVRGA
                     STAHEGASSSEPAVYRGTDGEWNEVLTLLARVVPLLLSKNWDTRMAAAQAIYHITQAA
                     GVWDPDTGTERHVSAPIKAEETPSLGEADRLQFASFSLPHVLQTGTKLLASVGKEYDV
                     PELMSRERLQHAKKDVLGKLGLGFGADDMDMGIDMDAELAGSKPAPKPAPAPEPEPGA
                     DRALSARERNQLKRKRKLEAKAQTRAPVAHVEPEKRAKLDSTAQASDKAAAVFSLQTQ
                     RGEWPFRALAELLSVELVSPTWEARHGAALGLRELFRTQGYGGGRVMHASKQDNDERH
                     AVWCENLAVRLLCVFALDRLGDFVFDHVVAPVRETASQTLAQLLPHMTNELVRSTHHV
                     LLEMVRQDSVREAQLVGREGQRPYIWEVRHAGLLGIKYEVMMRVDVLGVEDDMLSDVL
                     DVAQLGLRDNDDDVRAVAAAMLLPITSNIVSHQLARVSDLLDQLFVCVSDKRDDLSSS
                     AASVMDLLASLMSHAEVLGIIDVASLAQRVTMLFRFFRHTITNVRLSMLNAMHALLQC
                     SSLPHDWVTDDLIRLLLQNMLVEERAPIREATARVWSQALQVLGPRAAQLAAPHFPAL
                     LALVMTPIGTPMDTSLFYVPPRARSEHNIDRGILAQDLTLVSTDTVLRGRLGAASALG
                     DLLALAPPSSETCKLLQEALEARSALQKCLGAVVAQRWAECVPSVSELLAIDAVRGVH
                     ATLLQLLDTSMPPIYTEMHVLLQRMQHDCHVLGQMMVRDAHIARDRVPAVSSPCTTAD
                     AQRLAETAATLAPSCTTVVEQSRKIQRAIEQYDATKETQDVLVLAAVAGAVVAWGVLP
                     PKLNPLIRSLMNSIKYEENADLQARAACSIARLVRLCTLPTAHANPSAKIVKNLCAFV
                     CQDTSITPLFVETKGEREGTGALPVAPPSERRASAEPETLTPSRLIRRGAECALMHLC
                     QQFGAQIWDELPILWTSAAEPLLHDAPMDDARGQALLDACSVLECIAPHVHTDLHESL
                     ASLLDALVRVSQNEFRVLRGASARCFSVVTKCITDQGMHALVEQVVPVLGSAELLCRQ
                     GAMEVVSCTVRVQDERLLPYVLFLVVPVLGRMNDSDESIRLLATNTFAELVKLLPLIH
                     GLPDPPHFSPALLARRETEKAFLAQLMDGSKVAPYKMPIEMKVQLRPYQMDGVSWMAF
                     LARYQLHGILCDDMGLGKTLQSIALLSCKHHERHERWEQTQAPDAKRIPSLIVCPPTL
                     TGHWVHEIETYSPNLTALLYAGHPSDRARLKAQINQVDVVVMSYDVVRNDVQDLASRS
                     WFYCILDEGHVICSPKTKTTRSVKQMRAQHRLILSGTPIQNNVLELWSLFDFLMPGFL
                     GSDQSFHERFARPVLACRSGKPSAAEKEAATLALEALHKQIVPFLLRRLKEDVLDDLP
                     PKIIQDVECELSDIQKQLYDDFVKATDDDDEEEEEDKKNNTEPKEQQHIFQKLQYLRK
                     LANHPSLVLDAAVPAQKKLLEQVNANRGTLAGLSHAPKLQALRQLLLDCGIGHDTQAN
                     DAALIGADTGASVSQHRVLIFCQMRHMLDVIEQDLFRPLMPQVTYLRLDGTVSSDRRH
                     SIVQSFNADPSIDILLLTTSVGGLGLTLTGADTVIFVEHDWNPMKDLQAMDRAHRLGQ
                     KKVVNVYRLITRNTLESSIMGLQQFKMNIANSVVTQQNKSIDQMDTDRILDLFGPSPP
                     SDAQAETKPPPVKGISQKALLASLEHMPDMNEDEYADMKQWRPSAS"
     gene            complement(<780963..>781919)
                     /locus_tag="MRET_2109"
                     /note="MRES_08375"
                     /db_xref="GeneID:38738875"
     mRNA            complement(<780963..>781919)
                     /locus_tag="MRET_2109"
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 1"
                     /transcript_id="XM_027628736.1"
                     /db_xref="GeneID:38738875"
     CDS             complement(780963..781919)
                     /locus_tag="MRET_2109"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 1"
                     /protein_id="XP_027484047.1"
                     /db_xref="GeneID:38738875"
                     /translation="MSFVSRLGQALRRSLLGVKNDTARIMRMEVSAMEHATDSQLLYK
                     LATPADLEQMATGADSDIGGLSRCHFSLERETLEGKVPSVFGRFYGTLSSQIPRGSSL
                     ERSGYAAFRNKTRPTLFSMQTWDTSFHPYLAILVRNRLASSSTPSSPSLRSALHANDQ
                     TGPAIPRAVEALGLPYGNVPARSPDPPLFFVNIQTDGPVTTDLYQHRLFLDESQGTNW
                     QTITIPFDSFVLTNLGVVSDLQVSMLREKILTVGVSALVDPPLLPVREEGEPEPATAP
                     ETLGALRREPSRGGKRDTLVKFDLDIAGIWAVASPVDAMQLL"
     gene            <782048..>783493
                     /locus_tag="MRET_2110"
                     /note="MRES_08380"
                     /db_xref="GeneID:38738876"
     mRNA            <782048..>783493
                     /locus_tag="MRET_2110"
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM44"
                     /transcript_id="XM_027628737.1"
                     /db_xref="GeneID:38738876"
     CDS             782048..783493
                     /locus_tag="MRET_2110"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM44"
                     /protein_id="XP_027484731.1"
                     /db_xref="GeneID:38738876"
                     /translation="MITAAGRMPITHIVLKRALHSTARCENIPRSPFQVFVDTLRQEL
                     TKSREFQDNLKQLQGESAKFQDSETMRKAREAYERARIVSSIKHNPRLQAAAEQLRKN
                     GGQISAAIGTTLRQMEESELMRSLSAMSSRIRRQLEESTAPVRNTEVYKAFAETINEA
                     FDDGNSGIDIRLAQGTSAADARRIKRELRLRKIGRRPPVHDVEAEPVDPIVAAAAAAG
                     EAAGRETSGAEAPADQPPPAPKRLGGYAVMNRVNENANAGSDLVLAPESAQGSRWEKF
                     TQQSPIMQRLSEWHEQYQDSENPFIERLRGVTNRVASWFEENETAQVVRSIKQLDPSF
                     TLAGFTTELREYVVPEVLDAYHTAQRNLLRQWCGEATFNVLMATLEPYMKRGYVADGR
                     ILDLSSVDVVQGKMLETGPMPVLVITFQTQELMYFKDPKTGEIIDGSVEQAIQCRYAM
                     VLTRVESELENEITGGWKIIELARRGQTAFM"
     gene            complement(<783505..>785202)
                     /locus_tag="MRET_2111"
                     /note="MRES_08385"
                     /db_xref="GeneID:38738877"
     mRNA            complement(<783505..>785202)
                     /locus_tag="MRET_2111"
                     /product="CCCH zinc finger and SMR"
                     /transcript_id="XM_027628738.1"
                     /db_xref="GeneID:38738877"
     CDS             complement(783505..785202)
                     /locus_tag="MRET_2111"
                     /codon_start=1
                     /product="CCCH zinc finger and SMR"
                     /protein_id="XP_027484730.1"
                     /db_xref="GeneID:38738877"
                     /translation="MATSSGHAHVRAYLHSLLGRQLDKKEYMDAENALLAQLDRMRDG
                     DDDDACMALHEVLRVHMQRLRPISEAELDAAALTLMLKHRDDTMRTSTVIRSTPSSTT
                     SSPYTPPADARHANELRPPQPIKVSAPDTFPDDEEDEFSPFAPPSASALYQGAASAPP
                     LSVPDMSALSLHAEASAPMLTPLEVFCSVFVAHNQGLFPDEPDAPHRFQRASLMIQHA
                     LDISHYDISAALQIVKQAHDAGVDIMDMQPPDSAGSDDPTTRVCRFFLAGECRRSDCR
                     FSHDLNKALCRFWLRGQCLNDPCLFMHDYEALSMLAQSIVVAPAPPEPEPEPSWIPPR
                     PKPDASQTPWAMAAKSAPASTTPKVMPRGSTSTVSSKRLALRPPSLLPTLSTGSALAI
                     DMGKVRASQPRHQDRWKTIEALLHARHERLRERLQVGAGGDAGGWGSSAQASQERGSR
                     GLRGRWMGAGLGLCLGVAKPQVAGASLSLDERTEAVLDLHGLHVDEALEACEQFLLAL
                     ESEGFRGLAYLCVGAGKHSVRSRGKLASSVREFLQSWGYPHADYDGVLACDPCTHLS"
     gene            <785309..>787102
                     /locus_tag="MRET_2112"
                     /note="MRES_08390"
                     /db_xref="GeneID:38738878"
     mRNA            <785309..>787102
                     /locus_tag="MRET_2112"
                     /product="RNA polymerase II-associated factor 1"
                     /transcript_id="XM_027628739.1"
                     /db_xref="GeneID:38738878"
     CDS             785309..787102
                     /locus_tag="MRET_2112"
                     /codon_start=1
                     /product="RNA polymerase II-associated factor 1"
                     /protein_id="XP_027484733.1"
                     /db_xref="GeneID:38738878"
                     /translation="MATRRKRDLIERVRYPNPLPALPHAPRLTRIPEPEPNYVSPMYL
                     QRMAESLQLPLTVDAEAGMPLDLARLEYLWLEDGTHPSEMDGVLEWDKLDEDDAFLLS
                     EAGMQPAEAEDLAPQSTAQAQAASVTWLRRTEYLGAEQRKQKAEAKAEHEAPSHDTSR
                     PAQIERILHGFDAANAPLATLRHPSKPHVHAVEAYELLPDPETWTTSFQVVRFASALG
                     RANDPRWDAAMLRPVTDPITGKQRVSMYLTCADTLPQYGEPDVVDAEELDAETQQRRQ
                     DTAAARFKKRRRLGTYPRVPWLDGEDGGDANVYGTGFRHVRDFEPMEQPVPTDHLLAV
                     VMDDEKPDAAPELAHVQADAPISAQDEEEDLFGDEDESQKDVSTTLPPQSEAERARQQ
                     HVVAPASQGRKVAYYHHIDMRYGLQIRRARKTEQRLLVPYEGFWHRMIVGHRPMTERE
                     LTKRLFLRDGVDKLNLEGLEYVESESEDEAEAHNQEEGHGAPEEDNDQEDGRGAPEEG
                     EEALMEDAAVHVQEREETGHEGPEETKEDEGEEREEEEDGQGETADEGGEDDADEEAD
                     LEVDADELADLQAEADLHPDDMPTEGRRRHT"
     gene            complement(<787113..>790454)
                     /locus_tag="MRET_2113"
                     /note="MRES_08395"
                     /db_xref="GeneID:38738879"
     mRNA            complement(<787113..>790454)
                     /locus_tag="MRET_2113"
                     /product="PAB-dependent poly(A)-specific ribonuclease
                     subunit 2"
                     /transcript_id="XM_027628740.1"
                     /db_xref="GeneID:38738879"
     CDS             complement(787113..790454)
                     /locus_tag="MRET_2113"
                     /codon_start=1
                     /product="PAB-dependent poly(A)-specific ribonuclease
                     subunit 2"
                     /protein_id="XP_027484732.1"
                     /db_xref="GeneID:38738879"
                     /translation="MTEWTQRAHVLADHAVSGVLGHVSSLHFDTMSELLWVGSASGQL
                     TSHTGALPTLPRYTSLAAHGVPKQPRHVRGILSDDKFIISLSEGRVCASQRQGLGRWS
                     MQIEDHAPGVALAGLCASPQSASSDIIVGGAAPNSHDALFALHSISGRVVRSAVSDGT
                     VTQLRKGSRYLCVGTEQGTIQLHDPRSLRAEHKLPAHHGGLIDLQTDGHLIYSIGWTL
                     RQGRRIPEPFIKAHDVRTMQALIPTPLTAPGGPALLAIHPKKSSIVAVATPQSQFQLV
                     DIHQPGQSQFYSMPSAALITALAFSSSAEALAFGESDGSVRVWTSDAHANTLRINAYP
                     TPPVSMPDYAPPPPVMEWTDDTPLSCIGMPHYDKPLLSRINYDALWSDASPLFSIRAP
                     VRPDALEHAQHIRGLTYAPLPRHLRGTRNRLVPSDPVLARLDRHGKLTPAARMRLRQT
                     QHGAVRRIPPPLSARHTEPMPDYYGHLSIPYSRFGVEDFDFASYNQTRYAGLETNIGA
                     AYANSYFQALHYTQPFRAFAKQHTIMPCADDDCLLCEAGFLFRMLEDAHGTHCQATQL
                     LRVLTRSPQAALLGLLDESNAPYSHMAQTLNHFFLECASQHALRTSTSAALDRAFLPL
                     CVNPCAWSLLQYSTCHACGHTTARSQLAHVVDLLYPTGAAPHTYDFATLLSASMLRET
                     FFKSTCRQCYTRFAPHNTWRSAASTHALPAVLCVNTCIDGAEQFHHWEPTDHGFVPLR
                     LAMDVEHGYVHAQSVWDASAPWPRAGTACYMLRAMVIQAQGARDAPHLCALVRAPNDD
                     DAPDAWYVFNDFLVRPITEAEALRFGEPWKVPALLVWERVDDVAESHAKHLADLARHL
                     RPDLSLLLQDTHISQHRRDDLCRHRILSESELPKPGTLVAIDAEFVSLAQEELEVFSD
                     GTRTLIQPSSLALARVSVLRGEGPREGEPFIDDHIWTTEPIVDYLTQFSGIQPDDLDP
                     KRTQRTLVSHKTAYKKLRMLTDLGCRFIGHGLAKDFRIINIFVPPSQVIDTVQLYHSP
                     AHPRNLSLRFLSWFLLKKDIQQGLALGVEQHDGHDSIEDALAALQLFRKYEQFERDGR
                     LEDMLEDLYEIGPRVNWRPPEKIAS"
     gene            complement(<790548..>791165)
                     /locus_tag="MRET_2114"
                     /note="MRES_08400"
                     /db_xref="GeneID:38738880"
     mRNA            complement(<790548..>791165)
                     /locus_tag="MRET_2114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628741.1"
                     /db_xref="GeneID:38738880"
     CDS             complement(790548..791165)
                     /locus_tag="MRET_2114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484727.1"
                     /db_xref="GeneID:38738880"
                     /translation="MTAFRATALRWQAQRGMPEALMDRFAQWSASARARCSNVSTAPG
                     QAPVSDVARKAFQHWRHEETGHWQPPKYSLRRQAQLVRASFQTGREDQVRLSPKFERY
                     ARRINDMPRHEVITGWSTHIAWPTLSAEEDEKEAKRIAQTYGSHGPYAGRSSARMFKG
                     HKGERASLARRRRVHENMSTMEATIAEWRREKAAERAKLKPISPL"
     gene            complement(<791266..>792258)
                     /locus_tag="MRET_2115"
                     /note="MRES_08405"
                     /db_xref="GeneID:38738881"
     mRNA            complement(<791266..>792258)
                     /locus_tag="MRET_2115"
                     /product="SRP40, C-terminal domain protein"
                     /transcript_id="XM_027628742.1"
                     /db_xref="GeneID:38738881"
     CDS             complement(791266..792258)
                     /locus_tag="MRET_2115"
                     /codon_start=1
                     /product="SRP40, C-terminal domain protein"
                     /protein_id="XP_027484726.1"
                     /db_xref="GeneID:38738881"
                     /translation="MGKAWILGFLAMLGAGSAYLEPELMESSMSNSTEVLLGKRSAYS
                     GMATWYDVETWKAGACGQDIDNSMHIVALNEPMYGSLNERSSWCGKKIMIANGLKTAK
                     AVIMDACPQTKQCHHGALDMSMSLFQEFHHLVLGVFPITWWTIDDDDDHPSHPPEKTS
                     SHSHHDNSTRSRSDSSSSHSSTPSSSTSSSSFASSSSSYPTSSSKSDGNAASRSSARS
                     AASASAASARARAASIAKKQSLSKASARSASSASQEMAASSHASSHGSQTHATTSSSS
                     SSSSSGGRTPHQDTSTSKSTSNDDDPRAGNLENFVKVLNGLSMLVHAAAHDEQE"
     gene            <792861..>794597
                     /locus_tag="MRET_2116"
                     /note="MRES_08410"
                     /db_xref="GeneID:38738882"
     mRNA            <792861..>794597
                     /locus_tag="MRET_2116"
                     /product="sugar transporter"
                     /transcript_id="XM_027628743.1"
                     /db_xref="GeneID:38738882"
     CDS             792861..794597
                     /locus_tag="MRET_2116"
                     /codon_start=1
                     /product="sugar transporter"
                     /protein_id="XP_027484729.1"
                     /db_xref="GeneID:38738882"
                     /translation="MKFYELPSIPGSSRIRGWSLTAFCAFVCASGFLLFGYDQGVMSL
                     LITEPMLATSMPKIASYSPNGANQEEYYAKHNDDPVEYHPEAFDANVQGAVVSCYELG
                     CLIGSGFVLFKGDTLGRRWCVVIGSIIMIIGTIIMVADDHMSTFIVGRIIAGVGNGLN
                     TATIPMLQSELSRPQYRGLLVFIEGALLAGGVMLSYWIDFGFFFLKFNSVQWRFPIAF
                     QIVFAMILLFGVLVMPESPRWLVKKGRKEDANKVLSQLYDRPLDDAEVQQELNTLMDT
                     IRKTEMDLGPFKLKELVTNGPHQNFYRLLLGCGSQCMQQWTGINNLTYYASTVFKMVQ
                     PDDVASRALVASSGILYFIAASCAIFFIDIAGRRMLMIWCACGMMICFAIIAGMVQMV
                     KHPEYTPGGDTKSYGKVAEAFIYLYFIPWSLGWLGMTWLYPAEINPIRTRAPATALST
                     CTNWLMNFTVVMISPPAFENLEGHTFTMFGAFNLIFMPIVYVFYPETKRRGLEEMDLF
                     FADAHKEGFWKASRFQTTAVYLSVTRPYLTSEEVDAIISQREDLGGSRFNKPAITNDL
                     DAIEPEEEGLQA"
     gene            <794896..>800499
                     /locus_tag="MRET_2117"
                     /note="MRES_08415"
                     /db_xref="GeneID:38738883"
     mRNA            <794896..>800499
                     /locus_tag="MRET_2117"
                     /product="proteasome activator subunit 4"
                     /transcript_id="XM_027628744.1"
                     /db_xref="GeneID:38738883"
     CDS             794896..800499
                     /locus_tag="MRET_2117"
                     /codon_start=1
                     /product="proteasome activator subunit 4"
                     /protein_id="XP_027484728.1"
                     /db_xref="GeneID:38738883"
                     /translation="MDVDFLTDDPLDDVKWPIQHLEVTPRFLHWLPYRSITQVEYDAL
                     LVRALENLSRSVQTEQWGTNLMEWCQYLKYLFALKYPMSLALRARMARLFYELAVMPK
                     LDASLTEMAATICVHLLSPKQQISIKDLELPWKPLYHVLEHAVRHKQRRIGSSSIAGV
                     LLDLAECCQRFFPASEASAMLEAMLPNLDGHDLNSVISVQALLVHFLPLSKPDEWLPA
                     LFQLWATFKSSLFDDQMLDLLARLTELHVTEPHSTSKWSETGIFSDEQFALIMTKCLR
                     SAGLPVGVNKTANAALMAQSASVRAGADATASQKTLRMKKPSDRLHSFALILVYSIAC
                     DDPNVSSFGGSKALAHLAQFVQATEMYFHPSNWGPWQEQLATFVQHLTWTFARRVKAE
                     KQDDCRTPAEWRITPRIQEEFVRILRTICLLSLFSKDPVTSLSTQSSLKRMAFLQPEL
                     ILPAILQRSYNSLEALETTQRTGVVIAVLATTSQPMLSRSLYAAGAKHLAPLLHLCLP
                     GIDMNDSMKTMSTCMFILSASISLVISDASMNMDDYDDETLIRVDDESVSTLSAEDYA
                     ARLSTADLDAWSTEFIRRVLALFAALPEEGKGGKIGEKNEEAVLNMLIATCDAFCSSL
                     GEEAFLRCFDLVLDYVRTTTAANGVKVVGSLIGCFARANSSVVLQHIIPLSCERIKAE
                     LEHGASSIRTTTTSVPCPQDTTLHWHINVLSNAIMFSGSALLPYRQEILSIMALLIDN
                     CRSERAYVLNGKFVQRVLTALVHTYPSEQRCVNPDEWDSDVRRFHSHRLFGRLYTQDQ
                     VTVSWHVPSKDEVDMAVEILEKVISPVLDRLDALFASSSLTHDEVWHNDVCRYLHVVR
                     YALAGQVDLASDAYYRQSVVPTEDMDDMDDVDPSTRVPPMDMGQGMAAITPSDPRFTC
                     VMAFRERVGTLLQRVSEVVLTLSADHVDAMKQVVRALRTYLVPHSAHTEEVQGLAKSV
                     AFFRTIGRRWAKQQRFPRILWIRRAMLYHVTRQRLQYLYLGRTACDNALILWLERLCT
                     SHYVPVRRIAQTTLESVCTMYRGTRWLCLPSLLEHLSPTASDEQVKGALYVLAAKSFQ
                     RTIVRNPRFTRPVLRALFCLQSRSRPSIQKLVRSILSDLASKLVDPAMFKAYFPLPSL
                     HDVASTFMTVPQRTETPRMAWLQKANASVAALQRDMLELLKSPKTHWAFAQLAMRVLR
                     AVLSRDQPVQPAIAEHVARLAISDDPGMRLHAQTTLVHILYLSKLQSFTDGIDLYLER
                     MHQPLKHCEPTQYTDAPEKRAAMFHAPLSSTSHLHDRPVEGWLVWPAYDTYYTTGPLP
                     PLPLETKQTLDAIARVVNTDAWWQAFVRHMSLEMERDYMAADTTTLVKSLFQMLGTTP
                     LTYAKPYIEQLVNDRDRHKHRAAAELTGGIVRGAKHWAPDVAQEALHAWLGSWLSRVM
                     CDCTLDSQPAWQMWVEYVFQQRDPRRLYALLTFLWDHSKGALSAKGQHLGPGQQAHAL
                     QLLASAVHALQAKSHGWDEGNKLTDALFSHFAHDYQEVRKAVCETLVEWEWTWLRPSL
                     KSVPELLAHSRSAHGSLLAHSDVMRQRCEALQKQLRSWRAQRQPLAYGTSKYDVIAST
                     GALWVCLCLDDHRLGPMSTYVLSLVPDLFEAFQLRDNEELSETAHDVLVQVASHPFSV
                     AQVPVLLEALLDILRRSESWHSRLDALPLLQIVYFQNLYLLSHDMKRCILDVLCSLLH
                     DPHVEVRDMAATTLAGIVRCSQRAHITELSQTFADMAAVPIPRRGSPGYEAAMTQVHA
                     GVLGACALVAAFPYDVPSWMPSLVLDTIAVHSESPVPISTTVRRCAADFRRTHQDTWA
                     EDQHKFGDRVQEVHDFTVGRSDYFA"
     gene            complement(<800502..>802601)
                     /locus_tag="MRET_2118"
                     /note="MRES_08420"
                     /db_xref="GeneID:38738884"
     mRNA            complement(<800502..>802601)
                     /locus_tag="MRET_2118"
                     /product="YdiU domain protein"
                     /transcript_id="XM_027628745.1"
                     /db_xref="GeneID:38738884"
     CDS             complement(800502..802601)
                     /locus_tag="MRET_2118"
                     /codon_start=1
                     /product="YdiU domain protein"
                     /protein_id="XP_027484725.1"
                     /db_xref="GeneID:38738884"
                     /translation="MPPRFRPLSLPQVPLSQQLTSNLIPDPVTPDAKALISSPTSFPS
                     LLRRSRIVRDGAHFSYVTPLPLPFPYEFPPYEQGEESEGVERFLSSYEPPNCREFAPA
                     RQHPPYPSARLVAFSPQAHAACVPHLNVGDTHEWIQQTSGKSVFSSGPLISADTSHLY
                     GSGEDTSPATARQALSDWASGRAFHLHVAGSLDSQEPGGVGVQFLTREEDDVRNTQSA
                     LSQLYTRTSYGPWSLRYGGHQFGEWAGQLGDGRTVSLVETLHPDSGRRMEIQIKGAGR
                     TPYSRFADGLATLKSSTREFLVSEYMAALGIPTSYSLCVVSLPDVPVLRETRTTAALN
                     MRIAPSWLRIGNFQLHSIRNEWESVRVLGEYVARELYGWSDVIKGQGVSDAPRPPWAL
                     RLVKEAGVRNAKTFALWQVYGFMHGVINTDNISLLGDTIDYGPYAFMDAINEDEICNH
                     SDVFGRYSYKMQPSMLVYAVDKLFEALAPLIGFEDLHERALRPGELLHSSAKERQAWA
                     DHAESYLDEVRALVQTSLLKAWAEAWANRLGVQDKDVDRIKYGLIDPFFRAFAGWDLS
                     RSLRTMCDFPTYGGDVHSFAERIARDAATKAPHAASVSDLAAWLETYRAKLTDEGRPP
                     SHVAMHMKRANPRFVLRNWTTDLVAEQLASSNDTKLLERVRAMCAAPFEAYDAPDDAS
                     LCEVGELLQSNTPSCSS"
     gene            <802687..>804312
                     /locus_tag="MRET_2119"
                     /note="MRES_08425"
                     /db_xref="GeneID:38738885"
     mRNA            <802687..>804312
                     /locus_tag="MRET_2119"
                     /product="phosphatidylinositol glycan, class M"
                     /transcript_id="XM_027628746.1"
                     /db_xref="GeneID:38738885"
     CDS             802687..804312
                     /locus_tag="MRET_2119"
                     /codon_start=1
                     /product="phosphatidylinositol glycan, class M"
                     /protein_id="XP_027484724.1"
                     /db_xref="GeneID:38738885"
                     /translation="MSPFRWTYVLLGLGLRIALLLWGEYQDSTATVPYTDVDYSVYND
                     GARLIWASCPLSETIDSPLYGDEEDLLNKPHLFEHVHCARGIVPAVSRFVLKNDPARP
                     DAAEMEWDSAWTAFLHTSYALTRPLFRFLGSLGDPFERATYRYTPLLACALAPAHALP
                     GDTWKWFGKLLFALADVGCAVLMWALLDERRAMHAHEAPGLAGASLTHLPGILWLLNP
                     FPAQIATRGSADSLVGLIVLGFLYCLIRATPELSLIRSPEPNEPPKERHDAGELRVAN
                     TPCFYAAAFFMALAVHFKIYPIIYSPSVLAHLANYRQHALALLCGISKPRRQDVWRLG
                     IEFGACAAFFYLVFMGLAWAIWGQPYIRHALLYHVVRQDHRHNFSVYFLPIYLSLDNV
                     IGSGWTQWLYSPLLSFLPQFLTVSIAGFALGGLDLVLACAVQTVVFVAWNKVYTSQYF
                     LWYLWFLPMVGVTMHFSSLAEIGCLVIIWVGAQALWLYHAYQLEFLAQDTFFALWLSS
                     LVLLFVQLACTQCCLTAWVRWRRRQAIAIHKTQ"
     gene            complement(<804319..>806610)
                     /locus_tag="MRET_2120"
                     /note="MRES_08430"
                     /db_xref="GeneID:38738886"
     mRNA            complement(<804319..>806610)
                     /locus_tag="MRET_2120"
                     /product="magnesium transporter"
                     /transcript_id="XM_027628747.1"
                     /db_xref="GeneID:38738886"
     CDS             complement(804319..806610)
                     /locus_tag="MRET_2120"
                     /codon_start=1
                     /product="magnesium transporter"
                     /protein_id="XP_027484176.1"
                     /db_xref="GeneID:38738886"
                     /translation="MSLPTHRYQDVPPETAPSPPKREERTNEDAQREHDLDAARLLSH
                     SNTDPLWMNDGEAPMAAPLAAPLAGMKDIPSVAKRFYQQNAASSTSLDSQSHFIDHRN
                     QSHSLSVNPNSPLAIRAAQGAESVHAQPDEQSKVHQRAAPALGNHPLVPLTAHADNVP
                     PAWEPPVDNQELAQSTHTSDSRPLEDDVCFPAPNQVEQADDTDRRGPMGRETKKPGYP
                     FTFDLSVLDAFANEEQEQHNGPGSWPHTSLSFGSPTSQEKRGSIGYTPFAGTGLTGGD
                     ATLYSRRPRRGQAAGLERGGGGKYQKKLAMFEGGHSVGRSPDAPLQSITSPSDKTDET
                     AQPLLQGATQPAYNGATSSQWRVPPIARPQPMHRGPRSTVPIPGAVHDKPYRFSFYSN
                     AMSSAIHARYLYELPGPGQTFEDLIRGVPAENDKLAEPKQPASNLPPGIPFIRGSNDY
                     DPEINTWWLDVLCPTDQEMKTLARTFGIHPLTTEDILMEETREKIELFRNYYLVCFRS
                     FDQDPYSPTYLEPLNMYIVVFREGTLSFHFRHTPHPHNVRRRIKQLKDYINVTADWIS
                     YALIDDITDAFAPLIQSIEFEVDSIDELVLILKEAEQSDMLRRIGTCRKKVMGLLRLM
