GenomeNet

Database: RefSeq
Entry: NC_040196
LinkDB: NC_040196
Original site: NC_040196 
LOCUS       NC_040196             846651 bp    DNA     linear   CON 11-JAN-2019
DEFINITION  Malassezia restricta chromosome IV, complete sequence.
ACCESSION   NC_040196
VERSION     NC_040196.1
DBLINK      BioProject: PRJNA495494
            BioSample: SAMN09478194
            Assembly: GCF_003290485.1
KEYWORDS    RefSeq.
SOURCE      Malassezia restricta
  ORGANISM  Malassezia restricta
            Eukaryota; Fungi; Dikarya; Basidiomycota; Ustilaginomycotina;
            Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
REFERENCE   1  (bases 1 to 846651)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Complete Genome Sequence of Malassezia restricta KCTC 27527
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 846651)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JAN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 846651)
  AUTHORS   Park,M., Cho,Y.-J., Lee,Y.W. and Jung,W.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2018) Division of Polar Life Science, Korea Polar
            Research Institute, 26, Songdomirae-ro, Yeonsu-gu, Incheon 21990,
            Korea, Republic of
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP030254.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: 2018
            Assembly Method        :: canu v. 1.7
            Assembly Name          :: MRES_180501
            Expected Final Version :: yes
            Genome Coverage        :: 38.8x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..846651
                     /organism="Malassezia restricta"
                     /mol_type="genomic DNA"
                     /strain="KCTC 27527"
                     /isolation_source="skin environment"
                     /host="Homo sapiens"
                     /db_xref="taxon:76775"
                     /chromosome="IV"
                     /country="South Korea: Konkuk University Hospital, Seoul"
                     /lat_lon="37.57 N 126.98 E"
                     /collection_date="2010-05-01"
     gene            <5746..>8352
                     /locus_tag="MRET_2364"
                     /note="MRES_11560"
                     /db_xref="GeneID:38739130"
     mRNA            <5746..>8352
                     /locus_tag="MRET_2364"
                     /product="reverse transcriptase"
                     /transcript_id="XM_027628991.1"
                     /db_xref="GeneID:38739130"
     CDS             5746..8352
                     /locus_tag="MRET_2364"
                     /codon_start=1
                     /product="reverse transcriptase"
                     /protein_id="XP_027484979.1"
                     /db_xref="GeneID:38739130"
                     /translation="MFATLRHTTNIKLRQLRLRQRELDEFRKTVNDKAVADSREAGKV
                     LSLLHQMLEWGYKFTDENEVNALKAFLNQAAWDQSISKEKIKEWGALLSKKLQVQDNR
                     YGLSEIFCKIVLEWIQHSFKSGASDSQKSEEPQRQELFEQKEVWEHYAFNEATVNEQQ
                     ITHYLLDLFSPIMSKNALDKEPLDLVRERISSYATNNILQVHRHSIKEAVNCILTEDL
                     FSADKRKSLESLRENNIILDELADVIRSELERIEDWDWENQPLALHIRRHINGKYRFY
                     MDVEIIEAILIQLIGMAWAKEIRYCFQIIVNSDAWNSSTDIHLTKKDIRRRKRFLGTS
                     TVEEEKNENIQKLRHLMYNQFYFLAQLPDSSTYASYDNDISDDDNGDDDGDEDDDDEG
                     LDHKKKPNSTGFIKHLTLRLISTELLIQKHLHGECTYFQTDFKWFGPSIPHDTLWAVL
                     KFFHFPEKWLRFFERFLKPEIVFADDTNDTKRRKRVRGIPMSHALSTTFGEILLFVLD
                     FAINQATHGLNLYRFHDDIHFFGRQKSCIVAWETLCKFVNVMGLTLNDEKSASITCTR
                     PGFVCPPSAKLPAGIVRWGFLHLSSGEWMVDQEIFKKNIDEMKFQLQSCQTIFAFVHA
                     YNTYIKFFANNLGHIGWSLGQKHARLAMEYLSIVQKSVFSDLSNGKHHDIVPYLSDRI
                     KNEPYLRASSVELPSEFFYFPTTMGGLNVHNPFAKFLGRISLLWPNIDERVEGTIELE
                     RKSYDKAKEKFEAGLGPQDLDPDEPFMSYDEYAKAFEARGRHLARLYKTMTDEFEESP
                     PRLSLNAQTLLKRYSSIHFGAPPPNLETWALEMFGSDAFDRFGDLNIGDKEYLPIGLV
                     NLLLKERMRWQN"
     gene            <8780..>10699
                     /locus_tag="MRET_2365"
                     /note="MRES_11565"
                     /db_xref="GeneID:38739131"
     mRNA            <8780..>10699
                     /locus_tag="MRET_2365"
                     /product="phospholipase C"
                     /transcript_id="XM_027628992.1"
                     /db_xref="GeneID:38739131"
     CDS             8780..10699
                     /locus_tag="MRET_2365"
                     /codon_start=1
                     /product="phospholipase C"
                     /protein_id="XP_027484980.1"
                     /db_xref="GeneID:38739131"
                     /translation="MVGFKSLFGAVSVAVALAGVKAADSLKDIEHVVFFMQENRAFDH
                     YFGTMAGVRGFQDPNVQMHPNNKSIFTQPVDSSIKPAPPKDVKELMYFYVGQAGGHYS
                     NSTQCMVGGSNGWEENHAAWNNGKNDGWALHNTPYSLGYYKRKELPVHFALAEEFIVG
                     DSYHESVTSASDTNRAVWLSGTINSPGSTPGGEPTKQGGPVVDDHRAAGCEKDSRGNP
                     VACLPLKWKTIPEYLEEQNISWLVYEDTDNGYHNMLEQFEQYEHDIIKQGPLAKKGIY
                     RPGLNKFMFDLKNGSLPQVSYIVTPIELSEHPPNTPDDGAWIQSHVINSLMKSQYWNR
                     TVLIMNYDETGGFADHVMSPLSPKGTDGEWMEDPFDHKLGQQPVGPGYRVPFYVVSPW
                     TRKGGVFTEIASHDSCILFLEKWSAAHGKNWTSKELNPWRRKHMSDLMSVFDFSKRDM
                     SVPRLPHVSKASKDPVTWKWNGVPICQARYNNDNQPPVPYGNQTELKKGFEVEKGYKR
                     VRGALTEGRHLVFETYNMALTVKDGKLQSGKASSKKDDKKQMFVLHWQGKEPKDGRGF
                     RISTQADKKKFLTKDLTFSSKEDDAVEVHFTDKGNGLGHVLSYDKKYLTQNQDGKVEW
                     VDSNPTTFSIYSVTF"
     gene            <10761..>11780
                     /locus_tag="MRET_2366"
                     /note="MRES_11570"
                     /db_xref="GeneID:38739132"
     mRNA            <10761..>11780
                     /locus_tag="MRET_2366"
                     /product="aryl-alcohol dehydrogenase"
                     /transcript_id="XM_027628993.1"
                     /db_xref="GeneID:38739132"
     CDS             10761..11780
                     /locus_tag="MRET_2366"
                     /codon_start=1
                     /product="aryl-alcohol dehydrogenase"
                     /protein_id="XP_027484976.1"
                     /db_xref="GeneID:38739132"
                     /translation="MEYVRLGESGLKVSRVILGCMSYGTPDWFEWVLNEEESLPLLHH
                     AYQMGINTWDTADVYSMGKSEELVGKALKLYNIPRERVVIMSKCFFGVADDGSMPPIL
                     AMTSNDGAMVNRVGLSRKHIFDAVEASVRRLGTYIDVLQIHRLDRDTPKEEIMRALND
                     VIERGWVRYIGASSMAAWEFQQLQNLAEKHGWHKFISMQNFYNLLYREEEREMIPYCH
                     DTGVGLVPWSPIARGILARPWTERSTKREHTDGFLHRLLRSRETEADKAIVDRVQELA
                     SKKGVSMAQVAIAWTLSKGVCPILGLSKKERINEAIDALQVKLSEEETQYLEAPYVPK
                     SVCGY"
     gene            <11857..>12273
                     /locus_tag="MRET_2367"
                     /note="MRES_11575"
                     /db_xref="GeneID:38739133"
     mRNA            <11857..>12273
                     /locus_tag="MRET_2367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628994.1"
                     /db_xref="GeneID:38739133"
     CDS             11857..12273
                     /locus_tag="MRET_2367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484977.1"
                     /db_xref="GeneID:38739133"
                     /translation="MKYFAALLVLLLVHTVCAVDVASGAASVFGDATSAIGGAASTAA
                     SGVSRGGAAVQSGVCKGVSCQSPTAKPTNPNQSYNGAMGTLHTYGESAPGASSQNPSG
                     GGRSSTSSRDNGAVSPRLSSLLMTTSVILAIMTASL"
     gene            <12361..>13467
                     /locus_tag="MRET_2368"
                     /note="MRES_11580"
                     /db_xref="GeneID:38739134"
     mRNA            <12361..>13467
                     /locus_tag="MRET_2368"
                     /product="protein phosphatase methylesterase 1"
                     /transcript_id="XM_027628995.1"
                     /db_xref="GeneID:38739134"
     CDS             12361..13467
                     /locus_tag="MRET_2368"
                     /codon_start=1
                     /product="protein phosphatase methylesterase 1"
                     /protein_id="XP_027485144.1"
                     /db_xref="GeneID:38739134"
                     /translation="MSRDLRVALFKQRHPPPLHHEDKEYEDEHDELGDLPSFGAGSTS
                     PARAPASFTPLSSDDCFATALEIDILCAPNTHATIRAYYTPPRGESNTVVVCHHGAGF
                     GALSYALMARDVSALSQGELGILAYDCRGHGRSTFPSHIVKDMSLASLTSDMIAVLQT
                     LFPASDARPSIILLGHSMGGAVAVETAHALERQNDIRVTGVVMIDIVEETSLELLPSM
                     SRIVRQRPEGFVSVASAIQWHVKTRTIRNAESARRSVPSLVHQSRRHAMLPWRWNADL
                     IATEPYWTGWFQGLSSKFLTCRAARLLVLAETDRLDQTLMIGQMQGKYQLSISPHAGH
                     CVQEDAPYATARTLVQFWRRNDRLPPGLRPVGTT"
     gene            <13534..>14391
                     /locus_tag="MRET_2369"
                     /note="MRES_11585"
                     /db_xref="GeneID:38739135"
     mRNA            <13534..>14391
                     /locus_tag="MRET_2369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628996.1"
                     /db_xref="GeneID:38739135"
     CDS             13534..14391
                     /locus_tag="MRET_2369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485243.1"
                     /db_xref="GeneID:38739135"
                     /translation="MSSTEAEEDAPSAWTTEPAPEDGGDDDFGDFEEGDVPAETSAPA
                     PVEMPSLPLSTDAQDPHMRDAIRDVLPYDFTHVEGVQGNVVEESMRQVEGLSQILVSE
                     RSRAMFRELSTHDVTNATLDWRRSHTRRQYLISLGVPINLDEMQGPTKEVLPPLELHV
                     NSPSDHAQDAAHESLGDRRRREMGLQEPSLPTGRIETILHMSEDDIKLLTLPELRELV
                     REAESLSKRMGDALQYHLVMREAFTSDSEMFHGIIRDLVVGASHKVAARAKQDKRSGL
                     LRPLTPGAK"
     gene            complement(<14409..>14855)
                     /locus_tag="MRET_2370"
                     /note="MRES_11590"
                     /db_xref="GeneID:38739136"
     mRNA            complement(<14409..>14855)
                     /locus_tag="MRET_2370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628997.1"
                     /db_xref="GeneID:38739136"
     CDS             complement(14409..14855)
                     /locus_tag="MRET_2370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485102.1"
                     /db_xref="GeneID:38739136"
                     /translation="MSVGDGLARLEEVLREVPMAEELQSMQRTLLPIKRSLDAGKRVS
                     RGLPLWVAIKVIKASWHADGSWPLIGYDEAARHHICDPELCIVPSMHVSQHKHADIIP
                     NEAYELGKRQRKNLPCTQAPPAPYMVEPDADTIARAYAARHAASPF"
     gene            <14896..>16399
                     /locus_tag="MRET_2371"
                     /note="MRES_11595"
                     /db_xref="GeneID:38739137"
     mRNA            join(<14896..14993,15019..>16399)
                     /locus_tag="MRET_2371"
                     /product="tRNA modification GTPase"
                     /transcript_id="XM_027628998.1"
                     /db_xref="GeneID:38739137"
     CDS             join(14896..14993,15019..16399)
                     /locus_tag="MRET_2371"
                     /codon_start=1
                     /product="tRNA modification GTPase"
                     /protein_id="XP_027485101.1"
                     /db_xref="GeneID:38739137"
                     /translation="MRCVRRLTTAAPTIYALASGRPPCGVAIVRVSGAHAPSVYEHMC
                     ASDKEARPFRMMRRAIVHPRTREKLDDALVTFFPHGRSFTGQATLELHLHGSAAVVRD
                     VLEALSDMQRVLETRDIRPALPGEFTRRAFEHGRMDLTACEALDSLLHAETTQQRRFA
                     QRAASGYQARMYDQLHMQLLDACAHTEAMLDFDDEDQIDTQLWHRVRDTVQRMRTYLA
                     SELQLDTPTHQRTYADAVMHGLRIALYGRPNAGKSSLLNRLVRRDAAIVTPYAGTTRD
                     IIEVSMELAGYRVSLADTAGLRKAHDVIEKMGMERTQTYVQEADLRVLVCTPDDLGGC
                     VPAAGHRRLPKDMLERWGAHMDEPVLVLVNKMDTYTPSPTDMDAEDGVPCVIWHTSVR
                     HNVGIDTLLHDLASQVSRLYEKDEGSVPLVTQARHRHLLLEVVASLDAMLRYDELDDA
                     PDLVMMAEELRRAASALAQVTGRAITSDTVLGEIFARFCIGK"
     gene            complement(<16400..>17212)
                     /locus_tag="MRET_2372"
                     /note="MRES_11600"
                     /db_xref="GeneID:38739138"
     mRNA            complement(<16400..>17212)
                     /locus_tag="MRET_2372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027628999.1"
                     /db_xref="GeneID:38739138"
     CDS             complement(16400..17212)
                     /locus_tag="MRET_2372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484815.1"
                     /db_xref="GeneID:38739138"
                     /translation="MPRQEEGPESARYSWKDLATSQAFTDALRRDVHILVDAFALTWI
                     WLDTQPQPDTPSSSFLRWEYGPFTVFERVWIRNHWHHASSTLGTYKAIRRDFSDMVIR
                     AFLDELAPVSAPQDTTSLRLLHAVGAAFGLACWWYAQPPGTYEALPLDTEAYRALIEL
                     PERARTVLDGEAHGHRIPPSSDMAYVVQQLLSGPYHVYVVPLTSPRLCASTTLHAKAH
                     AWPEATGAMDALGIPGATSQAGASANTAQALENLSLAQTNYAARHVDVSWQD"
     gene            complement(<17272..>18096)
                     /locus_tag="MRET_2373"
                     /db_xref="GeneID:38739139"
     mRNA            complement(<17272..>18096)
                     /locus_tag="MRET_2373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629000.1"
                     /db_xref="GeneID:38739139"
     CDS             complement(17272..18096)
                     /locus_tag="MRET_2373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485235.1"
                     /db_xref="GeneID:38739139"
                     /translation="MLFACVRAGAVRAVPRCMPLRPVARMLHTTPLRMEKSHSAVAQY
                     VGPMRMAYYRLKLFSLSSLSVAALFAPVFLLWPHKMELAARVGIVATTLGASSVSTAL
                     ISWIGSPYVGHMTLRRADPHAEPLHYISDTIKDAVLDDTPSDPTRHASEKYYMEIATL
                     SWHMRSLKTTVYAPSLLRAASRPLATWELPETPPPITIDAPASVGDHTISSLVAETVD
                     VSSGRVVGRWWARWRITGVDSSEPVAFEGACESEGKPVRYFYVDETQLGDAWRVLD"
     gene            complement(<18175..>19743)
                     /locus_tag="MRET_2374"
                     /note="MRES_11605"
                     /db_xref="GeneID:38739140"
     mRNA            complement(<18175..>19743)
                     /locus_tag="MRET_2374"
                     /product="hypothetical protein"
                     /transcript_id="XM_027629001.1"
                     /db_xref="GeneID:38739140"
     CDS             complement(18175..19743)
                     /locus_tag="MRET_2374"
                     /note="asparagine"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027485104.1"
                     /db_xref="GeneID:38739140"
                     /translation="MCGIALGVWHHEDTQPHDAWASVISQIQRRGRDAYHSVACTQEG
                     TRWELHASVLCLRGKELTPQPITSQDGHLHLAWNGQIFSSEHEDDPLLDMERNDGAII
                     MTRLEEHADQIPDVLVSTLSAVDGPYAFVLVDTRNACIYYGRDPLGRRSLLHTTTQGA
                     WHLASVSGAAWKAHWKEVDCDALWQVTWGQAPVRIPRRTSRFVLRAPCDDAPDHAALV
                     PDLQAVLSESVRQRVQKTRHARIGLLFSGGLDCTVLAALTAQHHAGPIDLINVSFENP
                     RAIAAAWAVAEAPVKHDTFPADPYAVPDRVTARESYAQLAQLYPTHTFRLVQVNVPYA
                     EYVSCLDTVQMLMSPQASVMDLSIAAALFFASRGEGYVDGVPYKTDARILLSGLGADE
                     LLAGYARHRQAWRRGGYDALTKELQLDLDRIPTRNLGRDDRVLSSHNREVRYPYLARK
                     VVAYLASLPVQAKAYFELDELGDKYLLRCLATHLGLTYAAQLPKRAIQFGTRSAKMDA
                     AGAHAKGTAQAFAS"
     gene            <19864..>20396
                     /locus_tag="MRET_2375"
                     /note="MRES_11610"
                     /db_xref="GeneID:38739141"
     mRNA            join(<19864..20006,20032..20258,20287..>20396)
                     /locus_tag="MRET_2375"
                     /product="DUF757 domain protein"
                     /transcript_id="XM_027629002.1"
                     /db_xref="GeneID:38739141"
     CDS             join(19864..20006,20032..20258,20287..20396)
                     /locus_tag="MRET_2375"
                     /codon_start=1
                     /product="DUF757 domain protein"
                     /protein_id="XP_027485103.1"
                     /db_xref="GeneID:38739141"
                     /translation="MSLSTFDPNQAQNLPEIEKQIAVRCVEHAQTYWSLLQKVRGSAL
                     RLTKLDNDIYSDFEQTFPELASSDDAIRKIDEDAMKSPAGKEKWRNFIMKYEKTVADY
                     NFGTLIRTDASDEYTQDNTIFLTRFQFYVFEIARCRRGMNDWVFHQARKEKSENAAK"
     gene            complement(<20452..>20899)
                     /locus_tag="MRET_2376"
                     /note="MRES_11615"
                     /db_xref="GeneID:38739142"
     mRNA            complement(join(<20452..20746,20787..>20899))
                     /locus_tag="MRET_2376"
                     /product="NADH-ubiquinone oxidoreductase subunit"
                     /transcript_id="XM_027629003.1"
                     /db_xref="GeneID:38739142"
     CDS             complement(join(20452..20746,20787..20899))
                     /locus_tag="MRET_2376"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase subunit"
                     /protein_id="XP_027485106.1"
                     /db_xref="GeneID:38739142"
                     /translation="MSLARTINHIRNGGFAKYWRDMQYIGDAKWGRMVGLDSNGNAYW
                     ENYEEQPGRQRWVDFKQPDYDSTQIEPIWHAWLSHTRAEPPSTDPMVSKFEKPWQIPA
                     YENFTGTRGAYRPYNTTKPKLYAWEPKIAARHG"
     gene            <21198..>23906
                     /locus_tag="MRET_2377"
                     /note="MRES_11620"
                     /db_xref="GeneID:38739143"
     mRNA            <21198..>23906
                     /locus_tag="MRET_2377"
                     /product="multifunctional beta-oxidation protein"
                     /transcript_id="XM_027629004.1"
                     /db_xref="GeneID:38739143"
     CDS             21198..23906
                     /locus_tag="MRET_2377"
                     /codon_start=1
                     /product="multifunctional beta-oxidation protein"
                     /protein_id="XP_027485105.1"
                     /db_xref="GeneID:38739143"
                     /translation="MADFPAVENGQISFKNRVVVVTGAGGGLGKTYALFYASRGAKVL
                     VNDLGTTPDGKKAADLAVEQITQAGGEAIANYDSNTQGAKIIQQAIDKWGRVDILINN
                     AGILRDKSFKSMSDKEWDQVMAVHVHGSFACAHAAWPHMRKQKFGRIINTSSAAGLYG
                     NFGQANYSAAKLALVAFSKTLGIEGEKYNILANSIAPVAASKMTETVMPPEMLENLRP
                     EFVVPIVAYLTSAENKDVNGEVFEMGAGFYAMLRRQRSHGHVFRTDQTFTPEAVREQL
                     NTILDFDERPEYPKRITDANYLDLLERAKEAPANAQGDKKIDYQNQTVLVTGAGAGLG
                     RAYAQLFARLGANVVVNDMSEKAALAVVDEIKSAGGRAAPSVGSVEDGEKRVQDAVDA
                     FGGLHVIVNNAGILRDKSFAGANEKDWNLVMNVHLRGTYKVCKAAWPIFSKQKYGRII
                     NTTSAVGLYGNFGQANYSTAKSGILGLTQTLAVEGERNNILANTIAPNAGTAMTATIW
                     PQEMVDAFKPDFVAPLVAYLGSNECECTKSLFEVSGGWIAAVRWERSGGCAFSTARPV
                     TPEMIQKKWAKITDFDPERASWPAAPSESLGDMISNFGNEEPDDDAEDFVDPEDTPEI
                     KQAKQTDYESTEFAYEDRDVILYNLGVGATEKDLDLVFEQADEFKALPTFGVIPPFSA
                     GSSISFDSFLPNFSPMMLLHGEQYLAIKGPIPTSGVLVNKPRVIEVLDKGKAAAVTTL
                     TTTVNKATGETVFENQMTTFIRGSGGFGGKKTGRDRGNASAANKPPSRPADKVVKEKT
                     SESQAALYRLSGDLNPLHIDPSFAAVGGFDKPILHGLCSFGIAGKHVFRAFGAFSDIK
                     VRFTGHVFPGETLETSMWKEGNKVIFVTKVVERGTMALGAAAATLA"
     gene            complement(<23959..>24322)
                     /locus_tag="MRET_2378"
                     /note="MRES_11625"
                     /db_xref="GeneID:38739144"
     mRNA            complement(join(<23959..24030,24059..>24322))
                     /locus_tag="MRET_2378"
                     /product="small nuclear ribonucleoprotein D2"
                     /transcript_id="XM_027629005.1"
                     /db_xref="GeneID:38739144"
     CDS             complement(join(23959..24030,24059..24322))
                     /locus_tag="MRET_2378"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein D2"
                     /protein_id="XP_027485017.1"
                     /db_xref="GeneID:38739144"
                     /translation="MSQYVNVPKSDLDEGQIRELEQYEIAQGPLSVLQQSVRNHSQVL
                     ISLRNNKKLLARVKAFDRHSNMVLENVKEMWTEVPKSKNKKPVHKDRFISKMFLRGDS
                     VVLVLRNIA"
     gene            <24433..>26796
                     /locus_tag="MRET_2379"
                     /note="MRES_11630"
                     /db_xref="GeneID:38739145"
     mRNA            <24433..>26796
                     /locus_tag="MRET_2379"
                     /product="glutamyl-tRNA synthetase"
                     /transcript_id="XM_027629006.1"
                     /db_xref="GeneID:38739145"
     CDS             24433..26796
                     /locus_tag="MRET_2379"
                     /codon_start=1
                     /product="glutamyl-tRNA synthetase"
                     /protein_id="XP_027484796.1"
                     /db_xref="GeneID:38739145"
                     /translation="MTSPRLVLDPSARLPFVAPLVLANVAREKKQDSVDLSFEVNAPT
                     ALQSSESVEGALPVLRALASMADMMGTSDAEKQAVESFLTQSESMASAPFQQAMQSAD
                     DLDQHLALRTYLVGARVSAADAAIWGAIRSSSPLLGIIKKHAHAHLARWFAHVDALPA
                     FSGAVAAMNEAKSNMFKNKKTAAGFDLFLQGAKEGEVVTRFPPEASGYLHVGHAKAAI
                     LNQYFAKAYKGRLIVRFDDTNPSKEKQEFEDAIVEDLALLGIKADVVTHTSDYFEKLQ
                     ELAVRMIKEGHAYADDTQQEQMRAERMDGIPSRRRDASVEENLQHFEAMLQGTEEGRS
                     WCLRAKMSVDNPNKAMRDPVMYRCNADVPHQRTGTKWKAYPTYDFACPVVDSLEGVTH
                     ALRTNEYHDRNPQYAWFLQALGLRNVEIWDYGRLNFVYTLLSKRKLQWFVDHGVVSDW
                     SDPRFPTVRGIRRRGMTIDCIQQFILSQGPSQQIINMEWDNIWALNKRLLDPVVPRFV
                     ALSENQLVKATIQGAPPAHEKQVPRHKKNAELGVKTTVYDSHIFLEQADAASFGDNEE
                     ITLMDWGNVIVRNKSVQDGVVTALELEAHLDGDFKVTKKKVTWLAQPTESRHLTPVML
                     LDFDYLITKKKLEEDDNFTDFLTPQTRFETPALADANVAELKEGDQIQFERNGYYILD
                     KVQGVDGRREFIKIPDGRAASSASKAAPDENPEQKKAAAAAARAQKAAQKEEKKKQKS
                     GKAPAADPVQKLIEEGTKSIHMYAAPLVQTPTDVPVSTTMYRMRPLM"
     gene            <26858..>27646
                     /locus_tag="MRET_2380"
                     /db_xref="GeneID:38739146"
     mRNA            <26858..>27646
                     /locus_tag="MRET_2380"
                     /product="dihydrofolate reductase"
                     /transcript_id="XM_027629007.1"
                     /db_xref="GeneID:38739146"
     CDS             26858..27646
                     /locus_tag="MRET_2380"
                     /codon_start=1
                     /product="dihydrofolate reductase"
                     /protein_id="XP_027485126.1"
                     /db_xref="GeneID:38739146"
                     /translation="MTRPAVPLGALPLTAIVAASARNGIGARGTLPWRLSKDMAYFRA
                     ITRHVVEPEHDDDVMRRAGYVRQPIPLKNAVIMGRHTWDSIPPRFRPLRDRINVVVST
                     TMTQHDLGLAEPDDDTLIARSLEDAVTLLEERRSWRYTQRPACAGSALAHTFIIGGAA
                     LYHHALTSTSDHWYLDGLLVTRIQEPADLHEKCDVFFTEFRTPAQIEWEQRLFQGPCP
                     TPATWTLASADTHVARFPCIAPGDVAPGLEEQGMLFQFQYWQRT"
     gene            <27668..>28480
                     /locus_tag="MRET_2381"
                     /note="MRES_11635"
                     /db_xref="GeneID:38739147"
     mRNA            <27668..>28480
                     /locus_tag="MRET_2381"
                     /product="2'-phosphotransferase"
                     /transcript_id="XM_027629008.1"
                     /db_xref="GeneID:38739147"
     CDS             27668..28480
                     /locus_tag="MRET_2381"
                     /codon_start=1
                     /product="2'-phosphotransferase"
                     /protein_id="XP_027484965.1"
                     /db_xref="GeneID:38739147"
                     /translation="MSTRTREDAKKAKQERKLQAQQKAAAKPPTPAPRPKQDSPEVQL
                     SKALAYILRHGAQKEHLHIRSDGYVRVSDILARPKIQKITMPEDRAPHLADIEHVVSS
                     NAKKRFELASGTDEGPCDGCGPVLWIRAVQGHSLEDVKDVSTDALTLDNVALHLPLRD
                     ESTGDHMAIHGTQAEAWDHIRASHELRRMGRNHIHMAQGLPGDSGVISGMRNSSTHLL
                     YINVSAALRDGIPFAMASNGVVLSSGAGETGALPLTYVLRVTDRHGHTIWPA"
     gene            complement(<28486..>29676)
                     /locus_tag="MRET_2382"
                     /note="MRES_11640"
                     /db_xref="GeneID:38739148"
     mRNA            complement(<28486..>29676)
                     /locus_tag="MRET_2382"
                     /product="V-type H+-transporting ATPase subunit C"
                     /transcript_id="XM_027629009.1"
                     /db_xref="GeneID:38739148"
     CDS             complement(28486..29676)
                     /locus_tag="MRET_2382"
                     /codon_start=1
                     /product="V-type H+-transporting ATPase subunit C"
                     /protein_id="XP_027485127.1"
                     /db_xref="GeneID:38739148"
                     /translation="MPSETSNWIVSVPVQEEKGHEQMFQDLVSQLVRDGACEQTDVAP
                     IRMPPLKTGTLESLIVMAEDLPKIDTIFAAILARIVDALRALLNDDEDAMNENMNIDG
                     MSVEDYVMSWKWNSGKYRVEKSLNDLIELFTKEMQSIDHIMRQKLTAYNAAKGQLQQL
                     ERKKHGNLTVCSLADIVHKDDMVDANSEFLTTLLVVVPKTQVKDWLAKYERLTPMVVP
                     RSSAQLAQDEDYVLYNVTLFKKVQEEFMQKARENKFHIREFVWDEGLLARERAELEQA
                     GASEKELWSELLRLSCVNFAEAFQSLFHFKIVRTFVESVLRFGLPATYFVAVVEPTPR
                     KAKAIIKSLVRQFDYLNEYISSQETKPADASTQQNETPGEFVNLLEQEVFPFVLTEQP
                     MITV"
     gene            <29771..>30533
                     /locus_tag="MRET_2383"
                     /note="MRES_11645"
                     /db_xref="GeneID:38739149"
     mRNA            join(<29771..29775,29801..>30533)
                     /locus_tag="MRET_2383"
                     /product="RNA-binding motif protein, X-linked 2"
                     /transcript_id="XM_027629010.1"
                     /db_xref="GeneID:38739149"
     CDS             join(29771..29775,29801..30533)
                     /locus_tag="MRET_2383"
                     /codon_start=1
                     /product="RNA-binding motif protein, X-linked 2"
                     /protein_id="XP_027485128.1"
                     /db_xref="GeneID:38739149"
                     /translation="MNSVREIQRINERELELGLHGSGSWHDQYKDSAYIYVGGLHYDM
                     TEGDVLTIFSQYGEIVHIHLPKPRSEPDTQQPKGHNRGFGFLMYEDQRSTVLAVDNLN
                     GTPVLGRTLRVDHVAHFRPERVRNAEGHLVEPEEQVLNCAPPETVVDDEGGEDDDLED
                     PMAAYLSDKRRRHEKRRDEKHRHRHHRHRRHHRHRDDHERDADQDHIDAGEKDTHSDA
                     RDASRGPQDRSRSATPVMDRRVRTDTP"
     gene            <30597..>31931
                     /locus_tag="MRET_2384"
                     /note="MRES_11650"
                     /db_xref="GeneID:38739150"
     mRNA            <30597..>31931
                     /locus_tag="MRET_2384"
                     /product="protein phosphatase PTC6"
                     /transcript_id="XM_027629011.1"
                     /db_xref="GeneID:38739150"
     CDS             30597..31931
                     /locus_tag="MRET_2384"
                     /codon_start=1
                     /product="protein phosphatase PTC6"
                     /protein_id="XP_027485123.1"
                     /db_xref="GeneID:38739150"
                     /translation="MRSVRVWARGVHDYVRVRSRQGLHARIPLRAGVSFGAAMSRGDR
                     AQQEDAMSTACVMLPCEQLRQNLLQNVSRRAKRDPWYGWTCDEAGGEELAAQVVWFGC
                     FDGHGGPQVSQLLQNKLHHVFEEADSSMVQDTVRYTCSIGGYFGRFQGGALERLVDPT
                     QLRRPCAAPASLEALADAAHASDLEHYVALDADQGAVHTQRHLAPSTAQMSMQERATL
                     AWLMMDREIQQNEAYRGAGSTASVLLLHSLDVPTAPWYASEYLAVTTVQLGDTRLVLC
                     DAETGEAIPLTRLHHPDDPIESDRLSRQGAGVLTDSFGESRFLGTLANTRSFGDTQAK
                     RYGMTAEPEVQTHILQGSRFAFIAGFSDGIGDVMTDQELVDECRYASHPQQAAERIMK
                     YAEDLGAEDNATILCIPLRGWGAIRGEDRTALQRRDRRLNTDIYRNRRNLCL"
     gene            complement(<31926..>33788)
                     /locus_tag="MRET_2385"
                     /note="MRES_11655"
                     /db_xref="GeneID:38739151"
     mRNA            complement(<31926..>33788)
                     /locus_tag="MRET_2385"
                     /product="pre-rRNA processing protein Esf1"
                     /transcript_id="XM_027629012.1"
                     /db_xref="GeneID:38739151"
     CDS             complement(31926..33788)
                     /locus_tag="MRET_2385"
                     /codon_start=1
                     /product="pre-rRNA processing protein Esf1"
                     /protein_id="XP_027484964.1"
                     /db_xref="GeneID:38739151"
                     /translation="MVRREKDARFARVHTDPRFHRPRKDDTKVVLDERFKDVLTKGPK
                     QLDRFGRKRHDTREAQDLERLYRLDSDADYARGEVELESSSEEDDDDEEEEEDDDDES
                     GDVVVGGADAVRKAQRHDDDSDASIDLEEDFDEEAIAELDAQAHTERDEDDERGDDTC
                     RLAVVNMDWDHVRAVDLFKVFASIVSPQATRAPLAQAHDDNMALETVHGQVRSVRIYM
                     SDFGRERLEREDIHGPPRAIFRKEAKRPAAQATEEGTEFDEDALRKYQLERLRYYYAI
                     ATFDSPQSARHVYNEIDGTEMERSANMFDLRFVPEEMDLPDGEDGRPAEYCDEATEDV
                     AHYEGLDYKTDALRHSRVKLTWDQDDPRRTKLTRTSQKGQLQEDDLKTYLASSDEDDE
                     EATSSRDRLRSLLHQMPTKSAFDDADDQDTMFTKPEGDMEISFVPALSTKKDEEHEET
                     TIEKYMRKQKERRERRRMAKKESEPEAPEPAPEEPAASEEPTPGDSDDEHHFQLQDIV
                     RAEKLGSKKLSRQQRKREAKRQAKRTALTQPSFVMDTKDPRFAAVLDDHRFAIDPSHP
                     GFIKTSGMQQLIQEGNRRRHEQAEQAQPAAPNVADLVTRLKNQSARPPKKARRS"
     gene            complement(<33835..>37131)
                     /locus_tag="MRET_2386"
                     /note="MRES_11660"
                     /db_xref="GeneID:38739152"
     mRNA            complement(<33835..>37131)
                     /locus_tag="MRET_2386"
                     /product="transcription elongation factor SPT5"
                     /transcript_id="XM_027629013.1"
                     /db_xref="GeneID:38739152"
     CDS             complement(33835..37131)
                     /locus_tag="MRET_2386"
                     /codon_start=1
                     /product="transcription elongation factor SPT5"
                     /protein_id="XP_027485124.1"
                     /db_xref="GeneID:38739152"
                     /translation="MDASERDVPGTTRPDDPVKQEDGEGARPTVEESRDIEKEADHQD
                     GHDHEAHEDAEGEEEEGEDEDNDDDGEEEEEEEDEEEDEEDDDEEEDGDRRRKKPRRN
                     RFLDVEAEVDNDDEEFEDEEAEELLREDGFIADDGLEESREAQLKTAADNQRLDHMRR
                     KEEEMSAEALAEELRQRHARSSRYASQSDYAEVPQRLLMPSVNDPGLWRIRCKRGRER
                     TLVATVLRRALTREASGRPLRIYSAFCRDSLDGQIFVEARRADDVLDAFDGLAGAYTT
                     NTKPFLVPILEMADLLKLEKKNTEVPVGGWVRMKRGKYAGDLAQVLDVAENGEEVGVK
                     LVPRIDMAPQEHDTYTDRAGRKRKKKVNSALTALGFRPPPRLFNAEEVQKAYPNDLPT
                     KRGGVWVFGGETFRDGYLERDVKISAVQVQDVHPSLDEVLNFTGETPDDQAGGVDLNL
                     LADASKQTWEATLQPGDHVEVFEGEQAGVSGTVDAMSGDVVTLELPDDALDGQKIEVP
                     AKCVRKQFRAGDHIKVLNGKHANETGLVVKVEEGITTFLSDLSLKEVSVFSKDIREAA
                     EVGSGVNVIGGYELHDLVQLDAQTAGVIFKIEPETFKVLDQNGHVVTVKPHQISMRRD
                     TARSVALDYNGHEVHAGDMVKEVEWPLSQFRQGQVVHIYQSSLVFVHNREYKENGGLF
                     IVRANHVEPLAPTNVKPRTDPSQMNPALKAMDADAGANASGPRRGGRDIYAGKTVAIV
                     RGPYKTYRGIIKETTGGMARVELHTMSKIITVPLDHMVEKNPVTGESRRLVGPGPAMQ
                     NPYAAPMSGGMTPAYAGALSGGKTPAYNPYDGGRTPAYGAMATPNPYGGRTPAYGAMA
                     TPNPYAAATPNPYAAGTTPNPYAAGTTPNPYGGRTPAYGGMAAAFTPNPYASTTPNPY
                     ASTTPNPYTSATPNPYASTTPNPYASTTPNPYASTTPNPYASTTPNPYASTTPNPYAA
                     ATPNPWAPQPTPMAPLLPGIRVRIVRDGSGMQYQRGAYDGALGKLTSHNPAGGNVELE
                     SGAQLADVPTSCIEALRPSAAGDACIVINGAWRGSHVTIETFDPSRCQVRMSDGHLYP
                     LPASLLALAA"
     gene            <37260..>38663
                     /locus_tag="MRET_2387"
                     /note="MRES_11665"
                     /db_xref="GeneID:38739153"
     mRNA            <37260..>38663
                     /locus_tag="MRET_2387"
                     /product="elongation factor Tu"
                     /transcript_id="XM_027629014.1"
                     /db_xref="GeneID:38739153"
     CDS             37260..38663
                     /locus_tag="MRET_2387"
                     /codon_start=1
                     /product="elongation factor Tu"
                     /protein_id="XP_027485125.1"
                     /db_xref="GeneID:38739153"
                     /translation="MSLARAVSLCPVRGAVSSAASLAACAAPSLVRCKHTGAMANGAR
                     RPSTRGAALPLSLGAVRTYAAESSGKYVRAKPHMNIGTIGHVDHGKTTLTAAITKVLH
                     ENSGEGKFVDYASIDKAPEEKERGITISTAHVEYETPNRHYAHVDCPGHADYIRNMIT
                     GAAQMDGAIIVVSATDGQMPQTREHLLLARQVGIKKLVVFVNKVDQVDDKEMLELVDM
                     EMRELLSTYGFDGDNTPIVTGSALAALEGRDEEIGRGAILKLMEETDAWLDLPPRDLD
                     KPFLMPVEDVFSISGRGTVVTGRVERGTITKGSEIEIIGLGGHLKTTLTGIEMFHKEL
                     DRGEAGDNMGALLRGIKREQVRRGQVVIAPGTVKPVKKFSAQIYILTKEEGGRYTPFM
                     NNYRPQLFIRTSDVTVSLTHPPGTENADEAMVMPGDNVELVCDLVHDIALEEGSRFTL
                     REGGKTVGTGIVTKILG"
     gene            <38885..>39338
                     /locus_tag="MRET_2388"
                     /note="MRES_11670"
                     /db_xref="GeneID:38739154"
     mRNA            join(<38885..38936,38968..38981,39021..>39338)
                     /locus_tag="MRET_2388"
                     /product="large subunit ribosomal protein L31e"
                     /transcript_id="XM_027629015.1"
                     /db_xref="GeneID:38739154"
     CDS             join(38885..38936,38968..38981,39021..39338)
                     /locus_tag="MRET_2388"
                     /codon_start=1
                     /product="large subunit ribosomal protein L31e"
                     /protein_id="XP_027485129.1"
                     /db_xref="GeneID:38739154"
                     /translation="MAPQDKTQKGRKTRSALNDVVTREYTIHLHKRVHRMQFKKRAPK
                     GVKEVVKFAQKTMGTNDVRLDPKLNQEIWKLGVKDVPRRIRVRLERKRNDDEDAKEKL
                     YTYATPVLGITNFHGLQTTVIEQDE"
     gene            complement(<39426..>40174)
                     /locus_tag="MRET_2389"
                     /note="MRES_11675"
                     /db_xref="GeneID:38739155"
     mRNA            complement(join(<39426..39493,39519..40097,40122..40138,
                     40164..>40174))
                     /locus_tag="MRET_2389"
                     /product="SMN domain protein"
                     /transcript_id="XM_027629016.1"
                     /db_xref="GeneID:38739155"
     CDS             complement(join(39426..39493,39519..40097,40122..40138,
                     40164..40174))
                     /locus_tag="MRET_2389"
                     /codon_start=1
                     /product="SMN domain protein"
                     /protein_id="XP_027485130.1"
                     /db_xref="GeneID:38739155"
                     /translation="MASELRTYEFQLSQVEHAIEADPGNAELTSLRDELANLIHLTKE
                     YHSATDAKPKPVQETHRYQAGDDCMARHHADDRWYPAKITAVTGSAENPVYSILFTKL
                     KTTDVVSSADLRPRSASQPSSAKSSSSSASRPMTRDELAEERERKRARKEKKMEREAA
                     KNREHDARQSAWQKFQAKAVKKKYGVAGDRSMFKTPDDPYAKIGSSGGRGMTKQAPRL
                     KHTYES"
     gene            <40226..>41143
                     /locus_tag="MRET_2390"
                     /note="MRES_11680"
                     /db_xref="GeneID:38739156"
     mRNA            <40226..>41143
                     /locus_tag="MRET_2390"
                     /product="alpha/beta-hydrolase"
                     /transcript_id="XM_027629017.1"
                     /db_xref="GeneID:38739156"
     CDS             40226..41143
                     /locus_tag="MRET_2390"
                     /codon_start=1
                     /product="alpha/beta-hydrolase"
                     /protein_id="XP_027485092.1"
                     /db_xref="GeneID:38739156"
                     /translation="MAPHLCRMPDGARIGYRVLGAEHAQGPTLVMVNGMSAVMDDWME
                     LAVPLARTRQVVLFDHRGLGASHGTGDEDVTIELMAHDVLRLCQALHLRVVHLLGFSM
                     GGLVAQAILSHPDAQPTPDEAGVVIHGIEVRRVILAATFTKSPRTEFRLDGAAIPDDA
                     TRTERAMAQLQYMLAMQYHPAVLGEGRPMQHKMDARMRRGLAARRPLNTMARQAVAIA
                     IYQGRDRLRYVPRHLPIAILHGRYDHMVAYDEAREIERFLPQARRLFPHVDGDREAYG
                     HLWFDYFDVDTAWLPPLVHFLDRPATARM"
     gene            <41246..>43801
                     /locus_tag="MRET_2391"
                     /note="MRES_11685"
                     /db_xref="GeneID:38739157"
     mRNA            <41246..>43801
                     /locus_tag="MRET_2391"
                     /product="subunit of ATP-dependent Isw2p-Itc1p chromatin
                     remodeling complex"
                     /transcript_id="XM_027629018.1"
                     /db_xref="GeneID:38739157"
     CDS             41246..43801
                     /locus_tag="MRET_2391"
                     /codon_start=1
                     /product="subunit of ATP-dependent Isw2p-Itc1p chromatin
                     remodeling complex"
                     /protein_id="XP_027485224.1"
                     /db_xref="GeneID:38739157"
                     /translation="MPIVKRKPVQPQGVPAALLSAYTERKEDRAVFFLAATGEVFEEY
                     EPYAARLSYYHQRIFQCELSGKSNLTFFEAAESEAQHTRAIQSQFPDALKVPVLRAAQ
                     FQTCGRLTELVERVYECMRQRFFVGEEVSVEDGARKLGIVRGGSCPAHPDRPLHADLQ
                     AGDEPRDDAPHTYTYTIELPASHTRLENVRAEQLSRGRLAFTKTILRRFLRDALCRDA
                     AGLMWLVREPTARRFGLPTEVPAPIQQKIDEAQAAKRRKSSDDAPHAKRRDTKKEEAP
                     KPTPKYPCEDTLLDPITPDELQVQVTGELPRQAHRPRLDSDEHLNVPPELFESFLAVY
                     YFFLSLGEPLGISHMALDDLDGALRHPVSDPPCPLLAEVHAVLLNAIVRDGAHSRDLA
                     PAAVAQRRALQDVEMPEEETSDEQQDAASDVSELSDSPERHVLDAARELSDGWSRRQL
                     SDEHRRGWERSVMGCLVDRATPDAVPRYLGILSHLTGVEYDDDASTSNAHHTVSERYV
                     HLPLSDKIHILLFLCELAVLTRDVKAYYDECESHLTELRKERVELARLRKKTREQMQT
                     LHAPAGKEEQEQEEQEDAAPEEPASDSDSERDELASDDVMDEADEADRYKRLAGTRQE
                     ALREKALQREEEEKRLAEEQARSKEQVRETKQLRDERRRLAESLQWCLRREEAIEREF
                     RQYAQIPRLQPLGCDRFLDRYYWLDGIGSAAASAYQTGRLFVQAPHRREWDALCTDYA
                     GGSAALERRRRTELQVDEPCAWGAWGVYTQPEQMEQLIAWLRPRGVREQALKAQLLKY
                     RDAIESGMRRRIDDIALGVREPVVETRRSTRMRSEQATQLRMPYMQWRNTART"
     gene            complement(<43798..>44125)
                     /locus_tag="MRET_2392"
                     /note="MRES_11690"
                     /db_xref="GeneID:38739158"
     mRNA            complement(join(<43798..43830,43856..43928,43952..43979,
                     44005..>44125))
                     /locus_tag="MRET_2392"
                     /product="U6 snRNA-associated Sm-like protein LSm5"
                     /transcript_id="XM_027629019.1"
                     /db_xref="GeneID:38739158"
     CDS             complement(join(43798..43830,43856..43928,43952..43979,
                     44005..44125))
                     /locus_tag="MRET_2392"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm5"
                     /protein_id="XP_027485091.1"
                     /db_xref="GeneID:38739158"
                     /translation="MSATILPLELVDRCIGSSIWVVMKGQREFVGKLLGFDDYVNMVL
                     EDVTEYENTPDGYKKVHLSKTLLNGNNICALVPGGEGPEH"
     gene            <44188..>45198
                     /locus_tag="MRET_2393"
                     /note="MRES_11695"
                     /db_xref="GeneID:38739159"
     mRNA            <44188..>45198
                     /locus_tag="MRET_2393"
                     /product="calcineurin-like phosphoesterase"
                     /transcript_id="XM_027629020.1"
                     /db_xref="GeneID:38739159"
     CDS             44188..45198
                     /locus_tag="MRET_2393"
                     /codon_start=1
                     /product="calcineurin-like phosphoesterase"
                     /protein_id="XP_027485090.1"
                     /db_xref="GeneID:38739159"
                     /translation="MQAAWLVAWALGLAALCLPWPRVVGETRRIVALGDIHGDYAHAT
                     AVLRAAGLLHAHHDAWAGGKTVFVSTGDTIDRGDDTIRLYQLFQRLRNESRAHGGDVI
                     HVLGNHEMMNAMLDWRYVTPGDVASFGGMDERRDAMSLHGWLGTEWMQHYQVTTHVDL
                     LPAADMPLYPTHRASFVHGGITPTFADMGVDAMNDVGHTLLEKSLARRGPLSKAEQAL
                     WSSDGPFWFRGYAQDPAKAACMMAEQARSSLGVYALIMGHTPQFTGIRTRCDGRVYII
                     DTGLSRAYGGRPSALDVKSRRWGPCVVSTFSAVDLSGTHHTLHHAWQCPYLRLGRRPR
                     TT"
     gene            complement(<45162..>46358)
                     /locus_tag="MRET_2394"
                     /note="MRES_11700"
                     /db_xref="GeneID:38739160"
     mRNA            complement(<45162..>46358)
                     /locus_tag="MRET_2394"
                     /product="ketol-acid reductoisomerase"
                     /transcript_id="XM_027629021.1"
                     /db_xref="GeneID:38739160"
     CDS             complement(45162..46358)
                     /locus_tag="MRET_2394"
                     /codon_start=1
                     /product="ketol-acid reductoisomerase"
                     /protein_id="XP_027485096.1"
                     /db_xref="GeneID:38739160"
                     /translation="MSAPLTRTALRTVSKAPRRVSARMMSLATRAAPRVSPSTAVPRV
                     AMQVRGMKTLDFAGTPEKVYEREDWPLEKLQDYFKDETFALLGYGSQGHGQGLNLRDN
                     GLNVIVGVRKDGESWRQAEADGWVPGKNLFSIEEAATKGTILMNLLSDAAQTSTWPHL
                     KEYVTPGKTLYFSHGFSIVYKDQTHVVPPENVDVILCAPKGSGRTVRTLFKEGRGINS
                     SVAVFQDVTGRALEKAVAIGIAVGSGYIYETTFQKEVFSDLYGERGCLMGGIQGMFKA
                     QYDVLRAHGHSPSEAFNETCEEALESLYPLIAQNGMDYMYKACSTTARRGALDWAPEF
                     EAACKPVFERLYQSVKDGSETRRALEFGSRKTYREDYDRETDAIADQEMWRVGHVVRG
                     LRPNRK"
     gene            <46534..>48669
                     /locus_tag="MRET_2395"
                     /note="MRES_11705"
                     /db_xref="GeneID:38739161"
     mRNA            <46534..>48669
                     /locus_tag="MRET_2395"
                     /product="homoaconitate hydratase"
                     /transcript_id="XM_027629022.1"
                     /db_xref="GeneID:38739161"
     CDS             46534..48669
                     /locus_tag="MRET_2395"
                     /codon_start=1
                     /product="homoaconitate hydratase"
                     /protein_id="XP_027485095.1"
                     /db_xref="GeneID:38739161"
                     /translation="MLWRALRGGRSASRLASSQVRYASTNQTYIEKVVQKYAVDWDPA
                     VPVRSGDYVSIRPATVMTHDNTGPVISKFHAIGAKRIHDPAQVVFALDHDVQNKSAKN
                     LDKYARIEAFAREQHVDFYPAGRGIGHQVLVEEGYAFPQTLCVASDSHSNMYGGVGAV
                     GTPIVRTDAAAIWATGKTWWQLPPMVKVELTGTLPPGVTGKDVIVALCGYFKNDEVLN
                     AAIEFTGDGVRALSIDERLSISNMTTEWGALAGVFPVDDTTLQWYEDLLRQMDRLQFH
                     FGSSPRPSETHPRLTWQHLEKLAKERFEADAGASYAKHLRFDLSTLTPHVSGPNSVKI
                     ATPLHELEQQNIPIHKAYLVSCVNSRASDIKAAADVLRGRKVAPGVEFYLAAASSLAQ
                     RAAEQSGDWGALLAAGAKPLPAGCGPCIGLGTGLLEDGEVGISATNRNYKGRMGSPKA
                     LAYLASPAVVAASAAAGKICGPTPSTASTKPSLSIVAEETAAPVASAPATLDPAFPPT
                     FSGALVFVPQDNLNTDALYPGKYTYQDDITPARQAEVVMENYDPSLAASIAQERAERA
                     SRQAASSIVLVSGYNFGTGSSREQAATALKYAGVPVVLAGSFSDVFKRNAINNGLICL
                     QCPELVDDLTSAYAKDGKRGAGGRQPGELSVWLRDATVSLDSSTGTVTLLHSDGTEKR
                     YTTRPAGIGRSIQDMYVAGGMESWVQQRL"
     gene            complement(<49066..>50421)
                     /locus_tag="MRET_2396"
                     /db_xref="GeneID:38739162"
     mRNA            complement(<49066..>50421)
                     /locus_tag="MRET_2396"
                     /product="tRNA dimethylallyltransferase"
                     /transcript_id="XM_027629023.1"
                     /db_xref="GeneID:38739162"
     CDS             complement(49066..50421)
                     /locus_tag="MRET_2396"
                     /codon_start=1
                     /product="tRNA dimethylallyltransferase"
                     /protein_id="XP_027485094.1"
                     /db_xref="GeneID:38739162"
                     /translation="MRRHRDVVAVIGSTGTGKSQLAVDLARHAAQHLGMHAEAISADS
                     MQTYVGLDVITNKADASEMEGIPHHLLSFLSPGQEYDITQFVADAGGLCAQLQQQGAL
                     PIVVGGTTYYVQHLLFPGRLVSQVPPTDYEGDVHARIASLPPDLRALWDALSDDPKAP
                     PPPGDLWPLLAHLDLACAQRWHHRDHRKVYRSLRILRDTGVPQSAWLSAQDEEDQQHG
                     RREPSRRLVLWVWSEREALHARLNARIQTMIERGLLDEIRDLRRIAGDAPTDYTRGIF
                     QAIGYKEFDAYLTHGGDDRFAAAITDMQTATRRYAKRQTSWIRNQLLPEIRKAQERGE
                     DVWLYLLDATDPAFWKERVSDPAHRILEAFIAHDPMPDPRAQSAAAAEQLAVPEQTGS
                     RLERNRLVACDTCTSDEAQPFLYRENERDKHMQSRTHRMALKRRSRAAYIAEGRARAR
                     S"
     gene            complement(<50436..>52414)
                     /locus_tag="MRET_2397"
                     /note="MRES_11710"
                     /db_xref="GeneID:38739163"
     mRNA            complement(join(<50436..50450,50483..>52414))
                     /locus_tag="MRET_2397"
                     /product="leukotriene-A4 hydrolase"
                     /transcript_id="XM_027629024.1"
                     /db_xref="GeneID:38739163"
     CDS             complement(join(50436..50450,50483..52414))
                     /locus_tag="MRET_2397"
                     /codon_start=1
                     /product="leukotriene-A4 hydrolase"
                     /protein_id="XP_027485093.1"
                     /db_xref="GeneID:38739163"
                     /translation="MHWVRCARLCLPGLRAFRPLRTLCTSIPRMNWTPPAPTAVPAPP
                     IPPIRDIHSCANVNDIKPLHLHLDWSIDWDAKCIRGAVTHELEVQKDGTAHATFDTSY
                     LDIREVQVDGARAAYQLEARRGPLGEPLRIHLGERMAGDRVKVAIDYATTPKCTALGW
                     LSASQTRAKKTPFLYSQCQAIHGRSLVPCMDTPSRKVTYTARVNSSIPVLMSALRRSS
                     ASDVYEFDQPVAIPTYLIAIVGGLLEFRALGPRTGVWAEPPDADAVQWEFERDAEPFL
                     TAAEQVVSPYVWTRYDSVVLPPSFPYGGMENANLTTLTPSLVCGDRSATDVLLHELCH
                     SWSGNLISCMNWESFWLNEGWTVYLERLLLEKLYGPAHRGFSYIIGAKALRDSLEGFQ
                     DTPRFQRLVPEFRDGEDPDDAFSSIPYDKGANFLLYLERVVGGLDVFAPYIQAYFTTF
                     QGRSISTEEWKAHLLAYFATHPTASQALQTVDWDAWLHGEGLELPVRMEYDQTLAAEA
                     FALAARWIKAIGDGVDGAFAASDMQGWNANQVVVFLERLHAGPRVPQSYAARLDEIYS
                     LSTAQNPEVRLRFYEVALEEQGGRYAEEAAAWVASQGRMKYCRTIFKALYRVEPALAQ
                     RTFLENESFYHPIAAAMIRKDLGL"
     gene            <52673..>54028
                     /locus_tag="MRET_2398"
                     /note="MRES_11715"
                     /db_xref="GeneID:38739164"
     mRNA            <52673..>54028
                     /locus_tag="MRET_2398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629025.1"
                     /db_xref="GeneID:38739164"
     CDS             52673..54028
                     /locus_tag="MRET_2398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485098.1"
                     /db_xref="GeneID:38739164"
                     /translation="MYQGSLVLIGVCRLWQIQVHAWRDDIQRTMASLRDKPKRSHDLC
                     HNVLPTAFTLPDTETTDSIMYEPCPALKRHTQTTVPWVHDVWSEAPDVPWQTSPQEPL
                     APLDLGLTDIAFPISPKDSSFTELPHRHIIASTSTPLPTVMRTGPAPNRAAPKRKCLS
                     DQKVGFDEEEWERRCEAARRSPCTRQWYSAWDRAWPKCTIKRLCLCTSHALETLWDTT
                     VGTHLRVLEQHYQNERNVCRNQWAQQQWEADVPAIEDEYTQEVGRGETVVDDVFPWTN
                     MSEWRWDVPEDDLGHDDSISSANTSIVQHAARWISPNVSSDSLERPRLSRAHDASLMT
                     PLLTGNEVSTASMDADTHDFYMYMQVVRQSVPERAYIPFPELIPPNHVGPHVPVHACM
                     YASLTQSGTRWFWHRRALVVSSNSSRMQKFTFTCNKKLARTGFEPANGGWLMWVKNHP
                     A"
     gene            complement(53960..54061)
                     /locus_tag="MRET_t0040"
                     /db_xref="GeneID:38741234"
     tRNA            complement(53960..54061)
                     /locus_tag="MRET_t0040"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:38741234"
     gene            complement(<54158..>54697)
                     /locus_tag="MRET_2399"
                     /note="MRES_11720"
                     /db_xref="GeneID:38739165"
     mRNA            complement(<54158..>54697)
                     /locus_tag="MRET_2399"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629026.1"
                     /db_xref="GeneID:38739165"
     CDS             complement(54158..54697)
                     /locus_tag="MRET_2399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485097.1"
                     /db_xref="GeneID:38739165"
                     /translation="MSELFDLLNFGSPRVSGTPSRHRSLSPSPRGRIAWDQPSSSPRE
                     ALSPLLAVPPAKPREYVPEHEEKENVIQVPEIQKSPSVTRNIRARRRARAQHPYTYNM
                     CSLAPPPPPLSKASSPQHKRRRTHIQRVQSDPVVSPGHSTRADTNQPSSDDSFSRVLD
                     EDFPIDSNALEEVAAEQGW"
     gene            <54813..>55182
                     /locus_tag="MRET_2400"
                     /note="MRES_11725"
                     /db_xref="GeneID:38739166"
     mRNA            join(<54813..54853,54879..54978,55006..>55182)
                     /locus_tag="MRET_2400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629027.1"
                     /db_xref="GeneID:38739166"
     CDS             join(54813..54853,54879..54978,55006..55182)
                     /locus_tag="MRET_2400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485228.1"
                     /db_xref="GeneID:38739166"
                     /translation="MSVPKQGPFILVARFVGKGESETDELERLLLNTTKRANSDAEPG
                     TKTYRLSRNANDKCKLIVFEEYDNEAALQAHQAADAYQAVEKRVSELASSFDIDFLHE
                     LHP"
     gene            complement(<55198..>56784)
                     /locus_tag="MRET_2401"
                     /note="MRES_11730"
                     /db_xref="GeneID:38739167"
     mRNA            complement(<55198..>56784)
                     /locus_tag="MRET_2401"
                     /product="pyruvate kinase"
                     /transcript_id="XM_027629028.1"
                     /db_xref="GeneID:38739167"
     CDS             complement(55198..56784)
                     /locus_tag="MRET_2401"
                     /codon_start=1
                     /product="pyruvate kinase"
                     /protein_id="XP_027485227.1"
                     /db_xref="GeneID:38739167"
                     /translation="MMNHFARMSQIEWYASLNPIEYKIQNKSMRKTSIIATIGPKTNN
                     VETLHQLRNAGVNIIRLNASHGDHGYFKSVIENCRQVEREAPGRPLALALDTKGPEMR
                     TGVMLNNEDVKIKAGHEMIVTTDEHFADKCSAEHLYIDYKNLPKKVEPGRQIFIDDGI
                     LSLRVLRVEGDNVIVRADNNGTLSSRKGVNLPLTEVDLPAVSPKDIEDLKFAAREEAD
                     IVFASFIRTREDIVLIRSILGEHAPRMRIIAKIENHQGVLNFNEIMDEADGIMVARGD
                     LGIEIPAPQVFLAQKMMIARCNLAGKPVICATQMLESMTYNNRPTRAEVSDVANAVVD
                     GADCVMLSGETAKGEYPVESVRYMAESAQLAEDSLSYTALFNQLRGSLHLPTSTIETI
                     SLVAVSASLEQRADAILLMSTSGETARLVSKYRPPCPILVVTRNKYTTRTCHLNRGTY
                     PFHYPLPHIQDMSRWQEDVDNRIKFGLSEALKLGLVRKGGTIVAVQGWRGGKGHTNSL
                     RILTVPTTSEGYILESTTAN"
     gene            complement(<56925..>59630)
                     /locus_tag="MRET_2402"
                     /note="MRES_11735"
                     /db_xref="GeneID:38739168"
     mRNA            complement(<56925..>59630)
                     /locus_tag="MRET_2402"
                     /product="mediator of RNA polymerase II transcription
                     subunit 5"
                     /transcript_id="XM_027629029.1"
                     /db_xref="GeneID:38739168"
     CDS             complement(56925..59630)
                     /locus_tag="MRET_2402"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 5"
                     /protein_id="XP_027485226.1"
                     /db_xref="GeneID:38739168"
                     /translation="MQADGVRREVLACLTHGATPFSLHARLLETAKAEGVLTELGEVL
                     PDVLLDLVLLVRPAPPLLFEYLDVLCLDRARYMGENTCDAGRVIVVLLRKINATVDQD
                     TLSTLCQHILDAVGDAPIWTNHFIQRGVASTESFLSFWHAALHLMQAEGPSSELCRRL
                     IAGAALQGWPGLDDIPLRHTVLEAWQNIPLTQNEASRQAVATLRQGLSVITAVDDLFD
                     EHPAAQSPPNASLWKSPAFFTYATSLQRAWRQAETSGGRHRPLLPTSGAPEPETVLLI
                     HGLSDSHLHWHRKYLSALGLLQARLLHAIEPPHDVGCAFVLEMLVAMAQAATVQLRTH
                     ASERHALLWRHIIGGVMPPLVAFLSGSVPSSHRDGLVMRDMIACFVHMYDPIRDWIEL
                     DECVMATSTHAVPLPTLILASFATWDSGLHAGPVSLESLPLHSNAEIHSFSQAVRTAL
                     GQHPESCGALLAQALQEPRLQLVIANEFSHLFTEWSESLTPDLAHVHAVCLMLEPHVP
                     RVLDMLHLYIDKQKMAHALVRVLSRIEQRIWQDHSELASIGRVILFLQYLSYYIDQTG
                     IPSSGYAYIFMTRNISSINMHAFPEQSLSLIIRWCRCLVEGQAITDDLLAVSPPWTMY
                     RITPTILSLLLEAHMYSLLDDSALFKACSYFLQVPLAYNVPCAVQWLVQFASSTLAKS
                     QYDAKLLSHVVMYVRVIHKLLTSTSDVFSPLYRSILAHTVLPLLTNERLILVLSTSEF
                     NLPSFIMALESMVEPRLTKYEWISDVLMQNEQGRLWAGLAKYVGHLTHEGLQPGMAQQ
                     LLKVALHTTAEHTWATKLIAAMFAMVYPYDHVTVPLSLARVTLFQWDAQHAKAEHVIH
                     LSRIIGLSIVLVKHMPGHEEGLPAFLDSLPAVGTESFSRLLRLDA"
     gene            <59680..>60705
                     /locus_tag="MRET_2403"
                     /note="MRES_11740"
                     /db_xref="GeneID:38739169"
     mRNA            <59680..>60705
                     /locus_tag="MRET_2403"
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 5"
                     /transcript_id="XM_027629030.1"
                     /db_xref="GeneID:38739169"
     CDS             59680..60705
                     /locus_tag="MRET_2403"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 5"
                     /protein_id="XP_027485225.1"
                     /db_xref="GeneID:38739169"
                     /translation="MLRVPVRSLMTSALRWRATPSFASPQTPYHIFDRDTKCLQRSRA
                     AVRRPLNEAGTAFEADERRRGEVSRLTDYVRDAGAMSLAERLQDIQRPFPTVVELGAG
                     PGLLRHHLDVGGVGIEKLVMCDMSEELLFRDRHLDKNFSFEIERRVVDEEMLPFEENS
                     LDCIVASGSLHWTNDLPGALIQIQRALKPDGVFLGYMLGGDTLFELRTSLLLAEQERQ
                     GGLSNHVSPMTDTRDVSSLLTRAQFTLQTVDMDEIVVHYPSMYELVQDLRDMGESNAV
                     VNRRPYMHRETLLAAAATYQALHGTPEGHVPATFAQIFMIGWKPSPDQKKALRPGSAS
                     HSLKDVL"
     gene            complement(<60700..>61566)
                     /locus_tag="MRET_2404"
                     /note="MRES_11745"
                     /db_xref="GeneID:38739170"
     mRNA            complement(<60700..>61566)
                     /locus_tag="MRET_2404"
                     /product="alpha-soluble NSF attachment protein"
                     /transcript_id="XM_027629031.1"
                     /db_xref="GeneID:38739170"
     CDS             complement(60700..61566)
                     /locus_tag="MRET_2404"
                     /codon_start=1
                     /product="alpha-soluble NSF attachment protein"
                     /protein_id="XP_027485231.1"
                     /db_xref="GeneID:38739170"
                     /translation="MGGSSAEELLQRAEKKASSTGGWFSSTQSKREEAIELYKEAAHK
                     LRAENRMEEAGSVLIKAADLEIQINEKDFAANTYFEASKCYRMVRLDQAVMALGRCSD
                     LLVERGRFRQAADRQKNMAELYREDPNHFDQGLEAYDRAANWYLQEGATATASACQRE
                     AAQLAIQLQQYPRAIELWEAVAASSLNSNLTKYSVKEYYLNAGLCYLAIPDHGAATRA
                     MAFYAQQDPTFPSTTEAQFLHGVLEACEHSDLDAFDARVRDFDRMKPITGWRATLLHT
                     VRNTVADGPDLS"
     gene            complement(<61649..>63280)
                     /locus_tag="MRET_2405"
                     /note="MRES_11750"
                     /db_xref="GeneID:38739171"
     mRNA            complement(join(<61649..63108,63133..>63280))
                     /locus_tag="MRET_2405"
                     /product="aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln)
                     amidotransferase subunit B"
                     /transcript_id="XM_027629032.1"
                     /db_xref="GeneID:38739171"
     CDS             complement(join(61649..63108,63133..63280))
                     /locus_tag="MRET_2405"
                     /codon_start=1
                     /product="aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln)
                     amidotransferase subunit B"
                     /protein_id="XP_027485249.1"
                     /db_xref="GeneID:38739171"
                     /translation="MLRWARLGTRSLHTARARGQAPPLLPTGWQAVIGIECHAQLLAP
                     TKLFSPTPPPPLHAPPNTLVSSFDAGYPGTLPCLQEGAVTAALKAALALQCQVEHVSV
                     FDRKHYVYADLPTGYQITQHRQPFARNGSVSIRFEDGFLSSPDDALDIPIVQLQLEQD
                     TGKTTYAATDDASQVCLIDYNRAGVALVEIVSAPVLRTPEQAGAYVRKLRQLLRCVGA
                     SDGNMNEGSLRCDANVSIHRIGEPFGPRTEIKNLNSIKFMMHALDFEIRRQFTEVSQG
                     RAVEPSTRGFHEATGETYLLRRKEDALDYRFMPEPNVGALHVSPVQLAALAETLPELP
                     DARHARLRAQYGLSVRDVNVLLRLNVDDDGDARTAQMDAVDYFEELVRLECAPQAAAN
                     WTIHTLPKFLGQMRLAFHHNPVPPAALAELIHMLDEEIITQSTAQALLRTFVREKKIP
                     TRNGCLAIREHVHENNLNRMHDDELRPLCQQVVRAFPAEVEAIQKGKHKVLARLVGEA
                     MRHTQGRADPAHITRLLTDMTGASIGK"
     gene            <63379..>64506
                     /locus_tag="MRET_2406"
                     /note="MRES_11755"
                     /db_xref="GeneID:38739172"
     mRNA            <63379..>64506
                     /locus_tag="MRET_2406"
                     /product="serine/threonine-protein phosphatase 2A
                     activator"
                     /transcript_id="XM_027629033.1"
                     /db_xref="GeneID:38739172"
     CDS             63379..64506
                     /locus_tag="MRET_2406"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 2A
                     activator"
                     /protein_id="XP_027485230.1"
                     /db_xref="GeneID:38739172"
                     /translation="MTPLDAEDPSVRAHLARPRKCIQSDTDMHIWQQSDAHHTILLFL
                     MQLSEACVMQPTRDVVWHERETYAASDSVIDRVLALLIELDTWTDEIVPDTGPHRFGN
                     LAFRTWGARLQERAEALLRRCLPPHLHAFITELYAYLVDAFGSFVRIDYGTGHELHMV
                     AWLAYLYRLGALSEEGAEARIALEVIPAYLRVVWHLQDRYTLEPAGSHGVWGLDDFHF
                     VPYILGAAQLRDTTMSPLQMADLSLYPHARMREPRVGPRLSPRDTIMYIAPTHASPMP
                     NMYTSSLARIHSLKRGPFSEHSPLLFDISRNVPTWPKVHAGMLKMYDAECLLKRPVVQ
                     HFVFGGVGYVWPHTETHAPPRPTRMTPAVGARPTMHPRHAQ"
     gene            complement(<64507..>66702)
                     /locus_tag="MRET_2407"
                     /note="MRES_11760"
                     /db_xref="GeneID:38739173"
     mRNA            complement(<64507..>66702)
                     /locus_tag="MRET_2407"
                     /product="threonyl-tRNA synthetase"
                     /transcript_id="XM_027629034.1"
                     /db_xref="GeneID:38739173"
     CDS             complement(64507..66702)
                     /locus_tag="MRET_2407"
                     /codon_start=1
                     /product="threonyl-tRNA synthetase"
                     /protein_id="XP_027485229.1"
                     /db_xref="GeneID:38739173"
                     /translation="MSSSENQASAAPEQLANAVKDMSVNSKPDKKAKGGGAGGMPLEF
                     EPRPAFFQARIDMFERIKAEQDSARAAAERKPITITMPDGSTREGLSWETSPMDIARA
                     ISKSLSERIVISKVNGQLWDLERPLEGDVTLELLDFDHPEGKRVFWHSSAHVLGEAAE
                     RHYGCHLCIGPPTDEGFYYEMGMGDSGDRAVRSEDFDPLEKLINLAVKDKQTFERAVL
                     TKEQLLEMFKYNKYKVHIINSKIPDGTSTTVYRCGPMIDLCVGPHIPHTGRIKAMTVL
                     KNSASYFLGDQKNDSLQRLYGISFPDKKQMTEYKHFLAEAAKRDHRRIGREQELFMFH
                     ELSPGSCFWLPHGARIYNTLQEFIKGEYRRRGFDEVITPNMYNSKLWETSGHWANYKD
                     DMFALSVDKETFALKPMNCPGHCLMFGSRDRSYKELPLRLADFGVIHRNEASGALSGL
                     TRVRRFVQDDAHIFCRASQIEDEMMHCFDFLQTVYGLFGFTFKMELSTRPEKHLGDVA
                     TWDAAEKRLASALDRFVPGQWELNPGDGAFYGPKIDITISDAMRRQHQCATIQLDFQL
                     PQRFNLEYKTPQGGADGENQTERPVMIHRAVVGSLERFIAILIENFAGKWPFWLSPRQ
                     VLVVPVTQSVYEYAQDVRSTLWDHGFYADVDLSDNTLNKKIRNGELAQYNFVFVVGHE
                     EKESRSVNVRNRDTDPKVAKGKTDTIPLDVVLSQLQQLKSSRAIDNQLP"
     gene            <66827..>67297
                     /locus_tag="MRET_2408"
                     /db_xref="GeneID:38739174"
     mRNA            join(<66827..66976,67008..67078,67105..>67297)
                     /locus_tag="MRET_2408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629035.1"
                     /db_xref="GeneID:38739174"
     CDS             join(66827..66976,67008..67078,67105..67297)
                     /locus_tag="MRET_2408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485100.1"
                     /db_xref="GeneID:38739174"
                     /translation="MVSNTPSNGAPAPSKQKSKAYLSSVAIQSDAIKYRQKYKELKRK
                     VHEIEQENDKLQALTLRIKGNIQRLRLERAILYEHLESRVQQVPVVSEIPEAETQTLE
                     ADAEVSAHSDEASKSKDTPNEPHEPDVAAPPAPTA"
     gene            <67514..>70420
                     /locus_tag="MRET_2409"
                     /note="MRES_11765"
                     /db_xref="GeneID:38739175"
     mRNA            <67514..>70420
                     /locus_tag="MRET_2409"
                     /product="AT-rich interactive domain protein"
                     /transcript_id="XM_027629036.1"
                     /db_xref="GeneID:38739175"
     CDS             67514..70420
                     /locus_tag="MRET_2409"
                     /codon_start=1
                     /product="AT-rich interactive domain protein"
                     /protein_id="XP_027485099.1"
                     /db_xref="GeneID:38739175"
                     /translation="MSFPPGGNVFQGNSQQQFAQYVQQQKQQHHMQTGQQPFQSPQLG
                     FSGYPNAQQQQDFMPNITPQQIQAILNQKNSAMQTGLQGNQYMPSPIMSQLQPGMPIP
                     TSMPMPSTQPHQPPPPRQANGSVNIIADLVNKAKAGLLSPMQLAQLRAILGQESIQPS
                     QQNPVMQPSMSTSSPVIPMKKSPMMMPNQQPTAGPNMPQMNMLLNAANVQQPQQQANL
                     LQGLQFIQKIQQKLAEIDQKLATSIHEHERQMLQHNRQELLRVQGTIIQKLSQGSQMH
                     QQNFNSSSPNLMANATSSPLTNFSQPNFNNAPKPSMNMMNTPNAASHMSPANSFQMPA
                     KMPAPTPSQPAANVAITPDQFKRALAVLQHRHGKPVQMNPIVNGYPIDLYQLFNTVQS
                     MGGSKITTQKGLWNTVVGSLGYVSLNQAQVSALAVQVAQVYKTYLELFEEVWNRAMVH
                     QMSMSHQMNKTNVPDMPQTSQGSASMPHSGISPNAVFDAMMQRPNQQVSPPLSSYQKD
                     PSLSVDLSETDKLPTTKPQYSLASPKTPAGKPSRVVWPQEEQKSTQSMASDQTAEKSH
                     TASKDKTKRPTIRVTTRMLEEARSLLYKVELSLSVSRPKLPVIEDIPESEKAIILQQV
                     EQLVSLKTTVSALLPVFLAMTQNLEPAKRVKIMIYIFEDQLALLPSRKCIMRLSDLEK
                     LKVQMTRCIGFVRIHDEKLARKVMAKAVADQPELLQRKATHSVESSAENTSPVTAAPK
                     QMSLGSAEMKEDGDDDDIEITATNIKTPINSATSPTQPLKISGKEKTSNIPRVSALSS
                     LEPKDVPGQAINKLMTEQIQNEQLSQNSPIQFLEKAWNKLITVETQTKANKFNVDVLR
                     HQLDDMSWPNTSLESLIYTAIDAPYQIGLHDTKQRNEYSTALYTNEPFLKNDADERHA
                     SHSSDTKLTSFDKIILKPAPDAWREQATNEDSKNKLNDLTSESDQDWWSKDFFK"
     gene            <70781..>71293
                     /locus_tag="MRET_2410"
                     /db_xref="GeneID:38739176"
     mRNA            <70781..>71293
                     /locus_tag="MRET_2410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629037.1"
                     /db_xref="GeneID:38739176"
     CDS             70781..71293
                     /locus_tag="MRET_2410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484969.1"
                     /db_xref="GeneID:38739176"
                     /translation="MNRNVRFSACVRRHRDMSWLSKDVIFRAIPDFVFLSVVTSLALN
                     TTVQLRLRDERNRQFMIQRELLRRLRDQLRISRRRTLSDTPNICKQLVLAGLRPSDYG
                     FEGMAVKDAEETTKVHHPHLSWYEVFFTGRALSPAVKIEPQDFGSEQWEQDFLRMLEE
                     LDKAEAQPNA"
     gene            <71728..>73389
                     /locus_tag="MRET_2411"
                     /note="MRES_11770"
                     /db_xref="GeneID:38739177"
     mRNA            <71728..>73389
                     /locus_tag="MRET_2411"
                     /product="farnesyl-diphosphate farnesyltransferase"
                     /transcript_id="XM_027629038.1"
                     /db_xref="GeneID:38739177"
     CDS             71728..73389
                     /locus_tag="MRET_2411"
                     /codon_start=1
                     /product="farnesyl-diphosphate farnesyltransferase"
                     /protein_id="XP_027484970.1"
                     /db_xref="GeneID:38739177"
                     /translation="MEYVKLAVTHPSELRSLITYKVWRDPVHDFRRNPEASGFDRERM
                     RACWSFLDATSRSFAAVIKELKGELSRVICIFYLVLRGLDTVEDDMTLKPEVKIPLLL
                     DFHKKLNEPGWNFTGSGPNEKDRQLLVEFDKVIDEYQLLNEGCRFVIADICARMGAGM
                     ASYIELGNSPAGLTMQTWGDYDLYCHFVAGLVGEGLSGLFVQTQIERPLIGLQLSLSN
                     HMGLFLQKTNIIRDYAEDCREGRSFWPKECWGTDGVFAHQGEVQRGVIETRRGSGSYK
                     FADTIEGRKARQVLSAMLLDAMSHVTSSLEYLILLRDQSVFNFCATPQVMAIATLGKL
                     VENADVYKKNVKIRKSLAVRLILRSTNPRDVATIFLNFAREIHQKLSADDPNYVRWCV
                     ELGRIQMWCEYNFPSYVLSAYRNKNSDIRAHTYQSWVFARDREIRYKALGKSEQQLSA
                     EAEAERLLETDKGAYKMLFGVIGLALVLIILIAYGCWMFVWYTIEGRVDPLSLFLYYS
                     YRLARERIWDMKITLSPLFWYRFWSSLFDQAGSLTMEDMRVYHGH"
     gene            complement(<73400..>75229)
                     /locus_tag="MRET_2412"
                     /note="MRES_11775"
                     /db_xref="GeneID:38739178"
     mRNA            complement(<73400..>75229)
                     /locus_tag="MRET_2412"
                     /product="protein KRI1"
                     /transcript_id="XM_027629039.1"
                     /db_xref="GeneID:38739178"
     CDS             complement(73400..75229)
                     /locus_tag="MRET_2412"
                     /codon_start=1
                     /product="protein KRI1"
                     /protein_id="XP_027484971.1"
                     /db_xref="GeneID:38739178"
                     /translation="MVDLFEDAAEAPDEQQLSINQSYAERYQHNKRRVHLEQLQQKYG
                     EEEGDSDESDSEDVTEDEDGEQLTPQVDAAILRTLQRIREKGSDLYDADNRVFDIEQA
                     QLRKGAPSARSSSSKKMTLQDYQRSRVLDAMKNSSDPAKDIADATMRQPEPAIDTKMP
                     ATHDAEQEAIRAEFLDAAREDGEDDDLFHVRKADGEDTYRSALMNALGNEGNEDQIRS
                     LLRDHTDDASRSKESEDFLMNYIMNRGWVDTDLPTTAPNARDWEAEAAELESEASFDS
                     AADAFEHAYNFRFEDPSLAQKAFAIDSFPRHTEDSIRRPDDRRKKARHERTERKKSEK
                     KTKMRELEQLKALKRQEIAEKLKKLRQVSGSDNRMDGHAFDGVDFDKDFDPEEHDRLM
                     QAQFDDAYYAQADNDKPQWDQDIDEIIAAESKPEKKSKKNKNSAEDVMDADFVDGQDT
                     KLSKKERKALKKKEKKAAKKQQDADDAVDENDMDAEKIENRVPEADRQKEARELMDEY
                     YNLGYEDMIGDTPTRFKYASVPKDSYGLSAVDILMADDADLNNVVGLKHMQPYRRGPT
                     RPANLKKRLKRFRDDMDAREQPQEQPKKKRLGRKERQRLKESS"
     gene            <75306..>82814
                     /locus_tag="MRET_2413"
                     /note="MRES_11780"
                     /db_xref="GeneID:38739179"
     mRNA            <75306..>82814
                     /locus_tag="MRET_2413"
                     /product="U3 small nucleolar RNA-associated protein 20"
                     /transcript_id="XM_027629040.1"
                     /db_xref="GeneID:38739179"
     CDS             75306..82814
                     /locus_tag="MRET_2413"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 20"
                     /protein_id="XP_027484896.1"
                     /db_xref="GeneID:38739179"
                     /translation="MGDTPGVHRYVSFHERLKHINIDLARESGTTWGAASGLQVSGLD
                     APASVFAEATGAADVSTVAEASDIHSTAFGTALEQWYELNLSLPFHTFHARVMPMAQS
                     LVLLLHHRDEIAAALDTFLSDTQHWLAWDALLDLVPRMAFDLGPEFLHVYQRLLTAVL
                     RASCTMHKNLTHGDDALAARIVERAFHSAAWLFRAVSSLMRTDAPDILLTSWSIVRGV
                     LIDKQTTSHAWRFATEALSHLIRKAPISHLHALQARMIADADDASAEGIAATWANSCQ
                     SASHTLHSRTREMLSCVLVLDAQPVELVRRLGSWIITSLVHHAHAEDMDPVFDMLLCA
                     DASGDALHTQLVWITTAVGTRKGTRVSDDAEARLLGWLLHLDERLVWTADHVPLLEAY
                     TALVSAALLRARVQDMTSHGKRLLDAFAQRPTRDHFAVPWSALHGLIRVLSDPAVAWR
                     SFRAFGLPGALDATTRALEVDEASALALLVQLESQGHLAPLLEAPPTTVVLRWAKRMR
                     HTVQRRIDALAEHLERTSLDTAGWECLLAVPLAYLFPAHIDTLATSLVRCIHAAKDAD
                     VLGILMASLVRCKATRAISDMLADTNTFVRLLQPNRAVLPAMADMVRMSQRQLDVSVV
                     WPCLTDAIRDSDRVLVRAALDILASTVHDTTNVFKMLSDVEGMALEVQTIATRNTKLR
                     QTQREACRVLARDDIQLEALVHYTVGTLRLNFRPVWAASRDTLVALCSAVPESVWRVS
                     FAELRMTEALLQQGTLRVPASVESEAEEDVETTALASLTDAAWQQRWQWMQRHLCLTS
                     TSPTTMAQDMLHARSAAPDVRLDVAHYASEILRLYAQHVSLPERHSAAFVPHVQAQWT
                     SIVDADEAVMPTALRAERLRLILDVFGAFHHAARMHDAADMKARFLALCADPELVVQR
                     AALDCLLTWRDAWLVAHTEKLHALLEPAKFRDTLAQLDLSASSEQWGSARPLTMQVIL
                     RLLYGMLVSRRGLRTSGAGQGARRTAILAALFECAPDELGLLADLMLTSFADRLPEPR
                     KQLGFLGLLGDVLEHLGKPLAPSMPRFVHVVIAIAASAEPSDPTMRLLRRTALRRLAD
                     LVRYAHVDWAPFRTRILDDIVLPRLKTFAEDSVQSPSSLLDLCNAWASQHSTLLCFLS
                     DERVLSGVYAGLSSASIKPAVAHTILDIAERIHDAASDDDEVRDVIVAPTAPALLTHL
                     VPLVRHTVHASFAYELASRERDELLRKELSTMSYLAPHMTRADEAAAVLHLLVPLMEH
                     SARAVQERVKTELLRTVTLLLPRAGHAGPDVDVLYALFARLGAELQSPPARAQYTLAL
                     SELANIDHGLKRVTTWVAQLNAYHKLHEPDMDTRLEAWDAILAPSPAIDAREWHALLY
                     QALFFVMDTDELVLRTNAAALLQHFVKASVSVDTLPLVRDVFLPSVYRRLHTRAEPVR
                     KELFNVLGVAVAELHTHLPPLAELHVLLAGDDEASVFTNLFHIQAHRRVRAMHRLADA
                     ASQLRSKTLSELLVPLVWHFLLPNASGGIDMNMANEALACIRRMASHLQWGHYYFWLK
                     RFLRELQEHVAKDDTSATERLHVRGIVGVLEAFHFDCTQHVDHVDEDATPTQPDGPPA
                     AVSLHLATTISTRVLPPLYEALHADENRLPPRLPLIVGAARLALHLPADRRPVELFKV
                     FGELGRALRSKLQSTRDTCRAIALQMLQAIGATYLPDVVHELRRMLTRGPQLAVCAYT
                     IHSLLVALSTGDAPPLTLLDRGVRDITEAVMEDLFGLTSEDRVTVEFRTKVRELRQSK
                     SLDSFEHLARLADPASLQELLIPLRGVLATSIEPKVVHTAHECLHRIASGMSANPHLD
                     AQAFLVLCYTLIARGEKALQSRVDQAPHLAQNAHLFVELGLDLLTTALRRSRFDMHDQ
                     DTVAKLVPLIRAVGETLYARHAPVVERGLRAAAALARCPLPTLDEALPVMQKQMLVLL
                     RHAGGIHSAIAQTTLRALSVVIREGRAKAPPAQHLTELLHLVSSDLDAPESQGSIFAL
                     LRAIVSRAFVVPEIYDVMDRIAELLVTSHDAQVREVCRSLYLAFLLDYPQGHGRLKNQ
                     LEFLAKHLAYESEGGRRSVLELVGAILAKFSPEVVAQYAQLFFVALVMQLANEESTAC
                     RKQAADVLGTLLHVLPANERDGLLRMTRPWAMAQGTPQAQKLAAVALRVYDIAAASEC
                     PAWAAQDAATAVAHVLTHSAEAMDEDVVSWHLTYQALQTMQTLARDAHAWTSLAACIP
                     HVLTLLTLPHAWCRIAACRVLGAYFAAGHTLDASEYVRAARQLVAQLYSAFLDDALVL
                     QIVRNLVFLGKAFANGDADGVEDSDSDDVEDDVAPRLAWLYTKLSHTARLDDGHTRPA
                     SGPQRVGAVLKWFAAMATQLDASITTHFLVHILSPLQRVTDDEQAPDDLKTLASEVQD
                     LIQAQVETTAFTRAYAHVKQTRLEKRRVRKHERLMEDVMDPERAAKRRASRNTAKHES
                     RKRKHAHFRDIRQSGKRTKKTD"
     gene            complement(<82811..>83347)
                     /locus_tag="MRET_2414"
                     /note="MRES_11785"
                     /db_xref="GeneID:38739180"
     mRNA            complement(<82811..>83347)
                     /locus_tag="MRET_2414"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629041.1"
                     /db_xref="GeneID:38739180"
     CDS             complement(82811..83347)
                     /locus_tag="MRET_2414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484875.1"
                     /db_xref="GeneID:38739180"
                     /translation="MSLFVRVQGPTAHGALWRLSPSHMLAMLSFFARQWGEISYVSFP
                     RARGQGRLLGYGTVTFADAKSVPRVLQAAAQQHGRLRIPFSTQLEDPESIAYASLAEC
                     DRALTASPSLRDSVAMHAPLAPSAKNTSYDCFYVKVERSEKPFPQAPMRRPTPLVRKF
                     DGFSGQWAERVAYWAKKR"
     gene            <83443..>86160
                     /locus_tag="MRET_2415"
                     /note="MRES_11790"
                     /db_xref="GeneID:38739181"
     mRNA            <83443..>86160
                     /locus_tag="MRET_2415"
                     /product="SEL1 domain protein"
                     /transcript_id="XM_027629042.1"
                     /db_xref="GeneID:38739181"
     CDS             83443..86160
                     /locus_tag="MRET_2415"
                     /codon_start=1
                     /product="SEL1 domain protein"
                     /protein_id="XP_027484876.1"
                     /db_xref="GeneID:38739181"
                     /translation="MRLAWLWWAAACAAVHALPSDETTRTQSEALEEALVMLRSLVGQ
                     KDSFIDTPSSGGQLRRIWRRWTQHHALSPQQHAMGTYTGTIRYALATLLDYVMDKPRD
                     PQRAPHTYYDSPVVPLWPDWDFDADKAAGTYPAINGWEQAMWGPFVGPIHDAPSPAMS
                     SIVHNFTSAYSKSSLLDLVRGDMPPPITPTPDPALQNVRVHAIRLLESVAYPDNDDND
                     AEHLIRASFIANQTRTPQSDALWILGEHYLWGTHGAQPDIEKARQAYERLALMGNATA
                     HARLGYLYSSRFMADIHGAPRSEAEALIHYTMAAQEGDWHAMNALAYRQLYGLGTSVN
                     CTESLIWLDHLAQRAHNEFLAGPPGGLTLPYNKVRLSDRVRLGGPTFQLASGQHFKAT
                     FSSSPISYYKALSDKPPALLLDAHALHELMEQYEFLAQEDPIEQIRYVFAMYFGSIVG
                     YRESLGAVRPNYTEAARHALALATKAWPIPILLSHVDEELVRHGRRGPLLRYVSLPSY
                     QAYAAKKAAVLLGVMHLRGEGVPQDAKIAKVWLTRAATEGDALGMAYLGMMYEHGYGG
                     LKIDTSRAWDLYRHSYNNTSLSLLGMAKQQIKAGHPEHAQPILLNALERIGTPKGLAF
                     TSAKFDALYWNAGLEADYLYKAPDPTRCRQVATKFQALVHRGDWEDPVYHRGEAALDR
                     GDVATALHAWSMAAEAGMAEAQDNVAHILDQFTSWRHIVEPRPYDALALEYWAQSAMQ
                     DSTLAQTKICDYVLHGFLPHRRSMAQAARCYRSQVDGSNDLLNKWRLAQLYEDGAEGF
                     ERDFPLAKRLYDVILLHSPLLNLTVTWALMRLHAKAFWAMLCGDTTAQRLFASYMPTV
                     SLQVSSDWLFDATLLLASLAALGLLVLVRRHMHRRWTETQRAYQDARTL"
     gene            <86235..>88886
                     /locus_tag="MRET_2416"
                     /note="MRES_11795"
                     /db_xref="GeneID:38739182"
     mRNA            <86235..>88886
                     /locus_tag="MRET_2416"
                     /product="ER membrane protein that plays a central role in
                     ERAD"
                     /transcript_id="XM_027629043.1"
                     /db_xref="GeneID:38739182"
     CDS             86235..88886
                     /locus_tag="MRET_2416"
                     /codon_start=1
                     /product="ER membrane protein that plays a central role in
                     ERAD"
                     /protein_id="XP_027484967.1"
                     /db_xref="GeneID:38739182"
                     /translation="MHVPWLLATGVALCAAAGSLPSHQVTDLSEEARSHYFASQYAGA
                     HEAVDAALALLRSLTRGTLHGSTYAVEEVPLSSFRSQLASWLSWWLHPPQHRRRAAHT
                     YYDMPETPLWPDWDFDADSHTTFPVINGWEQAMWGTAPAFPDSVSQSINESLAAGLYR
                     RTHKKQTLIDMLRGPITTKLVSRDSPTDSTREHALQLLTWAADLLSSDALWILGEHYL
                     WGTHGAQPDIEKARQAYERLALMGNATAHARLGYLYSSRFMADMYGAPQSNAEALEHY
                     ELAASSGNWHAINALAFRLRYGIGLSQNCTRSLELSDQVATQTYAQYLDGPPGGRTLP
                     YSKVRLSDRAWFMLGEKPLLSERDMRVHMSPPAWVSHFPSGPINYRAALVQPDAMDTL
                     LAHHTSKVDEQDAVKTLEYARYLYYGSILSDHDALGAIHPNHTLAAQLAYTLAVQRWP
                     TPITIQDNDNPHEMRDKAASMLTTQPMPEEQAQIAASAAALLGLMYLRGEGVPQDAEI
                     ASIWLARASEAKDPLGMTSMIMMYLNGYGGPAKDEKKNRAYDHYVTQYLDIFHPELIL
                     AKSELGKYEFRQNNTDKAHLLFKRARNAIQLSSQMPGRYFLMSKFEPYYLSARLSVDK
                     LYRERHYDGCPTWSIESFRVFAHRADWSDPMYHRGEAAMDRGDVSTALRAWSIAAEAG
                     MEEAQDNIAYFLDPYVHGPLSDSDQIFLHTESRREPSSYVHHMGELAHHYWTLSAKQE
                     SAYARLMLCDYLKRHSPDDVQRVATCYKAIDSYHARMRLAQWQIEREHDFVLAKQANE
                     RLSPYVQLGANPAWPQMASCLRLYVYALAAWALVKGDASAQHLFGIHRIPLVSDVVLF
                     TTGIVGLATLALVRRRLLRGLRDMPRT"
     gene            <88991..>91651
                     /locus_tag="MRET_2417"
                     /note="MRES_11800"
                     /db_xref="GeneID:38739183"
     mRNA            <88991..>91651
                     /locus_tag="MRET_2417"
                     /product="heat shock protein 70 LHS1"
                     /transcript_id="XM_027629044.1"
                     /db_xref="GeneID:38739183"
     CDS             88991..91651
                     /locus_tag="MRET_2417"
                     /codon_start=1
                     /product="heat shock protein 70 LHS1"
                     /protein_id="XP_027484968.1"
                     /db_xref="GeneID:38739183"
                     /translation="MHRSTQMLAWVAFVAAALVLLASPSSAIGVVSIDYGTEWIKAAL