                     GNKADVIKGLAKRSNEYWSVAPKSDIGMYLSDIQDHLITMTQNLNHYEMILSRSHSNY
                     LAQISIEMTDANNQINDVLSKLTALGTIIVPMNVITGLWGMNVQVPGQDIDNLNWFGG
                     ICTAMVIIAVTGYITTVRYLSNR"
     gene            <807072..>807785
                     /locus_tag="MRET_2121"
                     /note="MRES_08435"
                     /db_xref="GeneID:38738887"
     mRNA            <807072..>807785
                     /locus_tag="MRET_2121"
                     /product="SUR7/PalI family protein"
                     /transcript_id="XM_027628748.1"
                     /db_xref="GeneID:38738887"
     CDS             807072..807785
                     /locus_tag="MRET_2121"
                     /codon_start=1
                     /product="SUR7/PalI family protein"
                     /protein_id="XP_027484686.1"
                     /db_xref="GeneID:38738887"
                     /translation="MRILGAVYGQILLFCATGLVILANVGQLTGNMVARNIRLFSVQP
                     YNDFENGKGTTSKYDYPIGQNNGIRPLYAWGLYNYCGGSTDYEVLRCSPSKFGFTFNI
                     VQAVADDIPANISNINLPAIENQSSITNYTRAAFYLLFVGTILVGVAFLVSLLFHPAA
                     LSLASILTFLGFAVLVCGASIDTYFINQLKNHTLGIQSSMIEFGNALWMFWAAVGAAL
                     FAMPGLIGGAAAGHADTPY"
     gene            complement(<807933..>808289)
                     /locus_tag="MRET_2122"
                     /db_xref="GeneID:38738888"
     mRNA            complement(<807933..>808289)
                     /locus_tag="MRET_2122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628749.1"
                     /db_xref="GeneID:38738888"
     CDS             complement(807933..808289)
                     /locus_tag="MRET_2122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484178.1"
                     /db_xref="GeneID:38738888"
                     /translation="METSTVGAPVNVCCKGAKFCSYLAWSSTPFDKQDCMAKAATRFP
                     ELAVLVSLLVVSWGLLGGWERTLKAAAQPSVEQISDIPWLSFPICLAYLIPLLVPITT
                     YVVIAHWTGSELFRYS"
     gene            <808549..>808959
                     /locus_tag="MRET_2123"
                     /note="MRES_08440"
                     /db_xref="GeneID:38738889"
     mRNA            <808549..>808959
                     /locus_tag="MRET_2123"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628750.1"
                     /db_xref="GeneID:38738889"
     CDS             808549..808959
                     /locus_tag="MRET_2123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484179.1"
                     /db_xref="GeneID:38738889"
                     /translation="MVNLFSSALSLVALVSAAVPTLAYDSESLNARLVYDPQILYPDC
                     KTEWTVGQRVNVTWNAKDMPRQFRNLTGVIRLGHIEEGSPNEHLANTLAKNFKMADGN
                     VTFTVPKVDERNDYVVVLMGDSGNHSPKFTIHSA"
     gene            <809215..>810486
                     /locus_tag="MRET_2124"
                     /note="MRES_08445"
                     /db_xref="GeneID:38738890"
     mRNA            <809215..>810486
                     /locus_tag="MRET_2124"
                     /product="acyl-CoA dehydrogenase"
                     /transcript_id="XM_027628751.1"
                     /db_xref="GeneID:38738890"
     CDS             809215..810486
                     /locus_tag="MRET_2124"
                     /codon_start=1
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="XP_027484172.1"
                     /db_xref="GeneID:38738890"
                     /translation="MSFLSSRSLAASKGFVSSNVRASLAPASARLFSKTAAAQNISFE
                     LSEDQQAYQELARKFTRENIIPVARHYDQTMEYPWDVIKKAHSVGLLNTHVPEKFGGP
                     GLGLMECSLITEELAYGCTGIQTAIEANGLAEAPVLVAGNDEQKAKYLGRMTEEPLVA
                     SYGVTEPGAGSDVANISTRAEKRGDKWILNGTKMWITNGGHANWYFVLARTNPEERPH
                     KALSGFIVDGDAPGVIRGKKEINMGQRCSDTRMITFEDVEVPEENLLGKPGDGFKIAM
                     GAFDITRPLVASGAVGLAQRALYEATIYAKERKTMGKPIINHQAIAFMLADMQMAVES
                     SRNLVWKACYTKDQGQRNSFYASMAKCLASRAAVSNADQAVQIYGGLGFNSESSVEKL
                     YRDAKIFELYEGTSQIQRLIISRHLADLYNA"
     gene            complement(<810563..>812593)
                     /locus_tag="MRET_2125"
                     /note="MRES_08450"
                     /db_xref="GeneID:38738891"
     mRNA            complement(<810563..>812593)
                     /locus_tag="MRET_2125"
                     /product="CBS PB1 domain protein"
                     /transcript_id="XM_027628752.1"
                     /db_xref="GeneID:38738891"
     CDS             complement(810563..812593)
                     /locus_tag="MRET_2125"
                     /codon_start=1
                     /product="CBS PB1 domain protein"
                     /protein_id="XP_027484173.1"
                     /db_xref="GeneID:38738891"
                     /translation="MSATPSYRNSPHSSDTRKRQSRRDEAIRKRIEAELSRKSGKPST
                     PQHGRRRNPIQAGTVSALRPLPALTVPHTMSITDASQLCAAKRTDCVLVVDNEEHLAG
                     IFTAKDLAYRIVASGVDARMTPVSAIMTTSPLVTRDTTSATEALSMMVSRGFRHLPVC
                     NEDGDVVGLLDIAKVFYEALEKLERAHGSSQKLYHALEGVQNEWGGGPQQAMMQYVQT
                     LRERMSMPDLSTILDSRTIPCTVGVRTTVRDAARLMKEHRTTAVCVMENAPSPQGERG
                     ITSGKIAGIFTSKDVVLRVIAAGLDPERCSVVRVMTPHPDTGTPSLSIQEALRKMHDG
                     RYLNLPVVDVDGRLVGVVDVLKLTYATLEQINSMSNGDDSDGGPMWNRFWNSFGQGAG
                     SAFGEESASGVSSSQRMGTDSLMSPTGGAVDISSDVHPNDSASGVGEGGSALDVPASS
                     ETDDGTYLFKFVTPSGRVHRFQARYDSFETIHEIVLIKLAGDPFFSSVPVSHSAPAEP
                     IRSDVDDEDRLPLHIFTPPMPSAPQANPPDVKDFTLAYKDDDDDLVLITTDSDVMDSV
                     KVARHQCRDRVLLVLQGGRTWDEAVAKQGVHGGHATVSFATAANRQRQRDMADVQARS
                     VQSSEDREKGQGSPPTDALFGIIPRDMALPAAIGFASFAGVVAACIVKFGRP"
     gene            <812722..>813825
                     /locus_tag="MRET_2126"
                     /note="MRES_08455"
                     /db_xref="GeneID:38738892"
     mRNA            <812722..>813825
                     /locus_tag="MRET_2126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628753.1"
                     /db_xref="GeneID:38738892"
     CDS             812722..813825
                     /locus_tag="MRET_2126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484174.1"
                     /db_xref="GeneID:38738892"
                     /translation="MGVAEKIKEVEAEMARTQKNKATEYHIGLLRAKLAKLRMQLLEP
                     DKKSGKSGEGFDVMKSGNARVVLIGFPSVGKSTLLSTITETESATAAYEYTTLTAIPG
                     VLEYEGARIQLLDLPGIIEGAAQGRGRGRQVVSVAKTADLVMMMLDATKSAQQRPLLE
                     KELDDVGIRLNQTKPDVVLKKKSGGGIVVTKAMGLTLTKIDEKMIRSILQGYKIHNCD
                     VMIREDITVDQFIDVLLGNRKYVPCLYVYNKIDGISMEEMDRLANEPHSAVISCNLNL
                     NLDYLVERIWDELNLNRVYTKKRGEHPDLADPIVVRRGATIEHVCHGVHRALVDKFAY
                     AMVYGKSSKFPLAQKVGLHHVVANDDVVTIFTR"
     gene            <813851..>815689
                     /locus_tag="MRET_2127"
                     /note="MRES_08460"
                     /db_xref="GeneID:38738893"
     mRNA            <813851..>815689
                     /locus_tag="MRET_2127"
                     /product="phospholipid:diacylglycerol acyltransferase"
                     /transcript_id="XM_027628754.1"
                     /db_xref="GeneID:38738893"
     CDS             813851..815689
                     /locus_tag="MRET_2127"
                     /codon_start=1
                     /product="phospholipid:diacylglycerol acyltransferase"
                     /protein_id="XP_027484175.1"
                     /db_xref="GeneID:38738893"
                     /translation="MVPRGWRWLWTSFVVAVIATVMGVLVVQNTELTSRVNELVGSLD
                     DPWSVLKDTGLWNDKLLSKEMRENMEQMFSKARKWYETHDFEVGRRLKREGAEPHHPV
                     VLIPGIVSSGLESWDTSEEESPLFRQRLWGSTSMFRSALFDKEKWVRHLMLDPVTGVD
                     PEGIRVRAAQGLDAASYFAAGYWVWSKIVENLAAVGYDINQIYLASYDWRLSTRNLEE
                     RDHFFSRIMSQIEFNSRVYKRKTVLISHSMGGTVAMYLLKWLEHERGAAWIDEHIEAL
                     ANLSGTLLGVPKAMPALMTGEMRDTVQVPSMLAYLLERFFSAQERAALFRTWAGSSSM
                     IVKGGNAVWGDVHGAPDDTPNATKTHGILMEYANRPDLNETEPTRKLRADDVYPWLNK
                     HTDQHYQNMLKTNYSFGIERDSAKIRANNKDPTKWTNPLEVALPHAPHMKVYCIYGWN
                     KPTERSYWMYEQETESALNERSPDGFEFSESLRNRTSDTDTLMVSRIDGQMNDEKSVP
                     PLDSGVRMGEGDGTVSLLSLGSMCAHGWHMDRYNPARLKVVTHEVYHNPEAFDLRGGT
                     SSGDHIDILGSKDLNEAIVRIATGRGDQVQERIYSPIATYAKRIQW"
     gene            <815712..>816122
                     /locus_tag="MRET_2128"
                     /db_xref="GeneID:38738894"
     mRNA            <815712..>816122
                     /locus_tag="MRET_2128"
                     /product="diphthamide biosynthesis protein 4"
                     /transcript_id="XM_027628755.1"
                     /db_xref="GeneID:38738894"
     CDS             815712..816122
                     /locus_tag="MRET_2128"
                     /codon_start=1
                     /product="diphthamide biosynthesis protein 4"
                     /protein_id="XP_027484181.1"
                     /db_xref="GeneID:38738894"
                     /translation="MDHDAYAVLGVEPTDSASVIRAAYLRLARQYHPDKAGASYEAER
                     MQHIVRAYETLYDPASRAAYDQRRRQGRAEIRVAETVLVDDMDMDEDTMQFVYPCRCG
                     QMYAVAADAIVQGTRYVACAGCSETIHIMLDDEA"
     gene            complement(<816135..>818126)
                     /locus_tag="MRET_2129"
                     /note="MRES_08465"
                     /db_xref="GeneID:38738895"
     mRNA            complement(<816135..>818126)
                     /locus_tag="MRET_2129"
                     /product="sentrin-specific protease 1"
                     /transcript_id="XM_027628756.1"
                     /db_xref="GeneID:38738895"
     CDS             complement(816135..818126)
                     /locus_tag="MRET_2129"
                     /codon_start=1
                     /product="sentrin-specific protease 1"
                     /protein_id="XP_027484182.1"
                     /db_xref="GeneID:38738895"
                     /translation="MPKRTRDEAHSDSMSGWWDRFVTYFFRLAKKARSEDVTHTVDER
                     REKSECEPLEGDVNVKDSSPMCESVHTGETRAHTNLDEGMEKERTKGHTEDDKQKEVD
                     QECVDDDRSEDDDRSEVDDQSEVNDQSEVNDQSEVDDQSEVDDQSEVNDQSEDDDQSE
                     DDDQNEVDSQNEDDQDSGDSASDSSDSSIVIVDTPSPPTPAQPAPRTPSSPQAPVTTS
                     SLSRFLASRPRSIPTPRPSPFRPQYAPTKTLFKSKRSDIPRQHRRRTLSSMNQRRKGP
                     LAMDEFKAGMRAKQQARIVSMIHESYRGMRHGSMRYEDFHALVRKRTHVQLLMDLETL
                     RMQPLTPPVLDEQAYTQRTLEALSRREAHAKAQLPPPIVPTEAKLSAAREARRKRLDM
                     HGVLGRGPLPKALPPDADAVVSDIWDRRSGVVASMTGAQVEAHDMAKLRPGKWLNDEV
                     INFYGQLLMQRSSQAEASDCWRIHVFSSFFWQNLTTRGYAGVRRWSRRVDLFTKDLIL
                     LPINVGQAHWVCAAINLRLRRFEYYDSMGIPSPGVFATLRAYISDEMRDKKQLEIDLS
                     DWTDYFAGETSPQQQNGYDCGVFAVQTLEQLSRRDPAVPYPPRALEARLFTAPADPTE
                     LALLREEHACEYAWNFDQRDMPYLRRRMAYEIYTKQLLP"
     gene            <818232..>820409
                     /locus_tag="MRET_2130"
                     /note="MRES_08470"
                     /db_xref="GeneID:38738896"
     mRNA            <818232..>820409
                     /locus_tag="MRET_2130"
                     /product="regulatory factor Sgt1"
                     /transcript_id="XM_027628757.1"
                     /db_xref="GeneID:38738896"
     CDS             818232..820409
                     /locus_tag="MRET_2130"
                     /codon_start=1
                     /product="regulatory factor Sgt1"
                     /protein_id="XP_027484108.1"
                     /db_xref="GeneID:38738896"
                     /translation="MPPVPGSEDEAGESPSLFVARVNMPHDADAMGMILEQDLERMST
                     LPSQDHYIWDREPPLVRVTDAHTLEVSMRVQDCVDDEWFLTYLLREWTRSHLDACVSV
                     TDQDGEFLLIEAADVLPSWAQPDTTENRVWIYQGELHLVPLDASNSIPLSVNQATCLV
                     RDPTCKTQAPTAVQDKVFARLAAYPGAASTHHHTTLAFVSLGAARILASYPQSVAEAV
                     HALTTRDVVSMRSTKRYASYLHIDACADEHLAPMPPAVDAVLVRVRCTRHLYARMSFD
                     KFFPPSLLGRRWQHQVEQYRLATSGKTQNISETDAVWGRWCDTGAKLTCGLSMWLESL
                     GQRPTHHPAVSLDPSRHEHFLASLTRLGYFGDEMRDSAEWKAREAQAIKTATRLAAPI
                     EATPTTSISDVLATIRDPVSIPTLSLDAPVSTLVSHEDSDAWLSMAPEDVVALLEGRG
                     QEEAEDATMDKFQTFMNKMQTFLESQGDVEGALMEDDDHAFDDGDEAEEDSSDEWDER
                     KNALVDPLPAEEWGAYQHEKSKAQSQCSSARLGGLSKVDHLDGDSDSGSSLEDDEDVP
                     DMTPKEDVLQEQDMHDFIEFTRQTLGLSETQYGEILEERRKRGAFVPQQSDGPLASLD
                     AALDSMERELAQAKRHRAPEAMDDEDELNEEEAELLQHLLASGMSLPDSLKHFSSEHD
                     VHKDDVEMLGDFLESFKAQGGRPGPVGTLSQRLGVGALPRDHP"
     gene            complement(<820648..>821487)
                     /locus_tag="MRET_2131"
                     /note="MRES_08475"
                     /db_xref="GeneID:38738897"
     mRNA            complement(<820648..>821487)
                     /locus_tag="MRET_2131"
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 3"
                     /transcript_id="XM_027628758.1"
                     /db_xref="GeneID:38738897"
     CDS             complement(820648..821487)
                     /locus_tag="MRET_2131"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 3"
                     /protein_id="XP_027484107.1"
                     /db_xref="GeneID:38738897"
                     /translation="MSATAARTLLRCARPARLPSMHQSVLVSARALSTTFKVSEQGDK
                     VMLETPYVERANLNPMVKYESMQGPLHDYGSWVISALPRFIQQFSVYKDELTFYVAPS
                     GLIPTMTFLRDHTNTQFKALMDISGADYPSRSQRFEVNYHLLSLRHNARIRVKTYADE
                     VTPVPTVTSLFRSADWFEREAWDMYGIFFAGHPDLRRILTDYGFEGHPLRKDFPLTGY
                     TEVRWDEEKKRVVYEPVQLMQAHRNFEAASSWEQVGQGVSYTPNEHKLVPPKPAEDNK
                     DKK"
     gene            <821612..>822295
                     /locus_tag="MRET_2132"
                     /note="MRES_08480"
                     /db_xref="GeneID:38738898"
     mRNA            join(<821612..821981,822009..>822295)
                     /locus_tag="MRET_2132"
                     /product="pre-mRNA-splicing factor SPF27"
                     /transcript_id="XM_027628759.1"
                     /db_xref="GeneID:38738898"
     CDS             join(821612..821981,822009..822295)
                     /locus_tag="MRET_2132"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor SPF27"
                     /protein_id="XP_027484106.1"
                     /db_xref="GeneID:38738898"
                     /translation="MVAGDERPVCAAADALPYYDTDIDTIPDLRVEAERAIEHEKRHF
                     VPHDSMPPAFEFGAHWAAELERAERGEKLQVLDTSRYQLPHPPDDAKEEEWRAALINA
                     EVQLRYMDGRLLNLELLRRYGPNVWRLHNYQQEGMAALQTRLLDEATHDMDELNRTRK
                     AMHWQLGDKISMYESRWRDLVSRNLSIRVANLAMRAEIDDLTRRTDAARRTLAAMEEA
                     "
     gene            complement(<822321..>823136)
                     /locus_tag="MRET_2133"
                     /note="MRES_08485"
                     /db_xref="GeneID:38738899"
     mRNA            complement(<822321..>823136)
                     /locus_tag="MRET_2133"
                     /product="rRNA processing protein RRP15"
                     /transcript_id="XM_027628760.1"
                     /db_xref="GeneID:38738899"
     CDS             complement(822321..823136)
                     /locus_tag="MRET_2133"
                     /codon_start=1
                     /product="rRNA processing protein RRP15"
                     /protein_id="XP_027484105.1"
                     /db_xref="GeneID:38738899"
                     /translation="MASAPKAQAVPRTKHRVRMAVPAVTKNINEDEGLDQGDIEGEDT
                     DDADDDADGDDDDADEGDDHVDEGDDDDDDDDDDDDIPAGGRSNKTKKRKRRAVSLNA
                     FGETLEQLLGTESAPAPNEILSLAPRLRHTANASTLRAKAARLALEKRKEREERAHIK
                     DVIGEWGPPGSLSYAGHAPLSGPALDAWTEQGGAKGYERRLRKTAQRGVVKLFNAIRA
                     AQSTTEDDIERARMTQKSRKVNELGNKDMAVKELSKTHFLDMLRQAPKGTSRS"
     gene            <823306..>824620
                     /locus_tag="MRET_2134"
                     /note="MRES_08490"
                     /db_xref="GeneID:38738900"
     mRNA            join(<823306..823613,823648..>824620)
                     /locus_tag="MRET_2134"
                     /product="succinyl-CoA synthetase beta subunit"
                     /transcript_id="XM_027628761.1"
                     /db_xref="GeneID:38738900"
     CDS             join(823306..823613,823648..824620)
                     /locus_tag="MRET_2134"
                     /codon_start=1
                     /product="succinyl-CoA synthetase beta subunit"
                     /protein_id="XP_027484112.1"
                     /db_xref="GeneID:38738900"
                     /translation="MIRALNLFRSRATAAQSLLRHGSNAAVQKRFLSIHEHLSMGLLN
                     KYGINTPKFLTAKDADEAYHAAQKFGGKPIVVKAQVLAGGRGKGHFDNGLQGGVHLVK
                     TPEEARELAGKMIGNKLITKQTGAGGRLCNAVMIAEARTPKHEYYVALLNDRVSQLPV
                     LIASNQGGMSIEDVAKENPDAIVTTPIDFTKGLDFETAKQVAHKLGFSGSEQEKEAAE
                     TFVKLYQLFSERDATQVEINPLAESEDGAVLCMDAKLGFDENADFRQKEVFEMRDLTQ
                     EDPSEVKAGKYGLNFIKLDGNIGCLVNGAGLAMATLDVLSLNGGKPANFLDVGGGANA
                     EAVKQAFDIVLEGEGVRAIFVNIFGGIMRCDVIAEGIIKATKEMDLHVPLVVRLQGTK
                     EEEAKELIRKSGLKIQAYNDLDEAARKAVEAAAH"
     gene            complement(<824707..>825168)
                     /locus_tag="MRET_2135"
                     /db_xref="GeneID:38738901"
     mRNA            complement(<824707..>825168)
                     /locus_tag="MRET_2135"
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /transcript_id="XM_027628762.1"
                     /db_xref="GeneID:38738901"
     CDS             complement(824707..825168)
                     /locus_tag="MRET_2135"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /protein_id="XP_027484111.1"
                     /db_xref="GeneID:38738901"
                     /translation="MTLYADLCVRLQNASRAKLKSVPIPYTKANVAISAILLQHGFIY
                     NMTRGSIAGPSAVDWNTAPDVRKRLWIDLKYRADDRPVLERMNLVSKPSRHLSMTKDE
                     LLLWVSGRRAKFVAPLRTGEIGIIDCGKHGWFEAKEAMRRNLHGEVVCRVS"
     gene            complement(<825227..>826114)
                     /locus_tag="MRET_2136"
                     /note="MRES_08495"
                     /db_xref="GeneID:38738902"
     mRNA            complement(join(<825227..825277,825303..825500,
                     825527..825535,825563..825926,825954..826001,
                     826026..>826114))
                     /locus_tag="MRET_2136"
                     /product="S-adenosylmethionine-dependent
                     methyltransferase"
                     /transcript_id="XM_027628763.1"
                     /db_xref="GeneID:38738902"
     CDS             complement(join(825227..825277,825303..825500,
                     825527..825535,825563..825926,825954..826001,
                     826026..826114))
                     /locus_tag="MRET_2136"
                     /codon_start=1
                     /product="S-adenosylmethionine-dependent
                     methyltransferase"
                     /protein_id="XP_027484110.1"
                     /db_xref="GeneID:38738902"
                     /translation="MPAVPTIMNGVENLPESKLGTKEHWDQVYEREVATYKDIGDEGE
                     VWFGEDSVERMIRYLCDLFEEEPRSEPRYVLDIGTGNGHLLFALMEAQEEDLAPGTVD
                     PSRLCGIDYSPASIQLCHSIAENRGNECKQISFLECDLRDMSSMDTLTKRANDGQGWD
                     VVCDKGTYDAIALSSQLVNGKLPVDLYVDAVCRLTRAREGLFFITSCNFTKTELEAKF
                     VPAGFVVEHVVPTPSFTFGGHKGSSVTTMAFRRA"
     gene            complement(<826678..>827027)
                     /locus_tag="MRET_2137"
                     /db_xref="GeneID:38738903"
     mRNA            complement(join(<826678..826703,826746..826968,
                     827025..>827027))
                     /locus_tag="MRET_2137"
                     /product="small subunit ribosomal protein S27e"
                     /transcript_id="XM_027628764.1"
                     /db_xref="GeneID:38738903"
     CDS             complement(join(826678..826703,826746..826968,
                     827025..827027))
                     /locus_tag="MRET_2137"
                     /codon_start=1
                     /product="small subunit ribosomal protein S27e"
                     /protein_id="XP_027484109.1"
                     /db_xref="GeneID:38738903"
                     /translation="MTLAVDLINPSHEQQQNCHKLKRLVQSPNSFFMDVKCPGCFAIT
                     TVFSHAQSVVLCGSCAQVLSQPTGGKARLAVGCSFRRKA"
     gene            <827393..>827980
                     /locus_tag="MRET_2138"
                     /note="MRES_08500"
                     /db_xref="GeneID:38738904"
     mRNA            <827393..>827980
                     /locus_tag="MRET_2138"
                     /product="large subunit ribosomal protein L19e"
                     /transcript_id="XM_027628765.1"
                     /db_xref="GeneID:38738904"
     CDS             827393..827980
                     /locus_tag="MRET_2138"
                     /codon_start=1
                     /product="large subunit ribosomal protein L19e"
                     /protein_id="XP_027484114.1"
                     /db_xref="GeneID:38738904"
                     /translation="MVNLSVQRRLAASVLGVGKRKVWLDPAEQTDIANANSRANIRKL
                     IKDGQIIRKPQVSQSRERIRDMHKAKRLGRHTGYGKRKGTAEARFPTKVQWMRRLRVL
                     RRLLRKYREAGKIDKHLYHELYLKSKGNVFKNKRVLMEHIHKAKAEKLRSKHLADQME
                     ARRLRNKTLRERRAQRVAEKRAAILAVEQHGEEQQ"
     gene            complement(<828378..>829781)
                     /locus_tag="MRET_2139"
                     /note="MRES_08505"
                     /db_xref="GeneID:38738905"
     mRNA            complement(<828378..>829781)
                     /locus_tag="MRET_2139"
                     /product="protein of unknown function (DUF2413)"
                     /transcript_id="XM_027628766.1"
                     /db_xref="GeneID:38738905"
     CDS             complement(828378..829781)
                     /locus_tag="MRET_2139"
                     /codon_start=1