                     VKPGMPFDLVLGRDSKRKVQASVAFKGKVPTDGRLEKMERLLSSDAYAFASRSPLQSY
                     HAAKLLLGQTCRADGKDTPAVEYYRSVLGNHVTQLPGGYESGSTCVIMPSPSTLPTTF
                     WRPEEIVGMQLDHMRELAEETSGELLNIGRSFSSIFDSARNGLDTVITVPIFYTLHER
                     QALLDAALLAGFRPQLISDAAAAATSYAHSRTFAKPERHIFYDAGSGSVRATLVEMGP
                     STDSTRSGANRVTVLDAAWDRLAGGLAMDLVVRDMLADAFDKANPSEPSVRQNARAMA
                     RLLREANKIKHVLSANAAASASIESLANDIDLRTSIDREAFEARMRSDGLIQRFGQPI
                     DELLTRTKTAWSDITSVVLVGGASRVPSVHAELLARGVPQEKLAQNVNADEAAVLGAA
                     LAVASTQPQLRMKPVDVVDAHMYAIHAHVQGRDELVFPAGPYVPGTEWNLTLPNVRTD
                     ASIELFTPTKERLDAGDAGALQRIRFEGVDRIFGELRALGIDVQTLPTKLNASIRSEP
                     FGTFLARFPLLTIEPPTPLPEALHTFFGVNASAPKNETKPPAPRLIDLFPNSTSLGPV
                     RPLAGLEKAGSFERLRLIVHEARQRALRDTAFNELESSVYRSRDMMQDDALAAARTND
                     EAQRVLSKADELGTWLSTEADQADAKTIQKRQRELDALVSPISRRMSEAERRPAIVAD
                     MRTTLQRARTFVDEAKANLTQALAQKSASKYTAAELDTLDAQIRKDATWLEDGVLAQD
                     KRKLQEEPVLFVSDILARDQKLQDTVKRLSRRRIPKTRPKKSSSTTSASSSTSTSSTT
                     TTPATSSSLTSSTTSAGTSTSSSRPVHDEL"
     gene            <91702..>94338
                     /locus_tag="MRET_2418"
                     /note="MRES_11805"
                     /db_xref="GeneID:38739184"
     mRNA            <91702..>94338
                     /locus_tag="MRET_2418"
                     /product="Ca2+-transporting ATPase"
                     /transcript_id="XM_027629045.1"
                     /db_xref="GeneID:38739184"
     CDS             91702..94338
                     /locus_tag="MRET_2418"
                     /codon_start=1
                     /product="Ca2+-transporting ATPase"
                     /protein_id="XP_027485131.1"
                     /db_xref="GeneID:38739184"
                     /translation="MSHGQNSDMPYGRRQAKLSERYMRMSVEDVLKDLDVPSLEQGLD
                     TETVQARQQEHGKNELEASEPDPLWLRWLQQFKEPMNALLIGSAVVSLLVGETDDAIC
                     ITLALAIVITVGIAQEYRSEKSLEALSHLVPHKCQVVRHGTTRTIDASELVPGDVIKL
                     RTGDRIPADMRLVHVSDLDVNESALTGETSGVRKSTDEKTEEPTNLAYMGTLVQKGSA
                     TGVVYGTGVHTEFGGIFGMVDTVDERQTPLQLSMSDLAQRLSILSLCLIAVLLLVGVL
                     QRKSWIEMFTMAVSLAVAAIPEGLPIVVTVTLALGALQMSRRHAIVKRLPSVETLGCM
                     SVICSDKTGTLTTGHMRIVQLYTVPDGLVDARPQSLSQAMTRHLQAGFFCNNATRNER
                     GELIGQATEVAMAEAPELMGLSLDHKDWTRTNEVPFDSDRKFMAVTGQGDAERTPGSA
                     QLMKGAPEVVLKHCTTYLAQQRPMQLTEQVRQEILHVLSDCTERGLRVLATAMSTNGR
                     HYTFCGLQAMHDPPREQVHDAIRTLQRAQVNIVMITGDAETTARAIAQQLGIASSPTV
                     MTGPTIESLSDRQLQDRVRHVSVFARTKPEHKLRIVSALQANQEVVGMTGDGVNDAPA
                     LKLAEVGIAMGSGTDVTKEAADVILVDDNFATIMGAVREGKSIFYNIQNFVTFQLSTS
                     IAALVLISLSTLLKLHFPLNAMQILFINILMDGPPSQSLGVDPAHECVMQRPPRARDS
                     PVLTKRLFGRVAFTASVMVTLTYVVFLSGYVSTMESRHESTMTFTCFVMLALVSAIQN
                     RGLYTGLWENPMLLWTTGGSLAMQLLIVYFGPLQRIFLTDALSVNHLLYLLGMSITGF
                     GIQECRRIYERYLDDHASDTMA"
     gene            complement(<94339..>95733)
                     /locus_tag="MRET_2419"
                     /note="MRES_11810"
                     /db_xref="GeneID:38739185"
     mRNA            complement(<94339..>95733)
                     /locus_tag="MRET_2419"
                     /product="regulator of chromosome condensation (RCC1)
                     repeat protein"
                     /transcript_id="XM_027629046.1"
                     /db_xref="GeneID:38739185"
     CDS             complement(94339..95733)
                     /locus_tag="MRET_2419"
                     /codon_start=1
                     /product="regulator of chromosome condensation (RCC1)
                     repeat protein"
                     /protein_id="XP_027484972.1"
                     /db_xref="GeneID:38739185"
                     /translation="MSRRGWGRVLVCGRVAADEAGHDIVGAGECLAAPHVLRSMCHIR
                     VREVLTSCVADHAVFLSVEGDAYVYGRNREGQCGVSGSGWLYHARCLDRERDFEPPLA
                     ADDVIATGATGATHTLLVTAQGAVYAAGSHEHGECGMHTRETPFKRVDMPFGVVHAAC
                     GRAWSLVVTREGHVYGMGSCESGVLGDGMYRHTGPSRLVYDCVWQPMRIAPLVNIARV
                     SCGESHAAALDHEGYVYVWGTASLSRLGCGTQMDQGSPVRIPQFVRKQQRVRSVVCGR
                     TSTWCVDQAHRLWAAGTWRAKGDGGPNQSFLIYKPLQELADYDVHCVAAGADTFQCLA
                     SSRVWAWGEQAWHAELGAHTAPPVPAELDMVHGLRVVGLASGRHTSYWLVEPDDDGAY
                     ADLVRYPPTVPESSSVCMVCRQSNEDDDATLLECDRCENPYHLSCLSPPLDEVPQGEW
                     FCEACVDRKKRRLS"
     gene            <95799..>96403
                     /locus_tag="MRET_2420"
                     /note="MRES_11815"
                     /db_xref="GeneID:38739186"
     mRNA            join(<95799..96219,96246..>96403)
                     /locus_tag="MRET_2420"
                     /product="ribonuclease P protein subunit POP4"
                     /transcript_id="XM_027629047.1"
                     /db_xref="GeneID:38739186"
     CDS             join(95799..96219,96246..96403)
                     /locus_tag="MRET_2420"
                     /codon_start=1
                     /product="ribonuclease P protein subunit POP4"
                     /protein_id="XP_027485038.1"
                     /db_xref="GeneID:38739186"
                     /translation="MDLAAPDAAQRVWREVLGPDAGSREQYETRIHGKKLPLANIDRP
                     APPPATPMLRHQYAKAMRRATRTPAKAKRARRRPVSTPSLPQIEPLVSLWTSYIRDAL
                     GLHGLTRTSANLRLQSTSYVTSLQTSLLKMDWTGAHATVIRSSQPTHVHISGVIVQET
                     HETLRIVTDGSIKCKYALLTHQASPNTTPCFA"
     gene            complement(<96516..>97781)
                     /locus_tag="MRET_2421"
                     /note="MRES_11820"
                     /db_xref="GeneID:38739187"
     mRNA            complement(<96516..>97781)
                     /locus_tag="MRET_2421"
                     /product="saccharopine dehydrogenase"
                     /transcript_id="XM_027629048.1"
                     /db_xref="GeneID:38739187"
     CDS             complement(96516..97781)
                     /locus_tag="MRET_2421"
                     /codon_start=1
                     /product="saccharopine dehydrogenase"
                     /protein_id="XP_027485037.1"
                     /db_xref="GeneID:38739187"
                     /translation="MTTRAYDVVLYGASGFTGSLAAQYLAEHPQQPRVAFAGRNEAKI
                     RGVMDKLTGVSKERLDSIGVIKASAEDMDSIKSMVAQASVVINMVGPYALYKGFELAQ
                     AAAEAGTGYVDLTGEGSVYQRIQRELHDVAKRTHAAIVPSSGFDCLPFDLTTYLAVQE
                     VRKASGGKADVDHALCGYLVKGSISGGTIASLVGQAKVSPITFHDAYELSPIRGSQKA
                     QVVMQRFLPQFNKYGAFTLFTPHNTGVTNRSWGLLQQVNHPTSYGPHFRYLEGFIVPS
                     VIAAYITSTIMMTVAWLVSYVPFVGDFMMKSVPQGTGAPIEKQLQGFGDIRTLAYSTD
                     KKTVGLATFGVKGDPGYLRTAMFISETALTLALEKQRLSTLGQEGGVLTPATIGGDVL
                     AERLSKYGGVKIVTKDVSNSKDLCKEAEA"
     gene            <97927..>99600
                     /locus_tag="MRET_2422"
                     /note="MRES_11825"
                     /db_xref="GeneID:38739188"
     mRNA            <97927..>99600
                     /locus_tag="MRET_2422"
                     /product="T-complex protein 1 subunit theta"
                     /transcript_id="XM_027629049.1"
                     /db_xref="GeneID:38739188"
     CDS             97927..99600
                     /locus_tag="MRET_2422"
                     /codon_start=1
                     /product="T-complex protein 1 subunit theta"
                     /protein_id="XP_027485040.1"
                     /db_xref="GeneID:38739188"
                     /translation="MALKVPRAGGPSLFKDGYKQFQGIEEAVLRNIQAVNELSDIVRT
                     SYGPNGRNKMIVNHLGRIFVTSDAATIIREMEVVHPAAKLLVYASQQQEAEMGDGTNF
                     VMILAGELLRQAEVLISLGLHPTEIVQGYELARDRALEILDDLSIATLSSPPTQESLA
                     LALRPTLASKQYGHEDILAPLVAQAVSMVIPSSAATSSTLRDFSVDNVRVVKIMGSSL
                     SQSRVVRGMVFGREPEGSVKSASDAKVAVFSCGLDISQTETKGTVLLHNAEELKNFSR
                     GEEIQLEQMLKEIADSGVKIVVTQSSVGELALHYLNRLGIMVCRVPSKFDLQRLCRLL
                     GATPLARIGAPMPEEAGFVDSAVTTEIGGDRVTVFRQEEQGKGGKSHPRLATIVLRGA
                     TTSMLDDAERTIEDGVNAVKSLTRDPRLVPGAGATEIELARQIVAYGERTPGLNQHAI
                     KKYGEALQVIPRTLAETCGLDATDVVSKLHAQHAAKEKADTGVDVENATDGTMSTIDA
                     QVFDVLVAKHWALRYATNAAIDVLRVDSIIMSKPAGIKAPGRNPNWDED"
     gene            complement(<99628..>102402)
                     /locus_tag="MRET_2423"
                     /note="MRES_11830"
                     /db_xref="GeneID:38739189"
     mRNA            complement(<99628..>102402)
                     /locus_tag="MRET_2423"
                     /product="transportin-1"
                     /transcript_id="XM_027629050.1"
                     /db_xref="GeneID:38739189"
     CDS             complement(99628..102402)
                     /locus_tag="MRET_2423"
                     /codon_start=1
                     /product="transportin-1"
                     /protein_id="XP_027485039.1"
                     /db_xref="GeneID:38739189"
                     /translation="MTTAAASWSPQPEGLAELVELFRQSTSTEREVQRRIAHRLDAIS
                     QIPDYLNYLVLVFVQMTGEEVSTRSVAGLLAKNHLYFNAPRVSPESLAFVQHMILPAL
                     SFSDTVLRNVATQIIAVLMQVVKPVNWIDGLSTLTQAMDSSDLNEAEAALSTFAKISE
                     DMPEELDACEIQGMRPLDVLIPKLLHATAHADARIRVHALNSLNQFIQIGSPSMSANM
                     DAYVAVLFQRATDERPIVRKFVCKALVYVLSTWPEKLAPDMNSVVEYMLYSTQDSDED
                     VALEAAEFWLQFAEEPRLSEQLRPNLPRIIPVLLKCMVYSELSLLMMGDIQDDAAEPD
                     RPEDIRPRHYGGTMHRSERDDEAQGSGHKSRAAIDADFDDDDEWDDDELDDDLDDEAG
                     SWNLRKCCAAALDVLATQFRHEILPDLLPLLKDRLFSDDWIQREAGILALGAIAEGCI
                     EDMTPHLPTLIPLLVNMLRDPQPLVRSITCWTLGRYSSWCAGEAAEHQQQYFVPVLEG
                     LLAMVLDNNKRVQEAGCSAFATLEEEVGPALAPFLAPVLRALVMAFDKYHQKNMLILY
                     DAVGTLADSVGPALNEPEYIHMLMMPLTAKWAALDDADPDLIPLLECMASVTIAMGAG
                     FQPHAVPVYQRCVSIIHQNLRAHEQAAVHGLTDDDDEMPDHTFLIVALDLLSGLCQGL
                     GAQSQELVAHVQPLILPQLLPCLTHIEPPVRQSAFALLGDLAINAFSELKPYLAAYMP
                     VVLSHISVEQMHDALSVCNNATWAAGEIALQCPNDTDFPVWVPELLSKLMAVLMHPKC
                     AKSLSENAAVTIGRLGLVATPLVAPQLPVFMEPWCQALWDIKDNDEKESAFLGLCMMI
                     HANPNGATAGFAYFCNAVVRWTAPSERLNNEFRKILYGFRDMSGDRWDAHKAQFPPVI
                     CQRLEERYGL"
     gene            <102482..>104260
                     /locus_tag="MRET_2424"
                     /note="MRES_11835"
                     /db_xref="GeneID:38739190"
     mRNA            <102482..>104260
                     /locus_tag="MRET_2424"
                     /product="xylulokinase"
                     /transcript_id="XM_027629051.1"
                     /db_xref="GeneID:38739190"
     CDS             102482..104260
                     /locus_tag="MRET_2424"
                     /codon_start=1
                     /product="xylulokinase"
                     /protein_id="XP_027485034.1"
                     /db_xref="GeneID:38739190"
                     /translation="MLRSSSGGRCLGPGRQASDTSTMSSAYFVGLDLSTQALKASLLD
                     ASLRGVDEVSVRFDVDVPEFGTSGGVLRHGHALLDEPEAVAAPVDMYVAAMDVLWDRI
                     AEKWPVDRIVALSAAGQQHASVYWAQGATDLLRDVEAHAPLRPQLAGAFSRAIVPNWQ
                     DATTLDECAELMRWADTTGGMCEVTGSMAHTRFTGAQILRWRRRHPEQYARTERIALV
                     SNFVTTLLLAGGADARIAPLDQSDACGMNLWDMRTRAWSQPLLAMVDGAQAGALEAKL
                     GHVVLDPRVPVGRVGTWLQRRYGLASSCLVCQATGDNPATLQCLTPRMGEAVISLGTS
                     DTVLLPSQVYTPDPTYHIFAHPVTTGEAHGTPPYFLMLVYKNGSLAREWVRDTYAGGT
                     WAGFDAALQSAAEPLQRGTGFFWLRPEIIPWHARGLHRFNEHDEPIEAFEDATYHVPA
                     IVQSQCLAFKTSIDRVLRTSRTPLQRVYVVGGAAENEHVCQLLADVLGCDVARPRIVG
                     RSAETGQRVPYNYCSVGAACRARWVWAVMQGEHAPFETCMTEARGGEDAYDLVARPDP
                     ARTEAFAACVPRWTALASRAYAEGIE"
     gene            complement(<104231..>105148)
                     /locus_tag="MRET_2425"
                     /note="MRES_11840"
                     /db_xref="GeneID:38739191"
     mRNA            complement(<104231..>105148)
                     /locus_tag="MRET_2425"
                     /product="geranylgeranyl diphosphate synthase, type III"
                     /transcript_id="XM_027629052.1"
                     /db_xref="GeneID:38739191"
     CDS             complement(104231..105148)
                     /locus_tag="MRET_2425"
                     /codon_start=1
                     /product="geranylgeranyl diphosphate synthase, type III"
                     /protein_id="XP_027485033.1"
                     /db_xref="GeneID:38739191"
                     /translation="MGPPIAARLPAQPAWTPAQEAMIMEPYAYLDAQPGKEFRSHLLD
                     AFHVWMPSVASEALTHIKALIRRLHHASLMIDDVEDASDMRRGAPAAHKVFGVAQTIN
                     TANYAYFQVLSDVAHWQPRALPALIRELEWLHRGQGLELYWREHATCPTESEYADMVV
                     HKTGGLFRVALCLMDSVADTDAAPFVPLANLLGLLFQIRDDYLNLQPPSACDDITEGK
                     FSFPLIHAVRTAKDATLLTMLQQHTQDPALKQQAVAYMQDVTNSFAYTRDVWHALHTQ
                     TRTEIARLERTWGENQAMHRLLDALRIGA"
     gene            <105251..>105725
                     /locus_tag="MRET_2426"
                     /note="MRES_11845"
                     /db_xref="GeneID:38739192"
     mRNA            join(<105251..105326,105358..>105725)
                     /locus_tag="MRET_2426"
                     /product="DNA-directed RNA polymerases I, II, and III
                     subunit RPABC3"
                     /transcript_id="XM_027629053.1"
                     /db_xref="GeneID:38739192"
     CDS             join(105251..105326,105358..105725)
                     /locus_tag="MRET_2426"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases I, II, and III
                     subunit RPABC3"
                     /protein_id="XP_027485036.1"
                     /db_xref="GeneID:38739192"
                     /translation="MSVNSLFDTQFVVKEIDPDGKKFDRVSRVIATSPTLDMTLSIDI
                     ATDIYPVHVGQQLAFLLVSSLRRDKAESDSAADRDAWRLDQDDTSLASGYDYVMYGKI
                     FKYDERSTEQVSVYGSFGGLLMALTGSFRHLSKITVGANVYLLLR"
     gene            <105790..>107394
                     /locus_tag="MRET_2427"
                     /note="MRES_11850"
                     /db_xref="GeneID:38739193"
     mRNA            <105790..>107394
                     /locus_tag="MRET_2427"
                     /product="TBC1 domain family member 2"
                     /transcript_id="XM_027629054.1"
                     /db_xref="GeneID:38739193"
     CDS             105790..107394
                     /locus_tag="MRET_2427"
                     /codon_start=1
                     /product="TBC1 domain family member 2"
                     /protein_id="XP_027485035.1"
                     /db_xref="GeneID:38739193"
                     /translation="MPRSGRGPPRRAAHGAWVDDDDAWAATSDDDEFVARIATEPVAL
                     SAPSPPAPPAWTLVTSEPPAAEQHSHPTRKTSGASAATSSAAAAAAAADNDEQTFTWA
                     ERHMALGSPHLGATPPTVYLEAVVEDPMFLLAKCKARTYTMSPPSTPKDESAPPPLPT
                     EDVGTWIGAAAFDPLATMSDGVFTTPSLPPPPPPPSSPPRAPAARLERRTSSRTLRNR
                     HRLVQCLQSEHIDMAVLRSLAWKGVPPDLRPIVWPILLGYLPPTAALRTSTLARKRAE
                     YASGVERAFRRESLDRAAWHQIRIDVPRTNPGLRLWQQAETQRALERILYVWAIRHPA
                     SGYVQGINDLVTPFFEVCLSAYTDTDPETFELATLPQYVREALEADTFWCMSRLLDGI
                     QDNYIFAQPGILRQLSVMSDVVQRMDPELHAHLAEQGVEYMQFSFRWMNCLLMREMSV
                     KSIIRIWDTYLAEGADSFAGFHPFVCAVFLHRWREALLTMDFQGMIMFLQSLPTQHWS
                     DKDAEMLLSEAFMYKSLFGNSAHIGS"
     gene            complement(<107391..>108263)
                     /locus_tag="MRET_2428"
                     /note="MRES_11855"
                     /db_xref="GeneID:38739194"
     mRNA            complement(<107391..>108263)
                     /locus_tag="MRET_2428"
                     /product="RNA exonuclease 4"
                     /transcript_id="XM_027629055.1"
                     /db_xref="GeneID:38739194"
     CDS             complement(107391..108263)
                     /locus_tag="MRET_2428"
                     /codon_start=1
                     /product="RNA exonuclease 4"
                     /protein_id="XP_027485032.1"
                     /db_xref="GeneID:38739194"
                     /translation="MTADAPAGSHWKALQQQMQGPRKKRSTRSLHAKAEVVSTSATDA
                     LPWFAEDLAPGDLALAMSEAPSAATAEARKRQVLGEPYNATAAKREPGHYLAIDCEMV
                     GVGPRGTGSHLARVSIVNWYGHVVLDTFVRPRERVTDFRTWVSGVRPSDLKHAPPLAE
                     VQARVAELIKGRVLVGHAIHNDLKALLLSHPRHKIRDTSTFQPLRELAGNKQPGLRTL
                     ARLVLDIEIQAKHAAHSPVEDAQATMAVFRTQKAAWDASLGIGVKKHDAPRRTPSLRR
                     PKSTEGWWEEEAAH"
     gene            <108262..>109227
                     /locus_tag="MRET_2429"
                     /note="MRES_11860"
                     /db_xref="GeneID:38739195"
     mRNA            <108262..>109227
                     /locus_tag="MRET_2429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629056.1"
                     /db_xref="GeneID:38739195"
     CDS             108262..109227
                     /locus_tag="MRET_2429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485031.1"
                     /db_xref="GeneID:38739195"
                     /translation="MMVEGRGGFFSPSLFVIMLLGWRWGRCLGVRAYTSKADDVRVIY
                     RGGPYMRKPYFYAAGACFVLAGLNFGLFIRDYFVWPLFPTDGAVPELARPSLRYSLAA
                     GTVLFASLCGWYFVFAPSRMVTRLTVYPATGLLGIRTAAPSPSRLLPSAWTRRPFFQR
                     AGTVSPHDARERLVPLRDVYRLQGSAEGSEMQVWDELLQGRHKDAVPAAMRSRLARFK
                     LGASKYDQQDMLMLRVGASRLAFQLTARPDASSLAPVPPPRGLRGWWQRALRGATDWD
                     APRGYVASAAEQRAPRMRRSEPWFLDRAKFDQLFPLDASRYRKRT"
     gene            complement(<109229..>113005)
                     /locus_tag="MRET_2430"
                     /note="MRES_11865"
                     /db_xref="GeneID:38739196"
     mRNA            complement(<109229..>113005)
                     /locus_tag="MRET_2430"
                     /product="phospholipid-transporting ATPase"
                     /transcript_id="XM_027629057.1"
                     /db_xref="GeneID:38739196"
     CDS             complement(109229..113005)
                     /locus_tag="MRET_2430"
                     /codon_start=1
                     /product="phospholipid-transporting ATPase"
                     /protein_id="XP_027485067.1"
                     /db_xref="GeneID:38739196"
                     /translation="MDDDETETLFGAPRRRNEPTHVLAALDDDVDLLDGDDMKPPADD
                     GASVLGVAKAAPADDVLWDEEHWIDDIPMRPVGSSKRIEADDDDDAIQPTSRRPPSPP
                     PQPEREAPRRPAASTSRGAQLLRLLLADAKWQLLSLRHRLRRELRSWRGLPVGDDKRT
                     IVLNDAAANVNDDYDSNQVMTNKYNLVTFVPVFLVEQFSKYANLFFLFIGCIQQIPGV
                     SPTNRWTTLVPLAIVLLIAAAKEISEDWQRYTADMEMNAHLVPVLDVSSGTWVSRAWR
                     EVRVGDIVRVSRDEFFPADLVLLSSSEPEGLAYVETANLDGETNLKVKQALPLTAPLV
                     SATRVSSLRGTLSCEAPNNSLYTFDGTLDVPGQAPRPVGPDQLLLRGAQLRNAPWVYG
                     LVVFTGHDTKLLQNATKTPLKRTRVEKHVNALILSLFGLLMALSLMSSIGAQVYIGSA
                     PAYLMPQLDGRSGVRQFVESVLTFIILYNSLIPISLIVSMDVVKLQQAALINSDLDLY
                     YEPHDTPAQCRRSNLVEDLGQIDYIFSDKTGTLTRNEMQFRQASIAGATFADVVSDAP
                     AAEERFAWASLPDVLARGDALARAVHAFLCLLAVCHTVIPEARGDGRVVFQASSPDEA
                     ALVAGAQALGYEFTTRTPRSVYVQVQGAEQAYELLQVCEFTSARKRMSTVVREPSGRI
                     VVYCKGADTVMLPRLSPACAHVDATLQHLEAYASEGLRTLCVAMRVLDAAEYEAWARR
                     YEQAAAQLDGRRAALDAVAEELEQDLELLGATAIEDKLQDGVPETIATLQTAGIRVWV
                     LTGDRQETAINIGYSCRLISESMSLLIVNEATAADTASVIQQQLATIEAHPDAAEELA
                     LIVEGRSLQHALQAPLAAPFLRLASQCKAVMCCRVSPLQKALVVELVKAYTDALLLAI
                     GDGANDVGMIQAAHVGVGISGHEGLQAARSADVSISQFRFLRKLLLVHGNWSYARLSK
                     MVLYSFYKTVTLYVTLFWYSFYNGFSGQTAYESWSQSFYNVAFTMLPTLVIGIFDQYV
                     SAVMLERYPQLYHEPFFTGRAIGGWMANAVYHSITNFFFVTYMFEAQTIRHAGHTTYQ
                     WLWGTALYFSVLVTVLGKAALVSNVWTRYTLLAIPGSLGLTLVFFVVFATIAPALGVS
                     MEYSYIVPRLLGTPRFWIVIVFVPVLSLLRDLLWRFWQRTYRPKSYHIVQEMQKYQLQ
                     DVHPRTDAFRKNIRQVRAVQRMRRSRGYAFSQTEHHQAHLVRQYDTTQARPQGM"
     gene            <113096..>113716
                     /locus_tag="MRET_2431"
                     /note="MRES_11870"
                     /db_xref="GeneID:38739197"
     mRNA            <113096..>113716
                     /locus_tag="MRET_2431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629058.1"
                     /db_xref="GeneID:38739197"
     CDS             113096..113716
                     /locus_tag="MRET_2431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485068.1"
                     /db_xref="GeneID:38739197"
                     /translation="MDDARSEARRPARDGERQRGRRMLGLLNATLAQAREPRRAGERP
                     APGPPPSAAQQEAMEAERRAHDAERASIRRMSARVHELTDKLAAYEAAHRTARANKRR
                     LSSFLVTHTQHSTPPEPREADEVAATAAARSVPQVPLCGGDRLYEVYYLPRKLLPVQE
                     EALDAQEERVDAEIDRADDDWDRVREAMQTELQRTKQALERHHVAW"
     gene            complement(<113717..>114628)
                     /locus_tag="MRET_2432"
                     /note="MRES_11875"
                     /db_xref="GeneID:38739198"
     mRNA            complement(<113717..>114628)
                     /locus_tag="MRET_2432"
                     /product="alkaline ceramidase"
                     /transcript_id="XM_027629059.1"
                     /db_xref="GeneID:38739198"
     CDS             complement(113717..114628)
                     /locus_tag="MRET_2432"
                     /codon_start=1
                     /product="alkaline ceramidase"
                     /protein_id="XP_027485065.1"
                     /db_xref="GeneID:38739198"
                     /translation="MSWLDRSEHQLEGGYWGEVTSTLLWCEQKYQWSKYLAEPVNSLT
                     NALFLACAAYAMYRVHTERLHARFYGCALGVGAVGVGSLLFHMTLKHEAQLLDELPMI
                     WASSFLTWSFLDQTLFLGTRIDRRVLPAIIFALNVWITVTYMSNGDPVFHQVAYASIM
                     VVSILHAIYILTHPKAPLNTSDSARRRRHEARSLEFVGTVLFIVGFGIWNVDNIFCAQ
                     LRAARAWVGYPWAILLEGHGWWHVFTCFGAYLLLVACEVLAMSYLEHPDNFVVVYGRG
                     LPYLARVRAYDPHHTLLRDYTAARKQQ"
     gene            complement(<114700..>115521)
                     /locus_tag="MRET_2433"
                     /db_xref="GeneID:38739199"
     mRNA            complement(<114700..>115521)
                     /locus_tag="MRET_2433"
                     /product="DUF850 domain protein"
                     /transcript_id="XM_027629060.1"
                     /db_xref="GeneID:38739199"
     CDS             complement(114700..115521)
                     /locus_tag="MRET_2433"
                     /codon_start=1
                     /product="DUF850 domain protein"
                     /protein_id="XP_027485066.1"
                     /db_xref="GeneID:38739199"
                     /translation="MPVQQSLLLDSDLRNWVLLPITVVMVLVGMFRNNLMQLFESKPK
                     LATLAAARQQNIMRRASALRLNYPVLPPASVAARKAFLARVLSDGSYLDPQAKRVTSP
                     DEMPESPVNDAMMENLMDQAKRSLLMMVPQTVIMGWVNFFFTGFVLIRLPFPLTQRFK
                     IMLQRDIDTPDLDVSWVSSLSWYFLNLYGLDAIYRLVLGNNRAADSMRDMAAFGAGAA
                     MMQQQPQMPGQQVDHAKLHAAERESLELIGAVSTKDARWIGDGIEARVLGAYASS"
     gene            <115626..>119099
                     /locus_tag="MRET_2434"
                     /note="MRES_11880"
                     /db_xref="GeneID:38739200"
     mRNA            <115626..>119099
                     /locus_tag="MRET_2434"
                     /product="structural maintenance of chromosomes protein"
                     /transcript_id="XM_027629061.1"
                     /db_xref="GeneID:38739200"
     CDS             115626..119099
                     /locus_tag="MRET_2434"
                     /codon_start=1
                     /product="structural maintenance of chromosomes protein"
                     /protein_id="XP_027485063.1"
                     /db_xref="GeneID:38739200"
                     /translation="MVIQALTIHGFKSFRDPVSITTFSPAQNVVVGRNGSGKSNLFAA
                     IRFVLGDAYTASLTREERQALLFDGSGAVSTTLSAYVEITLSNEDGRFPVHADQIVLR
                     RTISLTRDDYMIDRKSATKQDVANLLESAGFSASNPYYIVPQGRITHLTNATDAERLE
                     VLKDVAGTRAYEQRRAESLDILRATDARYQGSSELLSQLETRLEELAREQGELEKFYA
                     RDRERRCLEYTIYQRELVDVSDMLETLEHERRREVDESNTRREKWAQHDQALAEYEAQ
                     HAHIQQQMEQLALDQAQLEHERRELAKAQAQLDNRLEDADPRETVLPTQLDGLTETMA
                     QREAQLAQQTREHTQVMHELEAKRAAFERDRTRMSALYAKQARAARFQSVADRDAALH
                     AHMSDVDQEAAALDHAVKEAQAACDAAKAQAAELAGQRTSLESHVAQQGADLASMQDE
                     WRTLRDERDALLEHKKELWKQETKTSAQLTHARDELSSAQRSLVGTMDRATAAGLQCV
                     EALVARENIKGVYGPLYQLFRVDDRYKTAVEATAGASLFHVVVDTDETASRILHLLQQ
                     EKSGRVTFMPLNRLRPPDTPYPQAPDAIVMLRKLSFDELLLPAFKQVFGKTIICPRLD
                     IAAAYVRSTQGLNAITLDGDQVDRRGALSGGYHDASRSRLDAVRRVQRSLATVEAGEQ
                     ALAQQRHELHELEQTCTHKYSEMLRLEGQRHQLHESRAAAHHELTWLRRSETDAYARC
                     ERLEQVVSQRHVEQTSLATRRAALEAEIGTPLDQGLTSAETDELRALLSRQSHDEAAL
                     AQLTRTSMALSESISALSSELDEVLRRSHADLVERLEMPDVGANSDALRQSTATNAQR
                     LVDAQEQYDRLAGELAEIEQAMHAIRGQDDMHADDVARQRHTAERFAARKQRLEAQRD
                     RINERIRDLGMLPEEAFQRYQSRSTEQLATQLQKVRASLDEVAHVNKRAVEQFQAFSK
                     QRDALLQRHADLQASHASITELIDVLDARKQAALDATCTQVASHFAAVFAELVPGGRG
                     QLELHPDVGVSIHVTFHQNSMRMSQLSGGQKTLVALALVFAIQQSDPAPFYLFDEIDA
                     NLDTQYRTAVAQKVYTLARDAQFITTTFRPELVERADKHFGVLFGPQKVSSIVDISRA
                     EARDFVEAVEA"
     gene            complement(<119096..>119734)
                     /locus_tag="MRET_2435"
                     /note="MRES_11885"
                     /db_xref="GeneID:38739201"
     mRNA            complement(<119096..>119734)
                     /locus_tag="MRET_2435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629062.1"
                     /db_xref="GeneID:38739201"
     CDS             complement(119096..119734)
                     /locus_tag="MRET_2435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485064.1"
                     /db_xref="GeneID:38739201"
                     /translation="MDVDMQDASSRRGANRRAAREVSIKGSSVPKPTPVIVANLVKGT
                     SPEDVRLTFDALGRLVYVREHHVPSLGANAVAYEVAFEQRADAQAACKKYHGVLADGR
                     VLQVTMKEARPSRRRRAPPPKEPEVSERFEEEKLPLPVLRQLAQAEAKYLAETERILR
                     NKDAATPSLKDRLGSLPLAERLALAGPRTSAQKRRRTKQRRVQKKAGGMDVD"
     gene            complement(<119807..>121771)
                     /locus_tag="MRET_2436"
                     /note="MRES_11890"
                     /db_xref="GeneID:38739202"
     mRNA            complement(<119807..>121771)
                     /locus_tag="MRET_2436"
                     /product="bZIP transcription factor"
                     /transcript_id="XM_027629063.1"
                     /db_xref="GeneID:38739202"
     CDS             complement(119807..121771)
                     /locus_tag="MRET_2436"
                     /codon_start=1
                     /product="bZIP transcription factor"
                     /protein_id="XP_027485061.1"
                     /db_xref="GeneID:38739202"
                     /translation="MSTLEPSSRGTFSPMGHVFRHQQQPGAAEPGSSEFDAFIHSDLC
                     VQDPAVASSMHPQPPPPQPPGAHVPATFPFVPYMCKQEDPALALWSTGTPPSALMCPD
                     TTHAQAPAALRVPESSFANASIWTPSAAGQNATPTPQSLPSAPRPPHPSSAALLDATP
                     AAAQRVVPPDPAAFNKGEASEGAASMTLSELMRDDQGGPWTSAPQPKRARTSESPEPK
                     MRSVSATEVPHVPDMRARSHMPPRRSASTGARRPPPSASQVTESGLPFPVIDTSAKHS
                     SLFVPPDTSGLTKKEARLVKNRAAAFLSRQRKREQFEELACKCRALARLSWLLWDALD
                     PQGLSSSRVSVIPPTNGASLLHEKLKYEPEDVRTTLQQVVQQRGTMIVENIMGDDAPS
                     LKARTNGVLAQLMETERECEDLRAEVERLRAKTQEAPPSPASPSLLHLVGRALMQVRH
                     ASSECDAHDLLPRDDGSLHMQMRVVPTSDVVLCTLQAADQPEHADEAVDEKPWRCSTP
                     VDSSEASVPSLSTSASPTLSSLSSGTASSRRHRSVMAYHASGAPCAPSASLLHEVKTM
                     DLDEWVQTHGSSLDDISRAAQDLHSLITQRGMCLEPGCFLAATMNDHDKALPGKLTLY
                     ARMGTPASVDAHAHLVTVVRDTLRALHEEP"
     gene            complement(<121921..>122781)
                     /locus_tag="MRET_2437"
                     /note="MRES_11895"
                     /db_xref="GeneID:38739203"
     mRNA            complement(<121921..>122781)
                     /locus_tag="MRET_2437"
                     /product="transcription initiation factor TFIID subunit
                     10"
                     /transcript_id="XM_027629064.1"
                     /db_xref="GeneID:38739203"
     CDS             complement(121921..122781)
                     /locus_tag="MRET_2437"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit
                     10"
                     /protein_id="XP_027485062.1"
                     /db_xref="GeneID:38739203"
                     /translation="MASSPLIRAPSKAPRASEPQDVPQDVREKWQDGTVASLSLLPVA
                     AVSPDSPVRTALAASRAHRGQCVLVVENEQLQGYVDMVDLVAHETQGSLDDAVRDIQR
                     RFVPDATFRIIHSHTPLGDVAAFLQTRDVALVTDDEGQYITNVIVPGDLMRYADHQPA
                     ARATIGSRPEEETRRDHAMVEILRQLHGYTPLIPDEVTDYYLERAGFQCEDVRLKRLL
                     ALATEKFVSDIASDAFQYARIRTNAGPSRSHRPGASARDRTRTVLTMDDLSAALGEYG
                     IDARRAETFR"
     gene            <122857..>123411
                     /locus_tag="MRET_2438"
                     /note="MRES_11900"
                     /db_xref="GeneID:38739204"
     mRNA            <122857..>123411
                     /locus_tag="MRET_2438"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629065.1"
                     /db_xref="GeneID:38739204"
     CDS             122857..123411
                     /locus_tag="MRET_2438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485059.1"
                     /db_xref="GeneID:38739204"
                     /translation="MPPQEASSLAGLRSQLYEARERAKNAPLKRKEPKRLRMRASMQP
                     AEHSEDDVRLAASQHALASKAARYEAGYKDDEELIDWDSKGAKVEYEDEFGRTRTGDD
                     AAIYGPATSFPVYIRPDVPVPDVRPRGAAYYRFAQDAETRQSQQAALSELRKETLQER
                     GKAASTGAARREARRRFLTSFRAS"
     gene            complement(<123406..>125019)
                     /locus_tag="MRET_2439"
                     /note="MRES_11905"
                     /db_xref="GeneID:38739205"
     mRNA            complement(<123406..>125019)
                     /locus_tag="MRET_2439"
                     /product="leucine-rich repeat protein"
                     /transcript_id="XM_027629066.1"
                     /db_xref="GeneID:38739205"
     CDS             complement(123406..125019)
                     /locus_tag="MRET_2439"
                     /codon_start=1
                     /product="leucine-rich repeat protein"
                     /protein_id="XP_027485060.1"
                     /db_xref="GeneID:38739205"
                     /translation="MSFRLPEASTSSSSPPPWGLEPSSPPSSPTPTTSFHSLDPFSGS
                     AKSLSISRPRQTRWARSATTPAAPRTAHSLDVPNVDHHDREALLEQFFDEASEEEDAS
                     MVEMGSSYDAPSTFARPFVRTDSANTDPLSAAGRVDSMQRATQRTRLTGTSPKKLTRH
                     GSHLAPWEQADDPPPPRPGDVPWDAVVTRVFDEGREHPTLLFGGHGLTHISNVIGDLR
                     HYVTIEHTRSRLELYLWDNLLTKLPSALFQLTNLGVLSLRKNQLTHLPAAIGELRHLR
                     ELNIGGNALTYLPAEIQQLQLDTFTYVPNPFVCVPPGSLLETRHVHGDRPAPPPPGPR
                     WTRAHTLATVVPAAPTTRVIARVLGPCERRSKPSLANLCMQRLLSDDPLVIEQYETGC
                     LRALEHTVDARFVARIEAARRSATASWGTRVDARDPQVAWYAGADNVDAMLEADDAGH
                     NVWFNRCPAHDRESRTDWPSCSGPLFVDAAEERIEWVSHVAGVRVAKQGIEMAGTSVR
                     GMPAEHAGCLPILWRGCSVGCLAFLDDSL"
     gene            complement(<125079..>126107)
                     /locus_tag="MRET_2440"
                     /note="MRES_11910"
                     /db_xref="GeneID:38739206"
     mRNA            complement(<125079..>126107)
                     /locus_tag="MRET_2440"
                     /product="solute carrier family 39 (zinc transporter),
                     member 9"
                     /transcript_id="XM_027629067.1"
                     /db_xref="GeneID:38739206"
     CDS             complement(125079..126107)
                     /locus_tag="MRET_2440"
                     /codon_start=1
                     /product="solute carrier family 39 (zinc transporter),
                     member 9"
                     /protein_id="XP_027484874.1"
                     /db_xref="GeneID:38739206"
                     /translation="MQSGALLVLTCLFMSVCTYGVGTLPLAFQLSRHSLRKLELWGAG
                     LLLGAALTVVIPEGIQNVYASRADGARYALPPKDLVAFCLLGGFLLMFVVEQHMTARS
                     AQPRASPSPSVLSDAPSEATLQWQPRMDDAEPWYSVLSGLLGILVHAAADGVAMGSSV
                     ESSDVSLRVVVILAILVHKAPASVGICTLLMSRHSPQNQIRFAVLVFAVTTPAFALLT
                     YGILQGLLTATGSTGAVIGSREIGAILSFSGGTFLFVAIHAVMELASHPVSQHTRTGE
                     HHPHDDDHPIHAQVETRLVAPLLPRFLGEQDAVAHSSTRSLAYVIVGSIVPRLLQLLV
                     GHHHHSPS"
     gene            complement(<126201..>127217)
                     /locus_tag="MRET_2441"
                     /note="MRES_11915"
                     /db_xref="GeneID:38739207"
     mRNA            complement(<126201..>127217)
                     /locus_tag="MRET_2441"
                     /product="2-nitropropane dioxygenase"
                     /transcript_id="XM_027629068.1"
                     /db_xref="GeneID:38739207"
     CDS             complement(126201..127217)
                     /locus_tag="MRET_2441"
                     /codon_start=1
                     /product="2-nitropropane dioxygenase"
                     /protein_id="XP_027484870.1"
                     /db_xref="GeneID:38739207"
                     /translation="MTIHTVLTNTLKLRVPLVMGGMQWVGKPALAAAVSNAGALGMLT
                     ALTQPTPEALRAAIEETRSLIDPQIAKERSQYGAFGVNITLLPAIVPPDYEGYARAAL
                     EAGVRIFETAGSNPEPVIKVLKQSGAFVIHKCTAIRHGLKAAQLGADMLSIDGLECAG
                     HPGEDDIGGLVLLALAAEKSPIPFIASGGMANGRSLAAALALGACGANMGTRFMATRE
                     SEIHDKIKAHLVQSSERDTVHIMRSLRNTARVYKNKVALEVIEKEKQRAQFADIRPLV
                     SGQRGKKVYENGEVDAGIWTAGQTAGLIHDIPTCKELVARIERDAEQVMTQSAALITP
                     SPRL"
     gene            <127379..>128074
                     /locus_tag="MRET_2442"
                     /note="MRES_11920"
                     /db_xref="GeneID:38739208"
     mRNA            join(<127379..127881,127908..127996,128025..>128074)
                     /locus_tag="MRET_2442"
                     /product="ER lumen protein retaining receptor"
                     /transcript_id="XM_027629069.1"
                     /db_xref="GeneID:38739208"
     CDS             join(127379..127881,127908..127996,128025..128074)
                     /locus_tag="MRET_2442"
                     /codon_start=1
                     /product="ER lumen protein retaining receptor"
                     /protein_id="XP_027484869.1"
                     /db_xref="GeneID:38739208"
                     /translation="MNLFRLLGDLSHLASIFILIHKILTSRSCRGISFKTQLMYTIVF
                     VTRYLDLLHPPSAYLILMKLFFISSSAYILYLMKVQFRSRYETDIDSIRLEYLLGVPA
                     ILALLFHVQFTFLEVMWSFSIFLEAVAILPQMFLLQRLGEAETITTHYIFALGAYRAL
                     YLLNWIYRFIFERHHPFLLIPFLAGLVQTGLYGDFFYIYFTKVIQGKKFELPA"
     gene            complement(128181..128273)
                     /locus_tag="MRET_t0041"
                     /db_xref="GeneID:38741235"
     tRNA            complement(128181..128273)
                     /locus_tag="MRET_t0041"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:38741235"
     gene            complement(<128394..>130232)
                     /locus_tag="MRET_2443"
                     /note="MRES_11925"
                     /db_xref="GeneID:38739209"
     mRNA            complement(<128394..>130232)
                     /locus_tag="MRET_2443"
                     /product="negative regulator of differentiation 1"
                     /transcript_id="XM_027629070.1"
                     /db_xref="GeneID:38739209"
     CDS             complement(128394..130232)
                     /locus_tag="MRET_2443"
                     /codon_start=1
                     /product="negative regulator of differentiation 1"
                     /protein_id="XP_027484868.1"
                     /db_xref="GeneID:38739209"
                     /translation="MHDAELHPEAASAQASPHATPSISSSPSSTALDQASSAMHTLRV
                     TDSDESTSLLPATPYSHEAAYPIVPPTLPSSAAATPSSMAMPMVGWSSPMAASMPYMM
                     AIPGGGQSPLPLAYPNYAAPGTSHDFAMPTAAMATTGMVPVGRTVYIGNMPPDVSAEE
                     LLDNVHFGPIESVRLLPEKNCAFVSFLSGQVAAAFHADSSVRRISLRNRELKIGWGKP
                     SVPPPAVMYAVQHHNASRNVYFGQLDDSVTEDTLRSTLSKYGPIDQIKLIREQRIAFV
                     HFLSIQAAMKVVSSLPMDTEWSKYRINYGKDRCAYVPKGQQQTQAHNHQAAAMGLATA
                     MWLGYPTGYLNYGQVPPGSPFYMDAESSASTDPEARARFQGQMLGQVEPQMYQFGNRT
                     VYLGNLHPDTTVEDICNHVRGGILQSIRYMPDRHIAFVTFVDHNTALTFFHMALVSGI
                     NVLNRRLKIGWGKPTGPLSPAIALAVQSGASRNVYIGNISDHALMSEEKIRQDLSQYG
                     ELEMVNTLRERNCAFANFTNIQSAIKCIEGLKYHPDYQSVKVSYGKDRCGNPPKYLSR
                     LAMNWQAQTRAAPFPVGQAQEPMAHDASTPHDQHGSSPSPEPLIST"
     gene            complement(<130577..>131536)
                     /locus_tag="MRET_2444"
                     /note="MRES_11930"
                     /db_xref="GeneID:38739210"
     mRNA            complement(<130577..>131536)
                     /locus_tag="MRET_2444"
                     /product="solute carrier family 25 (mitochondrial citrate
                     transporter), member 1"
                     /transcript_id="XM_027629071.1"
                     /db_xref="GeneID:38739210"
     CDS             complement(130577..131536)
                     /locus_tag="MRET_2444"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial citrate
                     transporter), member 1"
                     /protein_id="XP_027484862.1"
                     /db_xref="GeneID:38739210"
                     /translation="MSAEKKTNKPRVSPATHLIAGGIAGFAEACTCHPLDTIKVRMQL
                     SRRGRGISEKPRGFFATGVHIVRRESPLGLYKGLGAVVAGIVPKMAIRFMSFEQYKLA
                     LANRETGVTSPQGVFVAGLLAGTTEAVAVVNPMEVVKIRLQAQQHSLADPLEKPRYQN
                     AAHALYTIVREEGFGTLYRGVALTALRQATNQAANFTAYQELKSLAQRVQQTQDLPSY
                     ETATIGLISGALGPFSNAPIDTIKTRIQRAAKVEGETAMGRIVKVASDMFKQEGVSAF
                     WKGITPRVARVAPGQAVVFTIYEKVKGMIESSHEKKAQAVVKQ"
     gene            complement(<131880..>135263)
                     /locus_tag="MRET_2445"
                     /note="MRES_11935"
                     /db_xref="GeneID:38739211"
     mRNA            complement(<131880..>135263)
                     /locus_tag="MRET_2445"
                     /product="cell polarity protein"
                     /transcript_id="XM_027629072.1"
                     /db_xref="GeneID:38739211"
     CDS             complement(131880..135263)
                     /locus_tag="MRET_2445"
                     /codon_start=1
                     /product="cell polarity protein"
                     /protein_id="XP_027484858.1"
                     /db_xref="GeneID:38739211"
                     /translation="MAQQAQRMGARFLHQLTNLGGGSGNTSQDMSTHSTGSNTSPVKN
                     QLASLFQKGPPAPSPDISLPARKPGTSYDGVGDDASMRFGEAFSDGMAPHAAYQQRPL
                     AGGATDSMPSVNAPSMYQPAFQGYHPPSAPYQDMRGYGMPDANANMVYAMPEQPMAAA
                     SAPTMPATHPPAPVPPAARDTSLDDSGMALRQGQPWTNTSPTKRMDPSEIDHLSRIYY
                     MSLLQFFRSQAVRSSLLTPSRTNAREKLTRLNKQQFAELSTDVHDELQRRQDESQSQP
                     YLQGRHEFHPKRNQARQKLATLPKNRFRDLASDVFFELERRYPELPQDLRHESLEELM
                     GPREGQAPEGMPPAPDVPGPSVVQGGQDVVAPAADVREASGGTSPTGQALSPGPYGPQ
                     PVPVPVSVEPRMRSTEPTASRMSSAVAQQQLADLMADAQQMSSAQMFAPTRVSVAEEP
                     AEPAQPGTEPRSVDGGAAAGAVLATPGGVAAAASQRGALMDPAEVQASRDRVDLLQKQ
                     VQLLEEQERALRAQGAERDRALEELRSQNAQLQERLATLQQHVSEHERTAAELRSEHD
                     RHLLVLSDKEAELRSERDRHRVVMDDKEAELLQHRANLDALRAQYNDLNLVHAARSRD
                     VEAEAQWKRQLEDMQRETLEQQNMVQGLRSEVATLLEELRRLSARNDAMTTDKESDVA
                     IIRDLHMQMSAYKRRYEGTKAELRIAQSASQVWAQPHVDEWKYVSPTGAVADTNLKSF
                     QTSIDELLTTARSAAPSNVLIAMKTVVLSTTLVTDDIAKYESQPENELGALSAQQRED
                     VETLKTSISDALTNLMNACRNHASSQGLAPVSLIDAAATHVAIAVVEVVKLLKLRRVP
                     RPSEDDFSFESTNDATALSSPPSGLKPLHTRSALSPPAHSAPPLPPSSRRPSATAHAS
                     PVSLRSLSYSHSNLEARMRSMDMKAGLVRSPPPPPPAEPASTTPAAAGGSTARTMDVE
                     EPQEAAAEQGVDASREDDELENWGELRNYIEVQTEAIVHSIQSLLSALREGAQGVQLN
                     ENLTQITTIVSSIVAISRDHLPNAGTPKQESISTEAERIFAELTENCDRLSDMQSNTT
                     FDRTAKSIMASASYGVAKGLKALNELLNAADEVPDASRG"
     gene            complement(<135498..>136043)
                     /locus_tag="MRET_2446"
                     /note="MRES_11940"
                     /db_xref="GeneID:38739212"
     mRNA            complement(<135498..>136043)
                     /locus_tag="MRET_2446"
                     /product="mitochondrial matrix iron chaperone"
                     /transcript_id="XM_027629073.1"
                     /db_xref="GeneID:38739212"
     CDS             complement(135498..136043)
                     /locus_tag="MRET_2446"
                     /codon_start=1
                     /product="mitochondrial matrix iron chaperone"
                     /protein_id="XP_027484871.1"
                     /db_xref="GeneID:38739212"
                     /translation="MWTRRLAQQMVRYVPRMGVAPRSRHMVLARAAHTTPVWAKGAAS
                     STPTYRAGELRMVDYHRMIDHSLDTLTSQLEELMETQDIDALEEKAPQGSEEGEWDVE
                     YATGVINVRLGSYGTYVINKQPPTQQLWLSSPTSGPKRFDYDTDKGVWFTYRDGELFL
                     FHELLSRELSAVFDTPLSLHL"
     gene            <136222..>137397
                     /locus_tag="MRET_2447"
                     /note="MRES_11945"
                     /db_xref="GeneID:38739213"
     mRNA            <136222..>137397
                     /locus_tag="MRET_2447"
                     /product="protein kinase A"
                     /transcript_id="XM_027629074.1"
                     /db_xref="GeneID:38739213"
     CDS             136222..137397
                     /locus_tag="MRET_2447"
                     /codon_start=1
                     /product="protein kinase A"
                     /protein_id="XP_027485195.1"
                     /db_xref="GeneID:38739213"
                     /translation="MPHFFGFPPFRRDASEKANAERSAASQNTHVAKPSTSHSTVALA
                     GAGAGESAPNVDPYTGLTVRHLKGRYKLQDFSILRTLGTGSFGRVHLVRSVHNQRFYA
                     IKVLRKQHVVKMKQVEHVNNEHLVLSMIRHPFLVNLWGTFQDPTFLYLVMDFVPGGEL
                     FSLLRQSRRFPPKVAKFYISEVALAIDFLHMHNIIYRDLKPENILIGADGHLKLIDFG
                     FAKVTAQTNGMCWTLCGTPDYLAPEVIRAKGYNASVDWWSVGVLLFEMLAGYPPFYTE
                     DGNPIKLYEKIIAGHVNYPSFFEPGAKDLLQSLLTADLSKRFGNLHRGSRDIFAHMWF
                     AEIDWECLYRKEIPAPYIPNINMDGDASKFERYPENDLSEYERPDAPDEYPHLFPDF"
     gene            complement(<137394..>138863)
                     /locus_tag="MRET_2448"
                     /note="MRES_11950"
                     /db_xref="GeneID:38739214"
     mRNA            complement(<137394..>138863)
                     /locus_tag="MRET_2448"
                     /product="cerevisin"
                     /transcript_id="XM_027629075.1"
                     /db_xref="GeneID:38739214"
     CDS             complement(137394..138863)
                     /locus_tag="MRET_2448"
                     /codon_start=1
                     /product="cerevisin"
                     /protein_id="XP_027484974.1"
                     /db_xref="GeneID:38739214"
                     /translation="MWVRVVLLCIAVACTAALAFPTSWGAMAPLVQAPGTKAVPDKYM
                     VVLKEGVSADRLVAHSANVASFFRGSGDAGPISHVYDMGDAMRGYAGHFSPEDIALIR
                     SHPDVAFVERDSIVDVTMLAQDDRNVRNMSGSAVQYTFPWDNPYRHLTEQGAPWGLAR
                     ISHQRSLSLGTFNKYVYESIGGEGVTAYVIDTGVNIEHSDFGGRAKWGTTIPANDTDT
                     DGHGHGTHVAGTIASNTFGVAKKAEIIAVKVLGSHGQGSMSDVTAGVLWAVKDAENKT
                     RMMRGSRKLRGFVSNMSLGGTKSPTLDRAVGGAVAAGMHFGVAAGNEDQDACNVSPAD
                     VRAAVTVGASTIADERAFFSNTGPCVDIFAPGLNILSLWNAGPQSINTISGTSMAAPH
                     VVGLMAYLLSIYGSSDFRVMEEAKPVRSLVAAVHALLPSWVARFLPLAYELTPLPIES
                     TVRPADLKRAMRRMATSHALANLDMDTVNKLAYNNATTS"
     gene            <138970..>140646
                     /locus_tag="MRET_2449"
                     /note="MRES_11955"
                     /db_xref="GeneID:38739215"
     mRNA            <138970..>140646
                     /locus_tag="MRET_2449"
                     /product="asparaginyl-tRNA synthetase"
                     /transcript_id="XM_027629076.1"
                     /db_xref="GeneID:38739215"
     CDS             138970..140646
                     /locus_tag="MRET_2449"
                     /codon_start=1
                     /product="asparaginyl-tRNA synthetase"
                     /protein_id="XP_027484973.1"
                     /db_xref="GeneID:38739215"
                     /translation="MESVVQGTAAMDVNAPRVYVDEAKGHDESGQGTEAAPYATALGA
                     MLARGPDVSILSRKDEGYEPLSASGVKKAKKLYDMAIKKKQKAAELASQEAERAEQDK
                     KKLEESKKVVLDVPSEPAKRIKICAGVHNRDVRVKVCGWVHRLRSQKDRMFLVLRDGT
                     GYMQCVLQDKLIQTYDALTLTLESSVEMYGTIKALPEGKTAPDNHELVVDYWVCVGKA
                     PGGDDAITNRISENTDPSIQADNRHLMLRGETASAVMHVRAAVMQGFRDEFASSGVME
                     VTPPCMVQTQVEGGATLFQFDYYGQPAFLTQSSQLYLETCLPALGDVYCVQESFRAEK
                     SHTRRHLSEYTHLEAELAFVTFDDLLSHIEQDICGMVDRVLQNDKVRQLIEQLNPGFQ
                     PPKRPFMRLSYKDAIAYLNEHNILNEHGEPHKIGDDIAEAAERKMTDQLAVPILLHSF
                     PREIKAFYMKRVPGDEAFTESVDLLMPGVGEIVGGSMRMTGNEELLEAYKHEGIDPQP
                     YYWYTDQRKYGTCEHGGYGLGVERLLAWLTNRWTVRECSLYPRWTGRCTP"
     gene            complement(<140651..>141454)
                     /locus_tag="MRET_2450"
                     /note="MRES_11960"
                     /db_xref="GeneID:38739216"
     mRNA            complement(<140651..>141454)
                     /locus_tag="MRET_2450"
                     /product="essential protein required for maturation of 18S
                     rRNA"
                     /transcript_id="XM_027629077.1"
                     /db_xref="GeneID:38739216"
     CDS             complement(140651..141454)
                     /locus_tag="MRET_2450"
                     /codon_start=1
                     /product="essential protein required for maturation of 18S
                     rRNA"
                     /protein_id="XP_027485003.1"
                     /db_xref="GeneID:38739216"
                     /translation="MPREPQGRRGHGRRRPMPARGETTSVNKLKSMIRQTKRLLGKES
                     IEPGTRIEAERRLRAMELELEESMQSNKERQFATRYHKVKFFERQKLMRRLRQLRREP
                     ESRQVRAQLFEHRVFLNYVLHFPADRRYVSLFAGNKEPVAPSADAPDRAHQKAAEFFK
                     HVRKSMKRGTMAAEPDRDLHHREEQHRRTRAQHVKRSEVDVGDGDGDDDGDDDGDDDG
                     DDDEADDDEADDDEADDDGDGDDGDDDDDEMHDRADPPPSSVANDDFFA"
     gene            <141531..>143549
                     /locus_tag="MRET_2451"
                     /note="MRES_11965"
                     /db_xref="GeneID:38739217"
     mRNA            join(<141531..141536,141565..141657,141684..141807,
                     141832..>143549)
                     /locus_tag="MRET_2451"
                     /product="transcriptional activator SPT7"
                     /transcript_id="XM_027629078.1"
                     /db_xref="GeneID:38739217"
     CDS             join(141531..141536,141565..141657,141684..141807,
                     141832..143549)
                     /locus_tag="MRET_2451"
                     /codon_start=1
                     /product="transcriptional activator SPT7"
                     /protein_id="XP_027485004.1"
                     /db_xref="GeneID:38739217"
                     /translation="MKYLLQAIDAHRDQVPLQDAELLRLLSEAQKGRDEREEYQEAME
                     RILTELRNYTEHSQAFLVRVSKRDAPDYYDVIQNPMDLGTMQKKLRGGCYKTKSQFAH
                     DLNLIWDNCLVYNASPTHPLRRNATVMRKKANHLLEFLSDKNDTQDLLSQWQSASHAE
                     KPIEDIPPPAVAPAAETPTAPSTSAPAHDVPFSQRHALRRNPESCLVFHELDAKLSDL
                     EDGANAANPAPTLDVLHQVPASHLHPLAAALPQSTPTAQQRWWAACASDAMLCAGLPV
                     VPHAGHVVDHEPDAAYTSRLPSQRAGIPRMMAHNIRTLRRLYSTHQKIHELAEAIEFD
                     VPIPPSIGVVDDEDEPEPPSVPPPVPYATSTPYPRLSRSYAQAQTSWQTQVLLAHAGF
                     EGAHSSPVQVLADVAAKYLMGLGRTLRLYVDRFAHHMSPTDMLEHVMLSRGTNLSALE
                     SYVSQDIGRYGQRLQEWLRKQKHVLHEQLQGVDSATVDDADLLASDGEALMLGHFAAG
                     LGDDFFGFRELGLESELGLPHLAVPSRLFFGTSHAPHKVASDGKLGTSKPVLDAPPPP
                     VPLVACSLPAQIGLLRTWYAQQLGSMPFLPDQVPERPRYKVPTTGKLPARPMVSRAHR
                     PASVPAGSAPQPQQQAKRQRVS"
     gene            <143729..>147316
                     /locus_tag="MRET_2452"
                     /note="MRES_11970"
                     /db_xref="GeneID:38739218"
     mRNA            <143729..>147316
                     /locus_tag="MRET_2452"
                     /product="translation initiation factor 4G"
                     /transcript_id="XM_027629079.1"
                     /db_xref="GeneID:38739218"
     CDS             143729..147316
                     /locus_tag="MRET_2452"
                     /codon_start=1
                     /product="translation initiation factor 4G"
                     /protein_id="XP_027485005.1"
                     /db_xref="GeneID:38739218"
                     /translation="MSGTEKRATTAPKPGKPGSHTKAPRDVSEGAAVSMPKTAPRAAQ
                     GINFGTVDDQNAVMSSSPAAQPTTGEHLRGGNLTVFGSVSAESGAAHEKKIGFGPKKH
                     MDFQKLFQGPKKVHQQDQQSQQQPAAPVASAMGATPPPFVSSWQPPMYPHVGYPMSPG
                     GYPYMAQPQQPWNQAAAPGSPSILPANASPHTAPRPVNGGFYPQTPAAAPPTSSNFTM
                     SAGARMFEPQKSKALRIVNPETQTEIDLGHLKKTSQSSASPTQPTSAKAPADASHAPK
                     QKEVSNESRVKTQNDFQQKVLRLKMEKEAEARRAEEAKREEERQAEEAKREEERKAEE
                     AKREEERKAEEAKREEERKAEEAKREEERKAEEAKREEERKAEEAKREEERKAEEAKR
                     EEERKAEAAKREGERKAEEAQHAEERKKEETQGAEAKDGAESKDNAAQDGQAPEASSS
                     KTEEAQPPSRAIESARLIDDLSSITYPPDVHPPKAELNKDAAPGRYRYDRDFLLQFMS
                     VYTEKPFELPDLASIGMESVPVRGGRRGAGPSRGGMDGGRGQVGRTSEERFASSMRAG
                     PGGFPSGSRGGSASRTGGGPVPSRETMGTGIPMGGGRSKGHRGRQRDGRPRENPPEKG
                     GPTIPLDQVAPLEFSENRWKPQSHDKTSTADHSLVVERKVKSLLNKLTLEKFDSISDK
                     IIEFANESKNETDGRTLRQVIALVFEKAIDESAWSEMYAQLCAKIQMSLSPDIRDEVL
                     DEKEQKEYRGGMLFRKYLLTWCQGDFEKGWAGAKEERSEKEYELMSDEYYEAQKAKRR
                     GLGLIQFVGELFKLQMLQPRIMHTCIVRLLRTTTEPEEDEIESVCRLLTTVGYLLDSA
                     SGNHKSRMDVYFKRIDDILKSPALASRMRFMLMDVVDLRNNNWVPRHDQSAPKTIGEI
                     HAEAAQQQQQKEAEKFSRGGPRRGQPRHAPPPEQASHDGWSTVGNAPPSRSGRATDFS
                     GFGKGLDRSSNGKLGGGPQSVFHRRNQRDDERSMSPTPNMFNLLTGEGNTEEPHRRKL
                     QLQPRTKPLDDGHTAATPSEPSEEDIKRKVSNDVKEYLEIRDLNEGIQSIEALEAKHR
                     PSFVDALVTSVLDKKQDSVDAACHLLQALAERSLLDESMLMEGFKPQVTILDDTSMDA
                     PSAYGFMAQLLVQSTLAQAKIEELANGMEGEGLKPPKDRLLAKVQDVQS"
     gene            complement(<147347..>150355)
                     /locus_tag="MRET_2453"
                     /note="MRES_11975"
                     /db_xref="GeneID:38739219"
     mRNA            complement(<147347..>150355)
                     /locus_tag="MRET_2453"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629080.1"
                     /db_xref="GeneID:38739219"
     CDS             complement(147347..150355)
                     /locus_tag="MRET_2453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485006.1"
                     /db_xref="GeneID:38739219"
                     /translation="MVIMPAPSSPLTDYNSLGRRLTMQRSPSVPDPGAEPPVVSEDAL
                     RSTCSASPTQRRRSTLYRTIQRRVSHNSLNSDNIGPSAMSHSSQRNKYRMSFRGVSMG
                     ATDPPRDGSQRSSSSGRLWPFSRPRIPDEQPDDVFHDAINDEMTRPATSSPYVRPSTT
                     LSLPHSTLWRDANNSSPIIPLGTDTPPMRSTSPMPAFPRKPVHQLSNNVVLVVEPRHQ
                     VLHMFGALQVTGSYSLSGTLRVSLPHAMDECRDIQVRSLQMRLSGYSLYIDQMGRYSC
                     MRLCDIKQDVMEATTQLALPPHGASMYETEYDMFVPGWLPASISTRTVSTFYKLEAVA
                     ELCDVCTSSSLTRPGHPVCVRSSPGLVVIQRSREIVPIPVAQTAAFLGPDVPLTRNPF
                     RRETNPFRAAEPEAPTPWMPRPMPRPTPPPKRSRTSRAPLRHYTHLAHLHLPVPVMMN
                     GKTHATLPVKLCLSVPSYSSTHAISHEDQPPLIFWLQVELDPAWQGATVRSDVRVREM
                     EAVCVQMEKYSTTLSRSYCTAFALGNDDNSFVAPEELPFFDHLPQDTGVYTPQSALAA
                     SHAPAQPYSVQLAENRKHLELNRTQPNERLNTIERFRAYTVGPLPSREKQSEKERESH
                     AHGKSATFTTPKSRRTVSNALSRLSIFSPHRDAASTADHATEPEPVSTAYDAGPNAGS
                     VENTKASYVLEGEDGAGLALNQKRVRLSFSLPLVPSCGSMAVKYNAPQLLPDYESPHM
                     RIRHKLKVKVRFAFEGANLPPHAGMQSVVMSVPVRFSEAPPMEALSQAPPLVLPKSAQ
                     SYVPAEGAANAALPPAYVRAAYSTNGSAQTRQHSGYLPAYAQLFREDGSRLEDDAEVL
                     PPYPDQKTRTTRPAEEHRDHERFSAHLARELRLVSSAEREQKTPAAISLVDALNAHDD
                     EQLRGMAEAMDDEIMEERLGEEMVAYDDYEDMPRSERPATMSPGLDMPAAALPASPAE
                     PAAPVLPVPQPALPMASLMYLSPSRSARAT"
     gene            complement(<150574..>152091)
                     /locus_tag="MRET_2454"
                     /note="MRES_11980"
                     /db_xref="GeneID:38739220"
     mRNA            complement(<150574..>152091)
                     /locus_tag="MRET_2454"
                     /product="AHNAK nucleoprotein"
                     /transcript_id="XM_027629081.1"
                     /db_xref="GeneID:38739220"
     CDS             complement(150574..152091)
                     /locus_tag="MRET_2454"
                     /codon_start=1
                     /product="AHNAK nucleoprotein"
                     /protein_id="XP_027485007.1"
                     /db_xref="GeneID:38739220"
                     /translation="MRIAFGLLVVFGTSVGLSPALQHDPEPESLQSTLSTRRMHHLRV
                     YQPYAHHIRRGIIAGDNNVLQQGSNLLSSLVGGEFTTINKNSRASPTSSTHATRSTRE
                     RGGGGALPSSHEFTTLDNNSRAPSPSSTSSASSPTTSASSPSTSTSTPTTSTSSPTPT
                     SSRTSSSPSSSTRESDSSMVGAGAGGGASSTPTTMRRSSRTSSSTSMETSDRTSSGDD
                     ESSSSTPTSTGNPVSEDRSPSSATSAPSSASHASNDSSDADDSDSESDEGSKSSSPSM
                     NNASNARKSDDGTDHTGVIAGVCTAGGVVILAILGFVLYKFLNKRAGSADKPEQAIQW
                     PDVTYDAGPATPTGLAAAQHDAPADTSVDMSGYEDNPFVDRVDSAAAPMSAQSNALPE
                     SYVDVPPATFGYASDAPTQPVAESTALATTYPKALVPSQSPTSNAPVSVPLSSADPPP
                     NVPHRGDGAQFQHFVVGQTYPEEAIQLPYDAPVTRELYREQPDASPFDESRAVKN"
     gene            complement(<152317..>153621)
                     /locus_tag="MRET_2455"
                     /note="MRES_11985"
                     /db_xref="GeneID:38739221"
     mRNA            complement(<152317..>153621)
                     /locus_tag="MRET_2455"
                     /product="mitochondrial GTPase MTG1"
                     /transcript_id="XM_027629082.1"
                     /db_xref="GeneID:38739221"
     CDS             complement(152317..153621)
                     /locus_tag="MRET_2455"
                     /codon_start=1
                     /product="mitochondrial GTPase MTG1"
                     /protein_id="XP_027485008.1"
                     /db_xref="GeneID:38739221"
                     /translation="MLPSAVRLAASEAGSFTPRTKFEFPIKTPSWYIGHMHRAMRSIP
                     SMLARTPPPLVIEVRDARVPFTSINPAFEKALQNAPSANERVRIAPQTYMPGWAARRL
                     VVYTKSDQIEPAWESPILHALSQHTLDKNVMFVDTRKKSDVQRVYDWVCARAKLLSKS
                     AAQAATRRPASAMRHSHLSGAAKHTSTPETGVRLLVVGMPNVGKSSLLNALRFVGTGK
                     PGAASTHPHPGHTRKVTGTVRITPSTPSLARLDRSGGIDMKRLVAHEAKRGPAVYVYD
                     TPGIMVPFLGAPEEGGAEAALKLALIGCMKQTLFDPEELADYLLFRMNQRYLYACAHA
                     NGQDVPWPAYTGLMRTPTLTDDSQAFLTSVAEKAPGARQRGGYLNLTVAADHVITQFQ
                     RGLLGSRELDLGLAEGPDDVALSSDLKAHVARRLRQAMERIP"
     gene            <153674..>154684
                     /locus_tag="MRET_2456"
                     /note="MRES_11990"
                     /db_xref="GeneID:38739222"
     mRNA            <153674..>154684
                     /locus_tag="MRET_2456"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629083.1"
                     /db_xref="GeneID:38739222"
     CDS             153674..154684
                     /locus_tag="MRET_2456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485009.1"
                     /db_xref="GeneID:38739222"
                     /translation="MQADVHLRVLWKGMVVLHDGMQLPGVTIVTSMQPWAHLRGTSHH
                     DDASNLPMLEAEAELCFALEMVRHHPLRARKAERTGDAELVASGSIRLDLHAAEDVTM
                     AYLQQLFCLPGDSILFLTFAPSTASSSSIELVVFGRVCSDGSLDLVVGREVRQPSRHT
                     RPDDPLPRIPTRERALDARIRKRGQLSLSEHTNPPVTPGRHGEKRAHKVHVDRVPIKW
                     EHNSPSPTPPRSASPLWHPVLPIMQNHARGTVPDASIEQANRLLIKKLIKHQLAGRGV
                     ERDHQDHAACFQTAYAGTCLVFRDALDTCALDQVRVAHIVQAHLDMYVHPHHLALCTR
                     RA"
     gene            <154762..>157431
                     /locus_tag="MRET_2457"
                     /note="MRES_11995"
                     /db_xref="GeneID:38739223"
     mRNA            <154762..>157431
                     /locus_tag="MRET_2457"
                     /product="pseudouridine synthase"
                     /transcript_id="XM_027629084.1"
                     /db_xref="GeneID:38739223"
     CDS             154762..157431
                     /locus_tag="MRET_2457"
                     /codon_start=1
                     /product="pseudouridine synthase"
                     /protein_id="XP_027485010.1"
                     /db_xref="GeneID:38739223"
                     /translation="MTERVAAPGLRRLPPYWHEYKTRAKTRWYGRQILEVFTTEFRDR
                     TREYYIWAIHQGLCTVNGHSVQPTYILQNNDFLVNRVHKHEPAVTNAPVRILFRDDAM
                     GRIVVVKPGSIPVHATGRYHHHTLVEMVKQQAQLSNLYTSNRLDRLTSGIMVCSTTKE
                     AACELGNDFNAGLVNKAYVCRVAGRFPDGIIDCREPILSVDRQSGLNIVHPKGKECRT
                     LFQCLSYDPTADSSVLVCRPITGRTHQIRVHAQWLGHPISNDPLYHHPVWSTVDRDIL
                     ATAQPRHYERVGGGSGNVEVERVLTALKGTRDDAEGWSRWRDQEFFGALNRQLGYEDV
                     PVPGPNGQRTPPPPPGEDMPPGTATCDTCYIPLLPDPAPQDMYIYLHAIKYWTDTWVF
                     EDELPWWARSSAKASASLPPLALIAHHTGDDALGLGKGGAQRRLDTQLQPAMQLASLP
                     LAPRPDACAHDESLQVFVEVTRGLEDAAQREMLQHLGADPSASSCLTSALHSGIIQVD
                     APLHAQVVARYEACQLPIATGVYYAMGHMSLPRDMLDALFDQRVEVLGKKGAQKPQPT
                     LAEQALLQWLTQQWHAHQAQRDKALDLWMKRASRRTRTWCVVVDRSSYVLPSLSTQAL
                     ETHLASLVTGWLDSHSWTPASTRAEADMVIKCTMAPRFGAQSPLQLGPRAHKGNPPGT
                     CFFQLHVPGGPCNVAADALRTSLARSRAHAVCALLPLGDGTCVGTLHSKDSHLADALR
                     AMLHARGRMTAQVPYGSTSAHALHGAVVELPESARDEPHALLFDHFVTELECLSHALA
                     PGKFALVLTSETKTCMRALRELENRARREHSPYVLRMDTGVTLGDAWPAEHAATFKDA
                     QQEASLRSGGTWRALAHHRSFLACVAQAPLYST"
     gene            <157616..>159169
                     /locus_tag="MRET_2458"
                     /db_xref="GeneID:38739224"
     mRNA            <157616..>159169
                     /locus_tag="MRET_2458"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629085.1"
                     /db_xref="GeneID:38739224"
     CDS             157616..159169
                     /locus_tag="MRET_2458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485000.1"
                     /db_xref="GeneID:38739224"
                     /translation="MHMLRRISPTYRRWAQWLWVAACCCIVGGQDPHAHPDKSVDDPT
                     TNRHITADQLKRQTEVVEFVCVAGLTLYCWEYLMTLGREISMWLHPRRLLHPQVILFL
                     LIRYATVPALVVTSYSTWGHFEREEECINHEQLTVAVVQFVVACVFSWRTIAIWRRAG
                     WVVASMVTFTLLLFGASIGLLYFSHESLLASGACRPSYDQNSDPDSVSDVNTVMWFYL
                     IGMIFDTTAVVLSTYKLVVYANMGRQIQKITFRDPFEMHRQQLAKGESVSNPGLNDID
                     PFESQTHSPPTAYRRLSDAFTAVLFSPVRATNNVFTWWYSLTPLVARLLRNGIFYFVV
                     ATAYNLNNFIHEAKKSLHSKSFLALYAPLMCVMCQRLLLVEFDEVWTPYDPDVEYPGR
                     QLVDRIMRPMQSVSRGSHADLARFDRFASALEEHHASIITSSPPREPPRSTVSPPPVA
                     REKQCEENIPSLPRFIFPTSSPFSSHTFSVNQLLPPRSAMVAAATSTPPPKLTLAQEQ
                     QALHMAGML"
     gene            complement(<159208..>160458)
                     /locus_tag="MRET_2459"
                     /note="MRES_12000"
                     /db_xref="GeneID:38739225"
     mRNA            complement(<159208..>160458)
                     /locus_tag="MRET_2459"
                     /product="nuclear polyadenylated RNA-binding protein"
                     /transcript_id="XM_027629086.1"
                     /db_xref="GeneID:38739225"
     CDS             complement(159208..160458)
                     /locus_tag="MRET_2459"
                     /codon_start=1
                     /product="nuclear polyadenylated RNA-binding protein"
                     /protein_id="XP_027485001.1"
                     /db_xref="GeneID:38739225"
                     /translation="MSESLELELGTPQASRIQEGVQNVLVEHDLAMKDDTVMAEYVTV
                     MMANRKGPDMIAEELRELIGGELDASITQKIWKCACDVLSPPKTHAQERARSASPPPP
                     PQPESTEQRTKDRWNDQKPARTKKKRSERNERRENADEKPASVSILGRAGVPDPRAEP
                     FMPMPPPLAAMAAMAAMSGGPSLFSRLDPMMPDNPPPMPGAGLTTMPSSVPRDMAAFP
                     HAPAQSALCRWSLQCTNPMCEYSHPSPANAGRGGDPSALVLRTDACEHGAECTDKECV
                     LSHVSPAVGFIKARGSVPPPSMPTLAGVPCKFQQQCLNPACTYLHYDAMGRIVPPPGQ
                     GNAIPCRFGSACTRPDCVYSHPPKSQVPCRYGSGCTRPGCFYTHPQDAPLRPTSDRLK
                     AFATEDPDCERIVPEEQAAAGVST"
     gene            <160743..>161052
                     /locus_tag="MRET_2460"
                     /db_xref="GeneID:38739226"
     mRNA            join(<160743..160781,160807..160857,160882..>161052)
                     /locus_tag="MRET_2460"
                     /product="U6 snRNA-associated Sm-like protein LSm4"
                     /transcript_id="XM_027629087.1"
                     /db_xref="GeneID:38739226"
     CDS             join(160743..160781,160807..160857,160882..161052)
                     /locus_tag="MRET_2460"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm4"
                     /protein_id="XP_027484886.1"
                     /db_xref="GeneID:38739226"
                     /translation="MNITMRDVYETSANGEKFWKMPEVYIKGSTIKYCRVAHELIDTV
                     REAEEQARKHRQQAANHSHGRGHRDGHHGRARGGQRGHRSRT"
     gene            complement(<161074..>161514)
                     /locus_tag="MRET_2461"
                     /note="MRES_12005"
                     /db_xref="GeneID:38739227"
     mRNA            complement(<161074..>161514)
                     /locus_tag="MRET_2461"
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /transcript_id="XM_027629088.1"
                     /db_xref="GeneID:38739227"
     CDS             complement(161074..161514)
                     /locus_tag="MRET_2461"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="XP_027484885.1"
                     /db_xref="GeneID:38739227"
                     /translation="MQLKAVLLCLAGAAALVSAKQPPKDLLIGVTYRPESCPIKAQDG
                     DEVFMHYTGRLWDGTQFDSSHERGKPLSLTLGAGMVIAGWERGLRDMCIGEKRKLQIP
                     PHLGYGDMSMGDIIPAGSTLVFDVELVDIDGKRVRAIREPRNEL"
     gene            complement(<161576..>163387)
                     /locus_tag="MRET_2462"
                     /note="MRES_12010"
                     /db_xref="GeneID:38739228"
     mRNA            complement(<161576..>163387)
                     /locus_tag="MRET_2462"
                     /product="mediator of RNA polymerase II transcription
                     subunit 17"
                     /transcript_id="XM_027629089.1"
                     /db_xref="GeneID:38739228"
     CDS             complement(161576..163387)
                     /locus_tag="MRET_2462"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 17"
                     /protein_id="XP_027484888.1"
                     /db_xref="GeneID:38739228"
                     /translation="MTDVRLRVGRVRAPDSVLDASGGSGSLSQERTLLDIQADGHRII
                     APTLSFHDHERARRMRLWAERGDFRLIHADDLDDVDRKAPQIDAVEALRAVYQDHAQP
                     PTSEQAEAQASASSARLGTIAESEFVPLRDNLLHQLEVSLFHAEQAQNLLGMLIQNTR
                     SDTSSVLAAQSEYFLDPHALSLSALERAIPEESNAPPRPLSVSEQKLILQEKHASIRN
                     AAQILVHGADEMEQCLESERSRWHGLQKIQRRGWKLTPGRPLVDIERFDTQTVKHDVL
                     QGFGVPIVQGNGSIKEEGARDAWIGYGPSEAPISVLQRTLAYWADAPTPGPHLAFPDR
                     TWRRLQVEFHDHASKQIWKSESTRETRSDDADLDAQLYDAQLDVVDAELFRELTVQSG
                     TLSPVLARTISDHCISLPLSSTLEMRFVLVPYDELSSGEESPWPTLLLHVLRLRMLRG
                     WTVRIRAMWDKRAASIALHPPKVRFALMAPLWELYEYTLFLSRLRAILDQTLSGFDNA
                     RTLWEPYGAIHDVHQWISHLLDLSTSNDDLIPVGGSVWIYYGSVMIAHLSLRAPSHML
                     AHFPHHATSHGTGVRMSVELESLAPFLVSECSALASA"
     gene            <163522..>164745
                     /locus_tag="MRET_2463"
                     /note="MRES_12015"
                     /db_xref="GeneID:38739229"
     mRNA            <163522..>164745
                     /locus_tag="MRET_2463"
                     /product="histidinol-phosphate aminotransferase"
                     /transcript_id="XM_027629090.1"
                     /db_xref="GeneID:38739229"
     CDS             163522..164745
                     /locus_tag="MRET_2463"
                     /codon_start=1
                     /product="histidinol-phosphate aminotransferase"
                     /protein_id="XP_027484887.1"
                     /db_xref="GeneID:38739229"
                     /translation="MILGVNERACALAKAHKPEHFDLERVVRPNILALKPYRCARDDY
                     QDGILLDANENSLGPSAVHAEEHLRLHRYPDPSLYGVREAMTRLRGLPHPAYTFMGVG
                     SDEAIDLIQRCFARPGQDKILVCPPTYGMYQVSACVNDIGIVQVPLTMPGDPRGAFQL
                     DVPKIQATLAADPAIKLVFLCSPGNPTGTLLPLDDVRAVLDTPAYQGMVVVDEAYIDF
                     ALEQQAMKKEHGPLSAVSLVHEYANVIVSQTLSKAFGLAGVRLGLAFAQPPIIQVLMN
                     TKAPYNVSTLAAHAASEALAPEGMERMRSNVRTLIENRQALIEALSTVPGMGQVLGTN
                     DANFVLVQVLDAPNGSPDSQRAEAVYKAMAEQHGLVVRNRSSELGCAGCLRITVGTAD
                     ENKQCLQLLRHLLAM"
     gene            complement(<164756..>167083)
                     /locus_tag="MRET_2464"
                     /note="MRES_12020"
                     /db_xref="GeneID:38739230"
     mRNA            complement(join(<164756..166945,166970..>167083))
                     /locus_tag="MRET_2464"
                     /product="pre-mRNA-splicing factor CDC5/CEF1"
                     /transcript_id="XM_027629091.1"
                     /db_xref="GeneID:38739230"
     CDS             complement(join(164756..166945,166970..167083))
                     /locus_tag="MRET_2464"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CDC5/CEF1"
                     /protein_id="XP_027484890.1"
                     /db_xref="GeneID:38739230"
                     /translation="MESRDAHFATSSVARLVDRGDSRQCGMVRVVKGGVWKNTEDEIL
                     KAAVSKYGMNQWARISSLLVRKTPKQCKARWYEWLDPSIKKIEWSREEDEKLLHMAKL
                     MPTQWRTIAPIVGRTATQCLERYQQLLDDADAHESGLGLAGPGVEAAPSADQVLKLRP
                     GEIDPDPESRPAKPDPVDMDEDEKEMLSEARARLANTEGKKAKRKARERALDEARRLS
                     TLQKRRELRAAGIVGKGRDKAKGIDYNAEIPFEKQPLPGFYDTSAEAAKTYEEPMRRT
                     LLQMEPGPQPTDEEAKRKRDKAMNKPSRHEEALRRMQEADKVSKRRKLMLPHAQVSEA
                     DMEQIIKLGHAGEEARALVEHGESATEGLLGTYTPIERPAPDATPARAPVADALVREA
                     RELHARTVTQTPLLGDENVPMPSTARPSEPASTPAATPYRDALGLNDGSATPRDAKMQ
                     ARIAKRQLAARLAALPAPKNDFDIVVDEPPVPEPIVHDDVEEDAAVRDARLAQEAAEE
                     RERAWARRTQVVQRALPRPVDVNPHQLEVLLASLRASDDEAQRLVDHEVVQLMAQDAR
                     VFPLPGSRNVGGQTSALWPVPDTYLAQARALVEAETLHATEPSEPVDMPEAWAPDGTR
                     VFRDTLSREAYIQGAQQRLEVLRTKMNDAATQALKSEKLLSKLLGGYQARSRRLGGQV
                     TEAAAKHADMSVRISALERLASSEPAAGQERLERIAADVARLSAIERMAQGEHKELQE
                     QRAAAQEAWDEIQTELDMRRAEAALLA"
     gene            <167133..>167717
                     /locus_tag="MRET_2465"
                     /note="MRES_12025"
                     /db_xref="GeneID:38739231"
     mRNA            <167133..>167717
                     /locus_tag="MRET_2465"
                     /product="vacuolar protein sorting-associated protein"
                     /transcript_id="XM_027629092.1"
                     /db_xref="GeneID:38739231"
     CDS             167133..167717
                     /locus_tag="MRET_2465"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein"
                     /protein_id="XP_027484889.1"
                     /db_xref="GeneID:38739231"
                     /translation="MSSLGETRRVCRIQLPSLARFVKTSGHSFGIYVAGAVFAAGWWL
                     FFDACIRSGSRHPPVAPPAPGQPIEPPVHDVRILFDDWVPGICATIGLAIVNLVDKRH
                     LVDDGSALGTWRDDPVMWRTRTWLFVGFAFLAGGLAGSLALLIIKYMMNPHAVGYVEY
                     GVASVLQNLAIMACAIVLWFSQRTESDYEYSLTL"
     gene            complement(<167724..>168480)
                     /locus_tag="MRET_2466"
                     /note="MRES_12030"
                     /db_xref="GeneID:38739232"
     mRNA            complement(join(<167724..167773,167799..>168480))
                     /locus_tag="MRET_2466"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629093.1"
                     /db_xref="GeneID:38739232"
     CDS             complement(join(167724..167773,167799..168480))
                     /locus_tag="MRET_2466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484892.1"
                     /db_xref="GeneID:38739232"
                     /translation="MPTTQAPEAPPRVRMSTATARRRIMWNAGGLFLFWSLRWAPQAG
                     LEDVYFAVLDRLMQVRGVPFGTDELIDSTLLWLKYALSIVFVGNLVEALAIYVNTPTQ
                     PQSASASSAPIPGTPVGEALARKVSHGKATIPPKAFQTSPVTPVPGASTFRRSASPIS
                     RTSPSQAMRTSPFRASGIGLGRPTSGPFQASRSLSPSSPFAPRSASRASPSGVQRSWS
                     PASMRSTELDDANEVERALQGLGKV"
     gene            <168607..>169074
                     /locus_tag="MRET_2467"
                     /note="MRES_12035"
                     /db_xref="GeneID:38739233"
     mRNA            <168607..>169074
                     /locus_tag="MRET_2467"
                     /product="calcium sensor Efh"
                     /transcript_id="XM_027629094.1"
                     /db_xref="GeneID:38739233"
     CDS             168607..169074
                     /locus_tag="MRET_2467"
                     /codon_start=1
                     /product="calcium sensor Efh"
                     /protein_id="XP_027484891.1"
                     /db_xref="GeneID:38739233"
                     /translation="MSEASPLSNLTPVQIKQLQRVFYALDKNADGRVSQEDVAAALRS
                     LGVPQAEEEARGCYENVPDSTYELMSFLAMMSGVLHPFADMQKLREAFESFDEKDEGY
                     IPTDTAREILDYNDDMTDTWLVPPFVDRSRTRFDYRKFLSTLGMCEWKELVAP"
     gene            complement(<169141..>170429)
                     /locus_tag="MRET_2468"
                     /note="MRES_12040"
                     /db_xref="GeneID:38739234"
     mRNA            complement(join(<169141..170303,170327..>170429))
                     /locus_tag="MRET_2468"
                     /product="nicotinate phosphoribosyltransferase"
                     /transcript_id="XM_027629095.1"
                     /db_xref="GeneID:38739234"
     CDS             complement(join(169141..170303,170327..170429))
                     /locus_tag="MRET_2468"
                     /codon_start=1
                     /product="nicotinate phosphoribosyltransferase"
                     /protein_id="XP_027484894.1"
                     /db_xref="GeneID:38739234"
                     /translation="MTIPVRLPSLLDTDLYKFTMQQAVLHHFPDTQVTYHFTNRAGDM
                     LFTRECADQIQLAINHLGTLRLTPDELEWLRTSCAYLREPYLSFLREFALRPAEQVQL
                     CYTPVNDTHGTLGIDIRGAWKDVILYEVPVMAIISETYFAMCDTDWRLDGQREQAYRK
                     GRDLLEHGIVLSEFGTRRRRSLATHEAVMDGLVQAHKDVQAAHLPKAGRLLGTSNVHL
                     AKKYGLVPSGTIAHEWTMGIATLMGYEHSNLHALLLWDKVYQPPAFTPTQPSEDLTIA
                     LTDTFSTKVFWEDITSNPLGSDILKRWRGLRQDSGDSGAFVQHALDMYRKMGIDPSTK
                     LVIFSDGLNVSRCKELQRMAEECGIRAGFGVGTNLTNDFCRVSDGTPSRALNMVIKLS
                     SVQGKPAIKISDDLTKNTGDPDEVAYVQL"
     gene            complement(<170489..>171155)
                     /locus_tag="MRET_2469"
                     /db_xref="GeneID:38739235"
     mRNA            complement(join(<170489..170580,170605..170707,
                     170733..170847,170872..>171155))
                     /locus_tag="MRET_2469"
                     /product="dynactin 5"
                     /transcript_id="XM_027629096.1"
                     /db_xref="GeneID:38739235"
     CDS             complement(join(170489..170580,170605..170707,
                     170733..170847,170872..171155))
                     /locus_tag="MRET_2469"
                     /codon_start=1
                     /product="dynactin 5"
                     /protein_id="XP_027484893.1"
                     /db_xref="GeneID:38739235"
                     /translation="MPRSAPPPPPPAQPGEYIQTAATGNKISRRSCIYGASKIVLGGK
                     CIVHTGAMIRGDLVRVLRTQGSSSSVVIVTGRYLRLEQGSILHPPAKTYQGVFSYFPM
                     RIGDYVRIGAHSIVEAAQIGSHVDIGERCIIGRFCVIRDGAQILDGAVLAPQTVVPSH
                     CIYGGSPARRVGTLPESFTSSHELDSRTYFHAFRPPR"
     gene            complement(<171201..>174077)
                     /locus_tag="MRET_2470"
                     /note="MRES_12045"
                     /db_xref="GeneID:38739236"
     mRNA            complement(<171201..>174077)
                     /locus_tag="MRET_2470"
                     /product="dynamin-binding protein"
                     /transcript_id="XM_027629097.1"
                     /db_xref="GeneID:38739236"
     CDS             complement(171201..174077)
                     /locus_tag="MRET_2470"
                     /codon_start=1
                     /product="dynamin-binding protein"
                     /protein_id="XP_027484932.1"
                     /db_xref="GeneID:38739236"
                     /translation="MRDAKPHTRKVSQGVASQKRGSSLNASSSPRTEQVPVTVETPPV
                     SHPVLRSWASTYPLRYDADTPLPNPASPAWSGSSRHSPSMRTTASSPHLQAHGVSMNN
                     VAQLSLPTTSVDQGQMSPPRRSQADLKGLGVSMEGGRKLPTSAVPPINTNLRSVTPEI
                     SMPSTPLYVSPPSSQAPRMRALSQGAASVTRRTRPTLEGGEVSKQSSSPNLGLVFRAK
                     NASDLSHSPDFPNPHAIPDPPTSSRTVRQKQHLLNEMAETERSYAGDLCVITNLYIYQ
                     ARLRAGMRSMTNSSLSVLQPSSRASSASSEPEIDPRASPNDMDSRRSPMLLRPQSPMS
                     SGRASPVPLFSAALPFSVTDIQVIFAGVESCTSLALSMSNLLAAAARGECNVSSVFLD
                     KWQQIEQVFSFYCSRHEASIARLSDMVARNPATSAFLRECDDVSRQHTTAWDLPSLLI
                     KPVQRVLKYPLFLRSIMECTEPHDPEYVQLQMALRQMEGVASRINESKKRMDIVGQHG
                     FEHPAAQRSGFRSGPLRRSKTPSNVDTAPLTDDEHRYHDLVAQLHMAEKYIVQFTERC
                     SQWMQNVRRMYLVEIRAMDEWMAVYRCGEVRYAASLERLHRFRELLHWRVLNSAYSQL
                     ETSMHHAVYVKLNALQNLLERPKMVILNRAAKEPDFRRYLHDRARRPKTKLHGGALAF
                     LSMHVQLMSEIPTLLRCIDLVMMRCLYALTCVQMTFFGQMTDLLHEFGAKYMPGIRTP
                     VMVSPITGGHMSDMLPSSADSSMTGTDASLHLTDIPWPQHAHLPLMMQNLSVSQPSPE
                     RVLHTGRNASHSLSPSTTPHMTNPEPLTLPTFPSLDIPVSMTVAETREHRLRRTSAQP
                     AVPLLRPAPVTDVAPAPPIRPLSTSGVPLMMPSGPASAPAIVVQPQQAWDKALQRRSQ
                     FSADESLASHLGDATTFYDARSSIGDLSVQLRSSDTSAHALPRP"
     gene            complement(<174252..>175616)
                     /locus_tag="MRET_2471"
                     /note="MRES_12050"
                     /db_xref="GeneID:38739237"
     mRNA            complement(<174252..>175616)
                     /locus_tag="MRET_2471"
                     /product="glucan 1,3-beta-glucosidase"
                     /transcript_id="XM_027629098.1"
                     /db_xref="GeneID:38739237"
     CDS             complement(174252..175616)
                     /locus_tag="MRET_2471"
                     /codon_start=1
                     /product="glucan 1,3-beta-glucosidase"
                     /protein_id="XP_027484933.1"
                     /db_xref="GeneID:38739237"
                     /translation="MKSTFLSFLGVAMTMATMALATNVRDTRGSISVRHGGSKRSGIS
                     SEDLEQMGDQMAARANLNLRFNYGRDMVRGVGIGGWLVIENFITPSIYEKAGDDRVID