                     /product="protein of unknown function (DUF2413)"
                     /protein_id="XP_027484113.1"
                     /db_xref="GeneID:38738905"
                     /translation="MSNETRPPRGASTRKHDVDALLADLSLDVKPPRVSRKPSARPFE
                     HKSSSTRPDDAQSLLDDLEGLVQRRRSLQRDAKEGEESPNKQASAASHTASPGSRPGL
                     DPARPMQRTSPSPSKVVAPVRPPSSESVSPRDVKTQESTPTAQEPITAPETSAEPAKE
                     GAWGGWGNLFSTASKLAEQARNEIGRRTAGVVPNMPLDKDAHPEQQIFDLGNKVAQRV
                     RGFVQQGGLEHIRDNITAAGLRGWNDIVNAVVLPMEAHDSLHITVSHDMVGYDGIETL
                     AFKVLSRVLSQAELDISVSRDTSVPSQEPETASERKYDLYAADTREQGLQQAKEALHR
                     LCDSVLSTTDENDTSACPVILRIQPFYDQLLAPGEDDLFATVAQGKQKEPAGGANGLF
                     FYVWWVDPKHKLSHVTQSQAVPSWWLTVSDAENHWVELVLSDTLENAIATVSQDYIQS
                     RRALFAKATATASAAEP"
     gene            <829968..>830537
                     /locus_tag="MRET_2140"
                     /db_xref="GeneID:38738906"
     mRNA            <829968..>830537
                     /locus_tag="MRET_2140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628767.1"
                     /db_xref="GeneID:38738906"
     CDS             829968..830537
                     /locus_tag="MRET_2140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484558.1"
                     /db_xref="GeneID:38738906"
                     /translation="MGSWNKRPLCAADTWREVKHQRCCAYEDDSDTESGLKRAYSPPP
                     WEDDSTYDEGPSMKRRHIDREMNGHMLQMSIQDSRATAPESTCIHDEDMTQGNSYEIA
                     PDRIYVHSLDDDDDDNSDVTDNSWQVHPRIARHLNEEEFRRLHQRLDVPRWIAPSNEP
                     DPPKALVLWKPPLWTPATEEPAESMDIGS"
     gene            <830652..>832583
                     /locus_tag="MRET_2141"
                     /note="MRES_08510"
                     /db_xref="GeneID:38738907"
     mRNA            <830652..>832583
                     /locus_tag="MRET_2141"
                     /product="serine/threonine-protein phosphatase 2B
                     catalytic subunit"
                     /transcript_id="XM_027628768.1"
                     /db_xref="GeneID:38738907"
     CDS             830652..832583
                     /locus_tag="MRET_2141"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 2B
                     catalytic subunit"
                     /protein_id="XP_027484559.1"
                     /db_xref="GeneID:38738907"
                     /translation="MNEPHIADGAVHRRQRIENAYDKIAHKNLLPQIDFTVHTLDDGE
                     QVSTQERVIKDVQAPAFHPPTPEQFWSKKDPTKPDVQFLKNHFYREGRLTHDQARYIL
                     IQATELLRAEPNLLELDAPITVCGDIHGQYYDLMKLFEVGGNPAETRYLFLGDYVDRG
                     YFSIECVLYLWSLKLWYPNSLFLIRGNHECRHLTDYFTFKLECKHKYSEEIYDLCMES
                     FCALPLGAVMNKQFLCIHGGLSPELQTLDDLRTINRFREPPTHGLICDILWADPLEEF
                     GQETTNESFVHNHVRGCSYFFTYQAACQFLERNNLLSIIRAHEAQDAGYRMYRKTKVT
                     GFPSVMTIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCTPHPYWLPNFMDVFTWSLP
                     FVGEKVTDMLIAMLNICSKEELEEEEDDTSLNFDRHSASNGQALSFSDAGDSTPNSSL
                     DDYPERRTVIKNKILAVGRMSRVFHVLREEAERVSELKVATGTGKLPYGTLALGSEGI
                     KEAIHNFDEARKVDIENERMPPSLVDADPLTDDTDMSTPMPALTNTLPSQLAMPVGTG
                     PRTPPSMPMHRRTHSRTSSLGTTMTSPSNRRRSIESTVSMIREALEGRPGNDIGHHNH
                     HFHDDSPSSPRSPLSREPR"
     gene            <832737..>833528
                     /locus_tag="MRET_2142"
                     /note="MRES_08515"
                     /db_xref="GeneID:38738908"
     mRNA            <832737..>833528
                     /locus_tag="MRET_2142"
                     /product="20S proteasome subunit beta 6"
                     /transcript_id="XM_027628769.1"
                     /db_xref="GeneID:38738908"
     CDS             832737..833528
                     /locus_tag="MRET_2142"
                     /codon_start=1
                     /product="20S proteasome subunit beta 6"
                     /protein_id="XP_027484556.1"
                     /db_xref="GeneID:38738908"
                     /translation="MPVGHQFSPYTSNGGSIMAIHGDDYCVIAGDTRQSEGYNIQTRY
                     KPKVFRLTDKATLATNGFSADAEALVSRIKIRLEMYQHTHGRSMPLHAIARMLSTILY
                     SKRFFPYYVYNILGGIDEEGRGAVYGYDPVGSYERIVCCASGAAQGLLQPFLDNQVMF
                     KNQMPTPETSIPEPGHLPLPHALRIVMDSFTSATERHIEVGDGLEVFIVRSMKPRASE
                     ETATTAQQPAMDISLEQFGAVDALGGEDAFTPGACMVIRRELKKD"
     gene            <833710..>834804
                     /locus_tag="MRET_2143"
                     /note="MRES_08520"
                     /db_xref="GeneID:38738909"
     mRNA            <833710..>834804
                     /locus_tag="MRET_2143"
                     /product="Dsk2-ubiquitin-like protein"
                     /transcript_id="XM_027628770.1"
                     /db_xref="GeneID:38738909"
     CDS             833710..834804
                     /locus_tag="MRET_2143"
                     /codon_start=1
                     /product="Dsk2-ubiquitin-like protein"
                     /protein_id="XP_027484319.1"
                     /db_xref="GeneID:38738909"
                     /translation="MSNTDEDAGKSITLHIKGPSALKLSVTISKDQTVLQLKERIATE
                     NNDFPAESQRLIYSGKVLKDPETLASYNVQDNHTIHMVRAAIKTSSGASNTPASSGRT
                     MSQATASRAAEAQGVPSSFSAGQQFTNNPLSALNRADYAGPHMANLLNEAGGMFGNFG
                     GMNPRDPNVMLGMMQNPEFLQHMRSMLARPEVVDQIIASNPQMQAMGPQVRDMMQSEY
                     FRDLVTNPEMIQRMTQLSQMMGGLPGTGAPSWPPPGAFGAPPTQDSAQRDAAHNAASD
                     PLASLAQLQSLLGGMGGAAGAGGLNPLAAALAGSGNQAQPTDQRAPEERYATQLEQLQ
                     TMGFLDPRENLRALLMSGGSVEGAVTILLD"
     gene            complement(<834967..>835740)
                     /locus_tag="MRET_2144"
                     /note="MRES_08525"
                     /db_xref="GeneID:38738910"
     mRNA            complement(<834967..>835740)
                     /locus_tag="MRET_2144"
                     /product="glycerol-3-phosphate phosphatase"
                     /transcript_id="XM_027628771.1"
                     /db_xref="GeneID:38738910"
     CDS             complement(834967..835740)
                     /locus_tag="MRET_2144"
                     /codon_start=1
                     /product="glycerol-3-phosphate phosphatase"
                     /protein_id="XP_027484562.1"
                     /db_xref="GeneID:38738910"
                     /translation="MPTYEVETDTLLFDMDGTLVSSTAALSAVWAEFCEQYNMDLNDL
                     LTNSHGKRTVENLEERLPQLTHEQAQSEAYRFENRIIELSDERRAKATKEPTAEDPQG
                     SIVGLPGVKDLLTQINEGAKQDPSRRPGWAIVTSATGDYARRAFLSTKSSDLPKVFVS
                     SDDVTKGKPNPEPYKKGAELSHVNPTNCIVVEDAPAGVLSGKRAGARVLALKTTHEAE
                     RLWRQGADFVVDDLSKVKAHWSGDKVVLTIDSEERPSFE"
     gene            complement(<836124..>836916)
                     /locus_tag="MRET_2145"
                     /note="MRES_08530"
                     /db_xref="GeneID:38738911"
     mRNA            complement(join(<836124..836491,836520..>836916))
                     /locus_tag="MRET_2145"
                     /product="glycerol-3-phosphate phosphatase"
                     /transcript_id="XM_027628772.1"
                     /db_xref="GeneID:38738911"
     CDS             complement(join(836124..836491,836520..836916))
                     /locus_tag="MRET_2145"
                     /codon_start=1
                     /product="glycerol-3-phosphate phosphatase"
                     /protein_id="XP_027484320.1"
                     /db_xref="GeneID:38738911"
                     /translation="MKVQVDVDTVLFDMDGTLIDSTPAVNATWVEFAKEYNLDIDHVL
                     HYSHGHRTVENLKRYIPSLESDALMKEVVRFESRILEIAQENMDRAIKTGNADGTIIA
                     MPGARPLLEQIQCGRDKNPARRAGWAIVTSATSAYAQKAFVASNVSTPPDTFVTSDVC
                     AHGKPDPEPYAKGAELSKADISKCIVVEDAPPGVLSGKRAGARVLGLRTTHEGQRMWE
                     QGADWVVPDLSYVQAEWLDGDRLVLTIDTEEAPTRI"
     gene            complement(<837053..>838804)
                     /locus_tag="MRET_2146"
                     /note="MRES_08535"
                     /db_xref="GeneID:38738912"
     mRNA            complement(<837053..>838804)
                     /locus_tag="MRET_2146"
                     /product="SNF1 kinase complex beta-subunit Gal83"
                     /transcript_id="XM_027628773.1"
                     /db_xref="GeneID:38738912"
     CDS             complement(837053..838804)
                     /locus_tag="MRET_2146"
                     /codon_start=1
                     /product="SNF1 kinase complex beta-subunit Gal83"
                     /protein_id="XP_027484560.1"
                     /db_xref="GeneID:38738912"
                     /translation="MGNTQSLYHLQDRNRDGTRPLTPSESTSQTSREAEAVVTTHQPG
                     HLYSHTLSLEACPDMEAKASDQRNLAYSTHPNARAIVAGSQFARYGASDTSLNEPAST
                     SSDASSSVSLSEIDAPSRDSPIERSEILQRRATGVHLEVNTDHEPLPSTPSTLDVKTP
                     RVSASYSMCKTPPGNSGDDRSMRIAQRSSVLFSDDVPWNVNETPRTGSREPDSDDDTH
                     PHVNARLRSLPSYLKIPTAIPRSFTSSRIAFDDAGAAADSSRASKFWPHDTKTPNREP
                     ESGAISAPLIGSTPHDSKSLSAEFQGLGLSAAAVPDGKQDAVSSATHPTPNVPLTPVN
                     LIWRGRGKRVYVTGTFADEWQSKIPLRQLRPQTPFLGTVYLPPGTHRLKFIVDDRWRV
                     SPDMDTATDGDGTLVNYVEIPNLQDHSRTSMTRMNAKRDDTWKRAMHELKTAHLSPRG
                     EWEELSDELPGLSETIWTSHVPSSVELAQEAEEHMLEQADHVSENESSLLPRPPQLPR
                     QLEKVILNAGISSKHEPIHAKAALVDDNSVLPAPNHAVLNHLATGAIKNGVLAMGTVS
                     RYKHKYVTTVLYRPVHM"
     gene            <838975..>839343
                     /locus_tag="MRET_2147"
                     /db_xref="GeneID:38738913"
     mRNA            join(<838975..839017,839043..839144,839179..839277,
                     839306..>839343)
                     /locus_tag="MRET_2147"
                     /product="anaphase-promoting complex subunit 11"
                     /transcript_id="XM_027628774.1"
                     /db_xref="GeneID:38738913"
     CDS             join(838975..839017,839043..839144,839179..839277,
                     839306..839343)
                     /locus_tag="MRET_2147"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit 11"
                     /protein_id="XP_027484561.1"
                     /db_xref="GeneID:38738913"
                     /translation="MKVHIRNWHPVGYWHWNVRDPDDVCGICQNYFDGVCGACRDPGD
                     ACPLAVGECTHEFHMHCINRWLMERHEPLCPLCKRPWVEVTTQALTASA"
     gene            <839480..>841196
                     /locus_tag="MRET_2148"
                     /note="MRES_08540"
                     /db_xref="GeneID:38738914"
     mRNA            join(<839480..841038,841070..>841196)
                     /locus_tag="MRET_2148"
                     /product="kinesin family member C1"
                     /transcript_id="XM_027628775.1"
                     /db_xref="GeneID:38738914"
     CDS             join(839480..841038,841070..841196)
                     /locus_tag="MRET_2148"
                     /codon_start=1
                     /product="kinesin family member C1"
                     /protein_id="XP_027484564.1"
                     /db_xref="GeneID:38738914"
                     /translation="MPPTRTRSASPQRVRARRVGDAGSRAPAKAPQAASSDMRHLFAL
                     EAQRMQATRLRERAAQEQRRERTRTLDEQLDEERRIAKENRPPGHEWRGYQDYEVELL
                     RAQCEEQVASLQADVLARDEEIKRLRDLLEQHTKQASEQASAQHTWAARVSDLEAQLR
                     THDARTQQLRTEASDALAHTRDLEARLAEADALRRHLHNQVQELRGNVRVYARVRPAA
                     RADPVAEWRYPDAALLATQLEVHVPSESAMGHASVKTHAFAFDHVFPPAATQSDVFAE
                     VSDLLQSVLDGYHTTIFAYGQTGSGKTHTLEGGAGIDWQHAAHALDNDAGLIPRAMHM
                     LWRTAEKQRTHGWSYTFEAQMVEVYLDQVSDLLSDASRRCEIKHTPTHTHVEHAAVEP
                     LAKPEDVYALLARAQKRRQVAATRMNERSSRSHSIFALRVHGECTRPDATATTHATLN
                     LVDLAGSERLAASGSANDAQRLKEAQSINKSLSSLADVISALAAQAKHVPYRNSTLTW
                     LLKPSLSRGAKTLMLLALSPLQAHLSETLCSLRFAAQVHGTHLGPHRHPPRPS"
     gene            complement(<841193..>842605)
                     /locus_tag="MRET_2149"
                     /note="MRES_08545"
                     /db_xref="GeneID:38738915"
     mRNA            complement(<841193..>842605)
                     /locus_tag="MRET_2149"
                     /product="nuclear segregation protein"
                     /transcript_id="XM_027628776.1"
                     /db_xref="GeneID:38738915"
     CDS             complement(841193..842605)
                     /locus_tag="MRET_2149"
                     /codon_start=1
                     /product="nuclear segregation protein"
                     /protein_id="XP_027484565.1"
                     /db_xref="GeneID:38738915"
                     /translation="MVDSTKTHGAVAAAPTPTVEIVKQPGGRPDQKHHNGEMDRLKSE
                     IDQTHAKIAQIRAALSGESLADSPSGKRRSALKDELTALRNQQAGRKGTRGKVFDELK
                     QVQDDIAHKIKALQQAKSKAPFKSVSELDAQVAQIEAQIESGSMKIVEERKALNDIST
                     LKRSRKSVEQFGEQQKEIDELRAHVADLRLSLDDPEMAAANKRYEEIKAEMDELSKEQ
                     EKLFGNRGKLLSQRTALSKHLDELYQARRDRLTAYHAENDKFFARVRAERERRQEAQR
                     KEREEADRMRQEAEIQALREDAALPAFAKEIEDCDVLIRYFSGASEEDTKGENVTQSA
                     SNSQPEVPKPDATVPEGAVVARKKGDEDDYFAGTGTGKKKGKGKKSGQQAAKAHGSDE
                     AGGAFNVPFGMLSALLSLSIPPPTNQADVPRLVDNIKLKREYFVSNQPHQTQENMRKV
                     EEKIAALQAKTASKETPAAA"
     gene            complement(<842749..>844344)
                     /locus_tag="MRET_2150"
                     /note="MRES_08550"
                     /db_xref="GeneID:38738916"
     mRNA            complement(<842749..>844344)
                     /locus_tag="MRET_2150"
                     /product="CTD kinase subunit alpha"
                     /transcript_id="XM_027628777.1"
                     /db_xref="GeneID:38738916"
     CDS             complement(842749..844344)
                     /locus_tag="MRET_2150"
                     /codon_start=1
                     /product="CTD kinase subunit alpha"
                     /protein_id="XP_027484508.1"
                     /db_xref="GeneID:38738916"
                     /translation="MRQENARGRGAHAPGQRPYQRRHENSWRSNSRYAHPRPPPEAET
                     HPRYNSHHRSFSPSQSSTSGRWWHRYPHGRSDEPDRKRRRDNTPPPPRQAPSTRFDRS
                     KPPLRDENRHLARRQNHDLSAQGHFDRSRHTPTSRWQSGNNEAPPQQHETTPDAQEAK
                     PPPPPPGPPPMKPKPSRLERAPSDTTSSLVDAYEIVAQVGEGTYGQVYKASAGSSSRL
                     VALKKIRMDNAREGFPVTSMREMKLLQALRHENVIRLHETMTSRTGSVYMVFEYMEHD
                     LNGLLVHPEVSFTHAHIKSLAQQLLRGLAYLHYRAVLHRDLKGSNLLLNRQGILKIAD
                     FGLARTYYKRKKGDYTNRVVTLWYRPPELLLGATQYGAEVDAWGAGCLFLELFQRRAV
                     FQGRDEIHQLQVMTRVLGPLSPEAWPDVQYMPWYELMRLEHKNDASKDTQSSSTVGTF
                     HSDFGGLLTEGAMSLAEGLLAYDPRRRLSMCEALQCPYFTSEAPAPEPPAELLSSLDG
                     EWHELQSKLALRHAQHQASKQVP"
     gene            <844551..>846980
                     /locus_tag="MRET_2151"
                     /note="MRES_08555"
                     /db_xref="GeneID:38738917"
     mRNA            <844551..>846980
                     /locus_tag="MRET_2151"
                     /product="fungal Zn(2)-Cys(6) binuclear cluster domain
                     protein"
                     /transcript_id="XM_027628778.1"
                     /db_xref="GeneID:38738917"
     CDS             844551..846980
                     /locus_tag="MRET_2151"
                     /codon_start=1
                     /product="fungal Zn(2)-Cys(6) binuclear cluster domain
                     protein"
                     /protein_id="XP_027484507.1"
                     /db_xref="GeneID:38738917"
                     /translation="MEELDFLDSQKLQAHSMTSTSTDSDAATQPPPRKRTKAHSCNSC
                     RRRKLKCDRGWPCGACRDRNEAHLCTWQEGVVPERVGRDAPDNMMLIQRMASLESKFD
                     ALLDKIDRMGDSKSGKELSTVQSETHNLEEMQSNSISDASFMLSMFLQPTDLAQRRRV
                     LSRMLLNTPNIKLLASILDSFNGQMHWISCIVDKKCVEAYLNDVVLLQNEVMHKKDFV
                     EKLNKDELTRYIYSVSSCLAICSLSLVISRDTKLDILRNDKDSLPLFQRYIRESLIGL
                     SSLPVLDEPNINFVIIMVTLVCCLGFSRSPGMASCLIGHAVQVAFLLDMDVEPPPDMP
                     FEEASRSVQVYCVLCTQDWFATMTIKRYPLIPFDKERFPSIFGTTEQRSKYLTPYQQL
                     KFKLAHLYCRSSPLMMPRAENYAYICQLHDEAMEILSVLPSMWPSTSDHAVNMFESSE
                     NLHRMIGLGAVHYLLLRIHLPFYMRGWNDSNYVTSRETCYSSARNLLHLFRQAFSWKV
                     GKSQNGDPSETLVPDDVSVPARMWYFSHWCTAAALLLLKHLAMLHERSGQQSWDHERE
                     CIVVDLCIMSRLFQYLSSISSFAREGYDAMQRVASHALHNDHEAKPLSGENCVTHWAD
                     RIMPSRTGSPSFEPMSVLSTLSKRNEFKYIPDKGQERPASNSGSSDSSLSSAVYPPTQ
                     SPGFSTPSKSVSDSTSPSVSDEELDTFWAKFVGSTSKQGSMINPLSLDMNASSGLPEP
                     SAFLMQSHHSAPVRVDPDMALMFQQEFTESDPLHLNSSTITPFTDDFLRSMDLSFALD
                     PSPATVPIPQT"
     gene            <847062..>849422
                     /locus_tag="MRET_2152"
                     /note="MRES_08560"
                     /db_xref="GeneID:38738918"
     mRNA            <847062..>849422
                     /locus_tag="MRET_2152"
                     /product="xeroderma pigmentosum group C-complementing
                     protein"
                     /transcript_id="XM_027628779.1"
                     /db_xref="GeneID:38738918"
     CDS             847062..849422
                     /locus_tag="MRET_2152"
                     /codon_start=1
                     /product="xeroderma pigmentosum group C-complementing
                     protein"
                     /protein_id="XP_027484510.1"
                     /db_xref="GeneID:38738918"
                     /translation="MARASARDEAGDAMNVTMSEEEDMEEVEMEDVGMDEVDIEPHAY
                     ADLYHEHTPGPHEPKNAIEITLSKPKETPKRKAPIATPQDRKNRVLIHQIHVVTILAA
                     ARLRNQWCNDLSLRNTLQDMVPDILLRKLQAIQPRHEPERRQRVRMFEAFMTDLIHWW
                     HGRFHVHTRVATAAAWRQPSIDTFQPVRIPPNTWVDGWIVESPSQRMQRHKQEARHKL
                     HPATEVSIFPPGAETSTPTYLCLLPPPEICASPTDLVAAAHAQLGSRETKAILFCALC
                     RSLGVPARLVVSPQVSSYTFSQSRPKSIPAAAEEEEEEEEETLYIEPLDEKAPPTVWV
                     EVYSKPYQHWLTVDPVRGFLKATGLRNMEPHASQRQNKLVYVVAFEEDGYARDVTARY
                     TRQLHTRVARMRPSGRHTDWWARVVRALHRPQKLDRDAVEDVELQDQARREPMPTSAG
                     AFKDHPVYVLERHLHRDQVIHPLHRVGTFQGQPVYLRAHVVQLRSARQWYNVGRDVKP
                     GEEPLKWTKQRSYTTTGKRLEEQVRATTGEDAMEGLFAEFQTRLYTPPPVVDGHVPRN
                     AFGNVDLFVPTMLPAGGTHVAHHLAARAAKQLNVSFADAVVGFEFRRFRSLPKLNGIV
                     VPTASASLVWDAIRQLEAHEVQNERAKVQKRAWKNWDKLITALLVSRRVQDEYKSVLT
                     VPEPQPEQAPLEESGTRQLRDVPELEPEPGPEPESKPAPSVPEPRAPHPSGPIVSLDE
                     MIAAESPPPTPPRRRIVLVRRHSPPRRRQSSRQRNHARPSYAEDDD"
     gene            complement(<849428..>850567)
                     /locus_tag="MRET_2153"
                     /note="MRES_08565"
                     /db_xref="GeneID:38738919"
     mRNA            complement(<849428..>850567)
                     /locus_tag="MRET_2153"
                     /product="carnosine N-methyltransferase"
                     /transcript_id="XM_027628780.1"
                     /db_xref="GeneID:38738919"
     CDS             complement(849428..850567)
                     /locus_tag="MRET_2153"
                     /codon_start=1
                     /product="carnosine N-methyltransferase"
                     /protein_id="XP_027484509.1"
                     /db_xref="GeneID:38738919"
                     /translation="MSVDTDERDHFQAVLRAWDDYLPYSLHRNNERRSSLYAQPHEHQ
                     AMLSRLSTPVPGPPGTPGAYAGFRDKLNEMDDRIRRNADVLSSMAQFCHSFLGIMNTE
                     PSMPPRTEQPTRSVSDRDQDRVRTVLKQMVRDWSQEGAEERKLAYDPIIEAVVSRVPR
                     NRRVLVPGSGLGRLAFELTQRGYACQGNEFSYFMLIPAHFILNCTERIHQHALFPFVH
                     SASNWRSASDMLRCIHVPDVLPSSLPEEADFSMVAGEFVEVYAKPEEHGAWDVVTTCY
                     FMDTAKNVLRYLEVINAVLPIGGLWINVGPLLWHFEHDTEPSLELTLEELLALAVECG
                     FEVEERRTLAPQTYTGAPLSMLSHHYVPEFWVCKKVRHHPMAPSI"
     gene            <850566..>852632
                     /locus_tag="MRET_2154"
                     /note="MRES_08570"
                     /db_xref="GeneID:38738920"
     mRNA            <850566..>852632
                     /locus_tag="MRET_2154"
                     /product="cytomegalovirus gH-receptor family protein"
                     /transcript_id="XM_027628781.1"
                     /db_xref="GeneID:38738920"
     CDS             850566..852632
                     /locus_tag="MRET_2154"
                     /codon_start=1
                     /product="cytomegalovirus gH-receptor family protein"
                     /protein_id="XP_027484512.1"
                     /db_xref="GeneID:38738920"
                     /translation="MQWAWVLHFLHIHTSCMPRQPGEMEAPTKRLDGVLNPAHHHEED
                     VWEDEEDEAHSTFETPVVAEFPRKEEIRRPQDVSPRPGSRRLSERFTERRKSSLRESD
                     STHLRHAHLSSTPSTPIRRTTKLHAPNAVSDSWCGRACHTVLTVLGLSAPFDAGDYVY
                     TVSSGTESHSSTLWDHLMDEVLLTSNETTQELRWERVSNFMAMPAWIEQMMWIGTLVS
                     LNAFLYMVTILPLRFGMAWIRWARNTWTWLRSNKKQFLTISNKCDILKGLLVWQTCYI
                     LSHVADASKMYHSVRGQDVLKLSVIFSVLEISDRLCSSFGQDVLDTLLSRYTLGRRAD
                     GSHAYLRIAGYYALCLAYMIFHTFVLLYQLVTLNVAINSYDNELLTLLLSNQFVEIKT
                     TVFKRFEKETLFQLACADVVERFQLGVTLGTIGLRNLMELSGASAMGGTGALGPLPTS
                     FEVYPYVNVLFRTLNPVLTVLISEVLVDWLKHAFIAKQNHIRPAVYGRFVDVLCRDIL
                     PPQSSVAMDGYTQRQSSFVDQSPLVIRRLGLAVLPLVCVLIRMASQVVYMFLPKERTS
                     FEYVIQTTAVFFSTLAVWLSLIVFKLLLGSYLVSYAKQRYASWHEREKEEQRNAKGRP
                     PIGEMPITMAHNAQIPEMVDKREDNAASVGLYGQQSPSIRAPGKKQDMSLLDVQRFSF
                     AGNRLW"
     gene            complement(<852633..>853553)
                     /locus_tag="MRET_2155"
                     /note="MRES_08575"
                     /db_xref="GeneID:38738921"
     mRNA            complement(<852633..>853553)
                     /locus_tag="MRET_2155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628782.1"
                     /db_xref="GeneID:38738921"
     CDS             complement(852633..853553)
                     /locus_tag="MRET_2155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484511.1"
                     /db_xref="GeneID:38738921"
                     /translation="MMHPETDPVFSSYILGTAADWQDLVWRTHIHEKLIPIAVLSVVH
                     AVRISHGTRMLSGGIHGRLGLFQSIVLNLIVLFGSSCLLSLLLGMPSPLLMSPFAIAL
                     YTSVHTILYVSGLGTFFVQLHSKPSLARCFDLVLACIDAVCRTEGIVSLGLVQVQRHA
                     NPVIASSWFVQILAGALVSGGMPLIAATFHLHSPMGLWQMGTPAWVQQPSRLLHADLI
                     GGAVASLLLLVLTSGHLDAKVPWIPRPSPTFAQWLSLRHKPDMHRVTHLPYLSLREAK
                     ALGTLTLFLCLTLPILFRPAVQKEAKKAKE"
     gene            <853631..>855157
                     /locus_tag="MRET_2156"
                     /note="MRES_08580"
                     /db_xref="GeneID:38738922"
     mRNA            <853631..>855157
                     /locus_tag="MRET_2156"
                     /product="rRNA-processing protein EBP2"
                     /transcript_id="XM_027628783.1"
                     /db_xref="GeneID:38738922"
     CDS             853631..855157
                     /locus_tag="MRET_2156"
                     /codon_start=1
                     /product="rRNA-processing protein EBP2"
                     /protein_id="XP_027484514.1"
                     /db_xref="GeneID:38738922"
                     /translation="MAKSQARRAQRAKDVVPHDLEDEEALHEGEDEAGISQKGLDRLM
                     RALGPDSLGDMDMALLEQLRNEEDEEQDEDEDENDDEDEDDEEEENVENLIDDEAEDD
                     VDEQEEEEEEDDDDEDVEDLIDDEAEEEDADDDEEDEDDDDEDVEDLIDDEAEEEDVD
                     DEEEEDSEGRIDDESKEEEDENSVEIDNKDGKNASSSAPKDSLAASILRSGLVPDEDD
                     DDDEEEEEEEEEENDDEEEEIPLDSLPSSASLSEQALASRHNRIRINNTEAMQRVYED
                     MRLDGPSTSGKMPWIETMSLVYEHATADEVPDAQNDLDRELSFYRQSLAAAIRGRELV
                     LAAKVSFSRPNDYFAEMVKTDEHMERVRQRLLDESASIKASEDAKRQRELKKYGKKIQ
                     TEKLFERQRSKRDMQEKVNALKRKRQTGLDMDDDEFDVQLEEALGERKASQRTQRGPN
                     KKRQYRDEKYGFGGKKRHNKSNTAESTDQVGPSRRKPGQRPKGGKAKRPGKARRAARR
                     "
     gene            complement(<855170..>856255)
                     /locus_tag="MRET_2157"
                     /note="MRES_08585"
                     /db_xref="GeneID:38738923"
     mRNA            complement(<855170..>856255)
                     /locus_tag="MRET_2157"
                     /product="RNA polymerase-associated protein LEO1"
                     /transcript_id="XM_027628784.1"
                     /db_xref="GeneID:38738923"
     CDS             complement(855170..856255)
                     /locus_tag="MRET_2157"
                     /codon_start=1
                     /product="RNA polymerase-associated protein LEO1"
                     /protein_id="XP_027484722.1"
                     /db_xref="GeneID:38738923"
                     /translation="MSDTEMAQAPPREEEDLFGDEASNDGAHASDEDRMDEEKAALEY
                     YEDDASASAPVMEERTAWVNVPQLPMRRTKETLLARLPNFVRYKDRPFDPASWDERDD
                     DADDDAEEVGDKHARSVLRTMSTIRWRWQDAGPSSYTPQSNARIVRWSDGSESLQIGS
                     EFLDVTRHAEPSTQGMPLTYIYVPHPEEGLLEAECAVRTSLTFKPNVHSETHSKIASA
                     IRHQRGMRVVASTDAFSDVDPEREKERIERQLKDAEKRKQRERMKAQRESNDFDGDLD
                     LGTRRHGVRGRASRSHVTEWSDDDEGPAAHAYDYEDEDDGFIVHDEEDGDEPEADDDD
                     VDRADRDIEAHERRRREEHHQEGEHTE"
     gene            <856385..>857795
                     /locus_tag="MRET_2158"
                     /note="MRES_08590"
                     /db_xref="GeneID:38738924"
     mRNA            join(<856385..856397,856426..>857795)
                     /locus_tag="MRET_2158"
                     /product="inverted formin"
                     /transcript_id="XM_027628785.1"
                     /db_xref="GeneID:38738924"
     CDS             join(856385..856397,856426..857795)
                     /locus_tag="MRET_2158"
                     /codon_start=1
                     /product="inverted formin"
                     /protein_id="XP_027484516.1"
                     /db_xref="GeneID:38738924"
                     /translation="MADMPAEDTMSGMNERKDCMYDKKMLLELSYSPLVRAPQGMASL
                     EEWYGPWKPYMPASSMSQSRSRDGRKDTQDASFPRRESGRAGHARRGPSEDGTERRSA
                     TFKPSGFVPAPGAPRHRGMRRPDDDERGWRRPAHDEQKGSGVPAWMQDDGTQTRPSAT
                     SGVESIEAFKAQMREMERQQRGEKPSAPPVPDATEGPEETEAEQASRFARFFDVHRDT
                     KETKHGTSSPAIGSLDLFGMWQNLQSRDADKRPSAPTASSSAVPKADTSAASGPGHAR
                     GMAHSQPVSQTHSPLVSPPTQSAAPSVLPPSLPDQGAAPKPSAADMASMQMLMSKLMS
                     ARHPSSAPLAEAPPGLGTPPRPAGPPGLSGAAHGPPGLAGRPPAPPPPPPPTGQGGAP
                     MTSMAFLQSLMNTSVRPPPSVPPGMPAPWPPMYGAPSGHGPPGAPPPGLLPRRPPGMA
                     APPWMQAKDP"
     gene            complement(<857817..>859502)
                     /locus_tag="MRET_2159"
                     /note="MRES_08595"
                     /db_xref="GeneID:38738925"
     mRNA            complement(<857817..>859502)
                     /locus_tag="MRET_2159"
                     /product="zinc finger protein"
                     /transcript_id="XM_027628786.1"
                     /db_xref="GeneID:38738925"
     CDS             complement(857817..859502)
                     /locus_tag="MRET_2159"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_027484515.1"
                     /db_xref="GeneID:38738925"
                     /translation="MDEREGTGTAGPDKKVSTPSSSLAVDKSQIPRPYKCPLCTRAFY
                     RLEHQTRHIRTHTGEKPHACTHPGCDKRFSRSDELTRHLRIHANDKRNAPGDGNDPAL
                     DRKGAALPKRRTRGAPRGRGAAKAGRPHVMHESEWPLPDAKASSDVAPPSAMPPAPVP
                     TYPSTVPMRDGGEMSALASLASGELKELHRQERESKAYAMRAAKYPYDEPRYAHQAAY
                     DLPPSLGHVPLDERYDYAPTYADRYREMRYERDPQHVFMPTQMMRASYAGRYGSLPPS
                     REASPGPTPPWTWMDDVHGDYETAASFRSRVRSNYVTPSGSPVLGPLRDMSIFTAPNS
                     PLPSRAGSPVHARPVRPDLPRVASQGSLSTLHTEGPNHTPGTSHHHGSMRFRAHPYDA
                     HTRRPHYHFAPHYTSAHPLSTLGERSTTTSVHADPADDLIKVPVSPSAYAPSSSSHVP
                     SPMMRSTRARWDAPPTPAMHMRSHLAHSAITRSAPASAANSPPGSPHLRPVFPPVSHL
                     APYSPAHDAKARPSNRVLSMPRMHDESHEAPADRITLPPLGPSVSGQKPMTLS"
     gene            <859947..>861503
                     /locus_tag="MRET_2160"
                     /note="MRES_08600"
                     /db_xref="GeneID:38738926"
     mRNA            join(<859947..859995,860038..860072,860100..>861503)
                     /locus_tag="MRET_2160"
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /transcript_id="XM_027628787.1"
                     /db_xref="GeneID:38738926"
     CDS             join(859947..859995,860038..860072,860100..861503)
                     /locus_tag="MRET_2160"
                     /codon_start=1
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /protein_id="XP_027484670.1"
                     /db_xref="GeneID:38738926"
                     /translation="MSSERQQVLSKDTTILVFGASGDLAKKKIFPALLRLFRHGDLPK
                     DTIIVGYARSKMTQQEFHERISSHFEGPKEDQNAFLGMCRYLSGQYDEEASFRELNAQ
                     VSKWEFERNRQHRHRIFYLALPPNVFVPVSGHLRMFCYSEGNVNRIVIEKPFGRDVDS
                     CREMLTSMKKMWSENETFRIDHYLGKEMIKNILPFRFGNGFIEHMLNNSMVDNVQFTF
                     KEPFGTEGRGGYFDKFGIIRDIQQNHLCQVFSLFTMDEPANFSPEAIRDAKVKLLRSV
                     RPISKDHALLGQYTATEDKPGYKDDETVPKDSNTPTFAAIVLKIENDRWRDVPFIMRA
                     GKALDGAKVEIRVQFRDIKHKFDDKIERNELVLRIQPGEALYLTINAKLPGMTHLTVP
                     VELDMTYRSRFQDAYIPEAYEALILDCLRDEHANFVRDDELEASWQIFTPLLHAIESG
                     EVPCAPYKYGTSGPEGLRDFMGKFGYRPLDLYHRPQAQQDVNAKV"
     gene            complement(<861607..>862258)
                     /locus_tag="MRET_2161"
                     /note="MRES_08605"
                     /db_xref="GeneID:38738927"
     mRNA            complement(join(<861607..862211,862255..>862258))
                     /locus_tag="MRET_2161"
                     /product="superoxide dismutase, Fe-Mn family"
                     /transcript_id="XM_027628788.1"
                     /db_xref="GeneID:38738927"
     CDS             complement(join(861607..862211,862255..862258))
                     /locus_tag="MRET_2161"
                     /codon_start=1
                     /product="superoxide dismutase, Fe-Mn family"
                     /protein_id="XP_027484671.1"
                     /db_xref="GeneID:38738927"
                     /translation="MVEATLPPLPYEYNALEPFISAEIMTLHHSKHHQTYINNLNAAS
                     KASVEAEKNGDLQKVLELQSAIKFNGGSHMNHSLFWKIMAPPSQGGGKLEDGQLKQAI
                     EKEFGDIETFKNKFNSASAAIQGSGWCWLGLSKTGNLDIVTTKDQDPLLSHHAIIGSD
                     IWEHSWYLQYRNDKATYFKQWWNVVNWKEAENRYNEAKKASL"
     gene            complement(<862425..>863460)
                     /locus_tag="MRET_2162"
                     /note="MRES_08610"
                     /db_xref="GeneID:38738928"
     mRNA            complement(join(<862425..863259,863288..>863460))
                     /locus_tag="MRET_2162"
                     /product="zinc finger protein (RING finger)"
                     /transcript_id="XM_027628789.1"
                     /db_xref="GeneID:38738928"
     CDS             complement(join(862425..863259,863288..863460))
                     /locus_tag="MRET_2162"
                     /codon_start=1
                     /product="zinc finger protein (RING finger)"
                     /protein_id="XP_027484672.1"
                     /db_xref="GeneID:38738928"
                     /translation="MRTGTRDGSRKRPKVVVESDDDTQALDHEPSHAHVAMAQIEQGL
                     LCGICIELYDRPCVLSPCGHVFCAGCLVTWFSVAQEVNEDPYDERRQGLIRRKKMCPS
                     CRAQINTPPVELWALKDVLAAIRNYKGVSISNTSEIKQSLWDGLFNPTTFYHVIRDQD
                     DGVLRCGICSSEILDGQCTGNDCGIVYENLSDEEQALHADNVHAESEDVSADEEEDAG
                     SLNDFVVDDNDDVGQEIESASDDSSIVAVSPKRSEQDMSSSSEQEDDDTLPDPSYVRR
                     KRLEALLQARSRRRHPSGPASPPTDSESQDYTDEHDTDDHGGHMIYDEAEEASSDVAS
                     V"
     gene            <863610..>864917
                     /locus_tag="MRET_2163"
                     /note="MRES_08615"
                     /db_xref="GeneID:38738929"
     mRNA            <863610..>864917
                     /locus_tag="MRET_2163"
                     /product="ATP-dependent RNA helicase UAP56/SUB2"
                     /transcript_id="XM_027628790.1"
                     /db_xref="GeneID:38738929"
     CDS             863610..864917
                     /locus_tag="MRET_2163"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase UAP56/SUB2"
                     /protein_id="XP_027484673.1"
                     /db_xref="GeneID:38738929"
                     /translation="MENEDLIDYEEEVSVPTSGAAQTDAGASAGAPAASGADEGNKKG
                     SYVGIHSTGFRDFLLKPELLRAISDLGFEHPSEVQQECIPQSILGMDVVCQAKSGMGK
                     TAVFVLASLQQLEPVDGEVSVIVLCHTRELAYQIRNEYARFTKYMPEVRTAVVYGGTP
                     IKEDQAMLADKTKCPHILVGTPGRMTGLVRDKSLKASEVKHFVIDECDKILDNLEMRR
                     DVQEIFRATPHHKQVMMFSATLAKEIRPTCKKFMQNPLEIYVDDETKLTLHGLRQYYV
                     RLEEAAKNRKLNDLLDTLEFNQVIIFVKSISRANQLDQLLRECNFPSICIHGALAQDE
                     RIKRYQQFKNFEKRILVATDIFGRGIDVERVNVSISYDTPSDADSYLHRVGRAGRFGT
                     KGLAITFVSSDEDAEVLKQIQSRFEVAVPELPDSIEASTYMNA"
     gene            <864988..>865626
                     /locus_tag="MRET_2164"
                     /note="MRES_08620"
                     /db_xref="GeneID:38738930"
     mRNA            <864988..>865626
                     /locus_tag="MRET_2164"
                     /product="methyltransferase-like protein 13"
                     /transcript_id="XM_027628791.1"
                     /db_xref="GeneID:38738930"
     CDS             864988..865626
                     /locus_tag="MRET_2164"
                     /codon_start=1
                     /product="methyltransferase-like protein 13"
                     /protein_id="XP_027484674.1"
                     /db_xref="GeneID:38738930"
                     /translation="MSREVDIDDPKNADFQTVEYWDKRYAAEAEDADFDWFRKYRDIQ
                     HIFHELVPDRQSRILMLGCGNSTLSKDMYDDGYTHIVNLDYSAVVIDKMQARFPELDW
                     RVMDIRDLDKHADKLGGPASWDVIVDKGTMDALMAENGSVWSPSEQVLNNVAQEVDGV
                     LHLLKSHTGVFLYFTFGQPHFRRPHMQRDAWTIETRELGDMFHYYLYIARKH"
     gene            complement(<865623..>866360)
                     /locus_tag="MRET_2165"
                     /note="MRES_08625"
                     /db_xref="GeneID:38738931"
     mRNA            complement(<865623..>866360)
                     /locus_tag="MRET_2165"
                     /product="pre-mRNA-splicing factor spp2"
                     /transcript_id="XM_027628792.1"
                     /db_xref="GeneID:38738931"
     CDS             complement(865623..866360)
                     /locus_tag="MRET_2165"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor spp2"
                     /protein_id="XP_027484238.1"
                     /db_xref="GeneID:38738931"
                     /translation="MSISFSLKHAAKGVKAARLNRARLDEEEEEEENSVRDVPLSGKR
                     KRETSLPAAPKVIPLLSSSDWRQDRKRRNGVVKPENFKPLDGDTTPPANQASSRDDTP
                     PPTSQDPSDAAALQALLSGDAVSTKTAGPKRIITQPSEEDMLHHDVDTRPDEPTLHDY
                     QSMPVEEFGAAMLRGMGWREGMGAGKQRNGPAQAPEVRKRAALLGLGAKERPIPTSVG
                     PRHRSSDPKRFSHHDTRSRHSPMSMRR"
     gene            <866469..>867725
                     /locus_tag="MRET_2166"
                     /db_xref="GeneID:38738932"
     mRNA            <866469..>867725
                     /locus_tag="MRET_2166"
                     /product="saccharopepsin"
                     /transcript_id="XM_027628793.1"
                     /db_xref="GeneID:38738932"
     CDS             866469..867725
                     /locus_tag="MRET_2166"
                     /codon_start=1
                     /product="saccharopepsin"
                     /protein_id="XP_027484675.1"
                     /db_xref="GeneID:38738932"
                     /translation="MKLGLAVFLALAVAGVHAGVFKSRLSKLPNAGQRTLSSMVSQAE
                     FLGAKYGAAGKQQPFSLIHDAAGDVRIQSTDAGMMSERWHANANAGHNVPLTDFLNAQ
                     YFADIEIGSPPQQFKVILDTGSANLWIPSESCTSIACLIHRKYDNALSTTYQANGSDF
                     GIHYGSGSVEGFVSRDNLKISDLEIKGQEFGEATTEPGLAFAFGKFDGILGLAYDTIS
                     VNKIVPPFYKMVEQNLLDENLFAFYLGENDSEGGEATFGGVDTDKFEDPIVYAPVRRR
                     GYWEVALNKVGFGDEELELPRTGAAIDTGTSLIAMPSAVAEILNKQIGAKRSWTGQYS
                     LDCSRIPSLPSLTFYLDNKPYTLEGKDYILNIQNTCISSFMGMDLPEPVGPLWIIGDV
                     FLRKFYTVYNLDKNAVGFAKAVHRHH"
     gene            <868168..>870228
                     /locus_tag="MRET_2167"
                     /note="MRES_08630"
                     /db_xref="GeneID:38738933"
     mRNA            <868168..>870228
                     /locus_tag="MRET_2167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628794.1"
                     /db_xref="GeneID:38738933"
     CDS             868168..870228
                     /locus_tag="MRET_2167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484676.1"
                     /db_xref="GeneID:38738933"
                     /translation="MMWKTAGPSMIRWSLLAILLATLMQSSGVNALPHRGHVLAARSA
                     LTSSTSSVSSAAQSTASKSVQTSQADGSQSNKKNEANDEEFARELQRTIQTQMEKESI
                     DGGVKFDLGEILGKMYKGESINMYGGVSKEKNNTSVSESLPRGTSTSSVSLSASSKKS
                     KSPKKFKSKKLSKSSPSSSSTTHSTSSHSESEPCTSSKSKSHSKSSPSSSSTTHSTSS
                     HSKSESSSSSSSKSHHRHHHKSKMAAKARKSRSSKSSNRLHKSKAHKSKAHKSHSSKS
                     KSRHSTSESTQSSEASQEMGRTAAVGAGQKSQRGGFYRISMNERADSGRKLGVVSGSR
                     VASTSAKEPHGNLPNQSVITNNPSYGFLEAQDDLYSIRKWAGDLGRLVSKEHRNETIM
                     ALFDAASRYYPDVDTKTVVRIMLADIKAESDFESENRSAGREDSGQSLGLLQVSPYGS
                     GELKQFQSMAQVDYNTYSWAVGTGSEDEVSMGGFSELGELVDFKTNKKINLKGLSDHD
                     LSRPWINIHIAMWIQSNLARTASRDPSDWHRIASSSKAVRKAYAPAIKQIVSSLENKG
                     SRNAASSSSSSSSSSSSSSSSSSWDEKEYASKLEKLEKEFQTKHNTRASFATGLGSWV
                     AGPTVDDSSGYNRSGDDVSKEYFNNISEGLSVMYTGSTKHKHKYGKKYLESIELVRGL
                     VDYN"
     gene            complement(<870303..>870663)
                     /locus_tag="MRET_2168"
                     /db_xref="GeneID:38738934"
     mRNA            complement(join(<870303..870346,870375..>870663))
                     /locus_tag="MRET_2168"
                     /product="dynein light chain roadblock-type"
                     /transcript_id="XM_027628795.1"
                     /db_xref="GeneID:38738934"
     CDS             complement(join(870303..870346,870375..870663))
                     /locus_tag="MRET_2168"
                     /codon_start=1
                     /product="dynein light chain roadblock-type"
                     /protein_id="XP_027484669.1"
                     /db_xref="GeneID:38738934"
                     /translation="MIQPDEDSVPDEAAQVLAQLTKHEHVRGCVALTAADQRVIWSGG
                     VTFASEAKLAQVVHFVRDTLAVVQRHMDILEPDDDLGLMRIRTGKYELLITPSKSYLL
                     VVMQDPSL"
     gene            complement(<870683..>873124)
                     /locus_tag="MRET_2169"
                     /note="MRES_08635"
                     /db_xref="GeneID:38738935"
     mRNA            complement(<870683..>873124)
                     /locus_tag="MRET_2169"
                     /product="mitotic spindle assembly checkpoint protein
                     MAD1"
                     /transcript_id="XM_027628796.1"
                     /db_xref="GeneID:38738935"
     CDS             complement(870683..873124)
                     /locus_tag="MRET_2169"
                     /codon_start=1
                     /product="mitotic spindle assembly checkpoint protein
                     MAD1"
                     /protein_id="XP_027484498.1"
                     /db_xref="GeneID:38738935"
                     /translation="MAGAERDALPETISTPSHTSQRRNVAALASSLPLPSSRRVTTPH
                     QAPPNDRRTPLAQGPLGGYRSLSRSKGTPMHDKLLGKRSFSSSSLQEQGGFSTPQPQG
                     SKRPLVSSVLATAPRPTRVTSNEHDAFQTPLVQRQRHHGISPSPASDDYELQMLRSEY
                     ERRIQTEQHANQVMEVQMRSQLRELEALKCQRVEVLREWETERAMQQEKQRAWDKVRS
                     ETEAQLASLRADSLRLQSRNDELESQLSATARDAHTESVSIKSQLARLQTECELSTSQ
                     NESLSRTNEHLLARINELESAPLEKSAPSDEDAALFKDQLSQSLTTIQRLEAANVRLT
                     SENKRLADASARIDVLRESNRGLEAKLTQLPKLQEALLEKDAELASLRDEQSRWISVL
                     EHGIKTEEHAAFMAAAHASDQAPPQTAVPETLSPETLPAYISTLRGTVMGLYARIEGL
                     GHSVEQMRTANLDLSRRAAQDSETETQLRKELHQKSDLLLRAQRQLDIQSDDLRRCKE
                     VLESFEQEAQQGDTSYEATHQRRITGLEERIALLMAECDSLTQKLAESERVPPTANHP
                     ASEEALLVLEAQFRELEQHAQALSTENETLWLRVGRGEFNAERERCLVLTDNPVSRDL
                     AVRTSTLEALRKENAGLLEQVEALHKQLTSAHLPAPATGTDAVVPLQTVDNLRAELTK
                     LQETLQLKDKGMLRLKQVFTAQANLFREAVQSLFGYKIRFMENGKVKLTSAYAGSARG
                     TTLVFRSDEGNVGEMKLQGEANDGLANVAHLRDYWLSDGIRHSVPCFLAALNLELYEN
                     TTQAIRSSFGADVEA"
     gene            complement(<873213..>874226)
                     /locus_tag="MRET_2170"
                     /db_xref="GeneID:38738936"
     mRNA            complement(<873213..>874226)
                     /locus_tag="MRET_2170"
                     /product="bZIP transcription factor"
                     /transcript_id="XM_027628797.1"
                     /db_xref="GeneID:38738936"
     CDS             complement(873213..874226)
                     /locus_tag="MRET_2170"
                     /codon_start=1
                     /product="bZIP transcription factor"
                     /protein_id="XP_027484609.1"
                     /db_xref="GeneID:38738936"
                     /translation="MTMEPALYSTWTESSSGKPNIHSNMFDQIPIASMSPPSAPSDDD
                     VSYSSSSAEKTWDEPSALFHLDFSSHEPTSGNMESALFAPPFDEPPTPFVQDRVAGTP
                     HGSINPQVLMPKIKDEPDDEESKALELTLKLQKSDSSHTSTSFTAFTPMRLDASDTSS
                     VDIKPIISSARLKSPSPDLDQENLRPSPEEYSRLSSKEKRQLRNKISARNFRNRRKEY
                     ITLLEEKLHERDSMIKQLQHQLSSLRLENGALHEELKVQRSRPVSTVDVSKLINALQR
                     NAHSPSSRASSPDALDGARPSCSSPSNFALSNKDTHVSSGRPDSPSNGACWNRLAHMA
                     MVA"
     gene            <874435..>874847
                     /locus_tag="MRET_2171"
                     /note="MRES_08640"
                     /db_xref="GeneID:38738937"
     mRNA            join(<874435..874496,874523..874628,874660..874746,
                     874773..>874847)
                     /locus_tag="MRET_2171"
                     /product="tubulin-specific chaperone A"
                     /transcript_id="XM_027628798.1"
                     /db_xref="GeneID:38738937"
     CDS             join(874435..874496,874523..874628,874660..874746,
                     874773..874847)
                     /locus_tag="MRET_2171"
                     /codon_start=1
                     /product="tubulin-specific chaperone A"
                     /protein_id="XP_027484608.1"
                     /db_xref="GeneID:38738937"
                     /translation="MGSDVQTEKRQLTIKTGVVQRLNKELGLYKQEADEQAVRVKDYV
                     DQGRDEWDIRKQEEILRDCEQMIPDTTRRLKDATTELHTYMTGVSEAARQTDEWHKAD
                     KALAAVP"
     gene            <874870..>876363
                     /locus_tag="MRET_2172"
                     /note="MRES_08645"
                     /db_xref="GeneID:38738938"
     mRNA            join(<874870..874961,874990..875025,875051..875157,
                     875189..>876363)
                     /locus_tag="MRET_2172"
                     /product="ribonuclease Z"
                     /transcript_id="XM_027628799.1"
                     /db_xref="GeneID:38738938"
     CDS             join(874870..874961,874990..875025,875051..875157,
                     875189..876363)
                     /locus_tag="MRET_2172"
                     /codon_start=1
                     /product="ribonuclease Z"
                     /protein_id="XP_027484607.1"
                     /db_xref="GeneID:38738938"
                     /translation="MMLVLMAPPPPIEVKFLGTCTSPIMTRNYSSLLVKLGHDTVMID
                     CGEGTQRQLILPHVQAGVKLSNIRTILITHLHPDHILGLTPLIFSMMGLSSAPGKDDR