                     EWSFGKYVPEEKAKKILKDHYDNFITEEDFKEIASYGLNHVRVSFPYWGIRTWGDEPY
                     VTLNQYDKLKEAAHWAEKYNLKMIIELHTVPGGANPYDHGGHKDHFNWLNEQKYEDRW
                     LEILDELVSEFSQSKYPAVSGISMVNEPNGDVNQVYGRYKKGYNTVRNSESDSDLIIL
                     LGDVFLNPAENDYWHSRFQPPKYQNVMTDTHVYRMFDPNSIKLSPEDRIQSYCNMKSG
                     FAEANKHLWALVGEWSPAVNDCAPGLNGRFEGARYDGSFGDSNYIGSCKGKTGNAKHF
                     SESYKRLLKKSWEAQVDTYEAGSGWIMWTWRTEHHNADDWSYRQGVRHGWIPKDPTQR
                     DFKC"
     gene            <175965..>178478
                     /locus_tag="MRET_2472"
                     /note="MRES_12055"
                     /db_xref="GeneID:38739238"
     mRNA            <175965..>178478
                     /locus_tag="MRET_2472"
                     /product="Sad1 UNC domain protein"
                     /transcript_id="XM_027629099.1"
                     /db_xref="GeneID:38739238"
     CDS             175965..178478
                     /locus_tag="MRET_2472"
                     /codon_start=1
                     /product="Sad1 UNC domain protein"
                     /protein_id="XP_027484930.1"
                     /db_xref="GeneID:38739238"
                     /translation="MQWVRKPWHWPLSVSVVATLLHLLGSLESVSGATNQHDVKITAA
                     SLRANAKGTPRHSMGYAFTCYSPTSPEQAPSTSDVAQIFDSSVAFLTDPRRMLLSNDL
                     LLCEVPLTDEWGQTHTHIYAMLGSVMVPHERLTALRDEHVLPRASHRVQEVDIAKAES
                     SHLDNARSDDPLLSFDEWKEQHLERKRKSRKNEKVRERAAQQSTTSSQRSFEQAATPA
                     SSTSSGAGIPRATSSESTIATGGLVNDTTVKQASKTPAAPPESGGPPHIYAVEDATSA
                     LAELKHRWNYASLDCAAMMHQANPLAKFAHAILSEKKDKYMLSPCPQSATHPGDRESR
                     PAQQFVVIELCQQIRVDTIVLANLEFFSSMFKVFTVRVARSLHAPPDEWHTLGMFHAR
                     NARGFQVFQVSDAPLSYFRFLRIDFLEHYGTEYYCPVSLLRVYGRNEREDADDDILND
                     IDDDDTTEDEDATPSTEPILELTSTHALVDDRVVERACVREPFPGVWRSVCERVEPVV
                     LPTPPALIQTPSTALPPTSHTCQVTQTLSEARDVRVPAPFVMELAPRTCALPSPPTPD
                     VSRRHATATNSSVEAKKQTSDSKAKPKPNQKPAGDTKAGGSESIYRTITKRLSALESN
                     TSLSMQYLQLSSQKMREKLMVLEQMQETRLAEFFAAMNASHGRAWEDKIERQNIALQR
                     VLQAFESQRLQYENEQALLLARVEHLTSSVRSQKRWGTVQLLLSLMLLMILAFTRGTT
                     NVATVAGVTEYPPYFVPDPPSSTATPDACDHWEESHDVLARREPVTLTPRPVSSIKYA
                     RRRYATPSPRVRRTRRPLGRLDTQSHESAPERTDKENAP"
     gene            complement(<178492..>179373)
                     /locus_tag="MRET_2473"
                     /db_xref="GeneID:38739239"
     mRNA            complement(<178492..>179373)
                     /locus_tag="MRET_2473"
                     /product="vacuole protein"
                     /transcript_id="XM_027629100.1"
                     /db_xref="GeneID:38739239"
     CDS             complement(178492..179373)
                     /locus_tag="MRET_2473"
                     /codon_start=1
                     /product="vacuole protein"
                     /protein_id="XP_027484931.1"
                     /db_xref="GeneID:38739239"
                     /translation="MPTTAAREGLAPWAYSALTHMFLSKNDMYGLGKSFALTTLSEVG
                     DKTFLVSAILAMRHSPVAVFWGCWVAMIIMSTLSSFMGAILPFLLTRRTAHWISALLF
                     VGFGCMALYQGFTMEGDEINREWKETQEEIQEDEEEHEMQDWRSPSSAPDSGPYPPPP
                     VTESRSPTEEAGVYLYVRDGLRNLCGLLFTPAFSQALTLSFLGEWGDRSQITTMILAS
                     THRMSIVAIGTSLAHMVCILMAVTAGAFFASRIEVRHLTIAGAIIFLLFGVHAAYDAM
                     YHPDPIPSMPREGHLQM"
     gene            complement(<179468..>182026)
                     /locus_tag="MRET_2474"
                     /note="MRES_12060"
                     /db_xref="GeneID:38739240"
     mRNA            complement(<179468..>182026)
                     /locus_tag="MRET_2474"
                     /product="potassium transport protein"
                     /transcript_id="XM_027629101.1"
                     /db_xref="GeneID:38739240"
     CDS             complement(179468..182026)
                     /locus_tag="MRET_2474"
                     /codon_start=1
                     /product="potassium transport protein"
                     /protein_id="XP_027484935.1"
                     /db_xref="GeneID:38739240"
                     /translation="MSRASVHRGIKRFATRMARWSDMYLNYFRVHMMYFIVMIMFWSA
                     IMYASNPKDHYIPYIDCLFMCASAMTVTGLVSVPVSDLTLWQQIILFCLMCCGNLIMV
                     STTTVLVRRHWFRAKFRRELGRSFTLRKRVEDVHAREQQELQDDIKRIRRFFHFPTTS
                     HPDPANATSRKPTQKPKLHAGMIQRVQGPAVQVNPTGQHTTMVSNPEPESILQEHRSS
                     ADASVRIADQPPSSQNKTKLRRLSFGDAPLRRPSDLWHTNLNLKPTHTVAPTMGRHDS
                     MTHAIPLTHARTWQVGADSAPDTELDEPEPESTDFTKLPGQALHRTMTKKRDTGLGGF
                     PSVFDFALSLVEMTSLRHRTRMPAARTMTMSRPLTDNDKDTTTKFAPYLTFDALVTGN
                     SHFRNLTSAQRRELGGVEYRALSLLSWLIPIYWFVCVAIVIVLTAPYLASDPAAQYRV
                     VLADQPKPPRNSTWFWIFQTVSSMTNTGMSLCDSSLSNPLRQSYMMLVPQMILIIIGN
                     TGFPIMLRFVIWFMSRCVSKQSRTYETLSFLLDHPRRCYLYLFPSHNTWFLLFVLFIL
                     TVSDWFLLMICDLATRHAFPSNGTWIFSSLFQSVSTRSSGFQTFDILSLTASERLLEV
                     VMMYIAAFPLMMTMRSTNVYEDRSLFVEEPSEQTDESESQAVWGRFIGTHIRNQLAYD
                     LWWVMLALWIVLLCEKNKVESEEYKTMSVFGVIFELISAYGTVGMSFGATKISASLVG
                     DMSVLSKLVIVAVMIRGRHRNLPSAVDRAVMLPHYLEHHDEVQDQTITSRPSMSLPPE
                     DALPRSSSRASHEPTIRRRTMSRTHTRFADDPVVDHSSLSFQPPPRVESPSSML"
     gene            complement(<182195..>182854)
                     /locus_tag="MRET_2475"
                     /note="MRES_12065"
                     /db_xref="GeneID:38739241"
     mRNA            complement(<182195..>182854)
                     /locus_tag="MRET_2475"
                     /product="PITH domain protein"
                     /transcript_id="XM_027629102.1"
                     /db_xref="GeneID:38739241"
     CDS             complement(182195..182854)
                     /locus_tag="MRET_2475"
                     /codon_start=1
                     /product="PITH domain protein"
                     /protein_id="XP_027484936.1"
                     /db_xref="GeneID:38739241"
                     /translation="MAAGCGHEHHHGHDDADHVKAGEGQQDILFLDVDREQVTALNEK
                     QTGSAAHIIRPYDQRMSDSPLLESDVDDELMVYVPFTGSVRLRSLLLRSGPGHATPRA
                     IHLYKNTEALDFGDAANETPKPLQKLTSIPESSDVVEIPLLAARFPDVQSLTLYIPGC
                     LGTERGVADAHTSISYLGFRGESRLLQRSGPASIVYEAAPRASDHTRVDGTAAGARPS
                     S"
     gene            complement(<182884..>185790)
                     /locus_tag="MRET_2476"
                     /note="MRES_12070"
                     /db_xref="GeneID:38739242"
     mRNA            complement(<182884..>185790)
                     /locus_tag="MRET_2476"
                     /product="SWI/SNF-related matrix-associated
                     actin-dependent regulator of chromatin subfamily B member
                     1"
                     /transcript_id="XM_027629103.1"
                     /db_xref="GeneID:38739242"
     CDS             complement(182884..185790)
                     /locus_tag="MRET_2476"
                     /codon_start=1
                     /product="SWI/SNF-related matrix-associated
                     actin-dependent regulator of chromatin subfamily B member
                     1"
                     /protein_id="XP_027484934.1"
                     /db_xref="GeneID:38739242"
                     /translation="MTNDVGRLPTTGGLTRVMLPTPHAAQGSSAWNERDAPSRQSPAS
                     NDVGVPSVAPTAYTTPTPPWMPPRPPAAVESGTINPAWMSQASTSHTFSHADTKPTVR
                     RTTSQPGPSRPVGRPPLLGKASGARRGRPPRQPRPPASEAAPVAPSFAAPVPGVVTRP
                     PPAPSAAWTPSLSVPKQQAVLVRAMQASKAQNDAHFTPFHALLQLGYVFMRCAQMPVT
                     PTASLGEGVVLRLDEASSLGVLPPQLATLASAARANVPPVAKAPAWPELPTFAPGQPF
                     VLGGAPPSQSAVGMPITPSNTHVRKLKDWKPMAAKDEDDLRATMEKDAAYDQLRRRQD
                     QAMEQELQARMKHLMRAQRPIPWWQRRVTESSPRTEPLQILYPAQKQRQHELRPKLQW
                     SERLAAMPETLVPIRLDIEHDPYKLRDTFMWNAVEDEASLDLFAASICEDLGVPSQVF
                     MELIKTAVQTQVNEFATTMALRMSSTSEHDDTRGRLTESDADAWRRLRSQEPDAVSTP
                     TDTQACDAEDELRVLIKIDIIVGATHLVDQFEWDIATADSLAAERFAEAFTADLGLAG
                     EFKTAIAHSIREQVAAYLRWLAIVGYPHQSLDGVEDDIRPSFLPAIPPSQAARQRDMV
                     DAFTPKLVQLNAVEVMHLEREHERDMRRKRRQTKGRRGAHNVDIEPQRTIRSVPLYGF
                     QGAVPEAERPMHARRAAAAAAAHLSSAAQHDASPGPDELPAPAKRIRHDWYEMFFLYP
                     RGREAPVHRAQPRLGQVPPAPAAPHRAPTEAPILRHVRPEDLERQQPIMHHGEWHCSN
                     CGVPGSLMPARRKGPLGEKSLCGPCGKYFHRHRRVPSVTYSRDPAHHRQRRDAFEHEA
                     LLAEDGEYDAKLGDAQAGAPAGASPPAWLVHAVHACRAKYPMDRFHLHLHARSPAPSD
                     DDVWRIKCTDCPGKVYKPGPSESLTNFEIHLKNRSHRAAVARRLEEAHALDAPT"
     gene            complement(<185866..>186939)
                     /locus_tag="MRET_2477"
                     /note="MRES_12075"
                     /db_xref="GeneID:38739243"
     mRNA            complement(<185866..>186939)
                     /locus_tag="MRET_2477"
                     /product="small subunit ribosomal protein S2"
                     /transcript_id="XM_027629104.1"
                     /db_xref="GeneID:38739243"
     CDS             complement(185866..186939)
                     /locus_tag="MRET_2477"
                     /codon_start=1
                     /product="small subunit ribosomal protein S2"
                     /protein_id="XP_027485146.1"
                     /db_xref="GeneID:38739243"
                     /translation="MASTARLSRAAWRAPRLARMFSSAQEMNAGFLIPEEPIDVPQAD
                     AEAVQVSREQTQAQLAAQDPEGAHDALERRIRRMRRAMMMDMAGLASTQTRDTSFRPF
                     KVRTQPLEAHQLTLSHLLAATAQMGHAKQHVKRSFEPLLYGYRHGMAVIDVERATLPA
                     LRRAAQVVRGITENDGVVLIVGTRPDLRPSIRSAVERLGANGFHVSTERWLPGVLTNA
                     SKLLASATQYSVQSQRTQGNLKDESVPNMTQLSTLGYRPDLVIVLNPTENEHAIREAT
                     QCHVPTMAIIDTNVDPRSVTYAIPANDDSPRVAELVMGVLSKAGEDGLRRRRAALEAW
                     DKHQRRLQKRRQEPAPLPSDTPS"
     gene            <187148..>189147
                     /locus_tag="MRET_2478"
                     /note="MRES_12080"
                     /db_xref="GeneID:38739244"
     mRNA            join(<187148..187664,187805..>189147)
                     /locus_tag="MRET_2478"
                     /product="heat shock 70kDa protein 1/2/6/8"
                     /transcript_id="XM_027629105.1"
                     /db_xref="GeneID:38739244"
     CDS             join(187148..187664,187805..189147)
                     /locus_tag="MRET_2478"
                     /codon_start=1
                     /product="heat shock 70kDa protein 1/2/6/8"
                     /protein_id="XP_027484937.1"
                     /db_xref="GeneID:38739244"
                     /translation="MSAEVPSTNDSNVYEGAIGIDLGTTYSCVGWWTNERVEIIANDQ
                     GNRTTPSYVAFTENERLIGDAAKNQAAMNPRQTVFDAKRLIGRRFDDPDVKKDMQSWP
                     FTVVDKDGSPVIEVEYLGEKKQFAPQEISSMVLLKMKEVAEAKIGKEVKKAVVTVPAY
                     FNDSQRLATKDAGAIAGLDVLRIINEPTAAAIAYGLDSKSSQEKNVLIFDLGGGTFDV
                     SLLNITGGVFAVKATAGDTHLGGEDFDNTLLEHFKKDFERKNKVDMSNDARALRRLRS
                     ACERAKRTLSSVTQTSVEVDSLFQGIDFQANITRARFEEINAAAFKGTLEPVAKVLKD
                     SKIPADKVDDIVLVGGSTRIPKIQSLVSEFFGGRQLNKSINPDEAVAYGAAVQGAVLT
                     NQTSDKTADLLLLDVAPLSLGVAMQGDMFGVVVPRNTPIPTNKTRVFTTVEDNQTQVT
                     FPVYEGERTQCKDNRLLGEFELTGIPPMPRGQAELVCTFEVDANGLLKVSAMDKASGR
                     KANITITNSVGRLSSTEIEQMIKDSETFKNADKEFQAKHDSRNDLEAYVHSVESTVSN
                     PAATFKRAAKIQIEQELAKAMELLEVEDASADDYRRASLRLKRSVQKGLSGGR"
     gene            complement(<189183..>192908)
                     /locus_tag="MRET_2479"
                     /note="MRES_12085"
                     /db_xref="GeneID:38739245"
     mRNA            complement(<189183..>192908)
                     /locus_tag="MRET_2479"
                     /product="ATP-binding cassette, subfamily B (MDR/TAP),
                     member 1"
                     /transcript_id="XM_027629106.1"
                     /db_xref="GeneID:38739245"
     CDS             complement(189183..192908)
                     /locus_tag="MRET_2479"
                     /codon_start=1
                     /product="ATP-binding cassette, subfamily B (MDR/TAP),
                     member 1"
                     /protein_id="XP_027484928.1"
                     /db_xref="GeneID:38739245"
                     /translation="MRCSTVPAPLDVDDCTEKVSIPSSGLCTPGWHVPGPTHAEVKRS
                     VSPVSLSSEKEAEAAWRMQVPPLRRSLRRLYAPLRWTELGLMVPGIVLALACGAIPIS
                     MSYVLGRAFRALGEYDSSRVDASAVLLDTMRDDCVGLVGLAGAALLLRALDTYVWLVI
                     GERGARAWRSSIIAAIVRKDVSWFDLGMSLESDTGAAGLLTMYASETDDVRLAMGIHV
                     GGMARHFATMLLSTVFSLTRQWKLTLVIYATLPLVVIITAVGDAMAAPLEARTRQQTR
                     ELSTLVEKCLSAIQLIKAYTWERAQMDALTACAAVYRRWHSRWTLVLGVRLGLGAAVS
                     LLTFLQGFGYGMVLVRHGQADAADVLSTFLACLVAMSQLQTILQRLAALERGVGAASR
                     LERLRLSCVTTSRIAPAPQPLPTVQGRLSLQRVSLSYPARPDVRVLRDVSMKLEGTTY
                     LVGPSGSGKSSIAAVVARLYDPVEGRVLIDGVDIRACAAYRAHVVCVRQEPLILERSL
                     RENLAPHPVAPERLEAVCAAMQLTSVVRALPHGLDTMLGTRGVSLSGGQQQRVALARA
                     LMLDAPVLVLDEATSALDHATALSIHAAIKAWRQDQTTIIITHDLSLVAPDEYVHVMS
                     DGRVVEHGPMRSLSYAPISYETRPPSYVARAPPAALLDEKAEAIDDAPVQPLSLPHAL
                     GWMWRTLPSRVWFCAALLLCVVSGITVPAFSLCLTQVLVAVAQHAPLAGGLLGATAGL
                     AVADGLCKGARLVVMDMLATHWMQRVRLYAMRMLLAQDCTFYDKEAPSTLTAHIVKEA
                     DDARLLVSEMVGQGAVLLAMGVGALVWSIVRGWHLTLCACALLLVGVVAQGVHGAWLA
                     RREGAAMHARTTAAERVYDYVRQQRAVRAMGLDALLETEALGAAERAYVAGLRTATAV
                     ACGAGLGDAIMYTAEAVLYALGAVLLTLGTYDVRRVLDVLSPLVFTLAYAASAASVMP
                     VAGQCLPALGRVRRLAMLREEAASDWHGTETPELAWGHVSLEHVSFSYGAAPLLTDVS
                     LHVTPGEKIALVGRSGSGKTTLLALLQRLYEPQQGSVYMDHHRLAAMDSAHLRSSLAV
                     VAQHPTLFPATVADNIAAGRPIAHDALVLAAQQACAHAFIEALPAQYATRLGTSTSLS
                     GGQAQRIEWARAFARRACLWLLDEPTSALDHATRDQILSHLRATDSTAVVVTHDVHVM
                     RQCDRVVVLEAGRIVAAGPWRTLQTHAALQRVLQPGG"
     gene            complement(<193072..>194322)
                     /locus_tag="MRET_2480"
                     /note="MRES_12090"
                     /db_xref="GeneID:38739246"
     mRNA            complement(<193072..>194322)
                     /locus_tag="MRET_2480"
                     /product="cyclin"
                     /transcript_id="XM_027629107.1"
                     /db_xref="GeneID:38739246"
     CDS             complement(193072..194322)
                     /locus_tag="MRET_2480"
                     /codon_start=1
                     /product="cyclin"
                     /protein_id="XP_027484821.1"
                     /db_xref="GeneID:38739246"
                     /translation="MASYISPGATASAASPAPATPQLESQDMRIPKSVSDHAMLEDRY
                     YGHRQISEAIERMIMALFSCTQDSMAAAVESPSSQTRHAPRLSYFVAYALYRTRLPMA
                     VVYFALLLLKRLKTQYPVARGSSGHRLFISSFMLACKMLCDDAYNNKSWVIVSQSLFS
                     LHEVNQMERELFMYLDLDLRVSSEELSAFALELERYGAPSVTLDDLKRTRLSVPVAST
                     SSTPTRSPAGKSSSSPAARRRTHRRCLSLRPDYWTYSSSGMPMSRHHRSESHEWSASS
                     MQRWSRSLARSSMPSQRSAPAVQNVTPAPSMAAIATQPAYYPAAAMAGMYGPSPAVSW
                     SSFYSTTNASNLSITTPHSLGSSLRPTPSTSMSELSLHSPISGGPMYSTMPMTMPSYH
                     DWDHPAKVPAYEVNESFRMARDVL"
     gene            <196538..>204286
                     /locus_tag="MRET_2481"
                     /note="MRES_12095"
                     /db_xref="GeneID:38739247"
     mRNA            <196538..>204286
                     /locus_tag="MRET_2481"
                     /product="translational activator GCN1"
                     /transcript_id="XM_027629108.1"
                     /db_xref="GeneID:38739247"
     CDS             196538..204286
                     /locus_tag="MRET_2481"
                     /codon_start=1
                     /product="translational activator GCN1"
                     /protein_id="XP_027484820.1"
                     /db_xref="GeneID:38739247"
                     /translation="MRTRDIKQWLRAADPAEAESPYDSDDEMAPDHEEPARPSIMEEA
                     ESDWDAFISCTASLLRETKSKRRHKFVNETIPMVAKDPETTSSERVALYKLLLEASFW
                     HTDLNTRFYLVQAGYVLLEADTASAPAKPCSSMLVDEAVHALEAETERLTRPDLCHTE
                     TRVQLETLYAWLHYVLTVAIRGDHVALKTDKAFIELVRMRARVYGTHMALRFPWIQLF
                     HCIMTKHRAWEEDLSSLSLMLHVALNIQAPDAWGAFLMQERILSNAHFTKEPHKQAAH
                     ELIESVKAPVLQYYTTHVICSKTPVPRAVRDAMAHRWLYFFEEYVTQADLDEHVLPSL
                     QKMLLRSPETAFLDFGFLCSRVNVDKAGMLSRFQNAILSSLASSNLSTREAVLTIRDT
                     NSRYLHPRRLLWHDDLVFFIEALCKSIKPGDVRSEEQRLAQYFLMKRILASPKNSPAL
                     LTCMAPIIQKETQPTSVKASIDAIFKHVEYLLNQDEEVPPVFVKALLSKTHSPKAPIR
                     AAALCGIYPALRLLSPRSTTRASQNESRVRLFKELMPSLGTSIQSAQTGALTSLEAAL
                     EGCVAVALIWGPLGPGHPLHAEAASLAPLDALLAAGSKPSFLLNEKVAHKMGEHDLVH
                     WHANALSFVLARQPIQKLHDKDVHAHVLALLRGYVHHSAYVGKEFYSPKLVSSAQDQV
                     KFILEHIRSHDTYLALDLARQVLGSENDVAPKLVQKLLMAVRTEDRVPDMIVLAHAPQ
                     LLGLSDTFFVPLCLVMDAEFDSLDPPEVVTQHVDHMLRLIYDAHADPAWRASAEAALS
                     TVALIAPEVVLPRVCGDIVRHLSVQSLEAWSAQDVAIWRAPGDKPYVDVLASHKSQQP
                     LDKGRTTSMDQWDAEVRASIAAKKAASAPKTLSQQDQAAVDAQLAREREIRDSIERER
                     THVLLALRRVRTVLRVPVPDTATHMFRLTMAVWTCLKSERARSLGVTEEAVPTLQALS
                     QACEARAKVVCGFIYSAMLRDVDAALVPLDYALESGEEIELRILYQLRFLVDAAPLEL
                     GSCGFVVPWLVQLVDQSRLGGDEAQDDRVVERLQLAVDTFAAHAVYGADTAFPRAETV
                     RALLVVLRRMPMLVHDSVAALRAFGEMISHTHEGQYALIMQLLEACLSEERRERDGAL
                     QCLVPLDLTELEFSPALWLAMHSDLAPLASQIWMENALDVPSTYVSSLVPLLRHAHAY
                     VRTSAARAVGAACALHPDTLGALLEALRMLYHAENYSLAPEYDQFGMVIESTLGREDP
                     WHVRVAVARAIEASAPSFRAADVVPFFVFALQPGTALSDRHEAVRHAMLEASSAVIDA
                     RGDDVLSELLSQLEASLESEHDAVTEAAVVLLGRAARYLPADSAHVRRVVERLLSALR
                     TPSELVQEAVASCLPALVRASAAAKDVPSIVDRLFVDLLHGDKYATRRGAAYGLAGVV
                     KGRGVSAIRELRILARLSEAAHDTSTTTTRQGALFAYELLASTLHVLLEPYVDGILAD
                     LLLCFGDTHADVREATQDAARVLMRSLSGQCLKLILPSLLDGLDEKQWRTKKGAVELL
                     GAMAFCAPRQLSAALPTIIPRLSEVLTDSHRQVSAAANQSLKQFGEVIHNPEIHALVP
                     SILKALVDPNAKTALALKGLLRTKFVHYIDAPSLALIAPIIERGLRERTVLLQKQAAQ
                     IVGHLASLTDARDYVPYLAKLTPLVRVVLVSPVPDARGVAAKALGTLVERLGEVHFVD
                     LVPSLLQVLRTDATGVDRHGAAQGLAEVLAGLGMERMERLLPTIIENTQDSTPYVREG
                     HLALLIYLPATFGARFLPHLQRIVPPIVASMADDIESVREASLRAGRMLITNYTQRSV
                     DLLLPQLEPRLFDTRHRVRLSALQLTADMLFRVSGISGKAEVENEADDETDEAAVAAS
                     SVQRTLVHALGAERRARILASIFILRQDPSMPVRQTAAHTWKALVHNTPRTAREVLPV
                     MLDILLSSSLASDDAEQREMAGRTLGELVRKLGEKILSETVPILSERATHAPKASVRA
                     GVCRAVTDVLSNATKTQLEDHEDALIGVVRHALGDAAPDVRAAAAHALDAMQAHLGTH
                     AIDATIPTLLEALDDERAPTALAALTEVVRTQPDIVFPVVVPTLAHVPVSASHAAALV
                     ALLPVAGAALPPQISVILSSLAASCDDETQVRYDVADALFEAITGVDALHQCVLQLLG
                     WLSARSPTRQALACHLFVHFSQRVTVPWTDYEVDFVRKLVSLYEHTEERVFAAARSAL
                     DACLHAIPKEHWGDLVVPLRRAIESTGAPSTPLAGLCQHRGASPFVPVLLHGLLQGTA
                     EQREQGALGLADLVEKTTPDALKPFITAMVGPLIRLCGDRHAPPVKMAILTSLHTMVQ
                     RVPLLVRPFYPQLQRSFQKALSDPASATVRSQAAHALGRLMGLQTRVEGVVNELVSTL
                     HRALAEPDDTADAAATALACLLTHVPHDKLSDGARASIAACLHDAFHADEEPREALKK
                     ALADVLAALVRFDAHAAEPLLSAQVLLPAPVDVHLAALCLRACMEQAPDALYAIARPP
                     SLVSQLTAAWLSEAPSVARAARETREMLRRSRPWNTDDTVLSAL"
     gene            complement(<204292..>205371)
                     /locus_tag="MRET_2482"
                     /db_xref="GeneID:38739248"
     mRNA            complement(<204292..>205371)
                     /locus_tag="MRET_2482"
                     /product="guanine nucleotide-binding protein G(i) subunit
                     alpha"
                     /transcript_id="XM_027629109.1"
                     /db_xref="GeneID:38739248"
     CDS             complement(204292..205371)
                     /locus_tag="MRET_2482"
                     /codon_start=1
                     /product="guanine nucleotide-binding protein G(i) subunit
                     alpha"
                     /protein_id="XP_027484819.1"
                     /db_xref="GeneID:38739248"
                     /translation="MGLCRSAPISNEEDWDPRQRSAEIDKHISEVSRHEFREYKLLLL
                     GSGESGKTTIVKQMKIIHQNGYSKQELYMFRLTVIKNLIDSVRAIALALRLLGMEPER
                     LESREAADVLTQYEVPADANAFLPPEIGELIQTLWTDPIIPRLLERRSEFYMMDNAGY
                     FLDAAPRIAMDSYIPTQEDVLHARSKTVGISETRFEMGRGLAIHLVDVGGQRSERNKW
                     IHCFDAVTSVIFCVALSEYDQVLLEDSHQNRMAESLVLFESIINSRWFQRSSIILFLN
                     KIDIFKQKLARRPLSDYFPEYTGGDDVNKAAKYILWRFMQVNHSKLCIYPHITQATDT
                     TNIRLVFAAVKETILQNSLRETGFL"
     gene            complement(<205592..>207073)
                     /locus_tag="MRET_2483"
                     /note="MRES_12100"
                     /db_xref="GeneID:38739249"
     mRNA            complement(<205592..>207073)
                     /locus_tag="MRET_2483"
                     /product="L-lactate dehydrogenase (cytochrome)"
                     /transcript_id="XM_027629110.1"
                     /db_xref="GeneID:38739249"
     CDS             complement(205592..207073)
                     /locus_tag="MRET_2483"
                     /codon_start=1
                     /product="L-lactate dehydrogenase (cytochrome)"
                     /protein_id="XP_027484818.1"
                     /db_xref="GeneID:38739249"
                     /translation="MGKITYEEVSKHNHAKDCWVILYGKVYDLTGFLPEHPGGSGVIV
                     KQAGKDATKLFDTIHPKGTIENSLSPEHCKGDFDSSTLPVEYKKAEEEEERKRKERLA
                     MLPPMSKCLNLGDLELVASKVLSPEAWAYYSSAADDLETYHENRAVFRRIWLRPRILR
                     NVRYVDPSTKILGIPSALPFYITATALGRMGHPDGELNLTRAAAKTGLIQMIPTLSSV
                     SFDEIIDARNQEGGPAQFFQLYVSTDRNVVANMLRRAEETNVKAIFVTVDAPQLGRRE
                     QDMRMHFVDEGSNVQGGHVEKRDEGAARAITSFIDPSFDWDDVLWMKRQTRLPILLKG
                     VQTWEDAVQAYEMGLAGVVLSNHGGRQLDFARSGVEVLEEVMRELRKRGSFPNPAFQV
                     MVDGGFRRGTDILKALAMGATAVGIGRPFLYAYSAYGVDGVIHAINLLRDELEMNMRL
                     IGARSIEELVPSMVDLSALHNHTGAVFPKQDQSVLDFMEKSRL"
     gene            <207242..>210238
                     /locus_tag="MRET_2484"
                     /note="MRES_12105"
                     /db_xref="GeneID:38739250"
     mRNA            <207242..>210238
                     /locus_tag="MRET_2484"
                     /product="intracellular protein transport protein USO1"
                     /transcript_id="XM_027629111.1"
                     /db_xref="GeneID:38739250"
     CDS             207242..210238
                     /locus_tag="MRET_2484"
                     /codon_start=1
                     /product="intracellular protein transport protein USO1"
                     /protein_id="XP_027484825.1"
                     /db_xref="GeneID:38739250"
                     /translation="MLHGLDLLRQQYKKYAEQRGLHSSPSATITVLSERLCDPTQSRD
                     NQRATVLSLKSLVRDHADQVSEHALVPLLNWIKTKSNEGDEETLRAAVECCLALCQAT
                     SDDPRTRARASQNMSRLLEEKDALLTLLTLLSLSHGFYTRFGALQLLVLLVEHRRLEV
                     QDYVLTAPGGSSSVLQCLEAAPSSSTEIIRNEALLLLPQLVRDNADIQKIVAFEGAFE
                     RLLDIIVQEGRIEGGVVVQDALDGLEALLLQNVSNQNYFRETLSIPLLGPLLFYPPPI
                     PPQAPEHTRQEYATHQRAFLLQEWDEQKLTNAQILLRCIRHLIDGQGDGHKSNRLAMC
                     KTGLAEALVQLSMASLAPPALKSDTLHVIAALLRGSREAQEMMSAMVITPVSVRPSTE
                     PGDGLPPMELTWEAPQPAMLRLISMAVRGPIPSADTDMALRVRCAALQAVEALIEQNM
                     DIRMTLWHAFVAAPTPDQTDNDSAGLLLNSVAHLPSTTLVASNKVPQHRFDPYQHLFA
                     ATILGYILYGSETSKEFARRVCLNEEGRCVADARVPSATDDDEPATLVHVVVGNLAMA
                     LREHADAVRRERAAQISDSNTSADWNKVIVGYLTLLCVWLWQSPPSIADLLSESANLQ
                     VLIQPAAQTTGVDPLIQGLSAFVLGTAYEFNALQATSDQSDEVLTRQAMHPILHSRIG
                     ADQFSTRIQAVKNDARFAACAPETLEMVGKPQAHTAGRTVSPDIWFTWPFVEFWKDNY
                     VRIQKSILQAPEASAASESEPSAELLDARQRLMTMEAQLARAQADAGMVETLRENLAQ
                     AQEAASMAQKEHAASQAAREAAQRELEAAHQVQNTLENEWKAEKDALRAEHALALDAH
                     EKTKAQLASVSADMETLRAQLANNSGTDEAQVAVSQRALEAARQETATEQAHVAHLQL
                     TIQQHDEHVHALQSRVASLEQEVREARAASASSQDDERIKALQMENEDLLVLLDELMQ
                     KRKSDKAKMRNAGWDVSDDEDDEDIA"
     gene            complement(<210235..>211506)
                     /locus_tag="MRET_2485"
                     /note="MRES_12110"
                     /db_xref="GeneID:38739251"
     mRNA            complement(<210235..>211506)
                     /locus_tag="MRET_2485"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629112.1"
                     /db_xref="GeneID:38739251"
     CDS             complement(210235..211506)
                     /locus_tag="MRET_2485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484824.1"
                     /db_xref="GeneID:38739251"
                     /translation="MAPSCGVYTCTLSTPRTCEYDAVASLRRMYAYSLWLGEAHTPLE
                     RVCTALDQLDAKHVTGVMSMLRTPMQLREKYQQIRHLDWSALDSTETYKNEDTCAMHA
                     ALLYGPMKEALLSEHRDAAIRAFITAIHCREIELHLIIVCWLLRHVGPLRKAEAPLPG
                     VDHHRDMPWEASYDSLRPLFDALADHVCLLQLSTTLDRSPVSAWQFGSATRQAPIHDE
                     RDEAQWFCEDVIGAFYAKSLPAEYGTLRVKCFGPGLFSSPVRRRRWHRTASAPQPPSP
                     TVTHESHPILNAERTEKRRPWPHSVRSPNQVHMSRRLVRTQSHMIQPPPPPPARTSKR
                     KRPASRWVSSPVKTLVTETPRHPRPPSHSVVEPMADSDVDDAPLSPSASRLPHEVGNR
                     TASPDSDSDVELFIPAAQKAARKRDPWSLLA"
     gene            <211560..>213644
                     /locus_tag="MRET_2486"
                     /note="MRES_12115"
                     /db_xref="GeneID:38739252"
     mRNA            <211560..>213644
                     /locus_tag="MRET_2486"
                     /product="WD repeat protein 59"
                     /transcript_id="XM_027629113.1"
                     /db_xref="GeneID:38739252"
     CDS             211560..213644
                     /locus_tag="MRET_2486"
                     /codon_start=1
                     /product="WD repeat protein 59"
                     /protein_id="XP_027484823.1"
                     /db_xref="GeneID:38739252"
                     /translation="MAQRTGPGSKTLASAIIDVHQPMGSMSLSPSNQEVVLGSKSGLY
                     VLDLDHLYTPPRFFAYSTPWEVADIQWNPHASRSNWVASTSNQKLVIWNLDRPVRQET
                     SKPPSSHLRSAMLEEVERSYMTPMLQDIQFNAWQGAARSFTGTQSESSQAVERLLDAH
                     SRAITDLNWSPMHPDVIASCSVDTWIRVWDLRMSRHITRPAQSLCSWNASMTQVKWNR
                     RTPHRIATSCDNKILIWDDRFGAVPLGTIEAHHSKVYGIDWSPAARAGSDRLMTCSLD
                     GTIKFWDLDSPSSRKALVQHSRITEPEFTIETPQPVWRARHLPSGHGALSISQRGDTG
                     ACMWSYGKKEPQRRFEGHTDHIKEFVVRSSSDSWQLITWSHDQTLRIWPMCSSEPATE
                     QAAAPPPPPTDLPDALCGSQSDSTDYDQDTMRSMTLSRSSLKKRAARTRRIRRAECAS
                     ELGDVEASHLPTSVHSLPNVCGPPDLDAVHWMAHVRVGGDVHDTDDDHLNTRKPRDMD
                     PSVLPQEILRVNAQYPNILESIDIAHRRCTIAVSGPWHQAGSGALAYLRVMFTFPLAY
                     PLEPPALEMERSTSIPFATRAALYRALVDLIEERAAEHALCLESCVAYLKHGQEASDD
                     HLASTRQTAPVLDSDAHAGDSFMHSYHVVSDAVMQLALRSTDLMDSSLGDLDIVRLMS
                     TNVFGQMRENTN"
     gene            complement(<213649..>215154)
                     /locus_tag="MRET_2487"
                     /note="MRES_12120"
                     /db_xref="GeneID:38739253"
     mRNA            complement(<213649..>215154)
                     /locus_tag="MRET_2487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629114.1"
                     /db_xref="GeneID:38739253"
     CDS             complement(213649..215154)
                     /locus_tag="MRET_2487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484822.1"
                     /db_xref="GeneID:38739253"
                     /translation="MDATTDAGAWAEHMLRVLQTGVHARLVGCSVVPPLPRPKNTLEA
                     MSHLSVLLSECEDLLAFEQVEKSLQQENFVVKEDGNDAFNYALAVQAVHALQQELHAV
                     REDDADPDATIVASPDTHPWHKRVKDTIQELEDRHADEMAQIYAQHSDELEALRSEHA
                     ADEAQQARDHHDQMETVRKTAHDELESVRAGLHAEYTASIEEMQRSWSTACASLSRTI
                     DDLHSQVASHAQSMAPVSKRIYALHEVIDALAAERMAVQVEVRTWRAKHAAVTNDMAS
                     LHEQLASRQSELAIRSSRLNETERQLHEVQREMECTAQAQADMDEMQARVAAAEAEVT
                     GLRDQLRALEPLCAERTQLASEVHELQKLVSMYKDSVTHAQLEHERTQQQLEKAEAQR
                     FALEQVLAERETELKSQRKSRAPRASSHDQATRIAELECELNAKAAEIEDGDTRLLTV
                     MKENKRLLSQLKALKSDSKRALQDVTNAKTVTAIPSSPTKQRMGIMRSHVA"
     gene            complement(<215249..>217405)
                     /locus_tag="MRET_2488"
                     /note="MRES_12125"
                     /db_xref="GeneID:38739254"
     mRNA            complement(<215249..>217405)
                     /locus_tag="MRET_2488"
                     /product="tyrosine-protein phosphatase 2/3"
                     /transcript_id="XM_027629115.1"
                     /db_xref="GeneID:38739254"
     CDS             complement(215249..217405)
                     /locus_tag="MRET_2488"
                     /codon_start=1
                     /product="tyrosine-protein phosphatase 2/3"
                     /protein_id="XP_027484817.1"
                     /db_xref="GeneID:38739254"
                     /translation="MCADPHKRTSEAQLAKSGQDSRVDSSGTAANASTTEPGYFELRH
                     HVPETPATPGVSNHAWTSLLPSSELPAPKTPSSHSAPVFPLPATLMAPRITPRLLSPT
                     SSQVAARTADMKQYLSLDPEMLLKLLQKRPILQHPIPEHVLILDIRPTTAFVRAHLRD
                     STNVCAPTTLLRRSEFTIERLEEQILDEGPEKETFQQWRSYTDAPSRISWIVALDTDS
                     TKPTSIGRSSAGGGGPSLLGLLRKFDVAGYKGTLCWVRGGFHAIMALAESAEFIEHDT
                     TKSPSYIPHAMRHRGLTLDAFRRASTVDAGLGGTDRLQAANPFFDNIRQNMELSCGIT
                     DIVPLDLDLDEAQLERMPRFVRDLAKMESSVRARHLAELFFSIEKSEQQRLQNIMQRH
                     SQESSSVHSKVPRAPVHVSQSALFPLLPSTHELSEDAFPLSITAALERGHDHRYRNFW
                     PFEHSRVKFEQPTKDAEYINASYVNPLRAWGDHHVYIATQAPMPSTFGAFWRVVWEHK
                     SPAIIMVARERESGRLQCDDYWSLTRIGPFQMRIMSERAISQAELDSREDRADSISPH
                     QAPVVLRRTIELLHSQHPDEPAHIVRQYQFLAWPDHSVPDKPDSLLGLMRLVHADTAS
                     NRDAPTIVHCSAGIGRTGTHILVDAVSTFLHRVRHLVDKEATSPQVEYWESPNDLIYE
                     ALMVMREQRMSTVETVRQYVFAYKAVIASLLPPSVP"
     gene            <217664..>218725
                     /locus_tag="MRET_2489"
                     /note="MRES_12130"
                     /db_xref="GeneID:38739255"
     mRNA            <217664..>218725
                     /locus_tag="MRET_2489"
                     /product="lectin, mannose-binding 2"
                     /transcript_id="XM_027629116.1"
                     /db_xref="GeneID:38739255"
     CDS             217664..218725
                     /locus_tag="MRET_2489"
                     /codon_start=1
                     /product="lectin, mannose-binding 2"
                     /protein_id="XP_027484816.1"
                     /db_xref="GeneID:38739255"
                     /translation="MVFRGSCIALAYLLAVSCAEAARSSASNPELRADAIMPIRTHSL
                     FAPYVDSTLQNNYWDYGGDAIIDTNRYVMLTQDRRNETGWLWSRLPIEANDFEITSEF
                     VMKGKSTTTGGDGFAMWLTTTRAQPGPVFGSMNRWNGLGIIFDTFPNQPHRGFFPRIS
                     VVENDGTKTYNTDSDGEKQDLAQCAMQLRHTPAETRLRFTYVKDVYMELAIQNQEWNQ
                     WNKCFRIPPVNLPGPPYLGFSASTGEVTDTHSIVSVWTNKIVYNSRTPADLDKEREQA
                     FADDKSSHWWAIHQKKEARRAHEHGLISYMLIRFFISLAWLIKWLVILALVAVGSFVG
                     YEVYKRKVQSAYKNRRMMA"
     gene            complement(<218734..>219314)
                     /locus_tag="MRET_2490"
                     /db_xref="GeneID:38739256"
     mRNA            complement(join(<218734..218780,218815..218846,
                     218872..>219314))
                     /locus_tag="MRET_2490"
                     /product="oligoribonuclease"
                     /transcript_id="XM_027629117.1"
                     /db_xref="GeneID:38739256"
     CDS             complement(join(218734..218780,218815..218846,
                     218872..219314))
                     /locus_tag="MRET_2490"
                     /codon_start=1
                     /product="oligoribonuclease"
                     /protein_id="XP_027484855.1"
                     /db_xref="GeneID:38739256"
                     /translation="MTGLDPKRDRLLEIACIVTDGQLQPVDEGVSYVIRTEPHILEGM
                     DEWCTRTHSQTGLYAACLDEACSHPHLDVRTAILAYVLDRVPTARKACLAGSSVHADK
                     MFLVNEMPELMAHLHYRIVDVSTIKELVRRWYGASYQRPDTGILHRALDDIRGSIQEL
                     EHYRKSVFRRDAP"
     gene            complement(<219394..>221580)
                     /locus_tag="MRET_2491"
                     /note="MRES_12135"
                     /db_xref="GeneID:38739257"
     mRNA            complement(<219394..>221580)
                     /locus_tag="MRET_2491"
                     /product="calpain-7"
                     /transcript_id="XM_027629118.1"
                     /db_xref="GeneID:38739257"
     CDS             complement(219394..221580)
                     /locus_tag="MRET_2491"
                     /codon_start=1
                     /product="calpain-7"
                     /protein_id="XP_027484856.1"
                     /db_xref="GeneID:38739257"
                     /translation="MDPAAEAVAKAAAAEAVDFELQKKYNAAFFQYTRAIRLFLEIAR
                     DDSSVTDARRMAERCLERAKRLRDAGRVPRGLGTKAWPPFWSENEHVPVEPSPELSPQ
                     QIEQGAQLQSLRDFPVYRADVRLVGGDMQQGCVSDCSFITALEIVAEHNARWGTNLAC
                     NMLYPQQDCVPCASPDGTYKVKLYMHGSLRCIHINDMLPVSRDGLWLCTKPRHKTQLW
                     PALLEKAYLVAKRSGYAFRGSHSSMDLYMLTGWIPEYIPMDEPTFQSEKTWMRLYEAW
                     RRGDCMVALSTNTAVDYADLEPLHCYGILALSAQGQDRIVTIINPWKTSDVSHRVTMS
                     WADVRHAFDALLVNWNPSLYPEMQSIQGVWEAQSDSAVRLDDVRTAQTEQYHLLLQHV
                     VDRPILLHLERDASICDEFDEQEYTALHVYPTLSSQRRADTETGGMMGVYMNTAHTLC
                     TVEPQDCTQYTIAVSRHGTQIPMPYTLTAYATCPMEFRALPQAWSHRAVFHGTWRAPL
                     HAAAPDEWYQPQYRLTVQEDTFLPRIQLMLTTVLTVPVRLTLCRSGERIHCLSTASKT
                     SCTGNFSRGMVVSDIQALQPGTYTLLLSASQPHMHVGQSYALTVESSVPVHVEGLPAI
                     GAGMYHRKAHSPASCVWKLDVPRRMPLMVCAAQDATGPLCVSITTHSHELATAHAVDD
                     THYVFLSTTPLEAGTYLLRVHGMAPVHVDMFGAQPVTLAPHSSELL"
     gene            <222049..>223149
                     /locus_tag="MRET_2492"
                     /note="MRES_12140"
                     /db_xref="GeneID:38739258"
     mRNA            <222049..>223149
                     /locus_tag="MRET_2492"
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /transcript_id="XM_027629119.1"
                     /db_xref="GeneID:38739258"
     CDS             222049..223149
                     /locus_tag="MRET_2492"
                     /codon_start=1
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="XP_027484857.1"
                     /db_xref="GeneID:38739258"
                     /translation="MMQAIKSAWRAALPVRGRALHTSHLKMSAWSVPPVQASAHQAMP
                     PVFRSDIQQMKREGTPLVCITAYDQPTALAVRGAGADMCLVGDSLANVALGYQATRSL
                     SLDAMIHHAKTVRASIHAPELQYDARCPRAPLVIVDMPFGSYGVSLEESVRHVMHVVK
                     ETQASAIKMEGSMELVPLIERLTTLGIDVMGHIGLQPQRFGDASGFRVQGATAHSALN
                     ILRTAQALEAAGCFSIVLECIPSKLGEAISQRLDIPTIGIGAGPHTHGQVLVCTDIMG
                     DLTSPSHVSAVLAGLEKGASAPAHMPETPWPPMPKFVRTFAASHVGSQRIVALRRFVE
                     AVRSRTFPDNTSEAYRIKTHEWETFLQLVDSS"
     gene            <223154..>225007
                     /locus_tag="MRET_2493"
                     /note="MRES_12145"
                     /db_xref="GeneID:38739259"
     mRNA            <223154..>225007
                     /locus_tag="MRET_2493"
                     /product="ABC transporter"
                     /transcript_id="XM_027629120.1"
                     /db_xref="GeneID:38739259"
     CDS             223154..225007
                     /locus_tag="MRET_2493"
                     /codon_start=1
                     /product="ABC transporter"
                     /protein_id="XP_027485222.1"
                     /db_xref="GeneID:38739259"
                     /translation="MWRITPGETASFMWRPWLGCVVRRSIHSSSHKPLLTLTKAHIPG
                     LKGTIHDYEAKVPSLTWSILDGAQNECWAIIGPTSSNAGAHVRQKIIDVVLGRYSPRA
                     ANTSNVPPSCTHMLDTLPREAVAYVPFETPSGNFGGEFIDYTTRYGSIRDEDRVTLFE
                     SLMESRDVYTGLVAQLHMRPDPLRLHQDNTGLLKWNSSYEREECIRKAHAICKHIQNT
                     APALGLTSLLSRPLISLSNGQMRRARILRALIQGAEWAVLEDPFKGLDQPSRNELTRL
                     FGELHANRTPRLCLVLREQDPVPSFITHILRVDEHGFVTQLGHKSEVPTEKDAEYPPG
                     SYDIVRRNAERGVYTGQKSSEPIVAMRHVSIEYESNPILQDVSLELQPGARMVLVGDN
                     GSGKTTLLSLLLGDHPRSFALSEQQLSLWGAARDAPRNAHVLLQRRIGHMSPELFHAF
                     PRKSLEAGGLTVADAIASGFDGIFTYRRRNEKQLERVAQLLRLFSPELVFDSKSMSSE
                     SVGDLPFASLTHGSQAVVLFLRALVHRPSLLILDEAFQGMSGHQVAKTRAFIDGTQSW
                     VYEGMSDTERAVDRAWREKVVIVAVSHYESEWPLTCGCLLRLSQGRVIESF"
     gene            complement(<225004..>228105)
                     /locus_tag="MRET_2494"
                     /note="MRES_12150"
                     /db_xref="GeneID:38739260"
     mRNA            complement(<225004..>228105)
                     /locus_tag="MRET_2494"
                     /product="mannosyl-oligosaccharide alpha-1,3-glucosidase"
                     /transcript_id="XM_027629121.1"
                     /db_xref="GeneID:38739260"
     CDS             complement(225004..228105)
                     /locus_tag="MRET_2494"
                     /codon_start=1
                     /product="mannosyl-oligosaccharide alpha-1,3-glucosidase"
                     /protein_id="XP_027484852.1"
                     /db_xref="GeneID:38739260"
                     /translation="MHRPSLLVWVLTLACAAALVAGVNPGVFKGCSDSSVCRRFRKVA
                     ENVESFTRPAYVSPYSLGSVPELEGAALHVPVMSALHDVSFELKTTFFADGNARLQMD
                     ERAPTYKDWRHYPEASVWGIAEMPALAHNVQIKQQSKAKTVVSWGDSTHEMHIEHAPL
                     RISFVRDGIVQMILNERALLHMEHFRAKPEDGLPKTDEQRAAHLQSRVHDLKQRHPTA
                     SASTIDMWSKFETPDEGEWEESWGGVADSKPKGPEGVALDISFPGYDTLYGLPEHASP
                     LSLRSTRAPPKGEEEEAGRFTDPYRLMNTDVFEYEYDSPMALYGSAPIVHALSQSSAV
                     SVLWMNAAETWVDIHKTKHRPGPKPASAALRAASRDDAKALSGGSSTRSSHVHFMSES
                     GILDLFVFMGPTLHRNMERYMSLVGRTALPQYFAIGYHQCRWNYWSDGDVKDVSSRFD
                     EADIPMDVIWLDIEYSAEHMYGMWDKKAFIDPSGMVQALDERGRKLVIILDPHLKKTD
                     KYYLYKEARDLDLLVKNPDNKTNYEGECWSGQASWIDFFQPRTWSWWIDQFSLIKHKL
                     EANARNVFVWNDMSEPAIFSGPEVSSPKDVLHYPGWENRDIHNINGLILHNLTATGLT
                     RRELGTRDTSGKVGVERRPFVLSRAWWLGSQRFGAIWTGDNLGTWEHFANSVPMILQN
                     GMGGMSFCGADIGGFFGNPDTELLVRWYQAGIFEPFFRAHAHIDTKRREPYLYDGAVG
                     DALRGLLRLRYKMLPVWYTAFWHSSLNGQPVLKPQALVFPHDTAGFDVDDQYLLGDSG
                     LLIKPPTTKGASHVDIYLADDEDYYHHFTGHVYRAPGGRVAVPAPLSDHVPMLQRGGS
                     VVPMRERVRRSAELQRLDPFTLYIAPSHDELAAEGHLYMDDGQTFAYRDDQAFLARKF
                     TLTRDGPGHLRLASTSLTGRDIHTSASSTALQVPGNAYEQETSSVRVERIIVYGLPEV
                     YRIIARDAHGHETSLAFTYTSGTSRSPTASDASARLASRLEIRDPRVLIGQDWSILME
                     IAP"
     gene            <228226..>229971
                     /locus_tag="MRET_2495"
                     /note="MRES_12155"
                     /db_xref="GeneID:38739261"
     mRNA            <228226..>229971
                     /locus_tag="MRET_2495"
                     /product="translation initiation factor 2A"
                     /transcript_id="XM_027629122.1"
                     /db_xref="GeneID:38739261"
     CDS             228226..229971
                     /locus_tag="MRET_2495"
                     /codon_start=1
                     /product="translation initiation factor 2A"
                     /protein_id="XP_027484998.1"
                     /db_xref="GeneID:38739261"
                     /translation="MDASTLQWAYRAQKSLGVKAGVPNFPDVHGFDGAHVGSRMLVYS
                     ASGSRLAVALEQGTQIYDVRDTGVELRLEVPVSRAIELALSPRGTYLQTWERPVKGED
                     GSYSRNLRIWHAETGELLGAFERRQIDGWQFQFTDREDYCVRSTASELQVFHPNNIQA
                     GAVGRLSAEHVQTFSVGPGPQPAISAFFPEKKGMPAFVRIYSLASILQGPPGAVAPAA
                     QKSFFKADKVTMKWNRAGSSLLLMTATDHDQTGKSYYGETNLYMLSTRGDFDCRVGLD
                     KEGPIHDFEWSPNSREFIVLYGYMPAKAVVFSYRVNVIAELGTQPRNLISYNPQGRLF
                     VLAGFGNLAGTVDIWDRERLADGKLFTLDASNSSVLEWSPDGQFLLTGTLSPRLRVDN
                     GVRIWHCTGKLVHVDMVDEMYSAAWRPQRFTEPPAFPKTLPPAPAPSTAAAAVLAKQQ
                     TAAKPMGAYRPPSARHAGASTGDFLRRDEQSSGPSVPSVPGASSKRGGRKVPGAPQKN
                     PAPPPKPTMGAADVGACSSDGGVVEKKLRNLTKKLKAIEQLKERRDKGEALEQTQLQK
                     IETEQEIRNELAALQ"
     gene            complement(<229983..>231623)
                     /locus_tag="MRET_2496"
                     /note="MRES_12160"
                     /db_xref="GeneID:38739262"
     mRNA            complement(<229983..>231623)
                     /locus_tag="MRET_2496"
                     /product="type I protein arginine methyltransferase"
                     /transcript_id="XM_027629123.1"
                     /db_xref="GeneID:38739262"
     CDS             complement(229983..231623)
                     /locus_tag="MRET_2496"
                     /codon_start=1
                     /product="type I protein arginine methyltransferase"
                     /protein_id="XP_027484853.1"
                     /db_xref="GeneID:38739262"
                     /translation="MSTEWDRPDEDDNFDGWNEASVPARALFPEWDARFDSAEKALEH
                     ARAQGCDLHALVSRLHLDAFQVIRLINYIRRPTTQPRPTPESIMSLTGHEAFLTDDNE
                     MKPVPGYEEDGLLQYDLAEESERMDTATELRILREAYDELRHRYAERFGITAAVAQDA
                     AAEQVSAPAPQPIDRHYFESYAGHDIHQTMIGDSVRTLSYAKFLLSPANAHLIRGKTV
                     MDVGCGSGILSLFCARAGAKQVLAIDASDVVERARANIEDNGFGHVVRVFRGRIEALD
                     EVLAPWASKVDLIVSEWMGYFLLYESMLPSVLYARDRYLREGGILAPSHSRMVLAAAT
                     DRGVLCERSRFWSDVYGFRMPSMTQGLSSEAATEDVEADAIVSDVATICDLPLEQIPV
                     AQPSFTAPFSLHVKEACKVHGFVSWFDTWFAPTPHVAFDDLPPVTVSPVQPSDVHGLD
                     LHGNEVVEASEATHGETVSFTTSPFGKPTHWKQTIFLLKTPIEVQAGTCIEGEIRVYA
                     SSANERELDVDLHYSADERPSTGEKRVATRTTQVYSVR"
     gene            complement(<231703..>232590)
                     /locus_tag="MRET_2497"
                     /note="MRES_12165"
                     /db_xref="GeneID:38739263"
     mRNA            complement(<231703..>232590)
                     /locus_tag="MRET_2497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629124.1"
                     /db_xref="GeneID:38739263"
     CDS             complement(231703..232590)
                     /locus_tag="MRET_2497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484854.1"
                     /db_xref="GeneID:38739263"
                     /translation="MAPHAEAEAKAQLQALEAQFYQQFDVPMMHAKKEAHDTEEESVG
                     EDDLDDDTMDDASNDDDLDDDLDLMEHAQAPKQRIPETVVFSDPSKRARDTQSKSSRK
                     QFMSSKIQDLHKEPVEAVSDAPKADSDDDDDQRANDRQLSELLSTTLFAPGTADATKK
                     RKLTTTTNETLARVMELSSADTIGSRAPGTGWAEKKLKAQELGKVPARIRAGLRRAAG
                     ERRDRDIETQKELGLWNPKMQKQSRMTRGSETERGSRAMQPKQRQRGIGSGVGKFRGG
                     ALHLSEADVRRIRGPHRAT"
     gene            <232663..>233367
                     /locus_tag="MRET_2498"
                     /note="MRES_12170"
                     /db_xref="GeneID:38739264"
     mRNA            <232663..>233367
                     /locus_tag="MRET_2498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629125.1"
                     /db_xref="GeneID:38739264"
     CDS             232663..233367
                     /locus_tag="MRET_2498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484850.1"
                     /db_xref="GeneID:38739264"
                     /translation="MEEHDESVEEVAVDAIVSHKLNVAENRVEYLIQWSENGKTTYTW
                     EPEENAVDADDLIYQYWCEKQGSSHAAALDNVNAARRIAPRSNLAEDQAPPSLPPLSE
                     ARPAARLPPLRSFSQRVKHVSRPTSLKRYNVPCTYKYSPYKIPYGRCEKYSSSSSSGS
                     RSPSSSGLPTLRQTEAGPVGEWDDQQAQVHALQRVNNHIETVVEVQGRTLTCSLHTAY
                     QHCPQAMLAFYQTRVL"
     gene            <233438..>234139
                     /locus_tag="MRET_2499"
                     /note="MRES_12175"
                     /db_xref="GeneID:38739265"
     mRNA            <233438..>234139
                     /locus_tag="MRET_2499"
                     /product="autophagy-related protein 101"
                     /transcript_id="XM_027629126.1"
                     /db_xref="GeneID:38739265"
     CDS             233438..234139
                     /locus_tag="MRET_2499"
                     /codon_start=1
                     /product="autophagy-related protein 101"
                     /protein_id="XP_027484851.1"
                     /db_xref="GeneID:38739265"
                     /translation="MRAASRIPIFTHDIHLSRSDAPQVLQGMLHTICFVRMLGLLQPD
                     TQVIKGVSMPYVNDVATQARIARAACDMFDALDHKRSKQRSTVCVDVVVGWHRLLAPP
                     NDTDTQPTRTASPEPGSMHYAVFESPYSWLASALAGGRTTTHLETRDERSTQRLLPRD
                     ASLDSRASDVFEQWVLSLHIHYDQDDTNLSEALTDYVMAAVSFANEHQDKLPAVTDTA
                     VCPFPFTMNSTVRER"
     gene            complement(<234136..>236961)
                     /locus_tag="MRET_2500"
                     /note="MRES_12180"
                     /db_xref="GeneID:38739266"
     mRNA            complement(<234136..>236961)
                     /locus_tag="MRET_2500"
                     /product="zinc metalloprotease"
                     /transcript_id="XM_027629127.1"
                     /db_xref="GeneID:38739266"
     CDS             complement(234136..236961)
                     /locus_tag="MRET_2500"
                     /codon_start=1
                     /product="zinc metalloprotease"
                     /protein_id="XP_027484950.1"
                     /db_xref="GeneID:38739266"
                     /translation="MADDRKREPLAYRPTKRAVVRELVSLACLACVLATASIYWHYRL
                     PTPLAPTTPLAPKPRGYASDAWFDALLSHQLDGGAASAYELADGEAYDGPLSSYFSEA
                     NAMLTMQHLSEGIGYRVVGTQKHVDAEVWLEDVLRRYEGTHATGGNEYATHVEVFRQQ
                     SDGRHRFEILGHPVWKRYYGMSNLIVRVSDGSEESKAHTLLVNAHIDSTIPSPGAVDD
                     AAGVAIMLEALRALTVRGAPRMKHGLVLLFNNGEESLQDASHLYMTQENITRASVRAV
                     VNLEGCGVSGPPLLFQATDPALIEAYSRVPHPFGTVVASDVFSSGIIMSDTDFRQFQE
                     YGHGLPGLDMAVVGSSYLYHTRRDVPSYVERGVLQHFGENTLSLIESLCLDAASPLAQ
                     IRRRPFQRLLPVYFSIASSYMIVLSPHLFKNIITSLSVLVNFLLSAMNSTEPRTAFVR
                     MAMISTIGIVGNYVAALVAANAVAFVLRCIAPLSWFGHEFYALALFVPPALTAIVGVQ
                     RWIHSLPERTRRPYLEYSSFAGAIIFHTFMALLMNFYLLGSAHVAVLIVLASLVPLIV
                     NDYLVLGLSRISSGLAPDTRLHFSTYPLHLLLPCTIGVEAVVSFLDLLVPLMGRMGTH
                     VPVDHVMGSLVAVLVCIVASVVTPLCHRYGPASMRKTMWVGLGVTCATAALFAAQGLP
                     VFDDRHPRRLLLHHVENVTSGEWHVAHSVLDSASRDRRLDAAIERTLLGDAPNASLSW
                     DHAAQAAPDMDILFPLTHFIDVTRVTLPSTPTRQALSRDTSRWAGVRLSCKDLHYDAA
                     NHTRHVLLRLEHPYLAWSTLSFDADIVEWDFDEPPPTGMQRHHLKDVSRYGERAFEMR
                     LALRTDEWPPLPVPSDSLRQATVPRGRFQVHVSGLDAHGMYPHHKDVSMDRLSMQTLG
                     ALDDMLRRDFPGIDPMLVSIIGGVGVC"
     gene            complement(<236999..>238951)
                     /locus_tag="MRET_2501"
                     /note="MRES_12185"
                     /db_xref="GeneID:38739267"
     mRNA            complement(<236999..>238951)
                     /locus_tag="MRET_2501"
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification enzyme"
                     /transcript_id="XM_027629128.1"
                     /db_xref="GeneID:38739267"
     CDS             complement(236999..238951)
                     /locus_tag="MRET_2501"
                     /codon_start=1
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification enzyme"
                     /protein_id="XP_027484951.1"
                     /db_xref="GeneID:38739267"
                     /translation="MWRRGVHTVVIGGGHAGVEAAAASARTGASTVLLTTSAATIGEM
                     SCNPSIGGIGKGTLTRETDALGGLSGIAADHAAIQFRMLNRSKGAAVHGPRAQMDRYL
                     YKTRIQQMLREIPRLSIREAHAHGLDMDEGPTGRRVTGVRLASGESIPCDQVVLCTGT
                     FLSACILLGKQRRPAGRMLPLPSQGTEPSTESLGASLARAGFQLARLKTGTPPRIAAS
                     SVALGARYPGHQAAQRSEALSVLCGDDEPAAFSFLHRDGPPIDACRQMYCYGTRTTPA
                     THEIVHTEVHGDDYDMTKYAGPRYCPSLEVKVLRFAHKSSHPVWLEPEGFLTTPQGDG
                     HVLYPNGLSCSLAPETQARLVRTIPGLEHAELLRPGYAVEYDHLDPRELLPTLETRRI
                     RGLALAGQINGTTGYEEASAQGLLAGLNAGLRAQRRPELCLSRSEAFVGVMLDDLRLQ
                     GVVEPYRMFTSRSEYRLSLRSDNADVRLTPLLHAVCPEAVSPARLRALHAVQADMDYG
                     MACLQRTKMTSRAWAQHGFQAADDVRTQSALDMMQRPHARIRDLLPFVPELRSMPAST
                     LERLATEAAYMPHLRRQAADIEAFERDEALALPADLAYDQLAGVSDEMKERLSRTRPR
                     TLGEAKRLAGCTPATYAVLWRHATGS"
     gene            <239059..>242199
                     /locus_tag="MRET_2502"
                     /note="MRES_12190"
                     /db_xref="GeneID:38739268"
     mRNA            <239059..>242199
                     /locus_tag="MRET_2502"
                     /product="GTP binding protein"
                     /transcript_id="XM_027629129.1"
                     /db_xref="GeneID:38739268"
     CDS             239059..242199
                     /locus_tag="MRET_2502"
                     /codon_start=1
                     /product="GTP binding protein"
                     /protein_id="XP_027484949.1"
                     /db_xref="GeneID:38739268"
                     /translation="MSSASARDAQASLPRARPALDESFSSGLGLGISVSHEKPQRASQ
                     RPASEVQHGRTPFQRTGPTASRIHRVHGMPSLATVDRIAINDVLEQYKPSSDESAMAD
                     TTHVSTHPGPSRPSAPLRASLETSSPSFLGAPTDARKDASLRASPPPEVPSAPGAHVS
                     APPAEPECRIEPSTSRIHIVGITTHKTAPRAETSRAEHHASMSPPGTNEIFPDGLFTS
                     MPTPHLHDPTQNDKPTSAVPEEPVPPSRPVSWARTLQELSPRADESRHSIENGHDVDA
                     LLAEEPEEDSVDKLLQEDGLGIARSSTMRRIVPKEAARTQSPPPERLSVDLPTLPSWS
                     PITLDGMLDDVPPASPPPYITRDKIRERVERRKTGAQSTSPALDPPARTAETRAPAPQ
                     DARPASAPPTRASEAVPRASSPAKPAARVLPTKEIPSRRETVRRDLNSPLAQFQSDMR
                     DAAHDAPPMSAQAPMAHLSQTLARQATWFDDAGHTDAEHRASSSSSSDAPLQRDAEPA
                     HEHRAASQAPPAAPTEELKDEAAADGPPTAFSFVMERELQRIVRESDQKYKVKERGVF
                     ADTPARRGGLGTHPAWMRLHKPTELTELMEQQPPMPTTVPDAQGSYTDGRLFLAMDAV
                     TLTAPITPSQDTQLYCVLDNGIHRVKTEQVPLTPPNKGATRIDQEFELIESPNFSLVL
                     SVMLDGVATDIPTEWGGLGSDVPRTSVGRFLSKRLGTHHRETMRSSPLSEPYGRVFFA
                     LRDALPHCYARAWALELPIQADSDGRTTLRRSAAQRLQRGRMRLRVLYLPPVPLVLES
                     TLPGNMEEAMQGIESVAWHQTTTSYQGVLTQLGGDCLSWRRRPMRIVGLNLVCYNEVT
                     RRPTTRIDLVQVVSVDECGPAAANAEHSAANDGAFPVPHSFCLSFRDGEKIYLFADTH
                     ESMLDWVRILRNIVAHKLTPPPAWALATVEAAQARTHARGPPSKAPKPPPNPPTAPAS
                     SQAHVAPPPPPSRSLPPTPSSPPPTAATPAPPVGATRRQAASQSPVLPTAPSRPSGQS
                     RLRTVARRWLGRARPT"
     gene            <242227..>243180
                     /locus_tag="MRET_2503"
                     /note="MRES_12195"
                     /db_xref="GeneID:38739269"
     mRNA            <242227..>243180
                     /locus_tag="MRET_2503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629130.1"
                     /db_xref="GeneID:38739269"
     CDS             242227..243180
                     /locus_tag="MRET_2503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485189.1"
                     /db_xref="GeneID:38739269"
                     /translation="MPPPPPASVVLPSDVVRRILVRAATLDASTGVRLLQLNRAWHAV
                     LVPCVYARVELGTAHALAMFRALVQAQPHKARAVRRLWIGPMHARSDLLPILSVPTPT
                     DSPYLVSQRGHVYSDTRLVLRACRRVEDVALSGSLVSADVVHSYGTACQPGIITSINP
                     HSFISAFNAPIFRRVHTLRVCDLNLSLSEVHAIRRMPALRSFTYTSPKDDGDVDQEVY
                     TLRLLVTCEDDDPLEALSRRLHLDDTRLELIIRTAPQRAAQLAARWHEVPGVEMRTRI
                     VPQHLIDAWDALRDLVFRAHDDIDADADPSSALRIMHDEWR"
     gene            complement(<243177..>244013)
                     /locus_tag="MRET_2504"
                     /note="MRES_12200"
                     /db_xref="GeneID:38739270"
     mRNA            complement(<243177..>244013)
                     /locus_tag="MRET_2504"
                     /product="inositol phospholipid synthesis and
                     fat-storage-inducing TM"
                     /transcript_id="XM_027629131.1"
                     /db_xref="GeneID:38739270"
     CDS             complement(243177..244013)
                     /locus_tag="MRET_2504"
                     /codon_start=1
                     /product="inositol phospholipid synthesis and
                     fat-storage-inducing TM"
                     /protein_id="XP_027485192.1"
                     /db_xref="GeneID:38739270"
                     /translation="MFRVHGYHKYLVLALASIMAMGMALSYLYSMNHFNLLLSATRAL
                     DYASFKQMERYTPSRAADRRNWVNVYFVKLSWFWNTLCTVVVVASLSNTVTWKRLSRF
                     AVRWALATCAWFTMSQWFFGASFLERVHVASGAQCLANSVRVSDELCRTRQRLTADSH
                     PQLFDRFEPGFSTAHASIHAGWHGGMDVSGHTFVLTLSILYLAELVVPCLTQRAIASM
                     PRGPLRYLKTFSLYGTLSLMVLWAFMLFTTSIYYHTTQEKVVAFLCALAVWICLPKEP
                     VS"
     gene            complement(<244293..>245102)
                     /locus_tag="MRET_2505"
                     /note="MRES_12205"
                     /db_xref="GeneID:38739271"
     mRNA            complement(<244293..>245102)
                     /locus_tag="MRET_2505"
                     /product="Pin2-interacting protein X1"
                     /transcript_id="XM_027629132.1"
                     /db_xref="GeneID:38739271"
     CDS             complement(244293..245102)
                     /locus_tag="MRET_2505"
                     /codon_start=1
                     /product="Pin2-interacting protein X1"
                     /protein_id="XP_027485122.1"
                     /db_xref="GeneID:38739271"
                     /translation="MGLSEPRRKQRLVGAAAHRNAAWTNDMSLPGQRMMSMMGWAPGE
                     GLGTTNKGLSTNLTVSMKLDNKGIGAHRHEREAREQGRSDAWVGAGGDLGSLFDRLNQ
                     ANEQATPSPPPEPRPSSSRLAHRAKFRRAKQLHGQSAANLNEIFGISASAQASTESQP
                     GKDKQDDKEKEDKAKRKEEKAKRKEDKAKRKEDKAQRKEDKAKRKKDKARSKDPSSKK
                     RKRDEEDESPPLVIRTNEQYVFQYLSNKLLRKKAEVARRKREQGIWWSGAA"
     gene            complement(<245173..>246246)
                     /locus_tag="MRET_2506"
                     /note="MRES_12210"
                     /db_xref="GeneID:38739272"
     mRNA            complement(<245173..>246246)
                     /locus_tag="MRET_2506"
                     /product="farnesyl diphosphate synthase"
                     /transcript_id="XM_027629133.1"
                     /db_xref="GeneID:38739272"
     CDS             complement(245173..246246)
                     /locus_tag="MRET_2506"
                     /codon_start=1
                     /product="farnesyl diphosphate synthase"
                     /protein_id="XP_027485190.1"
                     /db_xref="GeneID:38739272"
                     /translation="MSTVDQKLVKRQRFEGVFSQIVEELLQFLQSQNMPKEAVDWYKR
                     NLEYNTPGGKLNRGLSVVDTVEILLCSDGKRELSEEEYVQAAVLGWCVELLQAYFLVA
                     DDMMDASITRRGHPCWYRVEGVANIAINDAFMLEAAIYHLLKIHFKGKPYYGHLLELF
                     HDVTFQTELGQLIDLITAPEDSVDLSKFSLDKHHLIVVYKTAFYSFYLPVALAMRMCE
                     VDDEKLYQQAQDILIPLGEYFQIQDDYLDCYGAPEVIGKIGTDILDNKCSWNINVALA
                     HATPEQRKVLDENYGRKDAQCEQQVKDVFNAENIDLKAKFADYERQSYDRIHALIQNI
                     PEDSGLKRSVFVTFFDKVYKRSK"
     gene            complement(<246334..>247395)
                     /locus_tag="MRET_2507"
                     /note="MRES_12215"
                     /db_xref="GeneID:38739273"
     mRNA            complement(<246334..>247395)
                     /locus_tag="MRET_2507"
                     /product="omega-amidase"
                     /transcript_id="XM_027629134.1"
                     /db_xref="GeneID:38739273"
     CDS             complement(246334..247395)
                     /locus_tag="MRET_2507"
                     /codon_start=1
                     /product="omega-amidase"
                     /protein_id="XP_027485191.1"
                     /db_xref="GeneID:38739273"
                     /translation="MLHGGRLVQRLAPFRRVFSAMTSTPPTFRLQRTRVALVQLGGIG
                     TDKSANLTRARSAILDAVQQAPQGAVDMVVLPECFNSPYSVDQFAKYAESFSGLYEQV
                     KHMGHTETVSDGAHAWPIDNKDAEHPVTLSSQALEASPTLAMLSDVAKEMGVVLVGGS
                     MPERDDATGRIYNTSCVLDAQGRVLSLHRKLHLFDIDIPGKMTFQESKTLAAGDRITV
                     FDCSLGRFALGICYDLRFPENALIAARLGAGAILYPGAFNTTTGPVAWELLLRGRAID
                     NQVYTIGCSPARPPTGYPAWGHSTVVDPLGQVIVTCDEAETVVYASLDPERISDVRKM
                     VPISTQRRFDVYPNVAAAP"
     gene            <247666..>248010
                     /locus_tag="MRET_2508"
                     /db_xref="GeneID:38739274"
     mRNA            join(<247666..247746,247777..>248010)
                     /locus_tag="MRET_2508"
                     /product="succinate dehydrogenase assembly factor 1"
                     /transcript_id="XM_027629135.1"
                     /db_xref="GeneID:38739274"
     CDS             join(247666..247746,247777..248010)
                     /locus_tag="MRET_2508"
                     /codon_start=1
                     /product="succinate dehydrogenase assembly factor 1"
                     /protein_id="XP_027485211.1"
                     /db_xref="GeneID:38739274"
                     /translation="MKRYSQSQRAVMSLYRRGLRLIRTKPEASRFDFTLYLRHFFRHP
                     HMGGGLSVRDFATIEYMMRRASRMMEDVYENPSTKRIALSPAVRQEMHDLGLSSWRRG
                     RP"
     gene            <248013..>248840
                     /locus_tag="MRET_2509"
                     /note="MRES_12220"
                     /db_xref="GeneID:38739275"
     mRNA            <248013..>248840
                     /locus_tag="MRET_2509"
                     /product="mitochondrial inner membrane protease subunit 2"
                     /transcript_id="XM_027629136.1"
                     /db_xref="GeneID:38739275"
     CDS             248013..248840
                     /locus_tag="MRET_2509"
                     /codon_start=1
                     /product="mitochondrial inner membrane protease subunit 2"
                     /protein_id="XP_027485212.1"
                     /db_xref="GeneID:38739275"
                     /translation="MEVRICREVPNPPRRFAMYLRWARAGLGVHGAFVRMAHTRARDS
                     HARHVASNAPTLSRSFLRIVAWLPVALFVTHHVVTLANVHGTSMSPTFNPVSDEQRAR
                     PGPPPPTDIVLLNKLVSTTRQYKKGDIVTLYSPQEPTKLITKRILALGGDTVHFWVPS
                     GANLTPAPHSAPQDEVHSLAYTEIYHEALRQLATEIHEHESGAWMRITIPPNCAWVEG
                     DASALQSRYDRLHADMKSRDSRSFGPVPLGLIHARVEFIVWPLSRFGKPQSRPSNPR"
     gene            complement(<248827..>250686)
                     /locus_tag="MRET_2510"
                     /note="MRES_12225"
                     /db_xref="GeneID:38739276"
     mRNA            complement(<248827..>250686)
                     /locus_tag="MRET_2510"
                     /product="endopolyphosphatase"
                     /transcript_id="XM_027629137.1"
                     /db_xref="GeneID:38739276"
     CDS             complement(248827..250686)
                     /locus_tag="MRET_2510"
                     /codon_start=1
                     /product="endopolyphosphatase"
                     /protein_id="XP_027484992.1"
                     /db_xref="GeneID:38739276"
                     /translation="MRRAIAACAALTCVMAAQQPFTTQESNVPLLGRFLHITDMHLDR
                     NYREHSAVVSQCHREKPKHRHGGERRSGHWGTQQSDCDSPYALANLTMSWLADAWAVE
                     DHKPFDFVLWTGDTGRHDQDIELPRQVNEITDMNQAAIDLFDTYLPGVPIVPNFGNND
                     IVLHNTMPGGPTDELQWFSRIWKKHIPEDQMQVFLRGGYFAKDLIPNKLGVISLNTLY
                     FYDSNKAVEGCTRRSRWTSRDEVDPGTLQLEWLVERLVDFRRRNMQVHLIGHVPPTSG
                     NYFPRCYDVYTELVLRFQDTILAQHFGHMNFDTFFVQESSLANGGNKPSRDSVPILHK
                     QIEQDLRYDFESLPGNARTEMEYYGVFFEAPSVVPMYRPSVRVWTYNTTLDFRAAVAE
                     SDADLAALLDYVGFDSCDESDRSQECEWVGEDEEVEVLKRQGRRHRRPKRKHRRSHAR
                     LPRYASSLSPSRSNTFLSLLGYSQWVLPLNEVNEAYDHVYETQGLSAASMLRPNYTLE
                     YTTYDAPTLWHPYVDLSIQSSFPPPRHHELPSQHHVPVPKTILDGILQQNRLSSPFQC
                     QKSVCKMAQPLKIFTTYGLPDMTLRPMLDLARRLVLDKKMWKTYVNRMYTSVD"
     gene            complement(<250777..>252615)
                     /locus_tag="MRET_2511"
                     /note="MRES_12230"
                     /db_xref="GeneID:38739277"
     mRNA            complement(<250777..>252615)
                     /locus_tag="MRET_2511"
                     /product="isocitrate lyase"
                     /transcript_id="XM_027629138.1"
                     /db_xref="GeneID:38739277"
     CDS             complement(250777..252615)
                     /locus_tag="MRET_2511"
                     /codon_start=1
                     /product="isocitrate lyase"
                     /protein_id="XP_027484991.1"
                     /db_xref="GeneID:38739277"
                     /translation="MPLPIARSAIRRVSVHSSAFTLRCAGMRMISTPSKKKQDGGHTQ
                     PKAAASSLAHDATTAVRSLVPPPQPLRIVPPTPEEEAHMFESTVASVEQWLASPRFAQ
                     IHRPYTARDIVSKRGSMPVQPPASSLMADKLYALLERNATNRTAISTLGAIDPVQQSQ
                     MARQQDVVYVSGWACSSVLTTCDNEVGPDLADYPYTTVPNQVERLFKAQLHHDRKHWD
                     ERCHMSADQRATTPWVDYLRPIIADADTGHGGLSSVFRLAKLFAEQGAAAIHMEDQLH
                     GGKKCGHQAGKVLVSTGEHINRLVTARFAWDILGSSNILIARTDSESAKLISTNIDVR
                     DHEFIKGAYNLPPGTKSLSETLAEKEAQGVHGAELDNVEREWMDGVMLVTFNEAVANH
                     NASNPSLLEEYDRRVEGGVSNAEARRIASEIFGEKGVPAWDWHAPRTKEGYFHFKGGL
                     SAAIKRTKAFAPYSELLWLETKTPDLVRAQGFAAKIHEDFPGKWLVYNLSPSFNWSAH
                     GFSDNDLRTFISDLGLSGFVLQLISLAGIHSTALITHELSKAFKEDGMLAYVKLIQRK
                     ERESGTDMLTHQRWSGAQYMDRVLQTVSSGTSSTSSMGADSTEHTF"
     gene            <252779..>253732
                     /locus_tag="MRET_2512"
                     /note="MRES_12235"
                     /db_xref="GeneID:38739278"
     mRNA            <252779..>253732
                     /locus_tag="MRET_2512"
                     /product="DNA-directed RNA polymerase III subunit RPC4"
                     /transcript_id="XM_027629139.1"
                     /db_xref="GeneID:38739278"
     CDS             252779..253732
                     /locus_tag="MRET_2512"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC4"
                     /protein_id="XP_027484994.1"
                     /db_xref="GeneID:38739278"
                     /translation="MSDEPPKRSTPAAPGRTTSMVPSRAGSSVITPSSLRASTPQQGG
                     GRMMFRPVMPQRRRTPSAPPAATPAAPPPREEKSAPRRPPQRAHRQMAEMTATGPFAL
                     GSSDRGPERSRASAMMHHSVPRPVAIEARGVDVPTASIDIEHVQDMDPMAPQSMLRAP
                     PSLKREPTPVKMEAETPTADVNTAQALDLSESEDEGDDDAHASQFATSVQGGETDGQL
                     FLFQFPRTFPSFQHDQVVKVEEDATRPEGQIGRLDVYADGRVALRIGDIPFDVTSGSE
                     ASFLQQVVILDAEQQVAQCLGEVHSKLVVTPNLDDFMHHRT"
     gene            complement(<253762..>255380)
                     /locus_tag="MRET_2513"
                     /note="MRES_12240"
                     /db_xref="GeneID:38739279"
     mRNA            complement(join(<253762..255298,255325..>255380))
                     /locus_tag="MRET_2513"
                     /product="hypothetical protein"
                     /transcript_id="XM_027629140.1"
                     /db_xref="GeneID:38739279"
     CDS             complement(join(253762..255298,255325..255380))
                     /locus_tag="MRET_2513"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027484993.1"
                     /db_xref="GeneID:38739279"
                     /translation="MSMSGIPHEELPILEALISIRNQLTALKKDSGDYTNPHDVQLIY
                     NAVIKQITKLNAVREEQQLSNAAQDVVDDTDAADGGGGGGGHGGSSEFALAKNTRVDT
                     MLVDVFYMLSLFFLTIGRGRECPAMFSQIGCMKQLLDHMDESAVYTEADLMPFVSRIQ
                     ELREMIKNDERQNKHPPQLTKLMSHKLEACQRVVNKLQHALSVISVELLPIHQKLVQI
                     RRQLNAASARPKPPKGEVKQLQEELRKIDGKRVDGKFLGPGGSSVPEGQEMLAGLLES
                     CFELSNDILVRNSTVSPTLQPIYDRLLETKHQLEHLEQRHRWSLRETDLWTYHVTLKE
                     IDRMRVDGKFVDSEGRQPEGQLLLLYLLRRSYGLINKLLSSSEPLSEELMPISDKLST
                     ISKCLREVSKYGGTFSLRDMYPYRLALHQISSMRKPVMDKDGQPTQVVGWLAPDGTMP
                     EGQSILQAQYEEVEQTIDELLNREEDEGDEDDEDETLDGSAQSDTIERDTLSDSDRVM
                     SGPIVESQSMHSLASGPSELAS"
     gene            <255568..>256593
                     /locus_tag="MRET_2514"
                     /note="MRES_12245"
                     /db_xref="GeneID:38739280"
     mRNA            <255568..>256593
                     /locus_tag="MRET_2514"
                     /product="growth hormone-inducible transmembrane protein"
                     /transcript_id="XM_027629141.1"
                     /db_xref="GeneID:38739280"
     CDS             255568..256593
                     /locus_tag="MRET_2514"
                     /codon_start=1
                     /product="growth hormone-inducible transmembrane protein"
                     /protein_id="XP_027484996.1"
                     /db_xref="GeneID:38739280"
                     /translation="MFLATRIAQPCMVSRTAAMAARSLSTKSAARSAPLATRSPVMQQ
                     VRLMRHTRFQRPQPRSPAYAETGSEYQSSYGPSSFASQGGWTRALTSVGIVAGTAIGL
                     NLFFNRETRGALSVYESQYLNSTFTYLGTGLTITGLAAYGLHRFGYSARIMMANPWLV
                     LGVGLVASIGGMMGAQALPPNHPAKVPCWLLFNLSQAAVLSPLMFLNPAVLTRAGLYT
                     AGLMGSLCYVGATAKENQYLFLGGPLLAGVTIVALSSLAPLVLPMRFARTLAATEAIC
                     LYGGLAVFGGFVLWDTQKILHRARLATAGLIPADPLRESIGLELDFINIFTRIVQILA
                     LRDQRRR"
     gene            complement(<256618..>256998)
                     /locus_tag="MRET_2515"
                     /note="MRES_12250"
                     /db_xref="GeneID:38739281"
     mRNA            complement(<256618..>256998)
                     /locus_tag="MRET_2515"
                     /product="profilin"
                     /transcript_id="XM_027629142.1"
                     /db_xref="GeneID:38739281"
     CDS             complement(256618..256998)
                     /locus_tag="MRET_2515"
                     /codon_start=1
                     /product="profilin"
                     /protein_id="XP_027484995.1"
                     /db_xref="GeneID:38739281"
                     /translation="MSWQGYVDNNLVGTGKVSSACIVGLKGGVWASSPSLNLSTEEQH
                     AIIQGLADPSHLQANGVYVSGKKYLTLQANPRSIYGKAGGDGLCIVRTNQALLIGVYN
                     SPLLPGDANKVVEGLADYLISVGY"
     gene            <257252..>257998
                     /locus_tag="MRET_2516"
                     /note="MRES_12255"
                     /db_xref="GeneID:38739282"
     mRNA            <257252..>257998
                     /locus_tag="MRET_2516"
                     /product="triosephosphate isomerase (TIM)"
                     /transcript_id="XM_027629143.1"
                     /db_xref="GeneID:38739282"
     CDS             257252..257998
                     /locus_tag="MRET_2516"
                     /codon_start=1
                     /product="triosephosphate isomerase (TIM)"
                     /protein_id="XP_027484907.1"
                     /db_xref="GeneID:38739282"
                     /translation="MSRTFFVGGNWKMNGSVEQYQSLINNLLNAKLDSSVEVVISPPS
                     LYLLPSQKLLEGKNIALGAQNAYFKPSGAFTGEISVAQLKDAGIPWVILGHSERRSIF
                     GESDELVGQKTTAALESGLSVILCVGESLEQREKNESVNVVIHQLETATKDVKDWGKI
                     VIAYEPVWAIGTGKVATAEQAQEVHAAIRQWLAKKADQKVADATRVIYGGSVAAKNCK
                     ELASQPDIDGFLVGGASLKPEFADIVNARL"
     gene            <258054..>258326
                     /locus_tag="MRET_2517"
                     /db_xref="GeneID:38739283"
     mRNA            <258054..>258326
                     /locus_tag="MRET_2517"
                     /product="protein PET117"
                     /transcript_id="XM_027629144.1"
                     /db_xref="GeneID:38739283"
     CDS             258054..258326
                     /locus_tag="MRET_2517"
                     /codon_start=1
                     /product="protein PET117"
                     /protein_id="XP_027484906.1"
                     /db_xref="GeneID:38739283"
                     /translation="MAVWPPPSMSQAAKTTLGASIVATTCIIAGVHYLQVKERETMYK
                     GVQRDDERDREKKQRMVHLQENRERESRYLELQPQSSPSSGSTRLA"
     gene            complement(<258435..>259001)
                     /locus_tag="MRET_2518"
                     /note="MRES_12260"
                     /db_xref="GeneID:38739284"
     mRNA            complement(<258435..>259001)
                     /locus_tag="MRET_2518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629145.1"
                     /db_xref="GeneID:38739284"
     CDS             complement(258435..259001)
                     /locus_tag="MRET_2518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485237.1"
                     /db_xref="GeneID:38739284"
                     /translation="MALFMNKLNAAGLTPEDSMQLPTRAASAEEERVLQAFLNASIMS
                     DDDLASVFAPELIYTAPDGQVVVGKRAVAAKLREHTPIEAHHLLETPTMLPSNTVVLD
                     THTTGGARHLVVMKRRAADGLVSSITEEEGHRKALAPPLAARAMKTSVQSPTDMMMSP
                     CTSKLNLVKRRHLTKAKPTNLFAGMVNQ"
     gene            259267..259853
                     /locus_tag="MRET_nc0004"
                     /db_xref="GeneID:38741160"
     ncRNA           259267..259853
                     /ncRNA_class="RNase_MRP_RNA"
                     /locus_tag="MRET_nc0004"
                     /product="ribonuclease MRP RNA"
                     /transcript_id="XR_003525361.1"
                     /db_xref="GeneID:38741160"
     gene            <259912..>261702
                     /locus_tag="MRET_2519"
                     /note="MRES_12265"
                     /db_xref="GeneID:38739285"
     mRNA            <259912..>261702
                     /locus_tag="MRET_2519"
                     /product="phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase"
                     /transcript_id="XM_027629146.1"
                     /db_xref="GeneID:38739285"
     CDS             259912..261702
                     /locus_tag="MRET_2519"
                     /codon_start=1
                     /product="phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase"
                     /protein_id="XP_027484929.1"
                     /db_xref="GeneID:38739285"
                     /translation="MTQPTAILSVYDKTGLVELAQGLAAKGVRLLGSGGTARMVREAG
                     LEIGDVSDITHAPEMLHGRVKTLHPAVHGGILARTSLESDRADLEANKIAPIDIVVCN
                     LYPFEDTVAKDPAPSIAEAVEEVDIGGVTLIRAAAKNHDRVWVLCDPKDYATFLAHYG
                     EAADSDAAKQSRERFALKGFTHTAHYDTAISQYFREQYASPPREPVQYLTLRYGANPH
                     QKPACAYLPDRELPFKALSGSPGYINLLDSLNAWALVKELSQETQRPAAASFKHVSPA
                     GAAVAVPLSEVEARAYFVADLGPLSDLATAYARARGADRMSSFGDMIALSHTCDVQTA
                     RIISREVSDGVIAPGYEAEALEMLRGKKGGKYCVLQMDPTYEPHSIETRQVYGISLQQ
                     RRNDVRITPDMFKERVSAIKEVPESAVLDMIVATIALKYTQSNSVCYALHGQVIGLGA
                     GQQSRIHCTRLAGSKADNWWLRQHPRVLGLPFKKGTKRPDKSNAIDLYVEGTPLDGEE
                     RAQWESLFETLPAPLTPEERASHAAALKEVVVASDAFFPFPDNVYRAARSGAKYIAAP
                     GGSVMDDACVAAANAQNMVVARTHLRLFHH"
     gene            complement(<261703..>263085)
                     /locus_tag="MRET_2520"
                     /note="MRES_12270"
                     /db_xref="GeneID:38739286"
     mRNA            complement(<261703..>263085)
                     /locus_tag="MRET_2520"
                     /product="vacuolar fusion protein MON1"
                     /transcript_id="XM_027629147.1"
                     /db_xref="GeneID:38739286"
     CDS             complement(261703..263085)
                     /locus_tag="MRET_2520"
                     /codon_start=1
                     /product="vacuolar fusion protein MON1"
                     /protein_id="XP_027485011.1"
                     /db_xref="GeneID:38739286"
                     /translation="MPRWPWGSSGAMAPPASPTLRSSDSAPASLDTSHVSAHGPQPAE
                     TMPPSPMAESPPEDHTDTHAYMVFSVAGKLLYTSYDGEETWAYTQASVMHAMLSLFDE
                     HEALQRISLAHMHITFLQPKPLYVACLSTQATPDAIVQARLERLYAAILSLMSRARLQ
                     RLLARAPNLDLQALIGPMKAYLDCVVHDMHASPALALGTVPVRALDASLRDQLAQACL
                     QMEARPPQPLYVLLYDQEALLALAHPKRHAPYASDLALVNALVRVCGDHDTWAPLCLP
                     ALAPDGFVYVYASRVGRVRVALVCGDPDGYVACRAWRHALATSACMARVPSALSTPTL
                     TAEAMGLFGLRDVVFSSRRTRQCILSSHIPARRRAWMEHVLCALRGASPRPAPPALQR
                     QPPVPVPLELVIERTEHEAMLGWRTPVFELCISTSPLLASSAIGELANKVVAWIRQND
                     QRLFATPATF"
     gene            <263084..>264283
                     /locus_tag="MRET_2521"
                     /note="MRES_12275"
                     /db_xref="GeneID:38739287"
     mRNA            <263084..>264283
                     /locus_tag="MRET_2521"
                     /product="DUF890 domain protein"
                     /transcript_id="XM_027629148.1"
                     /db_xref="GeneID:38739287"
     CDS             263084..264283
                     /locus_tag="MRET_2521"
                     /codon_start=1
                     /product="DUF890 domain protein"
                     /protein_id="XP_027485012.1"
                     /db_xref="GeneID:38739287"
                     /translation="MVWGVEVGVMHPRNRYARRRERDVDWSDEEAKRVYTESVLRRDF
                     GVTCALARDRLCPALPNRLNYIHWLEDILQASGTRSHVAGLDIGTGHAAIFAVLLCAM
                     HPDWHMTGTDTDASALVLAQAMLRDPANQAWSRRLTLRHTPQDTLLPQDMDACFTICN
                     PPFYASAEERERLREAKASYQKPCTAHDAELYTPEGEVGFVQRLVHESTQHRERIAWY
                     TTMLGRHASVGAIVTLLRQRGIENYALTELTQGRTRRWALAWSFQPHRLPDTLTRRVG
                     PSLHAYVPPSCHRTWNVPLPSQDALVAQLHALDTLPPTDTDLTDTSLTVWTLCWTRTA
                     RRARQRGASTARKPASPLLVLHLDVESDVCIHVSWTYGLDRWAFDSLCQHILHRLRPV
                     TKRVATA"
     gene            complement(<264248..>265429)
                     /locus_tag="MRET_2522"
                     /note="MRES_12280"
                     /db_xref="GeneID:38739288"
     mRNA            complement(<264248..>265429)
                     /locus_tag="MRET_2522"
                     /product="lipoyl synthase"
                     /transcript_id="XM_027629149.1"
                     /db_xref="GeneID:38739288"
     CDS             complement(264248..265429)
                     /locus_tag="MRET_2522"
                     /codon_start=1
                     /product="lipoyl synthase"
                     /protein_id="XP_027485051.1"
                     /db_xref="GeneID:38739288"
                     /translation="MWVANRWGMPQRWMREAVRALHTSSARALSSPASVSRLEMLRQR
                     LAEEDAASLDEFAGMPAPAPRVRMGRVGDERLPSYTKTRIPKGANFSRIKRDLRGLGL
                     ATVCEEARCPNIGECWGGEGGKEAATATIMLMGDTCTRACRFCSVKTSRQPAALDPHE
                     PENTAEAISRWGLGYIVLTSVDRDDLADGGAAHIALTIQKIKQKARTMLVEALVPDFS
                     GSQACVEQVALSGLDVYAHNIETVERTTPFVRDRRAKYRQSLATLQHAKTVRPDLVTK
                     TSIMLGCGETDAEVEQTLRDLRSANVDVVTFGQYMRPTKRHMKVSEYVEPEKFAQWQA
                     TAEEMGFLYVASGPLVRSSYRAGELFIENVIRKRRGVGTPVDTKTVQALRGSDAFGDR
                     P"
     gene            <265518..>266729
                     /locus_tag="MRET_2523"
                     /note="MRES_12285"
                     /db_xref="GeneID:38739289"
     mRNA            <265518..>266729
                     /locus_tag="MRET_2523"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629150.1"
                     /db_xref="GeneID:38739289"
     CDS             265518..266729
                     /locus_tag="MRET_2523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485132.1"
                     /db_xref="GeneID:38739289"
                     /translation="MTHDEAPTSPVLPPPPRATAMIVIGMAGSGKSTFVSKLASHLGQ