                     PRLELVGPLGLRAFLRTTLSITYATLNSCFVVHELLWPSQPAYPHHPSGSFIYTEEDI
                     YLPPDVRGQTRTLPCMPPHANELPGRDIRMDESTGTWPRILQLGNVWISAAPITHRCP
                     TVGYVFEEAPTASKSVSPRDLAILDSNAEALFDLYQIRHPRSLLSRVLKARETLTLPD
                     GHVLVPPPLDRPGRKLCILGDTSDATAGLEDKGMLALARDADLLVHECTYAYMREKDV
                     LAAPSPEHAQLLQQLLLAEGEAEPRALSRGHSVPRIAGSFAGLIRARHVVFNHFSARL
                     PAPHTMSHAPLTSTDQLRPDARLAESEQWFHVMREIERQVTEFWHASLPEDVRAHMGD
                     RRAVAAYDGLAYILPPLSP"
     gene            <876398..>877762
                     /locus_tag="MRET_2173"
                     /note="MRES_08650"
                     /db_xref="GeneID:38738939"
     mRNA            <876398..>877762
                     /locus_tag="MRET_2173"
                     /product="serine/threonine-protein kinase PRP4"
                     /transcript_id="XM_027628800.1"
                     /db_xref="GeneID:38738939"
     CDS             876398..877762
                     /locus_tag="MRET_2173"
                     /codon_start=1
                     /product="serine/threonine-protein kinase PRP4"
                     /protein_id="XP_027484606.1"
                     /db_xref="GeneID:38738939"
                     /translation="MSQKRKAGDEEYDDYFVQREQEESRLAELRKRRREKLAQLAPPV
                     PPPAPPPMPEPEAPPRQAPEAPPEPLDDMFDVDNTAWSGREEPAKAPEQQAWSGTEDF
                     GGAEGAAGLHDNWDDPDGYYRVMLGEKLQQRYQIFAILGRGIFATVVRARDLQQNGRE
                     VAIKIARRQETMHKAGMREISILQRLSEADPDNKMFIVHFFTHFEHRGHLCMVFESLG
                     LNLREIVKRFGKDVGLNLQAVKTYTKQMLLALALLREKQFVHADIKPDNILVNEAKTI
                     AKLADFGSASTASEMEITPYLVSRFYRAPEIILGQPHGCEMDMWSMACTIYELATGHI
                     LFPGKNNNHMLLLMQKLRGKPLVKQLKKCEFALQHFEDYHTFLSTEVDTTTGESIVRR
                     VNTTHPTEDLRAKMLPGGTAKHMRPEELRQTQLLIDLLHRMLEWDPSKRITPLDALQH
                     AFVQ"
     gene            <877848..>879590
                     /locus_tag="MRET_2174"
                     /note="MRES_08655"
                     /db_xref="GeneID:38738940"
     mRNA            join(<877848..879228,879256..>879590)
                     /locus_tag="MRET_2174"
                     /product="ATP-dependent RNA helicase DDX5/DBP2"
                     /transcript_id="XM_027628801.1"
                     /db_xref="GeneID:38738940"
     CDS             join(877848..879228,879256..879590)
                     /locus_tag="MRET_2174"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DDX5/DBP2"
                     /protein_id="XP_027484605.1"
                     /db_xref="GeneID:38738940"
                     /translation="MSYGGYNGSNDAGSGGYRGGYGGGYRGGYGGGQGGGYGGGYGGG
                     YGSGYGGGYGGGYGGGYGGGYGGGYGGGYGGGYGGGYSGEELGAGLNKATWSEADLVP
                     FEKNFYKEDPRVTERSDEQVAEFRRAKEITLRGSNVPKPVMTFDETGYPDYIMREINK
                     LGFTEPSPIQSQAWPLAMSGRDLVAIAETGSGKTIGFALPSFVHIKAQPPLQYGDGPI
                     ALILAPTRELAVQIQNECSRFGSPCRVRTASVYGGVPKGPQIRALQRGAEIVIATPGR
                     LIDMLAIGKTNLRRVTYLVMDEADRMLDMGFEPQIRKIVEQIRPDRQTLMFSATWPKE
                     VQRMAADFLNDYVQVNIGSMELTANRNVKQVIEMCSEFDKRGRLIKHLEQISQENGKV
                     IIFANTKRGADDLTKFMRQDGWPALAIHGDKQQDERDWVLREFKSGNSPIMVATAVAS
                     RGLDVKDISYVINYDFPTNTEDYVHQIGRTGRAGRKGVAVTFFTSENAKSARELVGLL
                     RDAEQEIPPELQEMVRYSGGGGGGGYRGRGGRGRGRGRGGGFGGRRFGPRSSGANNIQ
                     VGSRW"
     gene            <879623..>880879
                     /locus_tag="MRET_2175"
                     /db_xref="GeneID:38738941"
     mRNA            <879623..>880879
                     /locus_tag="MRET_2175"
                     /product="DNA-(apurinic or apyrimidinic site) lyase"
                     /transcript_id="XM_027628802.1"
                     /db_xref="GeneID:38738941"
     CDS             879623..880879
                     /locus_tag="MRET_2175"
                     /codon_start=1
                     /product="DNA-(apurinic or apyrimidinic site) lyase"
                     /protein_id="XP_027484604.1"
                     /db_xref="GeneID:38738941"
                     /translation="MRLVCWNVNGLRTLRSYAPWDGLPTLEACLEALQADIACFQEVK
                     MTHRQLTYAMCVMEAYDAYYDLHPTKGYAGTATYVRRAVCMPRDAQVGVTGLGQDLDA
                     EGRCVVLDCGLFVLLNVYAPNETDAERLPYKMAFYRALEERVSKLIEEGREVLVVGDM
                     NVVADALDHCEGAHLPPHAARVWFRQWLAPHGALHDVTRRFHPERKNMYTCWSTQLDA
                     RRSNYGSRIDYTLATQGLLRWIRYADIQPHVYGSDHCPIYVDLYDHLDGESLADVVRP
                     GTEAPRLAASHQHRHQPRLDLWTVKRAPETRASRRPRPRQTKLDGFVRRPPPLSPSPP
                     PPLPAPEPHPQTSEWSALFTPRAPPLCTVHREPAISRRVTKPGVNHGRTFWMCARPVG
                     PGYAQQAVTPYRCRYFAWDTDVRRRR"
     gene            complement(<880863..>881960)
                     /locus_tag="MRET_2176"
                     /note="MRES_08660"
                     /db_xref="GeneID:38738942"
     mRNA            complement(<880863..>881960)
                     /locus_tag="MRET_2176"
                     /product="N6-L-threonylcarbamoyladenine synthase"
                     /transcript_id="XM_027628803.1"
                     /db_xref="GeneID:38738942"
     CDS             complement(880863..881960)
                     /locus_tag="MRET_2176"
                     /codon_start=1
                     /product="N6-L-threonylcarbamoyladenine synthase"
                     /protein_id="XP_027484603.1"
                     /db_xref="GeneID:38738942"
                     /translation="MLRRSVARQAPRSARTILGIESSCDDSCASVVRSDRTVLSSVVV
                     RQNHQDTQGIHPLHAARGHHRHVPRAIAQALDEAQLTIHDLDGIGVTRGPGMPGCLAV
                     GMTAAKTLAAVHAKPLVYLHHMRAHALTPLLTEAQPPAFPFLTLLVSGGHTMLVLVHS
                     LDRFAILADTLDDSVGNAFDKFARELQLGWQSASGALVEALAAHAQPHEPVLPHILLG
                     TPTFSYSGLRSAAARHIARVGGAAAMSHAAKAALAHDFQVAAFAPLEDKVVRALVPQQ
                     RGWQLPGMDPMSIRSVVCSGGVASNQFLRHRLRCALDKHGRSDVALHFPPLSLCVDNA
                     AMIAWAAHLYWHTRTHDMTPHVVAKWPIDAA"
     gene            complement(<881972..>882745)
                     /locus_tag="MRET_2177"
                     /db_xref="GeneID:38738943"
     mRNA            complement(<881972..>882745)
                     /locus_tag="MRET_2177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628804.1"
                     /db_xref="GeneID:38738943"
     CDS             complement(881972..882745)
                     /locus_tag="MRET_2177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484602.1"
                     /db_xref="GeneID:38738943"
                     /translation="MNRSSVIDLTDESPTSQPRSVPDEDVSVLNVRLVSPPYRTRRRR
                     QRHPVVDVDAMPEAPAGQHIHEGIPPGPYTRRVRRAPVSHADRTRLMERLEMLASRYV
                     ARAHQHGSPPQTLLRPYAEAPAVTCGHAMTPPALPKRFDRTWTHPLAPSPGFSQSIIE
                     PAIDVERVSSGDRDAVAPIPNTTPICARCQHALILNGVGEDRIWALPCGHVIDGRCVA
                     QLSDAASGKRHVFTCPVPQCKQRCHPEPGHSHSCIEVYS"
     gene            <883783..>884220
                     /locus_tag="MRET_2178"
                     /note="MRES_08665"
                     /db_xref="GeneID:38738944"
     mRNA            <883783..>884220
                     /locus_tag="MRET_2178"
                     /product="ribosomal protein L30p/L7e"
                     /transcript_id="XM_027628805.1"
                     /db_xref="GeneID:38738944"
     CDS             883783..884220
                     /locus_tag="MRET_2178"
                     /codon_start=1
                     /product="ribosomal protein L30p/L7e"
                     /protein_id="XP_027484611.1"
                     /db_xref="GeneID:38738944"
                     /translation="MRRMWTRNAVGRWALGSAMRHFHSTTSAWVSTSHYRITLRRSAI
                     GLPRRTGRVVEALGLRKRLQSVYHAQTPVIAGMILAIKELVHVENVRQLAPTSEQEEP
                     IWVNEEGHVVDAGRAARKAPRGFKVVGNLMDEQRDASLRASRS"
     gene            <884737..>885177
                     /locus_tag="MRET_2179"
                     /db_xref="GeneID:38738945"
     mRNA            <884737..>885177
                     /locus_tag="MRET_2179"
                     /product="4-hydroxybenzoate polyprenyltransferase,
                     mitochondrial"
                     /transcript_id="XM_027628806.1"
                     /db_xref="GeneID:38738945"
     CDS             884737..885177
                     /locus_tag="MRET_2179"
                     /codon_start=1
                     /product="4-hydroxybenzoate polyprenyltransferase,
                     mitochondrial"
                     /protein_id="XP_027484610.1"
                     /db_xref="GeneID:38738945"
                     /translation="MTTSVFAKSLPASVRDAVILSLRRTPPYPSNGHGGDSLRRLVLQ
                     RNALGSVMDVQDTGSTRHMSLRKFSAEMSPYASDTRSKQSSVRHAHPPLRKSRSAQDL
                     AVLSVVGDPLASSTHEELLEDMWFERVMEDLSLDDSASHHRPGL"
     gene            <885372..>886616
                     /locus_tag="MRET_2180"
                     /note="MRES_08670"
                     /db_xref="GeneID:38738946"
     mRNA            <885372..>886616
                     /locus_tag="MRET_2180"
                     /product="4-hydroxybenzoate polyprenyltransferase"
                     /transcript_id="XM_027628807.1"
                     /db_xref="GeneID:38738946"
     CDS             885372..886616
                     /locus_tag="MRET_2180"
                     /codon_start=1
                     /product="4-hydroxybenzoate polyprenyltransferase"
                     /protein_id="XP_027484373.1"
                     /db_xref="GeneID:38738946"
                     /translation="MQPIQLSPVGMRSLRPYALLALSTRSPRTALKARHNLPPYSTHY
                     GLTRLFATSVRFHTQDPSSLKSETSPSLPASSQSQPKKFSLRPYMDLMRMGRPIGTYL
                     LYAPCAWSITMAAQYTNAHPNVWLTNLALFAVGAFVMRSAGCVINDMWDAKIDAKVER
                     TKSRPIASGAVSYGQATTLLGLQLSTALAILLQLNTYSIVLGVIALVPVIIYPTMKRY
                     TNMPQIGMGISFTTGSLIGWSAVAGSCYWPAVLPLYASTIIWGIHYDLIYAHQDKVDD
                     KATGVGSMALLFGDEHTKKALTAFSIVWMALLAYAVQAQSPIFPSFFAENGDTLSFQD
                     WFQHTLNTGHPFFAVSWLATAAHVIWQIRTLNMNNPADCWAKFSSNRIVGLIIFLGLA
                     ADYLYQRMDGNGQAESAPIKAT"
     gene            <886920..>888248
                     /locus_tag="MRET_2181"
                     /note="MRES_08675"
                     /db_xref="GeneID:38738947"
     mRNA            <886920..>888248
                     /locus_tag="MRET_2181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628808.1"
                     /db_xref="GeneID:38738947"
     CDS             886920..888248
                     /locus_tag="MRET_2181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484374.1"
                     /db_xref="GeneID:38738947"
                     /translation="MWLKHFALCLLVSASIVQAGNPLATKDQKELDELSKSLLTEKSL
                     DGLREKARQQFVKSLRKYHVQLTDEVNKDLDIAMDELVFSSIQKAVNNDPSNPKVYWT
                     DTAKRSHDWFGLNVPGGRYSYDNPDCIYRIIPVSDKHKYRIRGRRFGNGTADQSFSVI
                     NNPNSQGTVAALYKQDLKVNDDGTYEIIISSGKKEGQNHIKSDWSAKQVYIRNNLGDW
                     SKETPDELSVEIISDTKKKSTKKRSRKDILKDAEHGLKQSIFFYGFGALDFKTLSQPL
                     NHLPNPDQSSWLGTLTSQAQSFSHFKLKSDEAFVITLTSGKSSYWVLPVTTMGLLTQD
                     PENNIVSFNPYQSAQNKNGSYTFVLSAKDTGIRNWIDTSKLSQGTLMVRWQGLPKGDG
                     TVKSIQLYSQVVKIDDLDKVLPSETERLDKDGRQRQIEQRRREYRRIHFQ"
     gene            <889357..>890685
                     /locus_tag="MRET_2182"
                     /db_xref="GeneID:38738948"
     mRNA            <889357..>890685
                     /locus_tag="MRET_2182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628809.1"
                     /db_xref="GeneID:38738948"
     CDS             889357..890685
                     /locus_tag="MRET_2182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484371.1"
                     /db_xref="GeneID:38738948"
                     /translation="MEVHLQSSRGRSRTRQKHFASKRSTGARHEDEQISWIADDICTR
                     CGAAAPHGKLYCSIKCRNADIASESSIKKVEEDDTVLHDSLNQLRYPMTLSPHLTPFS
                     LKPTTSLRKSSAPKHGRNGTSTCSLACDGDSQGVCRAHARKASQSTDSDVSDLIDTDL
                     TTPSPWRIGIDAPDDSDGISDLDDAELRLPPSVLGSEPASMPVTSGAIPLSIQSGTRT
                     PRPHKSCTSPALLPQLTAPSQHVQSPILFHRMPSSTNLPSSMGFISKIYPSHSLRHSH
                     IGNFESNSSGQCTPQFRRSPPRRVSPEREQGDVFHPNTLSKASTIQPTYPQEASIIKS
                     SPETVYPTSQGTVLNSRDINSASQHCAGRTSPGVDAMHKDDNEEPQRGRSRTRHGHSC
                     CTGRRRSLWATCHACSLPTTSLPSHQVLGNALLCPSLSSHNEENTKSPVF"
     gene            complement(<890980..>892089)
                     /locus_tag="MRET_2183"
                     /note="MRES_08680"
                     /db_xref="GeneID:38738949"
     mRNA            complement(<890980..>892089)
                     /locus_tag="MRET_2183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628810.1"
                     /db_xref="GeneID:38738949"
     CDS             complement(890980..892089)
                     /locus_tag="MRET_2183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484372.1"
                     /db_xref="GeneID:38738949"
                     /translation="MTTQARHIQRHHASRPSIMEVYHMITEEEAQARIKEEQERDRYA
                     KRWSSGYELLAEMQSRGAKQHSPPPPTIQLDDSLHESEIESPLQSKTRSSVSFSTSPP
                     YSPPQAEQPHEMSLYPLESSIYPSKHKISQDSPLKPNANIPDVDHIVAESELGSILTN
                     DTVSMGSKPEPSTQPPEAEDATVPYDLWKTVQLLKLITHGSQLADKQNGDESIRQMMH
                     LIKTQNASDSMFSQKDADTTDALAMDLRLEKISLDDAEYAQRLDDIRHRLGELVTKVD
                     LSSEHATSADISKTSFVASLWSQLSGFHKSTTRALFTSACIMLLALALLLGLRFRAEY
                     LWQYSYHDILYPSLYPLPSYVSLFLSPDVEYGAPF"
     gene            892196..892286
                     /locus_tag="MRET_t0036"
                     /db_xref="GeneID:38741230"
     tRNA            892196..892286
                     /locus_tag="MRET_t0036"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:38741230"
     gene            complement(<892597..>894057)
                     /locus_tag="MRET_2184"
                     /note="MRES_08685"
                     /db_xref="GeneID:38738950"
     mRNA            complement(<892597..>894057)
                     /locus_tag="MRET_2184"
                     /product="chitin deacetylase"
                     /transcript_id="XM_027628811.1"
                     /db_xref="GeneID:38738950"
     CDS             complement(892597..894057)
                     /locus_tag="MRET_2184"
                     /codon_start=1
                     /product="chitin deacetylase"
                     /protein_id="XP_027484369.1"
                     /db_xref="GeneID:38738950"
                     /translation="MQLSAKLLIAASLVASTSATLQNGVHPRHGHLLRRAQEPSNAAD
                     MAKIKDSDQPKDCLQYGDDAMTRLLKQKKLPKPSRIASIQEGDDEAKKVWKEIQDSGI
                     IPKDVKQKKGQTGEGGATNMGVDDNGYDSSKDPDCWWTASQCTKPKHNNKGMMPDIYT
                     CPEPSTYGLTFDDGPYCAHNEFYDYLKQKKLKATLFYIGSNVANFPYQAQRGLADGHD
                     ICVHTWAHRYTTTLTDEQVFAELFYTARAIKYATGVTPTCWRPPFGDVDDRVRAIAAG
                     LGLRTIIWEDDTNDWKIGEGATKSQVEQNYKNIAGKADKESPIVLAHELNTNTMETFM
                     KMEPTISKAYKHIVPITACQNVTKPYPEDITYPDYNDFINGKTEAKGLPDINSIKTDD
                     NATYKVVALADQKNGYANPGKGSSSGSSNSSNDSKDDSSKSSGSSDSKNDSSDSKNDS
                     SDKGDGDAGFSDLAHVKAGMTAAVAAVTLVVAMAMM"
     gene            894591..894681
                     /locus_tag="MRET_t0037"
                     /db_xref="GeneID:38741231"
     tRNA            894591..894681
                     /locus_tag="MRET_t0037"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:38741231"
     gene            <894784..>896199
                     /locus_tag="MRET_2185"
                     /note="MRES_08690"
                     /db_xref="GeneID:38738951"
     mRNA            <894784..>896199
                     /locus_tag="MRET_2185"
                     /product="ribosome biogenesis protein YTM1"
                     /transcript_id="XM_027628812.1"
                     /db_xref="GeneID:38738951"
     CDS             894784..896199
                     /locus_tag="MRET_2185"
                     /codon_start=1
                     /product="ribosome biogenesis protein YTM1"
                     /protein_id="XP_027484370.1"
                     /db_xref="GeneID:38738951"
                     /translation="MQDGAAPATMPIRLRTSIPGCSIPYVPYMVPVTWRRSQLSTLVN
                     KVLATAQDDREAYTSVPFDFIVDGTLLRCSLEEYLAQQGHSAETTLELEYIKSTMPPA
                     YKDAARQDDWVASVDAGRPGAILTASYDGIVRVYEAEALQKEPYAYTPAYASSVSLTS
                     AKWLGADAVVTGSMSGTVAVWRVPGQESKTVPVLQAAELEHHTSPVSSVDVAPTASAD
                     RVAVLSAGWDGSVALWDVPSDARFATSSDGSKKRRKHAQGAEDVDTGAAVPVPLAPTM
                     VLQHVAPSLGATAARALSTAPTPGPNARTLAALADGDRRIWSAAWDGSVKSWDVASGG
                     LLQGQKQTDKVPLCLDPLLAHAELVCGHMDHSLAMYDFRDAVSNAAVAMSGAHAAPVS
                     AVRVHPTQVHLFASGAYDGRIKVWDVRSPRQALFAVSDPMAASRDGGASRKVLGLDWT
                     PRGDALVAGGEDCRVCLYQGT"
     gene            complement(<896201..>898120)
                     /locus_tag="MRET_2186"
                     /note="MRES_08695"
                     /db_xref="GeneID:38738952"
     mRNA            complement(<896201..>898120)
                     /locus_tag="MRET_2186"
                     /product="endothelin-converting enzyme"
                     /transcript_id="XM_027628813.1"
                     /db_xref="GeneID:38738952"
     CDS             complement(896201..898120)
                     /locus_tag="MRET_2186"
                     /codon_start=1
                     /product="endothelin-converting enzyme"
                     /protein_id="XP_027484367.1"
                     /db_xref="GeneID:38738952"
                     /translation="MPRRSSEQAPLLGRRPRPNTLSAAQESLSRMEHASVLSTRDIVL
                     MIVCLCLVVTGLYTLIQYDDRRRMHDVCVSRHCVKTGARVLRALDESIDPCDDFVAFA
                     TGGSQARRANGTRVLDEVALDVDRAIHKLATRRIPREMPDADAQNLGKVQAWYAACRA
                     TNDTQPEADTVRAMLAMPRPHALAWLHAHALEAWGQLSVQPDASSPAHTATLHLAPPT
                     PASVSEIQAGLARLQHAGVSLAAQTSDIHHVHASLARAAPDATLPVDELARLAPSVDW
                     DAYFAALGTQPTHVRTSATLLRSIELTWTATPESVWRAYAAWAAVRALPDGSRRACVR
                     HMQASLGPLVHRYYVAEASLSSATAAHAARMADDIRATYFRRLYELPWLDAETRRTAL
                     AKASALTIHVASSASAQDLAQQYADLPVSQDSAQNAWHAGAHSMRHALAELGVSPYHA
                     RTGPWTAVQATYLPAHNELDIGAGLLRPPILDTAAPMYLRFGGLGSLLARDMSQALDG
                     TCGQHYDAYGTRRDWWSNATAHAFAQLETCLAQQGRDVPDAVADDAGLAHSYRAWHHI
                     LDNGGMRVFEQNQRLPGLVLYSHEQLFFIAYAQLWAERGSARDARRLHQALTHFAPFA
                     AAFECKAPRTRCDVW"
     gene            complement(<898137..>900149)
                     /locus_tag="MRET_2187"
                     /note="MRES_08700"
                     /db_xref="GeneID:38738953"
     mRNA            complement(<898137..>900149)
                     /locus_tag="MRET_2187"
                     /product="endothelin-converting enzyme"
                     /transcript_id="XM_027628814.1"
                     /db_xref="GeneID:38738953"
     CDS             complement(898137..900149)
                     /locus_tag="MRET_2187"
                     /codon_start=1
                     /product="endothelin-converting enzyme"
                     /protein_id="XP_027484368.1"
                     /db_xref="GeneID:38738953"
                     /translation="MSAARHDGVREASEAQPLLGTKRAPPRRVPELALVVVLLILLVS
                     ALVHTIQRDDERMMHRVCTTRPCLVASFELMRFLNESADPCNDFDEFATGGWRASYPA
                     SPSAPAYGVREQVEAQNDRLVQDLLWTLRDEDVSPADRLSLHKLRAFHEACTDTRAQN
                     EAGAAPLLDLLHELSRQLRAPNATTAAIAWLHARGFPVLFDAIIDGDPGRAPHAATPR
                     IVPSGLGLRAPAAYDDNVTRPWYEGLVHEGLAHVGGDAREVVAFEHELARLYPPATEL
                     ADPVATYHPLLTADLQVLAPLVDWPSYLHAHSPRVLPHRVLVSSPTYLRQLAALLHRT
                     PTRTLHAYLRWAVIRDAGTYLGPDVPLGQPARALQPAPSCMAALHAALGHMSGRLFAE
                     HTQPDVRGVRRMIDAIRTAYTQRLPDLPWLDAAARADARAKLHGLQAHIGAPAQPDAM
                     NADAIEAWYADLHIGDAHWANVLNARMHAHQHAWSLLGGELPPGSLGARRTTDARAAY
                     SALDNAVVCPAGLLQLPFYERDAPLYLQYGALGTLLAHEMTHAIDTPGRWYDADGRWR
                     TVRPATRHASTAARLDGLARSYEAWRALLAEGDSATYARNMRLPGLLTYTHEQLFFLA
                     YGALSAHQAPSQRIHDALTHFAPWAAAFHCPRRRSSGAPPSHRHVT"
     gene            <900209..>901495
                     /locus_tag="MRET_2188"
                     /note="MRES_08705"
                     /db_xref="GeneID:38738954"
     mRNA            <900209..>901495
                     /locus_tag="MRET_2188"
                     /product="YagE family protein"
                     /transcript_id="XM_027628815.1"
                     /db_xref="GeneID:38738954"
     CDS             900209..901495
                     /locus_tag="MRET_2188"
                     /codon_start=1
                     /product="YagE family protein"
                     /protein_id="XP_027484375.1"
                     /db_xref="GeneID:38738954"
                     /translation="MWSRTRSAWRPGRWLSVRYVRSAPPHRSGPTAASHKSTLRVMLE
                     RGGLLPATSAPFDFVSRQARMPSAYTFRRTRLPVSKAKALAQESRALREQVASDSAPP
                     WTEAEPRPTLPLTSTHVTSGELPEVAAFATAQSYNFDVLLSSGRLPLNWIWLEDREVI
                     YIPSWPAPYTSSGSVFLFRSGCYVTWGMSSEQNTAFYRDVIAGGDVPVEEARHEAVGD
                     EAMEYVHIPTEATRVVGDLIVLGQRRDDKEQRPSRASSAVPSLTLQARLAFSQGLAAS
                     ARLSVEESLLQHYLESVAPIPARLEASGKVPVPRKDVIRKLGTLLHIRQRLNLGRDNF
                     IDDPELYWENSHMETLYRSICSALDMKPRTEALNAKLNHCEHLLEVLRALLTEQSSHH
                     MELIIIYLIAFEVGMALVTHEYLPTPLAVWRLIVAE"
     gene            <901714..>902346
                     /locus_tag="MRET_2189"
                     /db_xref="GeneID:38738955"
     mRNA            <901714..>902346
                     /locus_tag="MRET_2189"
                     /product="coiled-coil domain protein"
                     /transcript_id="XM_027628816.1"
                     /db_xref="GeneID:38738955"
     CDS             901714..902346
                     /locus_tag="MRET_2189"
                     /codon_start=1
                     /product="coiled-coil domain protein"