                     RAASAAEEPHATRPYLINIDPAVSTLGYAPNVDIRDTIDYHRVMEEYKLGPNGGILTS
                     LNLFTTKFDQVLQLVDKRAQELDYMVLDTPGQIEIFTWSASGSIITDALATSMPTVLV
                     YVVDTPRTTAPATFMSNMLYACSILYKARLPFVIVFNKIDVQSHEFALEWMHDFEAFQ
                     RALMAGHARDPSTYATSGTKEPPTSFESRGEEPSYLNSLMNSMSLVLDEFYKNLTAVG
                     VSSATGQGMDAFLDAVQSARTEYLHDVRPLLEKTVAEKRAQRTESRENQMKALMRDMS
                     LREPRSGMAKIRSQQRADPQDTQAKYDGDGVIVDPDSDEEKPEYGAPGGDDRLSQRWN
                     NLDGSYWPTSL"
     gene            complement(<266731..>267762)
                     /locus_tag="MRET_2524"
                     /note="MRES_12290"
                     /db_xref="GeneID:38739290"
     mRNA            complement(<266731..>267762)
                     /locus_tag="MRET_2524"
                     /product="mitochondrial alcohol dehydrogenase isozyme III"
                     /transcript_id="XM_027629151.1"
                     /db_xref="GeneID:38739290"
     CDS             complement(266731..267762)
                     /locus_tag="MRET_2524"
                     /codon_start=1
                     /product="mitochondrial alcohol dehydrogenase isozyme III"
                     /protein_id="XP_027485013.1"
                     /db_xref="GeneID:38739290"
                     /translation="MSATVDLGTVFKGTPSGKIIEAKGGTRQLRPHDVVIDIVYSGLC
                     GTDLHYRKADMVLGHEGVGVVSQVGSEVRNFKVGDRAGWGYNHKSCGYCDHCFEGWDT
                     LCSERTMYGVKDLDFGSFGDRAVIDADYVHKIPEGMDLRSAGPFQCGGSTVYGAIVHA
                     GVKANDRVGVLGLGGLGHLAVQYLAKMGCEVVVFSGTNSKREQAMQLGAHEFVASKEN
                     PKFEGVKPVNSLIVTTSFLPDWDLYFSVMKRNGTIVPLSVSFDEMRLPYASLLMNQLC
                     VKASLVAPRLIHRQMLEFSARNNIVPMIEELEMNEEGLNTAFDRLDKGDVRYRFVLRN
                     PRYQGPAVK"
     gene            complement(<267945..>268548)
                     /locus_tag="MRET_2525"
                     /db_xref="GeneID:38739291"
     mRNA            complement(join(<267945..268036,268068..>268548))
                     /locus_tag="MRET_2525"
                     /product="DUF202 domain protein"
                     /transcript_id="XM_027629152.1"
                     /db_xref="GeneID:38739291"
     CDS             complement(join(267945..268036,268068..268548))
                     /locus_tag="MRET_2525"
                     /codon_start=1
                     /product="DUF202 domain protein"
                     /protein_id="XP_027485014.1"
                     /db_xref="GeneID:38739291"
                     /translation="MASTGNYFTRIYERAADMVNQVRHVSSDETRPLLHGQGQRSYQG
                     TEDDSIPVPKPRPVVTPVKVEAKVWFANERTWISWLRASLLLGTLALALFNSATYYDP
                     KTSTDPMVPDYEGRPRAAKAIRTFGLVYALISAFVLLWGLYSYQRRVTLIKMRWPGSF
                     DDLIGPPLVCGATFIAVLANFIVAVHQYLE"
     gene            complement(<268767..>269014)
                     /locus_tag="MRET_2526"
                     /db_xref="GeneID:38739292"
     mRNA            complement(join(<268767..268920,268947..>269014))
                     /locus_tag="MRET_2526"
                     /product="cytochrome c oxidase subunit 17"
                     /transcript_id="XM_027629153.1"
                     /db_xref="GeneID:38739292"
     CDS             complement(join(268767..268920,268947..269014))
                     /locus_tag="MRET_2526"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 17"
                     /protein_id="XP_027485015.1"
                     /db_xref="GeneID:38739292"
                     /translation="MSTSKPGTAPHLVTELNPKGIKPCCACPETKAARDDCFLRFGHS
                     VEEHGESARKCEELVKRHRACMASLGFNI"
     gene            <269262..>269696
                     /locus_tag="MRET_2527"
                     /note="MRES_12295"
                     /db_xref="GeneID:38739293"
     mRNA            join(<269262..269272,269312..269369,269433..>269696)
                     /locus_tag="MRET_2527"
                     /product="large subunit ribosomal protein LP1"
                     /transcript_id="XM_027629154.1"
                     /db_xref="GeneID:38739293"
     CDS             join(269262..269272,269312..269369,269433..269696)
                     /locus_tag="MRET_2527"
                     /codon_start=1
                     /product="large subunit ribosomal protein LP1"
                     /protein_id="XP_027485016.1"
                     /db_xref="GeneID:38739293"
                     /translation="MASADLASTYAALILADEGLEITSDKLVELTAAAGVPVEPIWAQ
                     LLSKALEGKDVKDLLTNVGAAGPAVAAAPAAGAAAGGDAPAEEAKEEKKEEAKEESDD
                     DMGFGLFD"
     gene            <269910..>272003
                     /locus_tag="MRET_2528"
                     /note="MRES_12300"
                     /db_xref="GeneID:38739294"
     mRNA            <269910..>272003
                     /locus_tag="MRET_2528"
                     /product="trehalase"
                     /transcript_id="XM_027629155.1"
                     /db_xref="GeneID:38739294"
     CDS             269910..272003
                     /locus_tag="MRET_2528"
                     /codon_start=1
                     /product="trehalase"
                     /protein_id="XP_027485157.1"
                     /db_xref="GeneID:38739294"
                     /translation="MTTPWEAEARLPAMPRPATPQRSMSMLHHVGHAAPVSADRAPLL
                     RRLSTDQQSTEKPLLREFSVDVEETFQRLLEQEDTDGDMQISISDRGPKSITLKTVKG
                     TTAEVRGTYMLASLLQELALAKDRGERHMVIREAQLAEDPIHRLSRMIRTMFWDNLTR
                     RIDAEGLEKVLLDPKNRSSHRRQLLYVPENEPDMLAYYRRVAQERPDLKLDVEALPTH
                     FTPEYVRDLNQRPGLLAIAMEKQVDELTGAVDMKGIPFVVPGARFNELYNWDSYFIAL
                     GLLEDGRLDLAKGPVDHFVFEIEHYHKIMNGNRSYYLLRSQPPFLTDFTRRVYARLVA
                     DEPSRDHKPWLKRALCAAIKEYRTVWMSEPRWDPATGLSRYHPEGLGVPPETEASHFT
                     NLLRPYAEKYQCSVNEFTRMYDHGQVHEPELDEYFRHDRAVRESGHDTSYRVERRCAN
                     LATIDLQALLYKYEVDIAELIRDEFDDDLDGEHSAVWFERAAFRQRQVDTYLWNEGKG
                     LYFDYDLCQQEQSVYESVTSFWAMWAGMASEAQARRMMRVSLSKFEATGGLVTGTEES
                     RGPVSLARPNRQWDYPYAWPPHQMLAWEGLARYGYMDDARRLAYRWMFMITTAFVNFN
                     GIVPEKFDAVALSHLVTAEYGNQGTQFAYVPREGFGWTNASFQVGLTYLTSHMRKAVA
                     ACQHPDDFFHRYRHL"
     gene            <272027..>272536
                     /locus_tag="MRET_2529"
                     /note="MRES_12305"
                     /db_xref="GeneID:38739295"
     mRNA            <272027..>272536
                     /locus_tag="MRET_2529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629156.1"
                     /db_xref="GeneID:38739295"
     CDS             272027..272536
                     /locus_tag="MRET_2529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485158.1"
                     /db_xref="GeneID:38739295"
                     /translation="MSDRAEQRRTIVSLATRPVSFQVLGEALGMAPDADALLDLVIEV
                     LALGMVRGRIDGVRGYLDVVSCIAEPQDVDALATALHAWRRDAYAALNDLDTQLAEHR
                     GYVRSLPSREVFLEALTPQRLGKRARCSSRSHEDESLAASSGPMPHARSYPASSSHAA
                     PAPSDPHGS"
     gene            complement(<272738..>273691)
                     /locus_tag="MRET_2530"
                     /note="MRES_12310"
                     /db_xref="GeneID:38739296"
     mRNA            complement(<272738..>273691)
                     /locus_tag="MRET_2530"
                     /product="acetolactate synthase I/III small subunit"
                     /transcript_id="XM_027629157.1"
                     /db_xref="GeneID:38739296"
     CDS             complement(272738..273691)
                     /locus_tag="MRET_2530"
                     /codon_start=1
                     /product="acetolactate synthase I/III small subunit"
                     /protein_id="XP_027484925.1"
                     /db_xref="GeneID:38739296"
                     /translation="MGSLMRSSSSAWHTAGRALRVMRLYSTAKGHDRLTSTSAMEHKL
                     QHPHRKLPPLPHLDRPVMEAGEAVSNILYNTPPPSTQPFRRHILNMFVQDEPGVLARV
                     SGCLAARGVNIDSLVVCATDVQDLSRMCIVLRGQEGTIEQVRRQLEDLVPVWAVVDYT
                     NTDVIEREIMLVKVSTLGPEYYEQNHLGLAEEAEHEVDYAVAQADEHSAPPMQPALTS
                     TQALSIKNDNLRSIIAIAGQFSGEVVDVSDASVIVQLCAKTTRLDAFYKLMRPFGILE
                     LSRSGTMVLPRTPIKSAWKSLSDREELDRRVDMDASMLPPG"
     gene            complement(<273766..>275367)
                     /locus_tag="MRET_2531"
                     /note="MRES_12315"
                     /db_xref="GeneID:38739297"
     mRNA            complement(<273766..>275367)
                     /locus_tag="MRET_2531"
                     /product="oxidoreductase"
                     /transcript_id="XM_027629158.1"
                     /db_xref="GeneID:38739297"
     CDS             complement(273766..275367)
                     /locus_tag="MRET_2531"
                     /codon_start=1
                     /product="oxidoreductase"
                     /protein_id="XP_027484924.1"
                     /db_xref="GeneID:38739297"
                     /translation="MRLPMLPRVVVALFVFAQFGLSHNSPSVVELDPGKESNSGLLQE
                     VLDPLGRISAQDSNAEYKPICRPTGQIQDACSDYESVEEWNARHIFHRLDKLRQTKYF
                     RYFVVDLFRECPFWREDQLCINRACTVERMQDMPEEFRSYRLSQLERSAEDIDLDADK
                     TQFCQLDDQDMTEDAIFVDLMKNPERFTGYAGASANRVWRSIYEENCFGGVKWTEPPR
                     QNSGDTSRFPMQKQMLGTLKGVPATLLNPDHPPTKSGSLESLIDSVKSPVDPASTEQC
                     LEKRVFYRVISGLHASISIHICNEYLDPDTKTWGPDLGCFITRISQHPERLQNVYFNY
                     VLLMRALSKAGEYLEKFSMRKGDEIVDEESRRQLNELLQVARQGRPSFDEHKLFELND
                     DPLHNYETLALKEDFRLHFRNISRIMDCVGCDKCRLWGKVQVTGLGTALRLLFAFEAT
                     EDQPHIVLGRNELVALINTAHRISESIQAIETFRTMYQETAMPNSRKKTSSYASAVYD
                     YVTRTWGAAFQALRTLVAGLAAEDL"
     gene            275580..275697
                     /locus_tag="MRET_nc0005"
                     /db_xref="GeneID:38741161"
     ncRNA           275580..275697
                     /ncRNA_class="snRNA"
                     /locus_tag="MRET_nc0005"
                     /product="U5 small nuclear RNA"
                     /transcript_id="XR_003525362.1"
                     /db_xref="GeneID:38741161"
     gene            <276456..>276947
                     /locus_tag="MRET_2532"
                     /db_xref="GeneID:38739298"
     mRNA            join(<276456..276708,276736..>276947)
                     /locus_tag="MRET_2532"
                     /product="regulatory subunit of the type I protein
                     phosphatase"
                     /transcript_id="XM_027629159.1"
                     /db_xref="GeneID:38739298"
     CDS             join(276456..276708,276736..276947)
                     /locus_tag="MRET_2532"
                     /codon_start=1
                     /product="regulatory subunit of the type I protein
                     phosphatase"
                     /protein_id="XP_027484986.1"
                     /db_xref="GeneID:38739298"
                     /translation="MLDQATSGRDGSSRSDSHGSRTLTIERHATPEADSFADTHVGTL
                     YLQGTQPDNQDVPSRRRSRQRVVWTEDTVDNEGCGKKKSKICCIYHKKRAFDESSSES
                     SASSDGDGSEPDISSSDDDEPTSARSLPSSHTHGAGCSHSSKPPPRNAYERS"
     gene            <277323..>278840
                     /locus_tag="MRET_2533"
                     /note="MRES_12320"
                     /db_xref="GeneID:38739299"
     mRNA            <277323..>278840
                     /locus_tag="MRET_2533"
                     /product="AHNAK nucleoprotein"
                     /transcript_id="XM_027629160.1"
                     /db_xref="GeneID:38739299"
     CDS             277323..278840
                     /locus_tag="MRET_2533"
                     /codon_start=1
                     /product="AHNAK nucleoprotein"
                     /protein_id="XP_027484985.1"
                     /db_xref="GeneID:38739299"
                     /translation="MPGNGGMVKPTHLPHQKVRGMQRLRRQELDPDARPRITRTTDYD
                     GDPATAIVAPYSTRYDDDGDPSTTLVRTLSTLEGNRASIRSISRSLKSDGMFTATDAD
                     GDPIITPSSTSSSSTGTATATEGAGRTSSSSITDTSPSPTSTSSMSSTSSSSSSSPRS
                     SSSSSSSSSSSTSSSSSSSSRQRNSSSDGSSTSTRSTIDPATAAPSSAKPAQTGSPKS
                     LSSDDDSHAGAIAGGVVGGVVGLAVVIALAALLAWYLRRKRSSAAPTAAEPTDTTEFP
                     TGYDDYDPSGGGSNNVVHRPVFYDAPATAPEQSAPASGMQELLATGAVPGAGAAAAAP
                     ANTSPPWPAAPAPAPRGTPPVSAPNVPAKTNTPRDISSGRLQNAADEAGVQRQTSTRP
                     MMQAPVAIPATDSQRTPKQTTTRPRVSPAYAATPPQGVQRTSGGATTHATEFYEPNNQ
                     MLSATYEDAWASSDSPYGRAGVGRVMEEDPPPPRAFHMQPGQVYTHASPLGAFTH"
     gene            complement(<278929..>279684)
                     /locus_tag="MRET_2534"
                     /note="MRES_12325"
                     /db_xref="GeneID:38739300"
     mRNA            complement(<278929..>279684)
                     /locus_tag="MRET_2534"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629161.1"
                     /db_xref="GeneID:38739300"
     CDS             complement(278929..279684)
                     /locus_tag="MRET_2534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484984.1"
                     /db_xref="GeneID:38739300"
                     /translation="MLVKFLHRTLLALVAVHAVLAASSSYESPSKNGGSMLTKQKEPL
                     NVIISGTSDEYVLSEKGFVDFGQAIGYDPDSFVGKVQGNGKQSANLGDGRGSTEQAGL
                     MRQHPGSVEAIVGGNHFRYWMQVGDKANTKAVFIAASVEKALKYHHDLVSNGYDQGRD
                     MIVKNATSQPRSWNGKKFTTKQIKMDKSLLKGVSKNDLNHNIGTDGGVAILEVSVSND
                     TEADKGDGDGTSLTAPASSLMLLAMIFICLSFL"
     gene            complement(<279851..>280126)
                     /locus_tag="MRET_2535"
                     /note="MRES_12330"
                     /db_xref="GeneID:38739301"
     mRNA            complement(join(<279851..280069,280100..>280126))
                     /locus_tag="MRET_2535"
                     /product="DASH complex subunit DAD4"
                     /transcript_id="XM_027629162.1"
                     /db_xref="GeneID:38739301"
     CDS             complement(join(279851..280069,280100..280126))
                     /locus_tag="MRET_2535"
                     /codon_start=1
                     /product="DASH complex subunit DAD4"
                     /protein_id="XP_027484983.1"
                     /db_xref="GeneID:38739301"
                     /translation="MPPAIENPYEERQALLLERIIKNVDLLNEALGEMNRSVADINQH
                     NQDITIVAEMWNGYHRNVDFNLQNMEGSSATSSLSHP"
     gene            <280261..>280953
                     /locus_tag="MRET_2536"
                     /note="MRES_12335"
                     /db_xref="GeneID:38739302"
     mRNA            join(<280261..280893,280924..>280953)
                     /locus_tag="MRET_2536"
                     /product="ribosomal protein S21"
                     /transcript_id="XM_027629163.1"
                     /db_xref="GeneID:38739302"
     CDS             join(280261..280893,280924..280953)
                     /locus_tag="MRET_2536"
                     /codon_start=1
                     /product="ribosomal protein S21"
                     /protein_id="XP_027484982.1"
                     /db_xref="GeneID:38739302"
                     /translation="MRLLASRVAAPFMRGMSLRASFAPSTRMLSSSAHRMDGSSSPNT
                     APSEDKPLSEQRGDKNSDASRADLWNQMLNTIIIDSPEKTSFKTEGAAVPQSRFGDSF
                     PSNMNKRAGPQPLSGMLDQLDAEFRERPTFGLPAPSTPTTGRSVAMSTSLNHTSAVLY
                     RQLSRILSRNNVRRELKLNERYEKPNQMRRRKRSERHRRRFADMVRKKVQLIMTLKSR
                     NA"
     gene            <281099..>281428
                     /locus_tag="MRET_2537"
                     /db_xref="GeneID:38739303"
     mRNA            <281099..>281428
                     /locus_tag="MRET_2537"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629164.1"
                     /db_xref="GeneID:38739303"
     CDS             281099..281428
                     /locus_tag="MRET_2537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484981.1"
                     /db_xref="GeneID:38739303"
                     /translation="MLQHAVPRLSISRQMVARSWRSLRVPYNRGMSHRPSEPLPEDTT
                     PAMWQRVAQLIAGTVATGSFAYFVLLGDFGEGDHCFVPIRQALNVDAPAWRAKLWPRS
                     NEQRTSS"
     gene            <281747..>282367
                     /locus_tag="MRET_2538"
                     /note="MRES_12340"
                     /db_xref="GeneID:38739304"
     mRNA            <281747..>282367
                     /locus_tag="MRET_2538"
                     /product="protein ROT1"
                     /transcript_id="XM_027629165.1"
                     /db_xref="GeneID:38739304"
     CDS             281747..282367
                     /locus_tag="MRET_2538"
                     /codon_start=1
                     /product="protein ROT1"
                     /protein_id="XP_027485218.1"
                     /db_xref="GeneID:38739304"
                     /translation="MRPAMLVWLIATLLLGHVMADLATEKRNRKIEGTWSSGAGNVMT
                     GQDEKGVAFFNPMRRHFTVPPTAGYSYSFTKDGHFEMAQFTYQTNPKDVHCFSASLVW
                     QHGTYKYDGTNIYMSPYKGDGAIQTMGECLDPQVQMNYYAEKEVGANVTVYTDNDIVF
                     YPDESMYVLQMHKFNGKPLPKMYLRYRPPRMMPTRSIFKQVIGAPG"
     gene            <282583..>284385
                     /locus_tag="MRET_2539"
                     /note="MRES_12345"
                     /db_xref="GeneID:38739305"
     mRNA            <282583..>284385
                     /locus_tag="MRET_2539"
                     /product="amino-acid N-acetyltransferase"
                     /transcript_id="XM_027629166.1"
                     /db_xref="GeneID:38739305"
     CDS             282583..284385
                     /locus_tag="MRET_2539"
                     /codon_start=1
                     /product="amino-acid N-acetyltransferase"
                     /protein_id="XP_027484966.1"
                     /db_xref="GeneID:38739305"
                     /translation="MSRVPRLVLEVLKSRATLRDSKPYLSMFTQRQPTPPVPRSAAQD
                     RAVLHDKAQSMSDSPPLSLATDATSTADRTSRTVPSLDKTYTALVKLQGPFSDRQLGS
                     IAEGLVYLQKLGLMCAIVLDHDSWPRSYPEALEDEDLLSYTSSSPETCRGLLEAGLRK
                     RMVQELWRVADALTDAGASSWPHTDAVMCISSHLSNMHLVGDASLHNVYRALRGGHIP
                     IIMPMALYEPPNEHTLRNVCVDANQVMVSLSREMSSENQTEDLTPLRLMVISREGGVP
                     SHARNGHPHLMINLASEYESIRASYIWNETHPAALSNLTMLRDCLAYMPHVASGLMAS
                     HRSPQSLVANLITNKAAYSPSLPPRLLAARREMRHMPTVVRAGMPVSVMTRWQDIDLG
                     RVQKVLESSFHRKLDAPAYFARLEKCLDFMIVTGDYEGLAIVTREYAPDDLPHTEPIA
                     YLDKFAILPSLQGSGAVDFLWNALRDEVHGLGLLDALNNNGGHNGIGQGRDLVWKSRA
                     ANKVNRWYFERSNGFMTLPGPPPHWYLFWCDAEDRLKRYAGEPVVSPGARLDDVWTNA
                     SETAPMLPIIVPEEQGRWDRWARCLQRIPSAWKA"
     gene            complement(<284382..>286130)
                     /locus_tag="MRET_2540"
                     /note="MRES_12350"
                     /db_xref="GeneID:38739306"
     mRNA            complement(<284382..>286130)
                     /locus_tag="MRET_2540"
                     /product="plasma membrane protein involved in remodeling
                     GPI anchors"
                     /transcript_id="XM_027629167.1"
                     /db_xref="GeneID:38739306"
     CDS             complement(284382..286130)
                     /locus_tag="MRET_2540"
                     /codon_start=1
                     /product="plasma membrane protein involved in remodeling
                     GPI anchors"
                     /protein_id="XP_027485050.1"
                     /db_xref="GeneID:38739306"
                     /translation="MLPMHLATQAGGDDPHPRLSSVGARMRHVTSLTPNAYATEPAQD
                     TSKAQASDMPPPSPPHWTTWEFYLYYVAAALVIPYMIYVPMYLSSPSRPEYAKYYYYL
                     VDGWMGGRMRDNSDHQYRLLRDHGLLLLVLMLSYAALSRLVRWIASRSGPHAQHVRMA
                     FLGVTGAVFVTALHGINAVKLFVFSILNYVLASSAAWLPPHIVQAMIWAYNGGMLFLV
                     FYTNGMPFATFWPSLAWLDTYAGLVPRWYISYNFTMLRLVSFALDYVWARCRRGTKPV
                     PTGVPSKDRMHLPHELPAYSLTAQLLYLSYPPLFIAGPIVTFNDFWSQVCKPLHIPVR
                     VIAVYACRCLFAVLSIEFMLHYMYVNAIKTAGVWDAYTPMEMAILSFWSLEFVWFKLV
                     VPWRLFRLWALLDGVDVPENVIRSITNSPSALRFWRAWHRSYNLWVVRYIYIPLGGAK
                     RQLVSSLVVFTFVALWHDLSFTLLAWAWLIVLFLVPEIVGRSLVPSRVYGQRPWFRHV
                     RALGTVANMFMMISANLVGFVIGLDGVQFVWSQMVETGAGRVCLLQLIVVLFIAAQLM
                     YEYRAEEWRRGIWKPY"
     gene            <286202..>286707
                     /locus_tag="MRET_2541"
                     /note="MRES_12355"
                     /db_xref="GeneID:38739307"
     mRNA            join(<286202..286207,286234..>286707)
                     /locus_tag="MRET_2541"
                     /product="AP-1 complex subunit sigma 1/2"
                     /transcript_id="XM_027629168.1"
                     /db_xref="GeneID:38739307"
     CDS             join(286202..286207,286234..286707)
                     /locus_tag="MRET_2541"
                     /codon_start=1
                     /product="AP-1 complex subunit sigma 1/2"
                     /protein_id="XP_027484844.1"
                     /db_xref="GeneID:38739307"
                     /translation="MAIQWVLLISRQGKVRLSKWYGTMSQKSKAKIVKDITQIILARR
                     SRMCNFVEYKENKVVYRRYASLFFVAGISPDDNELTTLEVIHRFVEVLDRYFGNVCEL
                     DLIFNFQKAYQVLDELLMAGELQESSKKSVLRVVMQGDNVEEAENEDNLARIGSRSG"
     gene            complement(<286722..>287162)
                     /locus_tag="MRET_2542"
                     /note="MRES_12360"
                     /db_xref="GeneID:38739308"
     mRNA            complement(<286722..>287162)
                     /locus_tag="MRET_2542"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629169.1"
                     /db_xref="GeneID:38739308"
     CDS             complement(286722..287162)
                     /locus_tag="MRET_2542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485048.1"
                     /db_xref="GeneID:38739308"
                     /translation="MWDGGVVGHAFFSTSMAEPLHAERHAAYAAVEPLCAKYPAQAGA
                     LFQTYVDLKYAARWRALDVRDTASLGKPGWAILVGEAPDASEHRQVVVPLQLEQTVDT
                     HMFTELFAHLPPDAATTHVLLAMMSNDATVVYYKLSQGLVKPVN"
     gene            complement(<287176..>287568)
                     /locus_tag="MRET_2543"
                     /db_xref="GeneID:38739309"
     mRNA            complement(join(<287176..287335,287364..287507,
                     287534..>287568))
                     /locus_tag="MRET_2543"
                     /product="EKC/KEOPS complex subunit PCC1/LAGE3"
                     /transcript_id="XM_027629170.1"
                     /db_xref="GeneID:38739309"
     CDS             complement(join(287176..287335,287364..287507,
                     287534..287568))
                     /locus_tag="MRET_2543"
                     /codon_start=1
                     /product="EKC/KEOPS complex subunit PCC1/LAGE3"
                     /protein_id="XP_027485049.1"
                     /db_xref="GeneID:38739309"
                     /translation="MATASVPLRHHVSVQLPCPTRDVATTIQRVIQVDKELRPHDVQK
                     KMDIEEGENGTVTLHVRMHATTLRHLRLSLNSFLDDAALIVRTMDTLRTGGTDLHTGA
                     VEQGSVGLAG"
     gene            <287697..>289490
                     /locus_tag="MRET_2544"
                     /note="MRES_12365"
                     /db_xref="GeneID:38739310"
     mRNA            <287697..>289490
                     /locus_tag="MRET_2544"
                     /product="ATP-dependent DNA helicase PIF1"
                     /transcript_id="XM_027629171.1"
                     /db_xref="GeneID:38739310"
     CDS             287697..289490
                     /locus_tag="MRET_2544"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase PIF1"
                     /protein_id="XP_027485056.1"
                     /db_xref="GeneID:38739310"
                     /translation="MAEDSHPIRSGLRMLKRSWSSNENVPPPQSSPPVIDLCSSPPRP
                     EAKHRKICDAPLPARPSPFHIPPRKADGDDDDFLPLGDQAPLMPRSRSSSPVKTSNIN
                     ALVKPLMGARSRSSTPQIPTSSVPTSPEKRSIARVFLSPEQQSVLEAAVKHGKNVFFT
                     GSAGAGKSYLLRQMIHDLHAKYSKSSGAVAITASTGIAACNIGGITLHSFSGVGIGTG
                     TVEQLCRYVRRNRNAVTRWKKTSVLVIDEVSMIDPKLFEKLECVARHIRQSVKPFGGI
                     QIIMSGDFFQLPPVSQGATSFVFESPTWSQVIEQKFNLTQVFRQRDQQFVNMLNDMRL
                     GKLAPETIQAFSKLERTPSLPEGIVPTELYAVRSDVDKANQMRLDALQTEMRTYTSLD
                     DGSLPPDQLQRTLENFMPSRRIALKKGAQVMLIKNVDRELSNGSVGTVLDFVDDESFK
                     ELYGEEDAPDTLLRAERAPGATRQESKTEPRPAPRWPLVRFHLVNGRTRDFLARPEAW
                     KTEEPSGKVVASRTQVPLILAWAMSIHKSQGQTLQYCRIDLRRVFEKGQAYVALSRAT
                     SLDGLQVIGFHPSKVMAHPKVIAWNRQEFAT"
     gene            complement(<289494..>290816)
                     /locus_tag="MRET_2545"
                     /note="MRES_12370"
                     /db_xref="GeneID:38739311"
     mRNA            complement(<289494..>290816)
                     /locus_tag="MRET_2545"
                     /product="translation initiation factor eIF-2B subunit
                     beta"
                     /transcript_id="XM_027629172.1"
                     /db_xref="GeneID:38739311"
     CDS             complement(289494..290816)
                     /locus_tag="MRET_2545"
                     /codon_start=1
                     /product="translation initiation factor eIF-2B subunit
                     beta"
                     /protein_id="XP_027485047.1"
                     /db_xref="GeneID:38739311"
                     /translation="MSEGIEQVLRDRFSLVAVKELENKLRRHQFVSTEAIAEATAKTL
                     RAVVSATKVSQLDELVGLIRTVGHYLQEAQPFEPVIGNVTRRILFLLREEAKALTSTL
                     GAGTTRPPLQPHASVVQSLAALSVSMPTSPATSMHASMSDISVPATPSRSFSISDLVL
                     PPMDHALVSSPYGVQSPLQDGNDSPSLRMSDSMSSDDEPAPQPAGATASHAYQLKPLL
                     IQAIQELLDEFDSVDTSIAKDARDHIHSGEVILTLGYSPTVQTFLRAAAKHRKFIAVV
                     PESAPAFSGHEMARALASDGLSVLLVPDSNVYALMPRVSKVILGARCVLANGGILATI
                     GSMAIAMAAREHSTPVVALAGVFKISPDWSWVGPERLRTGNQGPTSQLVNYASSRVLA
                     ERAEIENPLWDIVSPSDLDVIITNVGEHPPSYVYRLIQENYHEEDLNL"
     gene            complement(<290887..>292707)
                     /locus_tag="MRET_2546"
                     /note="MRES_12375"
                     /db_xref="GeneID:38739312"
     mRNA            complement(<290887..>292707)
                     /locus_tag="MRET_2546"
                     /product="hypothetical protein"
                     /transcript_id="XM_027629173.1"
                     /db_xref="GeneID:38739312"
     CDS             complement(290887..292707)
                     /locus_tag="MRET_2546"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027485042.1"
                     /db_xref="GeneID:38739312"
                     /translation="MTSPPLPTFAQDAAYISNVLERVDTQYVMTHLYDVASQRVFGRQ
                     CVDMVCGSAKPTHLDLRAEPSAGMARVLDVLHARTQTLSPAELLIVYVIWIALGEYNI
                     NAYRWMLRRDTMHVYIHRLVQNIWAGHYAAQTSASLVHDTDVAFEPALPLPPDHHRLH
                     VDARSDTPSDSRRTRHVLICVERHAMHILYECLCSVRLSSHDMRGITRPFVDHVLSVM
                     ETHESHEQSAICMSVMLALHEQCMMSTNAASLLSHIQHRLHTSKPFGENVVYLLNRTP
                     STTFDGCRFHILVLKLLGAIFTLRETASYFYVNDLKVLVDIFLRQLGDLPDAYDVLRQ
                     AYLCVLHALLTQTQLWSVEYKRAHIVRLLTNLVRTASLHDMSERTLTLAQLCLDAEWC
                     VGTDAGNTPLVACLHGEGGIRGASSSSHDHDVIQYMWLLACLQPTAASQACMLGVDAD
                     TIPLLWSEYELEDEQEACMPLDFDVRTLESWSRQSSGDAPPHIGNRRRAPPAPPARMP
                     RLAHTLSSASMPELHAHSSSVDPPSPSAASGTVTPPLRRQAPAIPARETPPTGLRAYV
                     QRYWRGKHDDTRHPRRRHVTSHDDFDTPAPRRRAPPPPPS"
     gene            <292777..>294387
                     /locus_tag="MRET_2547"
                     /note="MRES_12380"
                     /db_xref="GeneID:38739313"
     mRNA            <292777..>294387
                     /locus_tag="MRET_2547"
                     /product="origin recognition complex subunit 4"
                     /transcript_id="XM_027629174.1"
                     /db_xref="GeneID:38739313"
     CDS             292777..294387
                     /locus_tag="MRET_2547"
                     /codon_start=1
                     /product="origin recognition complex subunit 4"
                     /protein_id="XP_027485046.1"
                     /db_xref="GeneID:38739313"
                     /translation="MAEPQAADPAAHLDTHKQAVLSILSHALPPMASDAQPYMGQECI
                     GLGDAWRALYGLVRSSVYEHEGNSCLVAGESGCGKSVLVESVLRYVQHECMMERVLAP
                     WTVRLSALVHPTDRLCLSAMARQLMDQDALSQNNQVDDMLGPEQEEEEDDEDRPLIEW
                     AHASASEDEDDAPMEEVTPAPTTTDPNAILSTLAAALSHILSLLSTHTLGKRPLVLIL
                     DQFDQFAQRPRQALLYCLLDAVQSGSYAPGLVVIGTSTRVDATDFLEKRVKSRFSHRI
                     VHVHPPSFDQYVILARTALLGGMSNTLPPDAAWEKQVDALLQDPSFRASLRRLHDLSG
                     DVRLLYQALWPPIAALSASRPHLEASAFVAAAQAQRLDPTFAFLQELSNPEMAILISA
                     RHLQLCEREPFTFEMCFYHICQFVKRAHAILGTGDDRRVTVSFASLDTLASRTSMMQA
                     FQRLLDLELLLPEPARVSLTLPTGIASRTGPATSPYGTLPTPTVIPSVLPVRAQVSAK
                     AILESALSPERVEPLSSVMIKWAESTGL"
     gene            complement(<294513..>295952)
                     /locus_tag="MRET_2548"
                     /note="MRES_12385"
                     /db_xref="GeneID:38739314"
     mRNA            complement(<294513..>295952)
                     /locus_tag="MRET_2548"
                     /product="elongator complex protein 4"
                     /transcript_id="XM_027629175.1"
                     /db_xref="GeneID:38739314"
     CDS             complement(294513..295952)
                     /locus_tag="MRET_2548"
                     /codon_start=1
                     /product="elongator complex protein 4"
                     /protein_id="XP_027485069.1"
                     /db_xref="GeneID:38739314"
                     /translation="MSAFRRRTTAPGHARAPPEGVKAAPYDAPVPLLSTGIAALDDIM
                     CGGGVLAGSVLGFVPCAGTANEPAAMLGAPMLGGDLSATYNDATYSAAEAYTDLFLGY
                     FTAQGLASHHMNVVIGDSADVFVHQLMGLAESTEANENDHEVAGDMQQMKIAWRYGGQ
                     RPMAPHRTLPSSTLSSVFDLSKRIAPETIRRAKESQQLKAVSLDTDCAFEVAWRAIEE
                     AAERCRASSQAQTPVLRICLRSFGSPAWMDTAHTADAVRFLLRLRSLIRTLAMPPSGS
                     SIPPIPTIVSLSLSSYTYMQRKDARNGVNAAHRLIHLMDGCIGLSSFAATPGLSDVFP
                     DFVGALRVYRTPAIGTLTNPSLRASVLRGMGAGSSLESGASEGGAGGGENNLAFKIKR
                     KRVAIETLHLDTDGGVKERRTVPPEPEVPPPRSEAPRPDPTPSSPPKASSPAPPVPRL
                     FAGLGDLRQRGLKMAQNKNASIDRQNLDF"
     gene            <296087..>297337
                     /locus_tag="MRET_2549"
                     /note="MRES_12390"
                     /db_xref="GeneID:38739315"
     mRNA            <296087..>297337
                     /locus_tag="MRET_2549"
                     /product="26S proteasome regulatory subunit T6"
                     /transcript_id="XM_027629176.1"
                     /db_xref="GeneID:38739315"
     CDS             296087..297337
                     /locus_tag="MRET_2549"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit T6"
                     /protein_id="XP_027485070.1"
                     /db_xref="GeneID:38739315"
                     /translation="MVAAVASSQVSVDNQAGEQNHRESKAPAGVDSFFLSKIQSYELT
                     INEKAQNLRRLEAQRNSLNARVRMIHEELQLLQEPGSYVGEVEKVMGKKKVLVKIQPE
                     GKYVVDVASDIDVAQLKPSLRVALRSDSYTLHKILPNKIDPLVSLMMVEKVPDSTYEM
                     VGGLDRQIKEIKEVIELPVKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTD
                     CKFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRGDDGGNGD
                     SEVQRTMLELLNQLDGFEDTQNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPGPEA
                     RVSILRIHSRKMSLQRGINLRVLAEKMGQCSGAEVRGICTEAGMYALRERRQHVSQED
                     FELAISKVLKRQTDGSMSVNKLFT"
     gene            complement(<297343..>297992)
                     /locus_tag="MRET_2550"
                     /note="MRES_12395"
                     /db_xref="GeneID:38739316"
     mRNA            complement(join(<297343..297726,297753..>297992))
                     /locus_tag="MRET_2550"
                     /product="mitochondrial import receptor subunit TOM71"
                     /transcript_id="XM_027629177.1"
                     /db_xref="GeneID:38739316"
     CDS             complement(join(297343..297726,297753..297992))
                     /locus_tag="MRET_2550"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit TOM71"
                     /protein_id="XP_027484841.1"
                     /db_xref="GeneID:38739316"
                     /translation="MTEPTDSPFESLWHEAESLKEQGNEHFSKAKYAMSITSYTDALL
                     RLPSRHEPCPDASLQDQVKDTRTKVYTNLAAAHLKLDQFKETVTASSEALSEDPKNVK
                     ALYRRAMANERLGGWSRLESALKDYKALEELENEGLVPLSFHAELREALSRLPPKIHA
                     VGESEKAAMLGQLKNMGDKVLGWFGLSTDNFQLQQQENGGYSVQFKS"
     gene            complement(<298016..>299383)
                     /locus_tag="MRET_2551"
                     /note="MRES_12400"
                     /db_xref="GeneID:38739317"
     mRNA            complement(<298016..>299383)
                     /locus_tag="MRET_2551"
                     /product="tRNA-dihydrouridine synthase 1"
                     /transcript_id="XM_027629178.1"
                     /db_xref="GeneID:38739317"
     CDS             complement(298016..299383)
                     /locus_tag="MRET_2551"
                     /codon_start=1
                     /product="tRNA-dihydrouridine synthase 1"
                     /protein_id="XP_027484840.1"
                     /db_xref="GeneID:38739317"
                     /translation="MSKDFPDVDSFPETGVPKFEKLSGYDFYQSIGSPKRVVAPMVDQ
                     SELAWRILCRRYGADLVYSPMINAKIYAQQGRGMHRVREGFFNQDIGEEGAHILPLGD
                     VKDTDRPLIVQFCANDPDLLLDAAKSVEDKCDAIDLNLGCPQQIAKRGKFGAYLMDDW
                     DLVFRLINTLHLNLKVPVTAKFRVYESEEKSIAYARMIQRAGAQIATVHGRTREMKGH
                     KTGLADWSIVRAVKQALDIPVFANGNIMYAQDWRDCLVYTGCDGVMSAEGNLYNPAIF
                     HPEVGPDLSSLSDRNGDHSVFEPMRMVKVAHEYLDIVATLKTPTSHGAIKGHMFKITR
                     PALCIHTDLRPVLGGARAYDGEPGEDRVRDYRAFLHELAKRLEHDESLTQYYTRPDDL
                     PNYYVVPPHLQDTLDRTTRPDYIPHWYIQPYFRPPLNPPKSASGSDAKEEAPAAKRVK
                     IDSST"
     gene            <299561..>301063
                     /locus_tag="MRET_2552"
                     /note="MRES_12405"
                     /db_xref="GeneID:38739318"
     mRNA            join(<299561..299671,299706..299830,299862..299910,
                     299941..300343,300368..300931,300957..>301063)
                     /locus_tag="MRET_2552"
                     /product="sphingosine-1-phosphate phosphohydrolase"
                     /transcript_id="XM_027629179.1"
                     /db_xref="GeneID:38739318"
     CDS             join(299561..299671,299706..299830,299862..299910,
                     299941..300343,300368..300931,300957..301063)
                     /locus_tag="MRET_2552"
                     /codon_start=1
                     /product="sphingosine-1-phosphate phosphohydrolase"
                     /protein_id="XP_027485110.1"
                     /db_xref="GeneID:38739318"
                     /translation="MTTGGGIEAKRPSFIVSLHNVMERYVQRHSKTLARHQTFVSQPC
                     LDMYFSYTSVLGSHTFFMLFLPLMYLIVDQKFGRVLILSSALAVIFAAMLKDYVCVQR
                     PLSPPVRRIVVGTHHLEYGFPSTHSANSMTMAIVVYYFVQQFRPLLHIQVLSEIIHGS
                     SLWVQLANSYMFEILLSLYVFSIVYGRLYLGMHTVLDCVTGMLIGALSAGISIFSDNL
                     LLSYLNWGTVFVPLSLFVVGYLILALHPIPIQPCPCYEDVVCFIGAFVGVAMGNWRTN
                     NFYYADMHQLDALWRWVITGVSPGWQYRSRMMWTIAVVHRPAVRLCVASAFAIVPLVL
                     WKIVATPIVKTSVPAMYRVLMPQSSREPKLDVPQDQAVASTSAVPPASELRHRMAAVP
                     KPGSQIDSLSLERKMPSRTTELFCQDLPRLIVYTGIGFIGASFSHYLIEYFAVQPIHS
                     VQ"
     gene            complement(<301078..>301746)
                     /locus_tag="MRET_2553"
                     /note="MRES_12410"
                     /db_xref="GeneID:38739319"
     mRNA            complement(join(<301078..301155,301181..301281,
                     301307..301566,301592..>301746))
                     /locus_tag="MRET_2553"
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 3"
                     /transcript_id="XM_027629180.1"
                     /db_xref="GeneID:38739319"
     CDS             complement(join(301078..301155,301181..301281,
                     301307..301566,301592..301746))
                     /locus_tag="MRET_2553"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex subunit 3"
                     /protein_id="XP_027485045.1"
                     /db_xref="GeneID:38739319"
                     /translation="MQLWSRASTRQLGRAALRTVAWRSPARVGYVPLPRTYMNTRPVS
                     RHDTLPYDDLDASGSFVNINEDDSIPIRILKVSPTEIKLANGDVVPPTCIFLQGQTFV
                     WTPPPVDPMTAMPSGKGWEAWTEDVWSIFDMTMPKPEILVFGTGNTVLPVPHKIRSLL
                     HSMGIQLDVQNTRHACSTFNLLTEEGRNVAAALLPLT"
     gene            <301801..>302430
                     /locus_tag="MRET_2554"
                     /db_xref="GeneID:38739320"
     mRNA            join(<301801..301910,301936..301977,302003..302216,
                     302240..302387,302414..>302430)
                     /locus_tag="MRET_2554"
                     /product="peptidyl-prolyl isomerase H (cyclophilin H)"
                     /transcript_id="XM_027629181.1"
                     /db_xref="GeneID:38739320"
     CDS             join(301801..301910,301936..301977,302003..302216,
                     302240..302387,302414..302430)
                     /locus_tag="MRET_2554"
                     /codon_start=1
                     /product="peptidyl-prolyl isomerase H (cyclophilin H)"
                     /protein_id="XP_027485079.1"
                     /db_xref="GeneID:38739320"
                     /translation="MQGAGTKGRPVVFFDVNVGDTPVGRIKFELYSDIVPKTAENFRQ
                     LCTGEHRVNHQPMGYKGALFHRIIKDFMCQGGDFLNGDGTGSFSIYGDKFADENFILK
                     HDAPGLLSMANAGPHSNGCQFFITTQPAEFLDGKHVVFGRVVEGMLTVRKVEQVPCGA
                     NNRPRMDVRIVECGEM"
     gene            complement(<302433..>304892)
                     /locus_tag="MRET_2555"
                     /note="MRES_12415"
                     /db_xref="GeneID:38739321"
     mRNA            complement(<302433..>304892)
                     /locus_tag="MRET_2555"
                     /product="para-aminobenzoate (PABA) synthase"
                     /transcript_id="XM_027629182.1"
                     /db_xref="GeneID:38739321"
     CDS             complement(302433..304892)
                     /locus_tag="MRET_2555"
                     /codon_start=1
                     /product="para-aminobenzoate (PABA) synthase"
                     /protein_id="XP_027485041.1"
                     /db_xref="GeneID:38739321"
                     /translation="MNAPDGLPRIVIVDHYDSYTRNLIPLIASCFDPPPDPELLARRV
                     TVIPHTLPVLSPLAFRERLLTHVDALILSPGPGTSDNEVDFGQAAALLQSPELEHIPI
                     LGVCLGHQGIATTAGAKIVQLAAPFHGRTRELIMDSNSLSENGQKSIVSGIPEGTAVI
                     CYNSLCVDESTLPSTLRVVARSRLSPNETMVQAIEHTKRPLYGVQFHPESIETNGGTL
                     VMQNFLHNVAHFWARHDQARVEAWKDAMHTCLPPDIVALGSACLALGKQIHVPRRRWR
                     VFEKALTSCTSLPDKLAYDAPALFEKLFRRDEPGAVWLDSANPRDPQSHVSIQSRATC
                     IMTYDMDGVLRVHQPNVVRRIDMHPHQTLWDWMEDAQRTMQAQVHPMSPNAHTQFRTG
                     FVGYWGYELKDESLGLASLSSKRYEPHSGTGFDRTKLPAAQWAFCDHALCLDHATNTW
                     MAYALVDEGGDTCGPLAELETHGVRLGMPAAEAEAWLTQAQRAVDSLQRMADVPPASL
                     KVHTVDDAEVYKDRIEACRRYIASGESYELCLTTQFEGTLPFSPSYASYFSLYCALRQ
                     KNPAPFSAYVELVSCDGSTPQAILSTSPERFLTVSDAGAVEMRPIKGTKVRPGWGEDE
                     SDWFEKARHDASMQAYMVAEDESRKQALHMDPKERAENLMIADLIRADLQAVCYPGSV
                     AVPRLIALETYETVHQLVTSVTGQLRPGIGCVEAAKRCFPPGSMTGAPKRRSVELIET
                     LERTSHAPQGTTRRRGVYSGALGFMGVDGASNLSVVIRTVTVQNDHALVGAGGAVTFL
                     STLDGEWSEVMTKLGSVAALA"
     gene            complement(<305127..>305542)
                     /locus_tag="MRET_2556"
                     /note="MRES_12420"
                     /db_xref="GeneID:38739322"
     mRNA            complement(join(<305127..305161,305194..>305542))
                     /locus_tag="MRET_2556"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629183.1"
                     /db_xref="GeneID:38739322"
     CDS             complement(join(305127..305161,305194..305542))
                     /locus_tag="MRET_2556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485044.1"
                     /db_xref="GeneID:38739322"
                     /translation="MVENTYERTTEEDLQKYLFSKYAGHALSRDSTTAPKNDGAPPGD
                     WLPKYLDEKAEKEWAITSASDESVTSSQRELDEEYRRACEEWEEGVRQLQVAFQVVLI
                     PLIGKWVGRRWSYWLFARWFYRADK"
     gene            complement(<305680..>306210)
                     /locus_tag="MRET_2557"
                     /note="MRES_12425"
                     /db_xref="GeneID:38739323"
     mRNA            complement(<305680..>306210)
                     /locus_tag="MRET_2557"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629184.1"
                     /db_xref="GeneID:38739323"
     CDS             complement(305680..306210)
                     /locus_tag="MRET_2557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485043.1"
                     /db_xref="GeneID:38739323"
                     /translation="MSNNNNFSAQADQFGKEMSGKLQNAAGEFKEQSQAAKEQGQNLM
                     NKAEQNLPEAKKQGHSLLEQGQEYLNQATNYVHEHSQNLLNKGAEGAAEGSEQGESTF
                     AHLSKQAQKYASDAMQSVSNTFHQAGDKAAEGAEQAHPNESYLEAARRTANDAISNVQ
                     NYFSGSSAGSAPSAGK"
     gene            <306442..>307104
                     /locus_tag="MRET_2558"
                     /note="MRES_12430"
                     /db_xref="GeneID:38739324"
     mRNA            <306442..>307104
                     /locus_tag="MRET_2558"
                     /product="mitochondrial peroxiredoxin PRX1"
                     /transcript_id="XM_027629185.1"
                     /db_xref="GeneID:38739324"
     CDS             306442..307104
                     /locus_tag="MRET_2558"
                     /codon_start=1
                     /product="mitochondrial peroxiredoxin PRX1"
                     /protein_id="XP_027484843.1"
                     /db_xref="GeneID:38739324"
                     /translation="MPSHLRLGCVAPDFEAQTTQGCIKFHEWSANTWTVLFSHPDDFT
                     PVCTTELAEVARRASDFAKRGVKILGLSANDVSSHNRWAHDIQSIAQAPVTFPIIGDS
                     DRSIATLYDMLDALDPTNVDAHGAPFTVRDVFVIDPQHIIRLKISYPASTGRHFDEIL
                     RVIDALQLSDRHAVTTPANWRPGDRVIIHPKVSDSEAHSLFPDHESITPYLRMTRDPS
                     SS"
     gene            complement(<307113..>308597)
                     /locus_tag="MRET_2559"
                     /note="MRES_12435"
                     /db_xref="GeneID:38739325"
     mRNA            complement(<307113..>308597)
                     /locus_tag="MRET_2559"
                     /product="short-chain dehydrogenase reductase"
                     /transcript_id="XM_027629186.1"
                     /db_xref="GeneID:38739325"
     CDS             complement(307113..308597)
                     /locus_tag="MRET_2559"
                     /codon_start=1
                     /product="short-chain dehydrogenase reductase"
                     /protein_id="XP_027484842.1"
                     /db_xref="GeneID:38739325"
                     /translation="MDETQDPIANVSERICSHMNADHVDSLQHLVMFYERLPQLPVWC
                     HMTKICADHMVIGYVTSTQQYLLNKKASAIKISFEPPLQSMMDARQRLVSLSKKSEEE
                     NLRVLQQTSATTHQWERWNLDALLLRTRHFIAEPVTVAMLGIMLSMALYPNKVTQNEW
                     LQHQLATLLWPLQVITALFSVVLVILSILWLSRVWTNASPVPEDIRVLPTWLVTTLFR
                     RTLPVLTKEAWSGQTVVVTGGASGLGAALVQKLAGRGAKVASIDVSSACVDHEQVTAY
                     TCDISRRDDVSLTMNKIVEECGQPTMLINNAGVVHGMPLPTLPSESIARTMETNVMGP
                     FWLIKEVLPTMIRNNSGHIVTVSSIMGYAGFAKLTDYTASKHALVGLHESLRYELDSI
                     HKAPHVRTTLVTTGQLQDTPMFDGVTHSPFVHFVAPSISAHRVADAIVEALEQQESRH
                     IAMPWYASWTPALRLLPSFVRDGIQTALGANHAMPSPDEAYETK"
     gene            complement(<308735..>311395)
                     /locus_tag="MRET_2560"
                     /note="MRES_12440"
                     /db_xref="GeneID:38739326"
     mRNA            complement(<308735..>311395)
                     /locus_tag="MRET_2560"
                     /product="calcium permeable stress-gated cation channel"
                     /transcript_id="XM_027629187.1"
                     /db_xref="GeneID:38739326"
     CDS             complement(308735..311395)
                     /locus_tag="MRET_2560"
                     /codon_start=1
                     /product="calcium permeable stress-gated cation channel"
                     /protein_id="XP_027485153.1"
                     /db_xref="GeneID:38739326"
                     /translation="MINRRNLCLFSLIGLTLPYGVKAQKDTSTSAVISAVVLALILSG
                     VFLSCFIYLRPRFPALYQPKTYRALPPSRNTQPLPTDAFKWIGQFLRVPDAEILRING
                     FDAYSFIWFLVLMLRIFVPIWILSWIVFMPLYAADLPIQEEQGGDGRGTGFNMFIFGN
                     IVNENEQQQKRSAGVLIMHYIFMAWIVFNIHDVMKHFIRLRKEFLTSPEHRNTNQAKT
                     FLVSSVPNELLSETKMKELYGNVPGGVKRVWINRNLKELPDLVEKRDKLATKLEGAVC
                     KLISTAAKKVKKGKVDPLSVSEDDVPSLDVSDRYVPEKKRPTHRLGKIPCFGEKVDTI
                     NYSREELTRLNREIEASRQNVIDDYETYPPQSSAFILCNTMQGAYRGASFRPVENKTQ
                     MDRRYVEMHPDDVVWKNMNFNPYERKVRSACCWGVTWVTVIFWSIPVAVVSLFSNVDY
                     MSEKVSFLGWIKSIPNVPIGIIKAVLPTAALAVLNSLLPPWLRYNARMSGIPSKNLIE
                     LSLMTRFFIFMVIQNFIIFTVLSGIQQKLSDFSHAVHDPEKFVQTISSAIPRVSSFYL
                     EYVFLLGLSGAAGMFLQLVPLILYYIKLNFLGATPRKLWHLRNDMAAPAWGVLYPTTL
                     FITVLAFVYMMLQPVINGFASVTFFTYYLAHRYLFLYVFDVQPSTETAGAFFVKAIHY
                     TFICAYLSCLLVALMYLFNSRNNQSFIAMGVLTILLGVLVAVYHYYMTAWYKKEMAQI
                     PDLLAQKEQDMSVVPFSDGQDGAMPVLLPDKNEYYTDAQPFSQDHGIAMKAMGSAPGA
                     QTIQMEDPEEEQEKEQLREINTMNAFFNPARLKDQMIQWYPNDNFGIGRSQMAADIDA
                     GYQASVADAFINDKYKIDEKAEVPPGETKH"
     gene            <311729..>312101
                     /locus_tag="MRET_2561"
                     /db_xref="GeneID:38739327"
     mRNA            join(<311729..311769,311813..>312101)
                     /locus_tag="MRET_2561"
                     /product="ubiquitin related modifier 1"
                     /transcript_id="XM_027629188.1"
                     /db_xref="GeneID:38739327"
     CDS             join(311729..311769,311813..312101)
                     /locus_tag="MRET_2561"
                     /codon_start=1
                     /product="ubiquitin related modifier 1"
                     /protein_id="XP_027485154.1"
                     /db_xref="GeneID:38739327"
                     /translation="MGEAQDVRVIVEFGGGTELLLAPPHAKTHDIVLPASASDGGNRP
                     TMSTLVEYIRTHLIKEREELFVENDHVRPGILVLVNDSDWELEGEMCYELKSGDRVVF
                     ISTLHGG"
     gene            complement(<312145..>313962)
                     /locus_tag="MRET_2562"
                     /note="MRES_12445"
                     /db_xref="GeneID:38739328"
     mRNA            complement(<312145..>313962)
                     /locus_tag="MRET_2562"
                     /product="metal transporter CNNM"
                     /transcript_id="XM_027629189.1"
                     /db_xref="GeneID:38739328"
     CDS             complement(312145..313962)
                     /locus_tag="MRET_2562"
                     /codon_start=1
                     /product="metal transporter CNNM"
                     /protein_id="XP_027485155.1"
                     /db_xref="GeneID:38739328"
                     /translation="MHSLERTRPHGPGHGIAPASATKLVMALLAYVFHSAFMAVRASP
                     VVMWAVPTSSTMTMTRPRDHVEAPIEHNEPWKKVMDILMIAFLVLLGGVFAGLTLGLM
                     GLDMVNLQVLMTSGTDQERQNAAKVMRLLERGRHWVLVVLLLGNVIVNETLPIFLSEF
                     GSGLTAVILSTILIVIFGEIVPQSICARYGLSIGALCAPLVHGAMILLAPVAWPTAKL
                     LDYCLGEEHGTTYRKAELKTFVSLHQQIGTEHLNDDEVTIIRAVLDLNDKTVADVMTP
                     IEDVYTLPIDHVLDDAGVDELVQSGYSRVPIHENDRPDAILGMLLVKQLIQYDPEDAW
                     PVSRFHLTPLPETSPDLNLLDAINYMQVGRSHMILVSKHPGEPSGAMGVVTLEDIIEE
                     MIGEEIVDETDVFVDVHNKIKVVRTKPSGAKQDQWQPLIRGIIERRRKYGGPKNIPLH
                     NSFGTMGQGPMSRTRSFSRSSKYGTMPQSKAHDKVSIKKIGHRRTGSGPQSELSPGMQ
                     ADKTPLQTPKSMSSSITFSDYGPESLNLAESERTFQAPGPYIVEAVHGTSDEFRVITV
                     AELNEDTAHDLHNKAVHEAVKQAEESAHVSQFNDDPGPT"
     gene            <314136..>315239
                     /locus_tag="MRET_2563"
                     /note="MRES_12450"
                     /db_xref="GeneID:38739329"
     mRNA            <314136..>315239
                     /locus_tag="MRET_2563"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629190.1"
                     /db_xref="GeneID:38739329"
     CDS             314136..315239
                     /locus_tag="MRET_2563"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485156.1"
                     /db_xref="GeneID:38739329"
                     /translation="MTTVQRIKEIEDEMARTQKNKATAYHLGQLRAKLAKLKRELIAP
                     SSSGGGGGGMGFDVARTGIASVGFVGFPSVGKSTLMSGLTGTTSEAAAYEFTTLTTVP
                     GTMVVRGARIQILDLPGIIEGAKDGKGRGRQVIAVARTCNLIFIVLDVCKPLHDKQIL
                     EAELEGFGIRLNKKPPNVIVKKKDKGGLAITNTVPLTKLDHDEIRAVMSEYRISNADI
                     AFREDVTVEELIDVIEGNRIYIPCIYVLNKIDSISIEELDLLYKIPKSVPISSRMWLN
                     VDELVDKMWDELDLVRVYTKPRKCPPDYTSPVVLRRGKCTVEDFCNAIHREIFKQFKC
                     AVVWGTSAKHPRGQRVGGDHVLEDEDCVTIFKR"
     gene            complement(<315286..>316398)
                     /locus_tag="MRET_2564"
                     /note="MRES_12455"
                     /db_xref="GeneID:38739330"
     mRNA            complement(<315286..>316398)
                     /locus_tag="MRET_2564"
                     /product="cytoplasmic tRNA 2-thiolation protein 1"
                     /transcript_id="XM_027629191.1"
                     /db_xref="GeneID:38739330"
     CDS             complement(315286..316398)
                     /locus_tag="MRET_2564"
                     /codon_start=1
                     /product="cytoplasmic tRNA 2-thiolation protein 1"
                     /protein_id="XP_027485149.1"
                     /db_xref="GeneID:38739330"
                     /translation="MPRECVLCGQERAVLRRPKTGDLVCRNCFFYVFETEVHQTIVNA
                     QLFRRGDRVAIGASGGKDSTVLAYVMKTLNERYDYGLQLFLLSIDEGITGYRDDSLET
                     VKRNQEQYGIPLKVLGYKELYGWSMDDIVASVGRKNNCTFCGVFRRQALDRGAASLGV
                     DHIVTGHNADDMAETVLMNVLRGDIARLERCTDIVTKGPDGTEEDDEHQGCGGGQSGF
                     GGSGIRRSKPFKYAYEKEIVMYAYFKQLDYFSTECIYSPNAYRGYARSFLKDLESIRP
                     SSIIDIIHSGENLHVAGQVKRAVQRTCARCGYISSNELCKACVLLEGLNRGAPSLGIR
                     SDKSRAVREALADAQPDIGHTIPRWEGVQRSSATAW"
     gene            <316460..>317434
                     /locus_tag="MRET_2565"
                     /note="MRES_12460"
                     /db_xref="GeneID:38739331"
     mRNA            <316460..>317434
                     /locus_tag="MRET_2565"
                     /product="ubiquinone biosynthesis protein COQ4"
                     /transcript_id="XM_027629192.1"
                     /db_xref="GeneID:38739331"
     CDS             316460..317434
                     /locus_tag="MRET_2565"
                     /codon_start=1
                     /product="ubiquinone biosynthesis protein COQ4"
                     /protein_id="XP_027485150.1"
                     /db_xref="GeneID:38739331"
                     /translation="MLRRYVPYGTRRALTTTTRLASKASSSQHAHEVHEHSDYGVRAP
                     FWERALLGTGSALGLLVSPRRGDLLTVLTQVSSYPRIDELVYQMQSTHEGRRLLVERP
                     SINSHTIDIDALAQLPTDSFGRVWFEWLRANHVSPDGRCEAQYMPTFETRYVIQRYRE
                     THDFYHVLLGMPTSTLGETIVKYFEASHMHLPVAVLSAIGGSARILRDDGQAVLSQRT
                     TALDTPRLVGLADWAWRLGQLVRTPLISIAWERRFEQPLDELRAELGIDVPPPVLLDM
                     TQRPRTAQRTVAHVAGRRFFGWPSKVWERHGDKDERYAKSERRHHGQA"
     gene            complement(<317400..>318815)
                     /locus_tag="MRET_2566"
                     /note="MRES_12465"
                     /db_xref="GeneID:38739332"
     mRNA            complement(<317400..>318815)
                     /locus_tag="MRET_2566"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629193.1"
                     /db_xref="GeneID:38739332"
     CDS             complement(317400..318815)
                     /locus_tag="MRET_2566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485151.1"
                     /db_xref="GeneID:38739332"
                     /translation="MTSLLRSRLWTASPMLRLRPAVPVNGSTYATTARLLSRAPSQPS
                     STKSRAPPSGGVGSITIKAGVLFAGLSAFAIALTVYGVWDYFAAFRVWPKELREPLRA
                     AVKAQRNGKWKRSEKNFRHALETARMLGAEKLGKDPLLKTTGIAIALSAVLEEQGAWQ
                     EAIQVYLDALEEVRQTQQGASEPKRTPQEWMRAVALAQKIGDIAQKPGVHAPSMAHGP
                     KTITEEPCESYLAWSVEEMMRLVRGPSKEPVHLEDLPLPPWVDRQDLGASVEALGAFY
                     ASRGMAEYAVPLYVQAISMLLPTRRNRDAANDSPPPTVAERCHAAILMNNISQALTQS
                     HTDPGTMQRAIAWAMKGLDLVSLTSFRAGFLSDMPSEERDWLLQFSGLDPQRIGGVAK
                     TVEAESDMRLAHVKQQCLGTQFVLLYNLGMFYSMQNDKATARILFRRAMRQADRMQLR
                     DARSQCARAIARLDRDGDAQT"
     gene            complement(<318883..>320802)
                     /locus_tag="MRET_2567"
                     /note="MRES_12470"
                     /db_xref="GeneID:38739333"
     mRNA            complement(<318883..>320802)
                     /locus_tag="MRET_2567"
                     /product="cation diffusion facilitator"
                     /transcript_id="XM_027629194.1"
                     /db_xref="GeneID:38739333"
     CDS             complement(318883..320802)
                     /locus_tag="MRET_2567"
                     /codon_start=1
                     /product="cation diffusion facilitator"
                     /protein_id="XP_027485152.1"
                     /db_xref="GeneID:38739333"
                     /translation="MGGNPKGYDDEHRSSVTGVSNSGHDVLPTSSRKITMSPSRVGSE
                     ESVGGMKRTDSLASLRVLAQLIDGRTGYFEEARMSESALADIKNAGVREFYTQQNEHL
                     DGWREVDEVLESQFPTEVMRRFVVPQHIVAAEGAAGDTHNDRMADDIDDAIITDDEGE
                     SLSVHPFSYHAGRRGRGISERAMTSISGMLTKERMAMRGNSCAELAAESLQDLSTSIQ
                     LSEANREHKSLADLLERPDMDFSRDDSPYLRFERKSQNKTRRNRSLLRKMLSEHPVMD
                     EHAPSTSHPKLVEQFNYGSVSSTLPSSSSTTKPASMAVWTKADHERDQLLQNVPTHQR
                     KQDSDALVRFYININLLLNLLLVVGKIVAVWSSNSVSLLASLVDSVLDLLCTIVIFVM
                     SRATAYRSWHTFYKYPVGKRRLEPLGVLIFSVLMVVSFLQVLLESVSRLWDMWLGRSS
                     EKDLTLPMVGIVFMVMTIVTKTIMWMLCRSHKNSSMHAIAQDSENDAMFNMISLIFPI
                     LGQYLGLGILDPIGGAGLSIYIISEWVSTLADTTDKLTGKVASAQDAGRCLYLVSRFS
                     LVKAISGFEMYHVGDTMVAEVDVVLPMSFKLKEAHDLGEIITYCIESLTGIERAYIHL
                     DYNPSGQSGHIGQRG"
     gene            complement(<320969..>322111)
                     /locus_tag="MRET_2568"
                     /db_xref="GeneID:38739334"
     mRNA            complement(<320969..>322111)
                     /locus_tag="MRET_2568"
                     /product="3-isopropylmalate dehydrogenase"
                     /transcript_id="XM_027629195.1"
                     /db_xref="GeneID:38739334"
     CDS             complement(320969..322111)
                     /locus_tag="MRET_2568"
                     /codon_start=1
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="XP_027485147.1"
                     /db_xref="GeneID:38739334"
                     /translation="MSTTEYSITVLPGDGIGPEVIEQAVRVLEYISNKSSTFKLHIES
                     HDFGGAAIDSSGEPLPESTRVACKKADAILLGAVGGPKWGVGKVRPEQGLLAIRKELD
                     LYANVRPALFPSESLLEHSPLRPEVAKGTEFIVIRELVKGLYYGDRKEADLSAPDAKG
                     EAYDMMVYDKADVQRITRLAAYLAMQSSPPTKIHSIDKANVLATSRLWRHVVTETIEK
                     EFRDKGVEVDHHLVDSAAMVMVSNPRKLNGIVLTENMFGDILSDESSVIPGSLGLLPS
                     ASLSELPTGDKPCKGLYEPIHGSAPDIAGQGIANPVGTILSAALLLRWSLGKEHEATA
                     IERAVRRTLDSPDIGGFGLRTRDLGGQASTKDVGDKVLAALDDFLP"
     gene            complement(<322229..>323857)
                     /locus_tag="MRET_2569"
                     /note="MRES_12475"
                     /db_xref="GeneID:38739335"
     mRNA            complement(<322229..>323857)
                     /locus_tag="MRET_2569"
                     /product="A transporter"
                     /transcript_id="XM_027629196.1"
                     /db_xref="GeneID:38739335"
     CDS             complement(322229..323857)
                     /locus_tag="MRET_2569"
                     /codon_start=1
                     /product="A transporter"
                     /protein_id="XP_027485148.1"
                     /db_xref="GeneID:38739335"
                     /translation="MAEVQHDNSAEHVVSEKKDLSASDDVPDSFGTMTKDDKRAFILL
                     VVLYALQGIPVGLTFGTMPFLLKSHVGYGGLGFFMLSTYPYSIKLLWSPIVDSYFVSS
                     WRIPCTKWELYLGRRKSWIVPVQIIVGLTFIALAKNIDALMERADTLISLITCVFFAL
                     ISLAATQDIAVDGWALTLLSKNSLGYASTAQTIGVNLGYFMSFTVFLALNSVEACNKY
                     LRWTPKNTPILTLSGYLQMCGVAFICVTLWLLFYQKEAKESERMEIREAYSTIWQICQ
                     LRHVQLFLIVHMICKIGYQANDAVTGLKLVERGLGKEDLAFAVLVDFPFQLLFGYLTA
                     TWSRGDKALQPWMVAMVFKLLFAAMSMGVVAGMSADGSEPITTSYFLLILFSTILNSF
                     ASTVQFVGITAFHTQVADPVMGGTYMTLLNTISNLGGTWPRYFVLKMVDFFTVSMCRP
                     PLDVDFNKIEKMLHMSNASLSLGECKSEAGLEHCSKIGGTCATIRDGYFATSTICIAL
                     GVVTFVFFIVPICRRLQRIAPSEWHVVSHAQKKH"
     gene            <324000..>324962
                     /locus_tag="MRET_2570"
                     /note="MRES_12480"
                     /db_xref="GeneID:38739336"
     mRNA            <324000..>324962
                     /locus_tag="MRET_2570"
                     /product="thioesterase"
                     /transcript_id="XM_027629197.1"
                     /db_xref="GeneID:38739336"
     CDS             324000..324962
                     /locus_tag="MRET_2570"
                     /codon_start=1
                     /product="thioesterase"
                     /protein_id="XP_027485114.1"
                     /db_xref="GeneID:38739336"
                     /translation="MQRLLSGSSLSRHAISSHRMMYSVAVSQRSFSAGRAQRPSAKSG
                     HRSLAFWLLTGASAAGSCYLIGAKYPPRSIPFLFTPYSTKAGQMSEQETEAYCSEIER
                     AMHNLSAVREHISRSYEMPSATNVREKYGIKYHTPFAEKEEADYVITRPFVDAPPESL
                     EAQLTAGSLRGPHMFASFPMVFSKTKQGVKSGGGTEGDGMVVVHLGKNLCGYKGVIHG
                     GLIATLFDEALARSAFYSLPHHVGVTGKLELRYRKPVAADRFYLIETEVVETVGRKCF
                     VAGFLLDPKNRDVLAEANGVFIEPRWAKYASWVGSVDMRKHLDK"
     gene            complement(<327220..>328827)
                     /locus_tag="MRET_2571"
                     /note="MRES_12485"
                     /db_xref="GeneID:38739337"
     mRNA            complement(<327220..>328827)
                     /locus_tag="MRET_2571"
                     /product="transporter"
                     /transcript_id="XM_027629198.1"
                     /db_xref="GeneID:38739337"
     CDS             complement(327220..328827)
                     /locus_tag="MRET_2571"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_027485113.1"
                     /db_xref="GeneID:38739337"
                     /translation="MVPVNDMFEPEKEHEEEVPLRSQLDPAVYKSLERNACLKIDLQV
                     LPLCLLLYLLSFLDRTNVSQSMMDRGETRPDGSIKDPGIMTSLDMTPHQYATALSVLY
                     PTYMVFEIPANLMIKRVGARIWMPFLVMAWGLVETLQGLVSSKTGLYICRVFLGLTEA
                     GIMPGITVYLTFFYRPNELQYRQAFFFTGTSLSCAFSPLLAVAIRKMDGIAGQHGWQW
                     VFYLEGIFTVLVGFLSYFLLSNEPADCALLSPLEKRVAVERLQETSDRYTNHDDLATK
                     LKQTEPDVSEDEAPRYVASTWSREVWRAFTDIRCLLISVLGFCISMPIFSLAYFMPSI
                     VKGINDDYTTVESMLMSCPPFAVSFAFSLIIAVVSDRTRQRYFCMVACYVLCIVGLAV
                     ALGCNDSMTRYGGIIMVTSGGYAGPPCLLAWIANNTAGHYKTATALAMIIILDNCSGL
                     ASAWLFNTKTEAPRFTRGISTNLAMSVLGLILATILELLIMHERRQRARGRRDEAVLA
                     LYKRTRWTEEQLREYMGDDHPEFHLEL"
     gene            <328986..>330464
                     /locus_tag="MRET_2572"
                     /note="MRES_12490"
                     /db_xref="GeneID:38739338"
     mRNA            <328986..>330464
                     /locus_tag="MRET_2572"
                     /product="U4/U6.U5 tri-snRNP-associated protein 2"
                     /transcript_id="XM_027629199.1"
                     /db_xref="GeneID:38739338"
     CDS             328986..330464
                     /locus_tag="MRET_2572"
                     /codon_start=1
                     /product="U4/U6.U5 tri-snRNP-associated protein 2"
                     /protein_id="XP_027485112.1"
                     /db_xref="GeneID:38739338"
                     /translation="MASDQSAAAPEAGQKRPRTPEEEIKGAEYWEEQASKVARKACVR
                     RDLYLDTIHRDRLDFDVERVCSVSLSRTNVYACLVCGKYFQGRGPKTHAYFHSIDESH
                     HVFMHLDTTRVYVLPDNYAVDDPSLADIQYQFELTFSDEQLAQLDAPEQLSRDLHART
                     YVPGFLGLNNTAHHEAINVVLQALSHVAPLRDFFLRRRPGSDGTELLRRFGTLVRRLW
                     NPRAFKRQVSPHEFLQQVSQASHGRFTASEACDPVDFLGWLLNQLHRDLVGGSASMAR
                     KTSSIITDSFQGAMRLETQNVAVRTGLEEDASSAVRVDRAVRVDEVPFLFLAMDLPPL
                     PVFPDGSDNMMPQVPLAHLLAKYDGKTNQDVHGAIRRHKIKHLPPYLILHFRRFTRNR
                     FVDERNTTVVHFSPMGLDVKALVDAPDPQLGTTYKLMANITHEATAGTVRDQSTWSAQ
                     LHTRHVPPQWFQMHDDLVERVDPHMLFLGESYLQIWERVAPT"
     gene            complement(<330461..>331906)
                     /locus_tag="MRET_2573"
                     /note="MRES_12495"
                     /db_xref="GeneID:38739339"
     mRNA            complement(<330461..>331906)
                     /locus_tag="MRET_2573"
                     /product="aspartyl aminopeptidase"
                     /transcript_id="XM_027629200.1"
                     /db_xref="GeneID:38739339"
     CDS             complement(330461..331906)
                     /locus_tag="MRET_2573"
                     /codon_start=1
                     /product="aspartyl aminopeptidase"
                     /protein_id="XP_027485111.1"
                     /db_xref="GeneID:38739339"
                     /translation="MSSVALNRGPAVPAAARRFLQYVAASPSPFHATASSVSMLEEAG
                     FTKLHEHQSWNDKLYVGGRYYVQRNQSSLVAFVIGKQFTPGQGVHIIGAHTDSPHLRI
                     RPISKRSKEGYLQCSVETYGGGQWHTWFDRDLSLAGRVIVAQDASRFVSRLVHIQRPL
                     LRVPTLAIHLNRSVNEAFTFNHEDQLQPILGLASMLNEPDQSMAAVPGLSAKHHPVLL
                     ELLAQELDVPVSAIQDFELSLYDTQPPAVGGVSNEFLFAPRIDNQMSCFCATEALVAS
                     VLDLDALNTSQSIRAIALFDHEEVGSVSNQGAESNLLWSMIHRLSHLHVNGVEDSTAS
                     SAADLSEQSLARSFLISSDTAHAVHPNYASVHEQNLRPHMNAGPVIKINAKQRYASNA
                     ATSFLLRRVAQKAGVPVQEFEVRNDCACGSTIGPMLSKMVRTVDVGNPQLSMHSIREV
                     CGSHDVDYKIRLFVEFFRSFEQVDRELHIDD"
     gene            complement(<331951..>333783)
                     /locus_tag="MRET_2574"
                     /note="MRES_12500"
                     /db_xref="GeneID:38739340"
     mRNA            complement(<331951..>333783)
                     /locus_tag="MRET_2574"
                     /product="zinc finger protein, GATA type"
                     /transcript_id="XM_027629201.1"
                     /db_xref="GeneID:38739340"
     CDS             complement(331951..333783)
                     /locus_tag="MRET_2574"
                     /codon_start=1
                     /product="zinc finger protein, GATA type"
                     /protein_id="XP_027485116.1"
                     /db_xref="GeneID:38739340"
                     /translation="MEPPPPPRPMAPAGGGQATAAADARPKKPKAPARTKQGALASLE
                     GGYIGLPATDAPLPGFAPAGGGARKVLPEWVLPFPLGIRPCAAEGTPLASSPVLWQAL
                     RQTRMMHMLQVLPPFSHRHRAGVEYFDHVPRELLPDLPDRAAHALVSLGRADVQAGPM
                     RYVGVRFWHARRTSSPSAPTPLDPGFILRLQQRAEKDVHLQHLLQLARTHQLPPSGLA
                     QLNVILAELMPPPLPPSACAPPVVLVEFPENPGVLFLLPLWHMAIERCVSHDARHLLL
                     SFMIPAIGSKAAGESGKDEALRAVQGMLVRDVSAVPTAAAPEPAPPKAPAPRSRRATR
                     SKSESMPPPRTPSPPPIPARQHELFPLVWRITGPIDERLWDCFGRVPGALTNGTCASE
                     QDEHIFSAIKASIQARMASMPREQPLPQHVADADIPPGLSDHIHDKYAMRVLIHTSRP
                     QPKRKVATLSDTREPATRHAAERTALVSSVDARGDMLKPKRKRHVATHNPDGTLKSCG
                     ACGKTKTPMWRRGPKGPSQLCNACGAKWKAGRLVVPDVPPPPLVDDVMPVRHSKPAAP
                     SPAPSTSDSIVPTMPPVPTVPRTMEAPSAAPPPPPPPSAPSEGR"
     gene            <333855..>335891
                     /locus_tag="MRET_2575"
                     /note="MRES_12505"
                     /db_xref="GeneID:38739341"
     mRNA            <333855..>335891
                     /locus_tag="MRET_2575"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629202.1"
                     /db_xref="GeneID:38739341"
     CDS             333855..335891
                     /locus_tag="MRET_2575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485115.1"
                     /db_xref="GeneID:38739341"
                     /translation="MRHGWRRAAQAVQHVRCASSHVRPAERLAQYDWRRVQSLALGGP
                     DSRADVVDVVRHVRSKDPRASHLAKLCREHMLRGAWEQRPEMLSMALCVRAHETSVSD
                     AWHWMRSAYPTWIPHPDDASWAVQALLAAKEREAAWDVWQDTRSMHVMPRASAINALL
                     SAWGTHDAATSLVLDVGIAHLDIVGLSTYVHLHTKARVFREAVHDAAQVLRERLATSH
                     DKIAWHAMLLYTGYTRGTEAAMELARDSRDAFQPDAYTVSTLALCYAANGIASCDDAL
                     HMLDAIHEAVRVRPTTHALSMAIQAVLAQKSLGDPQQAFEAYALYREARTAWSLESDA
                     AVLQPLIEAHCAAFVPHIDRAWSLLQEHIYTPPRSLWARWRRTPQRPTVDLGLFYPLV
                     MACARLHATPLALEILACMRELRLRVPPHAALTMTRQLMSACATWDEATRTYHAVHAL
                     GGWAHDTYARVLALVCRHTIQDERAPPELALQVLGDMRHAGFHPSAQTYTVLLDYYAK
                     VHAGLAGVRATHALIQRDVQLEPDLVLIHALMNAYNYAGAPAQVLGIWDSLVVLCHNA
                     SGTLVDDITVTIVCDTCGRAGLLDVMRRVLDTVQDMDPALMTKNVYDAWVECLARCGH
                     LVEAMHVVLDEMRPHAHTMPDAKTVHTLLKFSQNDPEHGSHVRRALQEAFPALC"
     gene            complement(<335888..>336541)
                     /locus_tag="MRET_2576"
                     /note="MRES_12510"
                     /db_xref="GeneID:38739342"
     mRNA            complement(<335888..>336541)
                     /locus_tag="MRET_2576"
                     /product="exosome complex component CSL4"
                     /transcript_id="XM_027629203.1"
                     /db_xref="GeneID:38739342"
     CDS             complement(335888..336541)
                     /locus_tag="MRET_2576"
                     /codon_start=1
                     /product="exosome complex component CSL4"
                     /protein_id="XP_027485236.1"
                     /db_xref="GeneID:38739342"
                     /translation="MALGDLLLPGQPIATTRDAAPGEGTYVREGYVISSLIGRRSSGE
                     ERQAQVQGTQLPLALPQTGSTVIGRVTRVNPRQANISILVVDGLPCGGVQGTAVGAYS
                     NRAAGEGIDGSDFQGIVRAQDVRSTEKDSVVLVDCFRPGDIVRATVISLGDARSYYLS
                     TAHNDLGVVHATTCGPTRYGWAPAEHVLQPISWCEMADPVTGHVERRKCAKPDWLRA"
     gene            <336654..>338615
                     /locus_tag="MRET_2577"
                     /note="MRES_12515"
                     /db_xref="GeneID:38739343"
     mRNA            <336654..>338615
                     /locus_tag="MRET_2577"
                     /product="protein LTV1"
                     /transcript_id="XM_027629204.1"
                     /db_xref="GeneID:38739343"
     CDS             336654..338615
                     /locus_tag="MRET_2577"
                     /codon_start=1
                     /product="protein LTV1"
                     /protein_id="XP_027485255.1"
                     /db_xref="GeneID:38739343"
                     /translation="MAPKSIWRQPNAVHFQLVHRSQRDIMRHDPDAGAGVLKPFEPLN
                     RAGLKGKSRAELMQEDPSLGAEGDDALPRKNIGQAALYGIYYDDTEYDYMQHLRAIND
                     TENSMRGGVDEEDDTEAVWIPSAVPSKQKAPSFAWKDDEKKHDLMLPSSAFASEEISL
                     SQAYDDATPQGLQPDMDPHLRQTLEALDDDAFVDDDLNDDFFQDLVQDGVWSGQREAG
                     DEWRDAAPEGDDIWLDPVDRAKRELASAGGDESALSLEARVALFKARAKAADSDEEDE
                     ERDTLGELGPPVPRRVRPSGSVSSSGSALGKKGKPGALARRAASTKAGSVSGASSAWS
                     MTSSSMYRNPALTELDSQFDQVIRNYGGQATGDPELDALHGAFDDVQDDEEDEELDSE
                     TAEKLTRSDLDAILDEFLDHHEVIGGKLKQTLGDRTTTADEKLDIVRRELGEARITDT
                     GDDDEEVMPSKENPFLNPDIIGRDREQWDVETIQTTKTNLENHPRTIPAAESVRGSCH
                     ASTAAYTLPQSITVDGDDRIPKIRLHPRTGMPQIVGYTTTRKTRKASWPTPKEDEDVN
                     ENGDEDDGNASDATIDASKPVTVHKRDRNESKEARRQRKEAVKNEKQQRRIDKASAKK
                     AFSDERKRQNHAARRQTESRGGASGVHLA"
     gene            <338783..>340993
                     /locus_tag="MRET_2578"
                     /db_xref="GeneID:38739344"
     mRNA            <338783..>340993
                     /locus_tag="MRET_2578"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629205.1"
                     /db_xref="GeneID:38739344"
     CDS             338783..340993
                     /locus_tag="MRET_2578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485223.1"
                     /db_xref="GeneID:38739344"
                     /translation="MAQAYPDEARAMRHHTRQHAPRHRRVRRSRHYSQEKADQHPLET
                     QHRAESRRRSGYVTPPLSLSQRANATPKTSSVGHGGHRDVLVAGHSGKMHSGPSSRPA
                     PRRRPRKREGVKDDLATDVAHPPRQRSRKHGQPRHRSVRGTDSAIVSSRRTAGLLEGS
                     GTSVMDARSMHTAYSSLPPNRNEDADDAMLAAMEQPRTNRTRNLASVPQNQVNTMKEG
                     RVFPMNGIDNLTLLMEEDAYHPACFSMYLFKSTLDYRTVRDFFEVLVQLYPKYRYVVD
                     FQPYSAHIRDKKRRAKSEEEREKIHRERNEALKQGKLPPNHGPRTRYSRTMRAGSWLR
                     PAQWRIDEDFHISENIEVISCADRGSDDHLFKIAGRFLARPFDYNKPVWEALLVQGLD
                     TLNGGKSALMIKIHHCFSDGQGMIQSYHAALTAMSKGMGIKEVQQWVDIAKKKKSGRK
                     DVTPTVLGTMSHISYTVRELYMRKRKSFLYRNPSQPRSTQRLYYHSDGVPMDAFKRIR
                     QAFNSEFMALTLNDVAIAILARAMAQAAEQLNPRNTKQDRRAAVFVPISLRPEGNWDL
                     FNFTTGAMAWLPYPDLKNTTVVEQLSRVHKEMHRLKRSYLPKMWYKTFYHWCKHRILF
                     LPNYPVFRQFFYRAFSEYHVATNVPGPTEPVKFGKHEAYSYHVLPPSSPGKATMAIGM
                     ISYASDFSLAVSCDDVPEFKEVPRVLCEAFQDAAQALIEAADKHLASQRQQTHK"
     gene            complement(<341013..>342518)
                     /locus_tag="MRET_2579"
                     /note="MRES_12520"
                     /db_xref="GeneID:38739345"
     mRNA            complement(join(<341013..342188,342218..342280,
                     342309..>342518))
                     /locus_tag="MRET_2579"
                     /product="pyruvate dehydrogenase E2 component
                     (dihydrolipoamide acetyltransferase)"
                     /transcript_id="XM_027629206.1"
                     /db_xref="GeneID:38739345"
     CDS             complement(join(341013..342188,342218..342280,
                     342309..342518))
                     /locus_tag="MRET_2579"
                     /codon_start=1
                     /product="pyruvate dehydrogenase E2 component
                     (dihydrolipoamide acetyltransferase)"
                     /protein_id="XP_027484795.1"
                     /db_xref="GeneID:38739345"
                     /translation="MYALLRQQMLRAGMRMRLHPVAGLHTSAALRELSKFTMPAMSPT
                     MESGGIAAWHKKEGESFNSGEVLLEIETDKATMEVEAQDDGVLAKIISGDGSKDVPVN
                     KTIAIFAEEGDDLSGAEALAKEAEGEAAASNQAEEAKKDESKEEAKKEEAKKEESKKE
                     EPKKEAPPKTSSETQPSGGKPLDHVFATPVAKRIALERGIPLLQIKGSGPEGRILKED
                     VEKYASGGGASAAGATPSQAAAGPSYTDQPISNMRRTIAKRLTESKATLPHYYVTFDI
                     EMDRVLQLRELFNRASAEAANGNAEKAKDAKLSVNDFIVKAAAIALRQVPAANSAWHG
                     DFIREYHTQDISMAVATPNGLITPIIRNCGALGLSDIGRMSKELAKKARDGKLKPEEY
                     QGGSFTISNMGMMGTSHFTAIINPPQSCILAIGASESRLVPDESSEKGFKTVQVMKAT
                     ISADHRVVDGAMAAQWMQSFKAALENPLSFML"
     gene            <342667..>343737
                     /locus_tag="MRET_2580"
                     /db_xref="GeneID:38739346"
     mRNA            <342667..>343737
                     /locus_tag="MRET_2580"
                     /product="RecQ-mediated genome instability protein 1"
                     /transcript_id="XM_027629207.1"
                     /db_xref="GeneID:38739346"
     CDS             342667..343737
                     /locus_tag="MRET_2580"
                     /codon_start=1
                     /product="RecQ-mediated genome instability protein 1"
                     /protein_id="XP_027485214.1"
                     /db_xref="GeneID:38739346"
                     /translation="MPPAAQEHLQHVHDALLSELGHVPLSNVWLNECIAHLCSLYPTL
                     VFDRAQLLQRVRAQLLVSDLIQSMDHGSLQLHKYSQALVQVVGIMDVGVSAQSLYDAW
                     ISREAEPTTPFPRGMLRLELSDGFIQQPIMAYEYEPIPDLSLLTCLGTKLLLRHPIQE
                     RGILLLSPQSVCVLGGTIPELDSHAALAERICAPLNKDVSTLKVQRHPTTSLSFANTS
                     KKKSVESESQFKRVEEKQPDMEAISLDDNEDDDVLLMDAELAIREAELTHTQSPRSSL
                     LQKLYDTPMSTPSATPSSSHPESISTSARHAHDKLFVPKRGTPISQSSSIYLVSSDVE
                     DAADPPTDSRTYIAISDDSDDA"
     gene            <343869..>344540
                     /locus_tag="MRET_2581"
                     /db_xref="GeneID:38739347"
     mRNA            <343869..>344540
                     /locus_tag="MRET_2581"
                     /product="proteophosphoglycan ppg4"
                     /transcript_id="XM_027629208.1"
                     /db_xref="GeneID:38739347"
     CDS             343869..344540
                     /locus_tag="MRET_2581"
                     /codon_start=1
                     /product="proteophosphoglycan ppg4"
                     /protein_id="XP_027485215.1"
                     /db_xref="GeneID:38739347"
                     /translation="MPSQKRGDKMRNAAMQEAMRSTMRYRHGAIITKGGKILSQGHNH
                     VRTGFSGPLFAHEAVHLPSNRQMEVNDEDTSDNSCCHPATRSGPRSQSQAYFSMHAEM
                     HAVTSALRGAKPHIPRSSLILDPVDVACSKLREMSLEMQDGSRFSDASSMVSTGKRVV
                     NTKTKCDRALVEGAKREQERVAFATETQWCLKPRDKAGTKEKPKARPRWSFERCAVPM
                     LSIRR"
     gene            <344575..>345264
                     /locus_tag="MRET_2582"
                     /note="MRES_12525"
                     /db_xref="GeneID:38739348"
     mRNA            <344575..>345264
                     /locus_tag="MRET_2582"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629209.1"
                     /db_xref="GeneID:38739348"
     CDS             344575..345264
                     /locus_tag="MRET_2582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485213.1"
                     /db_xref="GeneID:38739348"
                     /translation="MQRTQQIEQRKREKRERKARGLRNASSSGSSSSSETLSLSDPPT
                     PPNEAAPLTVADEAERLSTSHTPPIPASTTLAYRKVVMRRSHSNMVDSRIRGADLYVV
                     RLLQDTHSKAKMKEQRRRQRGQTSVSDTASNVRPQYADSRPCWRCLEWMYWAGIKRVF
                     WTDTDGAWHGDKVVQLLFGSANPNGLASMTSSAVYVPVHLTQYEHAAAKLRIKTSSQR
                     SCMDDNDTFLM"
     gene            <345595..>349983
                     /locus_tag="MRET_2583"
                     /note="MRES_12530"
                     /db_xref="GeneID:38739349"
     mRNA            <345595..>349983
                     /locus_tag="MRET_2583"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629210.1"
                     /db_xref="GeneID:38739349"
     CDS             345595..349983
                     /locus_tag="MRET_2583"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484792.1"
                     /db_xref="GeneID:38739349"
                     /translation="MLKGMYDNQASHPVDAADQTMFVHESRPSETSNALDAFTDTDDE
                     GMRSDPHSTQTFQARTPSARLYQSRSSATASPSYFVIVIPPADLPVEALPRMVSARAL
                     ARRGTLLPLYPTLGGQLYAIAREYGLPSVGGISLYLVDDGNGNGGPRIGDSTWAALWS
                     SFFEDDLEDALPPPPMSDVFESEPHQRVSSFSYQRRGSGQYPTPPRPRQTTPSRRLQR
                     ISSHASMATTRSMPSGTFEPSRLPIVAKLEWVVDPLRAKWWPPFLAHAEAVAESATSP
                     SKSDGPPLPTPRSGGPRPLHLTSQLSSPPPSRGLPHPPATFTPPQQRLQPQPKSLEQA
                     LDQGQMQVQEQDENQDHKQLTDSPQLDAQHYSATKDEITPQDAPVKLRDAPIIVPARQ
                     DSDAPDSNPVSSAPEMTTAPTTQMDKPPFVQDGENWSMERVHPESDTTELTSLPVADA
                     TPPQETLKTETAQPDAVSEEASDKNADQSKPERHTMSATVASLSAAASRLFGHKPRTP
                     PSPELDVEEARDRLTEQERERALARRHKHRASIDIPRSVKRASVRMTEAMEQAGPDSE
                     SQADDGKARGHKRSTSTPHATSLTWNARSKNDDVFQLESLPAAPPVPDVQTSNVPENS
                     VSRPSSKPIDSLRMSDASTLRSPIMLDHTLPAIDPQHEEGMTLMDPPTAAQLSRQDSV
                     DFNNTLGDLQRALELLSPRSDVSQRRKTRIMHARRSARPSSVLVDTNDSPSLRSGAAA
                     PPVTDSLVPRESVQDFSPGDAGSNAVTQQPETDQSVKKTGVMPYESDPHLQPRKAPEA
                     ALASNASYLMTPSAHGNLSQFDGTTTWDAPVPDTSGWSAEHTPMTSALAQWGHGPQPA
                     WEVPSWQPSPMPRAMDEPQAWPYDVMASSTEPLHIRESQPFGHQTDDPASGFKEKMLD
                     PLTQRLQAFPDEQTFARETLSTKQTLTSEAVPNEAISSQETFSMHQARLVPEAPAQLM
                     PPDQMLTGQPPSQQATSHPTSLSVAPATPDFTSESIYQVPVPRLGPLPLSIPPHDGAW
                     SVRWDYPTENAQENQSEDTAQGARQGPPPPPKETDHELFQTQWLSNPDETSSQLGSSL
                     QNLQPETREDANEELWAPWSKGEAYTVNPSVPTHQGLPSSQPMAYGSMVDDTSLPQRD
                     PASVPYGIPAPPSVALGDHNMVQASSMYPPMQGRSTPQNQMPMMTSTLSPISPQAQGP
                     NTSGINTSELHMEPDPQGSPPVLSQSRHFFAKMSPKFKWNRRKKDDKTLSQPATPSGA
                     GQTLSLSMSEDDVSFSERPRPSPSSWTPLGKNGRRQNVHSADSQQGLTIETPPAVYSP
                     DVSKSNANVASKRQIASQSTMNNFAMQHDDSFEASFSAQHNPSSMPASAALSAPHGPT
                     PTDWQSLNTSASAPTTTMPSPSQLIALESQGVVSPTQTSDPHGEPNTNAHGNLLNAAE
                     QTLQDSTHKASQSVTSGMRQLFHRGL"
     gene            complement(<350035..>353628)
                     /locus_tag="MRET_2584"
                     /note="MRES_12535"
                     /db_xref="GeneID:38739350"
     mRNA            complement(<350035..>353628)
                     /locus_tag="MRET_2584"
                     /product="DNA-directed RNA polymerase II subunit RPB2"
                     /transcript_id="XM_027629211.1"
                     /db_xref="GeneID:38739350"
     CDS             complement(350035..353628)
                     /locus_tag="MRET_2584"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit RPB2"
                     /protein_id="XP_027485216.1"
                     /db_xref="GeneID:38739350"
                     /translation="MYVEEGVEEISQEDCWDVIKAFFEEKGLVRQQIDSFNEFMSNTV
                     QELVEESKSLTLEQAEQHTGNAEDKTRRYEIEFGQIYMNKPRQTEADGSTAPLFPQEA
                     RQRNLTYSAGLHVDVSQKVLIKGEEDELDENGDQLWIPDPSQEEIVDEKVYLGKVPIM
                     LHSHFCWLTDLPDEDKYSLNECPFDSGGYFIINGSEKVLIAQERMAANHVYVFSKAPP
                     SPITFLAEIRSAVERGGKTISTMQIKLFSRNREKSLNNTIKATLPYIRNDIPIVIVFR
                     ALGVVPDRDILQHICYDFNDTQMLEMLKPCIEEAFVIQDREVALDFIGRRGTTTGLSR
                     SKRTTYAQEILQKEMLPHISMSEGSNTKKAYFFGYMVHRLLLAALDRREIDDRDHFGK
                     KRLDLAGPLMSGLFRMLFRKVTRDIYRHLQRCVEDQKEFHLQAAVRHATITNGLRYSL
                     ATGNWGDQKKAMQSKAGVSQVLNRYTFASTLSHLRRCNTPIGRDGKIAKPRQLHNTHW
                     GMVCPAETPEGQACGLVKNLSLMSNISVGTPSAPIVEFLEEFGLTSLIDMQGADPKAT
                     KVFVNGVWLGTHDDPGQLVDTLRDLRRKDDISHEVSVVRDIREKELRIYTDAGRLMRP
                     LFIVDPQSMTLLIKRHHVEALNDESGEGWDWSRLVQSGVIEYLDTEEEETVLICMSPM
                     DLEQSREYKATNGNMPPDTSDATRRLRSAHTFAPDTWTHCEIHPAMILGVCASIIPFP
                     DHNQSPRNTYQSAMGKQAMGVFLTNYQIRMDTMANILYYPQKPLATTRAMEHLRFREL
                     PAGQNAIVAILCYSGYNQEDSVIMNQSAIDRGLFRSLYYRSFQDMEKKVGVITMEEFE
                     KPTRETAIRLKHGTYEKLDVDGLVPPGMRVSGEDIIIGKTAPLPPDSDELGMRSKLHT
                     KKDVSTPMKSTESGIIDQVLITTNGEGAKFVKVRVRSTRVPQVGDKFASRHGQKGTIG
                     ITYRQEDLPFTCEGITPDIIINPHAIPSRMTIGHLVECLLSKVATLSGQEGDATPFTD
                     LTVKGVSDILFSLGFQSRGLEVMYNGHTGRKLQAQVYLGPTYYQRLKHMVDDKIHSRA
                     RGPVQILTRQPVEGRSRDGGLRFGEMERDCMISHGMANFLKERMYDASDAYRLHICDL
                     CGLTAVANLRKGTFECRACRNRSAISQIHIPYAAKLLFQELMSMGIATRLY"
     gene            <353897..>354883
                     /locus_tag="MRET_2585"
                     /note="MRES_12540"
                     /db_xref="GeneID:38739351"
     mRNA            <353897..>354883
                     /locus_tag="MRET_2585"
                     /product="pre-mRNA-splicing factor CWC25"
                     /transcript_id="XM_027629212.1"
                     /db_xref="GeneID:38739351"
     CDS             353897..354883
                     /locus_tag="MRET_2585"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor CWC25"
                     /protein_id="XP_027485119.1"
                     /db_xref="GeneID:38739351"
                     /translation="MGAGDLNVKKSWHPRLQKNQEKVWMQEQEAEAERKKLDELRKER
                     EQERQMQELQRIHEAAGGKKRPERVEWMYATPASSSGPSEAELEEYLLGKKRVDKLLQ
                     GNEAAQLSRVSDPGNQRDDSTGANSARDMALKIREDPLFAIKKQEQAMQEMLLRDPSR
                     LRQMRARLGLPNETPRHRHEHENDRSRNRDRHHRQRRDRSHDDRRYRYDHSHRYHDTP
                     SRRRSRSPEPRRLDAKERDARLASMMNNAKSMETDRNAMIERVTELERHEQAQEERQR
                     DKTHDKSRGGRAKFFHDQQRQLWGDAGRNMNLEESLRRGRHALQSVGDDHVS"
     gene            complement(<354910..>356629)
                     /locus_tag="MRET_2586"
                     /note="MRES_12545"
                     /db_xref="GeneID:38739352"
     mRNA            complement(join(<354910..356459,356485..>356629))
                     /locus_tag="MRET_2586"
                     /product="integral membrane protein (Ptm1)"
                     /transcript_id="XM_027629213.1"
                     /db_xref="GeneID:38739352"
     CDS             complement(join(354910..356459,356485..356629))
                     /locus_tag="MRET_2586"
                     /codon_start=1
                     /product="integral membrane protein (Ptm1)"
                     /protein_id="XP_027485117.1"
                     /db_xref="GeneID:38739352"
                     /translation="MTRRWVVCVTALLLVFPMIQAYVVQIKDTYAMRQTCSGVRAGTD
                     SRVDVVFYPNSTGTVTTLVYEFQDIGIIGKVAPDGSQDKLFMCTPEAVQDKLCTDKDL
                     GLYLIDKPNLSGTSIQQQRIDFGASLTNQTILSHKVNTTGFYCVSVEPYGSNMAMSEA
                     FRGHVDFVNSFHGQLPASEHPKLYFYGWLTLTYLAMAIAWLMLCFKYKDQIVTVQHFI
                     TGTMVLLTIEMACEWAYYSYFNAHAIDYLHFRSISGQASVTGMARFWLLLTNILEPAR
                     ESLSFFLLLIVAMGYGVVRPTIGSVINKVYLLTALHFICGAMYSVGVTLVLLDIASEW
                     VAFFIFPLAFTLTAFYMWILSSLKATTRYLSERRQTFKCAMFQRLNSILIGSVAFVSL
                     YLFGMILYVSLVGPNDFLYQSWKYRWFLLDGILSLLYFVAFALIAWTWRPTGNNMRLA
                     MSDELATDEETPGAEYEIHAIGQDDLDRDALEVDPNHLHQLSQAQNDTGVPPEYNEFT
                     SDGRIELKDDKHHHDIEDDEFDVVFEADHDMSRRSYDTDQKNDHEVQRLRLHEEDL"
     gene            complement(<356747..>357892)
                     /locus_tag="MRET_2587"
                     /note="MRES_12550"
                     /db_xref="GeneID:38739353"
     mRNA            complement(<356747..>357892)
                     /locus_tag="MRET_2587"
                     /product="aminoacyl tRNA synthase complex-interacting
                     multifunctional protein 1"
                     /transcript_id="XM_027629214.1"
                     /db_xref="GeneID:38739353"
     CDS             complement(356747..357892)
                     /locus_tag="MRET_2587"
                     /codon_start=1
                     /product="aminoacyl tRNA synthase complex-interacting
                     multifunctional protein 1"
                     /protein_id="XP_027485118.1"
                     /db_xref="GeneID:38739353"
                     /translation="MAQRSRQLLADMYSRLVTDQTALKSLTSSTKPLRTFAHELASLT
                     SKPEAVLGEDVKTTDEWLDQVEGMNGSLETLDKKLEPITFLSGNAPTAADYSLFASLY
                     DIVSTLPPAAQHAHPSLVRYFSHMSHLSAGSNIDPPVKPFEPVYEGFPKIVRKAEPKK
                     EKKAKDEAAPAEGATAKPKKEKKAKDKSSSGNGGAPAAPDSGPLPSMVDLRVGKIVKV
                     ERHPDADSLYLEQVDFGEADGPRTILSGLVNFVPMDEMQNRWIVGVCNLKPVSMRGIK
                     SFGMILCATAREGKEGGVQPVSPPEGSQLGDRVFVDGYEGMEPLEQMNPKKKVFETIQ
                     PSYTSTDAKECAWVGPAPNGAADEKSVRLLRTARGVCMAHFAGASLS"
     gene            complement(<358003..>360423)
                     /locus_tag="MRET_2588"
                     /note="MRES_12555"
                     /db_xref="GeneID:38739354"
     mRNA            complement(<358003..>360423)
                     /locus_tag="MRET_2588"
                     /product="zinc finger protein, C3H1 type"
                     /transcript_id="XM_027629215.1"
                     /db_xref="GeneID:38739354"
     CDS             complement(358003..360423)
                     /locus_tag="MRET_2588"
                     /codon_start=1
                     /product="zinc finger protein, C3H1 type"
                     /protein_id="XP_027485120.1"
                     /db_xref="GeneID:38739354"
                     /translation="MSRATKIADPSLHAADHATHADGGRESLIVQKSVDELLRAAHAS
                     GHLNMSTRIPALKACPEELFDLLADDVPPWWSHDGLSPDASSTAAWSKRTPLRALVLT
                     KNNLAALDERIARFDALHRLDVRENRLSTLPSTFDQLVHLTTLHLSQNAFTKIPTCIL
                     ALPALTTLDLSHNQLETLWTPDDVGTRGVSPPNILPSLSTLDLSYNRLKTSALVPMPT
                     SLEHLSLKHNDLQHPIPMDVLYPAKRLQELVLAENELSDVVFALNGTSFALPHLRVLD
                     VRATQVASLAHLESHFASAPSLSLSEAKDKTRSPVHAPAHESPACTPHQLVRVSNIPA
                     QDKHEVLSVATQHKTILSVLYVLSDVQVRSESHRRRRGGRGRGGEDRARIREERDEDG
                     HSVTPNAGSALANAKLSTKKKEALGQVPCKFFRNNGCSAGDACPFAHTLPGEGQPKAV
                     CQWYIKGSCRFGHRCALAHILPGQPMSMDRKNKRLAQQGSSQAAAKQAEEQQQRRASE
                     KSENPKLASPSPNGAGATAMFIPSRTSNMSEELAVSVSATTADTELAQSGWSHDITRP
                     HTYDATSTSAFGTSPFNHPGSHGLFFNSQPEARGSQPTSPWSSRKNEDPLAESAHAED
                     FLPSSLSDLLTPTELERRMRSTRDASSTSSSMQPTSFMQEMISQSMPATSHRLGSFDV
                     SPPTPLGQAPKFGGSSFSFMSGSVQPTRRPGNHSVHASPFMPPIFDNLLGSPPSLSPP
                     GTLSSSLGGERAPMPMSTPSHKGLSDDARRRTSTSSLFHGRGTIPISPAIVPVSEEDA
                     DDTIFELE"
     gene            complement(<360705..>361994)
                     /locus_tag="MRET_2589"
                     /note="MRES_12560"
                     /db_xref="GeneID:38739355"
     mRNA            complement(<360705..>361994)
                     /locus_tag="MRET_2589"
                     /product="aminomethyltransferase"
                     /transcript_id="XM_027629216.1"
                     /db_xref="GeneID:38739355"
     CDS             complement(360705..361994)
                     /locus_tag="MRET_2589"
                     /codon_start=1
                     /product="aminomethyltransferase"
                     /protein_id="XP_027485121.1"
                     /db_xref="GeneID:38739355"
                     /translation="MMGSVRATHLANMRSAFLLATRRNVRMTVPTVQRCYAALHTSAS
                     VWDAKTGLYDFHVKHGAKIVPFGGYSMPLTYEGVGQVASHKHVREHAGLFDVGHMVQH
                     MFTGPTALAFLQHITPASLTSLEPFSSTLSVLLSNEGGILDDLIITKHSDTSFYVVTN
                     AGRRAEDLAWIAKQLSAWNDAHKGEGDTQHRVMEGQGLVALQGPSSAAVLQPLLPQGF
                     DLASLTFGKSAMVPISTMSNKSALCHVARGGYTGEDGFEISIPADATVDVTETILANE
                     EVQLAGLAARDSLRLEAGMCLYGHDLDESVSPVEGALAWTVGKDRRAAGDFLGAERVL
                     HELKEGPPRRRVGLLVSAGSPAREGTRVFAEDGQTEVGRVTSGIPSPTLGRNIAMALV
                     KNGYHKKDTPLQVEVRHKMREAIVTRLPFVPSKFYRG"
     gene            <362120..>366748
                     /locus_tag="MRET_2590"
                     /note="MRES_12565"
                     /db_xref="GeneID:38739356"
     mRNA            <362120..>366748
                     /locus_tag="MRET_2590"
                     /product="transporter"
                     /transcript_id="XM_027629217.1"
                     /db_xref="GeneID:38739356"
     CDS             362120..366748
                     /locus_tag="MRET_2590"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_027485159.1"
                     /db_xref="GeneID:38739356"
                     /translation="MVPAGDIWTPSSIIDSVELWVFWISVIFFGSYAHQLRRVDSHPL
                     RRSTMGRWLSLHTLSMPRVPKGITMIDLRIVNEQAFWRRVYVVQWVFIILGALGVWVT
                     AWTCPNNSTLFLPFLLQVIWVYSAYNPGSISLDVRWRTIYSVFFITLFFVVCELFRGA
                     FGYHLTTGHWINIALLTTICGLAGTAPGMPHYEVFGGKVVEIANREQEQDERDEEALS
                     TNVMQVAPCEAMNNSMIGVLFFTHVFTLIKTVWRYGKLGSLDVPVLGPELHAETLAMN
                     MQQHLQLEQPKVCSSHSGYQDELGEDEESNECTPLLRDSSHSSESTIVSPHARRLIFS
                     FVRANAFQFLILFILTAVSVVTYYAPAFFANRIFRVLESDIASTETPAQTLKRALPWV
                     LGLFITIITSSTLQGTLWSLMEGSLTVRLTTQLSMLLFNKTMNLAPAGHSSSTGQVFT
                     LQLMDVDRIVSATFHLCALLTSPLELILGGYFLYRVLGISALIGLSTSIFIIPLVVLL
                     CRALRTSNARLMDARDKRMSLLSECFLGIRMIKAQAWESVFDERVGKTRKDELHAQKT
                     TFVFETLMSSILEVNPLLLTFVALTCYTQVFHQVLLPSVAFTALALFTELRWVFLLLP
                     RAAISLLQTFVSADRIATYLLNPEVAPSPISCILVKPEACTLRLVNATLTWPTKDKAP
                     FTLRDVNATFSPGITLVCGRVGAGKSLLLHGLLQEARILAGYVDCPRSPRSGVPYDAQ
                     SKTAALQTLNTPQWLRSDLVAYAPQVPFLLHTTIRENILFGLPMGDGKRYQATLEVCG
                     LGPDLQDLKHGDLTDVGENGTELSGGQKARIGLARAVYSRARVLLLDDVFAAVDARTC
                     QHIITRLLRSGSFLDGRTVVLVSHNVQQVCQAVDCVVYLDNGGVSFYGKPQDFLESDH
                     FAGWQQDREEDTHEETPPPPHLATQGTKRTAEHREKGGISGRVWLAYIHACSGWSLSL
                     LTMLLFALTNLWDLVTNMWLRDWSASEGRTHTNAWWLSRYGGLLAIGIFFGVLRWIGI
                     YTMSLRASRKLFDQMIWRTLHAPLHFFDIMTRGRLLNRFGQDLEVLDTKFATAISEVA
                     IRVTKLLATAIALYMVGGTGFVLALLALLPVYAGMAHVYMIMARDLQRLNATSRSLVM
                     ATLTHVVHGVHVIRAFGAQDHFEIEMMGTLDNYNRFVWWAAQGGRWISQMFNLTSSFL
                     VLISCFIVLLQPNTEPASIEFSLTFLIDLNFVLLILMRMYTQLQVSAVAVERVFEFTD
                     SIEQEASATTETRPPNDWPQKGHIVVQDLVLRYSPDAPDVLKEISFDVPPGAKIAIVG
                     PTGSGKSSLFQALQRLVEPRSGRIIIDGQDLSKVDLHDLRSRLYFVPQDPVILSGTLR
                     SVLDVMNEFTDEEIYASLRAVRLVADDRTSFTNLDMPIGENGNNLSLGERQLLCVARA
                     LLHKSRVVLFDEASSSIDHTTDSLLTQCIHDVFKDSTVLTIAHRLRTVIGYDRILFLH
                     QGRIVETGTPAALLSDTTSHFYRLCKKTGSSELQHLIKEAQQTAQRHD"
     gene            complement(<366745..>368400)
                     /locus_tag="MRET_2591"
                     /note="MRES_12570"
                     /db_xref="GeneID:38739357"
     mRNA            complement(<366745..>368400)
                     /locus_tag="MRET_2591"
                     /product="nuclear fragile X mental retardation-interacting
                     protein 1 (NUFIP1)"
                     /transcript_id="XM_027629218.1"
                     /db_xref="GeneID:38739357"
     CDS             complement(366745..368400)
                     /locus_tag="MRET_2591"
                     /codon_start=1
                     /product="nuclear fragile X mental retardation-interacting
                     protein 1 (NUFIP1)"
                     /protein_id="XP_027484922.1"
                     /db_xref="GeneID:38739357"
                     /translation="MPDAPPAQPRRARKVPQYDEYGNYLGDIRDDELRKMEETKQVQS
                     PAIPSPRPPPLPVMREPILRSGHAVPTQRPLPSKRARTNATGPLLYCGADTTFLSHPS
                     RCSYTTHSELELLLHRADRHLLYPPGGIDALRRIDPMRIAEERERLARTRKGGARGAD
                     GPADSTILGLNIRLDTPELVEEWIKQRRKRFPTSSVVQKKDTKLQERTRLPVTVPQRD
                     AQSESSNHDASESEGASSDSNSDMDPEADAISSKQELPAYPDERPVCRFWLHGACSYG
                     QHCRNAHTDTPSPSHSRRRMHPRHTVSHPFQAPDLLRQLLEREILQHVDALAQLIYFL
                     LDNDMLSNVEFAPGDAQQQRERRARVAVVREDLSHEDKEDDTPSLAALPPTAPSPTLR
                     ALDELVWPEEPDPLIYLDPLRSTDPKPLRPSELLSLATDTRLRQILQPTSALHPHGEA
                     NVALRRSLESWAALPTPRHREAALQLMLGVSAHSPMHAHEAYAPLNPRSVPSVPHSSM
                     RQNRVIGESELFRLGLRMAPNEVRLLQHIGERVAALTSGLEYA"
     gene            complement(<368494..>369618)
                     /locus_tag="MRET_2592"
                     /note="MRES_12575"
                     /db_xref="GeneID:38739358"
     mRNA            complement(<368494..>369618)
                     /locus_tag="MRET_2592"
                     /product="large subunit ribosomal protein L4"
                     /transcript_id="XM_027629219.1"
                     /db_xref="GeneID:38739358"
     CDS             complement(368494..369618)
                     /locus_tag="MRET_2592"
                     /codon_start=1
                     /product="large subunit ribosomal protein L4"
                     /protein_id="XP_027485179.1"
                     /db_xref="GeneID:38739358"
                     /translation="MFGRAAHIAPAITSAGIRARSMIMRPMGTRFMHAHDAQASTSEA
                     DYTQVDGSELFAVERSSPIVHTRLSYLSPETRPKGKKALSYVPMSAHVFNAAPHQHAM
                     HMAVVYYLDALRSGTASTKTRSEVSRSGRKLRPQKGSGKARLSDAGSPMLRGGGVAHG
                     PKPRDFKTELPRKVRELALRSALSARLQEGSLHVVPSLHWYAPPMSTNKLARLLSAKQ
                     WTDALLLTAPRQPVLPMTSERGAMRPSSVDLLYTDDQIMRHAKYIRNFDLASRNLPDV
                     QLMRLHELPPHPRPRLEHEKQPGELHAYQVLQYKRVIMDLGALEWLEAKLGGSLVHQV
                     YAEEMLHWNEQQPPFDTSETHEAPPAATTDPLDTAVPSAA"
     gene            <369854..>370297
                     /locus_tag="MRET_2593"
                     /note="MRES_12580"
                     /db_xref="GeneID:38739359"
     mRNA            <369854..>370297
                     /locus_tag="MRET_2593"
                     /product="small subunit ribosomal protein S16e"
                     /transcript_id="XM_027629220.1"
                     /db_xref="GeneID:38739359"
     CDS             369854..370297
                     /locus_tag="MRET_2593"
                     /codon_start=1
                     /product="small subunit ribosomal protein S16e"
                     /protein_id="XP_027485178.1"
                     /db_xref="GeneID:38739359"
                     /translation="MSDAKGATPFVSCFGKKKTATAVAHAKEGKGQIRLNGQPISLVQ
                     PETLRLKVFEPVLVVGADKFAPVDIRLRVSGGGRVSQIYAIRQAIAKALVAYYAKYFD
                     AASALELRQLFISYDRTLLIADPRRCEPKKFGGQGARARRQKSYR"
     gene            complement(<370604..>372235)
                     /locus_tag="MRET_2594"
                     /note="MRES_12585"
                     /db_xref="GeneID:38739360"
     mRNA            complement(<370604..>372235)
                     /locus_tag="MRET_2594"
                     /product="SWI/SNF-related matrix-associated
                     actin-dependent regulator of chromatin subfamily D"
                     /transcript_id="XM_027629221.1"
                     /db_xref="GeneID:38739360"
     CDS             complement(370604..372235)
                     /locus_tag="MRET_2594"
                     /codon_start=1
                     /product="SWI/SNF-related matrix-associated
                     actin-dependent regulator of chromatin subfamily D"
                     /protein_id="XP_027485181.1"
                     /db_xref="GeneID:38739360"
                     /translation="MQQHPQGSYARAPAKTVAQAQAQAQSQAQARMQAQRIRARNHYD
                     ILVGEGFRGTKRDRPTDRSLPPSIKKQVKESAIYNDLQRMERNLDWTLARKRAELMDS
                     MGRPPKVKRTLRIFLSNTCANQPFQVAEKEESKQAADAADAADDADAGDDDEGADEPK
                     RRTAAKAESTDVPSWTMRIEGRLLDPSFRSRAGAALSAHATANRIGAHKFSNLIKSCV
                     VEFSRDPNLYPDESLGASNIVEWHRPSPSVAPHPPQPGVSGSTVTENPLIHSAEPALD
                     GFEIKRTGTEPVKAKIVLYPLYVPERYSLSPPLAQLLDIQEETRAGVLSALWAYIKQH
                     NLLDESDHRVVQLDAPLQALFRTPSINFHHIPEVLHRFLHPPQPIVLEYFVRTDKAEH
                     RNAMAFDVELDMDDWALRTRQHNVLARFDANSALSQEIASIDDRIAQTALTIRNRSAA
                     RQFFSRFAQDPQGHLNAWIASQARDLDTLLGASQTSQGAEGGAGSSVQFSSEEMRRAD
                     TFHGPWVNEAVIVSESQRLAERLQELQSDTVRSLS"
     gene            <372440..>373198
                     /locus_tag="MRET_2595"
                     /note="MRES_12590"
                     /db_xref="GeneID:38739361"
     mRNA            <372440..>373198
                     /locus_tag="MRET_2595"
                     /product="Ras-related protein Rab-5C"
                     /transcript_id="XM_027629222.1"
                     /db_xref="GeneID:38739361"
     CDS             372440..373198
                     /locus_tag="MRET_2595"
                     /codon_start=1
                     /product="Ras-related protein Rab-5C"
                     /protein_id="XP_027485180.1"
                     /db_xref="GeneID:38739361"
                     /translation="MASVSRAVEQPNSSILNADMTPIQTKLVLLGEAAVGKTSVVYRF
                     VQDDFQENREPTIGAAFLTQRCRLEDRLIKFEIWDTAGQERFHSLAPMYYRNAQASAV
                     VYDITKAASFEKAKNWVKELQRQANPHIVIALVGNKLDLVSDKLNPSEEEDSAKKVES
                     DDTDEDAAPAAQREVACSEAQQYADEMGLLFFETSAKTGENVLETFTEIAKHIPLEAK
                     PTSNQTTPSAGNARTELVDLQRRANVSGREGCSC"
     gene            complement(<373424..>374335)
                     /locus_tag="MRET_2596"
                     /note="MRES_12595"
                     /db_xref="GeneID:38739362"
     mRNA            complement(<373424..>374335)
                     /locus_tag="MRET_2596"
                     /product="solute carrier family 25 (mitochondrial adenine
                     nucleotide translocator), member 4/5/6/31"
                     /transcript_id="XM_027629223.1"
                     /db_xref="GeneID:38739362"
     CDS             complement(373424..374335)
                     /locus_tag="MRET_2596"
                     /codon_start=1
                     /product="solute carrier family 25 (mitochondrial adenine
                     nucleotide translocator), member 4/5/6/31"
                     /protein_id="XP_027485183.1"
                     /db_xref="GeneID:38739362"
                     /translation="MSGFLTDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGRL
                     SGPYKGIGDCFIRTYQNEGLASLWRGNTANVIRYFPTQALNFAFKDYFKALFRVPKEA
                     PYWKKFSSNIASGGAAGASSLVFVYSLDYARTRLANDAKSAAKGGERQFNGLIDVYRK
                     TMAVDGIMGLYRGFIPSVVGIVVYRGLYFGLYDSLKPILLPGKLSENFLASFFLGWGV
                     TTTAGLASYPLDTIRRRMMMTSGGGVAYKSMFHAASSIIAAEGAFSLMKGAGANILRG
                     IAAAGTIAGYDKLQQVMFGKVYKGGSG"
     gene            complement(<374726..>375982)
                     /locus_tag="MRET_2597"
                     /note="MRES_12600"
                     /db_xref="GeneID:38739363"
     mRNA            complement(join(<374726..374852,374889..>375982))
                     /locus_tag="MRET_2597"
                     /product="UBX domain protein 1"
                     /transcript_id="XM_027629224.1"
                     /db_xref="GeneID:38739363"
     CDS             complement(join(374726..374852,374889..375982))
                     /locus_tag="MRET_2597"
                     /codon_start=1
                     /product="UBX domain protein 1"
                     /protein_id="XP_027485182.1"
                     /db_xref="GeneID:38739363"
                     /translation="MEGDISQFVSITGASVEEARQYINSCNGDVNMAVASYFEACDDA
                     SQPVAPAVPANVSGPRTLSGAAVSDTATWPSNSMKKSSGAARKARSGGIMTFNDLRSN
                     DEPREDDDDPVNLFAGGERSGLNVENPELNRRGTGQSIVDDILSRAATSSHAGVPSSK
                     ASFMGLHGTSKNSAFTGKGFSIGGATVEDEKEDPVRPHDSSSANSHEAIDDEEPAVRH
                     LTFWQDGFSVEDGPLHRYDDPANQTILEAINSGRAPLSLLNVRFGQPVELLVARRTHE
                     KYVPPPPPPAKPFEGQGNRLGAPSAGSLVSYEPQDSAAELSSAPSAGSVQVDPSQPST
                     QIQVRLRDGQRLIIKLNLTHTVSDLRRQIETQRPDLAHQSYTLRTSFPPKPLSNDAST
                     VAEAQLANAVVLLS"
     gene            <376124..>376669
                     /locus_tag="MRET_2598"
                     /note="MRES_12605"
                     /db_xref="GeneID:38739364"
     mRNA            join(<376124..376307,376341..>376669)
                     /locus_tag="MRET_2598"
                     /product="Tim17/Tim22/Tim23/Pmp24 family protein"
                     /transcript_id="XM_027629225.1"
                     /db_xref="GeneID:38739364"
     CDS             join(376124..376307,376341..376669)
                     /locus_tag="MRET_2598"
                     /codon_start=1
                     /product="Tim17/Tim22/Tim23/Pmp24 family protein"
                     /protein_id="XP_027485199.1"
                     /db_xref="GeneID:38739364"
                     /translation="MTSSDVPQEFQARQPVNEAFNAASASAVAGLVVSAAQNCLQKHK
                     AGAMGVFSRTGGTIAIFTLIGGLFAYSDASLANFRHKEDGWNGAAGGCAAGLVMGAAS
                     RSMPLMAGSCAGLGALVGSFQAAGGNMLNRQGIRPEVRNIDPENNDSPLKTFSQERRF
                     RFFKKTPESE"
     gene            complement(<376784..>379714)
                     /locus_tag="MRET_2599"
                     /note="MRES_12610"
                     /db_xref="GeneID:38739365"
     mRNA            complement(join(<376784..379531,379619..>379714))
                     /locus_tag="MRET_2599"
                     /product="aminopeptidase"
                     /transcript_id="XM_027629226.1"
                     /db_xref="GeneID:38739365"
     CDS             complement(join(376784..379531,379619..379714))
                     /locus_tag="MRET_2599"
                     /codon_start=1
                     /product="aminopeptidase"
                     /protein_id="XP_027485198.1"
                     /db_xref="GeneID:38739365"
                     /translation="MFRTLYRSVPWNLFQSAIRVHTGRFSNCVLTKPIFQRFQPIRTM
                     ASQTNGTQWFRLPTDVRPVHYDLTMLSDLERLTFHGVADIALAVEQDTQRIEFNIGKG
                     LELSQVLVSFDGHHHVVQPSVDKQHERVTLSLPQSVAQGSSLSIVAGYKGEIDQSMMG
                     YYQSTWRHDGESGHYALTQFEPTSARRAFPCWDEPSHKATYTFRMLHRTNTTALANMP
                     SVRSQHVDVAQVAKLLHIDDLHLDMPALGDDSWTLTEFAKTPKMSTYLVAWANGVFRY
                     IEGAYTSPITGQQVPMRVYTTPEYIHQAQYALEVKQKVLPEYEKVFDIAYPLPKLDTL
                     VASDFDAGAMENWGLITGRTSVFLYDEKSGLQGLKLTAAVQSHECAHMWFGDIATMAW
                     WDNLWLNEAFATLMGEVIILDRVFPEWKSASEFIVSHLNRALDLDGKRSSHPIEVPLQ
                     GENVEDAVNQVFDAISYSKGASVLRMLAQMLGEDVFLRGVSQYLKRHLYSNTVTKDLW
                     DGISEASGLDVNAIMANWVLKQGFPVLTVTEGTDSIHVRQNRFLSTGDPAPEEDETLW
                     QVPLALKTVQDGKATTDMNAMLPGVRETDIPVPDAKNSVWKLNAETIGVYRVAYSPEH
                     LAKLGKAAAQKDSAFSLEDRVGLVSDAFTLAQAGYSKTSGGLALMHALRGDNSSLVNT
                     AAALNLGKLASVWWEQPQSVRDGINRFRADVFGPMARELTFEFGANDSSELRELRETV
                     ITAAASAGDTWTLDEIRRRFAPLQEHGDYSLIHPDLLRTVLSQAVKHGGEAEYETVMG
                     VYRAPPTPAHKTSAMVALGTTQDAALIQRTIEFVFSGQVKTQDFMYFFMSLSSNPRSR
                     RTLWETVKTRFDDLVKTFEGNFSLANLIKSSISTFTSDADARDIQQFFSSRDTSKFSM
                     SLAQGLDTVHAQTRWLERDAQDVARWLETQGYM"
     gene            complement(<379812..>382565)
                     /locus_tag="MRET_2600"
                     /note="MRES_12615"
                     /db_xref="GeneID:38739366"
     mRNA            complement(<379812..>382565)
                     /locus_tag="MRET_2600"
                     /product="aminopeptidase"
                     /transcript_id="XM_027629227.1"
                     /db_xref="GeneID:38739366"
     CDS             complement(379812..382565)
                     /locus_tag="MRET_2600"
                     /codon_start=1
                     /product="aminopeptidase"
                     /protein_id="XP_027485161.1"
                     /db_xref="GeneID:38739366"
                     /translation="MWTTALGVFASILLLGWQSLFHNQDYVPATLRPIGIARVPSARL
                     PTAVRPLHYDLSILSDLEHLQFYGGVNITLHVEQPTSVVEFHAGANLKMGDVRIATHS
                     GEYAAPPLRIPDRERVRVLLPRRLETDELAHILVSFRAPIDHSMRGYYYSTWRHNGES
                     GHYALTQFEPTSARRAFPCWDEPSYKATYSFRMLHSENTTALANMPSVRRRTARADDM
                     QRLLHASPDLRGAWLMTEFDTTPRMSTYLVAWANGAFQHVSNTAASPLTGRKIPVSLY
                     TTPEFIQQAAYTTDVMARVLAMYEKVFRIAYPLPKLDALVSADFDFGAMENWGLITGR
                     TSVFLHDETMGLRGQKNAASVMSHEIAHMWFGDIATMAWWDNLWLNEAFATLMGEAII
                     LDRVYPEWKSSREFVVMHWMRALELDAMRSSHAIEIPFRSARVEDEIAQVFDAISYSK
                     GASVLRMLAQVLGEDVFLHGVSRYLQRHLYGNTRTNDLWDAMSEVSGRDIRTLMTSWV
                     RQQGYPVITATESDSSIHVRQNRFLLTGDPSPEEDDTLWHVPLGLKVPGAVNKTLMLP
                     GIRAMTIDNTNASIWKLNADTMGVYRVAYEPNHLERLGRSPPGFLSVEDRIGLLDDAF
                     ALAQAGYTKTSAALTLTHAFRNESSQLVLQAMALRLEHLASVWWERPERAMIEHFQAD
                     VFGPLARQLSFEGGGHEPSDVRELRATVIAAAAAGGDAWTIGEIRRRFAPLQSRNESL
                     IHPDLIRTILTHAVKHGGKAEYETALRMYREPRTPLHRNYALMALGSTQQPALIERTI
                     KLVFDGEVPLQDYTYIFQALASNVHSRRRLWEATKQHFDELSGSLRGNFGLMGVVKAA
                     VSSLSSTADLEDVRQFFQRRNDTSFYSLSLAQSIEAVASQSHWLARDADDVQAWLVRH
                     TRS"
     gene            complement(<382624..>383121)
                     /locus_tag="MRET_2601"
                     /note="MRES_12620"
                     /db_xref="GeneID:38739367"
     mRNA            complement(<382624..>383121)
                     /locus_tag="MRET_2601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629228.1"
                     /db_xref="GeneID:38739367"
     CDS             complement(382624..383121)
                     /locus_tag="MRET_2601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485160.1"
                     /db_xref="GeneID:38739367"
                     /translation="MTTDPGGIQALLAKLRALQDRPPEPTSQRPTHARPWAAPARTLH
                     ALPFNEAVEHIEGLLRDPTFVQALRELQAQQDALEAELDRERRALIGTHGEHLRGSSG
                     ARTQASYAHWTWDALKRWDAHRHAQQRRLEEMRVPCFYDTNDPDALRQQQRLLPLLLS
                     AYHHV"
     gene            <383162..>383953
                     /locus_tag="MRET_2602"
                     /note="MRES_12625"
                     /db_xref="GeneID:38739368"
     mRNA            <383162..>383953
                     /locus_tag="MRET_2602"
                     /product="tRNA acetyltransferase TAN1"
                     /transcript_id="XM_027629229.1"
                     /db_xref="GeneID:38739368"
     CDS             383162..383953
                     /locus_tag="MRET_2602"
                     /codon_start=1
                     /product="tRNA acetyltransferase TAN1"
                     /protein_id="XP_027485163.1"
                     /db_xref="GeneID:38739368"
                     /translation="MSKRSHEAHAGRVSKRRRSGAHQRHTRKLVQVLDIPQCTGVFMS
                     CARGKERKAATELVELMEEHAQRMYADHAPQEASCTDIESQIEKELADMRRPAEPTRI
                     SSLDTDTECLCFIQCLPPVDSFSLLKDVLRTMEATGASRSRYVQRLVPVRVLCRADTD
                     SIRTAATAALAPAFADQPRTYRVEPRIRSHTSLSRDVLIPLVASCVPTNVAHRVDLAH
                     PDVIIVVEVLRNVCGIGTVDEYERFGKWNVQTLVERHNNDNVRST"
     gene            complement(<383923..>385083)
                     /locus_tag="MRET_2603"
                     /note="MRES_12630"
                     /db_xref="GeneID:38739369"
     mRNA            complement(<383923..>385083)
                     /locus_tag="MRET_2603"
                     /product="8-amino-7-oxononanoate synthase"
                     /transcript_id="XM_027629230.1"
                     /db_xref="GeneID:38739369"
     CDS             complement(383923..385083)
                     /locus_tag="MRET_2603"
                     /codon_start=1
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="XP_027485162.1"
                     /db_xref="GeneID:38739369"
                     /translation="MLDEQLTHALRVREAEGRRRRLLLSDAAEAERLARLVDFSSNDY
                     VSVARNPRVRRAWLERLGASDEAFGSTGSRLLDGDSTTHTQLEHKLAAYFHAPAALLC
                     NTGFDANVSLLSTIPQPGDAIVYDELVHASMHDGMRKSRAQTCVAFRHNDPADLDRVL
                     TNLRPHNNVFLALESVYSMDGTICALPDLIKVLERHAPHRNTRHILVDEAHGAGVYGQ
                     GGRGVCNALHCHVSARLVTFGKAFGCAGAVLLVPVLWREYLLNYARPLIYSTALPPSQ
                     AAAIDVVISAWERGEMEAAVQMLHTRVAELYTALGLRSDAALPPAPIVQVRSAHAKRL
                     AAHVQAAGFLVRAVCYPTVPRDKERVRVCVHAHNTAEDVARLAHVLRTLSLL"
     gene            <385141..>387780
                     /locus_tag="MRET_2604"
                     /note="MRES_12635"
                     /db_xref="GeneID:38739370"
     mRNA            <385141..>387780
                     /locus_tag="MRET_2604"
                     /product="Vam6/Vps39-like protein vacuolar protein
                     sorting-associated protein 39"
                     /transcript_id="XM_027629231.1"
                     /db_xref="GeneID:38739370"
     CDS             385141..387780
                     /locus_tag="MRET_2604"
                     /codon_start=1
                     /product="Vam6/Vps39-like protein vacuolar protein
                     sorting-associated protein 39"
                     /protein_id="XP_027485165.1"
                     /db_xref="GeneID:38739370"
                     /translation="MPDVYVPRVVVDRVPDATALGACDGRVYVGTSHGSIFEMGAPDV
                     ELSRGRHRRIDQISSIPGTPYMACMADGYVSVSTPASLDTPTSLPLSRGASFLVAGSW
                     LEAHSAETSIAASTSQRALGLRSMDEVAREKQKAPQNALVSMLAIACRRRRCVVMYRW
                     VDGAFWDAKVHPLPRGPQTLALLTEGQALVAGYGHYEYVRVVIPPAHASSVAWRLPPS
                     DALTSATWVDTHAWDTYAVPVEGDGDDASWWGRTDRPWAISLAHGVLVSTPRRGVVID
                     AHGRILPPSLPWSAVPYGGIACAPYVLLREADGSLGVYMQSTLRRAQSMTLPAGPVQL
                     LTDPPHVYAHGSLYALDVCGLEAQLDALTAAGAYAEALDMLNAEPIDKDARAHVGLAA
                     FVDGAFDTGMDVFMDVDMNPAYVLALYPASLTGPLAKPPSQWSALFGTRLPVHAESDA
                     FTSPQALDALVRYLNDRRRLLRSGSLPPPTAEAVDTQCLQQLRMCDCTPDTISTHEAV
                     AMAQVVDTALLTVFLRTKPSLVGALCRVDNWCDLAQVRTQLEARHMHQALVSLYRTRG
                     MHTEALAQLPEPEDMAAYLDTLGPEHTDLILSHARKVLDVAPALGLSIFTSDTHLTQL
                     PPERVAPDLAPTYPATCLAYLEAVMTVRDVAPALHTLRARLHLDACRHGAPLDAFIAF
                     LRSSTHYDADALLLEDLPWPLVRSVLLGRLGHYVEALHLLLVEAHLVSEAEAFCVEHS
                     TSAGPDLYATLLRLVRTHAPEHLLRVCEGVLTQHAKDVPLPDILALLPPEWPVQRVQA
                     LLLRNLHAQASDRVQQRIESALSTAHRAALDQSVRIQRQARVLVTDHSTCEQCGRRLG
                     ESVLAVVPATGATMHYYCAMQHT"
     gene            complement(<387786..>391862)
                     /locus_tag="MRET_2605"
                     /note="MRES_12640"
                     /db_xref="GeneID:38739371"
     mRNA            complement(<387786..>391862)
                     /locus_tag="MRET_2605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629232.1"
                     /db_xref="GeneID:38739371"
     CDS             complement(387786..391862)
                     /locus_tag="MRET_2605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485164.1"
                     /db_xref="GeneID:38739371"
                     /translation="MGDHNDDNMMPVSDYLVLRGVPSELHFVDVYDNQHASLRCVTLT
                     NVCEDDVHIRMPDSVQGIRWMQLRSSAGPLQVTWPPSLATNSVAWAREGGLESSNLRA
                     MRHLAANLDVCTMLTIEPQGTVHLFVEVQVREMRSSTLVADRQAECALPIEIVRGDKH
                     QHVTIPVSIRACEPELVMECVNADESKSGGRDRLMVLDVGDVVVHEHVARDVRVSNVS
                     DIACFLQVRTHGVRDDSPLTIVDQTTHERVGAEPIMLVPKEARVFTLALEPRESHANF
                     EQTVTFENANMPHNDVRVLVRANLLGAASDGALAVLSECPLDFGDCCGGQWTRQLLVL
                     KNAGDMPLDVMFRSEKDAEATFQLAELALQRESADDVDVPDDDVPLGGTSSSTARVAP
                     DAVDSPEGPVPDTDSDISSNASQAGSRAGSPEPRIGGDATSHSSETDAATQHDGSTTS
                     STRPSIALSSSVPSVAGPSVSGAPSSGHRAASYSVSALATSQPRGQRRLHDPVAMLRG
                     GGESQHNQLEELVMHPGAQYRIVVSYRPPRESAHDDYTAGRLRQTTFRLFLDYVRASD
                     NRHGGRQRREIVCFTRTCTPFISVSPRVVDFGMADVGARKSAQVSITNHSELETRVLL
                     RFVSKVLSMYTDEIAVPARQTVDLKMDFFPRRINESYRKQITVMNLLNRSNDQILEVR
                     ARNVDLQRVSFHSLFYRILTMSGSNFLDFGDVNIHSPSVRSFGIQNLCSTRLSLEMSV
                     AHPEDLQLFVKAPQLHTTRPDVQRGAARKEQFLEAISTDTPSLQRVPPAKRVTHTPRS
                     HVIALKRGSRGRATWPCGASVTYRDRSLLHTLAYLDLAAGTPGAADLRHRHRDVRVSR
                     NSRPPSRAVQDPAPPPPPSAPASASTPPPPSTAAAGASPALTGTWHRATRFADPQDVA
                     HLDLDSLIAALEHQPASLSTFFVRNVEAEERLVRTEINLQRALHQAITSGQLVPIGLL
                     DVPPHMIMQVVAVYTPHGSTRPHIQGNARKQDSRIFLRLLEFDTRRAMGVPEFEALRE
                     RDIDELPVRDLMVRSSVCRSMLELGQPHINFGQMDKGDHRDRKIWIQNRSEWALRYCI
                     RKSGSIASGDIRLGRGRYGIVPGYGKRGVDFTFSPSLSGPFHERLLVENVADHDNDQA
                     IILKANVRKVANFALDPSSLDFGTCYTADVSMPESVLLSNTTAKQRTFVVRLDDSVSE
                     ALSLDVLVSMSDDSATRRALSTEEEEEVETLFQKLKIASRKGNLDKLAKYRDRLTQLG
                     VAIPSTAVGSAEEPAADTKDSAHDDDLQRYTLLTCDRTCTLTTTIGAQSSQKLLVRVR
                     PCKRADQPPHDVQIPLQVHEQKNSDEKRHVMVHARVEC"
     gene            <392082..>393416
                     /locus_tag="MRET_2606"
                     /db_xref="GeneID:38739372"
     mRNA            <392082..>393416
                     /locus_tag="MRET_2606"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629233.1"
                     /db_xref="GeneID:38739372"
     CDS             392082..393416
                     /locus_tag="MRET_2606"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484927.1"
                     /db_xref="GeneID:38739372"
                     /translation="MRHWLATQGRRCLRSVAAQPREQVVTHIAKNPAALVPAVRSTLC
                     ARPASDTLLFSISKDLPRDVLQQLVACLTEAPQHVGALTGSLDGVPGTPYSVSLASIP
                     RSLATPFRSNIPGAPRIAVGRWPEQKEIWRTNPHKRTDHLESTGHWAPLWGRENVEHQ
                     VPAELEALPARDVRALFLFSDAYAQGLMEGLDFHFSQAHVLGSVAAFTPFVTGREHTL
                     FFQTHTHARGIYEKGAVGLALHAPASLERTYSGLVPVGPRLAITSARGNIISSLNHHN
                     AAQQMIWLLTNRKTAQGAPIQDPQHVRSMSSQVRKDDELFLGIFACQEDAMPLTMARI
                     QSGHPMRGTISIDTDTQICSNMFAQLYRSGEHGQHKDPPAPALVRYTMASGAEMSSAL
                     KGMAPQQGTTNGVISLPGIFFSASEMGWFGRHASQCTQAYTVPHASASLVWS"
     gene            complement(<393434..>393778)
                     /locus_tag="MRET_2607"
                     /note="MRES_12645"
                     /db_xref="GeneID:38739373"
     mRNA            complement(<393434..>393778)
                     /locus_tag="MRET_2607"
                     /product="RNA-binding protein"
                     /transcript_id="XM_027629234.1"
                     /db_xref="GeneID:38739373"
     CDS             complement(393434..393778)
                     /locus_tag="MRET_2607"
                     /codon_start=1
                     /product="RNA-binding protein"
                     /protein_id="XP_027484926.1"
                     /db_xref="GeneID:38739373"
                     /translation="MSLPEGRHNRILFVKNLNYNIHGGDLYELFGRYGAIRQIRLGTS
                     QQTRGTAFVVFEEANDAKNAIANLNGFHLMERYIVVLYHVPSRLSGKGSIDQREEELA
                     KAKQQFGIHDES"
     gene            <394282..>398769
                     /locus_tag="MRET_2608"
                     /note="MRES_12650"
                     /db_xref="GeneID:38739374"
     mRNA            <394282..>398769
                     /locus_tag="MRET_2608"
                     /product="chitin synthase"
                     /transcript_id="XM_027629235.1"
                     /db_xref="GeneID:38739374"
     CDS             394282..398769
                     /locus_tag="MRET_2608"
                     /codon_start=1
                     /product="chitin synthase"
                     /protein_id="XP_027485167.1"
                     /db_xref="GeneID:38739374"
                     /translation="MSFPTDSMQPTGNVNRKPSVTFQEQNRPSRPTSHEDLRGNKGQH
                     FGFSRHHSSDNLSQDVESGRSGMARKKSLVRPERERIDPNHRQWYYRNHAAQMDQNRN
                     SNVVYMPSSTGFLPQHGALPSGSGMAGFMGPGGGVSGYGVTGSKAPPPMNFHRGTSLR
                     RGKSILGQNDDKVESGIHFLRRGVSMRRVPPGNPDLANDNDDKQPETKAGSFDWIAPG
                     PVGPWMIYCWFITCCITSSCLNMVGIKTPEQQRAWREKMGLMVIILCLMAIVGYITFG
                     FTETVCGIQNRYLLDEVFKNKTHSSSALVGGKTLSLDDWTHKPFPGDDNPKYINLTTN
                     PIAYTYLYGADHGANLNLLFQKTGDACEGILEPVPNQNPPRYFKCAILRRRFPSGSRI
                     FEDPGACHTVETRSKIMSNSTDIPVHGTAFVSWDQLKDYDNYLFYRSAVIDLNILEYS
                     DAKLTPFMQELKNNDTKKEWTKMDVTAKAMRRGLTKELDCLKQLGSIASLDVDSYGCI
                     ASKVELVVSMIVIVGVVGIKFLFALFFAWCLSWRIGNYDKESYAQRMKRMNDMEDWSE
                     DIYRPAPAGYRPNVKKPFLPTTSRFNQMYQKPQARPTTMERKIAAARMGTNSVVGSPP
                     HSPMLATARSSTSITQPMLPSSQSIHSSNSGSESPWGPCPFPLWNVVPQPPASYQPFN
                     FPLVHTICLVTAYSESIEGLRTTLDSLSTTNYPNSHKLLLVIADGIVKGADSDVSTPD
                     ICLSMMKDLVVPPEEVEGYSYVAIADGSKRHNMAKVYAGFYDYDDQTVERSKQQRVPM
                     ILIAKCGSMLELDSAKPGNRGKRDSQVVLMAFMQKVLFDERMTQFEYEFFNAIWRVTG
                     ITPENYEIVLMVDADTKVFPDSLTRMVASMVQDPEIMGLCGETKIANKAQTWVTMIQV
                     FEYYISHHQTKGFESCFGVVTCLPGCFSAYRIKAPKGPKGFYVPILANPDIVEHYSEN
                     VVDTLHKKNLLLLGEDRYLTTLMLKTFPKRKLMFVPSAVCKTVVPDAFRVLRSQRRRW
                     INSTVHNLFELIQVNGLCGTFCFSMRFVVFMDTVGTLVLPAAIAFTVYVVITAILTPI
                     QNQGKDSGEKKEFPTLPLVLLALILGLPGVLIVVTSRRFMYVIWMLIYLISLPIWNLV
                     LPTYAYWHMDDFSWGATRVVQGEKKGESHASAEGEFDSSDIVMKRYVEFERERRWRAG
                     IESRDAPSDAGGMSTMGSYTDEKPQPTLPDDRVARGRLDSVPLLELPAPLGTDSRQRP
                     GPSSPPGAMGASSGSRSPPLSPSGQTNPWASTSGVGPVVPSSPPPLGAQSSNSDASAM
                     ARQHLFGSMRAGAPRPPALVRPPGTLSPPSRPMATAPPGPVSPPSFRGKVSSPPPMYT
                     GTGPGSPPVRPLSSGPNPWASVASTAAGSRPPLPGFHGSSTAQSQQTPAVRAPSTVAQ
                     APKDVRRVSLVDDGPVAQADGGMRQVVRGARRQTSVNNGGAASPASPSLNASNPFQLP
                     K"
     gene            <399022..>401877
                     /locus_tag="MRET_2609"
                     /note="MRES_12655"
                     /db_xref="GeneID:38739375"
     mRNA            <399022..>401877
                     /locus_tag="MRET_2609"
                     /product="SH3 domain protein"
                     /transcript_id="XM_027629236.1"
                     /db_xref="GeneID:38739375"
     CDS             399022..401877
                     /locus_tag="MRET_2609"
                     /codon_start=1
                     /product="SH3 domain protein"
                     /protein_id="XP_027485166.1"
                     /db_xref="GeneID:38739375"
                     /translation="MRPASDPAPSSEASVPLDGEIYEDDMIDPEFITYHGEESFDYGV
                     NDGDMPDDAMYDEDEYDDEYEEELSSSPSIPDEDINFDLVYTLHTFIATVEGQATVQK
                     GDHLVLLDDSNSYWWLVRVLVSQEVGYIPAENIETPYERLARLNKHRNVEIATARGQD
                     NELPPNHVASGELIKSRTFGGINKHSGKVSALSRRGLRDTTVEQVDKAPAKKMGVLFG
                     ETEYLEHSDLDHFDEEYMGEGEDDYVYDDEPEPDEDKQVDNLEQELSEPRQQEHLQNT
                     PEVLSERHSTEEKTSPTSEESNTHGESRSKRPNSLLEFPGTEMAYNVTRVFAGENIES
                     DCTFKTVLLNELTTSTELVHQALQRFQLQDNVQDYAIVLHHLDGEEQILPPYEHPLQM
                     MQMLSNISSMEPLEVPSKHDSAGSLASLLDTSSSRCMYDYSNDRFGKLYLVRRIPLHK
                     PVSALTMPSTTSSQDKQLRFTIQLVLYDTDLPDNMFFHPTTGNPTRGTKPLIQELPGE
                     QRRFMRLAKNATVAEVIEAGIEAFQLPDAVVDGGDDIEDRTRFSRPRCKYVLHIQSAS
                     HNEQPLHPASKVLAAYDTLPLLQFVDTDVKRKSLDFTVAPGVMDDILSTDPLFVLRIA
                     REKRKEEGVVPLGTPRGWQPSVLNRSPPSPSWSVSMSSSRERDNYEALPRHMTWSNRP
                     MVQHSTRLANPLLSPAGSMREIQELPKPPPSSADDSWVQKDRDVSQDGGLYSSAPEPF
                     APLPSSSVQNEVDTMLSRLALDPALDPSKRALTSPIKMSPLNIPPPNSSLHRTSSIRS
                     VSANDMTPEPRGMAHMPRRVGDRVLSDSTVATGTDRQGREKYNFHALYGIVDALVLEK
                     TLATETHTLEPDASSHNGLHRTSLIMAKLLEETPSEKIWTKWNGLFALPWPSLASAPS
                     TSTEKVREHFMPLMKQITELENDLDDTLRSVLAYRDA"
     gene            complement(<401958..>403278)
                     /locus_tag="MRET_2610"
                     /note="MRES_12660"
                     /db_xref="GeneID:38739376"
     mRNA            complement(join(<401958..403113,403145..>403278))
                     /locus_tag="MRET_2610"
                     /product="4-aminobutyrate aminotransferase"
                     /transcript_id="XM_027629237.1"
                     /db_xref="GeneID:38739376"
     CDS             complement(join(401958..403113,403145..403278))
                     /locus_tag="MRET_2610"
                     /codon_start=1
                     /product="4-aminobutyrate aminotransferase"
                     /protein_id="XP_027484879.1"
                     /db_xref="GeneID:38739376"
                     /translation="MSQAAKFGAQHITRGIGRMSQHVFTEARGTYLFTDQGKRLLDMT
                     SGIGVVNLGHCHPAVTHAAQEQCAKVTHAQVNLGYSSAQIDLLKALLPIMPQPSLDSF
                     FLWNSGSEAVEAAVKVARAYTKRQNIIVAKGSYHGRTNATAAMTRSKMSYSEGVGPYM
                     PGIFTMEFPYYSQLFKPVQTSTDELVDISLKRLELLFKQETSPRDTAAIILETVLGEG
                     GYVPAPTAFLEGVRAICDKHGILLIVDEIQAGFGRTGKMFAIEHSGVRPDLMTFAKGF
                     ANGYPISCLVGNKGVMDVMSPGTLGGTYAGNAVACAAARATIETFQNERILENVAERS
                     KQLFSGLDAIRQTSFGKVIEDIRGMGLMVGVQFASGPGEPIAQRLSKACLERDMLIMS
                     TSSFDVIRWIPPLTVSEQELSDALAIFSDALEEVVSK"
     gene            complement(<403429..>407166)
                     /locus_tag="MRET_2611"
                     /note="MRES_12665"
                     /db_xref="GeneID:38739377"
     mRNA            complement(<403429..>407166)
                     /locus_tag="MRET_2611"
                     /product="FH domain protein"
                     /transcript_id="XM_027629238.1"
                     /db_xref="GeneID:38739377"
     CDS             complement(403429..407166)
                     /locus_tag="MRET_2611"
                     /codon_start=1
                     /product="FH domain protein"
                     /protein_id="XP_027484880.1"
                     /db_xref="GeneID:38739377"
                     /translation="MTVARDLHQHEHDQSPLTRTDVHMSLGADEHVGSRNTEASTSNG
                     SHTHLGTTPSTDNADEFLARAQALGLRLSRTDYERTRAGVAAFLKAERLPPASPSTSS
                     AETSTKRNVSNADVEHHRDVTPQLSRWLRTTSGQLSFFTAVVRPMHTQPTEEHRARVT
                     LDEVGSAEEKRRRRIRRRRMLEKQMLLESGHEAQSRATSPPLSTAEPSSPIRLSRDNS
                     VVAESHGLESPLSISTAHAPIHDEPSQLGSPPTSPDIKMLNRMARVDPAGKLWLAPSS
                     SIQDDVHGLSSETSFTPGLDEHTPGMDEGDNTSSDALNGWGPRPFTRASSGATDQLNA
                     CMKSMSLLDRIMMSKTSPRRMRREAKARERSRTEDADVADSSTISLVPSQDNAMPDTS
                     MSSWADISSDYTTDPDKLSVSGSGESSTPETKTTQILTQSLSSTPAPAHRRSHSRHTS
                     LSSLRRVHAVSTPLQEHQRPSDDISPDILPFTTLTPTSRFDPNTQITPMRYSPSMGVD
                     YSYSRSTFAFSPNLITPWTHQGRLMSNAGLSNVPSSPFVAGEWASGHHMASSTGTIRG
                     GVSNFAFSSTPLSHLPPNDPDLSAPFISSPSRLQCIESFPGRSPQGRDMDMSPTKRPL
                     VTSPLANKSQSKPTSYSTMDRPSPVSTLMPSTTPSFSPVWRQISSLESRTPQRRTDTI
                     SPADIFGVSATQAHLSASASGVSPHAESAELPDAMPPVSSFNTPIPAPRQLVESPKST
                     DDDSEHPSAPSATVSMTNNSSPESRSWQQNSSRSRSSRRKNGVSRNPSTALAKTPAYG
                     DDVFAKESFSMSPIKPAFKDVCNEMMASSDSGQTEWDQPDGSRIVKLVSEELQAALNS
                     GTLDHEPEPRYFRLPPGHGSSKSKPSSVSYAGLIGQAILASSDGRLSLAEIYSWISSV
                     YPYYERGDRGWQNSIRHNLSLNKSFVKLERESSIPGKGGWWAIQPGHESRFQNGLYLP
                     NGGRIDAPMSRSIRSASVAPSNPFSDDRARRKRTPLTPSQTNTASHRNSDTKDTMHPS
                     SAKRTKTLRPIKFMQVHPSPLVHPPTSDGISSPSILASPSHDSKTDMDSFDTSTSRSV
                     LATPGNGINAAPISAVTNAYRMSPSMQVRDSPSSARALLEGSNAPSNDLYPSAYPNMA
                     DYGSGGMMYLNRDIPYHDYGIQMTSSPHKHIAMHSSVMPQTSHQVACIPVHNMPMPFP
                     HLQAHVPLVPAEYTRFTTEQNASVSWPDPMRVSGYKQDAPW"
     gene            complement(<407605..>410070)
                     /locus_tag="MRET_2612"
                     /db_xref="GeneID:38739378"
     mRNA            complement(join(<407605..407643,407681..407691,
                     407724..>410070))
                     /locus_tag="MRET_2612"
                     /product="cullin 3"
                     /transcript_id="XM_027629239.1"
                     /db_xref="GeneID:38739378"
     CDS             complement(join(407605..407643,407681..407691,
                     407724..410070))
                     /locus_tag="MRET_2612"
                     /codon_start=1
                     /product="cullin 3"
                     /protein_id="XP_027484877.1"
                     /db_xref="GeneID:38739378"
                     /translation="MSTGAPRRLGVRHHKLRAPRKHGLSVSVEEMWSRLSAAIAQIQH
                     HNISKLSYEEHYRYAYNLILNQQGDMLYQGVQLQIQDHLVNQSDMRLTPVFSLSIEEA
                     QAASQAMSGSDKGKLRDNTARLLGLLPGNAEALFPTIPAGERFLSAVTAMWDDHCSCM
                     SKIRDVLKYVDRVYVPNHRREPIWDLGLDLFRDTVVRSTRVPCRTNLLVAMLRQVYCE
                     REGATVERRTIKAVTDMLLSLLHDAKQSVYTHDFEPIFLSTTSEYYATEATRLLESQR
                     ATYYLQSAERRFAEEQARVDACLSPNTLAPLKEIVERRLLTEHLDEILAMPDGGLVVL
                     LDTDARADMERMYRLFRLVPTGLDALNKVLRAYVTDRGKIINETTLCESKNTQTPSAE
                     MALSWLNQVLDTKSRLDGVLATSFQGDKSCEAAINEAMDTFINLNTRAPEFISLYIDE
                     HLRKGTRFADDTTALEPVLDKTITIFRYVHEKDVFERYYKMHLTRRLLHNRSASDDAE
                     RSMIAKLKVECGHGYVQKLQGMLNDMKLSEEVLRAFHHTLEREGTSLPLQLNVNVLTA
                     TYWPIASPKEPSIFPTALTEACNAFEKFYDTRHRGRVLTWQPSLGTADVRVQFKSRTH
                     ELVVSTYALMVLLLFEHADVLTYGHIRDATRMPDADLQRTLQSLACAKYKILRKEPKG
                     RDVSENDSFVFNADFTCPLARVKIAQIAAKIETPQERQETNVKIEEERKNQVEACIVR
                     IMKSRKTLAHNELVNEVVQQLMQRFQPSPALIKKRIESLLDREYLERTGTRHVYQYVA
                     "
     gene            <410198..>413287
                     /locus_tag="MRET_2613"
                     /note="MRES_12670"
                     /db_xref="GeneID:38739379"
     mRNA            <410198..>413287
                     /locus_tag="MRET_2613"
                     /product="serine/threonine-protein kinase MRCK"
                     /transcript_id="XM_027629240.1"
                     /db_xref="GeneID:38739379"
     CDS             410198..413287
                     /locus_tag="MRET_2613"
                     /codon_start=1
                     /product="serine/threonine-protein kinase MRCK"
                     /protein_id="XP_027484878.1"
                     /db_xref="GeneID:38739379"
                     /translation="MAVSSVKENRSWSARHARINSALHSSELIVAISPLAAFTTQHAA
                     FVRVLLSQLRHHLREESQMGHEVDCALALLWSSLTPARSTSLSPVNTSTIMSIERTRE
                     RARTHLDDVLRASLQPNDFSSQCTLQHGATGMVEVVRCRMDRKLYVLKSMLKGVVRRE
                     ACRFSPVYESQLLAEGYDSGDVSWTPQLHAAFQSPRSLHLLMEYLPAGDLDSLLQAAS
                     QAETRYPGKNERGLLQESWVVRYAVDMIAALGWLHSLCFVHRDIKPSNFLLDKSGRLK
                     LCDFATCAPYAYFDELKERRVLAYYTQRPAGTCDYIAPEILQCEEARIQQECVSPPLH
                     TRSSFQPDSRVPGAYGPAVDWWSLGVVLYEMTFGKLPFWAPQAADVYERIVHHEQHFT
                     IKDTDLPCSEALASLIRLLICPENRRLGRHSTSDVQRHHVFHDVPWENVTEIPPPFVP
                     DLRNGTNEHVSVLHSPNGVASGNVGWDSLSMDTPPSFSAMFQGPLDQFPEFDSLDTDP
                     VDVSWGMDLCIPPSISPAPPTPPTASSPVPSNPSEPPPSPLSSSACAEIDTHFCAFSY
                     VPRSDAFEVPTPPRCTSESPPPATSTPFLSKTTSFASSTPVTPAIATFSPDGPPLSTL
                     QRTALERAYMTRQDMHTPFRPSPSMVATASSSEGAAPNSPYPFPPPNRMQRTPRTPVV
                     PGVANFMPDTMGSDSRHSGGSTWKRSVSERQAWSELMRAVERSARKQSVPRHAPLRYA
                     IDEQSPSPPSSPQSPSHNRLPNALDAHISSSPDSNVSSSPPPSPPLLRSRSSYRDIRP
                     TNDANNSVHRSGNGELRHKRSTRQLLLDAQVTSTPTRAARTMPLVPVTVTSHAKGDAP
                     AGSSPRGRTLRTLRGSASVRDFRTEYMRLEEDNFVLPTLSAPVSASAAAAPPSTRSSM
                     DSHRTLSEYRRAPRPLNESEDAFGRRTSLSKQRNIARRMQSTLGLSGLYRYGRPTMVN
                     VLEQTTSSPIMSSPPRSFSGRETFARMRQEQSHIEQSVSVLEKDLDDLRTRVDKMPL"
     gene            complement(<413383..>414720)
                     /locus_tag="MRET_2614"
                     /note="MRES_12675"
                     /db_xref="GeneID:38739380"
     mRNA            complement(<413383..>414720)
                     /locus_tag="MRET_2614"
                     /product="transcription factor"
                     /transcript_id="XM_027629241.1"
                     /db_xref="GeneID:38739380"
     CDS             complement(413383..414720)
                     /locus_tag="MRET_2614"
                     /codon_start=1
                     /product="transcription factor"
                     /protein_id="XP_027484882.1"
                     /db_xref="GeneID:38739380"
                     /translation="MALSGLDHRALAPNSSNISPYSPHHDNPTPENKSLPPLLATSVS
                     IQRPSHPPPKPLWPHHEKKPRTVETHVDSVSQSPSVSASRQTSCANEDRMDSSVGSCP
                     GHGLCNGMGGSTECDGCPTYNNVKANPTWVPPLSAAPADDSLQASTAQAQASAPTSVS
                     TAAPYKSFTNEKQSSIEPLRCTNCQTTTTPLWRRDEEGNNICNACGLYFKLHGTHRPI
                     GMRKTVIKRRKRLMGPSTNGSNLLQAQHQTKSVSPMAKGMTRIKSNDEETPICPERER
                     EAALVLMEVGSSRLPQAGSSSPHRETDESGEWSYASQHDYAPHVCGGRLFRGFQTLAY
                     APRVSYGSRLLELERLRDELYMERNHLDELLDRTEQTLVELRHARYDVTSYTPPYTVP
                     YLHSPPVDDAPRRAHGPFSPATRAMEHTIKEVPDMPGPRLTPPPTWRTRDRKA"
     gene            complement(<415832..>416127)
                     /locus_tag="MRET_2615"
                     /note="MRES_12680"
                     /db_xref="GeneID:38739381"
     mRNA            complement(join(<415832..416077,416125..>416127))
                     /locus_tag="MRET_2615"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629242.1"
                     /db_xref="GeneID:38739381"
     CDS             complement(join(415832..416077,416125..416127))
                     /locus_tag="MRET_2615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484883.1"
                     /db_xref="GeneID:38739381"
                     /translation="MGSCFSSLGGGNDKSLNRTETSRGNELQRTTSSYTGSVADGMRY
                     SDNARPTDREHLTASQAYKSKTLEERIKQAERENRSRM"
     gene            <416335..>417429
                     /locus_tag="MRET_2616"
                     /note="MRES_12685"
                     /db_xref="GeneID:38739382"
     mRNA            <416335..>417429
                     /locus_tag="MRET_2616"
                     /product="Hsp70 nucleotide exchange factor FES1"
                     /transcript_id="XM_027629243.1"
                     /db_xref="GeneID:38739382"
     CDS             416335..417429
                     /locus_tag="MRET_2616"
                     /codon_start=1
                     /product="Hsp70 nucleotide exchange factor FES1"
                     /protein_id="XP_027484881.1"
                     /db_xref="GeneID:38739382"
                     /translation="MSNRTADQLLKWGIEHAPVHEDGTSSVAHVAADVATGRRPDLTD
                     PGLYDAIMGKSEAQMMQEELDVAVNPARTEEDRCIALDNFEMLIEQVDNANNMEPLRM
                     WPAVLALMNPVHTTPPIQVGAAWIVGTAVQNNDKAQAAAFSHGALPCILALLQDLSQE
                     AVCNKAVYALSSMLKHYPAAVHQFTELDGWTVLRSLLGINSLAVRRKVAFLLIQLLHQ
                     AKDALDTPVAGPVAPKAPIARVHPPADEAPAMMQHATTYPPVAQLLVDHGIIGALVDS
                     VVPSEDMEVDAPTSLSLCSGTYVRDDDDYLEKVVQALEALVSHEPCPSSLPEERLQQL
                     VQYLVATDGHQPRIAALDVDINALTTYLSR"
     gene            complement(<417418..>419841)
                     /locus_tag="MRET_2617"
                     /note="MRES_12690"
                     /db_xref="GeneID:38739383"
     mRNA            complement(<417418..>419841)
                     /locus_tag="MRET_2617"
                     /product="anaphase-promoting complex subunit 6"
                     /transcript_id="XM_027629244.1"
                     /db_xref="GeneID:38739383"
     CDS             complement(417418..419841)
                     /locus_tag="MRET_2617"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit 6"
                     /protein_id="XP_027485177.1"
                     /db_xref="GeneID:38739383"
                     /translation="MPPRRSSARRNAPDARRPIKLPTLVNADGSINVARMEDDEASNS
                     GLLDLVPSLPSTRIPSTQSVHTPVLDDDAVRMPPPLLGKERARKVSRSDAPRTAFSTH
                     APLHDERSVSSDESNVSVVVHDQDPPKAPVSDPTPNLPMRLRRWMHDAMKQHMYGTAI
                     FWGQQVVALETSEAAYNDAYWLAQAYFLTHQYERAEQLLTTPLRCGAVPLPSDSHGET
                     PVGTRGDALHAALTATRASSVLPPQLQERRGHADTYASVAPRQDAPKSAARTRVTSAR
                     RRKRSPSPSDPFQVSQEAPIPMDDEFSRLVVRADASERPGPCLVNWSAPCRYLAAQCQ
                     VRMGQFHEALALTGEDHTRWTGHAMSAKTPALDGGLKLGSSVCHLRGQIYLRLDEPAK
                     AKEAFMLALALDVKNYDSFVALVHGSLLGEEEQWSFVQTLEYAAQAGAEDHAQADMEW
                     VRLMYTTQLSQRMVQHALHAAHARQSIVNAHEGMRSHPPVLYSFAEQLWQAMRLEDAF
                     TVTQHILSLDAGFFLALPIHLGCMYYLPRLRPSLFLLAHKLTEAHPDSCEAWYAVGIW
                     YAAAHRWSDARRYFSKASLLDPRFVPSWIAFGHSFALEGESDQAITAYSTAARKFPQA
                     GLPRLFIGMEQLVQGNRSLALLFLESAAEELESDPLCANERGVALFLSGQVTEAMHLF
                     LQAIQTASETQHPASAWSAVHLNLGMAYRRLHRDDDARECFLRVIELDAACAPAYIAL
                     GMCAHRQGDLAGAVGWYHEGLGIDPRDPVGTELLAIALDARAAQGLPEALALSVDETS
                     VSMEESSAA"
     gene            <420375..>422090
                     /locus_tag="MRET_2618"
                     /note="MRES_12695"
                     /db_xref="GeneID:38739384"
     mRNA            <420375..>422090
                     /locus_tag="MRET_2618"
                     /product="A/G-specific adenine glycosylase"
                     /transcript_id="XM_027629245.1"
                     /db_xref="GeneID:38739384"
     CDS             420375..422090
                     /locus_tag="MRET_2618"
                     /codon_start=1
                     /product="A/G-specific adenine glycosylase"
                     /protein_id="XP_027485197.1"
                     /db_xref="GeneID:38739384"
                     /translation="MHFFALSLMAPTRATTRAKTPAWACLSEPRTHGSKVHAARPLGR
                     PHAPTYHRPYLLDQPDTAQHLLAWFDHKQHDRDMPWRQAWIEPDVPHSSKRPRLDAEA
                     PLTREERIQRRAYEVWISEIMLQQTRVETVREYWKAWMEKWPTLEALANASVDDVLAV
                     WRGLGYYGRARRIHEAAQKVMTDPHLRGQLPANAQELMEHIPGVGPYTAGAISSIVFG
                     HAVPILDGNVARVLCRQTGLYSDPRAKSTNDLLWHMARMLVESVAPHERSDVPGRWNQ
                     GLMELGSTLCTPTRPGCDTCPIKPTCLTYAEGRMYEGDLAQSEEKDMEDLCTWCAPIP
                     DPADDPTDVETTSPKKKKSLQQMTLTGKKAAPPKKSQGLDLCTKYTQLFPMRIAKQPP
                     RNETRLVCIIRATSFDGVDLAEPLYMISQRPDQGLLAKLWEFPTDILPIPHDEELDDS
                     TCMDRTHDFVASLRPPPPMRTSADQGPAAGNAPVILRPTNVRRLGRVRHEFSHLHWHM
                     HVVLAEVDALSPRESNRRDKTLAASASPSSYVQPIEWALADGVEAASMGTGLQRCWSL
                     LTRSV"
     gene            <422503..>422925
                     /locus_tag="MRET_2619"
                     /note="MRES_12700"
                     /db_xref="GeneID:38739385"
     mRNA            <422503..>422925
                     /locus_tag="MRET_2619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629246.1"
                     /db_xref="GeneID:38739385"
     CDS             422503..422925
                     /locus_tag="MRET_2619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484884.1"
                     /db_xref="GeneID:38739385"
                     /translation="MKFSSIIALAALFVAGSATVSANHVERAHQLKARVHKENGIEKR
                     GQGKMTWYAGGMLNAPACGGDAPSDDDFIVAVAENGGYGSCNQKVRLHYQGQTVEATI
                     RDFCDGCGFGHFDATKGLFSKFAGLEEGVLTGVDYQLL"
     gene            complement(<423336..>424169)
                     /locus_tag="MRET_2620"
                     /note="MRES_12705"
                     /db_xref="GeneID:38739386"
     mRNA            complement(<423336..>424169)
                     /locus_tag="MRET_2620"
                     /product="AP-3 complex subunit sigma"
                     /transcript_id="XM_027629247.1"
                     /db_xref="GeneID:38739386"
     CDS             complement(423336..424169)
                     /locus_tag="MRET_2620"
                     /codon_start=1
                     /product="AP-3 complex subunit sigma"
                     /protein_id="XP_027485077.1"
                     /db_xref="GeneID:38739386"
                     /translation="MTIRAVLIFNNYGRPRLTKFYSHLPTDRQQTLIQLIFQIVSRRD
                     ENAVCNFLDAPELTPFLPPTTGDAWSRLKTTSSLKSDEQEDVSSDFDPWLDYEDDLST
                     EKLQYHHATHRWRPDDELRVIYRHYATLYFVLVVDQSESELGILDLIQVLVEALDESF
                     ENVCELDLIFHFEEVHAIVDQIVQGGLVLETNLGQIVTAVQAVRQAYKAPLSSASSIS
                     SLPGSLASSLSSTWSPLSLGHLADRGTDTLDFIQQFGSQYWHAIQSNAARPSGMRSRF
                     S"
     gene            complement(<424303..>425039)
                     /locus_tag="MRET_2621"
                     /db_xref="GeneID:38739387"
     mRNA            complement(join(<424303..424434,424476..424556,
                     424586..424731,424778..424794,424832..424973,
                     425006..>425039))
                     /locus_tag="MRET_2621"
                     /product="ADP-ribosylation factor-like protein 2"
                     /transcript_id="XM_027629248.1"
                     /db_xref="GeneID:38739387"
     CDS             complement(join(424303..424434,424476..424556,
                     424586..424731,424778..424794,424832..424973,
                     425006..425039))
                     /locus_tag="MRET_2621"
                     /codon_start=1
                     /product="ADP-ribosylation factor-like protein 2"
                     /protein_id="XP_027484845.1"
                     /db_xref="GeneID:38739387"
                     /translation="MGLLSILQKNKYKDRELRILFLGLDNAGKTTTLKQLLGEPLDTI
                     SPTFGFSIRTLVRHSFTLNIWDVGGQRTLRPYWRNYFEKTDGVVWVVDSGDVTRMHDC
                     RMELWNLLGEERLASASILILANKQDVPGALASDDIRKLLKLDDIQTHAWRIQPTSAY
                     TGENVNGALDWLLEDIRERLYYY"
     gene            <425259..>426894
                     /locus_tag="MRET_2622"
                     /note="MRES_12710"
                     /db_xref="GeneID:38739388"
     mRNA            join(<425259..425303,425344..425571,425614..>426894)
                     /locus_tag="MRET_2622"
                     /product="acyl-CoA dehydrogenase"
                     /transcript_id="XM_027629249.1"
                     /db_xref="GeneID:38739388"
     CDS             join(425259..425303,425344..425571,425614..426894)
                     /locus_tag="MRET_2622"
                     /codon_start=1
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="XP_027485076.1"
                     /db_xref="GeneID:38739388"
                     /translation="MTQELKRFSREEIAKHNKPDDLWIIVDSYVYDLSGFIDAHPGGQ
                     AVLLMDDVAGKDATETFFGLHSIEVLMRRGVKNLIIGKVEGEEPKVHYPQPGDISKVP
                     YAEPAWLVENFHSPYYSDSHRRLQREMRVFTEKYVLPVAEKCEVSGERPDVELVKLMG
                     ANGLNAMRLGPGKHLAGRKLFADIKPEEFDYFHELIITQELSRCGTRGFMDALQGGMV
                     IGLPPVINFGSDEMKREIVEPVFRGEKFISLAITEAFAGSDVMGLRTYAKKTEDGQHY
                     IVNGTKKWITNGNFADYFTTACRTDEGFAVILIPRALGVETRIIHTSYSPSAGTAFVM
                     FNNIKVPAKNVIGQDGMGIPIVLSNFNHERWVMCCGTIRGARGICEILMKWIHQRKVF
                     GRPLTSQAVVRQKLAFLITQVEAGQAFLEHITLQMNKMSYKQQSKFLAGPIALLKAWS
                     TRISHEVADNAVQIMGGRGLTRSGMGRKIENYNRNYKYDAVLGGTEEVLADLGIRQSF
                     RFFPHDHKL"
     gene            complement(<428823..>430490)
                     /locus_tag="MRET_2623"
                     /note="MRES_12715"
                     /db_xref="GeneID:38739389"
     mRNA            complement(<428823..>430490)
                     /locus_tag="MRET_2623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629250.1"
                     /db_xref="GeneID:38739389"
     CDS             complement(428823..430490)
                     /locus_tag="MRET_2623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485075.1"
                     /db_xref="GeneID:38739389"
                     /translation="MLRRPLVTQLRKSLNIIHLTRRWRSEIATGSLDEKPTVGELDKL
                     FAQSRSHDAKKVWTHTFTRMSDSFTRQQLYELARSANLKDMKASTPKAMIVKAFLEQR
                     FNLTDPNEETASIFVRLPMSSVFLLTQCGALLFKSAQNFGAQVYMGKSGNDVGVAITG
                     TKRAVQNMQDWLETFERDIQYMSTPYRPQAHTLPWIMKRTQCHVSQDNGDAKLAFLHP
                     YHAQQATMLLEQQMHVQSLQWENLWSFTPDRHVTASPLPFCPSSMADPSDEFNVSLGT
                     WTRLSGGISDLPNVLCHLNDASLVDPLAWLASRAYQMEPTSDPSVMVDGPWESNLSLT
                     FGHILWKDQPSITQPLTSHISAPAFFFESELPNATTQTPYIPGWTEMSMDELETERIY
                     YRGLTPWGPMDLVVIHEIQHEQLVPRACWWQYETHVPILCPFAPVDVCLTAVNRAPSR
                     LDVPELIRTVDLDDSFRSLPTTLSVEFAGTKFWRLWRSERIVQRTSSYAHTDHPNELI
                     FHRVSLRRNSMPHFSHITRIDFPTWSNDYIGMLTSLLRTSYPTLGKQ"
     gene            complement(<430565..>431119)
                     /locus_tag="MRET_2624"
                     /note="MRES_12720"
                     /db_xref="GeneID:38739390"
     mRNA            complement(<430565..>431119)
                     /locus_tag="MRET_2624"
                     /product="exosome complex protein LRP1"
                     /transcript_id="XM_027629251.1"
                     /db_xref="GeneID:38739390"
     CDS             complement(430565..431119)
                     /locus_tag="MRET_2624"
                     /codon_start=1
                     /product="exosome complex protein LRP1"
                     /protein_id="XP_027485074.1"
                     /db_xref="GeneID:38739390"
                     /translation="MSHSSYAHTVSDPTDIVNKLREQIGPVKQNVQTAFGKRMEECLS
                     DLEAKDAAARANDPNVSLQHRLTASKMLVSAAYVYLDMIWMYLKTKGIDPSTHPVHAE
                     LERVHAYFDKLKKVGPPDLDKQSNRLRVDADASKRMVHAATKLGKHTRFDEQDSEKQA
                     QEEDSATLTKKSKKRTTGKAKKTN"
     gene            complement(<431215..>432129)
                     /locus_tag="MRET_2625"
                     /db_xref="GeneID:38739391"
     mRNA            complement(<431215..>432129)
                     /locus_tag="MRET_2625"
                     /product="homeobox domain protein"
                     /transcript_id="XM_027629252.1"
                     /db_xref="GeneID:38739391"
     CDS             complement(431215..432129)
                     /locus_tag="MRET_2625"
                     /codon_start=1
                     /product="homeobox domain protein"
                     /protein_id="XP_027485073.1"
                     /db_xref="GeneID:38739391"
                     /translation="MLTQEQIRQKLLEFECTLLNALAGDVDESYYAQLRQLTETVRRE
                     FSMQQEHGTLTNATLQLGARVSDRLQQLAHLLHEERMQMQCIHSAANMELATILRSTA
                     KQPSVRGASCSDRRDPALNAKNMRNWFLRNLGHPFPSREEKEMILAETNAFIRDHSMR
                     LKYSQIVLWFINTRRRSGWTSFLRCYARGDKTKLLELAWAIQNEEGGTHETRHWSAGN
                     LRDLPAGSRRSIQCDTSSAQRHIRTLLPNLNDDAICTMRREWSRIADRVRIGAKERVG
                     EWVEEVIRTPSVPSASASHRRALRRVMP"
     gene            <432606..>434186
                     /locus_tag="MRET_2626"
                     /note="MRES_12725"
                     /db_xref="GeneID:38739392"
     mRNA            <432606..>434186
                     /locus_tag="MRET_2626"
                     /product="homeobox domain protein"
                     /transcript_id="XM_027629253.1"
                     /db_xref="GeneID:38739392"
     CDS             432606..434186
                     /locus_tag="MRET_2626"
                     /codon_start=1
                     /product="homeobox domain protein"
                     /protein_id="XP_027485072.1"
                     /db_xref="GeneID:38739392"
                     /translation="MRPELDFLDECLHTLRDLRTGHAPVLQSPIMDMPDAHLNLQHVC
                     AQSFAAALRKRPISSEVHDALVSMYERNLGQLKHMYTEHFRDAQQRWGSARQRALPQI
                     QRLFEVQCQMAACDLQHAIVTLVDERLELFAADASAPQESHRPHSAHAIAILERAFEH
                     TPNITQAEKYKLAHATGLQPRQVTIWFQNRRNRRSNARRTTTLESDFMSPDPGLPSPP
                     PSRLEDPSLPSPIRKYPHDLKQESNGIIKREGNLSTAVPEWSGTASIEPPAIDGPAQS
                     MTFSSSPLQHGDAALSPSTIQMHTPALVPSVVAPSSPTMLASAQATPASTAASMSIMP
                     AAPPLSLDQLLDMDNARQCVVFSPLDSLPRLDFDDLRLDVTTMENWLGMPSASGVSSL
                     HVPPISAGAIRAAEVALAHSLNAPDELMGRAADEGWSLSEQITPVWNVPAEAHQRLHP
                     DPAVRLDGVMLRRDSFAKLERQAPPPSAPLMTTSHYATSPLSMANAVTGARWNHDAIA
                     PSLLTCDFSRIISSPLVP"
     gene            <434387..>436102
                     /locus_tag="MRET_2627"
                     /note="MRES_12730"
                     /db_xref="GeneID:38739393"
     mRNA            <434387..>436102
                     /locus_tag="MRET_2627"
                     /product="methionine permease"
                     /transcript_id="XM_027629254.1"
                     /db_xref="GeneID:38739393"
     CDS             434387..436102
                     /locus_tag="MRET_2627"
                     /codon_start=1
                     /product="methionine permease"
                     /protein_id="XP_027485071.1"
                     /db_xref="GeneID:38739393"
                     /translation="MTGSFDKQAGEKKIVTEEGSLSDLPSDEETRLGHPGSSPDSKTE
                     AGEDYPPAEVHYDELPQGRQLGTISAIFLMVNRILGTGVFSTTSTILEQSGSAGMSII
                     YWVIGGVIAGCGFAVYAEFATAMHRNGGELNYLQHVYRKPKHLVASAYAAQALLLGQA
                     AGNANAAGQYFLRAGKDPNRVGEETDEWSSKGIGIAVILSALFMHAALPKYGLIFQNT
                     VGLFKVVILLLIVFAGFAALAGRTIGPAPDNLSHAFVNSRSDVYGVCQCIYNAIWSYV
                     GYSNLFYALGEVKNPARTMKIAGIVSLVTLTILYVLCQVAYFAAVPMDEILNSKQIIA
                     AAFFKHMFGERSAKALSVFVALSAVANVFAVLFAQGRLNQALGRDNIIPFAKMFASNR
                     PFNTPLAGLSWHAIVTLILMLAPPQGDAYQLVLSLAQYPLNVVNTAVGLGLCLTYVPV
                     SSRFRVPWLREWRPTFRATLPIAIFFTLVSAFLVVVPWIPPPSEEEATFKDIWYGMAP
                     SIALGFFGAGALYWFCWYVLMPAVGKYKLVERQSSLKDGTPITVFDRVHPSEVDDHVS
                     YNSST"
     gene            complement(<436141..>440496)
                     /locus_tag="MRET_2628"
                     /note="MRES_12735"
                     /db_xref="GeneID:38739394"
     mRNA            complement(<436141..>440496)
                     /locus_tag="MRET_2628"
                     /product="ATP-dependent RNA helicase DHX29"
                     /transcript_id="XM_027629255.1"
                     /db_xref="GeneID:38739394"
     CDS             complement(436141..440496)
                     /locus_tag="MRET_2628"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase DHX29"
                     /protein_id="XP_027485232.1"
                     /db_xref="GeneID:38739394"
                     /translation="MAKKKKLQLKSNVQRGFATTSQPKREAPPKEAPQAAEAASKTPD
                     ETPSAASQSTAPPVPKEAPSSDAFDPEAEELQALQNLVQLVYPKVEKETQRRGKTIQF
                     QQRFAKTLLPASLDAGVCVETLAMVRHDAEAITDCEQVNFLADDPRQRMLRDTLGVSP
                     PAESEAKALERALTLWELLLSLGFSREQATMALLYAPNLETEECVAWLVAQLEPQTYR
                     ALSFNVDTPQEYAAPKAASMDESIPPVYEGYTFTRAEQDPALVAKDTAPKKEDVRVVT
                     ASSVDAQTVERIRAQTDTLLQDLNAQLDQDDPLVDVIEHPNDAWSTARIVALQVDKDR
                     ARRSKLLGGVPDDELASLLSHAEASKRLDRLAARAKDMMQQSEMQPDFHRGLSNQRFR
                     ERMRQLEADEAAKAAELQREEEARQQRRADIEQLDELSASPDQEQDEAPQDEGLFDLL
                     EEPAPAAPDASVQLRSIATQGSQRTPRSLLSDVLRHVDPGASYKFIPISSGTVHRSEL
                     RIQWTASGGRPPLVDTFRLTKEGCASRTLADDYVATIALNCFGRERQVQRHMSPGFRD
                     IWDELESLRSQQMNAFLRDEVLHVQHTLRRRVPPAPPKREQRKTLMEPVVAPIATRAR
                     EPSDALRDMWTRRMSSEAYQAMLPGRRDLPIYQARDAILQCVATSQVVVLSGETGCGK
                     STQLPSYLMEDCLARGEPCKMYVTEPRRISAITLAERVSQELGEKPRSMGSPESLVGY
                     AIRLESQIGANARLIYATTGMVLRMLESSVLDDVTHIIVDEVHERSIESDFLLIVLKK
                     LMQERPDLKIVLMSATLDAERISAYFDGCPTLAVPGRTFPVDVHYLEDVLEMCDYTLD
                     LESPYARTDKMNKVDLKTNIDDIEEDEDDVDDVPGIQDTQRYSAKTIDTLLHLNEHKI
                     PYELLAALVERLCSDPAYESFSRAILVFLPGMGEIRECMRHLSELRRFQTECQVHVLH
                     SSIASDEQTAAFAPPPQGMRKIVLATNMAETGITIPDITCVIDSGRHREMRYDEKRKI
                     SRLVDCFIARSNAKQRRGRAGRVQHGICFHLFTRKRHDEYLDAHPIPEMLRLSLQELA
                     LQLKVMPLRIGASIEDALSQALDPPLAANIQRAVASLVDVEALTPNEEITPLGRHLCH
                     MPLDVHLAKFLLVAVLFGCVDAALSIAAVLNSKSPFLRNMGREAGRGRAAFHSTEAQS
                     DFMAFAQMFRAWRSSVSRHQGQAFCSAHSLSADVLYQIEELRQQYFSYLIDTGFVQVD
                     TDTRNALARRRSRQGRPRLMDIPAHLDTYGQSVPVVTLALVTAMYPKLLQVDEKTQQM
                     RTLTNNQPAAVHPSSVNARRALGTPSTHFVLYHAIVYSHRLYAWETAVVDDRMVLLVG
                     GDAEFKHTSRSMYIDHNRVRMSTYDAPSLVALRVLRAQLKDILQTSYRSPGRPWTPTQ
                     HRTMQLVFRTLGVSS"
     gene            <440626..>442856
                     /locus_tag="MRET_2629"
                     /note="MRES_12740"
                     /db_xref="GeneID:38739395"
     mRNA            join(<440626..440717,440744..>442856)
                     /locus_tag="MRET_2629"
                     /product="INO80 complex subunit 1"
                     /transcript_id="XM_027629256.1"
                     /db_xref="GeneID:38739395"
     CDS             join(440626..440717,440744..442856)
                     /locus_tag="MRET_2629"
                     /codon_start=1
                     /product="INO80 complex subunit 1"
                     /protein_id="XP_027485078.1"
                     /db_xref="GeneID:38739395"
                     /translation="MESTSDSRSHTPMSEAVGHGASAGPTSMARTSSQARNQPVKRYD
                     GEPLSRTDVQHAMLCYLFSDTRRVFTNPRAGTRGAPMSTFVHSVAHGGHETQGSASNA
                     NDSDKSALSHAPPAVQACVTSAMAGPHPSFVWPYGQSAGSARRSDESPEEKEAWEKRC
                     SDYLTWRDAHYPMSITPVNELTDEDKQNDACMAWAHPGAEKLTFKELYIEALMNSGKC
                     TKSMREKCFLDEEYAEDFSKVCLLVNVGRINTTLAFYPEMKTILRSYHPLPSLQKSEN
                     TRRNMQDAPRMKSLLKAVLLPSERPGPPGGSGTASASAKHEEGTDTEEVPTDVAEVAR
                     RLRRQRYPPTSVVTLIFLLTQQSTDIMSMHFPPPFDVHSLFFPQASHPVSAKDRANVF
                     LWLLYHYLEGPAALPPGAPGTENPFDDDVSRAARHRAHEAWIQQGSVPLSEAHPLWQG
                     TPNPAYAKWCEMYEHLLDPNGDTYASATSRRFIKKRGADPTDEADVPACPESHTDRLL
                     VPAMPRMSPDAYAREDADPPEEIAWGKQMQEERAAFLVRFQEEEQAKVLAQSGILDDP
                     EHGRYDEARPKKRLPMNTQSCYPLANILANAAAAGSHAGALTRSPIGFVKRARLSSRH
                     SHSSRDHRLASSDLHDLDLDIDGDEHGDEHSQNSFWDLDLSAAMGSAPAPSMLQRAWE
                     RIKLHADQDDEKHDSDDDTNDSDDEAMLARQLLVLRRTREARGENKAQVAAV"
     gene            <442878..>444500
                     /locus_tag="MRET_2630"
                     /db_xref="GeneID:38739396"
     mRNA            <442878..>444500
                     /locus_tag="MRET_2630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629257.1"
                     /db_xref="GeneID:38739396"
     CDS             442878..444500
                     /locus_tag="MRET_2630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484846.1"
                     /db_xref="GeneID:38739396"
                     /translation="MFRANRSLSSDAFEAYRLAPRQDAYTRIYPLPKRVYVHSAQAGA
                     RLGYKELKAQADYPVAAIVQNELSYVAEDGSLIHAAIGMDISFRVQDTPYANAGVFDG
                     SQCMPTLSRMGNAWVLSGTGTSLLAIHGDAHTQVEVPGVEHDGEAMPWHVMHAQESYA
                     LLQRAVRHSPSTYFDVVCVSLSDDRAHILWHVTCDHPVTYALCNGPEALLAAETPVSL
                     PTRDTPKPLPWYAWSQTPDDVSCSITLPLSVSKDDVRATFKPQGFSLSLCPPHARIYD
                     HPPQSAEEHLLQGTMENCTLWASILADESTWSWETSPHNAKLVLHMTKAHSGTRWPSL
                     LVNDDSVPETLDATDMAPMMDRLDPYTSSRLLQDGLEDEDFDMGTPWHLSYIDANGKV
                     LHAQDQVSFLARSIPSSRDPAVLLKHDMDGHVFTPPSPISFFAWTHTETVPAISYVLA
                     SKRDAHPIYMYRGTSMTWIIAVETRTSTSQSLVYVYGIGHNEAGPSTSGWCRIHPLEV
                     GPVLDVMVIPSRHELVCLCESSIAIITHALLG"
     gene            complement(<444465..>445333)
                     /locus_tag="MRET_2631"
                     /db_xref="GeneID:38739397"
     mRNA            complement(join(<444465..444713,444742..444786,
                     444812..>445333))
                     /locus_tag="MRET_2631"
                     /product="DNA 5' AMP hydrolase involved in DNA repair"
                     /transcript_id="XM_027629258.1"
                     /db_xref="GeneID:38739397"
     CDS             complement(join(444465..444713,444742..444786,
                     444812..445333))
                     /locus_tag="MRET_2631"
                     /codon_start=1
                     /product="DNA 5' AMP hydrolase involved in DNA repair"
                     /protein_id="XP_027484847.1"
                     /db_xref="GeneID:38739397"
                     /translation="MASKAMSRTAPLLLAHSTEPWSVSPPNAMWYDALKYIAKHKDIS
                     TFPKGLLVDADPYTYTICDGYPKAQYHFLILPRIPFYVNYNEERTEVPESDMESISTL
                     LKSRFARDILRRISDARDRLVVRIHESMKQSRVRPDGAYAYYPESEADWGHTVWGVQS
                     GFHNVPSMRHLHLHVISTDLVSQRLKRKKHYLSFHPGVEYWLPMEQAQQWVDQGRTQL
                     PHAPEYYESLLEGPFVALDGMPKTFSDLPEVKYYLKQRFSRVSSQQRMSDNRN"
     gene            <445496..>446617
                     /locus_tag="MRET_2632"
                     /note="MRES_12745"
                     /db_xref="GeneID:38739398"
     mRNA            <445496..>446617
                     /locus_tag="MRET_2632"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629259.1"
                     /db_xref="GeneID:38739398"
     CDS             445496..446617
                     /locus_tag="MRET_2632"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484848.1"
                     /db_xref="GeneID:38739398"
                     /translation="MPNHVPPTGIRRSRRIAEKRGDACTEQSPPPMPSAPRLEADTPQ
                     FDGPRPAWVTGQDTRSDTLPASPKRGAGGTEFEPRVLPPLSQHAIKHMPMNKGTLGMG
                     LSFPKHTSNKSLTDTTQSKSSRSPRKSVSFHEVGERSCEDSSDFAATPTPLAPRIGTL
                     ESGRFSPHSQPENDGLLVSEDHEEAKVPPRHVSSRMQHSASIRREAPIRLDTMPSDGD
                     VIGLGIDIPEIQDPVEGVTASIKGMSLEKAPLRERSTNAGPKRVPFGEKRLTQDTLRD