                     /protein_id="XP_027484376.1"
                     /db_xref="GeneID:38738955"
                     /translation="MKQLERARQQAKKEQDSERKPKYMHQFFEAAETRERDRLRAEAK
                     RIQRERAAEGDAFRDTEAFVTSAYQAQQEAWQRAEEEERLRETRARSRSRGVAAFRHR
                     ILHDESERRQALLTALSQPTDVQAQAAAPMSDRQRAERAEAQGLHVELNDDHQIVDQR
                     DLLQRGLNVMRKRKDARDEAPTPTSRAKRSHLMEEALLARVGDDSDDDEA"
     gene            <902372..>903205
                     /locus_tag="MRET_2190"
                     /note="MRES_08710"
                     /db_xref="GeneID:38738956"
     mRNA            <902372..>903205
                     /locus_tag="MRET_2190"
                     /product="4'-phosphopantetheinyl transferase"
                     /transcript_id="XM_027628817.1"
                     /db_xref="GeneID:38738956"
     CDS             902372..903205
                     /locus_tag="MRET_2190"
                     /codon_start=1
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="XP_027484327.1"
                     /db_xref="GeneID:38738956"
                     /translation="MLDVQVWVVDVSAWHREPYTRPGASQVPALDARLVGAEDATRIG
                     RYVRAIDRVRAFVACLLPRVMLVATQCVGHWRDVAIQRTESGRPCTDVPHIDFNLSHD
                     GDWVVMAFSRTHRVGVDVMQVALPHFEESSASFCHTMSSSMSRSEREWVAQGASEADV
                     LSRLYDVWTYKEALTKNMGLGLGYDFARIDLRFGRDVRLAMDGRAVDTFRFRELALPC
                     GASSRAPGSRVAIALGPRDAWEAPMSKQAVPAQQAMDEGWLRMWTYDAWLDYAWAMSG
                     V"
     gene            complement(<903210..>903642)
                     /locus_tag="MRET_2191"
                     /note="MRES_08715"
                     /db_xref="GeneID:38738957"
     mRNA            complement(join(<903210..903262,903291..>903642))
                     /locus_tag="MRET_2191"
                     /product="vacuolar protein sorting 55 superfamily"
                     /transcript_id="XM_027628818.1"
                     /db_xref="GeneID:38738957"
     CDS             complement(join(903210..903262,903291..903642))
                     /locus_tag="MRET_2191"
                     /codon_start=1
                     /product="vacuolar protein sorting 55 superfamily"
                     /protein_id="XP_027484326.1"
                     /db_xref="GeneID:38738957"
                     /translation="MSVAATNGIHTVIFLSFSLALGFLLVILSCAVWSNWMPIWSALS
                     FALAPTPNACFGHLAGADSFSDYHDAYLDMGYFLTGALLMTGIALPIVLAHTGIITGT
                     AAVLTLCGGLLVYGTMMAYAAFFHTPDEYDDL"
     gene            <903835..>905809
                     /locus_tag="MRET_2192"
                     /note="MRES_08720"
                     /db_xref="GeneID:38738958"
     mRNA            join(<903835..903919,903950..903999,904029..904222,
                     904249..>905809)
                     /locus_tag="MRET_2192"
                     /product="CCR4-NOT transcription complex subunit 4"
                     /transcript_id="XM_027628819.1"
                     /db_xref="GeneID:38738958"
     CDS             join(903835..903919,903950..903999,904029..904222,
                     904249..905809)
                     /locus_tag="MRET_2192"
                     /codon_start=1
                     /product="CCR4-NOT transcription complex subunit 4"
                     /protein_id="XP_027484211.1"
                     /db_xref="GeneID:38738958"
                     /translation="MARRTSTMPTGMAAYVGAASGSSVHGEHSHAKATTAHDMYLSDE
                     TDDMECPLCLEEIDISDANFKPCPCGYQICRFCWHHIKQNLNGRCPACRRKYSDQAIE
                     FKAMSTEEIMRLTNAKKNKEREKKEMEATNRKHLANMRVVQKNLVYVVGLSPKLAREE
                     FIPTLKGPDYFGQYGRVAKILISKRMTSSKYGHGSHDPSMGVYVTYQSKEDAARAIVA
                     IDGSKEPGGRIIRASYGTTKYCTSYLRNMPCSNAGCTYLHEPGEEADSFTKEDLATLR
                     HAARDTEHKIKPASMHLMPITKKASTEAISHASPAPSAAGDEGSALPRTASWANAGKM
                     FSAAGEPAPMPPPRDPQAFPGLAAAAAAPTHSPKMRPKAAKAPAATRAREADSVPSSP
                     TPRKAAPIVLDDVRRHDMVEPPYLFSTFDWPLLTHWGDGDFSFYLPSLPTSMAPTDDH
                     DAAPYSGTFNPFDEPDSVWGPYEQARVPDAAWPLRQQAALHRGVAPHMLDNVRAPEEQ
                     RSAAAAMLAARARQLQEAGETVSTHSMSDVRTHLARQQAQQQAQHGPTADAHSLLTLL
                     RRGQEPDVLADAATPPAPPPGLRTQPPNRATGLLLAQLLGTPPAQQHPDAYAAGVPPA
                     TVRQP"
     gene            <905968..>909657
                     /locus_tag="MRET_2193"
                     /note="MRES_08725"
                     /db_xref="GeneID:38738959"
     mRNA            <905968..>909657
                     /locus_tag="MRET_2193"
                     /product="trafficking protein particle complex subunit 9"
                     /transcript_id="XM_027628820.1"
                     /db_xref="GeneID:38738959"
     CDS             905968..909657
                     /locus_tag="MRET_2193"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 9"
                     /protein_id="XP_027484328.1"
                     /db_xref="GeneID:38738959"
                     /translation="MAAAPTFSASGTPSFCAPAKIRILLVPAAPLEQAEFERWSSVVR
                     AYEHIPLTDVPRSRPPPRAPVYEQSEVHLSFVTTHDSASTYLAPFQLHHVVHGVLGLA
                     TRTTALERVPRMLSEAYPHAFAHRVWAFDVRKARENGDMAMEHDDGVDDAFEPQSDVC
                     RAREPGVHVVPAVRRDAQDVRWYVRQLLADMIGSLLDQLDHYVAHLDELETPRETLRG
                     AAPPPAPAPSEMRLVPRKSTVATASKIFGLKKSSVEKPAPSLRVVKVKADAAMMSGYL
                     WDALELYDSILTHTGRERALAGGHDAVWFAGALEGWAVTRVILSRMGGEAVAQAPCLL
                     YPLTPGKDKDTHDPTPEPLAWRDVAEAYALALAIYRQCLAPPHVQLEALRSMTNETSR
                     DYTPPYVYASACLQYARFLLALFASGGWNADAHDQLMYGGDPPALDTGVPLTFSEQAH
                     LAAVSGIYRHEIAAAASAALTPSLPLLVPTEQLRILAPLHRICTLLSYTRLAAHIGRV
                     LGTVVCSMLTRTLRTRSIAPHVAWDSVRDMLRWHTHTTTMPRADAVPTGVFASANPAL
                     VLGIAACDAYGIDILASPLVHVPPTHILEIARQRICAYAYTDMLTSALGDEGRRWLPR
                     LSDSAAVAYRPRAPFGWHDLQVQLLQDLIVQCEALDEPLGQVFFAALLLRHTRPTAAI
                     LDGLRHALPRAQTYAPHVQLRYWGPPDLLRSMQWHAGRVHVSLCNPWPIPLPLYDVHA
                     VGAGLDVSTPAVQAVVPPHCLHTLQLHVVPQAPGTWHLRGVRVRLWGAEAHTLHIHKS
                     SAPIRCAAGLLGRPGAQLVQWIIQARVRDLSQALERPPASLACALGAPRAPCHIRLPT
                     SVVLLMDGASEHVRVALHNPSDAPIDVPCSVDDGQPPPHREASEIELYEHEWLALHEP
                     VATIHPTRVSVAPHATAYADVHVRGRTGCDWLRLHAGSEVATLPLCVEPSVMTSDLRV
                     ERISDASAQRLFAALQAPAPQPGPYVLVSFHARNVSTSSLRVCIDAGVRLERTLPSGE
                     SARMAWPMAPMTLTHADLLRPIPALCERQYVVPKTTLSDAAKAQFWVREALWQRVRAT
                     WTTSAEAHGDVHLRALWPSDAHVPLLVAPRVHVDVHMDTAAATDSVVRPTIRVRGLEG
                     AQCVRVRIEPRLGTDAPRMHAMAPEGAWDMTWSPLASPELEWTTSVCFLSEGPWLVGA
                     YAHVIWPNATEPHLYASTAVQVDVS"
     gene            <909687..>911141
                     /locus_tag="MRET_2194"
                     /note="MRES_08730"
                     /db_xref="GeneID:38738960"
     mRNA            <909687..>911141
                     /locus_tag="MRET_2194"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628821.1"
                     /db_xref="GeneID:38738960"
     CDS             909687..911141
                     /locus_tag="MRET_2194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484208.1"
                     /db_xref="GeneID:38738960"
                     /translation="MADRWRHSLGSLERRTRPLSYRQTPRIEPCRSSSSDTSLHKRSS
                     EEEASPAVKRARFTPKPPIPRRPLHALPPAPRSPSSPFFAIPRKPGGSWPRPTPSSPP
                     TILVSPPDSDMAAIMARCARPSTDATWQRAFIRTLLTRDQLAFDKLAWQLDLVFAKLA
                     ATLNCDVAGLAKHAARQTIELLTRAWRPATPEDYALSPPSFRLPRMTHELIPRTPATS
                     KAHALWSQQVSATVGADMAERLSLHIAHTVWYMAVRDARRPYTRPAIMAQYCAHILAY
                     LRRWTAHEHLHPLHLLPTAHLQTLESQHSACASTILHDVFQRNLHQQLTDFQKQRHTS
                     QPFLQVPGVDASSSHGPCLLTDVQGPDLIDAARFVGELARLHVVATPATVEQWLQALF
                     LHEIPWVQVPMHELEAGCALLLLTGSLSQLDMSACTLHEHSTRGSIHHQCLCKLEELA
                     RSRWVPASSKKWIQVRGEQLTSQEVIAYGRRGWT"
     gene            911187..911278
                     /locus_tag="MRET_t0038"
                     /db_xref="GeneID:38741232"
     tRNA            911187..911278
                     /locus_tag="MRET_t0038"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:38741232"
     gene            911349..911444
                     /locus_tag="MRET_t0039"
                     /db_xref="GeneID:38741233"
     tRNA            911349..911444
                     /locus_tag="MRET_t0039"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:38741233"
     gene            <911505..>912818
                     /locus_tag="MRET_2195"
                     /db_xref="GeneID:38738961"
     mRNA            join(<911505..912685,912710..>912818)
                     /locus_tag="MRET_2195"
                     /product="cysteine synthase A"
                     /transcript_id="XM_027628822.1"
                     /db_xref="GeneID:38738961"
     CDS             join(911505..912685,912710..912818)
                     /locus_tag="MRET_2195"
                     /codon_start=1
                     /product="cysteine synthase A"
                     /protein_id="XP_027484323.1"
                     /db_xref="GeneID:38738961"
                     /translation="MDRLARVFTRYRYTGIWVVGFLVGLCTGLGALALARAHRALERA
                     SIRRKVARSSPNNDFVPIQLQQSHSIVSGVEGMIGNTPLVRIRSLSDLTGCEILGKAE
                     FVNPGGSPKDRVALQIITEAEKDELLVPHTGSWIFEGTVGSTGISLATLACAKGYRCC
                     IVVPDDVAEEKATLLRRLGAVVEAVRPRGIVDPRHFVNEARTRAQSWKPNRHEPCARA
                     FFADQFETDANFSAHYEHTGPEIWTQTQGHVDAFVAGTGTGGTLSGVSAYLKEVSPSV
                     LTVAADPPGSGVYNRIQYGVMYNATEAEGTRRRHQVDTVVEGIGLNRLTRNLELGLPF
                     IDAAERVTDDEAVRMSRWLSTHDGLFLGSSSAVHCVAAVRTALRLKAQRPDTRPVVVT
                     ILADSGSRHLSKFQNDEAMQARGLNVVADIADILAPL"
     gene            complement(<912813..>914036)
                     /locus_tag="MRET_2196"
                     /note="MRES_08735"
                     /db_xref="GeneID:38738962"
     mRNA            complement(<912813..>914036)
                     /locus_tag="MRET_2196"
                     /product="helix-loop-helix DNA-binding domain protein"
                     /transcript_id="XM_027628823.1"
                     /db_xref="GeneID:38738962"
     CDS             complement(912813..914036)
                     /locus_tag="MRET_2196"
                     /codon_start=1
                     /product="helix-loop-helix DNA-binding domain protein"
                     /protein_id="XP_027484325.1"
                     /db_xref="GeneID:38738962"
                     /translation="MFLGREDVVRQGEGSDRSLALPDMSPHQSAPLSEAVMEKIPMSR
                     TPHMEQYDGVSHPQNQSLLPYLISSRSREDTIMRNRAALRSSTPTNDGRPHAPSWLSS
                     TPGASTSSGGSHAMYKAPLWRSSSLSVMPSSQKFSLRPSSQHDPYGFVRMAPDEMGNP
                     RYFRWYQRERHVPSIRSMQHPYLARRYVHRPMEYAHRAQMMPTPQTPPRPSQTPIQAP
                     GEVASVLEPYLSPSTPSTDVEPPSLDHVSRLVPSALHHVFEPDSTRDQPHLDKLRVRK
                     QRLHMAYTTGDWSLSDDVAMLWTDSKKRKASNQGPLSIEEKKANHIASEQKRRSNIRK
                     GYDTLASMLPAVTKTEPESVPEEDARANLPNEVSILLEAVEYLQGRLQRHEQLRQRKK
                     DLQHQLFQRYAGMSS"
     gene            complement(<914145..>916139)
                     /locus_tag="MRET_2197"
                     /note="MRES_08740"
                     /db_xref="GeneID:38738963"
     mRNA            complement(<914145..>916139)
                     /locus_tag="MRET_2197"
                     /product="beta-glucan synthesis-associated protein KRE6"
                     /transcript_id="XM_027628824.1"
                     /db_xref="GeneID:38738963"
     CDS             complement(914145..916139)
                     /locus_tag="MRET_2197"
                     /codon_start=1
                     /product="beta-glucan synthesis-associated protein KRE6"
                     /protein_id="XP_027484324.1"
                     /db_xref="GeneID:38738963"
                     /translation="MSARQYDRVAAEPRQSRERSAKSNVNGPREHAPTWNRKAYATDE
                     DPADRATYASRKSFGSENWEDAEDSTELNAFINMPSRVVQDPYLHDLESGTTNVSTPT
                     SVKHGVSSQVMEPASPGLYNSMTKRVGRQPNAGSTRPNAGQGMVMLHPMQAESDDYLH
                     IPDKNPDAHSWRPTLRGLGNVFTITIIGLSVLMLFVGYPILADHQRQFNKGLASFLAD
                     AESSKIPVRGLIDEDTEEQYHTWTNPVDKSQYDLVFSDEFNKDGRTFWPGDDPFWEGG
                     NFYYAATHDYEWYTPEAITTKDGYLLFTMDEYVERLNLFRSGMLQSWNKFCFQGGYIE
                     GSVILPGSHDMQGFWPGFWLMGNLGRPGYLGSTDGMWPYAYEACDVGIMPYQKDTDGS
                     PVAASRVKANGAKSYQHKNLSALPGMRFPSCTCSGQDHPGPNRKTARSAPELDIFEIQ
                     VQGDESHASQSYQVAPYDENYIWFNNKGSYKVYDSDITKRNPWSGNPYQEAMSCTTTL
                     PHWPFFDASKRPRPIRFGVEWDPDFENTGSGHITWYMDGKPTWTLNDAALSGNENTEI
                     SRRIFPKEPMFIIMNLGISSGFQQIQWDDLEFPAHMAFDYIRVYQKHGTQKRVTCNPD
                     NYPTADYIQRNLELYYNNNLTSYLDSSHQAWPKNSQMNQC"
     gene            complement(<916296..>918236)
                     /locus_tag="MRET_2198"
                     /note="MRES_08745"
                     /db_xref="GeneID:38738964"
     mRNA            complement(<916296..>918236)
                     /locus_tag="MRET_2198"
                     /product="AP complex subunit beta"
                     /transcript_id="XM_027628825.1"
                     /db_xref="GeneID:38738964"
     CDS             complement(916296..918236)
                     /locus_tag="MRET_2198"
                     /codon_start=1
                     /product="AP complex subunit beta"
                     /protein_id="XP_027484666.1"
                     /db_xref="GeneID:38738964"
                     /translation="MADHGRQDRCFVYGSAEELGSDLVNAKSYSKKVAVLKRIIANAT
                     MGNDMSALCTSVAECMSLQDIHIKKMGYFFLSNYGMRKKEALTPYIDLFTQDAKSQDA
                     ITRASALRTMASLLTDDMVHGLLDPVRSALYDKKPYVRKTAAMCVARMYMYDAALMEK
                     SGFIEKLFGMMYDTSTDVVVSAVAALYHMAESSHTMQLSVNFKQANHLVQVMHQCSEW
                     GQTYIMETLLFFTPQTGQEAHMLADALSRHVQVHSPTLALTASKVAMFLMNYMSDMER
                     MNALGRWIGYVLMPHMKAPPEILYTILTNVLLYLQRRPMVLRLELSPFLCTYSDPEYI
                     KLVKLDILYQLATQSNATDVLDELQSCVTDINENIARKATHMIGRLALKWSLVADPCV
                     AALKTIMQGRADYALQESVMVVKDILRKYPDRYGYIVTMLCDHIPSLYESPAKVSMIW
                     ILGHFCDRVEGSTDALHDYTLSFLDESSDVQLALLTATVKLFLRKPKSGGPIVQKILH
                     QATDLVANPDVRDRGYFYMRLLTLDASMAMAVAFADASSEEALEQIQQHVLDQLILHG
                     ASLVPLLQQNPPVMIPKVRHRFMPDSPALEPSARPHASTHMHAEPSQYHTMHDTDDEA
                     VYTDLAPPQPSNCASVAVGQLI"
     gene            <918368..>920008
                     /locus_tag="MRET_2199"
                     /db_xref="GeneID:38738965"
     mRNA            <918368..>920008
                     /locus_tag="MRET_2199"
                     /product="U3 small nucleolar RNA-associated protein 15"
                     /transcript_id="XM_027628826.1"
                     /db_xref="GeneID:38738965"
     CDS             918368..920008
                     /locus_tag="MRET_2199"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 15"
                     /protein_id="XP_027484329.1"
                     /db_xref="GeneID:38738965"
                     /translation="MEYQPLRAPPTAAATASSSLHSHSESLYWRNQFYSPVFLKEFAP
                     VTCIHFVPSSHATDDDPSGSSSRGRFAVTTGTRVQIYSMRTSRVVKTITRFKDVARSA
                     HFRSDARLLVAGEDTGNVQVFDTNSRTILRSFQGHQMPVHVSKFSTDITQVLTASDDR
                     TVRMWDMPEQKETRRFEGHTDYVRAGAISQDNPHVVMSGAYDGTVRLWDLRMSEHDGQ
                     AMCMEHGAPVEDVLVYPTGGSGVAVSAGGPMLRVWDIMSGGRCMRAISNHQKTITKLA
                     LSVESGAGFTSDEGSGGMRLLSGGLDHLVKVYDPAQDYRVTHTMRYPAPILSLAVSPD
                     ESHIAVGMSDGTLCIRKRELKASELESRERRRAALRTGAYEHFATGPTRASAATRADE
                     LSVESTRRQRLKRYDQLLKAFRYRDALDASLQQGVPASVTFALIMELIRRSPSGQADG
                     LRRAISGRDDVTLEPILRFLLRHVTNPQYTHLVCDTLNLVIDTYASVLGQSPIIDDLF
                     GRIWAKLGEEMRLQSQLFQVNGALEMLLARSALGAAMT"
     gene            complement(<920034..>920331)
                     /locus_tag="MRET_2200"
                     /db_xref="GeneID:38738966"
     mRNA            complement(join(<920034..920164,920210..920291,
                     920323..>920331))
                     /locus_tag="MRET_2200"
                     /product="copper chaperone"
                     /transcript_id="XM_027628827.1"
                     /db_xref="GeneID:38738966"
     CDS             complement(join(920034..920164,920210..920291,
                     920323..920331))
                     /locus_tag="MRET_2200"
                     /codon_start=1
                     /product="copper chaperone"
                     /protein_id="XP_027484255.1"
                     /db_xref="GeneID:38738966"
                     /translation="MTDTHKYHFDVKMTCGACSRAIERVLGKLEGVTSYTVSLEQQSV
                     DVEASVPFETVLEKIKNTGKEVLGAQVIA"
     gene            <920563..>921191
                     /locus_tag="MRET_2201"
                     /db_xref="GeneID:38738967"
     mRNA            join(<920563..920577,920626..920842,921157..>921191)
                     /locus_tag="MRET_2201"
                     /product="small subunit ribosomal protein S21e"
                     /transcript_id="XM_027628828.1"
                     /db_xref="GeneID:38738967"
     CDS             join(920563..920577,920626..920842,921157..921191)
                     /locus_tag="MRET_2201"
                     /codon_start=1
                     /product="small subunit ribosomal protein S21e"
                     /protein_id="XP_027484254.1"
                     /db_xref="GeneID:38738967"
                     /translation="MENEHGELVDLYVPRKCAATGRLMEAKDHASVQIAVADVDENGK
                     MIPGSTTNIPISGAVRHQAESDDSINRIAQQMGLMKNVWSYQQK"
     gene            <921517..>924099
                     /locus_tag="MRET_2202"
                     /note="MRES_08750"
                     /db_xref="GeneID:38738968"
     mRNA            <921517..>924099
                     /locus_tag="MRET_2202"
                     /product="pumilio-family RNA binding repeat protein"
                     /transcript_id="XM_027628829.1"
                     /db_xref="GeneID:38738968"
     CDS             921517..924099
                     /locus_tag="MRET_2202"
                     /codon_start=1
                     /product="pumilio-family RNA binding repeat protein"
                     /protein_id="XP_027484257.1"
                     /db_xref="GeneID:38738968"
                     /translation="MMQENTGPDPLAGLPSIHYRHPSSRGAASPLEHPVLLPSAVPPR
                     PAPAPLSLHRTGSWSVHPTVSSPGPHPWDADALTSPPGLLPNGAPGRRRPRRTLTDNA
                     TEFLHAVDDLLGSQVSRHGPSHMPLPPPPGNLASHGMEGPLSPKSAAFPMPMEHAFGV
                     ESAGPAPLPLGSTKFGFPMPSHAIGSPPIHTQDERAPASDWPLSDVEGPPMWPSMYPP
                     TQTPAPIDPLGYGASTAVLSSSPDDATAPLHAEKSVALVLGDDEPRSHMPPAPPTSHA
                     RPDVLDASMQPSAFVNQDLAQRVRSMTLPVDLSVGPMRERTGSVHRAHRAPDSPSSPM
                     SGGRISTHARKSAAAAVAGHGVHGMYARYTPQSPSMASSATICDSPDALDPSSRPGPK
                     RRDEGKWFGRPGTLRLGDTVPIASTGPAVLDDELAPYVRARSQATVHDVHGDEGSVRS
                     RNSSRTRAYERGTGDLGGRFHRRDEGGVPRAVSVPLQDDAAHWELRDVRGQLAEISMD
                     QHGSRLIQEKLDHCTPQERTQVFEELFPESRRLMADVFGNYVIQKLLEYGTREQVRTL
                     GGQLEGHVLSLSLGTYGCRVVQKAFERVDEEQKIRLGQELHPHVLDCVRDQNANHVIQ
                     KILEQVPSPHLDFIASAFLGHVPVLASHCYSCRVLQRIFAYCSEEQRRPLLDEMHKDT
                     LRLMQDQYGNYVVQWVLQHGEERDRVAIVGVAKSHLLALSRHKFASNVVEHVIQVAQP
                     ADLADLLEELLAPLRASDVEGLPLLLEGTAPLCIATVMMQDQYANYVLQRFLQTLHGH
                     DRERLVQTIRPVLYALRQRQALMAAQSNAASTPYTGSIRIPGGGHIGNKPLLAIERLI
                     EQGP"
     gene            <924191..>926179
                     /locus_tag="MRET_2203"
                     /note="MRES_08755"
                     /db_xref="GeneID:38738969"
     mRNA            <924191..>926179
                     /locus_tag="MRET_2203"
                     /product="TBC1 domain family member 15"
                     /transcript_id="XM_027628830.1"
                     /db_xref="GeneID:38738969"
     CDS             924191..926179
                     /locus_tag="MRET_2203"
                     /codon_start=1
                     /product="TBC1 domain family member 15"
                     /protein_id="XP_027484256.1"
                     /db_xref="GeneID:38738969"
                     /translation="MTGGQAVLALPAAVHPTARTCDNVHGRVQIGTEGDAPQHARNMV
                     VHFGVPDAPQHPCAFRVPLRDLRAIREHVPSAMRPIGFVELYAQSKHTLFFHTCPYDE
                     HRRASSDWDGHRLVDALVPFADILASQQVPSLYLINPSAEERAKHQTPRFADDAIEAV
                     LARRSPLPPAPTHSDTLAAWAKSTHMSVLTQLSHVMRGARDSGHAFLSHPIVRRAAPQ
                     LSASQAGPYMVSAQTDSTAPTSSDPLSVEFDAARVYLTKWARQVAQEGELNRMAEQAM
                     LRDPDRDAESLLGTSYLPTLPQTDKLVPLTHAACTELLDSGAPAHDIAQRVFRHGLTP
                     EARRLLWPYMLGALPLNSRREGRDAQDAEMQRTYDMWKQRWFGQPRPRAAEHEASQHR
                     IWIDCLRADTKHDFFQHEPPLDIEAHVVASGWLRSRPQGAEHAQVNKHVFLLSEILWT
                     FDVYAEHANDTKLPAIEGYVQGMSDLCSVCYVACSGDEARTFWTFVALMRMWGSHYVA
                     DQSGMRHELLLLQRLVAELCPRLYAYLQRIDGLNLFFCFRWLLVCFKREFVLDDVLRI
                     WDAMWSARWSEAEHRGWPLCTHMHLFVALAILESHERLILRYLASFDEVLMFIHSLAF
                     QMDATSVLRRAEALVYRLRSRVGQEPPVDEELRSMVLC"
     gene            complement(<926189..>926854)
                     /locus_tag="MRET_2204"
                     /note="MRES_08760"
                     /db_xref="GeneID:38738970"
     mRNA            complement(<926189..>926854)
                     /locus_tag="MRET_2204"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628831.1"
                     /db_xref="GeneID:38738970"
     CDS             complement(926189..926854)
                     /locus_tag="MRET_2204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484251.1"
                     /db_xref="GeneID:38738970"
                     /translation="MSHTCALVRRVPYTALPSDVRRVAGAPVRIDFVRTHAMVPSEMV
                     MVEYATEAEARALQRQRPCIGGEALQVECLSAAQRQAFFQRHYAHWPSEWLAALDIGA
                     SYPMQSVVLRHLPFDTTAEKLEKKLQRHYALGLQIPPRIDWHMSQLVRPTTPPLASSF