                     KKMQSSFKISSQNKAEATSTASTSKFVDENGRPISYTIPTKRYMLPSCRKARSSMSQS
                     AMQRDRVMFSVSYQHAHNRTTTQPSIHINQHSRRTYALR"
     gene            complement(<446621..>447868)
                     /locus_tag="MRET_2633"
                     /note="MRES_12750"
                     /db_xref="GeneID:38739399"
     mRNA            complement(<446621..>447868)
                     /locus_tag="MRET_2633"
                     /product="N5-hydroxy-L-ornithine N5-transacylase"
                     /transcript_id="XM_027629260.1"
                     /db_xref="GeneID:38739399"
     CDS             complement(446621..447868)
                     /locus_tag="MRET_2633"
                     /codon_start=1
                     /product="N5-hydroxy-L-ornithine N5-transacylase"
                     /protein_id="XP_027484849.1"
                     /db_xref="GeneID:38739399"
                     /translation="MAASALIQPDIHAPVIVKPQLYALYVKENTRLDVHVQHDGEHRG
                     RTVHHLCIETNDDAFAVPHVRVVAPCEPYTHPSEEPNDNSFAARALRMARVSLPISLS
                     LWQVWACTYVLFTLWPDQEYFVLEADGCAWRKPLLSSGLAFPHPDHIQQQDWLHNGTL
                     VVSRAAFWQGAGPGGPHVWVPFMETNAAFPMVQASYKCAPQGLAAAPLHPFRPPASDV
                     TQPLYRRYVPEVGQTLSFRCARSNCDADVDLLHTWHATDRVNTGWRQNMPREAHKKYL
                     EDLEASSDHIPLIAEWNGEAFGYMEIYYAKETSLRTYYDAGDFDRGFHALVGEEKFRG
                     PHRVRSWMGSLIHMLFLLDPRTMRVVSEPRASNTKMVEYECLCGGHVEKLIDFPHKRA
                     ALVFIPRERFFQLCPLGPLPGRT"
     gene            <448104..>449723
                     /locus_tag="MRET_2634"
                     /note="MRES_12755"
                     /db_xref="GeneID:38739400"
     mRNA            <448104..>449723
                     /locus_tag="MRET_2634"
                     /product="L-ornithine N5-monooxygenase"
                     /transcript_id="XM_027629261.1"
                     /db_xref="GeneID:38739400"
     CDS             448104..449723
                     /locus_tag="MRET_2634"
                     /codon_start=1
                     /product="L-ornithine N5-monooxygenase"
                     /protein_id="XP_027484797.1"
                     /db_xref="GeneID:38739400"
                     /translation="MDLATEMYDHIGVGFGPANLALCISLHENERAKATGFSMCFLEK
                     QTEFAWHPALLLPGAQLQVSPLKDLATMRDPTSSCTFLNFLHEEGRLMPYINREEKVP
                     SRREWSAYLAWAAKRMDSYVRYGRQVVDIVPMEEKGVLSYYRIECEHVETKQRESFFS
                     RNVSLAVGGWAKVPYVFQSMYKYPSDQGLSRVVHASTFLPQITKLAPLLHRKTKPLRF
                     AIIGGGQSAVEILCYLRNQFAQADLDMIFRASALVPSDDSPFVNAAAFDPSSVSTFWQ
                     STARQRAAQLAEFKRTNYSVVRHDLLGHVYEMVYDQDIDYREPMEEDKGKIRLLSNTE
                     LVRAEQLSSEHGEDEGCIRIDTCTNAGEVLERSGTYDAVFLGTGFERDPSLLPFVQTL
                     AKYFPLLSTQGAAQLHEQELALDDQVMHSHDPESMRAQVRGITRDYRLVPADLSQWRM
                     SLSMPTDVAQCVARSQLGREGCREPSLPPSRAASLPDTSAAQSEAPAVSGQIFLFGCN
                     ERTHGLSDSLMSMVAHRAGIVTASLLHAKGM"
     gene            complement(<449732..>452530)
                     /locus_tag="MRET_2635"
                     /note="MRES_12760"
                     /db_xref="GeneID:38739401"
     mRNA            complement(<449732..>452530)
                     /locus_tag="MRET_2635"
                     /product="exocyst complex component 1"
                     /transcript_id="XM_027629262.1"
                     /db_xref="GeneID:38739401"
     CDS             complement(449732..452530)
                     /locus_tag="MRET_2635"
                     /codon_start=1
                     /product="exocyst complex component 1"
                     /protein_id="XP_027484798.1"
                     /db_xref="GeneID:38739401"
                     /translation="MSEQIRAALKSRVADNEYISHLKVREYADANAASQAAPSCKTRY
                     IILGVSPSQQRAFVYKARRNANGTYSIGKEWEASHVRSIVREGSNVLVTFSITHRWEI
                     DASQDPIPFLNDLATIVHRAHGALPKISGWSYEPSILEKPPPEKPPMTQPPPPTAASP
                     SVPQRTPRREPQPVPQRTQQPALVEEVSASAAPAVTTAPPRPILQRRLTRPTAAQAST
                     ALVAPRDDENSTLSQVEEMLEGFEWKVARHAAPDVRPKRFGTADVIEERLLEELAALE
                     SSGIHAMIEPDERVARVLRDIDNALLQLDRLDASVAGYKMQLLSRSEDIGFIQSQNRG
                     LQVQTSNQHLLLQEVEALLSTIQVDQQAMQKLATTTFSAGAQVSDLESAASSLYKSIL
                     QSRPDKHKQMAGVDTKGMAEHLAQSEAAAREFNERLVTEFQSELERAMHAQLNDLQHS
                     QLSMASEPTLPPHDVMEQWLGKYCGLALYLRETTPDLFDKFSHMYMAFEAQCYRTELQ
                     RVFGAAAKHAGRTRHDDGPSQALQRILASLLARVSAEQTFLADLLQINDDSLTFADYM
                     DLEPYYKHRAAVTMALPTQGPQQALEHAMHQIFAVVVPELDAFVSQAYQQNAWSVVGM
                     LVETELAQRTLTQRAGGAGVAELLHKNSTRLHAELGRLLHGQLQAVEQTKVSVHRRCG
                     ILPVFQAFPGFVARMEAQMGEADALPVRTAVDEGYDRIAHALMTTIQSIPQTAGAMMD
                     EDKGQLNHHVLVIMNVFHLYTSIKPGTPPNAALVRVQAQAQTQFETSLTGYVKTILRR
                     PLGKVIDFCHGIETLLPTTPATEVALHSHFSRSSAKKLVRDLSQKDVRKAIEALSKRI
                     QKHFDDEDASTALTHIELAHVLQQVWQSSQDMFTAEVERLGRILLTCYPQSGLGLEIS
                     SQDVQRLFQTLAPTGRRR"
     gene            <452643..>453605
                     /locus_tag="MRET_2636"
                     /note="MRES_12765"
                     /db_xref="GeneID:38739402"
     mRNA            <452643..>453605
                     /locus_tag="MRET_2636"
                     /product="DUF2305 domain protein"
                     /transcript_id="XM_027629263.1"
                     /db_xref="GeneID:38739402"
     CDS             452643..453605
                     /locus_tag="MRET_2636"
                     /codon_start=1
                     /product="DUF2305 domain protein"
                     /protein_id="XP_027484799.1"
                     /db_xref="GeneID:38739402"
                     /translation="MSSPSTLFVGGVRARLWRAPQPRAAILFICGNPGVTSYYTEYLT
                     QLYDALHGQCTILCKGSLGIDETGPEAPPPTGVWPFRYYGLEDQIASQSRALDTLRDL
                     VPPSTPLFVQGHSLGAFMALQLLNMHADKIHAMYLLFPAICHIAQAPQARITRTFLFM
                     PVFALVHMMCWILSRIPRSWLYWIIGHTSLRYSPDATADLVARPYAVATAVYMFHDEL
                     RMIKDIPTHVAERAKDKIVRSYWGQGDSDSWSTSFHRRHAESALHLDRWQNVIHTAPP
                     SKHTSTECQDALPHAFCLRHSEAIARITSRWVQADGPGPHGPLG"
     gene            <453655..>457461
                     /locus_tag="MRET_2637"
                     /note="MRES_12770"
                     /db_xref="GeneID:38739403"
     mRNA            <453655..>457461
                     /locus_tag="MRET_2637"
                     /product="WD repeat protein"
                     /transcript_id="XM_027629264.1"
                     /db_xref="GeneID:38739403"
     CDS             453655..457461
                     /locus_tag="MRET_2637"
                     /codon_start=1
                     /product="WD repeat protein"
                     /protein_id="XP_027484800.1"
                     /db_xref="GeneID:38739403"
                     /translation="MSAAALPSLVQQWASLGASHAPAEDVPKDSPRIAAALNTFASYV
                     DEARGLYICAQASGRRVNVFMDRSQLMQSLSFDDVRGAKNVVLKGISSVALSKDAPDS
                     DSLLLAASFGGIIAMWRLDAINLAKMGQAPKYGRWRLEGTLPLRGQLVSSLSVRQGLL
                     ATGSNQCVSVWKRGTYANAPWKQIWSTRTPRPLLRVQWSHDGQFLAAVPLHDTRVLVW
                     HVQDKQVHLVSKLRHTRTVHSIHWRRPQMPDDSRPPALVVITTNATAFVYATMPTELT
                     FRHWATVDASSYADDMSMAQRVISLMYCDGYHASVALRHDLQLLEQQEQLALTGVASS
                     SDTERQRRASRVKQLQQYLAQGPDLFFALLADGSMVVYGLFRMDEPTPSLWHALLTLR
                     VPPCISTEFSHAPLMLEFMPLAPKSLDSSRIYPTALIHGQTATGLRGTMAVSLLLLLD
                     GDIHGLFVQNTMTDTNVPAHSQSHTHTFLHAEHRSDILSLETTQQARSLLSFSRDGVM
                     IWWTLCEKGTMASLVSESQFRLRRAFAVCALGDGPNLCALDASHLNVALFDKACFVPH
                     DEDAIALNNVMLSRRELPQPVSPENVVLFRCIQVDGKDVIMLGQRDGTLYTWTCTSTP
                     SGLSLASHETHALMDGVVCAAVVPYWHPQTCAMALLAISPDGSLGVWDTLSWTQLHHV
                     HVGHGAEHVCASDDGHLAVLLHHDDTYTVCVHDLRLSPFANTLVHVHDMGCTSPSMAW
                     KTMKGGGAVLATGGDQHVTLLAEGRLTWTPIARVELHGMDSARISHVEWIAPHRLLIS
                     STCQLFLFDTDRHSSLEDMLARHTHTRPYYDATALLRCVQFGLVHDAQQTLQMLDRAA
                     AHGSWGRVHWTLQRASLASLEAPTPIPPLVERLHESQLPGVDKALCATLQGVHHAIHT
                     DVDVPGMQYLLAWYASQHTNAPMVWAYVSESQDALLSKVTSVWSDRVSWPVVRDSGVF
                     GWMRKREPLLPIMEQVARSAFTAGDDIDPVQCSLFYLALKKTHALRSVWRRAIGHSDQ
                     AKMLAFLAHDFSEERWRIAAQKNAYALMSQRRFAFAAAFFLLGDALSDAVHICVRKLD
                     DVPLAMAVARVYEESDYGPVFQRIVKQYAIPHAHTTGDRWLGVWAHLLLEEHVDAVRT
                     LTASLPAPADRRPMHDLPDPSMLLLLEYFKQQYWCYEALDPYTETQCVSFYARLLCMS
                     GCDWVGLTMLRSWSFARDAPEPPAPAPLPTESAPAPTKIGSLMGERRPPPAQTMAEFD
                     MSAFGL"
     gene            <457618..>458901
                     /locus_tag="MRET_2638"
                     /note="MRES_12775"
                     /db_xref="GeneID:38739404"
     mRNA            <457618..>458901
                     /locus_tag="MRET_2638"
                     /product="aspartate aminotransferase, mitochondrial"
                     /transcript_id="XM_027629265.1"
                     /db_xref="GeneID:38739404"
     CDS             457618..458901
                     /locus_tag="MRET_2638"
                     /codon_start=1
                     /product="aspartate aminotransferase, mitochondrial"
                     /protein_id="XP_027484997.1"
                     /db_xref="GeneID:38739404"
                     /translation="MSAMLTRASRFALVSKPFSQTLRFKSVWSGVQAGPPDAILGVTE
                     AFKRDTDPRKINLGVGAYRDEAGLPYVLPSVLEADKRIANMNLDKEYLPITGHSNYQK
                     LAATFAYGADSKPLKENRIATTQSISGTGSLRISGEFLARHYPYNKEVYLPTPSWGNH
                     RPIFLNSGLQVKQYTYYDKETVGLNLEGMLRDLKNAPSRSIVLLHACAHNPTGVDPTQ
                     EQWKQISDVVKEKEMFPLFDMAYQGFASGDPDRDAFAVRYFVEQGHQIALCQSFAKNM
                     GLYGERCGLFSLVTANEDEAKRVESQLKITIRPMYSNPPVHGARIAELVLSDPQLYAQ
                     WLKEVKGMADRINNMRRTLKTLLYEKHGSKHNWEHITNQIGMFAFLGVTPEQVNKLVN
                     EHHVYLTQDGRISVAGITDHNVGHLAASLHDVTSN"
     gene            complement(<458898..>460417)
                     /locus_tag="MRET_2639"
                     /note="MRES_12780"
                     /db_xref="GeneID:38739405"
     mRNA            complement(join(<458898..459023,459050..>460417))
                     /locus_tag="MRET_2639"
                     /product="DNA polymerase mu"
                     /transcript_id="XM_027629266.1"
                     /db_xref="GeneID:38739405"
     CDS             complement(join(458898..459023,459050..460417))
                     /locus_tag="MRET_2639"
                     /codon_start=1
                     /product="DNA polymerase mu"
                     /protein_id="XP_027484999.1"
                     /db_xref="GeneID:38739405"
                     /translation="MSGDVLGQAQWRQRGASDRILTHAIRVFILEEKINPSEYSRLCA
                     LAKQLGAVVCTDRRDANMLLTGIRAPKRIEMHTSAEERDCMPILETEWLDESARQKKC
                     LAFDGFLAWQPRRVKEQDPTAQCCMCDSDATPPPSSPFLNSSREASPAPTWTNSEYAV
                     CRPTPLRSPWNQALVDELELLRTHRRLAYDVHSELAYLRAASAVKAVPHFLATTSHAD
                     LRQIKGVGPKMATTIRQFYEEGYIPEARMIRSDPAVQTMLTFMKLYGIGPRTAERVYN
                     EGCRTLEDVTRRCKTDLSARLGPVTSLALLPDLSQLIPRDQVESIAAAIHHILQSMVP
                     DAHATIAGSFRRGKAASGDVDMVMSGTTSNSASSILSSLVQTLQRLGRVSHILSVPRQ
                     EDHREVDVAEVVYVASTALHGPVHRRVDIVFAAPNRYGAAILAWTGSSLYERDLRRWA
                     QARGFSFSQMGLVDLHTQRTLVTPTEEHVFDMLGLPWMPPTLRNADP"
     gene            <460524..>461599
                     /locus_tag="MRET_2640"
                     /db_xref="GeneID:38739406"
     mRNA            join(<460524..460645,460675..>461599)
                     /locus_tag="MRET_2640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629267.1"
                     /db_xref="GeneID:38739406"
     CDS             join(460524..460645,460675..461599)
                     /locus_tag="MRET_2640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484990.1"
                     /db_xref="GeneID:38739406"
                     /translation="MTGVGRVRHDATRASPYSSKPNVKNPSKSPRRYLHSAFDNFYDF
                     FMESNVHAGAPSIRPRITHTRQSSLRSSSEVSDESMSDEDTGTRDALSNDTGSWGQVP
                     MQSTPRPRAQREIQDDSFLDRLMTGAKDVPKAPKRKRGRPRKEEAAFTFHPSSIQPQA
                     SVSASFPRRATQTTSTPLEDSTEQPKRKRGRPRKRELAPHEEIALIAFKQSGHIPPWT
                     VIAPVDRPPQYPETHVYFRVPQTRRHPPSILDSPEAPKPQPSRWWHYKRPLLRGIPAR
                     RTDGQTPEPLPLAPPGRRPRTRVDYAALQHLQLANRARGAQLDVQALWQHRVSKEKAR
                     FTKAATTGDATTAA"
     gene            complement(<461583..>462729)
                     /locus_tag="MRET_2641"
                     /db_xref="GeneID:38739407"
     mRNA            complement(join(<461583..461627,461656..>462729))
                     /locus_tag="MRET_2641"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629268.1"
                     /db_xref="GeneID:38739407"
     CDS             complement(join(461583..461627,461656..462729))
                     /locus_tag="MRET_2641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484988.1"
                     /db_xref="GeneID:38739407"
                     /translation="MNVHSKDDRCDVSMAPNEEPMMRPGDHFPVNLRPVLEDVPWDNE
                     DEMPSVSTTCYIDRDSIRLPLHLPYTSADVSNWNALQKQSVHRLYAQHADRGQRPELV
                     RPPAESLDTSKPRRAPHDMIGWSFLSPHDEKKMALDGQHTLTQYKSSLAAWNQPWAFK
                     DALGADSNAHVAGNTLVGSRIHKGAFRVPWHRKLAVFLLRNPFVPLLLRLINIAVLTS
                     TLAVGVRLRRQLIQHDIESSVGISPLTAIIFAPLSLAYALFQIWLEYKSRPIGLWKAS
                     SKLWYMTLELVFVCLWSAELALSFDNYFTSTIGCIKSSSPFYSHAYQDTNANISDKSP
                     FCNLQTSLICLNFISVMVYLVVFLVSLFRIFYRVMLPL"
     gene            complement(<462793..>464031)
                     /locus_tag="MRET_2642"
                     /db_xref="GeneID:38739408"
     mRNA            complement(join(<462793..462897,462925..463832,
                     463860..>464031))
                     /locus_tag="MRET_2642"
                     /product="bacterial leucyl aminopeptidase"
                     /transcript_id="XM_027629269.1"
                     /db_xref="GeneID:38739408"
     CDS             complement(join(462793..462897,462925..463832,
                     463860..464031))
                     /locus_tag="MRET_2642"
                     /codon_start=1
                     /product="bacterial leucyl aminopeptidase"
                     /protein_id="XP_027485055.1"
                     /db_xref="GeneID:38739408"
                     /translation="MWYVRVVALLVLLSTYVLSTPLGVQQAYTIQSNISHEEYTIYRN
                     APLLTSWSMRHLELSDGRIMRVPELYKTWLRYRGIRFIDVTDTKVHAVIEGDEAPTYP
                     TKVRFDAELERAFQYVCEAGPRSDLKKLTSFFTRYYRSHTGYLSQKWLQSQVGLLAGM
                     LEAHTSIKVFQHPWPQSTIILHVKGSNETLTEERGVTILGAHQDSVNFVPVFAAPGAD
                     DDGSGTVTLLETLRALGKAGWKPASDVEFHWYSAEEGGLLGSQAVVDDYVRRHIRVYA
                     MMQQDMTAYVKSDTKERFGLVTDYVSPKLTQFLELLAKHYSDIPMVHTKLHYGASDHA
                     SWTRAGWPSAFVMEAPFEDCNLRMIHTSLDRYDIPGFSFPHLLRFVKLSMAFVVELAE
                     WA"
     gene            <464157..>468635
                     /locus_tag="MRET_2643"
                     /note="MRES_12785"
                     /db_xref="GeneID:38739409"
     mRNA            <464157..>468635
                     /locus_tag="MRET_2643"
                     /product="rRNA biogenesis protein RRP5"
                     /transcript_id="XM_027629270.1"
                     /db_xref="GeneID:38739409"
     CDS             464157..468635
                     /locus_tag="MRET_2643"
                     /codon_start=1
                     /product="rRNA biogenesis protein RRP5"
                     /protein_id="XP_027485054.1"
                     /db_xref="GeneID:38739409"
                     /translation="MKRSSSSPGSGESQRKRKASSSNEAVVAPNVAARPQLPTSFPRG
                     GGTGLTPVEYRQSVLEGRKESAATDDLFQESMSASKKMRGTKRKKEKKALAKAEASKD
                     RIRVELLNYKRLLPGTKILCNIQAIHPLALVVSMCDQMLGHIPVTSVSEKLTERLQNA
                     LDQDDEDNEEEDEEDEDEEDGPPELPDIFSVGQWVRASVESVTSIGSKRQWGMGREGG
                     EYERESQRVQLTMEPRIVNEGIRADDLSEGYLLSATVQSREDYGYSLDLGVSDDVHGF
                     IPTKEILRVGAVLLVQVASVDGRAVKCKQVQQAAPAPVSTPPSQSAILPGLPVKALIT
                     SHVPQGLCVKLFGMLDGTIDSFHLPRDVDEKDLAPGKKVIARVLWNMPGDFEQAQEAS
                     VDAVGARRIGLSCAPHVCSMEAPLVNAKPLTEAFPIGTPLRVRVVTVFREWGLVCQVI
                     GHDVGAFVHISFVSDEHVDALSATAGPWCVGTEHQARVTGHALTDRLLMISLQASVLE
                     KEFMRVSEVPLGRVVRVSIRKVTPKAIFVRLNGNVDGVVFPLHFSDVRLTHPEKKFKP
                     NLELKARIIHTDPMRNRIVLSFKRSLVTSELPLVAHMNEAKVGVITNAVVLRHLQASI
                     LVELGGTLRAVIPFSEASATTMLSEQLQQLYPAGKVVKVRITKVEPETGRIMASIKQT
                     SPEFLQHLNVEAVQVGESVKARFVSAQDGVAITLLEPSSTRALLALSNLAQQRNTTVD
                     ELEASLEEGELLEDLYVVSKHAAKGFVVLSHEKPVSKKHIQPGDVYEGCVVQRQDEHL
                     FCHVALKGTSCRARLHITECLDDLTKARLPEVGEHVTCCVLRARKGGNEADVSIRPSR
                     LTSDAQVKDPAIGSSDQLEAGMHLHGIVKAITNHGVYVALGPHTDGRVMIKELFDEYI
                     KDFRSQFHVGECVRGTVLHVEPNGQVEMSLKKSRLGQAVVQDVFADLQVGQKVAARVR
                     ATAEYGVFLKIDGTDISGLCHKSELSDNKTSDAVRAFAVGDRVKAVILKLDHEKKRIS
                     FGLKPSYFADEDFDDEEDEQEEDSDEEDEDDEDDDEDDEEEEVAHSLVDDEAEDEDED
                     GDEDEDENGDEDGEDDEDEDNEDLVDLMDDEDDDEDSMDDDVDESMGDLDPNDDVTKN
                     HVDEAESDGDDGDDALPARSIQEGFRWGAPEQESEDDSDEDELDKSTRPAKKAKSDDI
                     TADLSAKKLDSATDFERVLLGSPNSSYLWIQFMTFYLQLGDVDKARQVARRAIKVIHY
                     REEQEKLNVWMALLNIENLYGSPETLDAVFKEAVLCNDALEVHMRLLSIFEHGDKVDE
                     ALALFPRTAKKFGFVPDVWIRWYEFLLQHERSDDAHALVSRSLQSLDRTKHLRALTAY
                     ALAEYKLGDVEHARTLFETLVERYPKRSDLWWQYVDQEVRLENIEGARSLMERCLVAR
                     KHTTKQIKALLQKWLVIEKRIGDQAGVQRVLERARDFVARVQQGSVDEQVESEEDE"
     gene            complement(<468665..>471824)
                     /locus_tag="MRET_2644"
                     /note="MRES_12790"
                     /db_xref="GeneID:38739410"
     mRNA            complement(join(<468665..471785,471823..>471824))
                     /locus_tag="MRET_2644"
                     /product="Src like adaptor protein"
                     /transcript_id="XM_027629271.1"
                     /db_xref="GeneID:38739410"
     CDS             complement(join(468665..471785,471823..471824))
                     /locus_tag="MRET_2644"
                     /codon_start=1
                     /product="Src like adaptor protein"
                     /protein_id="XP_027485053.1"
                     /db_xref="GeneID:38739410"
                     /translation="MSRYSDSFIGGALRPLDRDKAEQELAVHLRKATSPEETSPKQKH
                     VRKCIVYTWDHKSSQSIWSGLRSLPIMNDDIQTFKALIVVHKILQEGHPVVLREAQSQ
                     MGWLDTCARMSSTSPRNYSQLIQAYVSFIHAKLRFHRMHKEFNGLFEYEEYISLKNID
                     NPDEGYETIIELMNLQDRIEKFQSLVFSTLRGRTNECQISSLVPLVKESYGIYKFLTS
                     MLRAMHRRTDAIDALEPLRGRYQHQHYALRRFYFECASLKYLTSLINVPKLNSEPPNL
                     LNSPDDHSREPLQLPPREPTPPSTPAGPTQSEIDEQARLLKEFEDKQRALKESEAAEA
                     RRIEEQALLREREFARKQAAQADEQRLAQEQLIRSQEINQIHGRAAEIERDLLFMRGQ
                     YERDQLMLQQYDMRVKALEMELAAAGQNVHAQMAGKDDMLQQLQEQVETWRKKYEALA
                     KLYSQLRNEHLELLNKYKQTQIKAGSAQEVINKMERMERDIKAKNLEMSDMIRERDRA
                     RLELDRARGGEREEVERLKRELRFAEERAEDAVQARSTEVSSIMTRMNAQIAELEEAL
                     ASHKAQLEAKDAEALILQEGMDSTIRQMKEMHVDQGTADEALNAQIDTIILDNSKKLS
                     AIIDSILQACADKLDDALYELETPSSAAMTASTPEYVLSLIEKAQASSNEFTAVFSLF
                     VEQQEVGGDHVNVIKSANQLAQAMCDSLVNVKGILRFCKSEEAMDRLTSVAVDAGHIL
                     LRFFLNIQSYRLAGMTSQQRTNVAVQQNAQVSTALGRLADSAQSLVGQRPSQLQGGEL
                     GDIIEREMISVASTIEQATQRLQTLLGRDRTSSRYTPTELQVHDTILEAAMAIMRAIG
                     VLIRASTESQEEIVARGRGTSSAQQFYKKNNRWTEGLISAARAVAFASTMLIEAADGV
                     IMGTHSLEQLIVASNEVSAATVQLVAASRVKSEFMSQTQERLEKAAKAVTDACRALVK
                     QVRMLTEKQDMMEDVDYSRMATHEFKVREMEQQVEVLKLEKDLAHARRVLGAMRRAGY
                     HATEEDGPLL"
     gene            complement(471979..472062)
                     /locus_tag="MRET_t0042"
                     /db_xref="GeneID:38741236"
     tRNA            complement(471979..472062)
                     /locus_tag="MRET_t0042"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:38741236"
     gene            complement(<472131..>473483)
                     /locus_tag="MRET_2645"
                     /note="MRES_12795"
                     /db_xref="GeneID:38739411"
     mRNA            complement(<472131..>473483)
                     /locus_tag="MRET_2645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629272.1"
                     /db_xref="GeneID:38739411"
     CDS             complement(472131..473483)
                     /locus_tag="MRET_2645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485052.1"
                     /db_xref="GeneID:38739411"
                     /translation="MSDVSGRRPLTGGSRMSPSAAKVHSIGSILTVVSCVFFAISFIS
                     SLTGVPGEVPTPAATTFNAKGISGHCNPFSYPGHIAHDPFPVWKTFDNVCPASTAMPD
                     MLASLPNAVSRTPGLKSTLRSPFISKQRQDQLMQAFKNRTVVLIGDGVDRTMIMNLCD
                     MVGEKPMSVDATHPWGASLKNQPLGRKDPGDTLLADYCYVPHYSAIFTSFYHYGADTN
                     ELWREQRDYLPPGQFEKRVSQLLKPYLEAMATPLPYNVQMPLARSSKPDLVVFSSSLW
                     DLAAWAMEDVSTYQTITTGDLSDNRLQWWRSRSVDMIEELRQQLGPSVPLAWRSTHVP
                     MTKVNDTVQWFFSSMHAKSSRAPDENGIQFAHPNRIIQLNHARRATLAMSNQASVRGW
                     LSKNVWSASSMPLLRDIPFGEVTMGQSTTQDTLLNPGIETYAYMFWSMVLQELLNLSL
                     "
     gene            complement(<473609..>474334)
                     /locus_tag="MRET_2646"
                     /db_xref="GeneID:38739412"
     mRNA            complement(<473609..>474334)
                     /locus_tag="MRET_2646"
                     /product="AN1-like zinc finger protein"
                     /transcript_id="XM_027629273.1"
                     /db_xref="GeneID:38739412"
     CDS             complement(473609..474334)
                     /locus_tag="MRET_2646"
                     /codon_start=1
                     /product="AN1-like zinc finger protein"
                     /protein_id="XP_027484987.1"
                     /db_xref="GeneID:38739412"
                     /translation="MLWIGAPCAHCRREDFLPLECGGCHKSFCTAHFAQDTHHCPHRQ
                     QSDVRVPICPLCHEPPHGWKRNASAAEVQRIMEAHWSASAGDQRSCAALVPRTSSQSL
                     CSYASCQRALKLAIRCPHCNAEFCLAHRAPTQHACQAKHGVPASVHAWKQVKPPSLPP
                     IKPTVASEPTKSRTPAPTKRPLDRAARRHAAQERQSMIRAMQERNKRGLLTEAEKVVL
                     AQKMAEVAADASHSRPPGPCTVM"
     gene            complement(<474814..>478428)
                     /locus_tag="MRET_2647"
                     /note="MRES_12800"
                     /db_xref="GeneID:38739413"
     mRNA            complement(<474814..>478428)
                     /locus_tag="MRET_2647"
                     /product="antiviral helicase SKI2"
                     /transcript_id="XM_027629274.1"
                     /db_xref="GeneID:38739413"
     CDS             complement(474814..478428)
                     /locus_tag="MRET_2647"
                     /codon_start=1
                     /product="antiviral helicase SKI2"
                     /protein_id="XP_027485219.1"
                     /db_xref="GeneID:38739413"
                     /translation="MLLSDMWDSLAIVPGRDADKIRKEIGDELFKQKRHLDSPYVMLP
                     QEQPERDDDFKEFLTLETGPSTFTVRFVKSGLRNRVIGIREVNKRPNDIDSSFMSLDV
                     PITSKDVDFVRGSVAAKPAVPSGLQEAALIASTDDDQFNDDEELRTVPPGFTRGYIAD
                     MPVDVTIKAPEWQAELEAQAPTETEHTLITVEDDGLYVPYVSRPPKNDMEASYDKTLE
                     GVTGFPRLFDDMPDVQKKEERREWAHIVEPSKSMHNFSELVPEMAYKYPFELDNFQKQ
                     AIYHLEQDDMVFVAAHTSAGKTVVAEYAIALSMKHLTRCLYTSPIKALSNQKFREFKQ
                     SFGAQNVGIITGDVHINPEAPCLIMTTEVLRTMLYRSATLLRDVEYVIFDEVHYVNDQ
                     ERGVVWEEVIIMLPSHVNVVLLSATVPNAKEFADWVGRTKQRDIYVISTSKRPVPLEH
                     FLYAGNELYKIAGENRQFQTDNFHKAVEALKPKKEREAAATGKRGAARGGRGGRGGAV
                     SHYQPKLTSNKSLWVNLVGMLRKRSLLPTVVFVFSKMRCEEYADSLPNTDLCTAAEKS
                     EVHVLIERSLLRLREEDRTVPQITRMRDMLHRGIGVHHSGLLPIVKELVELLFQRGVV
                     KVLFATETFAMGVNMPARSVVFSGIRKNDGTQFRTLLPGEYTQMSGRAGRRGLDNTGV
                     VVILCDKPELSTLNYMILGQPLKLKSQFRITYGMILNLLRIETLRIEEMIKRSFSENA
                     TQRLLPDQQAKLNELVSQAEQLDATLKNMPLQREEVEEVYAWTQRAVECSHAMMALVM
                     HHPFGAKCLSPGRVVLLFTGSSTISPALIVRASEKQFLVLVALSPRHQYKRTRTGEPP
                     YWITPHHIQSWDPETELVPEVCNVSPTDMALVTALEVDGVPTTAIQSQQPAAVKKGLE
                     LLRPSIQHIRTYLAATGNDITRSIIDLEVDWSRLRRMDFKDAQRERDEALDELVYVQP
                     RAYTSTFMDQYRLLHKRHILERDISKLRASMSIENLELLPDYHQRFSVLCELGCIQPD
                     TCSITVKGHVASQIRSANELILADLIIREVLVEYEPVELAALLSVFHFRDKTSVTPDL
                     THRVQEGLKEIGETADRIANVQLAHQLPADDDSSTLNDGLVQVVYEWANGMQFRDIMR
                     LTDVGEGTIVRCITRLDETFRELADSARVSGDAVLLGKMETCRQLCRRDIVFAASLYF
                     "
     gene            complement(<478517..>479066)
                     /locus_tag="MRET_2648"
                     /db_xref="GeneID:38739414"
     mRNA            complement(join(<478517..478524,478550..478582,
                     478608..478673,478700..>479066))
                     /locus_tag="MRET_2648"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629275.1"
                     /db_xref="GeneID:38739414"
     CDS             complement(join(478517..478524,478550..478582,
                     478608..478673,478700..479066))
                     /locus_tag="MRET_2648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484978.1"
                     /db_xref="GeneID:38739414"
                     /translation="MSELDDIFSSIQGGAPPSMPKKRRHDSGENTATKSSSSKPKKKS
                     KSRTTTSSDASEALAREKASSSSTSPSSTSHIPSSSKAAVPVIVHDDTTAKHQSKSAR
                     KPPPPKDDADVAFADSRGKDRKRTEEGYRVFTEDELKLNSGGDTPLCPFDCDCCF"
     gene            <479178..>480557
                     /locus_tag="MRET_2649"
                     /note="MRES_12805"
                     /db_xref="GeneID:38739415"
     mRNA            <479178..>480557
                     /locus_tag="MRET_2649"
                     /product="phosphatidylglycerophosphatase GEP4"
                     /transcript_id="XM_027629276.1"
                     /db_xref="GeneID:38739415"
     CDS             479178..480557
                     /locus_tag="MRET_2649"
                     /codon_start=1
                     /product="phosphatidylglycerophosphatase GEP4"
                     /protein_id="XP_027484975.1"
                     /db_xref="GeneID:38739415"
                     /translation="MNLHGIAAAVQSIRRPGLLIPHLHFASMRHLDWHRIYASGVRYI
                     VFDKDNCLTAPHHDQLAEPLQTTWKECRRVFGSENLLLVSNSAGSNSDPQALAAETVS
                     SNLGIPVLCHAAKKPSSQCARQVVEHFLSLAFRRAESSSTSPLHILVIGDRITTDMVF
                     AQRIARCLTKIESDGRHTQCTSILTKQLWGREGLGTRCLRLIESSVLRQLVRAGIPPG
                     GSWLQRGYHIPPELKTWVVPAVEAPSLASAPTITMPEPRMWTRLKSAWQAMVSEFFGS
                     VKHIQQLAWSALTATPTKQWRSSWRVPSSSKHLVSRSRARHMSTCRIVRAVHEKPVPR
                     RPMPSVPEKQSPPRSLFGISWLRWALAVAALILLPLGFMGGMKLNELVDTWRSGDLSH
                     EGERSLPPEPQVQEEVDRAVESESQLQQRKKITSLELEHYHLRRERERITEKLSHLDE
                     RQKAHSEQL"
     gene            complement(<480703..>482631)
                     /locus_tag="MRET_2650"
                     /note="MRES_12810"
                     /db_xref="GeneID:38739416"
     mRNA            complement(<480703..>482631)
                     /locus_tag="MRET_2650"
                     /product="transporter (MirC)"
                     /transcript_id="XM_027629277.1"
                     /db_xref="GeneID:38739416"
     CDS             complement(480703..482631)
                     /locus_tag="MRET_2650"
                     /codon_start=1
                     /product="transporter (MirC)"
                     /protein_id="XP_027484962.1"
                     /db_xref="GeneID:38739416"
                     /translation="MDRIGNFFSHLWRKYYPEFEIDQDGGTDKPVAKLAPESEVEPGH
                     ADLKEVDAKQVGVAIAEATYAVSGYTWYIILAVVWVAYFIYALDNQTAQSLAYTATSK
                     LESDTTKASESYASAYTAQMLFVAISKLFIAKLADIFGRSTATGVTMLCYTLGFIIMA
                     SSQKGDDYVAGAVFYGIGNSGIQMVIWIVLADLLSARFRVLGYGFVTFPIFITFAVGA
                     KIMKGLALQWRWVPGMFCILVPVVMTPLLCMLIYLEIKARRKNLVPRHPYLNHGLGRA
                     IWEFILDLDLVGLLLLVGGFAMIVTALIRASTPSILESTWSSPWVIGCFVVGPVILIF
                     LLPLWEWFVAPRPFIRYSWMNTDVLIAFMVGFFDNMVFQAGFQVAYNWVFISHGYKST
                     DLDLANYFTNSDNLALTLFGVVAGIIILFTRRFKWFLVAGACIRTIGFGLQIRYRDND
                     TTMPQAVWAQLVQGIGGAFLGEVTTLLSQITVRHQDVAMVTGVYLTLFSLGSSVGLAV
                     YTALLDAHFPAALDKYATLVSPQDRSTVATLGPFAALTSGPQLDSHPLLKAQVGTAYN
                     EAAKHVLYFAIGVSAALIILTLFVRDWVLPRSHNVVSDELPEKNPLHMSTDTTYDDAI
                     SETEKQNELYEAEVLSHE"
     gene            <483370..>484512
                     /locus_tag="MRET_2651"
                     /db_xref="GeneID:38739417"
     mRNA            <483370..>484512
                     /locus_tag="MRET_2651"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629278.1"
                     /db_xref="GeneID:38739417"
     CDS             483370..484512
                     /locus_tag="MRET_2651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484963.1"
                     /db_xref="GeneID:38739417"
                     /translation="MLGAHVRCRALRSPFQNRCSSTLTATMSVPPLVVLDLNGTLLYR
                     KKNNQGRTIPNGKITTRPYLQCFLEYCLGPYYQEKHKKLSKIWPVKNRTSVDKNAAPH
                     GSQFWLDAPGDAVWCPPRTRVCLMIWSSASEENVNKMTGLVAPFQIGRALFQRVWARP
                     TLVTSSQLATKVSTVKDLSIVWDELNRWDSYMQDSEARSRRPTFRSRALAGTRLFYYE
                     KKQEKSKAWKHVHTNHNDMPHNMLYKEAMQRNLSGMLDSYYGPLSHEPFGPKNTILLD
                     DSVGKARCQPNNHICIPEFDAQSASTYTSYLEHGSPPEMVDGLDDFLLQFIGVLDVLS
                     DVENVEQWILDGNAATFSRYQTPEERSEWVERGIQALAARSICVEP"
     gene            complement(484593..484693)
                     /locus_tag="MRET_t0043"
                     /db_xref="GeneID:38741237"
     tRNA            complement(484593..484693)
                     /locus_tag="MRET_t0043"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:38741237"
     gene            complement(<484820..>486698)
                     /locus_tag="MRET_2652"
                     /note="MRES_12815"
                     /db_xref="GeneID:38739418"
     mRNA            complement(join(<484820..484836,484868..>486698))
                     /locus_tag="MRET_2652"
                     /product="plastin-1"
                     /transcript_id="XM_027629279.1"
                     /db_xref="GeneID:38739418"
     CDS             complement(join(484820..484836,484868..486698))
                     /locus_tag="MRET_2652"
                     /codon_start=1
                     /product="plastin-1"
                     /protein_id="XP_027485254.1"
                     /db_xref="GeneID:38739418"
                     /translation="MEAIKLQRKYPHISQEEMMSIISKFKQMDMDDRGSLDRQVVMKE
                     VQQQEHASYDQVRETLKDVDLDASGRVELEDYVDLVSRLRTGSNSQAGVVSKGKVMVK
                     GSNASTQHTINEDERNEFTRHINTTLRHDAHIGSRLPIPTDTFQVFDECRDGLLLCKL
                     INAAVPDTIDERVLNLGRAGKGPNAFQMTENNNIVIQSAKAIGCSVVNIGAQDITDGR
                     EHLILGLIWQIVRRGLLNSIDLKHHPELYRLLEEGETHEDFLKLPPDQILLRWFNYHL
                     KAAHWHRRVSNFSKDVSDGENYTILLSQIKPDQCDRAPLQQQDLLARAEMILQRADAI
                     GCRKYLTPGSMLAGNPKLNLAFVAHLFNTWPSLEPLQDAPPVEEFDAEGEREARVFTL
                     WLNSLDVQPGVFNLFEDLKDGNILLQSFDKVHPGSVAWKRVSRAKDHTPLSRFKMVEN
                     TNYVIELAKAHHMHIVGIQGADITDGAKTLTLGLVWQVMRANVTTTLQGLSKSGNAVS
                     DQEILQWANDRVHSAGKSTRQLRSLRDPSLKNAQFLLDLLDTLRPGIVDYSIVTKGGT
                     EEECRLNAKLAISIARKLGALIFLVPEDIVEIRQRLILTFLASLMSLGA"
     gene            <486853..>489372
                     /locus_tag="MRET_2653"
                     /note="MRES_12820"
                     /db_xref="GeneID:38739419"
     mRNA            <486853..>489372
                     /locus_tag="MRET_2653"
                     /product="low-affinity vacuolar phosphate transporter"
                     /transcript_id="XM_027629280.1"
                     /db_xref="GeneID:38739419"
     CDS             486853..489372
                     /locus_tag="MRET_2653"
                     /codon_start=1
                     /product="low-affinity vacuolar phosphate transporter"
                     /protein_id="XP_027484961.1"
                     /db_xref="GeneID:38739419"
                     /translation="MKFSHSLHLNSVPDWSQHYLDYQHLKKVVYSLEREQYASNDTET
                     GEHGATLESESETLLSSDPSDLDRRFIVHLDAELRKIVDFYCWKEKELGDEVDMTHEH
                     IRMAEEDYDGVSGGESDAEAALDEPDSHRRAPVRTRSHASASDPDTESLPVSRWFHTF
                     GKKGSFHKSRRHRSPSNSSFDTNLASNDGNSMRGMAPNVWMSQDDYAIDLRLTLKRKL
                     IEIYTLLNELRGFSDLNQTGMKKILKKYDKITGGTLKDRYMEQVVKVKYPFQPQAHAL
                     LMDRVNEVVQMYARVAARGDEELAQQQLRMQLREEVVWHRNTVWREMINIERRAQAAT
                     LEKSLMGRTGGTLGEEPEMPRLLRTPFGTFVVPSFFTVGTLQLALSLLVFVLLLKAPA
                     LRIFDRVEVQNCFALLVLCTSLWVTEVVELFVTSLLVPFLIVTLRVAREGEGEGRRLS
                     APETSKWIFSQMFAPNISLLLGGFTLAAALSKYGIDKVLATRVLQYAGSRPSVVLLAH
                     MLVACFASMWISNVAAPVLMFSLVQPILRNLPPKSPYATSMVMGIALASNIGGQTSPI
                     ASPQNLIALQYMDKPLGWVQWFGITIPVSGVSLLALWLLLLWSFGTGSGVHIKRIPES
                     DHTFTLKQWFISGVCVGTIVLWCFQNQIQAMVGDMAVTALIPLVLFFGTGILTKEDFN
                     NFLWTIVFLAMGGIALGKAVASSGLLKSLDAFVQDRVNGLPLWGIMLILVAVGLVVAT
                     FISHTIAAVLLVPIAAQMGANLADPHPRLLIMATTLTSSAAMGLPVSGFPNMTAINLE
                     DEVGHHYVSVRTFLRVGIPASILATLIIATLGYVIMLFLGL"
     gene            complement(<489369..>490655)
                     /locus_tag="MRET_2654"
                     /note="MRES_12825"
                     /db_xref="GeneID:38739420"
     mRNA            complement(<489369..>490655)
                     /locus_tag="MRET_2654"
                     /product="solute carrier family 25, member 39/40"
                     /transcript_id="XM_027629281.1"
                     /db_xref="GeneID:38739420"
     CDS             complement(489369..490655)
                     /locus_tag="MRET_2654"
                     /codon_start=1
                     /product="solute carrier family 25, member 39/40"
                     /protein_id="XP_027485252.1"
                     /db_xref="GeneID:38739420"
                     /translation="MTESKASAAPGVRPGRKRMTFTDRALASIAGSVSTSFLMTPLDV
                     IKTRLQTQAQDVRPVSSDVGLAKGPPCPVHGTIPHASVQVPTTLRWLRPSPPLPVPLA
                     MQTPAMCIYPDKCSVAKLCETEVVMREGRLTGVWDGMAKMVRVEGWRSLWRGLLPTLA
                     MTIPSQVTYMSFYDVFRKSILSIEAPVPNWRESLTRSSPVPDFPCDMPCEHDDAFQDT
                     APVTQARVPLLVASLVSGAGARSISATLVTPLELLRTRLQASHGPSSFQSVIQPLCRE
                     VQQHGLRVLWRGLSATLWRDVPFSAIYFAGYEGGKVLFTGAGFGESPSSTFWHEFGVS
                     FTVAATSGCVAAVATHPFDLVKTRLQAEHENRHARVSSRSLFHTLRRMFAAEGVPGLF
                     RGLSPRLAKVAPACGIMMGAFEAASRLLSHARHDTH"
     gene            complement(<490749..>492473)
                     /locus_tag="MRET_2655"
                     /note="MRES_12830"
                     /db_xref="GeneID:38739421"
     mRNA            complement(<490749..>492473)
                     /locus_tag="MRET_2655"
                     /product="tRNA pseudouridine38/39 synthase"
                     /transcript_id="XM_027629282.1"
                     /db_xref="GeneID:38739421"
     CDS             complement(490749..492473)
                     /locus_tag="MRET_2655"
                     /codon_start=1
                     /product="tRNA pseudouridine38/39 synthase"
                     /protein_id="XP_027485253.1"
                     /db_xref="GeneID:38739421"
                     /translation="MLRGAVKPLVRQFARSHFTLRLPAYMHAREKYGDWSRNQLLRRI
                     AQLEGRAESLGVDVPPPESSPSASDAPPSSKKPPRPYDVSAQPCRKVALRFCYDGGSY
                     SGLAAQVGQMTPLPTVEETIWEALCTARLVDATKSMEEADWSRCGRTDAGVSAAGQVV
                     ALWIRSRCVDERPWRYKTGDEPIVLTDASEEELPYVATLNRLLPPTIRIQAWSPVRPS
                     FSARFDCVYRHYKYFFTLGAPHTLTWQPESPSQFVGRLDIERMRDAAARLVGEHDFRN
                     MCKVDASKQITNFRRRIDGATIDYVSHGWSDSEIPEPIPYRTDEPIYVLNLRGSAFLY
                     HQVRHIMAVLFLVGARLEEPSIIDELVNVETGAAAADRVHARQWLTSVEQEDAATPDK
                     MRMASLAMPHDDMPTVETRPTYEMAADRPLMLWDCGFRPEQVSWRASTYAGPLPASAT
                     CMDYTPSVRALSQLHALWTREAIHTELTRHLVLASSTGHGTQLPASTSFARARTPLVP
                     ASADMNEATGRAHLVPLGNGVVRPTTRYKPLLSRPRDVSAEAKNQKWREGKGRRRAER
                     RAPHSDPI"
     gene            complement(<492516..>493859)
                     /locus_tag="MRET_2656"
                     /note="MRES_12835"
                     /db_xref="GeneID:38739422"
     mRNA            complement(<492516..>493859)
                     /locus_tag="MRET_2656"
                     /product="SET domain protein"
                     /transcript_id="XM_027629283.1"
                     /db_xref="GeneID:38739422"
     CDS             complement(492516..493859)
                     /locus_tag="MRET_2656"
                     /codon_start=1
                     /product="SET domain protein"
                     /protein_id="XP_027484948.1"
                     /db_xref="GeneID:38739422"
                     /translation="MDLAAWDDSVDVVRLGSDAREEYSSAPGTLAVIASDPIPAGHVI
                     ARIPCKALLCARHSALSHHPAFQNVQASLTPVLSLTFCVLYEAELGDASKFASYLALF
                     PDVHLPLAWDPSSDEATWLRGTEASRILRRQEHAWSAGYKYIGTSCSELRHVWHTIGE
                     RIMLEALGARVSWAAFMRAFSWVSSRAFVVDLYHGLSMVPFADLLNHGAPNNAQIESD
                     VDAYSAEMGGTVDVRAIDSIDPGEEVLNSYGEIGNAELLCQYGFVLDTKSGWERCSWD
                     MRVPEECTQLCACLECDAPSIRHVTEPQQPADAQRASGDDGLPPAYVDAAGGVYDFAP
                     VSHTNRHDRQCPIFIDASGRASWVLWRLALGLCSEHVYGYEAASADTSLLPSHVRAAC
                     QRITRLCHARLSTMYIQRCKDALPSTSSSSTLHWAVQHAWQDWHLLRACLERYAT"
     gene            <493906..>494344
                     /locus_tag="MRET_2657"
                     /note="MRES_12840"
                     /db_xref="GeneID:38739423"
     mRNA            join(<493906..493927,493953..494051,494078..494172,
                     494198..494275,494300..>494344)
                     /locus_tag="MRET_2657"
                     /product="peptidyl-prolyl isomerase E (cyclophilin E)"
                     /transcript_id="XM_027629284.1"
                     /db_xref="GeneID:38739423"
     CDS             join(493906..493927,493953..494051,494078..494172,
                     494198..494275,494300..494344)
                     /locus_tag="MRET_2657"
                     /codon_start=1
                     /product="peptidyl-prolyl isomerase E (cyclophilin E)"
                     /protein_id="XP_027484958.1"
                     /db_xref="GeneID:38739423"
                     /translation="MPKTLYVGGLDAQVTEASLLALFSTFGDISDIQLPKETDHATKH
                     RGYAFITFTEEDDADDAIDNMNLNEVHGNVITVNVAKAQKILPNDTRRPIWETDAWLQ
                     EHNTAASEDH"
     gene            complement(<494374..>495159)
                     /locus_tag="MRET_2658"
                     /note="MRES_12845"
                     /db_xref="GeneID:38739424"
     mRNA            complement(join(<494374..494642,494670..>495159))
                     /locus_tag="MRET_2658"
                     /product="isopentenyl-diphosphate Delta-isomerase"
                     /transcript_id="XM_027629285.1"
                     /db_xref="GeneID:38739424"
     CDS             complement(join(494374..494642,494670..495159))
                     /locus_tag="MRET_2658"
                     /codon_start=1
                     /product="isopentenyl-diphosphate Delta-isomerase"
                     /protein_id="XP_027485250.1"
                     /db_xref="GeneID:38739424"
                     /translation="MLGLIRDMAAQVSTEQGYDASLQGHDEEQIRLMEERCIVTDRED
                     HMIRDGSKKECHLMTNINQGLLHRAFSVFLFDPLSGKLLLQKRASEKITFPDMWTNTC
                     CSHPLAIQSELHGSEGAKNAAQRKLEHELGISASQVPTDAFQFLTRIHYLAPSDGLWG
                     EHEIDYILFVTATVDVHVNQNEVGDTRWVSIEELKSLMNELDPQAFTPWFKLIVNAFL
                     FPWWQELMECKNPSTGCLDAKLLAHREDDKIHRL"
     gene            <495270..>495511
                     /locus_tag="MRET_2659"
                     /db_xref="GeneID:38739425"
     mRNA            join(<495270..495445,495493..>495511)
                     /locus_tag="MRET_2659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629286.1"
                     /db_xref="GeneID:38739425"
     CDS             join(495270..495445,495493..495511)
                     /locus_tag="MRET_2659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485251.1"
                     /db_xref="GeneID:38739425"
                     /translation="MWATSVETLAVPYQPSTWYVCKICTFAQRRVGMCPSPLSVLDSR
                     PKGAQEGQKLLALADYSGSK"
     gene            complement(<495610..>496637)
                     /locus_tag="MRET_2660"
                     /db_xref="GeneID:38739426"
     mRNA            complement(join(<495610..496028,496061..>496637))
                     /locus_tag="MRET_2660"
                     /product="prephenate dehydratase"
                     /transcript_id="XM_027629287.1"
                     /db_xref="GeneID:38739426"
     CDS             complement(join(495610..496028,496061..496637))
                     /locus_tag="MRET_2660"
                     /codon_start=1
                     /product="prephenate dehydratase"
                     /protein_id="XP_027484900.1"
                     /db_xref="GeneID:38739426"
                     /translation="MDPTAKTPESIKVVFLGPLGTYSHQAVLKLSGKGTLQLAPQTSI
                     REVVLHGAQDARLGHTVVVILPIENSTQGIVHEALESLTNSHLFSQHGLRIVDEIDLT
                     VAHALIVKSIIPNSFESIKEVHSHEQALGQCEKFLNKYLPHALRIPSHSTAEAVAKLN
                     QSPPGRVAAIASELCAVMFGMPVLAKSIQMTQSNFTRFLVCTNNLEDERVARILELNR
                     AALSFPKNPIHAAYRLKTFTLDVGAQIASFTDSLRRDVPAPWSLYGEVYVCEPEGHET
                     SDRWFLFEMHATPHEAKTYPAESDVPTQAIHSALGLSEDATLECLGVWQIPSVAP"
     gene            <496950..>498128
                     /locus_tag="MRET_2661"
                     /note="MRES_12850"
                     /db_xref="GeneID:38739427"
     mRNA            <496950..>498128
                     /locus_tag="MRET_2661"
                     /product="secreted aspartic endopeptidase"
                     /transcript_id="XM_027629288.1"
                     /db_xref="GeneID:38739427"
     CDS             496950..498128
                     /locus_tag="MRET_2661"
                     /codon_start=1
                     /product="secreted aspartic endopeptidase"
                     /protein_id="XP_027484899.1"
                     /db_xref="GeneID:38739427"
                     /translation="MRLFLRLALGLVAAAHVVLASSPTGLTVHLERRNFLLNDDNTVN
                     FKAVANHAKQLSHKYNFLMKKFKDNMGKDHPLLNALVEALSKRGEGEVGLTDIRSELL
                     WAGEIQFGNSKFKIDFDTGSADTLVNPGAYEPRKSSSSKKTSDEFETSYADNTRAVGA
                     IYTDDMVFGGLKAKNVAIGLSRSKFSDDGESVGIAGLSFPSIQAFPKKYDPIFVALMH
                     QKAVAEPVFQFTLKPGTGSTLHLGGVDYSKVKDKIDYVNVNPDDGFWITDGSVQGVKT
                     KFVIDSGTTLIIGPMDQVLEVISKLPGVTPHYNLDSLQATFDCSRPPTVDFEINGKKY
                     KLDKQQASYGTSFGRCVLSIMGQRGLPMHAWVLGDAFMQGVSVVFDMGRNRMGFAPSA
                     "
     gene            complement(<498453..>499445)
                     /locus_tag="MRET_2662"
                     /note="MRES_12855"
                     /db_xref="GeneID:38739428"
     mRNA            complement(<498453..>499445)
                     /locus_tag="MRET_2662"
                     /product="hydrolase, family 43 protein"
                     /transcript_id="XM_027629289.1"
                     /db_xref="GeneID:38739428"
     CDS             complement(498453..499445)
                     /locus_tag="MRET_2662"
                     /codon_start=1
                     /product="hydrolase, family 43 protein"
                     /protein_id="XP_027484898.1"
                     /db_xref="GeneID:38739428"
                     /translation="MSCRPIANVDMPDPWVYSWNGIFYLTFTLGNRIEIWASNNIEDF
                     NQPQKSLVWKPDGSGWAPGIWAPELHNINGVWYIYFSGEKPGQGPASHRTLILRSQSQ
                     DPMDPSGWQFVGPLQGVPDHWAIDATVFFIRNNLYCCYSGWPVGDNSDTEQDLFLVQL
                     ASPEQAMPETLVTISKPTYKWERPDGGKRGINEGPSYVEFNNVRGIVYSAHGSWTCDY
                     KLGLLLLTGENPLDPKSWTKRDSPLLSSDRSKGGPYGPGHASFVPTNDGRVMCMFHCT
                     FNVDDGWDNRKARVMCLDAKDFSPSASCCCCATGETPGDRPGGFLGKIINAIKK"
     gene            complement(<500596..>501357)
                     /locus_tag="MRET_2663"
                     /note="MRES_12860"
                     /db_xref="GeneID:38739429"
     mRNA            complement(join(<500596..501028,501055..501136,
                     501167..501287,501349..>501357))
                     /locus_tag="MRET_2663"
                     /product="GTPase KRas"
                     /transcript_id="XM_027629290.1"
                     /db_xref="GeneID:38739429"
     CDS             complement(join(500596..501028,501055..501136,
                     501167..501287,501349..501357))
                     /locus_tag="MRET_2663"
                     /codon_start=1
                     /product="GTPase KRas"
                     /protein_id="XP_027484897.1"
                     /db_xref="GeneID:38739429"
                     /translation="MPKSKLLRELKLVVVGGGGVGKSALTIQFSQNHFVDEYDPTIED
                     SYRKQCMIDNEMVLLDVLDTAGQEEYSAMREQYMRSGEGFLLVYSITSRSSFAEMATF
                     HQQVLRVKDMDYFPMVMVANKCDLEKERQVSTMEGYAMAKKIGCPFVETSAKQRINVD
                     EAFNDLVREIRRFMRNQPSLYNVAPSSATPGEKGTSAHFSQDGEKKGCKGCVII"
     gene            <501679..>503742
                     /locus_tag="MRET_2664"
                     /note="MRES_12865"
                     /db_xref="GeneID:38739430"
     mRNA            <501679..>503742
                     /locus_tag="MRET_2664"
                     /product="nucleoside diphosphatase"
                     /transcript_id="XM_027629291.1"
                     /db_xref="GeneID:38739430"
     CDS             501679..503742
                     /locus_tag="MRET_2664"
                     /codon_start=1
                     /product="nucleoside diphosphatase"
                     /protein_id="XP_027484903.1"
                     /db_xref="GeneID:38739430"
                     /translation="MEVGPRPIEEHAWKKQRRRPVSYRTQAMSAATTQSHEWYHHRRY
                     VVVVDAGSSGSRLMVYSWRNAAWERDMRMAQGEPLNVLPHLERGSGPSVSAPWQVKIE
                     PGFSSFAGRTQDIRGYVNQLLTHVRSVVPPNALPQTPIYIMATAGMRMLKPEVRQAIL
                     LETCRVIREQPFYFDPDVQDYAGADTDTACGGHVRVITGEEEGMLGWLAVNYLMHEFG
                     PQASTVGFLDMGGASSQIAFVPDSHDQNSRDLFHVTLHRLDASLDTHNVFVTTFLGYG
                     TNAARTRYLYALSERLGAPRTLPDPCLPRGLRIPMENGASTVHGTGSYAECLAAQQVL
                     LDRQATCPQHPCPFHGVHVPPIDFRDKQFVGVSEYWYSTDDVFRMGGVYDHDRFHRTA
                     SDFCASDWTQLESKWHAHEYPEQVTNSRLQMQCFKSAWMSTILHEGFQLPRASNLTTF
                     QSLNSLRGLSVSWTLGKALLEASRDASALKPLPPAPFDPVPWALGLGVGLALFFVCRR
                     LYRRAHWMRLRDHDPTEAHDLTVTTMTPDDDALALTPSRRPSAVRIVPRHLAYERPEQ
                     LASAGFPSISKANAHTLVKQMDAPAAVIPTGVSRTSSPSSFSPRTPTYRPEAASSDAY
                     VMSTSVALSRARSPMPPSSPAIPSPSTTPFDQARASPSHLGTPTSATAPFYAELRGRV
                     SPAPP"
     gene            <503888..>506275
                     /locus_tag="MRET_2665"
                     /note="MRES_12870"
                     /db_xref="GeneID:38739431"
     mRNA            <503888..>506275
                     /locus_tag="MRET_2665"
                     /product="exocyst complex component 3"
                     /transcript_id="XM_027629292.1"
                     /db_xref="GeneID:38739431"
     CDS             503888..506275
                     /locus_tag="MRET_2665"
                     /codon_start=1
                     /product="exocyst complex component 3"
                     /protein_id="XP_027484902.1"
                     /db_xref="GeneID:38739431"
                     /translation="MSRSAANYGSLLAEYLKSPDDLAKIPSLRRKLVQEHASLSAKLK
                     MGAKDQLEATRQGLLQLQSTRREIAGIQEIFAQVEGLFDEPGRGSGDASENQSFRLIS
                     DLSRLRRAFVQTTDIHEKFKAMSQDVQTLSHVLQQYQRDIYGPAPELLALHYKISQWE
                     TFRNEALHLAGTSAPDTREQLIAMLAPLEALLDAFEYYMITLFSHTLELARRGQSSVV
                     VRFVKIMERENYEDERTAAIRFAKHAKIDGAARFHGIATYGHSIKLYWHKFQDTLRGS
                     ALRRLQAQWNALPEPSAKGLHSQIHWLYDELDLVRRYVVPLFPASSHVYKIYVQAHHR
                     ALGELLRVQMPLDEVDAASLLELYDVVHAHEHRMLDPKRGIEASWLEPSLFGGREHNI
                     MDDYAGLITRKMDDWTETLMYDEVSAFVHREKAPEETSEGLYQLSCCVIFFRMMQQQT
                     DLAAQTHNGDLLVRVIEHACNVMHKMQATWMQMAQQEFKKQTSAKHPDDVNGGLVEYL
                     IALANDQLSSADECERLLHTLAEAAPPERRGRVRELLDTALNGFLDISKHCIQLLVDI
                     VMFDLRPAFKDMFTFPAWYIEGTTAMITETVRDYAGDYAARLEPNLYDVLSDDLVTRL
                     LTTYLTTLRQSARLRMPKAAERFKVDISELLNLIAAMRPPDEATSRVEVLHMIHAILN
                     APASMVFLPYWTFAKSHGPNFAFIEALLRARDDMDKSDIAAILESAKRKVRQEHIPDV
                     PEGGPTIMSAVSQAQASALSNLFSSWNTGAEGIAWSTLAQSAQSYLGSAGWRRDA"
     gene            complement(<506333..>507370)
                     /locus_tag="MRET_2666"
                     /note="MRES_12875"
                     /db_xref="GeneID:38739432"
     mRNA            complement(<506333..>507370)
                     /locus_tag="MRET_2666"
                     /product="CCCH finger DNA binding protein"
                     /transcript_id="XM_027629293.1"
                     /db_xref="GeneID:38739432"
     CDS             complement(506333..507370)
                     /locus_tag="MRET_2666"
                     /codon_start=1
                     /product="CCCH finger DNA binding protein"
                     /protein_id="XP_027484989.1"
                     /db_xref="GeneID:38739432"
                     /translation="MAPKNKKGGGGSGGAPKVTVDKTFGMKNKKGAKAQQQIKVIQQQ
                     QQQTGKSREALAKEKRREEEKRIKAEAEKRMKIEGPPIVQPHVPFGVDPKSLTCAFWK
                     AGRCDKGTRCKFSHSHDAQRKTQKKDLYTDTRDQKASAEEEKKNDTMDKWDQEHLNKV
                     INMKHGNPRTTTDKVCKYFLQAVEDGKYGWFWECPNGGEKCMYRHALPPGFVLKSERK
                     EREALEKANEISLEEFLESARHKLGQNLTPVTPESFQKWKKERLDKKAAEEEAVRQKK
                     QSQAQANKMIGLSGREIFAMNPDILADDDDDDDDGAIDMSTYMPSGWEQGRPDDQVPS
                     EGVANLHVQDN"
     gene            <509839..>510342
                     /locus_tag="MRET_2667"
                     /note="MRES_12885"
                     /db_xref="GeneID:38739433"
     mRNA            <509839..>510342
                     /locus_tag="MRET_2667"
                     /product="outer membrane protein TOM13"
                     /transcript_id="XM_027629294.1"
                     /db_xref="GeneID:38739433"
     CDS             509839..510342
                     /locus_tag="MRET_2667"
                     /codon_start=1
                     /product="outer membrane protein TOM13"
                     /protein_id="XP_027484901.1"
                     /db_xref="GeneID:38739433"
                     /translation="MALATDWPVQQWVGLDKHPGLRPEGEEKKLSGTSENRKEDDDSD
                     ILDDSVASIDDSISQISVEPPPLPPAPTGELTLSFIFSHGLSWKRRALLFTAVVAINI
                     GLPFINGLMLGFGEIFARAFIAPYIGLAPPLPTNRYSASPADVPALPISRWAGIRSSL
                     SRLFSFA"
     gene            complement(<510351..>511709)
                     /locus_tag="MRET_2668"
                     /db_xref="GeneID:38739434"
     mRNA            complement(<510351..>511709)
                     /locus_tag="MRET_2668"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629295.1"
                     /db_xref="GeneID:38739434"
     CDS             complement(510351..511709)
                     /locus_tag="MRET_2668"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484905.1"
                     /db_xref="GeneID:38739434"
                     /translation="MKYVAYSREDETFSEFLDQLKKQGPDVSLVSAQFSDLDDTRCRL
                     VLDCLLDLWGQVASQPSMYGRSMPGVRYLDFSSNHIQSFQASGLVQILNNNRLLSVLE
                     IQANELGKAGTEDIRAFACAMKHCSLRRLNITANRLGDAGLATFIDHLPDTGTSLLAL
                     HLSVNTFSTDTGSWKAAHSIARFLSSPKKCRGLKSIHLNGNHFGWEGVRAIAHAIIGS
                     RRACEATASGLVDLPPSILDACPPNTSLINIDLFSTGIDSLNSASKNVPPCVEWEAYS
                     AVSRENWYQLVMEQLEMNQYQQAVCQRAAARILGAARIIGCKSRWIEPPDGERDHFPF
                     RRLPVELRRHILFHVDSEQCLSHEQLINVLRWASEPSTLGYVREAGAWPPTQSLAVAD
                     NVWNLPPWSWTECYEYRSPPRNWYSDGLEYDELDGFDPAKMAFLECTGTVEMEHVASR
                     AS"
     gene            <511847..>513673
                     /locus_tag="MRET_2669"
                     /note="MRES_12890"
                     /db_xref="GeneID:38739435"
     mRNA            <511847..>513673
                     /locus_tag="MRET_2669"
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /transcript_id="XM_027629296.1"
                     /db_xref="GeneID:38739435"
     CDS             511847..513673
                     /locus_tag="MRET_2669"
                     /codon_start=1
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /protein_id="XP_027484904.1"
                     /db_xref="GeneID:38739435"
                     /translation="MDGGRTIGVLGGGQLGRMLGEAASRLNVTVRFLDAGEHTPAKQI
                     CSVPASIGGPRHVDGSFADKAKIHELASQVDILTVEIEHVDADQLQTVLDEGLVQAVH
                     PAPSTVRLIQDKYAQKMHLQKHGIPVVDSVHIEPSSNMKSAVKDVAEKLSLPLMLKSR
                     TQAYDGRGNFTLKSEDQIDAAIEALGNGSRPLYAEKWAPFEREIAVMVVRSVDGTVVS
                     YPAVETVHENSICHSVYAPLRTHQPELPKRACQIAERAVATFEGAGIFGVELFLLKDG
                     TILLNEIAPRPHNSGHYTMDACETSQFENHLRAILGLPLGSTALKVPSAAMLNILGLA
                     DLSKDRDALAKTLAPVLRSLSVPGATVHLYGKSGCRPGRKMGHINVVGPSDAHVRHRM
                     SQLLDELERAQIAAHESKPWDAEAAKRRAAVPPPGAPKSPQDFSHPEALVGIIMGSDS
                     DLPVMMNAAQTLKDFDVPFELTIVSAHRTPERMREYATSARTRGIRVIIAGAGGAAHL
                     PGMVAAQTCLPVIGVPVKGSSLDGVDSLHSIVQMPRGVPVATVAINNSMNAALLAIRM
                     LGTGIPAYADKIERHMHDMEAGVMEKVERLEHQGWWYGSPAK"
     gene            <513805..>515484
                     /locus_tag="MRET_2670"
                     /note="MRES_12895"
                     /db_xref="GeneID:38739436"
     mRNA            <513805..>515484
                     /locus_tag="MRET_2670"
                     /product="choline oxidase"
                     /transcript_id="XM_027629297.1"
                     /db_xref="GeneID:38739436"
     CDS             513805..515484
                     /locus_tag="MRET_2670"
                     /codon_start=1
                     /product="choline oxidase"
                     /protein_id="XP_027484942.1"
                     /db_xref="GeneID:38739436"
                     /translation="MPMQAFRRLSSLTSHLLPQEDTEFDYVIVGGGTVGCVLANRLTE
                     DAGVSVAVIEGGPSDEKEDRVLNLRRWLELLDSDLDYGYTTTEQPRGNSHILHSRARV
                     LGGCSSHNTLISFFPFNADLDNWRDYYGCPDWDAKTLQPYGSRLKMNIVPIAPQQRNH
                     VVRDWVKASSEVTGAPVFEDMNAQIAFRGGFDKGVGFFNISYDPYNGYRSSASTAYMH
                     PILPNGMTPRKNLHMFFETWAHALEYDAQDPLRVRGVRVTTKNGASKLIRARREVILC
                     AGAFDTPRLLLLSGIGSRSDLDKVGIPCRHDLPGVGLNLNDHPESIIIWETRHTPPET
                     VMSSDAGLFVRALPQNAEPVPHPGPDLMFHIYQVPFTENTAREGYPSPEHAICMTPNA
                     MRSRGRGKLWLASSDPTAKPMIDFKYFEDKDGYDERLMVEGIKIARKVAQQEPFRQHL
                     VREVAPGPACQTDEEISKYARSVAHTVYHPAGTCRMGTPNDASEDGKTVVVDQKDLKV
                     VGMRSLRICDASVLPTLPSVNPMLTILMVGERGAELIRKDAWVNGERRTDW"
     gene            complement(<515538..>518243)
                     /locus_tag="MRET_2671"
                     /db_xref="GeneID:38739437"
     mRNA            complement(<515538..>518243)
                     /locus_tag="MRET_2671"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629298.1"
                     /db_xref="GeneID:38739437"
     CDS             complement(515538..518243)
                     /locus_tag="MRET_2671"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484943.1"
                     /db_xref="GeneID:38739437"
                     /translation="MERSGTRRKSQKGGVLNALKDLVHKKAPNPKDALRTDPDSTTSQ
                     VSARHTPPDVSELRKLSKQGSSVAAPPTLSITEHDAPQSSISRSVSGTNNGPRHLPDE
                     PTFSTINSDVPLIPIQRNLSDAEQSSMQHDNEHADNLTAPGQFPDDAEESLGPNLLMA
                     SLQIPAFLGLDYSPFDLYKTSDKGENGASDIDDLPSSFYSGSEQAIMADSGENTDFFE
                     EKLNKKSGRSKHVFKSTNRTTPSSPKELASPHGSPRPHDDDWTITDEPDLFPEQEGDF
                     GDELHSNGSRLMGVNKSLHELDEVEINEFLNHFSRHTREVHLPHATRHFMRMPQWSDF
                     AYSSDEHDDDITPFAPNEKLAQRHRRSRLLMHVDRGLYMLESHDDPNEHYSDAAAYTP
                     NEDMDSPKGLRPESSQNTSTMSGRDSAVSRQSRINVAMEPYEVDIALDSGEDNFSDNV
                     EVSPLPKSPKRVRIGKDHARKTPLLDDAHVDGIAFCVAYILALVEQYAPDDLDEAPIT
                     EYRESRARSHIERLYIIAPFWEQLVHYLRTLYCWEEPRRTAAAAMIYFVLWYSDLLPT
                     AFFTVLLYYVLQFRFFPQDESLLHRRVHERMLRGQHANRLAERLKRRSRLDILDLYKR
                     WARTYGVVSQVFAGDVADFHEKIKNLLLWRNPNASRRTSILLFGLVVFATLSSPALIL
                     KVFFFICGFTFFALMPLQTLYPRYRRALNPLWWAVLGAPTDAQWAIQLLRSRHARYQA
                     WLAQTKNSTMKYSGSMSPSMPSPSLGDTRISQTQQRTGKSHLNIPTDKASKGKAIAMD
                     NRKLDSFLCQHYGVPGHLNVTPSHFYFSPLLVKGHASKLYVTSLEEMEGLRKTHTTRL
                     GIWDSHGLKITRHGKNTLFLSNMTRRDEAFNLLLTLASHIVQDLV"
     gene            complement(<518409..>521822)
                     /locus_tag="MRET_2672"
                     /note="MRES_12900"
                     /db_xref="GeneID:38739438"
     mRNA            complement(<518409..>521822)
                     /locus_tag="MRET_2672"
                     /product="E3 ubiquitin-protein ligase MARCH6"
                     /transcript_id="XM_027629299.1"
                     /db_xref="GeneID:38739438"
     CDS             complement(518409..521822)
                     /locus_tag="MRET_2672"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase MARCH6"
                     /protein_id="XP_027484944.1"
                     /db_xref="GeneID:38739438"
                     /translation="MFPNDDLRATEWLYASRMDGQEVADEIPTCRICRSEEEPDAPLY
                     HPCKCTGSIRYCHEDCLVQWLQHSQKKHCELCGYHFVFRKHYTHQNSGGIVPIMMYVR
                     YFVVRLVQLAMYLLRLVVVAVTWFVLVPYATRRIWTSYIQSCDWFAEFVLRRPIVALS
                     TKVADAPTRRTDSTLVALMRFIVYELTKDWSTSIALTIAVVVTFIGIFFLREHMMNAQ
                     ILAADHAAVEENAPDHQRHMRQLAQDAMFLAQQRMQRMRELDVDALARRDQMQGTPPE
                     DEDEWEDEEEPEAHQEIVWEPRLHLEPRRRFVGALTPADTPLDEGEWVDETASDQEED
                     RQDDRHVEENLAPLPAPAIPNAEEEEADVNEENEELDENAEHLAEDIDATLHAVGLRG
                     PWLDLGQTFILVQMLIIMTMSVCVAIPYGVGRVLGFRAYDMVLLPAKALRLITDPIFE
                     HMIRGLAWLLPISGRVTASESHASSLSLPPWLSVPWQGFASIGKALDAYTCGGHITQR
                     ALCVILGHLYILLLLQLEARYGTWLHGGTTHFVDVIVKYYGTALKSGMIMLLDFLGFP
                     VFCGLVIDWCFLPLFEGASIATLVGHAQAAPVSFFFTRWVSGTVYMFFFAQFLGGIRS
                     VVRPGVMCWIRDNADPDFQPMAEMVEDSLRLQLLKMVESAIMCGAYAVIVIGGATRAL
                     HLVPGLLPLHWAPLTPRTLVPVELILIHFGLRIAVRRMRFIYFGKRLFRAFWIWTARF
                     VRMSAYIMGDEQPHEHQRLEYASWADWARSFLQSVPATRVDDGGYARVPANDRPAPKT
                     AMFIRTDKHGHPVDEQARELLQKQHTVLDTMQNKSPYTIVYVPSRLRLRLCVILVLLG
                     SLCTFVVMMALGAPLLAGRLVGYWNAWPPVHDVYTWLVGCVVLGGLVLLGRAAYTLSD
                     ARQYQRLSNAQESNVKSMIRGTVRFVYHMAAFGGIVPLLTGAVLHLYILTNASDVPRF
                     SAWYAWAYGALLLNAALMIALLLFPDHVPLLWDIHDHMQAGRLWRVPLGPVSRRILAP
                     VVGALTAILAAPYVLAFMGLFLTNGLDAPITTQLKYVCAAQNTILVCAVCAAARLYIH
                     KRLHYWTYALHDELYLASTELCNYEVGQHRLASDAFQYGSLPDAVLRSG"
     gene            complement(<521896..>523394)
                     /locus_tag="MRET_2673"
                     /db_xref="GeneID:38739439"
     mRNA            complement(join(<521896..523354,523381..>523394))
                     /locus_tag="MRET_2673"
                     /product="aromatic-L-amino-acid/L-tryptophan
                     decarboxylase"
                     /transcript_id="XM_027629300.1"
                     /db_xref="GeneID:38739439"
     CDS             complement(join(521896..523354,523381..523394))
                     /locus_tag="MRET_2673"
                     /codon_start=1
                     /product="aromatic-L-amino-acid/L-tryptophan
                     decarboxylase"
                     /protein_id="XP_027484945.1"
                     /db_xref="GeneID:38739439"
                     /translation="MDTERFRRAAYDAIDRICDYFENLESMPVTAQVERGYLAECLPS
                     HAPEHGEDWRDIMRDYDEHILRGITHWQHPMFYGFFPANTSYEGILADMLAAMTSNPG
                     FNWIASPAVTELEFVVADWIAKMLGLSPSFYVSERSNNGGGLIFGSASESTLTMAIAA
                     RERVLHAISKKTGEDAETVRSTWLTRLVMYCSDQAHSSGVKTARILGLRCRVLPVSRE
                     HMYALRGDTLRNALEEDVKAGYLPFYVLTTYGTTNSCAVDHFDEIRAVSRAYPELWLH
                     VDAAYAGVTWSLPEMRDASLDAINEGFDSVSTNLHKWGLVPFESSPTFVRDRMHLAAA
                     LTLTPEYLKTKDGDMHPLSDLRNMQLSLGRRFRALKVWFVLRSYGVLGFQQHLRSHIS
                     LAQHFADAIVQKGVFELVCPPRWGLVVFRLVGPDNVEKLNRAFQQVLLAHSRDMFLTP
                     TVLPEVGYCFRLALGSPHVQAHHVDRTVRLLHEYAEHVRI"
     gene            <523570..>529203
                     /locus_tag="MRET_2674"
                     /note="MRES_12905"
                     /db_xref="GeneID:38739440"
     mRNA            <523570..>529203
                     /locus_tag="MRET_2674"
                     /product="nuclear pore complex protein Nup205"
                     /transcript_id="XM_027629301.1"
                     /db_xref="GeneID:38739440"
     CDS             523570..529203
                     /locus_tag="MRET_2674"
                     /codon_start=1
                     /product="nuclear pore complex protein Nup205"
                     /protein_id="XP_027484938.1"
                     /db_xref="GeneID:38739440"
                     /translation="MTSAAGVIHVFEPARFESLYDIIHTVSAVPDACDHDWYLAVERN
                     KHALSHLGRVQGPNDAERRDISKGVIMVNGKEKSLNADFVAQTLLLSDELQVSEGYAA
                     SLLQEGIAARARWGRAPSEVACLLYYRERLALLACVKELARGTYTLCVGGDLRTGIRM
                     GRVLDDVLQDGAFLENVLKELDTLRSERERVKASMQKARTTNASLSDEVQMERFAWIH
                     QAEQELCHVVYLLALARRLGPSAIEALLTYLAKCTVPTPTAQGPTAPSTSLCLMTAIL
                     AVLDTVPDEAGEWLAQHSAAPLCTAEALRNDARCLESIWRIVSTGAWATPGIQHVVQL
                     QLAVFLTEAFATHTSLSPALGQSTDDVQALAMRAITSDHDASALLFLLLRVLSFRRGS
                     DDDIDVEDLGPVSIDPEFQEYVLQQVEHLMRGLTSTCFPLLRKMQRSEEDAAISTLRA
                     SRPGSGVASSTRRYDIEALFDLMALLCRGRPESGLPFWQGPDRRISRFLLWAVDTREL
                     GQQRALLGMLASLAEGEQCAVYAHALLEHEAAAPTGSERRLVTWSHLFDWVAHYIEAF
                     QRHTVAVMPPEEMLLLRGFLGVLATVVRYSPATRDALFSHKAYAPLERLFALYACAVP
                     MDLKAALLRAMAAFATQTGTGASPRILSALWDNLDQSGAIRSVRGEPPRALYELEHIE
                     CVHGRYPGTHALVSFLSAILPHVAPVSNAATLVAHMQDTLSLTAPMLASRKSSAHAVS
                     YVTFVLDHVLLPASTRTYVRPAERWSLSAACLEFAEQCLATLPVAPLDSTHPGFDVLR
                     RLLSGTPFLQEIFFFVHPDPSCAGYEVINFNMAQTPDYVRVVRAALRILLHVLDLQND
                     VLHVLPLTHDAALKDRALFLPLDAHLLHAHQIVVQVALYVHCVDAEAAWLAVRLLRAL
                     ARTSTFQATDAFGPLRARTSCNRLVGLLDMTGETSRVISGVLAWLEADSDDGEDAGAS
                     PAKIQRELLDLFLDQLAPDAPAPNVAHLLLGFDMNAPESDRLVQGSRDALLHTLVKRV
                     TPPSTWTPALAERCYAVLHRACLHPYTSASMLRFLRMHDFCAVQLRALPLTPMTVPDQ
                     GTLVYGATGEAISTSPEWALALLHTHAHMLSLVALELHTLAVHDQLPRAAPLLAILLG
                     EPTKPEYGDVRGRWRSLLDATDVTWMDEHEAHNPKLAARLSPALVQDPIMAASRAYDI
                     HAVASLLLEERGTQDHAVWLDQARLVLLWAASQNTRKALAHARQEACAAWRQVLDVLV
                     CDVLGTTVRVDVRMPFLLDCVSALLPRLNETDETTVPSMAASTILSLLHAVRACEDQS
                     DADLGMIGPDRLVDTVRAILHVVCAAGSLTSASMRYDLYLSVVCAVQMVLRTSAAPRM
                     HSLLVAHADNLVHVLARDALDGSDVMQTVALTTLSHLVAWDATKGTASMRVGERLASA
                     GYMKSLVLRIQELDMPLQATLVPDPPSLNALYVYEALLTLLGRLAHSRASLLMDARIV
                     DVLARVDFPSLRPEHTLDDTDGFLPPVAERYASLLTPLLQLLAAILASMPHAHNSVHA
                     LLLAHQDALLATLHAATQASPGISDVEQAALLVQILTFVTPPSPFHAACLALAATYLV
                     PNAHDLLRPLTPTEREDASMLALTYNGLVQTAADTRLTLFESNARRAVDHLARALVQY
                     MEQTSSEGDARAILVPSMHVARVSDHASSAARVVAAPSLGVAIAALGDQCTSLTLAIS
                     SLERVESYRRDPDAVHADEWADLAQEAGLMSSSSVLSMQYRATCIKALERVSRDLVAT
                     VEAKLDMVERWLVLLVRHLDLFMHMSTARASFSTDALRSGARAMLMPILEERLAYLSV
                     PAHIVPSADDHATFLQMGARRIAEELLDTTLLPAS"
     gene            complement(<529231..>531864)
                     /locus_tag="MRET_2675"
                     /note="MRES_12910"
                     /db_xref="GeneID:38739441"
     mRNA            complement(<529231..>531864)
                     /locus_tag="MRET_2675"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629302.1"
                     /db_xref="GeneID:38739441"
     CDS             complement(529231..531864)
                     /locus_tag="MRET_2675"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484939.1"
                     /db_xref="GeneID:38739441"
                     /translation="MNYSTQGGARMQAPDGSSPPKIPYHESRNEELDGNKFLPPYPSA
                     AAFDHNETDILLEDDSRKLHLSSILTDDQPAVISETVSAKAFPTRHEKKCAECRRQHQ
                     HCDISLQEKLLSASGQSGTVRCSRCVQRNINCIQATSPQYRFCPRPTRTGRRIELGRQ
                     LHGSTMYADDADNLFEEEQQIYRQRFELSWPRIYLRLIHCYFNYAYTVVAVPEYERFA
                     HAFNRSFGDPTLMARYLNGLEGDEATCSYFKPKREYSQCKEPNALVEAYPETVELLLT
                     VMCAWGAHYIMLPFDQVNPECFTHMGHKSLRQAAEMDYQLGFSRKSPTDPPHNVMPVE
                     GTKRRHKRRQGVACDTCRLRRVRCDLMEQPLGTKACSRCRVKRIVCTDRYIQWKRERD
                     MLKNPNGTAASVPEVQLLPKREEFDMTGESIEDLFRISQPNLFDFGKSRESTCNYFIN
                     RALMLVHKYDLVNRRCIQSAAALLILSSLLDYRRPDISFDAHRVAVQHLKNLFTGAFF
                     DLNLLMRSQTVPELIRPLSANRVLFSAYLRDAIFHASHHREPLLCAEWFKVGFLDPDG
                     SLRPLTTCELVHFAQKLSPESSVAFCILLGQRIASVGHSIYRDVILQSKNIKLPPTME
                     TVQPLCEACQRLWDDLYAVETTLHILYAKCGSLFTAIRPVNVLMWAWNIFSMQFLLYQ
                     SVSRRINDWAIASYSLISLNDDAEGHEELTDRIYTLMRKGQKYTLNFSRVMALFVHQL
                     IPTGLVHRGTALIRNTFRIAQVLSRTPPMLENVHHGLDRDSAYTGSRPILFRDLLNPQ
                     PEPPKKEPIQTADPPSLVYPDDVSVLLQLPFSRSMGPFTREVRDKEIDYCIQALRRVG
                     FSFPNVDMEMSRIFDTVNAMQ"
     gene            <531974..>532525
                     /locus_tag="MRET_2676"
                     /db_xref="GeneID:38739442"
     mRNA            <531974..>532525
                     /locus_tag="MRET_2676"
                     /product="DUF2315 domain protein"
                     /transcript_id="XM_027629303.1"
                     /db_xref="GeneID:38739442"
     CDS             531974..532525
                     /locus_tag="MRET_2676"
                     /codon_start=1
                     /product="DUF2315 domain protein"
                     /protein_id="XP_027484940.1"
                     /db_xref="GeneID:38739442"
                     /translation="MHSSLARLARVASSHTRVFVGPPDAVSRLRPIVYDGIAGSVSRP
                     TSDSHPYSLSEFSAPIITKKRGAISSYAERVMSQLETLQLHTRLQTIWLDQFNHRFWT
                     DNNARFERAESDYKSRLALPGPVPLELMSPFYREWLRVNSVRLRNYNRVLWTTTYKVI
                     FAQIRLSLFSYYTRAILWLAGGL"
     gene            complement(<532533..>533165)
                     /locus_tag="MRET_2677"
                     /db_xref="GeneID:38739443"
     mRNA            complement(<532533..>533165)
                     /locus_tag="MRET_2677"
                     /product="DNA-directed RNA polymerase III subunit RPC7"
                     /transcript_id="XM_027629304.1"
                     /db_xref="GeneID:38739443"
     CDS             complement(532533..533165)
                     /locus_tag="MRET_2677"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC7"
                     /protein_id="XP_027484941.1"
                     /db_xref="GeneID:38739443"
                     /translation="MASGARRGGRSSAAMQKPNGLTYMEGAHLEEAYLKSDIKAVPVL
                     DPPTEHERYVASLQLDVIRCQWDSPYWTQHTPKRSGDTRLLRYTDKYQPDRRGASSSS
                     SFLQQVPLQKDVFPPHLWESFTSSETRRMERRAFPATGHTAAKIDWDNLHLEEKKNGE
                     GEEEPPPESDEEDLGDYEDEDDDDYAQNYFDNGEDDDDMDADGGDEAAFD"
     gene            complement(<533298..>535052)
                     /locus_tag="MRET_2678"
                     /note="MRES_12915"
                     /db_xref="GeneID:38739444"
     mRNA            complement(<533298..>535052)
                     /locus_tag="MRET_2678"
                     /product="stress-induced-phosphoprotein 1"
                     /transcript_id="XM_027629305.1"
                     /db_xref="GeneID:38739444"
     CDS             complement(533298..535052)
                     /locus_tag="MRET_2678"
                     /codon_start=1
                     /product="stress-induced-phosphoprotein 1"
                     /protein_id="XP_027484946.1"
                     /db_xref="GeneID:38739444"
                     /translation="MEDSAISLHRGDMSVAELKAQGNASFAAKDYASAIQHYTSAIEA
                     AKSTGEKDGVHVLYSNRSASYAGMKDWEAALKDAEETISLNPSFAKGYGRKGSALHGK
                     RMYDEAITAYQKGLEACPDDAGLKKGLADVERASQESMGTNDPASSIGNLFRDPQMFD
                     KLSKNPSTKDLLSDQAFVQQLKDLQSGKTNPMMAMQDQRMIQVMGALIGVDMKAFERP
                     SDSDDAQPPREQPAPKPSTAPPKEEPKMEPEPVDPAVAEAEKEKKIGNEHYLKRDFDV
                     AIQHYQKAWDLHHDITYLNNLGAVYFEKGELDTCIQTCEKAVEEGRAMLADYKLVAKA
                     FGRIGTAYLKKDDLEQAITYFEKSLTEHRTPEILNKLRQTEKEQKERARQAYIDPVKA
                     EEERNRGNTLYKEGDFPGSVQAYTESIKRNPSDPRGYTNRASAYTKLAALPEALKDAN
                     EAINVDPKFVKAYIRKCNVLFSMKEFTKALEAAQTASDIDSESEGGAQHQREIQGLLN
                     KCMNALYAQRSDETDEQTLERAMRDPEVAGIMQDPVMQSILQQAQSNPAALQDHMKNP
                     GIRAKIQKLVAAGIIRTR"
     gene            complement(<535171..>535737)
                     /locus_tag="MRET_2679"
                     /db_xref="GeneID:38739445"
     mRNA            complement(join(<535171..535261,535298..>535737))
                     /locus_tag="MRET_2679"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629306.1"
                     /db_xref="GeneID:38739445"
     CDS             complement(join(535171..535261,535298..535737))
                     /locus_tag="MRET_2679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484947.1"
                     /db_xref="GeneID:38739445"
                     /translation="MSTTPTSDTRAKYDALIPDSSRDDLHKTSSSSTMTEPYTAASQE
                     APAKRKLNDTDVAQEKRARRDTFDDDWSEFQRTVVAPLREPQPSYAHATISAEPELHA
                     TLTQDPKDVQSSKTERRSHIEQATREDILARIEEEERAQEEAGERIRILRARLARIKQ
                     ARRRPRDASLSESPAS"
     gene            <535878..>538184
                     /locus_tag="MRET_2680"
                     /note="MRES_12920"
                     /db_xref="GeneID:38739446"
     mRNA            <535878..>538184
                     /locus_tag="MRET_2680"
                     /product="cleavage stimulation factor subunit 3"
                     /transcript_id="XM_027629307.1"
                     /db_xref="GeneID:38739446"
     CDS             535878..538184
                     /locus_tag="MRET_2680"
                     /codon_start=1
                     /product="cleavage stimulation factor subunit 3"
                     /protein_id="XP_027484912.1"
                     /db_xref="GeneID:38739446"
                     /translation="MQASSAERQAYEHAVSQEPRIPGPWMELMAYVRQSGDLNDICDV
                     YDRFLEHFPQASAQWIEYVNLALSQSNFDQADAIFVRCLRSTLSMDLWKVYLAYVRRV
                     HPLPPFTGEENSPRDQTRRILEASYEYALKHIGWDRESGPIWQDYIQLVREREARGAW
                     QEGQKMDQLRRIYQRAVSTPMNHIEAIWKEYDAYENSLNKLTAKKFLAEHSPAYMQAR
                     AVLGEMKPLTDGLVRPSLPTPPSWIVPNSRAAPQKEHASYEAWHAYLAWEQTNPLALQ
                     DHGAWQHRVLCAYKKATMYIRFDAVVWYMAAHFCRTIQRENDMLVWLRDGIDACPWSI
                     LLRFTYADISTRLGRFSDATAALDDLVDYAQAQVDKRLSALADAKARIDEHMATERKQ
                     RLDKRAQLDSVPDDDDGDKAELADIERRVQEERDQQYQQLEKEAEATISVWRDAVSQV
                     WIKYMQFVRRSEGIRAARQIFSRARKSKHCSWQVYEASAMLEYHCAKEALVATKVFEL
                     ALKTFGPDEHLVVRYLDFLLSVNDDANARAVLERTVSSLPPERARIVWDRWATYEYNY
                     GDASGIARLETRMSDLYPGRPAVQSAAHKLQYRTLDWVRAHELGMEVSTTKPKESKRK
                     AESRSSAPEVSAPEPTKTSDSKADAPSSGGRTMEDIRRSLATSAEPVKRTRGKSEEKS
                     TKKSKSTVHDAPRKGARDTPPPSSSSLAPPPVPTIPDAILYFMSLLPHAMTYDGPPIP
                     PEAIFECLARSRLPLLPDARKAVAKRRP"
     gene            <538296..>538902
                     /locus_tag="MRET_2681"
                     /db_xref="GeneID:38739447"
     mRNA            join(<538296..538588,538614..>538902)
                     /locus_tag="MRET_2681"
                     /product="mitochondrial protein sorting (Msf1)"
                     /transcript_id="XM_027629308.1"
                     /db_xref="GeneID:38739447"
     CDS             join(538296..538588,538614..538902)
                     /locus_tag="MRET_2681"
                     /codon_start=1
                     /product="mitochondrial protein sorting (Msf1)"
                     /protein_id="XP_027484911.1"
                     /db_xref="GeneID:38739447"
                     /translation="MTRSFAASTLFPYPFPQVAQAIWFKYPNPYAEHVCSIDVLDHSI
                     CPRTGVVSVDRLISLNQNIPSWAKRLVGIGDSFFAFERIQFHPQRNYVEMHTVNLTHR
                     ELFQMNEEITYAPDREETRYDQAAHIQFLGLGHKPNALVSSAVTKIEDAALTRFRENA
                     KRGRSGFMHVLKALYDCPDASLLPRINKTGNES"
     gene            complement(<538907..>540181)
                     /locus_tag="MRET_2682"
                     /note="MRES_12925"
                     /db_xref="GeneID:38739448"
     mRNA            complement(<538907..>540181)
                     /locus_tag="MRET_2682"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629309.1"
                     /db_xref="GeneID:38739448"
     CDS             complement(538907..540181)
                     /locus_tag="MRET_2682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484914.1"
                     /db_xref="GeneID:38739448"
                     /translation="MSPTPLLPPRRPQHPVSWRPQDTQTMLPHGTAAPPPPPIPFNTS
                     RSLHHVSPSLSFGFGYTPSMVEQATSYASEAANSPLRYQTDGSAHAASAASRSVSKRR
                     RSSSASDIATDDVGMESAEDVPKRKRGALHMLDDTASPSTSASATTSSAKLPSRDLGR
                     ILAAYEKPVILSLVLDLAKEDERLAERIYTRLPTPSVDHAMATLQTLEARVRAAIPTS
                     ASAVAQVRDQYIWSRVRTVLAELVSELACLIPLFSMTPRSETSEAVHPSTAFTFLHAA
                     TSCALRVVRMLPADTVSLFKHVNGGTLLRSFQQSLTPVPDAREPFASTIFPMLLREWQ
                     AWLHAIDAAVNQHARIFGQDAILAWERGLASLGTGAVSSRGANEHAMRAMMDDTAAQM
                     HTCIGWLVQPAHRTSWLATSNGCSSAMDEGDE"
     gene            <540404..>541882
                     /locus_tag="MRET_2683"
                     /note="MRES_12930"
                     /db_xref="GeneID:38739449"
     mRNA            <540404..>541882
                     /locus_tag="MRET_2683"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629310.1"
                     /db_xref="GeneID:38739449"
     CDS             540404..541882
                     /locus_tag="MRET_2683"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484913.1"
                     /db_xref="GeneID:38739449"
                     /translation="MTALRRSARSKSTDKKEEPEVDKRPELSASDAERIARVLEALAP
                     DTLEQKMPFHSSPTLRALLSQPRPKLRDVWNAMKQASEQAARHDARGHVGILVAMHVL
                     VRMAHEGGHDVDDTAPTAYALHMHLPSGEYFTNAVHLRESYAHSLDTGVADLVSVAPL
                     VRGDVPTPSLGERVRQLKKSTQAPAPKSTTSAFLSYGAFGSSLGPSFDSTGSTVDAET
                     SASTWGEQQRVSRNLRRRWGHFLAQSVDAAYTTARNAMEEDGPESWSDADLIQAAVDV
                     DPALDPSLMKQAVDVLTTDDILTQNEIRLDELQEMQWLRVRMMKDDSVPIPPAMIERE
                     QLLAEQVLSSLVDLLCQAAPSALGRIARAAGPLMHMSHAALVSSISDTRTGVAPRGFW
                     GTLPDAFYGAASKTTLSLPGMPPDSSSWATLLRPAAIADNVTAHAAPERRNVLASEYE
                     QFAASPATAVKNVLIQPRAPAIYASSAPRPPYAAGGSPYPRP"
     gene            complement(<541920..>544178)
                     /locus_tag="MRET_2684"
                     /note="MRES_12935"
                     /db_xref="GeneID:38739450"
     mRNA            complement(<541920..>544178)
                     /locus_tag="MRET_2684"
                     /product="U3 small nucleolar RNA-associated protein 5"
                     /transcript_id="XM_027629311.1"
                     /db_xref="GeneID:38739450"
     CDS             complement(541920..544178)
                     /locus_tag="MRET_2684"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein 5"
                     /protein_id="XP_027484916.1"
                     /db_xref="GeneID:38739450"
                     /translation="MAKNKGAKPPKSRPASTSALSQPLKSEHGAQITAFSHDTALFAQ
                     VTQAVDRARLRVYAADKAGVLADFLLPETTACHALAWVLLDPHTETEGLSSKKRKALA
                     KAESQSESSASTPSEHVALGLSDGSILIYSPYTARVVYVLVASMQDSSASALTSLAFR
                     DDYLWGMTANGWVHGWAMSKLGSASQVERVPPAKHFLPDSKSPMSHLACAEPGPSHCL
                     ITAHHALALYDVQPDRPSLLHTFTGHATPVQHTAWTGDHSFVSAAAEDRHLYCWFTHM
                     SHAGAMITLDAPARRLLAWMETDTCVLLVVSERGTAQLYRMPHEAPKAKGLAVLTPCA
                     HIQTSFDASELIDVTRTPGGVLRYARVVKGFKVVLDEAPLYDGDALKSVIAFTTSAAT
                     KPDVALSGTQRYKDVPGAAGTRVELPAHAAATASLLGTEGGLLPDESAADPHDEALQD
                     GDMNEPTLAQRLKALKVQRGEAATSRGADGMDDEDDEDTAAPVGGASLASSLTQALHS
                     GDHALLTSCLVHSDPVLIRTTVRRISGPLSVRLLEACVDRLNRGGVKSKGALGSARAR
                     GIVEWIHQTLTFHTAYLMSLPNLVSRLSQLHHSLAARLASHERLLALKGRMELVMNQI
                     DMQMSYTADEANMSVQGQKLGKRSSASELDGRQQAVHEQQQGHTWVEPDDDEEQVEEI
                     GLSGGDDITFDDEDAEQDVDEDVEDMDEDEVDEDSDASVDDDDEDEDSGMDDDDDASD
                     DEEDEDDDALDE"
     gene            <544389..>545391
                     /locus_tag="MRET_2685"
                     /note="MRES_12940"
                     /db_xref="GeneID:38739451"
     mRNA            join(<544389..544401,544441..544455,544483..544511,
                     544546..>545391)
                     /locus_tag="MRET_2685"
                     /product="negative regulator of the PHO system"
                     /transcript_id="XM_027629312.1"
                     /db_xref="GeneID:38739451"
     CDS             join(544389..544401,544441..544455,544483..544511,
                     544546..545391)
                     /locus_tag="MRET_2685"
                     /codon_start=1
                     /product="negative regulator of the PHO system"
                     /protein_id="XP_027484915.1"
                     /db_xref="GeneID:38739451"
                     /translation="MNYVQLEKLGEGTYATVYKGRSRLTNEIVALKDIHLDAEEGTPS
                     TAIREISLMKELRHTNVVRLHDVIHTESKLMLVFEFMEQDLKRYMDTHGNRGALDPVT
                     VRSFTFQLLKGTAFCHENRVLHRDLKPQNLLINKRGELKLADFGLARAFGIPVNTFSN
                     EVVTLWYRAPDVLLGSRTYSTSIDVWSAGCIMAEMISGVPLFRGRDNNDQLMQIIRIL
                     GTPDEHTIKRILQESPEIQYRPLPRLPKVPFQTIFPKVHPLAIDLLEKLLQFDPSQRL
                     SADEALRHPYFTTSQAISNAPELS"
     gene            <545612..>547318
                     /locus_tag="MRET_2686"
                     /note="MRES_12945"
                     /db_xref="GeneID:38739452"
     mRNA            <545612..>547318
                     /locus_tag="MRET_2686"
                     /product="cell division cycle 20, cofactor of APC complex"
                     /transcript_id="XM_027629313.1"
                     /db_xref="GeneID:38739452"
     CDS             545612..547318
                     /locus_tag="MRET_2686"
                     /codon_start=1
                     /product="cell division cycle 20, cofactor of APC complex"
                     /protein_id="XP_027484918.1"
                     /db_xref="GeneID:38739452"
                     /translation="MMAPSTPTRAKGSAAALTRGLGMLSLDASSPLSNVSTNVRSPVR
                     MNPMMKGTMPPAVSRREKEDRLPVQSMDMPDARGVVVMKDWDGPDGGVNSALMTRRRS
                     ATMVSRGDRYIPNRELVRRSVNKPFLDDSGGDTLSRPSSSDEAFTSEASDSPPALEGA
                     CQVDLGHRILSFSAAPPTSSSAASTAHARRYANKPKSTLPSSLLAAGRRRIPTAPERV
                     LDAPAIVPDFYVNLLDWSSQNVIAIALQSAVHTWNSETGEAQFLLDLEEESERVGGGG
                     GGLVTSLRWDAHGNILAVGTDRGYTQIWDVARGARLRTLRPSYEGGADASAINAAAWA
                     MDGTLSVGYASGLIREHDVRQRTSETRSLEHAHTAQVCGLNWRGDSALLASGGNDNVV
                     KVWDRRTHVAKMRKENHRAAVKALAWSPHNSSLLATGGGSADRCIHFWNTTQNTRVQT
                     IQTGAQVTSLQWAPHYRELVSAHGVGTSESDAGALCVWAHPSGQKMAEVPDAHDGRVL
                     HTTLSPDGQTLATVGSDESLKFWRLFEQAPELHKAQQQRAGLHAGSYKGFARTAPTRA
                     LR"
     gene            complement(<547323..>548663)
                     /locus_tag="MRET_2687"
                     /note="MRES_12950"
                     /db_xref="GeneID:38739453"
     mRNA            complement(<547323..>548663)
                     /locus_tag="MRET_2687"
                     /product="glucose transporter"
                     /transcript_id="XM_027629314.1"
                     /db_xref="GeneID:38739453"
     CDS             complement(547323..548663)
                     /locus_tag="MRET_2687"
                     /codon_start=1
                     /product="glucose transporter"
                     /protein_id="XP_027484917.1"
                     /db_xref="GeneID:38739453"
                     /translation="MRGAGMRRPPGWVCMVAWIVLAPFHFGYGVSQLNALEKVWVCKP
                     STTTACLGMTEDEFGLATAMFTIGGTIASLLCAPAARYAYAGRRACLLMCASLALVSS
                     LLLSTTTTTKMISMARLVYGLCAGIAIVQTPLYLQELAPPAIRGAIGTLNQLAVVMGI
                     FTAQLVGTWAVTTHHPWQRVPQVSAAVALIQLIVGYVWACESPGWLEGDGTALGVGSA
                     AAAAQIRSRLGCTDGVYERVHAQDAPILGADERPPRTWAQGIRIVVVTQVAQQLSGVN
                     AIMYYSTGIMSRVLPHLAPFVGLLITLVNIIMTLPPLWLIDDARFGRRRLLLFSATSM
                     GLCCFVLAWALMRSYAWLSSVSILLVMASFAVGLGPVPFVMLPEVLPPSHVSLGSSIG
                     LGLNWLTNIVVALSFQPLRRLLGAWDGQTGSLVFVVLGVLNLAFASLIRRMYTT"
     gene            <548739..>549341
                     /locus_tag="MRET_2688"
                     /note="MRES_12955"
                     /db_xref="GeneID:38739454"
     mRNA            <548739..>549341
                     /locus_tag="MRET_2688"
                     /product="ferredoxin-2, mitochondrial"
                     /transcript_id="XM_027629315.1"
                     /db_xref="GeneID:38739454"
     CDS             548739..549341
                     /locus_tag="MRET_2688"
                     /codon_start=1
                     /product="ferredoxin-2, mitochondrial"
                     /protein_id="XP_027484909.1"
                     /db_xref="GeneID:38739454"
                     /translation="MRLRRPFSSRFPGLADHDSMRCGSELIKRAMAQQMPRIAWHAHS
                     RVAYTPVAARLSRSLVPLRSLTTTPPRCHGGITRPAPGTGIKVTFRDSQGKDIKTVEA
                     NDGDDILSIAHEYDIDLEGACEGSIACSTCHVILEEDVFDQLEEPCDDENDMLDLAFG
                     LTDTSRLGCQVHVTRNLDGLVVQLPSATRNMYVDGARGGH"
     gene            complement(<549338..>551023)
                     /locus_tag="MRET_2689"
                     /note="MRES_12960"
                     /db_xref="GeneID:38739455"
     mRNA            complement(<549338..>551023)
                     /locus_tag="MRET_2689"
                     /product="DEAD/DEAH box helicase"
                     /transcript_id="XM_027629316.1"
                     /db_xref="GeneID:38739455"
     CDS             complement(549338..551023)
                     /locus_tag="MRET_2689"
                     /codon_start=1
                     /product="DEAD/DEAH box helicase"
                     /protein_id="XP_027484908.1"
                     /db_xref="GeneID:38739455"
                     /translation="MACHGGSRIGLLARRIWPARICMRTIKTHAKDPFESLGLPSNLC
                     QQLHAALPHISTPTPVQAALIPAMLSPRDVILRAHTGSGKSFAVLLSLLARPRLLFKD
                     RSDATPGISALVLVPSNELAYQYMRWARELMPAELGAHMDAVIQCMVRGDAALSSIEA
                     QSERLRRTPPHILVGTPARIEECLASGPQGAHLLGVYTWRTLVLDEADALLRLPGRFP
                     SAKQRWKHLVHPSPGLHVLDTIMRARATYSGGERILSAGLERHAPLHGGDKRPPEPIR
                     RTQYRGAEKTTELARPMERTKDDVPLQLVCTSATANAVLRHFFGARTGWLRTNTRETR
                     HTAQWIDMTGMSGRISAVDAPKAGVMPREISHVCLVVHDVHGVPQWSDLDTAPNKEHR
                     HDARMPDVASDATPLLPEHAVDTLLLESLAYVYAYEGVRHGLALIPARWSVRRVHDEL
                     ASLGVPVRIVTPGEAPASPDEEVLYLLQSTSARGLDLPGLSHVFLVGIHAVQDAIHYT
                     HVAGRVARIHASGPRPPGQVVTLLRAHAPSEHKMARMYARVGVEVRAMKPRTP"
     gene            <551207..>553591
                     /locus_tag="MRET_2690"
                     /note="MRES_12965"
                     /db_xref="GeneID:38739456"
     mRNA            <551207..>553591
                     /locus_tag="MRET_2690"
                     /product="beta-glucan synthesis-associated protein KRE6"
                     /transcript_id="XM_027629317.1"
                     /db_xref="GeneID:38739456"
     CDS             551207..553591
                     /locus_tag="MRET_2690"
                     /codon_start=1
                     /product="beta-glucan synthesis-associated protein KRE6"
                     /protein_id="XP_027484956.1"
                     /db_xref="GeneID:38739456"
                     /translation="MSHHHRRSTDMAFIMDAYGQQPSTSMSFMAEDDTWGSDRDTSSH
                     TLLPPTSSQATDSYIFNATKNVPALDPLTRSLPSQRASNETTIPAWHHSSSGNESAFD
                     DTFTYVISRSKDSSIYDDEDLFTDMHSSYLRHSNQSRISMTDEDNIVSQYIQPPSSPK
                     LVHRRPTESNTPVFERQGLRRQRTIMSDSGDSFDMISAYGSDQDSLFKYDDDPFRSHK
                     PKWSAAGLAYTVSSPSRPKHLTDKHVLPADYHSATLAGGQMDDFLETDREWDETTLKL
                     HQYWSLRGTLNVSVLILIVLCVLMLFMGYPVLHEASQQKLRDTLKTPVDDQPRSLSGL
                     RTSLIDPDTPPEARTSKNSYTNKTMKLVFSDEFNQDGRSFYPGEDPFWEAENLHYWQT
                     ENYEWYHPSAITTANGSLVITLSQHPLHNLFFRGGMLTSWNKFCFTGGKLEARLILPG
                     RNNVSGLWPAVWTMGNLGRAGYGASTEGLWPYSYDSCDVGTLPNQTYLASQGGGPLAA
                     ETTGRYVEDFGPYLSYLPGQRLSRCTCLDSTEHPGPRHEDGTWVGRSAPEIDLIEALG
                     NNGEGEHGQTSMSLQVAPFDAAYNVTDPSGLIATNGSTHASKLNDYTGAVFQQAVSAK
                     VNTSDSAYTLTDHQFDTYAFEYNPGTSKDSYIKWFISNEEVFRIEAHALGPNKATEIG
                     ARPIPEEPMYLIMNLGISQSFNWINWDVLSEDWNNDPSNYRMLIDYVRVYQDEDKISE
                     DSISCSPSKFPTAEYIEKHMEAYTNPLLTSWVEAPERGGYNHTFPPNVLLGQCK"
     gene            complement(<553626..>554302)
                     /locus_tag="MRET_2691"
                     /db_xref="GeneID:38739457"
     mRNA            complement(join(<553626..554061,554091..554136,
                     554166..554176,554277..>554302))
                     /locus_tag="MRET_2691"
                     /product="cellular nucleic acid-binding protein"
                     /transcript_id="XM_027629318.1"
                     /db_xref="GeneID:38739457"
     CDS             complement(join(553626..554061,554091..554136,
                     554166..554176,554277..554302))
                     /locus_tag="MRET_2691"
                     /codon_start=1
                     /product="cellular nucleic acid-binding protein"
                     /protein_id="XP_027485193.1"
                     /db_xref="GeneID:38739457"
                     /translation="MSFSRSCYNCGRPGHTSAACPSAGTPTCYNCGQQGHVSVVCTNQ
                     TVPKTCFRCNESGHVSRDCPRAEAQGPGAGGECYRCGESGHIARMCPMGGGAPASRGS
                     SRSCYNCGGIGHFSRECSSAPGASASAGTKCYNCGNMGHMSRNCPRPPQHSCYTCGAE
                     DHIAAQCPQAAV"
     gene            complement(<554424..>555353)
                     /locus_tag="MRET_2692"
                     /note="MRES_12970"
                     /db_xref="GeneID:38739458"
     mRNA            complement(join(<554424..554821,554851..554950,
                     554982..555290,555321..>555353))
                     /locus_tag="MRET_2692"
                     /product="signal recognition particle subunit SRP19"
                     /transcript_id="XM_027629319.1"
                     /db_xref="GeneID:38739458"
     CDS             complement(join(554424..554821,554851..554950,
                     554982..555290,555321..555353))
                     /locus_tag="MRET_2692"
                     /codon_start=1
                     /product="signal recognition particle subunit SRP19"
                     /protein_id="XP_027484954.1"
                     /db_xref="GeneID:38739458"
                     /translation="MASDEFNDDTEFDLPDVPSAPMPPQQQDMMEQMMQQMMGGGAET
                     PKAQSRNVAADGDEDGPHKQWTSVYPIYLDAKRRYRHGCRRVAYHKALLFPNSQLIAN
                     AARKMQLEFMHEPYRKHPQDWENPGRVKVRLFDDQGTPIRADLPTKQALLNSMATLLQ
                     PVVGGQPPPLTPREKVSKRSSRAALRSRQRCIRNARTVDHIPPHSPAMPSGLLNIRMS
                     QMPGADALKQMGPLGNMMSSLGLGDEDDDEKTDTDASQQAANRPAPSLGRRQRRRVVR
                     IGR"
     gene            <555492..>557648
                     /locus_tag="MRET_2693"
                     /note="MRES_12975"
                     /db_xref="GeneID:38739459"
     mRNA            <555492..>557648
                     /locus_tag="MRET_2693"
                     /product="prolyl-tRNA synthetase"
                     /transcript_id="XM_027629320.1"
                     /db_xref="GeneID:38739459"
     CDS             555492..557648
                     /locus_tag="MRET_2693"
                     /codon_start=1
                     /product="prolyl-tRNA synthetase"
                     /protein_id="XP_027484955.1"
                     /db_xref="GeneID:38739459"
                     /translation="MSESILAALSALSIKASEPRSATHASASSQGEWAEALSALPDTA
                     KPANYRLLKTLVFKPKTAKSETPIPVMVVTDEATQTSTPAIGAHLKLKELRLAVPELL
                     HATLGATKDDVSPFSVTAENASKLRVLVDQDMVDSGAIYAVHARSASETVFVTGAALV
                     AYLTNVQASMDTVAFSTLTAPAKPQQSEVQKPVSKSKQDAKIQDAELIGITVRKELDF
                     PEWYQQVLRKGDMLDYYDVSGCYILKPWSYFVWECIQDFFNAEIRKIGVQNCSFPMFV
                     SSDVLEREKDHIEGFAPEVAWVTKAGKSDLEKPVAIRPTSETVMYPYYAKWIQSHRDL
                     PLRMNQWNSVVRWEFKHPQPFLRTREFLWQEGHTVHLHREQADEEVRYILDLYRRVYE
                     ELLAVPVVPGVKSEKEKFAGGLYTTTVEGYVPTTGRGIQGGTSHALGQNFSRMFDITV
                     QDPKASDEVRGKPEGRLFLWQNSWGLSTRTIGVMVMVHGDDKGLVMPPRVSQVQVVIV
                     PCGLGVKVSQEVKDAVNKLCADTEAQLRGAGIRAHADLRDNYNPGFKFNDWELRGVPL
                     RIEVGPKDYENKSAVAVRRDTGAKASLPIDSLVQRVPELLDSIHGDMLAKADAQFRDH
                     RKVVLTWDEFTPTLNEKNHVIIPWCEDSECEDDIKDRSARISLAGEAQDERAPSMGAK
                     SLCIPFDQSPYPPIEGHKCPQCGKPAKCWTMFGRSY"
     gene            complement(<557659..>559017)
                     /locus_tag="MRET_2694"
                     /note="MRES_12980"
                     /db_xref="GeneID:38739460"
     mRNA            complement(<557659..>559017)
                     /locus_tag="MRET_2694"
                     /product="seryl-tRNA synthetase"
                     /transcript_id="XM_027629321.1"
                     /db_xref="GeneID:38739460"
     CDS             complement(557659..559017)
                     /locus_tag="MRET_2694"
                     /codon_start=1
                     /product="seryl-tRNA synthetase"
                     /protein_id="XP_027484959.1"
                     /db_xref="GeneID:38739460"
                     /translation="MIDLQLLQVEKGGNPEVVRESQRKRFASVELVDEVLSLYKTWVT
                     LEFQLNQMQQEVNAIQKVITTKKKAKEDADAELAQKKEQDAKIADFKPKVAEAEREMR
                     LKAGTIGNIVGDKVPVSETEDDNLVTKTWHPDGPNGQFEKKDHFLSHHEVMYRLDLFD
                     TERGAKISGHRGFFLTGDGVDLNQALINYGLDFLRKKEYKKIMTPFMMRKEHMAKTAQ
                     LDQFDEELYKVTGDEDDKYLIATSEQPISAFHSNEWFDRPAEQLPIKYAGYSTCFRKE
                     AGSHGKDTWGIFRVHQFEKIEQFCITDPASSWDMLDHMLANSEEFYQSLQIPYRVVAI
                     VSSALNNAAAMKYDLEAWFPFQGEHKELVSCSNCTDYQSRRLEVRCGMKKQGDSKKQY
                     CHMLNGTLCATERALCCLVENWQTPDGLRIPPPLQPYMQGRDFLPFVRDLPKGSTSQK
                     RK"
     gene            <559147..>560493
                     /locus_tag="MRET_2695"
                     /note="MRES_12985"
                     /db_xref="GeneID:38739461"
     mRNA            <559147..>560493
                     /locus_tag="MRET_2695"
                     /product="DnaJ subfamily C member 2"
                     /transcript_id="XM_027629322.1"
                     /db_xref="GeneID:38739461"
     CDS             559147..560493
                     /locus_tag="MRET_2695"
                     /codon_start=1
                     /product="DnaJ subfamily C member 2"
                     /protein_id="XP_027484960.1"
                     /db_xref="GeneID:38739461"
                     /translation="MAAVIDLPFALPAAPKNYAPAQASSSSVSLTSVEVSPVGDAFLS
                     YMRRRLRQSTFEEDDALVKQRLDEHVAANTQVDELDNDIGEEPESQELLDSDPMQWKS
                     LDHYAVLGLSSRRYKATDYEIKIAHRKKVLKHHPDKKVSATGVSDDAFFKCVAKSFEI
                     LSNPEKRRQFDSVDEGVDDDNVPTGKESPERFYELWAPVFEREARFSKQTPVPSLGTK
                     DSTKEEVDDFYNFFYNFDSWRSFEYLDSEVNEGSDNRDEKRYTEKKNRNERARRKKED
                     NARLRNLVDKALSLDPRIKAFRAAERAAREAKKNKGRPGVPGAKGAAEVAAEEQRKKE
                     EAEKAAKEQAEKEQAEKVERDAAKKVREAAKKNLKKEKKTIRNIITGANYFQPEGTTP
                     SASVLDKQLTALDALCASLEPEQVLSLREACEKSTAEAKAALHKACEEKSLGDAFA"
     gene            complement(<560490..>561650)
                     /locus_tag="MRET_2696"
                     /note="MRES_12990"
                     /db_xref="GeneID:38739462"
     mRNA            complement(<560490..>561650)
                     /locus_tag="MRET_2696"
                     /product="ribonuclease h-like protein"
                     /transcript_id="XM_027629323.1"
                     /db_xref="GeneID:38739462"
     CDS             complement(560490..561650)
                     /locus_tag="MRET_2696"
                     /codon_start=1
                     /product="ribonuclease h-like protein"
                     /protein_id="XP_027484957.1"
                     /db_xref="GeneID:38739462"
                     /translation="MCAMLGRRVGRAFTSLRWTTMRAYSNAVDAMAASIADAHVPASS
                     TYTYRRPKYTIPKAMRAFQQPTVAYQVPRLHYLTGIQEVENALPDAVANTGTLERIIG
                     LDLEWNFGLSVGKTAVLQLATAFDIYVIQLSKMRNLPNSLASILTDPHIPKTGVAIHQ
                     DLAKLQRDFGLIPKGGLELSRLAWRFDAERWQNHRFLISLRDLCKGYLAVDLDKGATR
                     ISSWTQTPLSNEQIEYAASDAYVSLELVHAILLHAYRRNAITLNEIRACMQEAPHNRL
                     RKPQRSHSMSAPLAHQRAWEAWKQGASLQELALEKHIRLTTAGTYIAKAVQESPNPVE
                     HGSETWHRLRAEYSAADMRPITVRYAHGFARHGVFNYAELHQILHAFRMAQT"
     gene            complement(<561719..>562865)
                     /locus_tag="MRET_2697"
                     /note="MRES_12995"
                     /db_xref="GeneID:38739463"
     mRNA            complement(join(<561719..562720,562755..562781,
                     562812..>562865))
                     /locus_tag="MRET_2697"
                     /product="glycosyl hydrolases family 8"
                     /transcript_id="XM_027629324.1"
                     /db_xref="GeneID:38739463"
     CDS             complement(join(561719..562720,562755..562781,
                     562812..562865))
                     /locus_tag="MRET_2697"
                     /codon_start=1
                     /product="glycosyl hydrolases family 8"
                     /protein_id="XP_027485194.1"
                     /db_xref="GeneID:38739463"
                     /translation="MDARYHQWCSNYMRSSPCGLYCFYNGSGENGDAITCSEAHGYAM
                     LIAVLHGNQNDFDGLLSFFLSFRNGHGLMKWQVRQNGSGTLYVDEDANDCATDGDIDI
                     ATALFLASRNWPQGSSSFPAGAYGYEAAALSDAVLAHCIHPDLNVPLLGDWCCKDDKE
                     NCRLYDSTRSSDFILSSFLLFHMKHPNPQSRQRWQEVLESTLQVAISQLALYPRSGLL
                     ADFLVYDKRHGWHPSKGKHLESKYDGEMSWNACRTPWRLAHYYAVTGDQRILPLLQTM
                     HQTLMRCNFPSVPAGIRVRDGKALVDYSERAFIAPVGYLSYVLGDSSSHLAAIRAMDD
                     EEPGYFGDSIDLVIAEEAMAASTWLS"
     gene            complement(<563206..>563865)
                     /locus_tag="MRET_2698"
                     /note="MRES_13000"
                     /db_xref="GeneID:38739464"
     mRNA            complement(join(<563206..563637,563863..>563865))
                     /locus_tag="MRET_2698"
                     /product="small subunit ribosomal protein S17e"
                     /transcript_id="XM_027629325.1"
                     /db_xref="GeneID:38739464"
     CDS             complement(join(563206..563637,563863..563865))
                     /locus_tag="MRET_2698"
                     /codon_start=1
                     /product="small subunit ribosomal protein S17e"
                     /protein_id="XP_027484952.1"
                     /db_xref="GeneID:38739464"
                     /translation="MGRVRTKTTKRAARVLIEKYYPRLNPVDFHTNKKVIDEVAIVPS
                     KRLRNKIAGFTTHLMRRIQRGPVRGISFKLQEEERERKDQYVPEVSALDPSVAPLEVD
                     PDTEEMIQSLGFDNLPLLVTAPVTAHSLPERKGRHIPGAGRR"
     gene            <564105..>564822
                     /locus_tag="MRET_2699"
                     /note="MRES_13005"
                     /db_xref="GeneID:38739465"
     mRNA            join(<564105..564125,564170..564281,564563..>564822)
                     /locus_tag="MRET_2699"
                     /product="small subunit ribosomal protein S15Ae"
                     /transcript_id="XM_027629326.1"
                     /db_xref="GeneID:38739465"
     CDS             join(564105..564125,564170..564281,564563..564822)
                     /locus_tag="MRET_2699"
                     /codon_start=1
                     /product="small subunit ribosomal protein S15Ae"
                     /protein_id="XP_027484953.1"
                     /db_xref="GeneID:38739465"
                     /translation="MVRISVLNDALVSIVNAERRGKRQVLIRPSSRVVVRFLSVMQKH
                     GYIGDFEIIDDHRAGKIVVQLVGRLNKCGVISPRYPVPLSEMEKWVSAMLPARSFGFV
                     VLTTSSGIMDHEEARRKHVSGKILGYFY"
     gene            complement(<565025..>566002)
                     /locus_tag="MRET_2700"
                     /note="MRES_13010"
                     /db_xref="GeneID:38739466"
     mRNA            complement(join(<565025..565448,565475..565619,
                     565648..565778,565816..565915,565945..>566002))
                     /locus_tag="MRET_2700"
                     /product="THO complex subunit 7"
                     /transcript_id="XM_027629327.1"
                     /db_xref="GeneID:38739466"
     CDS             complement(join(565025..565448,565475..565619,
                     565648..565778,565816..565915,565945..566002))
                     /locus_tag="MRET_2700"
                     /codon_start=1
                     /product="THO complex subunit 7"
                     /protein_id="XP_027485135.1"
                     /db_xref="GeneID:38739466"
                     /translation="MDVDSDTATALMPLSSQQQDDILRNRLSTDDKHVRRIAKRIAVL
                     VQSSSSQDREAAALLLQSDLDLFSEHISKLHSIANTTSTAEMESYEQEMTALHEKSAE
                     KKAHIEMLKKRLDEAKEHRAQVSEYNIIANKILAYPSREEMMNSIQQHRDRIAQLQSE
                     IKKYDDASAHAKNELNSIVSALMELRQNIRSSLGYKPLPEESALCASTLNPKAHTFQS
                     ESSSADVTASNAKRTHNDSSGDGNKTCQTDHKRLRMQEDDKAQDQTPQPSKDNGDILD
                     QPSSSTPSV"
     gene            complement(<566333..>566855)
                     /locus_tag="MRET_2701"
                     /note="MRES_13015"
                     /db_xref="GeneID:38739467"
     mRNA            complement(join(<566333..566626,566736..>566855))
                     /locus_tag="MRET_2701"
                     /product="large subunit ribosomal protein L14e"
                     /transcript_id="XM_027629328.1"
                     /db_xref="GeneID:38739467"
     CDS             complement(join(566333..566626,566736..566855))
                     /locus_tag="MRET_2701"
                     /codon_start=1
                     /product="large subunit ribosomal protein L14e"
                     /protein_id="XP_027485136.1"
                     /db_xref="GeneID:38739467"
                     /translation="MGAQRMSFKRYVEVGRIVLISNGESKGKIATIVEIVDQNRGVID
                     GPSTGVPRQVMAFRDMTLTRFVIKVPRASGTPTVKKAFEASGVLEKWESSKWAKTLKA
                     REARKNTSDFERFKIQVLKKQRRNIINEAAKNVKA"
     gene            <567212..>569686
                     /locus_tag="MRET_2702"
                     /note="MRES_13020"
                     /db_xref="GeneID:38739468"
     mRNA            <567212..>569686
                     /locus_tag="MRET_2702"
                     /product="inositol-hexakisphosphate 5-kinase"
                     /transcript_id="XM_027629329.1"
                     /db_xref="GeneID:38739468"
     CDS             567212..569686
                     /locus_tag="MRET_2702"
                     /codon_start=1
                     /product="inositol-hexakisphosphate 5-kinase"
                     /protein_id="XP_027485137.1"
                     /db_xref="GeneID:38739468"
                     /translation="MLDRRDTRLQNMPPEATSQDTLTLAGVLASAPIPENSDVSIDEG
                     GQLSPRVGSGRKAAASLQLFMATQTPQLAPTQLEPVLDPVQDSASSEVVEPAHDPSPS
                     TNVAPAKPLRPQTLLQHSSDSLRRGESVSPDVLTYSTMYDNDDDQSRTADMCDSNSES
                     SSDESDTASEQETEAERGPPSDFRKVPEGYGSYANPITIQSPHLSAEPSVHVPHTVRR
                     HHHHHVQDSSEPPPSVVQLQPFNHQVGGHSHIFQFSRRAVCKPLTSRENQFYEALERD
                     HPDMLAFVPQYLGVLNVTYRHVHREEARNAQTEEEPRRKVFQGQSDNDHEVPEVAIDQ
                     NQHIMPDWLVRQSCRGMEEQEILNKQRESMILGKGSTSVNRRLQEQVIREVFRQSKSR
                     SRGKRSESSKSGTEERLAKSWEHDRKERKMPPFTSLDDVDSTWKQSRARSHGDYSSSH
                     EACQTSSTNVRHEQFILLEDLTGGLKAPCVLDLKMGTRQYGLDSTDAKKKSQTTKCNK
                     TTSRTHGVRICGMQMYDAQHDKFVFQDKYYGRNVKPHEFTSVLESFFHNGYQVLVHHI
                     PPLVEKLHCLARHACKLVGYRFYASSLLLIYDGDIRRQNTLLQGFEADVLQGARRPSA
                     QSDANTEHSESFPQMTPGSEASTVITSPPFAPSSVSSTAITLPSPVISEHASPKEDAQ
                     PQGRRFWRRGNMNIRIIDFAHCTTGRDFYFPEDHDGRLPQLPEEKCLPISRHSPAHRD
                     KPDVGYLWGLRCLALALQEIWDRERRRRLDAAHAASEEQQMDSTERSLALLRADIGAL
                     HVPGGEIFTELFGPDESGSLAGYIST"
     gene            <569765..>571675
                     /locus_tag="MRET_2703"
                     /db_xref="GeneID:38739469"
     mRNA            <569765..>571675
                     /locus_tag="MRET_2703"
                     /product="serine/threonine-protein kinase"
                     /transcript_id="XM_027629330.1"
                     /db_xref="GeneID:38739469"
     CDS             569765..571675
                     /locus_tag="MRET_2703"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_027485138.1"
                     /db_xref="GeneID:38739469"
                     /translation="MAAPPPKSSVPQNRLHTWKRKTSLYLGKDEERWAHIAADPASDS
                     PWKFVKSVVVPPPRLWENHDPITHKFASSLGIIPESAQYRSKLDIESTLLAKDVELGS
                     GAAQPRPFWQRGDRTKMPHASALLSPRSIQTEFLCQPNVSLQPASSDADLNDVLRHDA
                     PPNQLPTLEMRRHLRSKLLRAAIKDHVALPRAESPELHVREEPRCTSAVYDKREIHSL
                     VPRRNIELVEGTLYDEEGPFKEGAMSDSLSVRLFYAPGNNVGEGVSFLITTPDNRVFS
                     AAKRRRWAMDHNGNFFAAMEIKSAESKMQLALRESVDPQYVREFEIDLRKHYIDDILD
                     EMQKAETLMPGDNGVTPHVLQTEDGKVIRLEEDFPEEAFFVIAGCQDHEIYPVIARVF
                     VEAIRLLWHMHCHGWMHGDIKLENLMFNEKGVLRIIDFENASPFRGSPHHDGKIQLLS
                     FDWTPPELEVSFLGRRMGPTGDLYALGCNVIRGFALRDGITDNTVRQMLMGEGLAHFV
                     RFRERLLTSTASKPDAPPVQYGINLVPLLEEADFDAVPVYNNPARILRMFALRAPKLL
                     QYILAHCVAPSPDDRNERLGVALAEEMLNDPANADMWETVEKTVAHSIELSGSSWVRP
                     KLDEARRILELA"
     gene            complement(<571721..>574597)
                     /locus_tag="MRET_2704"
                     /note="MRES_13025"
                     /db_xref="GeneID:38739470"
     mRNA            complement(<571721..>574597)
                     /locus_tag="MRET_2704"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629331.1"
                     /db_xref="GeneID:38739470"
     CDS             complement(571721..574597)
                     /locus_tag="MRET_2704"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485139.1"
                     /db_xref="GeneID:38739470"
                     /translation="MDSHTSATPLKRSHSHDQDVLQAPSPPDQTKRSRTNQRPELADA
                     FLECLSSSDLIHIIRQLEQLLQDTPYLADAYALIYPENLEEHTSLRQQASAPTIPTTQ
                     PLLRTLSEPPSHEPETSSASMVPAPSLSTHTPHISSPLASQPVQTQTSPPSTLLTTAS
                     PLPSRLYTPSIPASVSDTTTPSLTTESLVTPSGTEPESASNNSNISSRIAAILESIQN
                     TNSSGPMLGLQGQPLAPSKQGAGTGVSNGLSSLLSNSFPHSSTRMPANSALSRLLEQS
                     STSATPPASTALSTSSASSSVLGNLASRAGFSTTPSLDYTSFSHPTTSVTSSAATSSP
                     LSPFTSTYGLHDSHSDEGNAPQRESPRITSTLPSYEDMIIEGLQVIGDVNGTPPRMLF
                     HWMEDTYPLMKNFRPSASQALQKAFKRGRLHKAGSLYRINPHWDGSNAGRKPTRRPQI
                     GKDHPMMVNGPKGPAPASPFKARAQFEGAAAYRQSSVHLNKHRNLRHPSSLRPGPKPY
                     GQPGAAPLDNPASSIFQNGAAAAALLLAHQQRTRDSNGNSSGLPTSTQDLTPTLTSLV
                     KQLRGSSATPVSDGPGSSSLSSVLASALLKHAQRPSDGSAAVSDPSMLTPLTNSLTST
                     SSPVLQSLSRLLSASRTDPTSSETGDATTKPTSVPYSTSPASSLPASGPGSLSASIET
                     LVRQATRTATQQAESSPSSAVTTGPLPSEPSTSTAPQLPTPSTSQSDLDAAVSQTLQA
                     AFQQLGPDKTATSMDSGDAMPDSNAASALEGIDTSELDGINLDDYGDALRTLTAALAG
                     TSAEGEEGDEEAQRLADEKAIADAEADLSDVGESEEDLPKSSSHGQSKDTNSSNRMES
                     LLRSYGIDVSSEAVHHLTETLRDPNMSVSELTEHSKDKGPNDSVQDGTPVVPSATDES
                     TAVPDTSTDLSLLDPNASDADKNQSIQTQLEALIASLAAENEES"
     gene            <575169..>576716
                     /locus_tag="MRET_2705"
                     /note="MRES_13030"
                     /db_xref="GeneID:38739471"
     mRNA            <575169..>576716
                     /locus_tag="MRET_2705"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629332.1"
                     /db_xref="GeneID:38739471"
     CDS             575169..576716
                     /locus_tag="MRET_2705"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485140.1"
                     /db_xref="GeneID:38739471"
                     /translation="MGSAADETRPGAVLSFFAAVWKILWEVWLEPFFQFLHLYEPKDR
                     TYGRSDVPFSKMEQRLHENPDVTVTFHKTMMPNGKDFVWYQVWEDKLAMRSTGRLADM
                     VFCHGTGVHSGTLASHSRRYLDAGYRLIVPDLPSHGYSTGRHVYQPTMKGYTDGVYQV
                     IHDVARRDDEALGKKTPKQNRRRTFLLGLSFGGLVALLYPIYYPGSTRTDTTHPDEIP
                     IDGVIGVGPIIHFNPKDVQVSPIIRLIMVVIKAMYGLRLELYVPHKKAVDKDPKVYKQ
                     LIDQDMRSHRGAFRVGHLYCVRNGIADVQEMADKFTVPVYIQHGLQDRVVSALSSLQW
                     LQKTMSDDIKMTVYPVCQHVIYRKAKSEEEDLAGRVSVLEDNVAWMNARCPGTGHIDR
                     GVSFSMDYSDTPKENNARTNTYSLASSGMMTPSEAALSSMGQNDLVQDTIQSLTDKLG
                     SIEHGAPGKGESQNRASQVTNRFSKNAPKLPVTPVTGADNEIEHRVYRENWTLSEELR
                     PYDILFD"
     gene            <576793..>578217
                     /locus_tag="MRET_2706"
                     /note="MRES_13035"
                     /db_xref="GeneID:38739472"
     mRNA            <576793..>578217
                     /locus_tag="MRET_2706"
                     /product="mitochondrial-processing peptidase subunit
                     alpha"
                     /transcript_id="XM_027629333.1"
                     /db_xref="GeneID:38739472"
     CDS             576793..578217
                     /locus_tag="MRET_2706"
                     /codon_start=1
                     /product="mitochondrial-processing peptidase subunit
                     alpha"
                     /protein_id="XP_027485141.1"
                     /db_xref="GeneID:38739472"
                     /translation="MLRLGARSWQRKTAQLLSWRSYASEASNEALQVTTLPNKVRVAT
                     EATPGHFSAVGVYVDAGSRYERPWIPGENGVSHLLDRMAFKSTRTRSASDMEQLIQAV
                     GGNVMCSSSRDTIMYQSSVFNQDIGKVLDVFSDTIRHPILDATELGMQREAAAWEVSE
                     IWSKPEMILPEIVHSVAYHENTLGHSLLCPIESLDVMTTDNLRAFMQAWYRPERIVVA
                     GAGMPHSELVALATEFFGDMHVPPQDPMLELLGKERARYTGGELVLPDPSSEFTHVYV
                     AYEGLSIHDDDIYALATLQMLLGGGGSFSAGGPGKGMYSRLYTNVLNQFYAVDHCASF
                     HHCYADSGLFGISASVHPSFNATVPYVIARELELCTSGAYHGSITNAELSRAKNQLKS
                     SLMMALESRLVEVEDLGRQVLVHGKKIHVRDMCAAIDRVDLATLHRVAKRVLMSGKPS
                     TVVVQGAELEGVGDIRSLLSSRGM"
     gene            complement(<578250..>579632)
                     /locus_tag="MRET_2707"
                     /note="MRES_13040"
                     /db_xref="GeneID:38739473"
     mRNA            complement(<578250..>579632)
                     /locus_tag="MRET_2707"
                     /product="PHD finger domain protein"
                     /transcript_id="XM_027629334.1"
                     /db_xref="GeneID:38739473"
     CDS             complement(578250..579632)
                     /locus_tag="MRET_2707"
                     /codon_start=1
                     /product="PHD finger domain protein"
                     /protein_id="XP_027485142.1"
                     /db_xref="GeneID:38739473"
                     /translation="MPVAEDGTTAPQVMPSSSSSLLLSPSPPINTKPAPRRRAKRRTR
                     RGVSASVCGRTQYALRASASHHASAIMRSGRTLSKGPEAPPPPMPPPSLPRQDVLRSF
                     STHPAGQLRSRSVRPVWIEGVGRVLLPQDAHREPAIPVYTPNIHRHALIAQWLAGDDD
                     DEPASSSPPQDALHPMMAKSLRERVRSQPYPSRASSAFHDLWIGLDGTRILRGTKQPQ
                     PRRRIAWTMRSLLASGLVPNMACHCGFTDEHMEVVSCDSCARWLHLACVGASHVDQLT
                     AHEWVCDDCYNDKAVIAHSPHKGLHAHAQLHSTTLSLAPSPQRLRTPSPPPSSPTPAP
                     AFVDMVTPSRHFAPSTLPDWLPTPTSLLATSPSMMLRTPHTRVHRSLVPDSPTPYTRS
                     AQRTIPWSTPSFSGDTLSDGMGLSSPMPETPTAPSRSRVLGLHRMPHGSPSPSLKSLA
                     PPTLLSWDET"
     gene            complement(<579782..>582412)
                     /locus_tag="MRET_2708"
                     /note="MRES_13045"
                     /db_xref="GeneID:38739474"
     mRNA            complement(join(<579782..579866,579891..>582412))
                     /locus_tag="MRET_2708"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629335.1"
                     /db_xref="GeneID:38739474"
     CDS             complement(join(579782..579866,579891..582412))
                     /locus_tag="MRET_2708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485133.1"
                     /db_xref="GeneID:38739474"
                     /translation="MSQRLAALQDLFDRGQQKEEASDASVDQSTTTYPAPEAGAIHSL
                     DLSSSIDVPLGDGPVSDSSHSHFPSIVQTPRRQASLAMPKPSAEATPRSTTQRDATPH
                     REAVTHNDATPHAASMLQDESSSLSESLHASQLAQSHGALDMLDEDEDVEASQSAAGT
                     SGHWGMQEIQRRTAAGFSIKSTLQKIEQLTAERDDLKIEVDFHRRNMSPEDVGAEVIS
                     LRQEKLGYVRRLQKMNELVKGQDQALKTVNRQVKSWEAKLADYDALVARLHEAEQRTQ
                     SHADVAHLEASLHAARQECQALMNELDALRANKIPDLEQAMAQRDTMIDDLHAELDEA
                     RSAGADTMMQQQLEEQHEMVCALQDALAAERLIVAEKEGEMDRLEGHVDAAESAAADL
                     QRELDVCRASEASAVADAQRMHTQVAQLRRDLDEAHMRQETRESSWRDQVADYGAQIE
                     ELRAALEQQAGETQHLSGLNERLNAKLVELVNDLKAEEDAREQADTTWSQRYDTNEAQ
                     TRRALATKDALIESLEAQLAQLRHEQQQHEQLTERLQETLRTNEANARTRMEEAAARH
                     TREMERLTDDMNDRLNVRQELQEEVTRLRAEARGMADTLQSETRMRLRTQDRLEAAQR
                     ALDEARKQEEMERARRPASPRPSSRNSDHALRTQLSERNALLTAVYDGLVHALQEDAA
                     VSDARLLHTDFRAFHDRLTQRLKRLAHVQAQFAQRSSAMEREHLHQLADVRRNQEARW
                     SQLDRIERSIRAAAEKQAQWRRRVLEKEDELTELHRTNRDLEHQVARLRDAPPPTPTH
                     TTPAMLSVRIRELERRCKEADERVKRERAGAKERAARDEARIRHLQTTLDCLNTLPPR
                     ADSGGRDRVVRP"
     gene            complement(<582711..>583071)
                     /locus_tag="MRET_2709"
                     /db_xref="GeneID:38739475"
     mRNA            complement(join(<582711..582737,582791..582817,
                     582884..582971,583019..>583071))
                     /locus_tag="MRET_2709"
                     /product="ubiquinol-cytochrome c reductase subunit 9"
                     /transcript_id="XM_027629336.1"
                     /db_xref="GeneID:38739475"
     CDS             complement(join(582711..582737,582791..582817,
                     582884..582971,583019..583071))
                     /locus_tag="MRET_2709"
                     /codon_start=1
                     /product="ubiquinol-cytochrome c reductase subunit 9"
                     /protein_id="XP_027485134.1"
                     /db_xref="GeneID:38739475"
                     /translation="MSLATGFYNLFVRRNSIFVGTIFAGAFGFGIAFDTLTEKWWDMN
                     NKGRQWKDIRDKILASSEDE"
     gene            complement(<583164..>583940)
                     /locus_tag="MRET_2710"
                     /note="MRES_13050"
                     /db_xref="GeneID:38739476"
     mRNA            complement(join(<583164..583199,583225..583388,
                     583417..583839,583868..>583940))
                     /locus_tag="MRET_2710"
                     /product="tether containing UBX domain for GLUT4"
                     /transcript_id="XM_027629337.1"
                     /db_xref="GeneID:38739476"
     CDS             complement(join(583164..583199,583225..583388,
                     583417..583839,583868..583940))
                     /locus_tag="MRET_2710"
                     /codon_start=1
                     /product="tether containing UBX domain for GLUT4"
                     /protein_id="XP_027485087.1"
                     /db_xref="GeneID:38739476"
                     /translation="MHPHLDAGTTTPIAVYRPPDRREYATPPPESDDFEPTAAELRAA
                     FSGAIAGRHGPHAPLMTSAMREKYDREHGKSKKQYDFIRIRVRFSDRTQIERTFPHNA
                     TILDVYDAVDHVLWEEHDHGTYVLFQSPPRRNFPRTHTTDTLRSLGFAPAAVLSIQWS
                     NPSKNAAHIPAPIKPEYAAQARDMPAPYQASTNIPSVRPSSSDAPSSDAQEARARRKF
                     PKWFKGTGGALSR"
     gene            <584027..>586891
                     /locus_tag="MRET_2711"
                     /note="MRES_13055"
                     /db_xref="GeneID:38739477"
     mRNA            <584027..>586891
                     /locus_tag="MRET_2711"
                     /product="synaptojanin"
                     /transcript_id="XM_027629338.1"
                     /db_xref="GeneID:38739477"
     CDS             584027..586891
                     /locus_tag="MRET_2711"
                     /codon_start=1
                     /product="synaptojanin"
                     /protein_id="XP_027485086.1"
                     /db_xref="GeneID:38739477"
                     /translation="MHVWLAEAHAQRHTVLVSHFHPRKPSDSSKVVLAFSVADGRCTL
                     TLLEADKIEWSRTRRVASLQGLLGLLPVGQDIFLVGVSSSETVGQILSEQRIYRVSNV
                     SFVCLTRRLQNDAALAQGVPDDAGAPDDPCAAIRKYMTGGSFYFSDGLHDITRRVQSS
                     CCGAPSSDFHAQFLWNAFMLEPIETFRMRLDVHRQRILDQERFFLRVIQGYVGVYQVR
                     ACRLAVVSRLSSLRAGTRFHARGIDDEGNAANFVETETVLVAKDLVYSFTQVRGSVPV
                     YWEQQGVQALNARIQITRSGAASWPGFCKHFDQLLHEYQRVFVLDLLGTRDVETLLAH
                     AYIDHLRELDETRPIKYYNFDFHNVSRAVGGMEGVGAELDRLHNVQTQRQYYRYTLCT
                     QGKMLERQSGVFRVNCFDCLDRTNVVEGLLSHAALRDFFHELRRHAQEPVCAQLAADT
                     SLPAALWQAHRDLWAGNGDALSNISTGTGSLNSNFVRTGTRKGLTGLISDAAKSASRL
                     YVNHFQDQTKQVAIDMLLGNRSGQQHVELYDPRYARVSEMMARRWHEYASVHDVQVWV
                     GTYNACAQSPAGIDLSVWLYQTPEPPDVVAVILEEIVPLNAQQMLQSARDEQAAWQRA
                     LSTTLHRTGIPYEALRNELLFGTALFVYVKSSLLPHIRRVEGTTKKTGFRGMSGNKGA
                     VAVRFELFDTSICMVGSHLSSGSNNKEERNADYHAIARDLVFTRGRTIDSHDHIFWAG
                     DLNYRIALPSAEDVRDLASRRQLEPLLLHDQLTDVRMSNQAFAGYDEMPIRFPPTYKF
                     DVGSDIYDTSEKLRPPAWTDRVLFKCTRPTLHIHPIAYDCAPIRASDHRPVGASLNVG
                     ICTLDTAYRDELYESLVNGMIEQDKKEGESSLARPPPSSDTAQWWNQAHQPPLSPALG
                     DPSVRGNPFEQRDPAPTPTLPTRQAVLSPPPIPPRPGKAP"
     gene            <586910..>588943
                     /locus_tag="MRET_2712"
                     /note="MRES_13060"
                     /db_xref="GeneID:38739478"
     mRNA            <586910..>588943
                     /locus_tag="MRET_2712"
                     /product="NADH dehydrogenase"
                     /transcript_id="XM_027629339.1"
                     /db_xref="GeneID:38739478"
     CDS             586910..588943
                     /locus_tag="MRET_2712"
                     /codon_start=1
                     /product="NADH dehydrogenase"
                     /protein_id="XP_027485085.1"
                     /db_xref="GeneID:38739478"
                     /translation="MDRARRSRTDPSRTSLPLEIMLRFSVRPLARPCTRSTIRMLSTG
                     TPQKASIRGRIWQSRFVRFSVYGVGSIGFTLAALLGGLLVYDSFTYHGLSIQEPIHPS
                     INESVRGGPENRPILLNKEAETGAPRKERLVIVGGGWGAVSLLNRLDPDLFEVTLISP
                     TNYFLFTPLLPAVTVGTVGAGSVTESLRRILQKCQGQFVQGAGRNLYLRDELDSKTRE
                     LTDYAPGLLEVEVISDKWDGSIEKPHEVNKDKIVYVPYDKLVVAVGCVSNDFGAKGLE
                     HAHRLKCMHDATQLRKNILENFEMASLPSVSPEERRRLLSFVICGGGPTGVEVAAEIF
                     DLIHEDISKYYPANLPQESSVHLLQYCSHILNTYSEKISEFAEERFRKEHMDVQTNAH
                     VDEITPTHVKFTVTNPLTNEKEVRTLPTGCTVWSAGIKMSDFTHLLSQMLPSQGHPHA
                     LKVDAQLRVMGAEPGTMYAVGDASTIDRDVMGYVVDNFAKFDKDLDGKLTLSEFAQFI
                     NVLRRKFPIASSNLQNVRKLLNKYDFHGDHQLNSDEVVKLVQDATKDMTSYPPTAQIA
                     SQEGRYLANKLNKYGKLKEQGKLPQMSADALDDAIYKPFKFHSLGNIAYLGNAAAFDL
                     PLPEPFKTFFGGIVAMYAWRSVYLSELVSFRTRALVLGDFIKRELWGRDVSWL"
     gene            <589193..>590797
                     /locus_tag="MRET_2713"
                     /note="MRES_13065"
                     /db_xref="GeneID:38739479"
     mRNA            <589193..>590797
                     /locus_tag="MRET_2713"
                     /product="amino acid transporter"
                     /transcript_id="XM_027629340.1"
                     /db_xref="GeneID:38739479"
     CDS             589193..590797
                     /locus_tag="MRET_2713"
                     /codon_start=1
                     /product="amino acid transporter"
                     /protein_id="XP_027485084.1"
                     /db_xref="GeneID:38739479"
                     /translation="MSCKEEVPEKMEPVPTPAEQDIITDTMIMDPDSGVKRGLKNRHL
                     SMMALAGIIGPGLLVGAGGALSSGGPASLIIGFGVVGIIAYSVMQSLGELTTMFPSGG
                     GFLQLADRFVDRAFGFIVGWNYFIVWAAVLANEYNVITSVLVFWSDKVPQWGYFLIFW
                     FFFMGFQMLGVESFGEAEFWLALVKILGLAAYFIFSIVYVSGGVNHDAVGFRYWHDPG
                     AFGGHGFRGVASVFIFCATFYAGIESVAVAATETRNPRKAVPSAIGQVVWRILFVYLG
                     SAFFFGITCPSNANGLISEDGALQSPMTIAIQYAGWQGGVHLINAFVFVTCLSAVNSS
                     IYIGSRTVLYMAQNQKAFKFLGYTNRRGVPVFAVILINAVGAISMMNVSTGASRAYQY
                     IINLSGVSTFLVWTFIIFMHFRFRRAMQVQGRSLDELPFRALLYPWVAIFGFILSIFL
                     ALVQGWKSFSPFDFGDFADAYILLPVSLVGYIGYKLLFRTKFWRAHEIDLDVGRRQDL
                     DSFSTFGSMDSTQGDDVIQEQKPIHS"
     gene            complement(<590868..>591944)
                     /locus_tag="MRET_2714"
                     /note="MRES_13070"
                     /db_xref="GeneID:38739480"
     mRNA            complement(<590868..>591944)
                     /locus_tag="MRET_2714"
                     /product="oxidoreductase"
                     /transcript_id="XM_027629341.1"
                     /db_xref="GeneID:38739480"
     CDS             complement(590868..591944)
                     /locus_tag="MRET_2714"
                     /codon_start=1
                     /product="oxidoreductase"
                     /protein_id="XP_027485083.1"
                     /db_xref="GeneID:38739480"
                     /translation="MSMNAIITQGISNAAVKQVEVPKLAPRSIKVKVLANALNPTDWK
                     HLDYVGRAGTTVGSDFVGTVVEKAPDAGTSVQVGDRVAGCVHGGWEEGVGAFADYVVT
                     VPEAVVAVPEAMKTEEAAGLGVAGFTALLGMFQDKHLGLPQPTSTDVPPVDPKLKVLV
                     WSGASSVGQFVIQIGRLIGAYVIVTASKKHEAWLKSLGAAEVHDYADAETPKRIAGAH
                     PDIKYAFDTYSMNGSQETIAGILTKEEENRIVSILSVDEARVKQINPKTKATFFILYT
                     VSGKRTEIFGALFEEDYCKEDAEALAKVCSGKDGLFYKLLSSGAVKPNRTSVQSGGFS
                     GMFQGMDAMRQNKVSGEKLVYPHA"
     gene            <592089..>592988
                     /locus_tag="MRET_2715"
                     /note="MRES_13075"
                     /db_xref="GeneID:38739481"
     mRNA            <592089..>592988
                     /locus_tag="MRET_2715"
                     /product="arp2 3 complex 34 kda subunit"
                     /transcript_id="XM_027629342.1"
                     /db_xref="GeneID:38739481"
     CDS             592089..592988
                     /locus_tag="MRET_2715"
                     /codon_start=1
                     /product="arp2 3 complex 34 kda subunit"
                     /protein_id="XP_027485082.1"
                     /db_xref="GeneID:38739481"
                     /translation="MAQAHVLWAFQAQPSTRESRQRRRDLSDVTEAYSSDEDADQPYP
                     AFPENGFGVSRPPTTSTPHDLSALEEQAEDRRWLPSTNVIVRAGSTQHTAELAMRQRA
                     RQEARRAARALHIPWRGQVADDARLLRVLDGVPPLGSTEDADQLSDWEEALETAKQDR
                     LRFGERDIVQIGRRRTLYEEEMSHTDDDIQRPPSGASLVNSPSILPDHTVPPPLVGPV
                     PWESMSADANPLSASWSDTTYPSLNTLRRHDGGLRPPASPPHRWTPQGPPRLAAAAAV
                     LDRLTAHDSMSYEDDTADMDTSL"
     gene            complement(<593006..>593638)
                     /locus_tag="MRET_2716"
                     /note="MRES_13080"
                     /db_xref="GeneID:38739482"
     mRNA            complement(<593006..>593638)
                     /locus_tag="MRET_2716"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629343.1"
                     /db_xref="GeneID:38739482"
     CDS             complement(593006..593638)
                     /locus_tag="MRET_2716"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485081.1"
                     /db_xref="GeneID:38739482"
                     /translation="MHRSFSTSVRIAAKKKPSGRTATTRYQYQYQGHTHTITYEPAEP
                     APPPSMPTTNWDDPVFHAPSRKPIRTMYSVPLGSNAPISELRPPVMTQKQARRSLMRF
                     PTHPTRVGIPPVPGLQVVPPIAIPRGTNIASETQARNAVLLLRDAQIRAGHYEPYQAG
                     ATLATPVAANKPESSAVLTADQALSLNNTMHPTGRRYVMERIGAQLHTKV"
     gene            <593760..>593969
                     /locus_tag="MRET_2717"
                     /note="MRES_13085"
                     /db_xref="GeneID:38739483"
     mRNA            <593760..>593969
                     /locus_tag="MRET_2717"
                     /product="heat shock factor-binding protein 1"
                     /transcript_id="XM_027629344.1"
                     /db_xref="GeneID:38739483"
     CDS             593760..593969
                     /locus_tag="MRET_2717"
                     /codon_start=1
                     /product="heat shock factor-binding protein 1"
                     /protein_id="XP_027485080.1"
                     /db_xref="GeneID:38739483"
                     /translation="MSNSAGESATTQQLGDWVESLLAQVEKRFAEQNQQVVKRMNEMA
                     DRIDALESSILELVHGSEAKPAPAA"
     gene            complement(<593998..>594993)
                     /locus_tag="MRET_2718"
                     /note="MRES_13090"
                     /db_xref="GeneID:38739484"
     mRNA            complement(join(<593998..594231,594256..>594993))
                     /locus_tag="MRET_2718"
                     /product="CORD and CS domain protein"
                     /transcript_id="XM_027629345.1"
                     /db_xref="GeneID:38739484"
     CDS             complement(join(593998..594231,594256..594993))
                     /locus_tag="MRET_2718"
                     /codon_start=1
                     /product="CORD and CS domain protein"
                     /protein_id="XP_027485089.1"
                     /db_xref="GeneID:38739484"
                     /translation="MVLCKRRGCGTEFDATGVSQGPCTYHPGAPVFHEGLKSWSCCKE
                     TNKPVLEFEQFMKLPGCAMAEAHTDEAQPLPTPQKPAVSNEEERLSTTLNAVQLNKPA
                     PIPPPTQGPPPPAPEPRDPDSLVHVPAGTACRRSGCNYVQKEALDTRDKTQETCRYHK
                     GVPIFHEGSKGYTCCKRRVLHFDDFLQIEPCTKAEHGHLFEAPKPADNGRVECRMDHY
                     ETPGDVRVTVYAKGVEQSNSVIEIRENEVVLSLALGATPSIPHTRRFERTLQLYAPVN
                     PSASTCTLGKMKLDLVLAKQTEGESWPTLERGERVFGYGLTFGRRTA"
     gene            <595104..>596066
                     /locus_tag="MRET_2719"
                     /note="MRES_13095"
                     /db_xref="GeneID:38739485"
     mRNA            <595104..>596066
                     /locus_tag="MRET_2719"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629346.1"
                     /db_xref="GeneID:38739485"
     CDS             595104..596066
                     /locus_tag="MRET_2719"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485088.1"
                     /db_xref="GeneID:38739485"
                     /translation="MRSGEAEPPTKRAPSLRRSHLESRRMSDSADADVIHMLLHPPAS
                     APGPFLAPTTEFVLCAPGALETHQSADHEGDERVRAILAFLSDPEKARRCAEARDIET
                     PDFVSANEPSMLGKTRGASGPIDDTSDEAYEQLHAKHERAEKRLRRLEKDALIRDRKR
                     VLERVRHIEQVDIIKLLPAFEAREAQEQGKRTRSELLEHLTHVHASVLADARALLDRY
                     NKLLPDEAQQVSGGRYQRASTRAIDGSPGPPSDRARADPPRMAPSLADLARRHDTPSA
                     RRPCPVSTRHSERLAFGERVPDCATRPDLFDDKIAAWLQQGEGP"
     gene            <596132..>597211
                     /locus_tag="MRET_2720"
                     /note="MRES_13100"
                     /db_xref="GeneID:38739486"
     mRNA            <596132..>597211
                     /locus_tag="MRET_2720"
                     /product="COMPASS component SWD2"
                     /transcript_id="XM_027629347.1"
                     /db_xref="GeneID:38739486"
     CDS             596132..597211
                     /locus_tag="MRET_2720"
                     /codon_start=1
                     /product="COMPASS component SWD2"
                     /protein_id="XP_027485020.1"
                     /db_xref="GeneID:38739486"
                     /translation="MDDEASASRPPLALSLELVSSFKPAKVFKDFVQPDCRVTSLDYD
                     DRGELCVTASDDETIQLYNCRSGKHIKTLYSKKYGVHLARFTHRSSAIVYASTKEDDT
                     VRYHSLHDNKYLQYFRGHKRRVTSLAMSPVDDTFLSAAVDDSVRLWDLRTPAAQGNMR
                     IQGHPIVAYDPSGLVFGIALNERSSILLYDIRKFDQNPFITITIDDTAALSQIMMPPR
                     IPVLTHLSFSHTGQYILAGTSGDVHYIADTYTGKVVYRLTGHIGLERADGASVGLVPK
                     AGISGQEMCWTPDGRMVIAGSAAGQVHVWALPEHPPATLPATLHSTTTLQGQEGTPSV
                     VAFNPRCAHMCTAGAQVAFWLPDLP"
     gene            <597231..>598103
                     /locus_tag="MRET_2721"
                     /db_xref="GeneID:38739487"
     mRNA            <597231..>598103
                     /locus_tag="MRET_2721"
                     /product="enoyl-CoA hydratase/isomerase family"
                     /transcript_id="XM_027629348.1"
                     /db_xref="GeneID:38739487"
     CDS             597231..598103
                     /locus_tag="MRET_2721"
                     /codon_start=1
                     /product="enoyl-CoA hydratase/isomerase family"
                     /protein_id="XP_027485021.1"
                     /db_xref="GeneID:38739487"
                     /translation="MSLFRAATQARCLVRAARWTRVGAAAYSTGASETKVYHSKDGTP
                     LVGSEFLRDKRIWILHLLAKETPDNRLTHTFIQSGLLPALRDVRQQWNAWVKAKDTAE
                     GAALVTAPPTDSKFFSNGLDLLKAVQDPHFFNDYLNAMFYELLTFPIPTVASMGGHAF
                     AAGFTLALAHDYRVMNSERGYACMNEIEFGAPIPKGMLGVIRSVAVSPLVQRKIALEA
                     HRFQATEALQHGLVDATAQGTQATLDMALALAEKLRSRSAKNAWQSIRESLKEEALAA
                     QFERPRALHTFSME"
     gene            <598183..>598962
                     /locus_tag="MRET_2722"
                     /db_xref="GeneID:38739488"
     mRNA            <598183..>598962
                     /locus_tag="MRET_2722"
                     /product="enoyl-CoA hydratase/isomerase family"
                     /transcript_id="XM_027629349.1"
                     /db_xref="GeneID:38739488"
     CDS             598183..598962
                     /locus_tag="MRET_2722"
                     /codon_start=1
                     /product="enoyl-CoA hydratase/isomerase family"
                     /protein_id="XP_027485018.1"
                     /db_xref="GeneID:38739488"
                     /translation="MSSQVKVYRAREDDVPLVRSEYLTDRGIWVLTMCGEQTPDNRLT
                     HTFLREGIIPALRDVRAEWHSRVEQDEINGGAALVTTAELSNKIFSNGLDLFNAIADP
                     HFFNEYLNAMFYELLTFPIPTVAAITGHAFAGGCTLALAHDYRVMNAQRGYLCMNEIE
                     FGAHIPSGMLGTIKSVVKSFQTMRKLVLEGHRFTSQEALEHGLVDAVADSPEAVLQTA
                     MGMAEKLRSRSASNGWQVNKELLHRESLAMQFEPPRVASKL"
     gene            complement(<598981..>599913)
                     /locus_tag="MRET_2723"
                     /db_xref="GeneID:38739489"
     mRNA            complement(<598981..>599913)
                     /locus_tag="MRET_2723"
                     /product="leucine-rich repeat protein"
                     /transcript_id="XM_027629350.1"
                     /db_xref="GeneID:38739489"
     CDS             complement(598981..599913)
                     /locus_tag="MRET_2723"
                     /codon_start=1
                     /product="leucine-rich repeat protein"
                     /protein_id="XP_027485019.1"
                     /db_xref="GeneID:38739489"
                     /translation="MTAFKVRLRVPSAQNAQASSGPKEASPSSSASQPDAEAAAESPA
                     DVSLQGEAASEDELADDSMAAEGSPDTSLNTTEPSKSKKAKSHRRLPPAPGSISAVAA
                     TLSLEELDALPSAKRRKGLKTRGAPGPGRGWRKGLSKGQKPVYRLPGSGMSTADLPQN
                     LAVQATTPPTIGKMAAAMTSETSSAQKRKHSSSTKTDSPAPSTSTIRVAQNAPDAVFK
                     YPSIPSSKDTPDILPLARIPNYIPTIQPLARSFASNKPRPWRQATREILSIGGRPWRA
                     PVWLSEASDEPAAPQEAPASEESTPAPATASSPA"
     gene            complement(<599987..>601684)
                     /locus_tag="MRET_2724"
                     /note="MRES_13105"
                     /db_xref="GeneID:38739490"
     mRNA            complement(<599987..>601684)
                     /locus_tag="MRET_2724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629351.1"
                     /db_xref="GeneID:38739490"
     CDS             complement(599987..601684)
                     /locus_tag="MRET_2724"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485024.1"
                     /db_xref="GeneID:38739490"
                     /translation="MRAYHAAQSCSGTLLTAVVAPTLHVHTPHRAMTSRALWTAAWRA
                     PVRGVFLLRGMALVQSAVRKLHRSVSDSMPPSSSPNCSLHTPSRRDELPCLVLDAALR
                     AQTPPADLLYLCHITTDIPCGLPRAVLQRQRAALFRVFCAQLSAGRFKDAAYMLRDAR
                     LRPSQPKHMLRMLLRRLGQHVSTLSTDPGQSAHAALRETLRSFEYDCARRGHLDTQVF
                     LRVLEHLLSRHMHTDMAHWAQSTAMMVSHPDPPFYAALAALVHRMTSTHRAPIQAAAF
                     IEALPPAWRTHAMYHDVLVHDREVYLAGQESMAWRKRLWHDLRTIPHLRLPSAQGVLA
                     QLSAHAHCVHKYRVWSDWLALEHQEDASPEMRARAVWLVTRTFVRAGHTRLAVRFAER
                     HASSAPAHGTPLLNTLLTGILEDMRKCRSVHDRTCVLRHMYECVWQAARRCQTNTMPT
                     LPILPELVSLAPSRAAQRVLWLLARVERLISTHVLCPNVQTLQLLIRAATKWDASMDS
                     QALWDMAALAPPRSPHTHRMRYSFFSELASALQRRADSRSARRARALLRHHRRRVKP"
     gene            <602011..>602949
                     /locus_tag="MRET_2725"
                     /note="MRES_13110"
                     /db_xref="GeneID:38739491"
     mRNA            <602011..>602949
                     /locus_tag="MRET_2725"
                     /product="large subunit ribosomal protein LP0"
                     /transcript_id="XM_027629352.1"
                     /db_xref="GeneID:38739491"
     CDS             602011..602949
                     /locus_tag="MRET_2725"
                     /codon_start=1
                     /product="large subunit ribosomal protein LP0"
                     /protein_id="XP_027485022.1"
                     /db_xref="GeneID:38739491"
                     /translation="MGVGRASKENWFARLNELIDSYSSIFVVNIDNVSSQQMHQIRQS
                     LRGEATVLMGKNTMVRRALRQVISERPEFERLVPYVRGNVGFVFTSGDLKEVRDKVIS
                     NRVAAPARAGAFAPVDIYVPAGNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVRVVE
                     SGNRVGQSESALLNLLNISPFTYGMTVVQIFDNGQVFASDVLDVSEEELVGRFTQGIQ
                     QVASISLALNYPTIASVMHSLVNSYKNLLAVSLATEYEFEGSAKLKEMLANPEAFAAA
                     AAPAAAEEAAAPAEEAKEEAKEEEEEDEDMGFGLFE"
     gene            complement(<603046..>603537)
                     /locus_tag="MRET_2726"
                     /db_xref="GeneID:38739492"
     mRNA            complement(<603046..>603537)
                     /locus_tag="MRET_2726"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629353.1"
                     /db_xref="GeneID:38739492"
     CDS             complement(603046..603537)
                     /locus_tag="MRET_2726"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484895.1"
                     /db_xref="GeneID:38739492"
                     /translation="MWASMRTVWICSLFCAYVLAAATNSMAPITKPTTSNNGQSACVQ
                     YGDCTKGANPAKTESYSSAIRPPPSHSVPYLSNAQDSSSYKASVAAAGASAAYDPKNN
                     RGSSTAVPPPTTVRFDTSVLSSGSVRVTKSHMDGSSATAWGPAGSALATLATLVFIAA
                     TAL"
     gene            <603809..>605467
                     /locus_tag="MRET_2727"
                     /note="MRES_13115"
                     /db_xref="GeneID:38739493"
     mRNA            <603809..>605467
                     /locus_tag="MRET_2727"
                     /product="glutamate decarboxylase"
                     /transcript_id="XM_027629354.1"
                     /db_xref="GeneID:38739493"
     CDS             603809..605467
                     /locus_tag="MRET_2727"
                     /codon_start=1
                     /product="glutamate decarboxylase"
                     /protein_id="XP_027485023.1"
                     /db_xref="GeneID:38739493"
                     /translation="MVLSMSVDPEEYVQRAQVQESNAALHKARSHKNNGVMSHYTLAG
                     RYGTKPIPKYHLPEKGLSERSTYHLLSNELLLDGKPGLNLASYVQTWMPEEATKLMVE
                     TIGINLCDQDEYPATISIHTRCISILSNLWKAPKTCIKDDGRRLAAMGTATTGSSEAI
                     MLGLLCAKRRWQQKRKAEGKDIHNPGPNLVFGANVQVCVEKFARYWEVEERPVPVDES
                     TNYCLDPKRAMDYIDENTIAVVVILGSTYTGHYEPVEEMAHELDELQQRTGLDIPIHV
                     DGASGAMVAPFATPDHKWSFDIPRVASINTSGHKFGLVYPGIGWIIFRSPELVPSDLV
                     FELHYLGSVEYSFGLNFSRPAAPMLGQMFNFISLGREGFTASMEACLMNARLLSRALE
                     YSGLFCVLSDIHRPAKKSVRVTTEASKYCPGLPVVSFRWTDEVRQEYPEMEQGWVQTL
                     LRAKGWIVPNYELPPNLEKVQILRVVVRENVTESLIEVLVQDLISITRHLMEQQRVAR
                     TVCKDTASATDMTNMLLTGHYEHGKNHGRPDGHGQPPKGYKSQC"
     gene            complement(<605476..>606459)
                     /locus_tag="MRET_2728"
                     /note="MRES_13120"
                     /db_xref="GeneID:38739494"
     mRNA            complement(join(<605476..605502,605530..>606459))
                     /locus_tag="MRET_2728"
                     /product="DNA-(apurinic or apyrimidinic site) lyase"
                     /transcript_id="XM_027629355.1"
                     /db_xref="GeneID:38739494"
     CDS             complement(join(605476..605502,605530..606459))
                     /locus_tag="MRET_2728"
                     /codon_start=1
                     /product="DNA-(apurinic or apyrimidinic site) lyase"
                     /protein_id="XP_027485057.1"
                     /db_xref="GeneID:38739494"
                     /translation="MTKRAASAAADDAKRVRVDAPVSPAAPSGRDHVAPACLPRNTQL
                     PSGPLSIDACAPGCTRIAIWNITSLKSSDNKGLMRYLHAENADVVVLSETKVNQVPSH
                     AGLDAMYKYRYWGIGEKKGYAGIAVLSKRKPVHVDYGLPGFDDPSSQARMLTVEFPHT
                     VLVGTYAVNAGDGLKTLPNKNRWNDALEQHLLSLQSKNKDVIWCGDLNVVWDDRDLAG
                     ASKKWNKAAGYTQAECDAHRRVLASTHMCDAWRERHPDAVGHYTYYGWRGQCRSRGSG
                     WRIDTFIVPQQSLDRVKRCEIRHEIYGASDHLPVVMDWDGEL"
     gene            <606588..>608624
                     /locus_tag="MRET_2729"
                     /note="MRES_13125"
                     /db_xref="GeneID:38739495"
     mRNA            <606588..>608624
                     /locus_tag="MRET_2729"
                     /product="chromosome transmission fidelity protein 18"
                     /transcript_id="XM_027629356.1"
                     /db_xref="GeneID:38739495"
     CDS             606588..608624
                     /locus_tag="MRET_2729"
                     /codon_start=1
                     /product="chromosome transmission fidelity protein 18"
                     /protein_id="XP_027485058.1"
                     /db_xref="GeneID:38739495"
                     /translation="MSEAHFGRAEARGPSVPAYIPAAPFAATRLDGTSVLIPRRRRIQ
                     AWRPSTTSASYAPALSEPLDVLMPRVRARPSEVAREPRRRWAADSRMWVDKYRPRAFT
                     DLLGDDRLHRDVLRWVKAWDPCVFGRDAPRARRVDERVPDKFGRPHERVLLLSGPPGL
                     GKTTLAHVVAQHAGYRVYELNASDARTAADVESRVRTALESDSLRGHGRPTLVVIDEI
                     DGATGGSDALGTSGFVRALVRLLERGAGAPRGKKSQPILRPIVCICNDLYAPALRPLR
                     PMSQIVRCYRPPTPLITRRLREICAREHLSADTRGLTMLCDVSHGDLRACLHALELLH
                     RDGRPVSVSTIQDASVGIKDSVVPLQRLWTQLFCAMDPTHVSWHGSHIHALVHELTAF
                     GDYDRLTHGCFEHYIHLRVPDQGWQRYADALDWLHFSQRMMHGTSFELLPYVPWTWVA
                     WHHLFANIANPVPEQPPRHDYERHMQLRATLETTEALRRCLPAHLAPFYAQDTIACEL
                     GPALARILSPDIKVHATPYASALPDLVDTLLLYGMSFEADRNEHGALVHRLHPCIDVF
                     AQYAAHSQADVGPSRHGARQHVQRELEAEQRRRRRRTLPETATQKEAPSSPHAASATA
                     PTYRDFFGRVMPTPAVPSQADAAPAGPSGLQVFYRFHEGYSNAVRKPIKLASLL"
     gene            complement(<608636..>611548)
                     /locus_tag="MRET_2730"
                     /note="MRES_13130"
                     /db_xref="GeneID:38739496"
     mRNA            complement(<608636..>611548)
                     /locus_tag="MRET_2730"
                     /product="U5 small nuclear ribonucleoprotein component"
                     /transcript_id="XM_027629357.1"
                     /db_xref="GeneID:38739496"
     CDS             complement(608636..611548)
                     /locus_tag="MRET_2730"
                     /codon_start=1
                     /product="U5 small nuclear ribonucleoprotein component"
                     /protein_id="XP_027485026.1"
                     /db_xref="GeneID:38739496"
                     /translation="MDDYDEFGNYIGPLSESEDEQEALGVEHAEPPPEPPAEDASGAQ
                     EEGAVIMHVDEPASQAVVLHEDKVYYPSASEVYGDDVETLVQEEDAQPLTQPIVEPER
                     VRSFAVEEQGLPEVRFDRQFMLNMMHFPDMIRHVAVVGHLAHGKTALVDMLVEETHRV
                     QVDAEKPLRYTDTHVLEQERGLSIRAMPMSFVLPTTRGKSYLVHVLDTPGHTNFQDEV
                     AASLRLADGVVLVVDVVEGVMCNTETIIRYCVREGLPIVLVLNKIDRLVLELRLPPTD
                     AFFKIQLTLEEVNRVVGEASGGDPERRLSPERGNVAFASTQAGYCFTLRSFAQMYAER
                     APIDVDAFAQRLWGHIYFDRASRTFTRRAPHPDAPRSFVQFVLEPLYKLYTLVLSADV
                     DVLRRTLASLRIQLPAAAFKMDVRPLLKLVLNAFLGSSTGLVDMCVEHLPSAAEASKA
                     ATTTAPPDSVLARAIERCDAQGPLLIQIAKVYPTSDATEFRAFGRVLSGTVSCGQSVK
                     VLGPTYTPEDEEDMAVETVSGVYVAEARYAVHAPGVPAGNWVLLSGIDATIAKSATVC
                     DTALPVADTYVLRPIVHMTESVLKVAIEPLRPAELPKMLDGLRKVNKCYPLVSTRVEE
                     SGEHTLLGTGELYLDCVMHDLRELYAEMEIKISDPVVKFCETVVETSAVQCFADTPNK
                     HNRLTLIAEPLEDGIAEDLERGLIDIHLPPRALARIFQERYGWDALAARSVWAFGPDD
                     HGPNVLVDDTLPDDVDKVQLYTVREYIKQGFQWATREGPLCDEPMRGVKIRLCHARIA
                     TEPIHRGGGQLIPTARRATYAAFLLATPRLMEPVYAAEIQTPPECVGTIYTLLARRRG
                     HVTSDAPKAGTPLSTMHALLPVIDANGFETDLRVATQGQAFVLQMFHHWAVVPGDPSD
                     TTIPLRPLEPAPPLGLARDFVLKMRRRKGLGDTVAVSTYLEHEMAVALAQAGMDIA"
     gene            <611721..>613562
                     /locus_tag="MRET_2731"
                     /note="MRES_13135"
                     /db_xref="GeneID:38739497"
     mRNA            <611721..>613562
                     /locus_tag="MRET_2731"
                     /product="solute carrier family 45, member 1/2/4"
                     /transcript_id="XM_027629358.1"
                     /db_xref="GeneID:38739497"
     CDS             611721..613562
                     /locus_tag="MRET_2731"
                     /codon_start=1
                     /product="solute carrier family 45, member 1/2/4"
                     /protein_id="XP_027485025.1"
                     /db_xref="GeneID:38739497"
                     /translation="MATDASGPPWVQAVRGRCHRWLHFTTLSLSLLGSQVVWSLELAY
                     GTPYLLSLGLSKSATGYVWMAGPLSGLIMQPVLGSLSDSSMSPFRRRKYMIGSSAVVA
                     LSTCLIAFSEPLSLLVLDAIGIGLGDWDPARRKHARYVMQVLSILGFWIFDFGVNGLQ
                     VTSRALILDHVGVAEQNEANAWHGRMLHAGNMIGYWCGWVDLASWPSLAWIGGGQFRR
                     FAVVSIACMCVCVAITCVFTPEHCTRMGAKQPSEGMVKRLHASIRQVWSVGRALPLSI
                     QRVCLVELLASMSWFPFLFYSTTYVLDMSHKKHKHHSDADRQIGSLAMLCFAILAMIS
                     GLILPSISLAGRTNASSVAEPEPWRTRSLSLRTIWTLGALFQAILMVGTFFVRKQAHA
                     IVLVMLMGIPWSVWMWVPYAMIGEFVREAEKSTAFSLYDEQWPAQRIMEHQKRASLQE
                     SEQHAYPRRWPSTFDSSLRSSSIRSVSGTHGPSIVSRGPEVVRPDDGNMLEDSTNGGT
                     VLGIHNLSIVLPQLLMALIAALVFRWTKGGNGDVAWVLRLSGFVALGAACLTRFVPLT
                     LTERKARHAGYTLLPDDDEAGAADAEDRMDDSTNESLDADPNDESME"
     gene            <613646..>614263
                     /locus_tag="MRET_2732"
                     /note="MRES_13140"
                     /db_xref="GeneID:38739498"
     mRNA            <613646..>614263
                     /locus_tag="MRET_2732"
                     /product="GTP-binding protein"
                     /transcript_id="XM_027629359.1"
                     /db_xref="GeneID:38739498"
     CDS             613646..614263
                     /locus_tag="MRET_2732"
                     /codon_start=1
                     /product="GTP-binding protein"
                     /protein_id="XP_027485028.1"
                     /db_xref="GeneID:38739498"
                     /translation="MAPVDACAGSVNKKLVVVGDGGCGKTCLLIVYSQNRFPEEYVPT
                     VFENYVPIVDYRGQKVEFALWDTAGQEEYDRLRPLSYPETDVILICFAIDYPTSLMNV
                     KDKWLPEILHFCEGVPYLLVGLKSDLRMDAHSLSLLTAQGVQPVSQEQGERFAQEIGA
                     RRYVECSAKANDGVREVFQAALEEAFGAKKWKRGLLSRHKKCTVL"
     gene            complement(<614303..>615031)
                     /locus_tag="MRET_2733"
                     /note="MRES_13145"
                     /db_xref="GeneID:38739499"
     mRNA            complement(<614303..>615031)
                     /locus_tag="MRET_2733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629360.1"
                     /db_xref="GeneID:38739499"
     CDS             complement(614303..615031)
                     /locus_tag="MRET_2733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485027.1"
                     /db_xref="GeneID:38739499"
                     /translation="MSRPRLGSNRYGTPSMCSDTPPSVSLSPDLDHCGTSVTEEMSLC
                     TPSPLIPAEVSPEFRWDMLVQELNDAYTTSEVKKEPMPFVPMSTLSSCISVPSSPAWL
                     LSTDPPSKLIDHTQSKRSLADAVTCPPKRMRSEIPNLLPMEPRPMAENLPRRDAVRAW
                     LLERRALLQKVQDDVCRDMAGLRRNQAYHAELRDKVGARIRELKEHRTEAEVWPIDDD
                     GIWSTSSAPMSSVADLLEKNILCL"
     gene            <615208..>617580
                     /locus_tag="MRET_2734"
                     /note="MRES_13150"
                     /db_xref="GeneID:38739500"
     mRNA            <615208..>617580
                     /locus_tag="MRET_2734"
                     /product="bloom syndrome protein"
                     /transcript_id="XM_027629361.1"
                     /db_xref="GeneID:38739500"
     CDS             615208..617580
                     /locus_tag="MRET_2734"
                     /codon_start=1
                     /product="bloom syndrome protein"
                     /protein_id="XP_027485030.1"
                     /db_xref="GeneID:38739500"
                     /translation="MSRFRFVDTDAIPLSPSNAFRPPSSSPASSCSTKRVSQKQEDKE
                     NTPLEQPTKRPRVAKPCTPVTSSPVTSSHIPSPQWTSMSTEDLQKRLAHLKEVRMHSM
                     EKRASIVCGDGIFDESSDYLKIEEQLCASRICAIEAELASRSSPSMPSSLSVPSDAIE
                     VLDDDEFDMTIPDKDLLEMEIPATPSIPSTPHPWDDQVRHSLRHIFRLTDFRPDQLEA
                     INATLSGRDVFCLMPTGGGKSLCYQLPATITKGHTDGLTVVISPLLALIHNQVKALLD
                     KNIPTIAINGDMPEADRQYARSELCRRDMNVRLLYVTPEFVSKSRLAHTIFQHLYSKQ
                     RLARFVIDEAHCVDQWGHDFRPDYVRLDMLRKEYPDVPIMALTATARIDTVQDIQRRL
                     GMRNALMLRQSFNRPNLTYRVCPKKRGGGTLDRIAAMIQEDHPNDCGIIYCLSRRDCE
                     NIASDLETKYGIRARHFHAGLNTQDKLRIQEGWEAGTFKVIVATIAFGMGIDKADVRF
                     VIHHSMPKSLEGYYQETGRAGRDGKLSECTLFWSMEDSRKLESMINDAPDIPVEQKRL
                     QCKTLYQVRQFCQSLTECRRTNILKYFGEHFDPKLCRGSCDNCQRTPAHLVDMTTMAK
                     HLVSMVKLLSEQSTSSHYTRSYLMAVFRGSMKKDIKDNGHHHNLYHGRGAQYSDDEVM
                     RLMDHLLTERVLTEFGKRVGFQRFPNYYIKLGPRASALLQGHLSIELDMPSKSGAAPA
                     PRRARRSNASNSSDDLDLTHISLSPHKARPSDTRPPIQIAAMPMLGPAHT"
     gene            complement(<617603..>619175)
                     /locus_tag="MRET_2735"
                     /note="MRES_13155"
                     /db_xref="GeneID:38739501"
     mRNA            complement(join(<617603..619044,619091..619110,
                     619159..>619175))
                     /locus_tag="MRET_2735"
                     /product="6-phosphogluconate dehydrogenase"
                     /transcript_id="XM_027629362.1"
                     /db_xref="GeneID:38739501"
     CDS             complement(join(617603..619044,619091..619110,
                     619159..619175))
                     /locus_tag="MRET_2735"
                     /codon_start=1
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="XP_027485029.1"
                     /db_xref="GeneID:38739501"
                     /translation="MSKEAVADIGLIGLAVMGQNLILNMNDKGFTVAAYNRTTSKVDD
                     FLANEAKGTKVVGAHSVEEFVSLLKRPRKIILLVKAGAAVDAFIEQLLPHLEKGDIII
                     DGGNSHFPDTERRCKEIEAKGLLYVGSGVSGGEEGARHGPSLMPGGSEDAWTSLKDIF
                     QKTAAQSDGEPCCDWVGGGGAGHYVKMVHNGIEYGDMQLICEAYWILKQGLGLHEKEI
                     AEIFKKWNKGVLDSFLIEITSDILAYNDEDGEPIVTKVLDSAGQKGTGKWTAINALDL
                     GQPVTLIGEAVFARCLSSLKAERQRASKILSGTKPRAFEGNKAQFIDDLEQALYASKI
                     VSYAQGFMLMREAAKTYNWKLNNPSIALMWRGGCIIRSVFLKDITNAFRKNPDLENLL
                     FDDFFANAISKAEDGWRRIIAQAVLWGVSTPAFSSAIAFYDGMRSETLPASLLQAQRD
                     YFGAHTFHVMPGKENDRLKAGEDIHINWTGRGGNVSASTYQA"
     gene            complement(<619313..>620290)
                     /locus_tag="MRET_2736"
                     /note="MRES_13160"
                     /db_xref="GeneID:38739502"
     mRNA            complement(<619313..>620290)
                     /locus_tag="MRET_2736"
                     /product="small glutamine-rich tetratricopeptide repeat
                     protein alpha"
                     /transcript_id="XM_027629363.1"
                     /db_xref="GeneID:38739502"
     CDS             complement(619313..620290)
                     /locus_tag="MRET_2736"
                     /codon_start=1
                     /product="small glutamine-rich tetratricopeptide repeat
                     protein alpha"
                     /protein_id="XP_027484812.1"
                     /db_xref="GeneID:38739502"
                     /translation="MSVSDASKPLAFAIASWLSTQNDEKLKQAAELVSSACSFDPKSA
                     SDKEKYAKNSPGLQAIFDVFLKTQQRMNSGNAAASSETESEKKPSEEDMNKAEALKNE
                     GNKYMSAKDYGAALDSYTKAIEIYSCSPVFYSNRAAAFSQIGQHDEAIADAQKAAEID
                     PNFGKAYSRLGHALFASGRFEEAVQAYEKGVEVDPSNKLMKSGLDASKAKLGETGSKD
                     HALSTTETPSNTSSNAADPFAGLGSGGAGGMPDISSLMNNPMVSQMAQQMMQNGGLEQ
                     LMNNPMLRQMAENFGSNGQMPDISSLMNNPQLRQMAQQFMGGMGGAPRR"
     gene            <620451..>623933
                     /locus_tag="MRET_2737"
                     /note="MRES_13165"
                     /db_xref="GeneID:38739503"
     mRNA            <620451..>623933
                     /locus_tag="MRET_2737"
                     /product="sterol-sensing domain of SREBP
                     cleavage-activation protein"
                     /transcript_id="XM_027629364.1"
                     /db_xref="GeneID:38739503"
     CDS             620451..623933
                     /locus_tag="MRET_2737"
                     /codon_start=1
                     /product="sterol-sensing domain of SREBP
                     cleavage-activation protein"
                     /protein_id="XP_027484811.1"
                     /db_xref="GeneID:38739503"
                     /translation="MFRRAKPGRRRASLQLNEWTLRDGRADRGRESSNLRASWHASLW
                     RPWRRKLTRAYGRAGVAFSEWFAWHGNWISHHQRRTVLLCNLVIASLFYPAVVLYLLT
                     TSEDPASTLHAPVCVMRDHIYAGDQPACVTGAQSPTNIWDVVKGSLQDLTGYVRSQAL
                     SDHYPVHDLRLVWDETPTLEVVNKNGHEAPVIHVAQVLMSSDKIRQGAGSPYGVLSPS
                     FLMTALALEKELDAKLLSDAPNKPSCVRRNETDTCLVLSPLEYWHRNAAAIKADPHPA
                     KSYTGSPIRAIVTPPVAPAAAHSPLPLLYSTTLAGRWPFLPLFSRAEYLVLTYFLHDS
                     HMDAWPGMVREAMERVAPATVSMPRDIAAGTTTLEFKPQSLTARPTINYKIVVVGYLL
                     LLLYIFRGLVQMRRLHSRFGMAFTGSVQLIIDLIMSLSLCALLGIRLTAVPWPILPFI
                     IVVVGSETMLFVIHVVTNTPLSLTVNSRIAYGLSQVAGPITFSTATDVLLLGVIGYVV
                     RNEAVTQFVLFTMCALVADYFMQMTFFITVLSIDIQRLELAEVLMQGTRAPGAAATPH
                     ADMPRRLRMDHPRSGTARLVHMLYRLWCMRSPRLVHALAIVLAAGTALVMYAPQVVSS
                     EAWLRVLYHRAHVPPDAELDQSPYGAFWRALNPDGALSVRVVLEPWILATTTTATGGL
                     PDAPGPWLEGLFYDRRGTTIFLFFLFVVGPIALTMVVLSFILHYLLQHSDKLESSHQD
                     GENIELRRLLDTHTSMPPDTMSMHLSVHADELHTAPILVTAASGTMFVSADTHNALRL
                     DNQGASVLWPLAMLRTKHEAVADASHIVALAVKAGCVAIGQYSGRISVWHVDAPQRLV
                     DMTSTAQAPIQHLAFHADMLLSLHRDGSVRGWLPDGESRVLVEAPESGGSWTCATVRA
                     TESGLFLGAASSRGHLAVYRIADDASLVCLVENASHVPLRCAALLPSSTTEQPAPEPM
                     AQMTPPRKPTAWQRSSAVPSHMLVAGDQDGVLHAWQVSECVSDMVVDVPLRDGAIRDV
                     RAAEGMLWVQTTNRVWLVEPSLRVRDSIANPRGCVDITPDGWLLGLCRAYASEARWEI
                     WRAQLLNSAVERISVDIESLIRAAVRDSVEQGLHPPSRLPLLTARVDRMVRRGSEWMI
                     PFGSTILSLKAEHM"
     gene            complement(<623956..>625944)
                     /locus_tag="MRET_2738"
                     /note="MRES_13170"
                     /db_xref="GeneID:38739504"
     mRNA            complement(<623956..>625944)
                     /locus_tag="MRET_2738"
                     /product="cohesin complex subunit SCC1"
                     /transcript_id="XM_027629365.1"
                     /db_xref="GeneID:38739504"
     CDS             complement(623956..625944)
                     /locus_tag="MRET_2738"
                     /codon_start=1
                     /product="cohesin complex subunit SCC1"
                     /protein_id="XP_027484814.1"
                     /db_xref="GeneID:38739504"
                     /translation="MIPNDAFLHNQGPLARVWLAAHWERKLSKTQFLQTSIPSNVDMI
                     VDEDEGQIALRLSGQLLLGFARIYSRKAKYLQDDCSDMLLRIKVAFRGSAVIDLSQEQ
                     LHVSRAAITLPDMFSPMDLLMPEPTLSDWGIGSRPRHMARHADITLPDTHYEMQDEED
                     EHIPLGPDGSILGMSVQGFDLGLVDESTPSRAVPPPKRARRETQRRSDVTRHTLPDLD
                     DSFESVGVARRAPSTEAAAMSEHVQALVGDVNLSADLSLEPLAPMDMSGAADVTTDTV
                     GFDVPDVPMAGTPPPVPSVYAAPRAPSTPSRHLTLDDVAHAELNPHTMARLRTAAQQQ
                     AASSAKAPRKRPIQDDVTEIFPARARSLQARAASVARTMNKESHEQHCLPASRVQLAA
                     MADQARGAKTAVPRGLDMAWGAAVEGLDANMTWDARRAWLATQAFARESEMQLWLHAI
                     HEQAQALNMDEEAFPMEVGRRAPDAPPAWPDVMDMDVSDVSKPAEGFDVSDVSHVPLD
                     DMPLPDVPNMEEEPAEPPAPRRSSRRQHTREDEEDRGRLAPLSRMSTPEYDGNDEVQV
                     DVPASNPLVAFDSRAPDTSVHGDTIRTKRAAHVLRTQMGESDTVSFRALSANATRRAA
                     AGFFFEMLVLGTRDCVQLKQDTPYGDIGVRAKPALQGI"
     gene            complement(<626107..>627828)
                     /locus_tag="MRET_2739"
                     /db_xref="GeneID:38739505"
     mRNA            complement(<626107..>627828)
                     /locus_tag="MRET_2739"
                     /product="solute carrier family 38 (sodium-coupled neutral
                     amino acid transporter), member 11"
                     /transcript_id="XM_027629366.1"
                     /db_xref="GeneID:38739505"
     CDS             complement(626107..627828)
                     /locus_tag="MRET_2739"
                     /codon_start=1
                     /product="solute carrier family 38 (sodium-coupled neutral
                     amino acid transporter), member 11"
                     /protein_id="XP_027484813.1"
                     /db_xref="GeneID:38739505"
                     /translation="MSQEDSEHGHNRDGEPLSTPPDGRRFAPPMRSLSASKEARFDID
                     SDDLDDSLAMPDPRFVPSISNGFPSSLNRSTPEGATQRTSFDLIGHGVRQLSQSLPPS
                     WDAEQLPDWLKRGAGVFEGTVNMANSILGAGIVGLPYSMRESGFVAGLALLVGIALLT
                     DWTIRLIVLNAKLSGRGTYIEIMGHCFGQRGRIAVSIFQFVFAFGGMCAFCVVVGDTI