                     TVLKLPPLHTESTSAWFLVCLSKVSDAMRLVRSWHRTRFLPKKFTVERTGDRYVVDAG
                     VLY"
     gene            <927259..>928773
                     /locus_tag="MRET_2205"
                     /note="MRES_08765"
                     /db_xref="GeneID:38738971"
     mRNA            <927259..>928773
                     /locus_tag="MRET_2205"
                     /product="3-oxoacid CoA-transferase"
                     /transcript_id="XM_027628832.1"
                     /db_xref="GeneID:38738971"
     CDS             927259..928773
                     /locus_tag="MRET_2205"
                     /codon_start=1
                     /product="3-oxoacid CoA-transferase"
                     /protein_id="XP_027484250.1"
                     /db_xref="GeneID:38738971"
                     /translation="MFTAVRATLRPNAVASKRCFSSLSVQLKQAGGGKIMTPKAAIAD
                     IPVGAKVMVGGFGLCGVPRTLLDEVVKRPELKDLDVYSNNLGTPGRGVGLLAREGRVR
                     SITGSFLGGNREFGDQFFRGEVQLNLCPQGTFAERIRAGAAGIPAFYTPTGYGTAVHK
                     GELVLKYEKKDGEEAKPVLISKPRESRRFGNRDFILEEAIYGDYALIHARKADEAGNL
                     IFHSTARNFNDPMARNARVTIAEVEEIVPVGSISSDEVHLPSIFVDRIVKAELPLEVE
                     KVCLSKPEGDATELTKRDIIAKRAAAELSDGMYVNLGVGMPNLVPSYLSKDVDVYVHT
                     ENGLLGVGPYPSKEEDVHTDIINAGKESITERPDAAAFDAVASFDIVRGGHLDVTMLG
                     ALQVTANGDLANYMIPGKFATGMGGAMDLVSNPDNTRVIVLTEHVDKTGKPKVVQNTE
                     LPLTGVRCVSTIITDLAVFNVDREKGGLTLVELQPGVTLEEVKAKTGADFKVAL"
     gene            complement(<928791..>930917)
                     /locus_tag="MRET_2206"
                     /note="MRES_08770"
                     /db_xref="GeneID:38738972"
     mRNA            complement(<928791..>930917)
                     /locus_tag="MRET_2206"
                     /product="metal transporter CNNM"
                     /transcript_id="XM_027628833.1"
                     /db_xref="GeneID:38738972"
     CDS             complement(928791..930917)
                     /locus_tag="MRET_2206"
                     /codon_start=1
                     /product="metal transporter CNNM"
                     /protein_id="XP_027484253.1"
                     /db_xref="GeneID:38738972"
                     /translation="MQDPDIRGMPSCSISVHEKNETVHESSLSVSSDTLDTSLPTVQP
                     SMHKSVASSKKAAFTFSPAVLLFMVITLFGFGMMAGTTVTSVAAPSIQNSLSWDLPFM
                     PKRAVDHVQPPSTAFHVDFFERFTKREESLGGDSKEGKNMPKGKKVAFALLIPILVIL
                     SGIFAGLTLGYMSLDETQLQVLMAQGSRKERAYASKIAPVRQDGHLLLTTLLIANMIT
                     NETLPIIADPVLGGGIQAVIVSIVLVVIFAELIPQSVCSRYGLYMGAHMAMFTRVVMF
                     ILYPIAWPVSRILHYALGPHHGTIYRRVELKELVTMHEAAGGHGGDLKHDTVTIVGGA
                     LDMQEKVAKQAMTPIERVNMIPLTARLDYPTLDRIVRSGHSRIPVYQDLNVSRSESGA
                     GTPNRGETVSSRISRSLGLTQQVALPEAPSIGDGAELERNPLADDSRALYSQPTTLEP
                     KVHRKIVGALLVKQCVLLDPEDAVPVSEMLINALPTVPWDEPLLNVLNVFQEGRSHMA
                     IVSPHSSYAAKATVPPKTKIPATLNASSELEKGTAAESTKEPKMRSLRSSHLQRLLHR
                     LRGGKASDFDNPDHPISASSTLPPAKVVEQNLAPDAPLGIITLEDVLEELIGEEILDE
                     YDSDGQSDTGSTSTWDIPMSENKTDRDSLEDRHDQRLTTSSATPSPLVFVKSPKASLV
                     PPSTAMQALEGDDITLTKPMISSENI"
     gene            <931404..>932702
                     /locus_tag="MRET_2207"
                     /note="MRES_08775"
                     /db_xref="GeneID:38738973"
     mRNA            join(<931404..931411,931456..931465,931509..>932702)
                     /locus_tag="MRET_2207"
                     /product="DnaJ subfamily A member 2"
                     /transcript_id="XM_027628834.1"
                     /db_xref="GeneID:38738973"
     CDS             join(931404..931411,931456..931465,931509..932702)
                     /locus_tag="MRET_2207"
                     /codon_start=1
                     /product="DnaJ subfamily A member 2"
                     /protein_id="XP_027484252.1"
                     /db_xref="GeneID:38738973"
                     /translation="MVKETKLYDLLGVSPEASQAELKKSYRKKALALHPDKGGDPELF
                     KEVTAAYEVLADESKREMYDRFGEEGLSEGMMGGGMDPQDLFSQLFGGAGGFFGGGGR
                     PRGPRKGKDLVHRVKATLEDLYNGKLTKLALQKHVLCNKCGGRGGKEGAVKSCNTCNG
                     QGIKVVLRQLGPMVQQMQQTCPDCHGAGEQINPKDRCTQCNGKKITQERKVLEVRIDK
                     GMEDGQQITFKEEADQAPNTIPGDVIIVVDEQPHPRFKRKMNDLFVNVEVDLLTALAG
                     GRVSIPHLDDHALSVEIPRGEIVRPGDMKVLRGQGMPSYRHHEMGDLYVNLSVKFPDS
                     LSEEQLQALEKALPARPAPAALSKDLDVEDVVMDSIDEHEAHRARTGPATTGEMEDDE
                     AGGPQVQCAQG"
     gene            complement(<932802..>933629)
                     /locus_tag="MRET_2208"
                     /note="MRES_08780"
                     /db_xref="GeneID:38738974"
     mRNA            complement(<932802..>933629)
                     /locus_tag="MRET_2208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628835.1"
                     /db_xref="GeneID:38738974"
     CDS             complement(932802..933629)
                     /locus_tag="MRET_2208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484259.1"
                     /db_xref="GeneID:38738974"
                     /translation="MAPTSRIYLTRHAEAEHNATGDSSIADALLTPLGEKQAQRLGLV
                     TPELQSTVELIISSPLRRTLQTTEAGYKDAIERLNGHANVLCLPQLQECNDVPCDTGS
                     HRSVLEAQEAFAKFNLEHLTPDWTSKQGFYAADSASLEKRAQWVRQFLRERPEQHIAV
                     VAHGDFLRRLTDEPTSYWANAEVRVFEFAPNAVTTDACPLVFVDHVEKGDWKGTASST
                     GVAHTSDLSSMEERVRQIQASVMSQTSELEQLDKMLAAAEQKHVHLKSQMGSSDPSA"
     gene            <933771..>934178
                     /locus_tag="MRET_2209"
                     /note="MRES_08785"
                     /db_xref="GeneID:38738975"
     mRNA            <933771..>934178
                     /locus_tag="MRET_2209"
                     /product="mitochondrial 54S ribosomal protein YmL38 YmL34"
                     /transcript_id="XM_027628836.1"
                     /db_xref="GeneID:38738975"
     CDS             933771..934178
                     /locus_tag="MRET_2209"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL38 YmL34"
                     /protein_id="XP_027484258.1"
                     /db_xref="GeneID:38738975"
                     /translation="MLGLKSTMSIIDNSGGLVAECIRVMRYKSSMGLGRVGDEVVVVV
                     QKAKPIPANQVSSASSNALKVRRGDVRHAVIVRTKKESQRPDGRVVKFDDNACVLLNN
                     RKEPLGSRVNGVVSSELRERGWGKILSLASKVV"
     gene            complement(<934220..>936067)
                     /locus_tag="MRET_2210"
                     /note="MRES_08790"
                     /db_xref="GeneID:38738976"
     mRNA            complement(<934220..>936067)
                     /locus_tag="MRET_2210"
                     /product="tRNA
                     (guanine26-N2/guanine27-N2)-dimethyltransferase"
                     /transcript_id="XM_027628837.1"
                     /db_xref="GeneID:38738976"
     CDS             complement(934220..936067)
                     /locus_tag="MRET_2210"
                     /codon_start=1
                     /product="tRNA
                     (guanine26-N2/guanine27-N2)-dimethyltransferase"
                     /protein_id="XP_027484303.1"
                     /db_xref="GeneID:38738976"
                     /translation="MAPQPILLSARTVAKYGIHIRANEAAFRENSATIVMPSKEAAFL
                     NPVQEFNRDLSTIAIITWSQMLDGEKRQRFEARNRARSKRAKAVSGEPDAKRIKTDEE
                     PHEHTYQSYKFKALEALSATGLRSIRYAKEIPLLGFVQANDLSATAVQALRRNLALNF
                     PPDRPVNEWIKMDVEQADEEEHEVEAEADPTPSGIHPDCKVHVNQGDAISLMYEHRDL
                     PKRYDLIDLDPYGTASPFLDAAVQSVTDGGLLCVTCTDLAVLAGHNYPEKCFSLYGGV
                     SIKAEYSHEAALRLVLHSISMAAGRYGRYVQPMLSLSIDFYLRVFVRVWSRPETVKQN
                     ASKTGLVYTCSKCSNFHIQPMGRCTESQSSKTGHSTLKFGSASGPPTDTHCAECGGTF
                     HVGGPMWFGPLHNRAFCDELLATLDSNKHPVHTEARIRGMVSTARDELPDAPFYFHPA
                     KIAGLFHCASPAMAPMVHALLHAGYRVSRSHCIPGSIKTNATRGEIYDLYRTWIRTNP
                     VNPERLKEGSPAKGLLSHVREDGTPAVQHREFEWDVEHPDTHSVIHGSPTDNKAVRYQ
                     MNPQANWGPGTAAKGHRKRVHRSLAPEELDRRTDAWRKDRTQEVGEDTS"
     gene            <936243..>938213
                     /locus_tag="MRET_2211"
                     /note="MRES_08795"
                     /db_xref="GeneID:38738977"
     mRNA            <936243..>938213
                     /locus_tag="MRET_2211"
                     /product="L-ascorbic acid binding protein"
                     /transcript_id="XM_027628838.1"
                     /db_xref="GeneID:38738977"
     CDS             936243..938213
                     /locus_tag="MRET_2211"
                     /codon_start=1
                     /product="L-ascorbic acid binding protein"
                     /protein_id="XP_027484304.1"
                     /db_xref="GeneID:38738977"
                     /translation="MADVRACFGEHVFKDDFITKKHEEYNQSGPYHHSVINDLVSEDL
                     LRGARDEIIEELHFTEKETDIYKVNQTGDLANLDGLGEEEANRLKSLMKLRNAMYSDE
                     FRGWLRRVTGCGPLSAKKKDMSINDYRHGCHLLNHDDVISTRRISFILYLPDPAEPWQ
                     PEWGGSFEMYPVKEKHVPDDLPSNIVPIKWNQFNFFVVQPGHSFHSVEEVVHPTQSRL
                     SISGWFHRLQPDEPGFSQEEEDRELQAEKEFSSVGSLISKKFMDAFVEYDEATYGGPS
                     LPGSRMSTEHLKFLAHFINPAYLTTKIQSTLFEKFGEDSHLLLSDFLRQDVADTLERV
                     LRAKDEEDGLVWWHGKQERVGFDSVRIQHHGVGTNRALQPSDEDRRWVLAGPPHRERF
                     ATLDSACTPSTAPAIDYAQTQSPLVSVPSSAADLLHVLTHQLFPSAAFRHFVSNITQL
                     IPMAARPIRARRFRPGLDYTLARSDDETVLDLTLTLTPDVVGSAKKVLKHTARPKGLA
                     SKHKETVSQGVLSKKDVEKLEGMWDRGDIGGWECYLAPHEGEEDPAVYQSAESRRAQR
                     AKEEEQQEPVEENDQEDEDFEDMDEDEDDDFDGVLLNVTPSYNTLNVVLRDEGVMRFV
                     KYLGASAGGSRWDIAAEYTVGAAEMEEDEASA"
     gene            complement(<938248..>941337)
                     /locus_tag="MRET_2212"
                     /note="MRES_08800"
                     /db_xref="GeneID:38738978"
     mRNA            complement(<938248..>941337)
                     /locus_tag="MRET_2212"
                     /product="peroxin-1"
                     /transcript_id="XM_027628839.1"
                     /db_xref="GeneID:38738978"
     CDS             complement(938248..941337)
                     /locus_tag="MRET_2212"
                     /codon_start=1
                     /product="peroxin-1"
                     /protein_id="XP_027484301.1"
                     /db_xref="GeneID:38738978"
                     /translation="MPSSSRSRATHARVLIDPALRASLVHLPASLCSTLIARNVVPQT
                     LIVELGTEAQTYYGGWTGMSPNASVLSDPNASDCVVASPALASLFSPGLSDGTLLSIR
                     LFRSPPVPIAQEVHVTPVSPDDWEILSVHAGEVEDNMLSQVRAAKQGQVLAVSVGRSA
                     STVIKFVVDRTVPPTRPLNTDHTDEQLSASIAVRLSTDTEVIIAPKTRFAQVPEEEPT
                     NLATFPSSAAPLTSHSAQNALAHVAWRVLPASYVPDDERDLSWAVVVPAAFAPPDTDR
                     PAYELVALAFKHHKLCVTRVSCPSSVKDEDAPQNATASASFGPGTMPEEEAASLHIQW
                     PERHVWIGASLRDKLGLQDLDLVTLSAPSPGAVREADKHEEHKGVHLCVAEPDPLAGM
                     AEPLKKCLDTVRVVRAMRDINVAEQGCMDAISSGQLPHPPRRPFSGTSGILLTGPSGS
                     GKTSLARAVGTHLAHDPSLLYRLQIVDCAQFVEERMPLVRARCKEWLDEAAWHAPTLL
                     VLDNLDLLMPADGEHVDTWRSCHLAHALVERIEETVRDYDVFVLATAQNASDVHAYLQ
                     NARVWAHTLSIKPPAKEARRQILHTLVQQVAFRAQSAVPELDYTDLVTHTDGYHVADL
                     KMLTDRAVHEATIRCVLDARDIMLDMCDFDRAQEGYTPLSLRDVKLETSATEWADIGG
                     LFATRQTLRETLEWPTKYAAIFANCPLRLRSGLLLYGYPGCGKTLLASAVAKECGLNF
                     ISVKGPEILNKYIGASEKSVRDLFERAESAKPCVLFFDEFDSIAPKRGHDSTGVTDRV
                     VNQMLTQMDGAEGLDGVYVLAATSRPDLIDAALLRPGRLDKSLLCDMPSRDDRVDILR
                     AIARKVPLDADVNLDVWAQKTEGYSGADLQALMYNAQLEAINENLRAPEKRETTEAQD
                     TINVAYLSIPPIDDSTAHTVSGAQKLALGRRLERMVRNTDMDLPSRGKTSSEAPRKTL
                     LVHTSHLDTSFRSTRPSVPPSEVARLGRIYAEFSGDRKAIFPDGTPSNQIGARTSLM"
     gene            <941525..>943330
                     /locus_tag="MRET_2213"
                     /note="MRES_08805"
                     /db_xref="GeneID:38738979"
     mRNA            <941525..>943330
                     /locus_tag="MRET_2213"
                     /product="mannosyl phosphorylinositol ceramide synthase
                     SUR1"
                     /transcript_id="XM_027628840.1"
                     /db_xref="GeneID:38738979"
     CDS             941525..943330
                     /locus_tag="MRET_2213"
                     /codon_start=1
                     /product="mannosyl phosphorylinositol ceramide synthase
                     SUR1"
                     /protein_id="XP_027484302.1"
                     /db_xref="GeneID:38738979"
                     /translation="MGLRSGRCSIILVRLFALFLLGTIIVLALIRQHFRINEDEYIRV
                     SELGTWEEIRASKRPAVLDHGSPMKMKEDAMPPEKIPRIIHQTWKTEELPPQWAEVRE
                     GCARLMPDYEYMLWTDAISREFIEKEYPWFLPTFDAYPYNIQRADAIRYFVLHKYGGV
                     YMDLDIGCQKRLDSLLRFDLILPKTIPVGVSNDLMFSVPGHSFMDLLIRSLNKFNHRF
                     FTHYATVMFSTGPMFVSTLHRVFASVHEKVAPSDAQQPGRGFQGIRVLPKSLYGKNLE
                     PDQVPDSFFVHMYGSSWHAGDAGFLIFLRKNGYALIFLGVVLLLACMRRSCFSFLARL
                     LHAIMSVLFRSRSKFSDAGAISGIKLDDVKTPRKVSTWYAKSPDVESKYCKTSEEGHA
                     RPSIPLPTISMNDAQAVPYHDVSENWSSLPASVGSAPPELSMQRRGSDTNTPLPTFYV
                     DHRSTPDSMDASNANSKDARVPAVKRISSATSRTFSSLIPPPLRRFRGASLKLPSKAT
                     TEKLPKEPPTRHSDEYHSEWERLVQDWESGRGLRSPTLHTALSPAPEPMETLDEPHLS
                     PTSPSQNQLLRRSHHHDPYRPATPAVFTSLNMEQK"
     gene            complement(<943369..>948024)
                     /locus_tag="MRET_2214"
                     /note="MRES_08810"
                     /db_xref="GeneID:38738980"
     mRNA            complement(<943369..>948024)
                     /locus_tag="MRET_2214"
                     /product="metal resistance protein YCF1"
                     /transcript_id="XM_027628841.1"
                     /db_xref="GeneID:38738980"
     CDS             complement(943369..948024)
                     /locus_tag="MRET_2214"
                     /codon_start=1
                     /product="metal resistance protein YCF1"
                     /protein_id="XP_027484299.1"
                     /db_xref="GeneID:38738980"
                     /translation="MAELGLWVPGFGTSSLWHEAPPHVYDAVMRPAAQITGLGSWVCD
                     GSEGWGPMSPTRDFDLTPCFQAAILWFLPAALFIVAAVRALRRWSQCEVQERSENSMQ
                     VLHEKDGVMTAVTLLAFVEFVVLIGMRSHLAPAQASLTGGIQILASGTMLIAYVLAAW
                     LQHTMHMKARHGSDETLVLWLLHLLIGPVRVRTILQVAPKSTLVQMLVVVPLCMRLLF
                     LLAALFLECSDVEVGDSIALPDDDDDVEAEAEPEEEPDEFAHKASPIEKANLFSRLSF
                     HWMQPLMSLGARKFLRESDMWSLPKSEEAEQLGHAFQYHWTKHAHASLERGHPLESTG
                     KLRFWQTLYSAFGAPFALAAIFKVVQDVMAFVQPQILRALLAFVQTWEWAPTDALRGT
                     PLRGFVMVALLFITSAIQTLSLHQYFQLVSVAGMRARAGVVTAIFRKSLRLSNKSRSE
                     QSSGDIVNLMSVDANRLPDFLMYAHILWSAVFQIVIAFVSLFDLLGWSAFVGVAIMLV
                     SVPVNTILATYLRQQSAVQMKVRDRRTGLMNEIILNIKSIKLFAWEEAFTRRLLSVRN
                     GEELPLLRNIGVASAGFNFFWQAIPFFVSLGTFITYSATSSQPLTADIVFPALSLYQL
                     LNFPLSMLAGIVSMFLQTQVSAGRLAAFFDSEELDNRGRRHAPTPAPPGGDAVRFRKA
                     SYAWSAEQLSPTLHELDLTVHSGELLAVLGRVGDGKSSLLSAILGDMVNVHGRLSVHG
                     QVAFFVQGGWCMGATVRDNILFGRTYDEALYRQCLYACALEPDLLVLQHGDLTEIGER
                     GVSLSGGQRARVALARACYAMADIYLLDDPLAAVDAHVGAHLWEHVIGPRGMLRTKTR
                     ILTLNAVSYLPQCDKIVTLRKGALLEERGTFEEVMAMKGEVYRVISSLKKSESQEQQE
                     EAQAELKKDKVQATEHASRPRPRELSLLELKATTMRHLRESKSPQEIQETGSVKWRVY
                     KDYIQSASSVGVALFFVAHILTQACMIARDVVLKQWSAVNARPDTNFDKAASYYLTLY
                     GSMGMLTSVGVCIAPMILYVWLVLSSAKRYHDSLFSSVLRYPLQWFETTPTGRLLNLF
                     SRDISVIDEVLPRVIQGMARSSVVVMGVVCVVTYSVPAFLVAIIPLAMAYRAVMRYYL
                     SSSRELKRIDAVSKSPIFTWFQEALGGLSTIRAFSQASGFTHAFETRVDLNQMCYFPA
                     VTCNRWLAVRIEFLGSFVILFASTMAIIVVTTGGRMSAGLLGLMLSQVLSTTQTLNWA
                     VRSASEVEQNIVSVERVMSYAGLPMEREAHIPETQPPPSWPSRGVVEFRHYSTQYRAD
                     LEPVLRDVSFKTRAGERIGVVGRTGAGKSTLTLALFRILEATEGSVYIDDIDISTLGL
                     QDLRQSMAIIPQDAQLWQGTLRQNLDPLHQYTDSELYRVLKQARLCGIVDDHAAGLLQ
                     PVSEGGSNFSAGQRQLICIARAMVRQSHILVLDEATSSIDLETDQLVQQIVRTGFTGT
                     TITIAHRLNTIMDSDRVLVLEQGRVVEFDAPATLLKNPRSQFYSMAREAGLVQAPPV"
     gene            <948138..>951170
                     /locus_tag="MRET_2215"
                     /note="MRES_08815"
                     /db_xref="GeneID:38738981"
     mRNA            <948138..>951170
                     /locus_tag="MRET_2215"
                     /product="homoaconitase"
                     /transcript_id="XM_027628842.1"
                     /db_xref="GeneID:38738981"
     CDS             948138..951170
                     /locus_tag="MRET_2215"
                     /codon_start=1
                     /product="homoaconitase"
                     /protein_id="XP_027484300.1"
                     /db_xref="GeneID:38738981"
                     /translation="MHQLFARRARRVTHGVRVGARACFATHAGSEARVHPSRMPRYAE
                     LLEQLSQVRPLVGGRPLTLSEKLLYTHLLDPAVDLAGAGADASKVRGARYLRLGIDRL
                     AMQDASAQMALLQFMTCGMSQSAVPASVHCDHLIQAFEGAQADLERSLDTQREVFAFL
                     ESACQKYGIEFWRPGSGIIHQIVLENYAAPGLLMLGTDSHTPNASGLGCLAIGVGGAD
                     AVDALTATPWELLAPKVLGVHLHGKLSPWCSAKDVILHLAGELTVRGGTGYIVEYFGA
                     GLQTLPATGLATMSNMGAEIGATTSAFPYTPAMGRYLGATGREAVARAAEQAARAGLL
                     SADAGAEYDRVIDIDLSQLEPSLNGPFTPDLNMKLSDFVARARQADCPHPVELSGALI
                     GSCTNSSYADMSRCADLAQQAQARGMKVQVPLDVTPGSEQVRATMERDQIEAALTNAG
                     ARVLANACGPCIGQWKRADKQGETNVILTSFNRNFRGRNDGNAQTLNFLAAPEIVTAY
                     AFAGRLDFNPMTDALTAPDGSEFRFAPPADKELPEHGYAMGDASYMPEPMPVPQPDVR
                     VDIDPKSERLEALQPFESYFAHGSYELPPMRCLMRIRGKCTTDHISAAGPWLKYKGHL
                     SHIANNTLMGAVNDETGRVNDARDYEAVEPRHDTIAAMAQRYRARGQPWVLVADHNYG
                     EGSAREHAALQLRLFGCAVVLARSIARIAETNLRKQGVVTLLFENEQDYERIGSGDMV
                     ETVNLADLLRPGVEDVQDVQVRVRVTKLDDDGNVREQFELPTRHSLSKTHLQWIRAGS
                     ALNDIRAKASRPPSAPSVPRSDVRAFSTCAVRRAAPPQVVPTGNDPRYEQLRQLLFPA
                     PPTGKKNTGPKTLADAVGHGDVSADVYETIHRAWKLHQRRQKAALAASLATKRARLDE
                     ALEDLRRTDTTLWKRANEYSSPTKRNAEEQQRLAHLGLSQQASADGGEVAGSRMLAKK
                     RARLMARTRLATLFPRELRAPTMTPPTRGWPSYAPDEE"
     gene            complement(<951183..>951758)
                     /locus_tag="MRET_2216"
                     /note="MRES_08820"
                     /db_xref="GeneID:38738982"
     mRNA            complement(<951183..>951758)
                     /locus_tag="MRET_2216"
                     /product="suppressor of G2 allele of SKP1"
                     /transcript_id="XM_027628843.1"
                     /db_xref="GeneID:38738982"
     CDS             complement(951183..951758)
                     /locus_tag="MRET_2216"
                     /codon_start=1
                     /product="suppressor of G2 allele of SKP1"
                     /protein_id="XP_027484297.1"
                     /db_xref="GeneID:38738982"
                     /translation="MSAPRHDYYQTAEHVVLSVYVRHQPKEDVSVRVEGQELRVCAPA
                     LSDAFTLSLWAPVSPEVDVAVVPSKIELTLRKCEGGVMWPTLVADGTRAAAPAPASMP
                     STAPRPASKWDALDYTDADDAPPSGSGDAELNAFFQKLYADADPDTRRAMVKSFQESG
                     GTALSTNWADVKDKTMSVRAPQGLEARRYEQ"
     gene            <951809..>953353
                     /locus_tag="MRET_2217"
                     /note="MRES_08825"
                     /db_xref="GeneID:38738983"
     mRNA            <951809..>953353
                     /locus_tag="MRET_2217"
                     /product="alpha-1,3-glucosyltransferase"
                     /transcript_id="XM_027628844.1"
                     /db_xref="GeneID:38738983"
     CDS             951809..953353
                     /locus_tag="MRET_2217"
                     /codon_start=1
                     /product="alpha-1,3-glucosyltransferase"
                     /protein_id="XP_027484298.1"
                     /db_xref="GeneID:38738983"
                     /translation="MERAAAVLLGTAIKVLLWPAYRSTDMEVHRNWLAITYSLPLRAW
                     YVDATSPWTLDYPPFFAYLSWLLAQPAAWIDARIVDVQRGLNYDAWSCVAYMRATVLC
                     TEGVLVYALYLLSRCTMGDETQNVLLLSILLHPGLLMVDHIHFQYNGFLFGVLFLSLW
                     AARTHRPLLCAALFASLLQLKHIYIYVAPAYFVYLLRAYMLPSLPTSASAVSAAIDRT
                     IKLGAATLVPFLLSILPFVLDAMRDVSYETNVLYAMYTRLFPFHRGLMHAYWAPNVWA
                     LYAAADRVLLRLQHQTLASTSRGLVGDTVMGALPNVPPSTCFALALSLALVYVVPLWR
                     KPSYTRLVVCVTLCGMASFGVGWHVHEKAILLAALPLGLVAHRRYVDWRTFQILSAVS
                     IVSLFPLLYTHQETPIKLIYSLLWYVIVHRSVSRRVLRPMPSNVSILLHALETIYLYG
                     LGVLAVCTNVAWPLLMHFAPTASRIPFAHMEFLPLLLTSVYCAIGFVHCWLRLSVSYL
                     LDSPAM"
     gene            complement(<953339..>954739)
                     /locus_tag="MRET_2218"
                     /note="MRES_08830"
                     /db_xref="GeneID:38738984"
     mRNA            complement(<953339..>954739)
                     /locus_tag="MRET_2218"
                     /product="Ras suppressor protein 1"
                     /transcript_id="XM_027628845.1"
                     /db_xref="GeneID:38738984"
     CDS             complement(953339..954739)
                     /locus_tag="MRET_2218"
                     /codon_start=1
                     /product="Ras suppressor protein 1"
                     /protein_id="XP_027484306.1"
                     /db_xref="GeneID:38738984"
                     /translation="MPSGKSRQASRPNKDVTESASEASDVLSSTSLSLAGHELPPREA
                     VSETLAQFIQLRRLDVSNIQASDAWPHGLKDLLWLAKAVRQSRKVGKRTGQAPLHRRL
                     TWLNLSGNAALGDSDGPIDGLDLLPELCVLNASHCTLRAFPPALGALSNLKALVLSHN
                     AIAALPATFPHMPELNTLVLSHNDLKALPKTMPASVPNLKKLSLGHNALSCDGIPDFQ
                     VCSHLREVRLNGNTQLGVLPPHIAAWGRGVDGGAPGLVLLDVSDCGLQDWDAVEPLLE
                     RPTNDIERHGLVNLSAKGNPIAGDRSYSSRLCEALPSLRILDNVRLHAPKATLKEPAE
                     TIPSKRKEVEPAPEPAPLQDDGPKKARKRSGRGPKKTKKTPDIPAAEPEAPRRKKIRR
                     KKTAKAVEMDMDTEIPPAAPVRSAAPEEPEDARSEPAPSGVVQVVQVNETRTKPAASA
                     AALLGKRQDDTALHGW"
     gene            complement(<954834..>956789)
                     /locus_tag="MRET_2219"
                     /note="MRES_08835"
                     /db_xref="GeneID:38738985"
     mRNA            complement(join(<954834..955891,955919..>956789))
                     /locus_tag="MRET_2219"
                     /product="orotidine 5-phosphate decarboxylase"
                     /transcript_id="XM_027628846.1"
                     /db_xref="GeneID:38738985"
     CDS             complement(join(954834..955891,955919..956789))
                     /locus_tag="MRET_2219"
                     /codon_start=1
                     /product="orotidine 5-phosphate decarboxylase"
                     /protein_id="XP_027484307.1"
                     /db_xref="GeneID:38738985"
                     /translation="MSAANRTYEERAQQHPNACAKGLLETIVHKNSNLCVSVDVTTKE
                     EFLAVVEAVGPYVALIKTHIDIIEDFDDDLVEQLTHLSVRYNFMIFEDRKFADIGNTV
                     SLQYAAGVHRIVRWSHMTNAHLIPGPGVISGLASVGVPYQRGLLLLAEMSTKGSLTTG
                     TYTTANVRAAMQDESQFVFGFIAMHRVHEDPAHLDPDLTHEQRAKDLLILTPGVGMDV
                     QGDGKGQQYRTPEQVIRDSGCDVMIVGRGIYGALLNKDLSRTEALESVKAQAQRYREA
                     GWKAYLERLAPTSHSFPRRSSRHSREIHTSVKAESPPPVKQALEPEPRASPTKKIKME
                     LTADEARKIKVPRRWKEVYDLLEKQRDDIVTPVDTMGCEENGLEERRADRGRLRADGK
                     EEDDKEKEQRRQFTTLVSLMLSSQTKDPVTADAVYKLQTRLPDGLTLASLRDAPHDQL
                     IDCIGKVSFYRRKADYLKSMTRILQEKHHGDVPRTIDELCEIPGVGPKMAFLQMQSMG
                     LNVGIGVDTHVHRISNRLGWCKTKTPEQTRLALQSWLPREYHGVINKQMVGFGQVICL
                     PVSPRCDLCYIGRAKLCPSYRKVDPKTLGKRVPVYYKNGTVDRGEGPVPIQDDADAHV
                     TPTEAVVRSAATSQALEW"
     gene            <956889..>959394
                     /locus_tag="MRET_2220"
                     /note="MRES_08840"
                     /db_xref="GeneID:38738986"
     mRNA            join(<956889..956917,956946..>959394)
                     /locus_tag="MRET_2220"
                     /product="kinesin family member 5"
                     /transcript_id="XM_027628847.1"
                     /db_xref="GeneID:38738986"
     CDS             join(956889..956917,956946..959394)
                     /locus_tag="MRET_2220"
                     /codon_start=1
                     /product="kinesin family member 5"
                     /protein_id="XP_027484286.1"
                     /db_xref="GeneID:38738986"
                     /translation="MAAHVKVVARFRPAQVQGESLRSGDDAVIVEHHDTQSVRLTRGS
                     DAVFTFDHVFPMDTSQAHVFDHSIKGTVNDVLQGYNGTIFAYGQTGSGKTYTMMGADI
                     QDDHTRGIIPRLTDQVFQGILHSPPTIEYTVKVSFMEIYMEKIRDLLAPDRINLPIQE
                     DKSKGVRVKGLSEHYMSSPDEVYDVIRRGTGVRVVSATRMNAESSRSHTIFTFTVQQR
                     NTETGATKSGCLYLVDLAGSEKVDKTGASGQTLEEAKKINRSLSALGMVINALTDGKS
                     AHVPYRDSKLTRILQESLGGNSRTTLIVNCSPVAYNADETLSTLRFGVRAKSIKNNAR
                     INAELSPNELRELVRKAHTQIHTYQSHIKQLETEVEAWRRGESVPMDAWTSFLGEQAP
                     SSKDVSASAAVAQEQRLIDQNRTLEAELMQARWKLEEVQMENRELKELADTAPSHEAP
                     AEVRVVETPAPRTSREQRVEEMLQALEGRQVALEPVMACMKPLVLACRQAPDFPLRMD
                     QLEWLEEEFLRTHMALSEQVMSTRIATQEMSVLQQQKQALESRNAALQQRFDLITNQI
                     GALENGLRVGEEGAVQLAELRHMLEEHSSTHLENTSSETLHLEQLLAIRGEETAGLLR
                     SLEDLKASHEEQRRAMTLLSAAVVRGDERGPDPACVQRLVDASRQMEKARELVTLRLR
                     EYERLKERLMEGLRERSERVVDLEMELEAMQDEYRVLLQNMDFGTQKRKMAVIERRLE
                     QLMGVQQRLIEQNATLKRDVALAEKRLASRADTIEELEWRLDAQNVDEAWDSSTEAHA
                     RIAKPLRGGGAESTATPQTARRWFFHA"
     gene            <959425..>960273
                     /locus_tag="MRET_2221"
                     /note="MRES_08845"
                     /db_xref="GeneID:38738987"
     mRNA            <959425..>960273
                     /locus_tag="MRET_2221"
                     /product="chorismate mutase"
                     /transcript_id="XM_027628848.1"
                     /db_xref="GeneID:38738987"
     CDS             959425..960273
                     /locus_tag="MRET_2221"
                     /codon_start=1
                     /product="chorismate mutase"
                     /protein_id="XP_027484285.1"
                     /db_xref="GeneID:38738987"
                     /translation="MADSINFHHASVQEILSLDNIRASLQRMEESIVFRLIERAQFAY
                     NACVYQDGAFPELREKEHWTGSWLAWSLRATEAWHAKLGRWLAPDEHPFTPLDQLPEP
                     VLAPNDYPEILHPHRVNVTHEIVQFYTQDIVPQITIREGRPLNDRQYGSSVVCDIEAL
                     SAIAHRIYFGMFVSESKFRADPAAFIPAIQTRDTDALASLITKPAVEQKLLERVHQKA
                     EVYGQNLDHTHQAAAERKIQSDDMVRLYQQYIIPLTKKVEIDYLLQRLDGLSPDELAR
                     LQNRAA"
     gene            complement(<960253..>965226)
                     /locus_tag="MRET_2222"
                     /note="MRES_08850"
                     /db_xref="GeneID:38738988"
     mRNA            complement(<960253..>965226)
                     /locus_tag="MRET_2222"
                     /product="E3 ubiquitin-protein ligase listerin"
                     /transcript_id="XM_027628849.1"
                     /db_xref="GeneID:38738988"
     CDS             complement(960253..965226)
                     /locus_tag="MRET_2222"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase listerin"
                     /protein_id="XP_027484350.1"
                     /db_xref="GeneID:38738988"
                     /translation="MAKGSRSKTSATPATRKKHAAASAAKRGEASEPKAQPAAPKPGK
                     PNAPGQPKKKLSKKERKALAKKKAWVPPPKPPKQAPYPLDSMGLASLLPPDLVVLLRK
                     ALKKDIITRVRTLESLLAWIQGRPQQAHEALSVEERCEAIALMLPCWVYLFPRLALTP
                     SQRIRQLTLQVHDAILAFPMPHPDASCVRDELLSYTHMASILGFWAVLSHDTSRTVTR
                     LGMQVWKTYVAWHEPNAQPTKLSLYEYTHVLVDHLRPILLSPMPAAALAQMTPSLQIT
                     PASADGTELQAKNRDDAHVDENAEEVNGRLVAGALAVLHGLLETAAEELMPELDAFFE
                     SAQLWSALLSREALRDDDEQAHGASSPVTRQRAWSLLALLWRIDAACVDRHKDTILPL
                     VMQAALAERDVAVMQDMLAVCLPLLRAYPSAWIDDEDENLLPQFQAWVQVMAPLVPAA
                     CFPAVIVFLSTMPPELVPHASTSLPMIMEPLLSLAQVLAQGMSHPRAWDAYMLMVCEC
                     LRFMVRRVAPDTEETRAYVADELQCMYSTMVLPCDALPLPERLRVKSARELGRCLAAL
                     GDSVPEGTLAMIHASIASIDVARDGPALTALLVEMASAGRADDALAHALLQRLLGAWE
                     PSSVALLTQLLESDLRTHLTSGDLADSALLVATHLIPSDLASEAPDSVVSFYTAYLRV
                     CAAPEAVWEALFGATLEAPRTVLPVLVRVARDAAPFASADRVRAWQHDMIPRLMAEPR
                     AWLALLDAPPDTLLNQETKDTLIRTLIHTAQHVDASEQPSFLRILCTWIGTRPHEHAL
                     QVCADAEAVAHLVPLVWRTGYLRDQQAYARTLWTYLTDASEALYPQAVEVLQTELLHG
                     TTPPRRIAAASRALPPALASQVGLSAEHLTHAMQDVAGAATSPLVAVHDPIVPLASTA
                     PPLVPAHMARLLRYAEACIDVPHTLSVAQTLPPIALAAMLLEDALVIGDKMEHVFTSP
                     RDAQACLVRLVHAVTRQLSSLAAHVSADWHTSAAAAMPSYDGCDALTALLHTVWTYAV
                     RTDALSYARLWSRLLSGVLSLTSASSSEADVWVRACRTKSAPLACAVLWATRTRPTAA
                     HARWRNELAADLSGVPSARANTDGVRLLHLLQCAAPPQETGEALIPTQRAIFVLQTLQ
                     RWVTSDDDLDETVFALLATLFTHVAPVVQSVAGRHLDMMLDVVEENIHAVVLSEPAGW
                     PTLLSTLMLLDTLYALRCHEHVQNALSAHRSALVGALHDAFVHVCAFVAASRPTPHDA
                     LDACTERLARLVDAHVPPERFTGPDDHDTLTRLVCTTTACRALQVAALSMLAKATHAR
                     VREQVVEMAVGSLSDAAVPQLSAPLVASLRAHAGYTPAVWADLDRHAVFSFLLQWLAV
                     LDHFVEASLPLRTVFASELQTLLPTQLLPSVFVLISGVPRDIPALDGLRYALDEVDVA
                     QLTPASVPALQGLAAHVYYRTLVHVPTQVRDWWMSLRDRQLSMRVAHFTSRFCTPVLA
                     ERELRHLRDPAALSRLQDESMSVRILASNEVVATYTVDEHPMEIGVRLPSDYPLHGVE
                     IRDLKRVGVSEAQWRAWLLAVQQLLSGRNGLILDALTLFKKNAEAKFQGYEGAECAIC
                     YSIISPTDQSLPTKPCRTCKHKFHGSCLFKWVSTSGASTCPLCRSIL"
     gene            <965358..>965716
                     /locus_tag="MRET_2223"
                     /db_xref="GeneID:38738989"
     mRNA            join(<965358..965395,965422..965494,965520..965555,
                     965582..>965716)
                     /locus_tag="MRET_2223"
                     /product="DUF2346 domain protein"
                     /transcript_id="XM_027628850.1"
                     /db_xref="GeneID:38738989"
     CDS             join(965358..965395,965422..965494,965520..965555,
                     965582..965716)
                     /locus_tag="MRET_2223"
                     /codon_start=1
                     /product="DUF2346 domain protein"
                     /protein_id="XP_027484349.1"
                     /db_xref="GeneID:38738989"
                     /translation="MAGPALEVFRFGMYLMFPLGFMLYFGDPNWYEKYVLPSRGRFMP
                     PETDFKQPHTKEELQQLLQEKREQASVAHDPAAVGLVSHFQKVDKERMI"
     gene            complement(<965721..>966273)
                     /locus_tag="MRET_2224"
                     /db_xref="GeneID:38738990"
     mRNA            complement(join(<965721..965852,965879..965946,
                     965973..>966273))
                     /locus_tag="MRET_2224"
                     /product="INO80 complex subunit C"
                     /transcript_id="XM_027628851.1"
                     /db_xref="GeneID:38738990"
     CDS             complement(join(965721..965852,965879..965946,
                     965973..966273))
                     /locus_tag="MRET_2224"
                     /codon_start=1
                     /product="INO80 complex subunit C"
                     /protein_id="XP_027484352.1"
                     /db_xref="GeneID:38738990"
                     /translation="MSEPGLTSEDLSVYVDKHPFKSEAYLQKMGANGAPVPSRRNKPL
                     KQILNQEREAYYQKRGMVDPTKKRGDSTPKRRKTEQEADSEVPAPREEGPLRDVPTYT
                     SVQAPPSLLPPKRYCDLTGLMAPYTDPKTRLRYHSAEVYQIIKGFAPGADNAYLALRG
                     DASQLL"
     gene            complement(<966333..>968528)
                     /locus_tag="MRET_2225"
                     /db_xref="GeneID:38738991"
     mRNA            complement(<966333..>968528)
                     /locus_tag="MRET_2225"
                     /product="endonuclease/exonuclease/phosphatase family"
                     /transcript_id="XM_027628852.1"
                     /db_xref="GeneID:38738991"
     CDS             complement(966333..968528)
                     /locus_tag="MRET_2225"
                     /codon_start=1
                     /product="endonuclease/exonuclease/phosphatase family"
                     /protein_id="XP_027484351.1"
                     /db_xref="GeneID:38738991"
                     /translation="MSRAFGRWGRQIGPSRVDKMEASQHPASSSQQNSAYHRYVDTIE
                     SSERETIKIRIMTWNMHGNVPMGDLEVLFGRVDPCMAPAQAPQNPHRIPQLPMSDTHP
                     YHIVVVSCQECPWGEGGQLMHKIHTAGEIGHAYRYTRARRDMTPADIQAAMSDHSWKD
                     TSAPNSRADVSTDSRPSLSLTIPSADDSILSNAAEHEIITNHEGCEMIVTSRAWSKVC
                     HDWLCRGLRRTCAELLAGSDPDSGVSAHSSPSTSSSARIPSISSVSSLSPQCMRHPPE
                     QLGVYNLLIKERLMGCYTAVYVWRGCADFVRGASAHAVSSGLLAGRMGNKGGVGISVM
                     LGTTRLLFINAHLAAHANRIDARIANIEKIKAELNVNTFLPPDHPQLDKRDITKNFDH
                     CFWCGDLNFRVDISRKHADSLLQQQSYDDALEFDQLRKVLRDGHAFDGFREAPIDFPP
                     TYKYDLQRAERQRLRHHPSMLLRKGAASVQASELPKKASSSSLSSAVEKRRPMWRRFL
                     HRFRHSEQAIEEEAMQCQDNNLATLTRKSSSSTLSGVSTSSSAMEQQEDDRQSRGVAS
                     SVAAHNSLSSKLQAAVHLHRSDSTSSSVAYDSSTKQRVPSWCDRVLWRSNDFSHTDIA
                     SMSTDTSHKKITRFLPWKHMHKSSKDSDAEASATHTFLLQAPLDWIHSMVESKNASLL
                     EPFLDEDMLVPSKGQVKVIDYSTIDDEGVQALGARSDHRPVLFSAAIGI"
     gene            complement(<968634..>969788)
                     /locus_tag="MRET_2226"
                     /db_xref="GeneID:38738992"
     mRNA            complement(join(<968634..969100,969128..>969788))
                     /locus_tag="MRET_2226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628853.1"
                     /db_xref="GeneID:38738992"
     CDS             complement(join(968634..969100,969128..969788))
                     /locus_tag="MRET_2226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484667.1"
                     /db_xref="GeneID:38738992"
                     /translation="MSRVASHSSSVLFDDHSSIFAFDEPGGGMNLELDDHDAPMDAWN
                     LQDDRSLESDESRSEDFDMYRDFYNMDQVPKQLEAEVAPSSVGGVPPMTARPKSHPLV
                     HIPTQHDPSAYSHDMHHLHDSFLAGDALKGQSFMFGPNDSFMELAPLGPEYTAEEHER
                     MTRAYRRGERLRKQKRLFGAWLRGERRCFGWLGRGSVLIFLFIFMALLAVLLYFVIPR
                     APDIDLVTHEALTAATKKSDIELTPIPKGFKMNGTLHFRVDYTNGWIPVHLLSLTTQV
                     KLAKTNKVIGHGTVPSQWIPGHKTSDLKVPISFSHKSVNQTGDDTQLTIQDACAHLYQ
                     GVRRPSMDFRIHVKMDLGGIVSPHEKDLTLNNVECPWEFPN"
     gene            complement(<969952..>970290)
                     /locus_tag="MRET_2227"
                     /db_xref="GeneID:38738993"
     mRNA            complement(<969952..>970290)
                     /locus_tag="MRET_2227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628854.1"
                     /db_xref="GeneID:38738993"
     CDS             complement(969952..970290)
                     /locus_tag="MRET_2227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484778.1"
                     /db_xref="GeneID:38738993"
                     /translation="MSLSVNDIPLPRDSVSTASDLTIAEDDLEILPAEDLDSDVEYLP
                     LQSLPSGRRLRLIFAHQSRFLFLQGIFLFAFVIVGMCLLVFLIPWFASSRRQAPTQHK
                     SSSERPLYTS"
     gene            <970340..>970762
                     /locus_tag="MRET_2228"
                     /db_xref="GeneID:38738994"
     mRNA            <970340..>970762
                     /locus_tag="MRET_2228"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628855.1"
                     /db_xref="GeneID:38738994"
     CDS             970340..970762
                     /locus_tag="MRET_2228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484760.1"
                     /db_xref="GeneID:38738994"
                     /translation="MRRRPRSRHQVLGSHTWRLFVSAMQYRWLVLLAYCLVCVQGQQP
                     PSSSASSSASGAVVTASQSDGVSSDSASSHAITRTAANAKEGALAGTAIAPGPNHRGK
                     TGPDDRHFVDAVDAVRPGWFWTVLFAYVTVYYHAAGSL"
     gene            complement(<970741..>972681)
                     /locus_tag="MRET_2229"
                     /note="MRES_08855"
                     /db_xref="GeneID:38738995"
     mRNA            complement(<970741..>972681)
                     /locus_tag="MRET_2229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628856.1"
                     /db_xref="GeneID:38738995"
     CDS             complement(970741..972681)
                     /locus_tag="MRET_2229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484504.1"
                     /db_xref="GeneID:38738995"
                     /translation="MPLPRELCTYILLRACEEPATRACTLRDVVDACHMPSHKPFHAA
                     CVKCDADMVLTVMQLNRAYYVIGAEILYRSVILHKPSQLLAFLHALVHRPALGRLVRH
                     LYIGSTAYVAECPVAYLSTGYSSVEQAFGIEKHRSSDHPCTPHGSVLPPALEHEITEI
                     GALYAGPHREHGVCIREPGFDFHGRFISRSEWAKRLCEVHSLLLWLRYLGHEERMYEV
                     QRWQAHPFPVEEHWCTLSKEHAHARRQIDAYLEEEEDQPGQDPFEPRALHLRPPGTRS
                     DPLDWDDATQFVDALPSSEDAVPTVITWHILRTFHSSSLPRWLCVLLAKALAYGRSAA
                     LESMMDRVPMPTPTHPVVTYQPAAPFFSHDRFDDVYMYAISGAMHLIGIGDQSLHMPH
                     SATEEADMPHDTSTALLASWERRPFGIALRDLRVPAAGHAAEHTPMSIPTLGTLIQQV
                     HALLGFVPHLESLGLSGVLERAIAGSRQCVQLECVQRLYLGPPPIFWEHTLQWGDPHH
                     RTFAHLRCLEVSGCMLLPIEAEALGGGNDALPALCDVTWSLYRATLDYDARSIVNTMA
                     IILGLSIPGAVPAPPVQQRRKGVQRLVVRMHRQAHDAVVTAAPTHVLHDARLVLEIAQ
                     AHGPIHPVVQAWASEHHRLPAA"
     gene            complement(<973141..>974910)
                     /locus_tag="MRET_2230"
                     /note="MRES_08860"
                     /db_xref="GeneID:38738996"
     mRNA            complement(<973141..>974910)
                     /locus_tag="MRET_2230"
                     /product="pyruvate decarboxylase"
                     /transcript_id="XM_027628857.1"
                     /db_xref="GeneID:38738996"
     CDS             complement(973141..974910)
                     /locus_tag="MRET_2230"
                     /codon_start=1
                     /product="pyruvate decarboxylase"
                     /protein_id="XP_027484391.1"
                     /db_xref="GeneID:38738996"
                     /translation="MKLGQYIVKRLEELHVTHVFGLPGDYNMQLLDHIEDSHKLQWVG
                     CANELNASYAADGYARAANRPAVLVTTFGVGELSALNGVAGSYTEMLPVLHIVGMPPS
                     AAQANHLWMHHTLGGNLYSAYYNMSQHISCDAALIGWSQRDLDNAPYHVDRVILTMLR
                     EKHPAYIGIPVDIIDMEVSGDMLDTPLVVPRPVVPAEKCEYVVNEVARDVEAAKRPLF
                     LVDGCVQRHNVVKLVYDFLKKIGVPVVVAPMGKSLFPEDDEQFLGEYVGRGSAPSLEA
                     IMEEVDLFVMLGGFKSDMNTGKFSYRTPTCHSIEIHSHSVQIGYAEISGIGFEEVLPA
                     LGERLAVHHDAYLRLTKELRARLPDKQTFPDESFISQDYLWHRIGQFLRPKDHVVCDM
                     GTSCFGATRTRVPTGAHYYQQLLYGSIGWSVGAVLGVLYGAQVTDKGRVILFVGDGSL
                     MLTMQEIATIMRYGLKPIIFVLNNDGYEIERKIHGPDRSYNNIPRLDYSLLLDFMSCT
                     RDVRADIRSHESSHVRQEASRSHHAEVNVPEKHYHSVRTREELEKLFEDEKVQNADGI
                     HLVELFLRRGDAPDLLNKFVNNI"
     gene            <975061..>976239
                     /locus_tag="MRET_2231"
                     /note="MRES_08865"
                     /db_xref="GeneID:38738997"
     mRNA            <975061..>976239
                     /locus_tag="MRET_2231"
                     /product="protein AIR1/2"
                     /transcript_id="XM_027628858.1"
                     /db_xref="GeneID:38738997"
     CDS             975061..976239
                     /locus_tag="MRET_2231"
                     /codon_start=1
                     /product="protein AIR1/2"
                     /protein_id="XP_027484392.1"
                     /db_xref="GeneID:38738997"
                     /translation="MGRSKSKRKSEPSFVVDTQSENVPESIGMTSKTAGSSTSTATGL
                     DLPDHVEIVTRDTPSIEPVPAQDGEYEQLDADTSRYYDAEANDERKRKGICPVCGEAG
                     HDKKKCPYKQCLACGAVNEHTTRDCPLSTSCFRCGGVGHLSRDCPAPRTGSRRRVCER
                     CGSTSHPETTCHTLWRQYTYYAPDEYDKVRAKKYRHEQRRMSDAQKREKRQNKARQGW
                     AANLVLPDHDAGPSDDTEDEQPHPSAPRDWDPARRVCYNCAAVGHHWGDDCFLRRTNP
                     TRPTGDPSPFSELMAHTGPFRMQHHDTMRSRRPSAPPPPTRTRHSLPGRPSLLDDMQD
                     MDEQYWLARHKKLRGQDAALSDLEDDTPPQPKPSKRPHRAGPRGRGSRFQPRYRGGYT
                     "
     gene            <976404..>978116
                     /locus_tag="MRET_2232"
                     /note="MRES_08870"
                     /db_xref="GeneID:38738998"
     mRNA            <976404..>978116
                     /locus_tag="MRET_2232"
                     /product="cell division control protein 6"
                     /transcript_id="XM_027628859.1"
                     /db_xref="GeneID:38738998"
     CDS             976404..978116
                     /locus_tag="MRET_2232"
                     /codon_start=1
                     /product="cell division control protein 6"
                     /protein_id="XP_027484551.1"
                     /db_xref="GeneID:38738998"
                     /translation="MATVSGLSAHSLAGAKTAVCAAMEDEPPSPSLGSLETRRDENKE
                     NIAPIRQVPAAILAEEHAVQTHDAIAMRTRRRMAARPVTPPSTPKKRRDASAQYTTPT
                     KRSKTLDTPPPTPTPSVYAQARALLRKEVLVGRCAERSKLHEFLDTSLQGNSSGCLHI
                     SGMPGTGKTALVRDVMRERADEHMYMNCVGLSHPQEAAHRVAAALNVPDVSALECLST
                     SRRHSLVVVLDEMDLWLHTHRDMLYRMFCLPKLLYARTQGAVRLALIGIANSLDLTEQ
                     FLPVLRSQGVSPSVLHFSPMPADEVQALLAARLHDVPSAFTHAALQLLARKLTASTGD
                     IRRALDTCRQALDLAEADQRGSVTPTHILRVFSQMAGHAQVSRVRALGVHAKLLLLAW
                     IILQQHAEAGLVRRSGTTRGDGGVSLSDLEAEYTRMLEYDAAFVTPLGGSELLDVLER
                     LEVQGLVRIWSEAGSSQASSSSVRVSPSAKRAAARQMLATNRRMAPTLERECLVRALT
                     TGATSPAEAADTTHTPTVVDAMTRLLERADLDIARQTKWRVDEQARVRKEELGGGRGA
                     IADM"
     gene            complement(<978121..>978480)
                     /locus_tag="MRET_2233"
                     /note="MRES_08875"
                     /db_xref="GeneID:38738999"
     mRNA            complement(join(<978121..978316,978341..>978480))
                     /locus_tag="MRET_2233"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628860.1"
                     /db_xref="GeneID:38738999"
     CDS             complement(join(978121..978316,978341..978480))
                     /locus_tag="MRET_2233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484552.1"
                     /db_xref="GeneID:38738999"
                     /translation="MPPSRRAASLQSVIAALETGAGARKLPKAIESLQLRVPRKFENK
                     RDWSFLRKELPRLVYHNPDLQVNVEHPDNAPPSMIVHFTNMPERTIIFGDKSSADITS
                     ELLAMAQHT"
     gene            <978588..>980561
                     /locus_tag="MRET_2234"
                     /note="MRES_08880"
                     /db_xref="GeneID:38739000"
     mRNA            <978588..>980561
                     /locus_tag="MRET_2234"
                     /product="mitochondrial division protein 1"
                     /transcript_id="XM_027628861.1"
                     /db_xref="GeneID:38739000"
     CDS             978588..980561
                     /locus_tag="MRET_2234"
                     /codon_start=1
                     /product="mitochondrial division protein 1"
                     /protein_id="XP_027484387.1"
                     /db_xref="GeneID:38739000"
                     /translation="MAKTQAPESAGGASFDPEPGRLLSDMAPQLMTPAMMNAIARVSL
                     QTNSMTTARDPFPLQRSILLLAPRFSMENPARSLARITHSIWQFSGIGKSSESKGRKR
                     ERTPITSMDVGVLEESQRILANADIDLDASLDTSILDENASDVDGVPVSLFRGYEATV
                     PHVSSGKARRRQIQASEATRRRKQPQNLLSLHELEAQDNEMLSERRNLEIRRALYHAE