                     PNVLSSVLPFLRGTIFSSRRFVIFVCTMAISYPLSLHRNIEKLSKASAVALLSMVFII
                     LAVIVRGPAMPPELKGDPSLRLSIVHPSNLIRSVSVISFAFVCHHNSLLIYGSLKEPS
                     MDKFRMVTHYSTFISTIAAVSMSIAGYWFFEDKTLSNILNNFPNTDVIVNIARFCFGL
                     NMFTTLPLECFVCREVLETYFFHGQYEYRRHLILTTSLVVSAMAISLLTCDLGIVLEI
                     TGGLSATALAFFFPSVCYLKLSHDAKQIERSALYFSVPSQEHQHDAAEDGHEPVMAEN
                     ISLPLRPGANAAMRQPQQEFKWWESTQLLSVCCAIFGALVLIVSVSTTLGDTWSGRKG
                     AVQQCHW"
     gene            <628117..>631170
                     /locus_tag="MRET_2740"
                     /note="MRES_13175"
                     /db_xref="GeneID:38739506"
     mRNA            <628117..>631170
                     /locus_tag="MRET_2740"
                     /product="GTPase-activating protein"
                     /transcript_id="XM_027629367.1"
                     /db_xref="GeneID:38739506"
     CDS             628117..631170
                     /locus_tag="MRET_2740"
                     /codon_start=1
                     /product="GTPase-activating protein"
                     /protein_id="XP_027484873.1"
                     /db_xref="GeneID:38739506"
                     /translation="MDHRAVPGRMADMPPGAQGANPYVRPAMQRHTSGLRLVSEDRER
                     IVRKDQMCVKCGTAITGQFVRALSGVYHLDCFTCADCGRNVASKFFSATPDMVLAAGG
                     GDQFPLCETDYFRRLDLLCARCGHALRGSYITALGSKYHVDHFTCSMCSTPFGPEDSY
                     YEHEGQVYCHFHYSTLFAIQCSGCQTAILKQFVEINRNNADEHWHPECYMIHRYWKIK
                     LAPSAPSHADAVQDVSLSMPGALALTPSSSEEQLAASNVAQETPASVLQKQRTMEMRV
                     FTIWRVLSSFEESSAGCISDMLRHVSNGKYVGGVRFAARFVLHVEVLFSAIDELEMHF
                     HHAQAQKIQYVREARMLCKKIVNFFSLLSHTQETGAQRMHITQELLSLVTGLAHYLKI
                     LIRISLTGALRLDQEYGVPAALESFLARLDELVTLQGGDTDTVHGYTSLPHVTIPTYD
                     TENASDLCVMCGKTVEDECARVGVTLRWHWSCVRCLVCQRTVFRPDDEILRDEQTSQA
                     VPVSQFVVRSSGRRSHAFCTGCAPSDAVGHFESVTRLEQYAFLLCVALNRLDALLKRR
                     SHLDVVPAHEAEPSELTDAESSTYRKSPETKRLESQYLDRHMSSKARVPHISSVADDP
                     DHSSDVSPALPDTPSTVTGAASPTFVSSQAPTSTLLRPNINASMAPISSPSTTPYDEG
                     ITLADIPMILQAEQVREQREQTSSTSSRRPISSLSAEELQVFKYVALLRVQKSSLLEF
                     VDMDDALELIETRKNTFWGKFLFKGTRDRRDVRKKGVFGVSLDYLVERHGADSVLGAT
                     PTPLRVPALIDDVVSAMRQMDVSVEGIFRKNGNVRRLKELADALDREVDTINLLDDHP
                     VQLAALLKKFLRDLPDPLLTSRLYELFVHTQCIEQPAERHYLVAMVAMLLPRHNRDAL
                     EVLFVFLRWVATFAYIDDEAGSRMDIPNLATVMAPSLLYSRSTEPTRGEAMLAQSVIR
                     HMLEHQDELWFVQDDMAPVLRDRSLIQAVPDLAPHELLKRCAPYA"
     gene            complement(<631211..>632335)
                     /locus_tag="MRET_2741"
                     /note="MRES_13180"
                     /db_xref="GeneID:38739507"
     mRNA            complement(<631211..>632335)
                     /locus_tag="MRET_2741"
                     /product="F-box protein 9"
                     /transcript_id="XM_027629368.1"
                     /db_xref="GeneID:38739507"
     CDS             complement(631211..632335)
                     /locus_tag="MRET_2741"
                     /codon_start=1
                     /product="F-box protein 9"
                     /protein_id="XP_027485196.1"
                     /db_xref="GeneID:38739507"
                     /translation="MDEELEAFRIAWCRDVAERAHGRAPNAAHSHMQAPSSDAMLKAA
                     APAVLPEAWADQERDALSMLLRTLSSKHVERVHEMMSQNTEDHTVWPEHVGTCISTIY
                     AADLEVSAVPMVQHMPDELWYRILLHVLMPTPLEPIWPTMLPDNMSFQLPLESWRRET
                     GPDYVSLERVARTCWRLRQLTSHPRLWRAIVQGTYAPPFAPLSCSWRDAYVHEPRVRM
                     NGTYIATCEYTQQGMSEENVWVRVLHVVRFFRYLRFFPNGRCLSWLTTDEPADVVHRL
                     EPGIRSKGCAAGHWRCLSEAGETLSRRGATILIEDLHDPTLPGYTFQMTLHMRSSPGR
                     WHRMDMLEYASLNLQTGEVLPIPHKHARPFLFSRVLSYGV"
     gene            complement(<632375..>635170)
                     /locus_tag="MRET_2742"
                     /note="MRES_13185"
                     /db_xref="GeneID:38739508"
     mRNA            complement(join(<632375..635137,635168..>635170))
                     /locus_tag="MRET_2742"
                     /product="transcription factor"
                     /transcript_id="XM_027629369.1"
                     /db_xref="GeneID:38739508"
     CDS             complement(join(632375..635137,635168..635170))
                     /locus_tag="MRET_2742"
                     /codon_start=1
                     /product="transcription factor"
                     /protein_id="XP_027484829.1"
                     /db_xref="GeneID:38739508"
                     /translation="MHPMHIQNGPPGMPPCDMYGSGMPPRYPLNVPRRPVRPSEGVPP
                     SMPYHYAPAPGYMPHVMDVQHMQPHAGPVYDGSFAAPHEASHMASGPPPQTHYVPAAP
                     NGVPAPQGSASIHAPIMHPAPSHAYSMPPSHMPPTQPLPSAQGAASVPLSGPTPTVYL
                     ATYSSVPVYEITVRGIALMRRRSDGYLNATQILKIAGIEKARRTRILEKEILTGEHDK
                     VQGGYGTFQGTWIPLHRAQELAINYNVYHLIRPLLDFDPVASRAVNAQQGAKRKADNT
                     AIPSQPAMPGTSASAPPQQPRFLTLRPPRSSTLGASAGGLVHTLLPNDDIPTSHAADG
                     VPPGSHPAQRTALGAYAAHGYVPQGVPLPPADSVAPSTDSSSHVHDLNVLSTTPLHSA
                     APPSNMADEMVEIGGPRFADKAVPPHLGDERERRAREVLTGLFVHEQPSTSAAPLEQL
                     HALLHSLGVDTTRRQHRSPLNLVIDDHGHTALHWAAALSRLSLVRMLTALPPAYGGAN
                     IILGNYAGETALHRSVLVTNAYELSQFPDLLDILAPSLETRDHRKRTVLHHIALVAGL
                     KGRTAPARYYMSCVLERISKNPAVLTGLLDAQDDEGETALSIAARLGNTNMIKMLLDA
                     GARKDLPNYLGITPLDWGITNASSPEGGVLNELGSYRASDMVRSLVKPSPGPVKKSQD
                     VREKLVQTLDELQVIFDREVRVKQDAIETTQIHLQAATRELAARRRDIQAAQGAVTER
                     EKMRQRSENLKRALASLPDQEPQDAAPEVTDAACVTDWSKDALAEADAALAKPEEAGE
                     KAATAAIMRLRWLTAYCEQAIAAMNTDVQERHKRLDQRKERYRKVVAACAQVPPDKVD
                     GLLDELLAAVESIGPDVDTNSVATFMDKVGRAHKQRSAADMTVAAPRTPPPSRPPPPS
                     EPPVAPP"
     gene            <635362..>638295
                     /locus_tag="MRET_2743"
                     /note="MRES_13190"
                     /db_xref="GeneID:38739509"
     mRNA            <635362..>638295
                     /locus_tag="MRET_2743"
                     /product="actin cytoskeleton-regulatory complex protein
                     SLA1"
                     /transcript_id="XM_027629370.1"
                     /db_xref="GeneID:38739509"
     CDS             635362..638295
                     /locus_tag="MRET_2743"
                     /codon_start=1
                     /product="actin cytoskeleton-regulatory complex protein
                     SLA1"
                     /protein_id="XP_027485220.1"
                     /db_xref="GeneID:38739509"
                     /translation="MRCLGVAVALYDYAAQADDELTLTEGDTLYVDELADEAWYKARL
                     RDGSHEGLVPANYVEMRAPEQVVVAAYDYEAQNHDELSFAEGRVLDVLERDGDWLLAR
                     IQGTDQMGLIPSNYVEEFGSSGAQEPVPASEPSPEAEPAQEHKPAPAPEPANVPSESP
                     AAQPPKPRMMAPPPPAPAPAPAPAPATAPAPTPPQAPEAPASVPLPSSLVPQATGAED
                     DLDETDGQASTVAPRAVPAAWTASSTQDEIQMWSVTELDMKKRKRKNKGTLGVGNGSV
                     FFATDTDGTAVPRVDIKHLKSTTLEKGKYLIITFERAAQVEGDVWVFHVGSRAAYQDI
                     SARIGKSKAISKQPAHTASTPRVSSSAPHSPPTQTGVPEMVVALYDFEAQADDELSVS
                     EGDQLVLIEREDHEWWKLQNAKGHIGVVPASYVEVLKENNSPALNALNHKFSTMRDPR
                     RAAPRRPTEAKRHESAARPLVDNPPQLPNQGRMRTWVDATGRFRVEAELVGVRTDTVR
                     LHKANGTLIDVPLFKMSLADLRYLEGITGRNLRTPSGPPSAASQRQSASGYPERSVSR
                     SRGRGPASSYRPDIDWFDFFVEAGVDMQHCARYADAFERDHMDTFVLPELSVDSLRRL
                     GLREGDILRVRRHVQNKYSKSSAPPPMPQRSPEEEEKQKETDEELARRLQAQEIAEQR
                     RLAPRKSTTRAPEPAPEPLPPRSTDMSRNTDDTSTAAAQEALQPNQTGVSAETIAAAV
                     EIIRRREREEAEEREKAAKKDERPADPNSALFDKLEKLKPSPKPSATPSMPDPNAPRG
                     PIAPVPINQSLLQPLIPLQGTGQFVPTNPTGATSMFAPQPPGFGMPQPTGMFSVPQPQ
                     APQPVPQPMLGQATADTTSASSQQDRFSAASVFEQMKTGSGAFSKDTSAPQSSGKYDP
                     LRAQPTGFAAGGIVDSSPFGGGMMMPQGMPTQSMMQMPMGTGMMMGMPGQPSGFMPAY
                     GFYPS"
     gene            complement(638387..638471)
                     /locus_tag="MRET_t0044"
                     /db_xref="GeneID:38741238"
     tRNA            complement(638387..638471)
                     /locus_tag="MRET_t0044"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:38741238"
     gene            complement(638488..638572)
                     /locus_tag="MRET_t0045"
                     /db_xref="GeneID:38741239"
     tRNA            complement(638488..638572)
                     /locus_tag="MRET_t0045"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:38741239"
     gene            <638704..>643308
                     /locus_tag="MRET_2744"
                     /note="MRES_13195"
                     /db_xref="GeneID:38739510"
     mRNA            <638704..>643308
                     /locus_tag="MRET_2744"
                     /product="START domain protein"
                     /transcript_id="XM_027629371.1"
                     /db_xref="GeneID:38739510"
     CDS             638704..643308
                     /locus_tag="MRET_2744"
                     /codon_start=1
                     /product="START domain protein"
                     /protein_id="XP_027484826.1"
                     /db_xref="GeneID:38739510"
                     /translation="MDGVTLPKVKKKWKDALHSSISLLERIHTEENASPQWTRAVPSR
                     DGAPDEIPEQVQLAVMRRRVANTDVFRATWEGMWDEGAGGVVDLEAFFALFSSQELLS
                     QWLPLVESSTMIEALGSHTRVCKTCFRLGWPASPRDAVLLTHTVRDDKRVLHVATSVP
                     RTADAPSYLRPSPPYIRTQIHLLALFVACPSPERVALTVYWSMDARGSMLGVRPNAMA
                     SSVPRMLPKMAACAKTRGMHVPYVHAFGAGLVVTSERAATALHVEFILVHDDDDDQVF
                     DAEAALPRSICVRMSAKNAWDVRLRTLDSAGGCPAYTSKLTRIGAWYELCIQYEKLED
                     AHATLHAALEASVRTDAEEGVYVDDFAMEATEQTPHASDNALLARLALSEQQTPSGNV
                     DTVQRGIQGLSPLAATVRRNYIYFTSLLQEPEAKWRRVSDVRGVTVTQLESIDPTLVV
                     YRAEATFVGLTVWDLYSALNSPAMVRRWNAALDDATLIQDLGGQSAVWHVRYAPAWLA
                     QARDATLVQTAYQSPTSIHVFSFSADEHISELPAPAPGTVRMQVDLCGWSIEALSPTT
                     VHVTLVEQSDPRGWLSKTRTPPQMIVAMAGAGEHVLRHGAPPCISRLFNARVQTQAYG
                     EDSFDVSYVAAACDAPDATHVECVLWASLEGWAPNLDVLVDPPPSSTSCLRRHRLAGG
                     GGLWITLEHRVADLSEQCVRVCVRKGPAKSLERGVVLLNGARVHVDVEGMDPAQLQAL
                     ARMKRTKPRHVPLDLPVRASRSADGYTEPIVESAAEVREPEVKPPTHPALDALALLRC
                     IHAERHPDPAGPQGGWSLMSEKNGVYVHRRLVERISPHVMVHRTDKIIQGVAAEDLLP
                     LVADPHARCAWDEHLASCRMLESFGSGTNTALWTSHASFLFAPRMFVVSSISAHGHGA
                     DVPLEQTSPVAAQQPVYFHATASCDASRWDMSLWNPDARPIGTVLMDGWIFENVDPYS
                     MEQYAIPSTRCIYVVAIDYGGVPRSLNALWNASLPECVVQLERWVSQHGPLSSVRMPP
                     RCVNVHGDARDDSLRGSWTLHRGRRASTLVTCDFEHDTRTQHVVAIVDMSVPSPKQLP
                     ALAGDDEAAETSTSPAPPRLSSRGSAYFHKRSAAAEPLILVDIQVALQYYPQGYDVQV
                     TWSHVEAGVCDLAALPASPPTDAMPIDVRVLDIQPSALQAATHTHAEPSHRHCVRVTL
                     PERAYTKPFLVRAVIAPLEGRAYTNATPSHVPVTINHRVAEICYGHESAREPLDVDVD
                     QLEHISEPTTRHVGLPHVPIASVAAHSPEAASTAAPTPSTENVSAADESTDAEKMAPT
                     APAPSSTPLMSLLSPQGWYDGVMSLVRPTKRTDTEASVSPTPNSQPPTSAAPSNASTS
                     VSSPASPVSPTTQTNQQVPMPRGGYQLSTLILFMILAFLLGSLTRAFVQPADFVLMPF
                     TSNNAVPAAPARSELKEGESLRMIDVAAREIDNFVRAARQLHTFARFGYTDEATLAEQ
                     EARSECLEESGMVRWHEMHRFVDIYLPGLPWRLVMGLAGV"
     gene            <643414..>644379
                     /locus_tag="MRET_2745"
                     /note="MRES_13200"
                     /db_xref="GeneID:38739511"
     mRNA            <643414..>644379
                     /locus_tag="MRET_2745"
                     /product="protein MAK16"
                     /transcript_id="XM_027629372.1"
                     /db_xref="GeneID:38739511"
     CDS             643414..644379
                     /locus_tag="MRET_2745"
                     /codon_start=1
                     /product="protein MAK16"
                     /protein_id="XP_027484827.1"
                     /db_xref="GeneID:38739511"
                     /translation="MQADDVIWSVIGHQFCSYKIKSSTHSTFCRNEYNLTGMCNRQSC
                     PLANSRYATVREHEGILYLYVKTAERAHSPRRQWERIRLSNRYSTALEQIDKELIYWP
                     NFIVHKAKQRLTKITQYLIKMRKIKLKEEEQPELVGVKKKTERREATRENKALRAAKL
                     EKSIEKELLDRLKRGAYGEAPLNVNESVWNAVLESAQARVPDAEGNALELEEELSDEE
                     QEEDIEAMDAEMRAMNDDDDEYGQREFVSDDEGSEDDDDLEDYDSLDEDSEDDTDDSD
                     TKKSSKRPAPKRPRSDARGKRGRPRVEIEYEQETEPLTAEQLSQW"
     gene            <644523..>646277
                     /locus_tag="MRET_2746"
                     /note="MRES_13205"
                     /db_xref="GeneID:38739512"
     mRNA            join(<644523..646081,646115..>646277)
                     /locus_tag="MRET_2746"
                     /product="TKL protein kinase"
                     /transcript_id="XM_027629373.1"
                     /db_xref="GeneID:38739512"
     CDS             join(644523..646081,646115..646277)
                     /locus_tag="MRET_2746"
                     /codon_start=1
                     /product="TKL protein kinase"
                     /protein_id="XP_027484828.1"
                     /db_xref="GeneID:38739512"
                     /translation="MLKPASGHLHDERLGSSPPSMPPRGSKNVQSAPKRTRAGQLKEE
                     TSSSGIMSSDSEWYATSSSDSDENVSSKKSRHKRHSRSFWGRRHVTGTPKRTKAAWVY
                     RSPHRTPRHRLRSSSKYPAPPPLPPHVHPFWRQNPAATHEKRPVYPVFLRSPRSRRLR
                     RFERSPNMNQKITMSPLHDDCTPRHLHAPAPNLDKDEFAWFDSSDSELSSVPDESSSF
                     PDLDDTPTHIPAQHIPQSNQNLPEQLSQKPTSYHGLKPAKIKTPQPKASESAHNEVQA
                     LDLGRLDLLDHVISPEKLVRQERIGAGAFKDVYRGLYHVSRMRVLPVAICDLRDELTE
                     MDIKELKFLRDLRHENIVQFIGIGIPTNLRLGPPCVIVSELCENGDLFDFIRNTPPPP
                     DVNIFRILLQIARGLEYLHTHKPMIVHRDCKSTNVLINAQGIAKISDFGLARVKRSKY
                     AMIRSLVGTVNWQAVELWSPKPQYNEKVDVWSAAMTFWEALQWHQTEKRYPFQGLNEH
                     QIYMNVRQKHLRPFTGSIRRRYGDDIVHLIDQMWQQNPRDRPSMSEVCAEIEVLIARR
                     ENSVSPS"
     gene            <646400..>647020
                     /locus_tag="MRET_2747"
                     /db_xref="GeneID:38739513"
     mRNA            <646400..>647020
                     /locus_tag="MRET_2747"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629374.1"
                     /db_xref="GeneID:38739513"
     CDS             646400..647020
                     /locus_tag="MRET_2747"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484872.1"
                     /db_xref="GeneID:38739513"
                     /translation="MSSNNSLTQQFMQVIRNRRTIYALSKKAILPDAQVVQLVQQAVR
                     EAPSSFNVQSSRVVILFGNQHDHYWGQIVPTALRQAAGEKAVEASKGKLDGFRAGTGT
                     ILFFEDTDLIKGQQQQFPMFASGFPTWSLHASGMAQIYTWAALEAEGYGANLQHYGNL
                     TGETLKRVYNLPESYEIQSEMVFGHPEAPAGAKDYIPDEERVVVFK"
     gene            <647401..>648027
                     /locus_tag="MRET_2748"
                     /note="MRES_13210"
                     /db_xref="GeneID:38739514"
     mRNA            <647401..>648027
                     /locus_tag="MRET_2748"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629375.1"
                     /db_xref="GeneID:38739514"
     CDS             647401..648027
                     /locus_tag="MRET_2748"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484793.1"
                     /db_xref="GeneID:38739514"
                     /translation="MASTTSSKEFLQVIQNRRTIYELSKKPILADDALVQYIRQLVKE
                     APSSFNVQSSRVVVLLGDQHSKYWNEIVPRAVSASVSDEALETMRPKLQNFAKAYGTI
                     LFFEDEKLIKTQQEQFPMFASGFPTWSLHASGMAQIYTWSGLEAVGYGANLQHYGNLT
                     GEMLKKEYSLPESYQIQSEMVFGYPEGLAQEKAYNPDHERVIAYGHSA"
     gene            complement(<648189..>649415)
                     /locus_tag="MRET_2749"
                     /db_xref="GeneID:38739515"
     mRNA            complement(<648189..>649415)
                     /locus_tag="MRET_2749"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629376.1"
                     /db_xref="GeneID:38739515"
     CDS             complement(648189..649415)
                     /locus_tag="MRET_2749"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484794.1"
                     /db_xref="GeneID:38739515"
                     /translation="MERLDARMKALAELTSSSRCTYSKDEQHQSNESWRSLLPPHNVI
                     NKTDNRPVQKRHSSMQSWHDYLTEDVDGSQDIFLGPNDLQDMLGFLGHEDDERSRSPI
                     FGNRADLFVRRPSPSLYSTSEKLCVRSPIRIPSDSSSSLGNCYSSFDSDQGKDSHKQN
                     YLNDNADVYGVLEAKRVSEPEQESSLLGNDRDSWPTSSRQSMHFLGDRQNSHSNSLAI
                     EPPSHLSLMDRSRSDSNVFSSLRNDVNHVNGLPSLQPTDHEPLCIDTTNVSPHSHNAT
                     NSHTVNHHDHRITLTTAPNSYCVCFYMPGFSLDGITLTMKGLHRRILHILANKWGSEQ
                     WEHFERRIVFAQDAQMSLIRARFENEQLIIQVPRKFVPPLSYDPSASGTEMTSADCLL
                     IPPEDNRRDSIKSAQF"
     gene            complement(<649768..>650667)
                     /locus_tag="MRET_2750"
                     /db_xref="GeneID:38739516"
     mRNA            complement(join(<649768..649902,649935..650023,
                     650055..>650667))
                     /locus_tag="MRET_2750"
                     /product="cyclin-dependent protein kinase regulator Pho80"
                     /transcript_id="XM_027629377.1"
                     /db_xref="GeneID:38739516"
     CDS             complement(join(649768..649902,649935..650023,
                     650055..650667))
                     /locus_tag="MRET_2750"
                     /codon_start=1
                     /product="cyclin-dependent protein kinase regulator Pho80"
                     /protein_id="XP_027485107.1"
                     /db_xref="GeneID:38739516"
                     /translation="MEQNTNAMDSKPNTTAQQSPLRRAQGSANIPKWSPSAVFSQFSS
                     GSSRSQDSSEILSSSGTRSSDGSVQNSPASNVITPAQRATFEKKELPARFYDADPEDL
                     FALISGMLLQLISHNDTIPLHPADLTRFHSRAPPGISVEAYLRRLAKYTTLDKPCMLI
                     ILIYIDRVCERMDGFTICSLTVHRFLCASVVCASKALCDSFSTNTHYARVGGISLVEM
                     NLLEKEFLNVIEWRLMVTAPVMQHYYASLVNMHPNYTLAPMLEPLPTMFPAISRSSHA
                     AS"
     gene            complement(<651205..>652357)
                     /locus_tag="MRET_2751"
                     /note="MRES_13215"
                     /db_xref="GeneID:38739517"
     mRNA            complement(join(<651205..651240,651267..651337,
                     651372..651424,651453..>652357))
                     /locus_tag="MRET_2751"
                     /product="pre-mRNA-splicing factor 18"
                     /transcript_id="XM_027629378.1"
                     /db_xref="GeneID:38739517"
     CDS             complement(join(651205..651240,651267..651337,
                     651372..651424,651453..652357))
                     /locus_tag="MRET_2751"
                     /codon_start=1
                     /product="pre-mRNA-splicing factor 18"
                     /protein_id="XP_027484920.1"
                     /db_xref="GeneID:38739517"
                     /translation="MEALKAHIVAQKRKVASETGSTSKYMRRGSIEQMQRAASAEEEH
                     DLPSPPARALTNPTSPPQPTQQPEPADESNERFTISNEEAVKRLRQKGEPIRLFGETD
                     RDRRLRLRALELLEEHDVHAQQGHDDSKRFMRTSESQVIMDRIEKHPSSQIPSESTES
                     REATASLPSQARVPARMREGIGMHTVMDLKLMWSDPARVYPILYYTLKGLLEDWGEAL
                     AQRPEDVRLSAQGRHVASLHAQTSEYIKPLLKALRRRSLEPDVLLRIAEIVHYMQLRE
                     YRKANDSYLQLSIGNAPWPIGITMAGIHERSADEKLATSRVAHVLNDEVSRKYIQSVK
                     RLITFAQSHYPPDDLSKLMG"
     gene            <652490..>652901
                     /locus_tag="MRET_2752"
                     /note="MRES_13220"
                     /db_xref="GeneID:38739518"
     mRNA            join(<652490..652546,652586..652602,652675..652683,
                     652712..652811,652845..>652901)
                     /locus_tag="MRET_2752"
                     /product="cytochrome c oxidase subunit 6b"
                     /transcript_id="XM_027629379.1"
                     /db_xref="GeneID:38739518"
     CDS             join(652490..652546,652586..652602,652675..652683,
                     652712..652811,652845..652901)
                     /locus_tag="MRET_2752"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 6b"
                     /protein_id="XP_027484919.1"
                     /db_xref="GeneID:38739518"
                     /translation="MPEILDLRTAAFDSRFPNQNQTRHCWQSYADYYRCVNAKGEDFE
                     PCKQFFSTFHSLCPNEWIEKWDEQREKGAFPAKLE"
     gene            complement(<652989..>654947)
                     /locus_tag="MRET_2753"
                     /note="MRES_13225"
                     /db_xref="GeneID:38739519"
     mRNA            complement(<652989..>654947)
                     /locus_tag="MRET_2753"
                     /product="tRNA (uracil-5-)-methyltransferase TRM9"
                     /transcript_id="XM_027629380.1"
                     /db_xref="GeneID:38739519"
     CDS             complement(652989..654947)
                     /locus_tag="MRET_2753"
                     /codon_start=1
                     /product="tRNA (uracil-5-)-methyltransferase TRM9"
                     /protein_id="XP_027484910.1"
                     /db_xref="GeneID:38739519"
                     /translation="MLLHRTSPLLVEGLVLPRLVMAAAASETGAVPRTAIQAVHDMLF
                     ELRALRAYAGTARISEEAHALSLHSATRLGLYSIGRPSAQERHTSRESVLHALDSIYA
                     ASRKLCEDLDASNTAHNDTLSTGVAELARVASELCDASSSVRAYSFCTDPQLMPFPPA
                     LWTGALARTSQPSTDHMQAADTLDTLCQGIIPTLSGMGLECFHERIDMPDAHADIQAT
                     HTLTCGGKNIVLDIGFGLRHEGDAHLPHVSLQVSFASTASAQTPGDRDKALADVVCLP
                     LQQLSLILFGLPTEARIFERLTRGSVPPTTAYAQAMTFWQAFISTLTTLVSIDGLCES
                     TPPADKPDAFQALDQVSRTAQRVCESEMHVLAQQYGEADEQRVVSLVMEHGHGLALSH
                     HHTPFLSLAYAPSHTATVRIGPCFLRFEPESKPSWTPIPHSDVPPEAYNILSTSVLEE
                     GQNRPQALIALLEPGMCVPLRIARHVYCALGLARFPWPSTTPRRSACGYVQQCLGTSR
                     RYYAASQDEESRHITALPFRSLAHLYSALELLREHARWATLLSSARLDQREDGTAITV
                     QLEEASPPGTSELRLSILSTRCNKTINAQLAYRGGYELQAQSVDMPLRTTTALDAQEA
                     HLITDALQQTPRLDVLVHRLLEWGTCST"
     gene            complement(<654963..>656103)
                     /locus_tag="MRET_2754"
                     /note="MRES_13230"
                     /db_xref="GeneID:38739520"
     mRNA            complement(join(<654963..655798,655833..>656103))
                     /locus_tag="MRET_2754"
                     /product="chitin binding peritrophin-A domain protein"
                     /transcript_id="XM_027629381.1"
                     /db_xref="GeneID:38739520"
     CDS             complement(join(654963..655798,655833..656103))
                     /locus_tag="MRET_2754"
                     /codon_start=1
                     /product="chitin binding peritrophin-A domain protein"
                     /protein_id="XP_027485109.1"
                     /db_xref="GeneID:38739520"
                     /translation="MSQVDAENVDVRSLDEALGENASEKASVPKTTAAEHEDVRAAKP
                     AASMPAAGPSTTLTEETIDRVWDMFPKLKRDTISDVLHSKRGNVDAAMPLLLEIYDPD
                     AARPHRSTSPYYAHHPAQSHSSNTLPYEPRRRKPFEPRWDPSQLSYSPRMTPPRTTPH
                     PSTFAPPPEPSPWPGPQQMQQLSEDFDRLTERGMAKFGSALSSLRQKAEAAMRNREGA
                     RTLFRPQSAYTDPMNPHTAPAPSWNPLQFTQKSPYDHDPQVVSESQLDELAPSPLSSM
                     DEKTAPPLPQHPAERSSTDHRTPQSSQASAPDATDSTSSKSATTPHGSDDTTSHDAPE
                     PSQTSSHKEPASSEPKSSATDDEEYIDNPFDDDD"
     gene            <656219..>657337
                     /locus_tag="MRET_2755"
                     /note="MRES_13235"
                     /db_xref="GeneID:38739521"
     mRNA            <656219..>657337
                     /locus_tag="MRET_2755"
                     /product="diacylglycerol kinase catalytic domain protein"
                     /transcript_id="XM_027629382.1"
                     /db_xref="GeneID:38739521"
     CDS             656219..657337
                     /locus_tag="MRET_2755"
                     /codon_start=1
                     /product="diacylglycerol kinase catalytic domain protein"
                     /protein_id="XP_027484923.1"
                     /db_xref="GeneID:38739521"
                     /translation="MSDTLYVVWNAVAGARRAAHMLEAYVMPRIRAWKEDKAPSVRVV
                     VHETEADAGAVRLGRAIAAHGRACTCVVLGGDGTVHELLEGLFSDAQPRTISIVLVPM
                     GTGNALYHTLMGPDTAPDPAWRLGSLEAFTKAQATKPLTLMQADPGHRLACVVVSHAL
                     HAAILRDSEALRARYPGPERFQIAAEQHLTSWVRATLTLLPDERHPVSVYDPRSRTFS
                     RPAAYEHSSDGRVHLSGPFLYMNAMTVDRLEPSFVPAPFASPTAPAPLRRPASAMDVI
                     VIRPTRQPSASSPDAFARDVLMPVLFQGMYQQGKHVDMQYEEQRPIVEYFRASGYMWE
                     PARDDALARTMCVDGTIIDGGERAVVRTTAHDVHAYCA"
     gene            complement(<657319..>658229)
                     /locus_tag="MRET_2756"
                     /note="MRES_13240"
                     /db_xref="GeneID:38739522"
     mRNA            complement(join(<657319..658076,658106..>658229))
                     /locus_tag="MRET_2756"
                     /product="hypothetical protein"
                     /transcript_id="XM_027629383.1"
                     /db_xref="GeneID:38739522"
     CDS             complement(join(657319..658076,658106..658229))
                     /locus_tag="MRET_2756"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_027485108.1"
                     /db_xref="GeneID:38739522"
                     /translation="MRHDAYASIAHLALNVTPPRTQWMNMGLWTQQDASFPDACQALA
                     EFLHQAAHIPPGARILDVGHGCGDSLLLLAETYKPACLHGVTFEAAQAQQARQRLGER
                     ATIWCADAVAWLKNSVDTYDTVLALDCAYHFSDRADFVRTVSQRLAPGGTLALVDLVG
                     AWPYPAWLTPAPSVPAPSRPPTVWERVQHYVICRLSRTNPHAFLSFDAYRALLHEAHL
                     DVVDVQDISHDVFPGLAAFLRGLGVHDRAWRGGSVWQRCALRAFGSVVHKWAHGGDSG
                     RVRCSLWVARKAQAQYA"
     gene            complement(<658296..>659261)
                     /locus_tag="MRET_2757"
                     /note="MRES_13245"
                     /db_xref="GeneID:38739523"
     mRNA            complement(<658296..>659261)
                     /locus_tag="MRET_2757"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629384.1"
                     /db_xref="GeneID:38739523"
     CDS             complement(658296..659261)
                     /locus_tag="MRET_2757"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484921.1"
                     /db_xref="GeneID:38739523"
                     /translation="MASGSYLDVPLNQHRPVQLFDPPMHDQAYSDSQAYDQRLSTSDA
                     VHDKFVDEPTMEESALFSDAPAMNRGSGMYQGVPRKGIWRVDELREFQNQSLPMRILR
                     VCLFILVIGIILALCIIMLIFVFLRPPNIGVKEVSAPVQSDVRIQGTSVQVPANISFV
                     ISNPNYVPATIKNITAHAYDKANQDTSMGVCHLSNQKIESRQNTTVTLPCKLEYSLEK
                     DPNLTIIKDIARSCFQSKDKHLQILLKVHLKVKLYSFTVPIDVNPSISFECPVTKKQI
                     QQIVGHKVDLDDILHNVRRRSLQEAWSALRERYLLRSSSSPGDEL"
     gene            complement(<659401..>661008)
                     /locus_tag="MRET_2758"
                     /note="MRES_13250"
                     /db_xref="GeneID:38739524"
     mRNA            complement(<659401..>661008)
                     /locus_tag="MRET_2758"
                     /product="T-complex protein 1 subunit delta"
                     /transcript_id="XM_027629385.1"
                     /db_xref="GeneID:38739524"
     CDS             complement(659401..661008)
                     /locus_tag="MRET_2758"
                     /codon_start=1
                     /product="T-complex protein 1 subunit delta"
                     /protein_id="XP_027485234.1"
                     /db_xref="GeneID:38739524"
                     /translation="MSASVASAQPKSGFRAFKNSDKPDEVRRSNLSAAKAVSDAIRTS
                     LGPKGMDKMIQTSSGEVVITNDGATILKHMAIVHPAARMLVDLSQAQDVEAGDGTTSV
                     VVLAGSLLGVAEKLLSKGIHPTMIAESFQRAAIKSVEYLNEISTPVDLSDRDSLLRAA
                     TTSLSSKVVSQYSSVLAPIAVDSVLRLVDLKNNETESVDLRDIRIVKKVGGTIDDTEL
                     VDGLVLEQNVVTSSGGPSRMEKAKIAVCQFQLSSPKPDMDNQIVVNDYRQMDRILKEE
                     RQYLLNMCKKIKKSGCNVLLMQKSILRDAVNELALHFLAKLKIMVVKDIERDEIEFLC
                     KSLGTSPIADIEAFTEDKLASAELVDEVQHSGARVVKVSKIKNPGRTVSVLCTGSNSL
                     VLEESERSLHDALCVVRCLVKKRALVAGGGAPEVHMSRRLAQYAQTLQSLEAYSFQAF
                     SEALEVIPTTLAENAGLNPISIVTELRNRHASGEKTAGINVRKGMITNILEENVLQPL
                     LVSTSALELATETVSLLLRIDDYQLSR"
     gene            complement(<661096..>662328)
                     /locus_tag="MRET_2759"
                     /note="MRES_13255"
                     /db_xref="GeneID:38739525"
     mRNA            complement(join(<661096..661339,661366..661922,
                     661947..662297,662326..>662328))
                     /locus_tag="MRET_2759"
                     /product="ubiquitin fusion degradation protein 1"
                     /transcript_id="XM_027629386.1"
                     /db_xref="GeneID:38739525"
     CDS             complement(join(661096..661339,661366..661922,
                     661947..662297,662326..662328))
                     /locus_tag="MRET_2759"
                     /codon_start=1
                     /product="ubiquitin fusion degradation protein 1"
                     /protein_id="XP_027485233.1"
                     /db_xref="GeneID:38739525"
                     /translation="MFGPLNRGLADLGRPARWGSMADFMSTFDQRFPAPLDAYEDYFK
                     AYHMSCFPGRERKDVSYGGKIIMPPSALSTITELELESPWTFLLRGTGRSRSQSTHAG
                     VVEFIADEGKVYLPSWIMRTLELENGDPIHIQGARLPKGKFVKLQPQTVDFLEISDPK
                     AVLEQALRNYPTLTPGNIIEISYNCLTFEILIMEVQPDAEGISIFETDLEVDFAPPKG
                     YVEPTPPTRPPPPTMASKWHIDQLKQDVILPGQDGSSSAGSTPRDPGSVPAPFKGFGQ
                     TLSGKKTKGKKDKPITPRDPHSMIRSTNHPTIVTNNTLLEEKRVPAALALPYGHLFFG
                     YDVQRLRVPAGSAPESDAPPEPQPELQAFRGSGHTLQSRPSPEVIEIDSD"
     gene            <662470..>663177
                     /locus_tag="MRET_2760"
                     /note="MRES_13260"
                     /db_xref="GeneID:38739526"
     mRNA            <662470..>663177
                     /locus_tag="MRET_2760"
                     /product="demethylmenaquinone methyltransferase"
                     /transcript_id="XM_027629387.1"
                     /db_xref="GeneID:38739526"
     CDS             662470..663177
                     /locus_tag="MRET_2760"
                     /codon_start=1
                     /product="demethylmenaquinone methyltransferase"
                     /protein_id="XP_027485209.1"
                     /db_xref="GeneID:38739526"
                     /translation="MVAASAVSELAQYSSCEVADALIKLKLPHGGYLPGLELYSPQPM
                     AGATSVCGPAFTVKMVWQSEVHAPRLSKHFMDVAERDSIMLISAPSSARSAVWGGLMT
                     ARAQSVGVRGVVIDGRCRDLAEHRDAGFPVFARGHSVLGQSPFTRPSEVQVPLVLADP
                     TVPLDAQGQPVFPPVTVHPGDILLGDVDGVVCVPQPLVGQVVEIARHGRHVDELCRQD
                     LRAGRGMQETLAVRRGT"
     gene            complement(<663185..>667048)
                     /locus_tag="MRET_2761"
                     /note="MRES_13265"
                     /db_xref="GeneID:38739527"
     mRNA            complement(<663185..>667048)
                     /locus_tag="MRET_2761"
                     /product="Csr1-phosphatidylinositol transfer protein"
                     /transcript_id="XM_027629388.1"
                     /db_xref="GeneID:38739527"
     CDS             complement(663185..667048)
                     /locus_tag="MRET_2761"
                     /codon_start=1
                     /product="Csr1-phosphatidylinositol transfer protein"
                     /protein_id="XP_027485210.1"
                     /db_xref="GeneID:38739527"
                     /translation="MTAPLPLVVPCDARRSLPRTFLSADVIPRASHDAGGADLGRAPF
                     VYAIARMVAKSHDDGEPLEEGYYGNLTPEQEKALKDVWAMLLDIWSRNVERSDELARL
                     GGPQKAHTGQELGDVSHKKSGAGKQKEAAHEHDCRFITTAVEKYGGRYLAYMFWRTVM
                     MDPPDHFVLRFLRARNFHTSEAVDMLIGALMFRLDINLEDILLQGEYGFRNERGFLDQ
                     YRRGISYIQGSTEKNELPIYFIHVGRHYTHEQNMDALQKFIVLSMENSRLLCSPPVEK
                     IIILFDLRGFGLKNADWQAMSFILKCMEAYYPESIRRIYIHSAPWIFKGIWSAIQPLL
                     NEDVHAKIKFSSSAKDLTDFIPMSRIPVDMGGTMDWTWQYAEPEEGENDIHKDTQTRD
                     AVQKEWDELQQQFLDATQQWIRGDADADARHVLVKQLRLKYYQIAPYVRARNVYQRKG
                     IVRDDFLVHWDYPQKDSSLLTQDVNEADCATQLVSWLREQGHDTLESSVGGSHTPCAS
                     CVATNMASRDAAADERDAPEEQQRSPGAHEQDAAEQDATDTPDEDDEGDDDSDGDDDA
                     AVHAQDFDMDDEECTMWQDAEEFSETDVSPEFAHVKVSRRRSMQNDAELHADMERTRE
                     AIQLFLNSQVREAEELCVDGADHRLYLSAGMSLLNSVKCLMTFEPDDMQMAIKSCKHT
                     IRIARVLRAKRRKLPKIMPGKSQPPLPATLLEQHAELVYAESLLCKSIVGIVYAGDTI
                     GLIREAMSLRKAYQYFRALLRAMEQAEDAKDASRGHSDAPPVDEDLRSGVCFGMGGCM
                     LVLSLLEPRLLKFMEGVGFEADRSKALEFFERAGGWSRVHHEPGLSAAQEGLRRPLCD
                     LAILVYHLSVPTMMPVPDVDVRLADHVLSWNRKRFPHGISYLFFSSLLYACQALPDKA
                     VHSFRLAIDAQNEYRQFHHLVFWRLALTYLGTCDYTPAYECFDLLSHEFHWSQCVYQY
                     AKAAVLFEQSSEHHMQAETIMRTVPGLVRKMAGRHMPFEHFVVRKAEKFVSPPPFGLP
                     AMEFAYLWHCLAQTPVYLLVEEHLERIDHVLRHLGQYESPAAFPGGAQAFYSQHCLAH
                     FLRGVVLRYAAFPKKYTVVQTPRHEHLPVAQMASDAAHALHTVCADGQHLDAVDRYLV
                     YFAHYELGKLYTAQGEFAKARCEFELIQSRKPLVPQDSPIPLKSGKASYLLSHMCQMR
                     ANFAMSSMPRHAAPPPHRPPHGPPKATSSRPPSEASRAAPSSATARTPVPTTHYNDIP
                     ETLTRTSADRRRDLGRRARQSRLLS"
     gene            complement(<667195..>668283)
                     /locus_tag="MRET_2762"
                     /note="MRES_13270"
                     /db_xref="GeneID:38739528"
     mRNA            complement(<667195..>668283)
                     /locus_tag="MRET_2762"
                     /product="zinc finger protein, C2H2 type"
                     /transcript_id="XM_027629389.1"
                     /db_xref="GeneID:38739528"
     CDS             complement(667195..668283)
                     /locus_tag="MRET_2762"
                     /codon_start=1
                     /product="zinc finger protein, C2H2 type"
                     /protein_id="XP_027485207.1"
                     /db_xref="GeneID:38739528"
                     /translation="MSSMSASSARADNGNSTATCTYPSSVSYMAMPSHHHPVGVPHGS
                     DTGRLVLHGHRAGSEARNMPFSNRSRMSAPSHDGFSTSFGAAGEALSMGDRHRMVPGP
                     QHPLEGASDLDMKPNMSYTMPASSTGSMEAAAKQYGLAGHRRADHSRHGLEESPPPPL
                     THPSSSSPSSSVNDDPEAKEMPHQMLHKCESCSKVYRHPSCLIKHRWEHTMYWKEASK
                     FLMSKHQQVQLLEAAAILVGMDSNARSLPEEKALWPAAVSPPSSGLLGCEYVNFDTLM
                     ATKARNAAMYHDSSRMQYGTSAPSASSMPSVHMHASPSKHRAHHALDETVEEGDDSGE
                     LDLSAREDTYGLHSGGDVMADMDMDADE"
     gene            complement(<668913..>669645)
                     /locus_tag="MRET_2763"
                     /note="MRES_13275"
                     /db_xref="GeneID:38739529"
     mRNA            complement(join(<668913..669193,669224..669612,
                     669638..>669645))
                     /locus_tag="MRET_2763"
                     /product="L-methionine (R)-S-oxide reductase"
                     /transcript_id="XM_027629390.1"
                     /db_xref="GeneID:38739529"
     CDS             complement(join(668913..669193,669224..669612,
                     669638..669645))
                     /locus_tag="MRET_2763"
                     /codon_start=1
                     /product="L-methionine (R)-S-oxide reductase"
                     /protein_id="XP_027485208.1"
                     /db_xref="GeneID:38739529"
                     /translation="MVHADAASVPAHIASKAAFYEHVQLQVDGLLDGQTNWVTNLANV
                     SSILYSSMNRFEAWRDKRVNWAGFYLLAPLFPGTRHLASLTRPMLWLGPFCGLPACQA
                     IPSERGRGVCADGSAQWPPAPLCVPHTEAYPGHIACDALSQSEIVVPIVVSRSQLSQT
                     HQAALRGEGPEHLVRAWAGRGTDDHVIVGVLDIDCESQNGFDAVDADALQRLVQRVVQ
                     ACDWCME"
     gene            <669812..>671338
                     /locus_tag="MRET_2764"
                     /note="MRES_13280"
                     /db_xref="GeneID:38739530"
     mRNA            <669812..>671338
                     /locus_tag="MRET_2764"
                     /product="homoserine O-acetyltransferase"
                     /transcript_id="XM_027629391.1"
                     /db_xref="GeneID:38739530"
     CDS             669812..671338
                     /locus_tag="MRET_2764"
                     /codon_start=1
                     /product="homoserine O-acetyltransferase"
                     /protein_id="XP_027485205.1"
                     /db_xref="GeneID:38739530"
                     /translation="MAGLWRMRSVTLLRAWARRDAVSMLSLRTYASRSCVAKASIEPM
                     PLPCIDQHEMRQSRVMGGSQHVGPAASQKDEMLGPEPSYTNIVSGYDIFLCDEPFALD
                     YGSVLPSYQIAYETWGTLNAARDNAILLHTGLSASSHAASTPRNTSKGWWEDFIGPGK
                     ALDTNKFFVVCTNVLGSCYGSTGPSSAHPLDADGAPYATRFPVLSIFDMVRAQFRLLD
                     HLGIDTLYASVGSSLGGMQSIAAAHLFRERVGRVISISGCARSAPSGIALRYAQRSVL
                     MADENWNRGFYYGPNQVQPHKGMKLARQIATITYRSGPEWEQRFGRRRHTQLTTEADA
                     ATHRAPALCPDFLVETYLDHQGEQFCLKYDANSLIYISKAMDLFDMTDDALAELGAAR
                     MEAHGDDGNLPVERIDHAPASPKRRPHITTISHPGAHAYVPSLARGLRRLHDVPILIL
                     GVQSDILFPVEQQRELAECIRMNGNTSVMYYEIDAPHGHDSFLIDVANVGGAIKGFLN
                     "
     gene            complement(<671331..>673046)
                     /locus_tag="MRET_2765"
                     /note="MRES_13285"
                     /db_xref="GeneID:38739531"
     mRNA            complement(<671331..>673046)
                     /locus_tag="MRET_2765"
                     /product="histidyl-tRNA synthetase"
                     /transcript_id="XM_027629392.1"
                     /db_xref="GeneID:38739531"
     CDS             complement(671331..673046)
                     /locus_tag="MRET_2765"
                     /codon_start=1
                     /product="histidyl-tRNA synthetase"
                     /protein_id="XP_027485206.1"
                     /db_xref="GeneID:38739531"
                     /translation="MPLGRLPLCVLRGARRFVVHPHRSMSKSSEAVAACRRQIEAQLD
                     KVRTLNASEAPIDAVSSEVAALQALSAQLSELSLSKKGGQKGKITLKTPKGTRDWEPL
                     SMSLRKHVFSTIERVFSTHGAVTIDTPVFELKEILAGKYGEDSKLIYDLQDQGGELCS
                     LRYDLTVPFARFVAMNPTEYGNIKRYHIAKVYRRDQPAMTKGRFREFYQCDFDIAGTY
                     DAMVPDAECLCVLVETLDALDIGAFTIKLNHRKLLDAIFAVCGVPDDKIRTISSAVDK
                     LDKSPWDEVKHEMVAEKGLPADVADRIGTYVLQRGSRELIAKLREDAALMQNNKAVEG
                     LADMELLFQYLDVYGVVDRVSFDLSLARGLDYYTGVIYEAITALSAPPTKEGAPAQRK
                     TKDNGELDESTVGVGSIAAGGRYDHLVGMFCGAKRPDAVPCVGVSIGVERVFSILLQR
                     LQEAQARGERTSVRQKEVDVYVMSMGDGLLLERMQVCKMLWDAGIKAEFLYKKKPKLQ
                     QQFAVVDKEQIPLAVLLAPGEWANGTVRVKQQLGKDEAGDDKGTEVPLTELAAFVQTK
                     LSPSS"
     gene            <673139..>673963
                     /locus_tag="MRET_2766"
                     /note="MRES_13290"
                     /db_xref="GeneID:38739532"
     mRNA            <673139..>673963
                     /locus_tag="MRET_2766"
                     /product="membrane fusion protein Use1"
                     /transcript_id="XM_027629393.1"
                     /db_xref="GeneID:38739532"
     CDS             673139..673963
                     /locus_tag="MRET_2766"
                     /codon_start=1
                     /product="membrane fusion protein Use1"
                     /protein_id="XP_027485203.1"
                     /db_xref="GeneID:38739532"
                     /translation="MALAAVDPFYRAREEPLVRAEHAPHNLARYLDALERMVRDEQAH
                     MASARALGAAADAERVQAIRAAAANAERMASSVPTTSEALPRIQRVREAADSLLSVVV
                     RRPAHPVPLEEYWNEYLYDGLAVHAAAPTEPEPVKEEATPPAVETPVAEAPTIEAPAL
                     RQRRPAPEATEAKPGPPRLQSDRSLQDALASELLRMAGVLKANTAAFSESLERDRVLV
                     EEASGRLDQNLGLMTRTRGQLGVFSKKARSMGWFTIGSIVCVVVCWMLMFVVIRLT"
     gene            complement(<673979..>674473)
                     /locus_tag="MRET_2767"
                     /note="MRES_13295"
                     /db_xref="GeneID:38739533"
     mRNA            complement(join(<673979..674095,674120..>674473))
                     /locus_tag="MRET_2767"
                     /product="2-iminobutanoate/2-iminopropanoate deaminase"
                     /transcript_id="XM_027629394.1"
                     /db_xref="GeneID:38739533"
     CDS             complement(join(673979..674095,674120..674473))
                     /locus_tag="MRET_2767"
                     /codon_start=1
                     /product="2-iminobutanoate/2-iminopropanoate deaminase"
                     /protein_id="XP_027485204.1"
                     /db_xref="GeneID:38739533"
                     /translation="MWVSATARAAGRCTWRPCTMVPTMINTHRSYKTISTPNAPSAIG
                     PYSQAVVHNGLAFVSGCIPFDPQTMQCVDGGVEAQAQRALDNLMAVVAAAGSDKSQVL
                     KTTVFLKDMNDFAKVNAIYEKAFAPYKPARSAVEVARLPRDVLVEVECIAAARE"
     gene            <674715..>678335
                     /locus_tag="MRET_2768"
                     /note="MRES_13300"
                     /db_xref="GeneID:38739534"
     mRNA            <674715..>678335
                     /locus_tag="MRET_2768"
                     /product="RhoGEF domain protein"
                     /transcript_id="XM_027629395.1"
                     /db_xref="GeneID:38739534"
     CDS             674715..678335
                     /locus_tag="MRET_2768"
                     /codon_start=1
                     /product="RhoGEF domain protein"
                     /protein_id="XP_027485201.1"
                     /db_xref="GeneID:38739534"
                     /translation="MSTTHEDEAASSSKITPPPLSLEGAVPAFSMPAFDGTSPASAGR
                     EAEPLPKASPSLSSSLGSASGVMPPFFTSRHRNSTDVAPETTEAPTGLRQAMRQAWHM
                     LPGFRKSSGHYGEMDESPDDGASRGARRWRDTDAPVAHGAAETSLQRIDSSASHRSLA
                     SSNESAPSPPSRTSSLQRSLHAHPMSEIPEHQEVASAPTGAPAAPGSEAVSRTTPLVP
                     LPPPPPEPPMSEKRAMFLRARTKSIDHMHKFLNLKNFAKDKARKYKRDPPPPPMMSAP
                     IGVSASDSSTSPGSTPPSTHPPDPPVQPVTIETAPLAPAPRMTGKTPPMLSPTITPVQ
                     PLAPSPSSASSRTSKPPSPSSPPSASPVAISCNEQRAEPTSVAEADANDSPAKPPSSY
                     SVTSLETRTSLATAHDSMDRSFHSPDKQLRRRSNSVPGTSMATPAQRIVSRDASDSSD
                     DRMRVGALALVSDDEEGDYEQLSPPTHDISMTSSVHDVFVEHGWSTHAPQSEHDGAQE
                     LLDNLGLDTLEAPQRRDAAPHALHLKPSMERDKIVERGTELPALPGEAFGVAHGDMPH
                     EAAEQSASAPVPATVIPSPPAAPLSAPVLSDGHDAQLEHDARSRPLTRILEPLNIKAL
                     SEQEAEATSPPWPLRYKPRSAETEPAPAPAPMPASSPRGSLDEAAGRRSEDDTSMRVP
                     RPLRGSKSSSLLTAVASQAHRIKKNAREAWPPSAHEDASFGADEEERRSLPPAPPPPP
                     PPMTSPSSQPETPMSMYRTKRNKSQPTLRIADDREFLEALEQVRMQHKERMAHRERVR
                     SSRKASMPNLRMPPSPHRPPLPMSRACSSGAEDRSGRSRAWSLASRAERESVRLSHSP
                     EPPDVSTSFLEVESVGSSSHSSVIVDEAPPGDKGEDEDSRDVVSNDDSDDHDQEEADG
                     DDDGRASSRAGSAMSDPIPNELGIGHTTGNEPSAPFTNDDDWKKEVKALFLIRELVQT
                     ERSYAAHLESLLIVVLKWAGRSSTRMQKNVLMPSQPLSTPQRTPSTTPAVPPHLVTLR
                     NMLPKLISVSRVLVYSIEDSPTSEGVARAFLSIRPRLEEVHVSWHAVVGATLRVMRST
                     EASKSKSKGRLGRVPVAPATAEIMRKNMRPDLVHGSDASPESDRRDKSRSTADAAPKE
                     LSAVDVAIMPTQRIPRYVLLLRDLLSHTRPDSEAYQVLHQALESVQELGYRCDQASTH
                     TQ"
     gene            <678444..>678809
                     /locus_tag="MRET_2769"
                     /note="MRES_13305"
                     /db_xref="GeneID:38739535"
     mRNA            join(<678444..678449,678483..678626,678657..>678809)
                     /locus_tag="MRET_2769"
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 5"
                     /transcript_id="XM_027629396.1"
                     /db_xref="GeneID:38739535"
     CDS             join(678444..678449,678483..678626,678657..678809)
                     /locus_tag="MRET_2769"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 5"
                     /protein_id="XP_027485202.1"
                     /db_xref="GeneID:38739535"
                     /translation="MASGFGVKGGPSRCFTFWQEFRKCYLTSESPSDCALPRDDYLEC
                     LHHTKELERTHQIHGRMIQLQHEESKRARDVAKHSNGLSLGLIDVDQDTQEAPQAA"
     gene            <678913..>680625
                     /locus_tag="MRET_2770"
                     /note="MRES_13310"
                     /db_xref="GeneID:38739536"
     mRNA            <678913..>680625
                     /locus_tag="MRET_2770"
                     /product="phosphatidylinositol glycan, class Q"
                     /transcript_id="XM_027629397.1"
                     /db_xref="GeneID:38739536"
     CDS             678913..680625
                     /locus_tag="MRET_2770"
                     /codon_start=1
                     /product="phosphatidylinositol glycan, class Q"
                     /protein_id="XP_027485175.1"
                     /db_xref="GeneID:38739536"
                     /translation="MSQLVAAGGAVGLTALVSCAADRLAEQRVALDAVQAEERLPSWP
                     PPSPLLPQPRPRPMLHIYWPADARAPGTVYGWSTHEVVVVACVHPDTEPRAWTHMPRV
                     RALGRCVRMQDEANEDAWLLVRLDARHMPHMRLRSSADICMLLYTPPNVLRGQSLELE
                     RATSAPYTRLEHLLAMDATRRDAIRSSSARLSTAVTYMNVASYACTCTPIPKQRTRVG
                     FPRLEMLRRASAYSLLCCALYRRLRGWGAWCEYRTLWNAVRHELKYDGRLQSQEAMQK
                     AMHACWSAWLMTLVDVALGCLLAGVMEAHSAKIHRAIVGGLACVGHASFHALFHWLAH
                     WPLGIKLNDELALFLSDALGSVSALYTYVVLEPAAAHIPSALRVWAWTSCFGASMALG
                     VGADALRVSTVHVRLMYGVLRRVLAFFVGAASELFDVFRSRKRNPLHGGRLDHAEHEV
                     DQLFVGTILFTLLAFLFPTVLLFYWACAARYFVVHATHTTLVCVVSMLYDMPLYTLLM
                     RFWDAASLSDGLVLQTRGVIRLHARPISVRDACRPVGVHVMRLSYLVRDAYHMLQGIR
                     LAPT"
     gene            complement(<680611..>681275)
                     /locus_tag="MRET_2771"
                     /note="MRES_13315"
                     /db_xref="GeneID:38739537"
     mRNA            complement(join(<680611..680669,680696..>681275))
                     /locus_tag="MRET_2771"
                     /product="Ras-related protein Rab-6A"
                     /transcript_id="XM_027629398.1"
                     /db_xref="GeneID:38739537"
     CDS             complement(join(680611..680669,680696..681275))
                     /locus_tag="MRET_2771"
                     /codon_start=1
                     /product="Ras-related protein Rab-6A"
                     /protein_id="XP_027485174.1"
                     /db_xref="GeneID:38739537"
                     /translation="MATTSGGSEYSSAMRKFKLVFLGEQSVGKTSLITRFMYDTFDGN
                     YQATIGIDFLSKTMYLDDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAIVVYDVTNRD
                     SFQSTSKWVEDVRAERGNEVIIALVGNKTDLNDKREVSTEEGEQRAKEYNNVMFLETS
                     AKAGHNVMPLFKKIAQALPGGDDAQNDSAAPHHTIDVSAQAEGESASSSCRC"
     gene            <681394..>682449
                     /locus_tag="MRET_2772"
                     /note="MRES_13320"
                     /db_xref="GeneID:38739538"
     mRNA            <681394..>682449
                     /locus_tag="MRET_2772"
                     /product="seipin"
                     /transcript_id="XM_027629399.1"
                     /db_xref="GeneID:38739538"
     CDS             681394..682449
                     /locus_tag="MRET_2772"
                     /codon_start=1
                     /product="seipin"
                     /protein_id="XP_027485002.1"
                     /db_xref="GeneID:38739538"
                     /translation="MKREVLPPRPVSRGPLRKSARRRGWVRRRSAHAPSYLDVAIQTV
                     WVYVRAIWRMLVQWPLEQCYRVTYAVFLSPTSHRIVLRMFMLCALHFTCMGLALLAFG
                     AFYYAWVPKVALSKDVWLQYGEGAPWADVRLDATPSDALVWQKEARQPMFDVDLPYDV
                     SLDLRIPVNRVNVDMGNFMVDMSLRTHDGTVLYESHRPVLLVPDPLFLRWTSRMSRML
                     WKPVLSEPVAPTQLVRVPLLRRIVPHASPIDSGPATFRQKGYLVSQAHVRIGLTTHQN
                     VILPDQPLPLALHPSVVQIEHATLRFEAYLSGAAYLLYAYPVFSLASFLVVFSSIEFG
                     VAVTIWLVSCAYFSWIA"
     gene            <682524..>683651
                     /locus_tag="MRET_2773"
                     /note="MRES_13325"
                     /db_xref="GeneID:38739539"
     mRNA            <682524..>683651
                     /locus_tag="MRET_2773"
                     /product="immunoglobulin-binding protein 1"
                     /transcript_id="XM_027629400.1"
                     /db_xref="GeneID:38739539"
     CDS             682524..683651
                     /locus_tag="MRET_2773"
                     /codon_start=1
                     /product="immunoglobulin-binding protein 1"
                     /protein_id="XP_027485176.1"
                     /db_xref="GeneID:38739539"
                     /translation="MSQDDASLTATLSAAFELASSHNAASEKVLQMLSDVARTADALS
                     VISPNDRLDEISTPALRMFLIPSLQADVQTRARIDPAEDRVTQRRKQVDASIGAARTF
                     FAMVRRHSALPDSVVTLLRPYMTKDAQQPMAPADKRMFKIQVLKLEKAAQARLVAFRD
                     AYRHRPTPPADVFYDPLVESGADDDDDTEMVPVVSATLEVPPVAHLRSYLMLLIVLHA
                     LRTANALESLLQEKELLQAPPMPEAPDAPTDTTWRLDPSWTSPASDAPLLSESGRPLR
                     PFTIIPKREQLKSEVFRPSHRLPTMSIDEYLEEETRRGRILPSTDKDAPTPRAQRQVE
                     SEQDGTRTADEAEEAARQEAIYWDAYTESHRRGEGNTMNRG"
     gene            complement(<683648..>685264)
                     /locus_tag="MRET_2774"
                     /note="MRES_13330"
                     /db_xref="GeneID:38739540"
     mRNA            complement(<683648..>685264)
                     /locus_tag="MRET_2774"
                     /product="sphingosine kinase"
                     /transcript_id="XM_027629401.1"
                     /db_xref="GeneID:38739540"
     CDS             complement(683648..685264)
                     /locus_tag="MRET_2774"
                     /codon_start=1
                     /product="sphingosine kinase"
                     /protein_id="XP_027485171.1"
                     /db_xref="GeneID:38739540"
                     /translation="MTKAASPWALPATVQGKAASVCIADRALEVVVDKSTWLHIPIEL
                     VLDVTWTSPTLSIAVVAPRRHLCHAPRVLSRTQWTERHKNAAELEPFTFEAQHVDGEG
                     AEWAAHVMQLAYHRTRPQRRVLIICNPFGGKGHAKKMLDDVVKPTFNAARCTIHVVET
                     KKRGDAYRSCESLDVSQYDALACVGGDGTLHESLNGLACRTDAAHALTLPVVPVPAGS
                     GNGLFVSLHGTAVGFSAVHACLSAIKGVPYTHELMTVTQPQDAFTSAYSCPYTLHGVG
                     PDGRSYVQYYSFMSQAIGIIADIDIGTESWRFMGDARFELGYVLSVLRNRPCPITVEV
                     CFGPSGTASRADMYHAAKKTPERIQESPLPVEDAHQLLRGSVLDPLPTADVPLRLSES
                     ARPPTDDTWTRLDVSVSSVYAGKVPFVSRGLMAFPYTCPSDGLMDVLIQDQRTSALQK
                     ISATLHGESGDHIFDRGMHYIKVHALRITPHPNTPRRFLSVDGEMVPYAPIQVEVSPL
                     RITLLTLSDDEWSAPSIRAHTIQAHASRYP"
     gene            complement(<685305..>686519)
                     /locus_tag="MRET_2775"
                     /note="MRES_13335"
                     /db_xref="GeneID:38739541"
     mRNA            complement(<685305..>686519)
                     /locus_tag="MRET_2775"
                     /product="protein disulfide-isomerase A6"
                     /transcript_id="XM_027629402.1"
                     /db_xref="GeneID:38739541"
     CDS             complement(685305..686519)
                     /locus_tag="MRET_2775"
                     /codon_start=1
                     /product="protein disulfide-isomerase A6"
                     /protein_id="XP_027485170.1"
                     /db_xref="GeneID:38739541"
                     /translation="MWLWTLVLALVAAVAQASHVLDLTQTADYDAVVGKSAGAMVEFF
                     APWCGHCKRLAPEYEKLADAFAKKKDKVVIAKVDADANRELADRIKLSGFPTLMYFPP
                     NSQQGVPYNGPRTTEALADFVTQQSQIKSSMPPPAPPAAIELNVDNFNSIVENPDLDV
                     LVEFYAPWCGHCKRLAPIYEQVARVLERDSHCVMAKIDVDDPKNAEIRTRFQIASFPT
                     LSFFPAGSSDKWPRPYLKERTAEELLAFMNEKCGTFRTLEGTLTPLAGRLPKLDGLAA
                     RFYAAVTEAARGTLLDEVKAYVQELKDHVSSTRKASAADYYVRVLERILRDGTEYVKR
                     EHERLSKMLSKQAQGLSALTGEKIDDITRKINVLSAVMNERIAKAATKATQDASSAAA
                     EATASSSAHDEL"
     gene            <686658..>687710
                     /locus_tag="MRET_2776"
                     /note="MRES_13340"
                     /db_xref="GeneID:38739542"
     mRNA            <686658..>687710
                     /locus_tag="MRET_2776"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629403.1"
                     /db_xref="GeneID:38739542"
     CDS             686658..687710
                     /locus_tag="MRET_2776"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485173.1"
                     /db_xref="GeneID:38739542"
                     /translation="MLPFVPRSVAGTKRVHPAGRPPPPPPPPKPQCHASRDMRPVAAA
                     LLNLLSPWWAAQRGVYSGNEALAELVQLATRQDVHVMQFLANPVLPRLGCTSSADLCA
                     ALEALYALHVVQQGRDAFHVRLAAADHVQVVFLEHAVEHACDALELAESVTSLVDAPH
                     VYAVVSPTATPMQVELPRRPIRDALVCLDAASAEELLLRYGWTYKSRPFGPSARCMTW
                     DQFEQRRAEYEAWRQELVRQNIQATRAAQHDHTDYPQHTIVAVMTAQSVAVDALKSRL
                     AAVAPNAIDYVDAQKPSVIYVRCASAAAAASVAQSLGPPSYVLQGAEQAAYWAQVPQR
                     VRHAAMRRSLKYTRAD"
     gene            complement(<687687..>690122)
                     /locus_tag="MRET_2777"
                     /note="MRES_13345"
                     /db_xref="GeneID:38739543"
     mRNA            complement(<687687..>690122)
                     /locus_tag="MRET_2777"
                     /product="urease"
                     /transcript_id="XM_027629404.1"
                     /db_xref="GeneID:38739543"
     CDS             complement(687687..690122)
                     /locus_tag="MRET_2777"
                     /codon_start=1
                     /product="urease"
                     /protein_id="XP_027485172.1"
                     /db_xref="GeneID:38739543"
                     /translation="MHLLPRERDKLYLREIGLLAQTRLARGLRLNETETIALLSTVLH
                     EMARSGQYTVASLMQRGKTILGYRHVRQGVAQIVHEIMIEATFPDGTFLVTVVHPICS
                     SSGSLEAALYGSGLSVPDDSIFPQIRTPEGPVPGKVMALTTAPPIQLFPGYRRRMMEI
                     TNTGDRAVQVGSHYPLPKVNQALKFPRDQAEGYKLDIAAGTAVRFEPGDTRRVTLVET
                     GPAYKARMSARDTTPLPDAPEPFSLSREAYATLYGPTTGDRVCLGDTNLWAVVERDCT
                     VYGDECTFGGGKVLRDGMGQTSGRRATDVLDTVITNALIVDYTGIIKADIGIKDGHIA
                     GIGTAGNPDTMVYVTQNMIVGSCTEVIAGEGLIVTAGGIDTHVHMLSMDMCEEGLASG
                     ILTLVGGGTGPAAGSRATTCTPGPWHIRKMLQATDTLPINILLTGKGNDSGEIPLREQ
                     IEAGCAGLKIHEDWGATCDVIDTCLRVCGEYDVQCTIHTDSLNESGFVEDTLRAIDGR
                     TIHTYHTEGAGGGHAPDIIRACGELNVLPASTNPTQPYASNTIDEHLDMLMVCHHLSK
                     NIAEDVAFADSRIRAETIAAEDVLHDIGAISIMSSDSQAMGRIGEVISRTWRLADKMK
                     AQRGPLRTTYSNDSLTDDNARIRRYIAKYTINPAVAHGISHVVGSVEVGKFADLVVYK
                     REHFGVRPEMVIKGGQIVMGNTGDSNGSIPTVQPIYLRKTFGFQPRCAAENSIAFVSK
                     VSLANVGRYGLSKRCMPVTRCTGLTKKDMLLNDTLPVIKVDPETFDVTADGQLMASEP
                     ATQVALSVGTGIF"
     gene            688967..689255
                     /locus_tag="MRET_nc0006"
                     /db_xref="GeneID:38741162"
     ncRNA           688967..689255
                     /ncRNA_class="antisense_RNA"
                     /locus_tag="MRET_nc0006"
                     /product="antisense small RNA"
                     /transcript_id="XR_003525363.1"
                     /db_xref="GeneID:38741162"
     gene            <690201..>690552
                     /locus_tag="MRET_2778"
                     /db_xref="GeneID:38739544"
     mRNA            join(<690201..690234,690267..690298,690324..690406,
                     690442..690496,690523..>690552)
                     /locus_tag="MRET_2778"
                     /product="ubiquitin-like protein Nedd8"
                     /transcript_id="XM_027629405.1"
                     /db_xref="GeneID:38739544"
     CDS             join(690201..690234,690267..690298,690324..690406,
                     690442..690496,690523..690552)
                     /locus_tag="MRET_2778"
                     /codon_start=1
                     /product="ubiquitin-like protein Nedd8"
                     /protein_id="XP_027485169.1"
                     /db_xref="GeneID:38739544"
                     /translation="MLIKVKTLTGKEIELHVESTDKILRIKERVEEKEGIPPAQQRLI
                     FGGKQMADDKVVKDYGIEGGTVLHLVLSLRGGM"
     gene            <690734..>691400
                     /locus_tag="MRET_2779"
                     /note="MRES_13350"
                     /db_xref="GeneID:38739545"
     mRNA            join(<690734..690973,691002..691130,691156..691244,
                     691269..691332,691359..>691400)
                     /locus_tag="MRET_2779"
                     /product="peroxiredoxin Q/BCP"
                     /transcript_id="XM_027629406.1"
                     /db_xref="GeneID:38739545"
     CDS             join(690734..690973,691002..691130,691156..691244,
                     691269..691332,691359..691400)
                     /locus_tag="MRET_2779"
                     /codon_start=1
                     /product="peroxiredoxin Q/BCP"
                     /protein_id="XP_027485168.1"
                     /db_xref="GeneID:38739545"
                     /translation="MADIQTRRQSARVAQKQKRSLDAPSEEAEAPSPKQTKTSTPATK
                     PLRVGDTLPSVELVDQDGKTVNVGELRKVVIFTYPKANTPGCTRQAQCFRDASSDWKQ
                     AGYDIFGLSSDSPKAQSTWAKKHALPYRLLSDPTRTVIGALTGTKASTKRSHFVVGED
                     GTLTLSTVGVKPGESSSAALMSVSPAQ"
     gene            complement(<691375..>692537)
                     /locus_tag="MRET_2780"
                     /db_xref="GeneID:38739546"
     mRNA            complement(join(<691375..692351,692382..692466,
                     692493..>692537))
                     /locus_tag="MRET_2780"
                     /product="ESCRT-I complex subunit TSG101"
                     /transcript_id="XM_027629407.1"
                     /db_xref="GeneID:38739546"
     CDS             complement(join(691375..692351,692382..692466,
                     692493..692537))
                     /locus_tag="MRET_2780"
                     /codon_start=1
                     /product="ESCRT-I complex subunit TSG101"
                     /protein_id="XP_027484859.1"
                     /db_xref="GeneID:38739546"
                     /translation="MHDLVFRWLSQVLVPYKERARIMSDMDTILTEYPTLRPRTDVYT
                     YNDGRSMLLLLLDGTIAVPFRGSVYNIPMHFWFPRVYPQEPPIVYVVPMRDMLLRSGA
                     HTTPEGCVQVPYIHTWMRKPEASSLLELVRECQAAFSLEPPVMAKRPTSPPAPPPLPR
                     QTVPAMPPLPPKANHASPRETEVPEVTMPAPPRPMNPAVTELHTKVHQQLSMRVAEMY
                     AAQTQSDAQLRMLLDDLERGAPALEDEMQRLRAVRDVCVTNTQRLSTMMDTAKRTTWE
                     LEARPEPDVDHMMSATSLVENQLLQLMADDQAIEDTLYQLSRALYSEQLSLDRFIKHT
                     RMLSREQFLKRALAQNIAHGLGWDAPLTGPATPT"
     gene            complement(<692560..>694161)
                     /locus_tag="MRET_2781"
                     /note="MRES_13355"
                     /db_xref="GeneID:38739547"
     mRNA            complement(<692560..>694161)
                     /locus_tag="MRET_2781"
                     /product="ATP-dependent RNA helicase MRH4, mitochondrial"
                     /transcript_id="XM_027629408.1"
                     /db_xref="GeneID:38739547"
     CDS             complement(692560..694161)
                     /locus_tag="MRET_2781"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase MRH4, mitochondrial"
                     /protein_id="XP_027484860.1"
                     /db_xref="GeneID:38739547"
                     /translation="MWRPHGVSLPVRWFSTGIRAGKHARTPLRHRLSHPTPRRRTSPH
                     EEARPGELPALEFAQALVPAETKTQFTSPPLSHGLLRMVHGLLGERARPTTPQAQSLA
                     HFFPRHGTARHTLIAAETGSGKTLAYLLPVLQRLHQSRSHTEHADIRHVQGGFEPCIM
                     PRALVLAPTHELARQISEVAKVLCHDASHKLRVACSSKPAYSATLQADLARLARLASF
                     SETWNGAPISPDVLVSTPSFVAEHKMLSLTNVEMLVVDEADTLLDEGFRSETMSVLQN
                     LSDSAQQLFVTATIPKSVRLFFDEACPSLVTLASPHLHHLPRRLSVMFVDPSGSKELA
                     VLKELFRVFTTPGCEHDQVLIFRDKRSSVEQLSRFLSQRNVDHVAWTGEGSDRKTRTS
                     PSLAPFLAGPSEYLARRSPPGQDAPRVLVTTSLLSRGLDFGPFLRHVFLPDAGRNTKR
                     SVHAANNNALELLHRAGRSARAGRSGTVVVFDKSSAPGKSKVLINRRGQKKGIVRGQM
                     DLLVQALRAPRPRRRWPPQRKGMST"
     gene            <694201..>695694
                     /locus_tag="MRET_2782"
                     /note="MRES_13360"
                     /db_xref="GeneID:38739548"
     mRNA            <694201..>695694
                     /locus_tag="MRET_2782"
                     /product="exopolyphosphatase"
                     /transcript_id="XM_027629409.1"
                     /db_xref="GeneID:38739548"
     CDS             694201..695694
                     /locus_tag="MRET_2782"
                     /codon_start=1
                     /product="exopolyphosphatase"
                     /protein_id="XP_027484861.1"
                     /db_xref="GeneID:38739548"
                     /translation="MAPPGRTIAQLWVAGIVVGIWLLVRRWLPLFPAKMSMLQAPHGM
                     DAYLRWAKAQAEAHWADPTKQHMTLLMGNEAGDLDSAASAIALSYVMNHEPRYFMERY
                     GLPPSVYVPVIQTPRTQLTYRRENLHVYQMIHTTPEALLCVDDLGDISSPRFGTTANV
                     SLGLVDHPRLGAAWGDKGRRVDVIVDHHEDDGSHPEAKLRVIRSPSSDPVGSAASLVA
                     NLISQAQGGRALLTEVADLLLSAIVLDTRNLKMQPSGKATDVDVHAYAYLRPHSSFGP
                     SEVDVRNGRVDTSHTKAWNEDLQRTKNDVSHLDTHALLSRDLKMTSMSGLHIGLAAVP
                     LSFSSWISGAYRTNAPVDTVREEVAEREWSVWWTQLAGFMREKGMDMAVVLLSYREAM
                     DGKTKSRRDLALAYFGQARFLEQVASSLEAFGSKKLFHDGVSLELETWKGQRRVPSGK
                     RERNMGIHGHQVSSVPGMTAVVWRQRNTNANRKIVQPALLRVLHHLL"
     gene            complement(<695689..>696249)
                     /locus_tag="MRET_2783"
                     /note="MRES_13365"
                     /db_xref="GeneID:38739549"
     mRNA            complement(<695689..>696249)
                     /locus_tag="MRET_2783"
                     /product="tyrosine-protein phosphatase SIW14"
                     /transcript_id="XM_027629410.1"
                     /db_xref="GeneID:38739549"
     CDS             complement(695689..696249)
                     /locus_tag="MRET_2783"
                     /codon_start=1
                     /product="tyrosine-protein phosphatase SIW14"
                     /protein_id="XP_027485238.1"
                     /db_xref="GeneID:38739549"
                     /translation="MEVGDVVITEGVGPLRHITRTASTETVVPPLNFDMVAPGVYRSG
                     HPNERNFSFLKRLNLKSIIYLANDDYRENVVQWAHREGIRIFHHRVTMNKEPFTEMDE
                     DEVASALTHILDERHLPVLIHCNKGKYRVGCVVGCIRRLQRWSHISLLEEYARFAGEK
                     MSDEEFIERFDLSRVKLDPVHCPSWL"
     gene            <696331..>698238
                     /locus_tag="MRET_2784"
                     /note="MRES_13370"
                     /db_xref="GeneID:38739550"
     mRNA            <696331..>698238
                     /locus_tag="MRET_2784"
                     /product="YagE family protein"
                     /transcript_id="XM_027629411.1"
                     /db_xref="GeneID:38739550"
     CDS             696331..698238
                     /locus_tag="MRET_2784"
                     /codon_start=1
                     /product="YagE family protein"
                     /protein_id="XP_027484863.1"
                     /db_xref="GeneID:38739550"
                     /translation="MAQRPGPSSGRVGEGGSQRRIPLPGISSTASALRSRRNETRVWP
                     YTDEIDDFEVETPGDAALHELPSGIIMPGVKSARMSQANASAANAAGEVPKSQPGRVT
                     ALKTGAMWASRAPPPKLPGSKPGFQFKGTPMRVPRYSLPVRAEKPVRASKVTGRHVLL
                     PSESQLAPMAMAEKPNKAGEEEEDDEEDEEDEEDENDVSQQPWEQRKGPVYYTFERMP
                     PLTRATTELPRLTSYAVSTSLNLRAVLAFLRREHGVRPRLYEGCVYALYFKPLLPGFG
                     RASVRSSRAPQTGSPGQESRHEREIQRDEESGYVGDYFVPQEEQEMDTNGYIPDEHQA
                     MDAPAPQASVAEPSDPDSAGARDMLLADEADERHESQHRRRRRRVVRINEASHTHAAE
                     PNEHAPQSIKDALDMAELVLLPYGVLVMFNFTQEEEELVIADIMQSGAIRNPHKMYDR
                     ELFHFCYDPNVRAPRIHNDFFTFREPNHLLKLSLAHAIAQSTKLSEFEESMHKTLELT
                     SHIPRELAQTGELRVSRRGALRMSGHLFKLRVDVNLTSDVLDTPDLFWDEASLQALYD
                     AIRAYLEIDDRAQTLNERLAVANELLEVIHEHFSNAAMSKITWIIIILIVVACIVAVG
                     EISARLILHAR"
     gene            <698737..>702840
                     /locus_tag="MRET_2785"
                     /note="MRES_13375"
                     /db_xref="GeneID:38739551"
     mRNA            <698737..>702840
                     /locus_tag="MRET_2785"
                     /product="vacuolar protein sorting-associated protein 54"
                     /transcript_id="XM_027629412.1"
                     /db_xref="GeneID:38739551"
     CDS             698737..702840
                     /locus_tag="MRET_2785"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 54"
                     /protein_id="XP_027484864.1"
                     /db_xref="GeneID:38739551"
                     /translation="MPTEEAAAPRDTQEDGSLSFTGLYAISTMLNHPWKKAAPIHAGS
                     ARFPPIGPASGHALPQMPPTDMHVLDEYVSEFSDEWNRYEREHALIRAHNATPSALPK
                     HLPPLSTVPQVFFSSDFDLGQPYTFDLVTERYKQSTTMGIEGDADVLQYGVVMNHMLQ
                     EKLSYYSDVIEQHLIVEIGAKSASFFDALATLHQLRTDAQSCLERTHSVSRKLHAVDA
                     YVRDGLEIARLQAERRDLEAQQDLLTQVQKLLERRDLVRLSVQHDEFENAMTLLEDLY
                     RVLDDASLPLHQLECLKGIRPQLEAEQGKMSECLQGDLAGILERALWADDMDVGCVQA
                     TSALDSVLSPPQTMNITLPADLLPVWSLLERCGGLPAALQSYTQRIDDLLIRGVRRLV
                     QPHDFAACAAPGSETPPRTWPEYMRALAAVLRALWLYAQCMQSVHDALNREVGRNVLT
                     DATQAIWSACERVTADVISLTRAPPLSQLGRDAFIVYFALVWRSMQQIEAASSQPSVS
                     LRSRVLSQAKTYLSQFHRVRVERAVRAIEDEVWTPIPVSAELQHTVQQLVEIASSDVP
                     TYCVPLTLDGEAPHDAVVESEQQRQLLVGSDSYFVVRASGQVIELLSDYARVIVNMPT
                     FAVEALGWVVEFLKQFNSRTCQVVLGAGAMRSAGLKNITARHLAIAAQSLSLMMALVP
                     SLRELLKRHLKPSQFVLLSDFDKLQNDFREHQYEIHAKLVSIMGDRVQVHSKALANTD
                     VNKCDGHLQPIQDLVRETGTLFRVMTQFLQPAVVQTISTRVFTDIDMRMAHAITAVDV
                     RTLDAHKLLISDVELLNEKMHAIDASWRGDKVTEAAKAKRPRLSIDARREGTPTLAYK
                     ARKSFGKRPPATQSPQIETNEAFQAPPESKPAEKGQDEEAKQKTPQPSIPENKAPNEP
                     ATNEPAANEPAANEAQESVPSTEAENTAEGKAEDKVLSPSTPATPSGPKSNADERVET
                     PLLPSQVVAGNAPLENATPTKPKDATFTPTPRKGRVSLEQRLAEAAKRRGAQRIQTQQ
                     AKEMPSPPSTPLSSKPSLAERLAGATKQDTKDSDESSSRTKETSKETGELKRENTSEL
                     QHIEEPNAETSGANKEPSQEKETSHAGERKTKQHDKTQDLSARKQPNEVERGNDQEVG
                     AVKELRDNQKNASVEELGQTEEPRLEEKTTRFAETVGAKEPSDAKQPSNFEENSHALE
                     PIKGEAFSESKGPSDGTSKDSAEQSKDQKPRNDMEPSLAGKFNKAEGPCDMLELDRGS
                     GDAKPEHAKEPSETKEPLDTKEATNQSHSDESGEPGSTSDTNRMNESESLLEHSLEPK
                     PNASSESTETSEPTGTTIRSDRVDSSQATPTDLAAESAEEPSTIASS"
     gene            complement(<702856..>706763)
                     /locus_tag="MRET_2786"
                     /note="MRES_13380"
                     /db_xref="GeneID:38739552"
     mRNA            complement(join(<702856..706664,706697..>706763))
                     /locus_tag="MRET_2786"
                     /product="BTB domain and ankyrin repeat protein"
                     /transcript_id="XM_027629413.1"
                     /db_xref="GeneID:38739552"
     CDS             complement(join(702856..706664,706697..706763))
                     /locus_tag="MRET_2786"
                     /codon_start=1
                     /product="BTB domain and ankyrin repeat protein"
                     /protein_id="XP_027484865.1"
                     /db_xref="GeneID:38739552"
                     /translation="MLSVPSLLDCWSVRDIARFRRVLKGNPSERSSSHGRSPASFGTS
                     ASGLSHGPCAPAEVNRRDHFGRTVLHLLCASDDPLATEFLQLLLTHPSVNVNLQDEES
                     GWTALHRALYAGHIHIALILLERTDIDYYIKDWEGLTAFDLYNTTVEGTCPSNMDEGS
                     GADLFVWGGNRNYTLGLSHGNDSALPERVKLKCNERRTPLIAGARFNRPHVRDISMSR
                     WHTVLATNEPRKNVYVCGIGSQARLGRSAQSLPTFEPLRDFSDTANIVVAGSDHTIIV
                     TETGAVYTFGSNRMAQLGYAIEEGLGVVSSSSGTKRSGATSHPNQHSLQGPVSDVSGV
                     ELDLQVTPRRVQGPLKREVIIGAAASRLHSVAYTASALYTWGTNNGQLGYDRHSAPVQ
                     VQPRRVTVVSVPVRQVAATEFATACLLESWDVMLLHGDANYRVMFPSPRVTSDVGMFR
                     PRQMQPKPCIRKLTCSGTTFAALSDLGDLFTFHVEHSSTTGAKVVPPRPHLVWSVRRK
                     FSAVRDVAIGNDNALILCTADGHVYVRAQKLELKVKSRTPKFQLVPYLQRIVQVRANV
                     TGSFAAMQVPWRLPTIPIRGRSLEQDLVSLVSPIQGMLIAGPVACETLHTDNGDENEE
                     DLSNSHVPRYVSQAKALLSHINEARSKFVSRDNASHHDAVLLVEHGAYAIPVHRLMLA
                     LRIPNLASVVWRGGEAYGVKVRDAHTVDCGKLSFASAMFLLLYLYTDDMPPVWCASVG
                     YLVAEQARQADFDVRLVYSELYEWATSLSMTALQEFLASRLVKPPRQTLHPQLHELFE
                     GLLTQKPLPGADVVLHLADADITCHSIFLRRSPMLESLLDWRAMRGDSGYVHIDMPHW
                     TWPIMRVGLAFLYMDADTAAFQGTDEDKSPDQFIDFVLDVLQLADELLLEKLQHITYG
                     FLSPRVKPTNVAALLSDALRLNAPAFSQVCMEYATRHLETLLEMGCLSSLDVRERRIL
                     AEYIQAQQDRVLHRSLARDRMLALSIKHQDYIAELDLPKPSLNLACLKVPKRMKSPRI
                     APVDDMPAPSTPSLQLQGDESLLFTMDDVAPEPLPEPAWQTVGARPPRQPRRSSDAPL
                     ASSPPMSAPRSSQKEQRPMGLSPPSTTSPITPGAQTSVIQMSLATKVTQKERKKQQQQ
                     QQQRALSSESRPAWKPTSSKSRKSDVWGTSPSSLPGPSLPGTPPAQSFAEIQAQQQAA
                     MVQQRAQQIKPKSFAQILHEERVAQQQADRDRQEAEAFERWFEEESRRVQEQEARLAQ
                     RGDQSRRGRPRRGRRRGKANPAMARIDDD"
     gene            <707048..>708493
                     /locus_tag="MRET_2787"
                     /note="MRES_13385"
                     /db_xref="GeneID:38739553"
     mRNA            <707048..>708493
                     /locus_tag="MRET_2787"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629414.1"
                     /db_xref="GeneID:38739553"
     CDS             707048..708493
                     /locus_tag="MRET_2787"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484866.1"
                     /db_xref="GeneID:38739553"
                     /translation="MGASYVLSRLFVSGKEQQQQQPSQKAKREARKRWSLPIKRSKTP
                     HRDSVDVKKPETFKQDMEQPIPKIVLESSPRDTQTVRDGFPTNLTEPVVQDEHAMTEE
                     QDMPNPHAPVAPEVPLAVQDEAAPRKANDQEPAAGHESTIEAPAPPSKGDTVASALPP
                     NGTPAAEEDVLAQRNVFLQHCQTLLYLKRVVQGQEPYVYSVRFRPDDFTSTVPLHALK
                     VWNFNSGKVYKALEHARQVTWPHEVLEVVSAIVEEVSTVAVVEEAIPEANVPLPIIES
                     LSVLLDALDGVYAKLLMWLDKDALRNLSGQPCSVPVVPSCELLDILQHTDRKLKKFIK
                     CIAKDLSFVARSVCHNEMGEWDKILCDQNLDWEDLSVQLQTRTERHSSGSSHTESLHE
                     TTSPPNATSPLTSNISMLETGSHDNGTRAHIQRSSVLGHFVRGKDVRRQNVTKELCAV
                     MKHPWSKRGDNNKQDNFSMTGPMFGRVSMEA"
     gene            708646..708729
                     /locus_tag="MRET_t0046"
                     /db_xref="GeneID:38741240"
     tRNA            708646..708729
                     /locus_tag="MRET_t0046"
                     /product="tRNA-Val"
                     /db_xref="GeneID:38741240"
     gene            complement(<708795..>710290)
                     /locus_tag="MRET_2788"
                     /note="MRES_13390"
                     /db_xref="GeneID:38739554"
     mRNA            complement(join(<708795..708813,708846..709375,
                     709538..>710290))
                     /locus_tag="MRET_2788"
                     /product="Obg-like ATPase 1"
                     /transcript_id="XM_027629415.1"
                     /db_xref="GeneID:38739554"
     CDS             complement(join(708795..708813,708846..709375,
                     709538..710290))
                     /locus_tag="MRET_2788"
                     /codon_start=1
                     /product="Obg-like ATPase 1"
                     /protein_id="XP_027484867.1"
                     /db_xref="GeneID:38739554"
                     /translation="MLGAFCARSWLKQRQLIAPVCRSYLHTTATVEKKAKKMAPKKNQ
                     QVVEKPRLGRPSNNLKMGIVGLPNVGKSTLFNTVAKCDLGKAANFPYATIEPEETRVY
                     VPDDRFLWLCDLYKPKSEVPAFLTVIDIAGLTSGASTGVGLGNAFLANVRAVDGIFQV
                     IRAFDDADIVHVEGDVDPTRDMEIISTELRLKDIEWVEKALDNARKNARSAGNNSLED
                     RKKKEEVAIIEKVLKCLQEDNMDVRKGDWNAKEVDVINSLLLLTAKPVIYLVNLSERD
                     YARKKNKWLPKIKQWIDENNPGDQLIPFSAALEEQLFTISDENELKEYLAKLGEGVQS
                     ALPKITKSGYDALDLIRYFTAGPDEVRAWSIRRGVKAPQAAGVIHSDFENKFVCGEIM
                     AFNDLKEAGSENACRANGKLVQKGKTYEMVDGDIAHWKAGA"
     gene            <710435..>710797
                     /locus_tag="MRET_2789"
                     /note="MRES_13395"
                     /db_xref="GeneID:38739555"
     mRNA            <710435..>710797
                     /locus_tag="MRET_2789"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629416.1"
                     /db_xref="GeneID:38739555"
     CDS             710435..710797
                     /locus_tag="MRET_2789"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485240.1"
                     /db_xref="GeneID:38739555"
                     /translation="MRWVFVVALLTVLALAVSAQEDERVKISMLLERRQALGGGAGKP
                     DTTTATTPASISGYTPPPRSTTPTPTNFKKGSILSLEDVDGYKEAKEFAQSSGVMTLA
                     PAVLVTGALAIVGGAIFL"
     gene            complement(<710916..>712047)
                     /locus_tag="MRET_2790"
                     /note="MRES_13400"
                     /db_xref="GeneID:38739556"
     mRNA            complement(join(<710916..711796,711822..>712047))
                     /locus_tag="MRET_2790"
                     /product="ribonuclease H2 subunit A"
                     /transcript_id="XM_027629417.1"
                     /db_xref="GeneID:38739556"
     CDS             complement(join(710916..711796,711822..712047))
                     /locus_tag="MRET_2790"
                     /codon_start=1
                     /product="ribonuclease H2 subunit A"
                     /protein_id="XP_027484839.1"
                     /db_xref="GeneID:38739556"
                     /translation="MLDAVPSVRATALTQSYTWRSHIPDACVSGTGHRRAPCVLGVDE
                     AGRGPVLGPLVYGVAFCPLNAQEGLRDLGFADSKTLTPARRDELLQALLREPSMGWAV
                     RVMSPQDISAGMMRRVPYNLNEQSCDATVQLIQGVLDAGIDVTHIFVDTVGEPTAYAA
                     KLKRHFPRYGHIEWKVARKADATYPIVGAASIAAKVTRDACLDNWVYAEQRLSSAALG
                     KRKRSDDDAWETGSGYPGDPKTVRYLKETLDPVFGWTGIVRFSWATAKSMLEEPVKTP
                     IPTTSILGTAYPPSSTRAFKVEWSDEAKAPKPQKSIASYFKAAAPNKQHMGTGAAASQ
                     SSGIHQRDRKMLSEHTSSLWRQLALSAATDADLF"
     gene            <712167..>714503
                     /locus_tag="MRET_2791"
                     /note="MRES_13405"
                     /db_xref="GeneID:38739557"
     mRNA            <712167..>714503
                     /locus_tag="MRET_2791"
                     /product="exosome complex exonuclease RRP6"
                     /transcript_id="XM_027629418.1"
                     /db_xref="GeneID:38739557"
     CDS             712167..714503
                     /locus_tag="MRET_2791"
                     /codon_start=1
                     /product="exosome complex exonuclease RRP6"
                     /protein_id="XP_027484838.1"
                     /db_xref="GeneID:38739557"
                     /translation="MEKRLSEVSEVLEPATRTAGLLPTSTDLDFYCSIDPGVKQALDG
                     VSGDLDDVLSTMTAWMGSERQRMDSMMDAASFSAQAGETIDRLLERTDVYLDEYAGRR
                     PIAPKDEPVVPSTGKLPKSLLFPKIPKPQDAFSRRPDNRACAPWTRQLRFGKPNARVP
                     LGWRDPAWDMPEHATVEGQYGTEGDARLNAYYVEIQQTPIPASAYRVDEPRAPEPLDL
                     DEPDASLTWVDSLDKLHALAAHLEEARVTEIAIDLEHHSHRTYLGLVCLMQISTRWGD
                     WIVDTLVDEVREHAEMLNASFTHPDKVLVLHGADHDILWLQRDLGLFVTNLFDTFQAA
                     RVLQFGSLSLAYLLLRYTGFEADKRFQTADWRIRPLPREMLFYARSDTHSLLYVYDCL
                     RLDLERYAGHSAITDVFERSKATASKTYIKVPWDAQGDSRNGWRTLWLRLGGDLARAA
                     QDAPPGTPLSREERILRRLHQWRDEKAREDDERPAFVLSDEVLISLALRPPLTLPEAH
                     TRTPMRLRKSVQRMHELVDAVKAEWEAYQAGLQPSMPKTDVAVDEDLGERYVRDEEGW
                     TEAGVQVGVWDAQAPQSRADAQLFRGLHVSSQAAPSTKRKSLFEMPSARTPSHAAATL
                     RRIQSEFVQRLGSLVGRGPERAGEPEEPEEPVKPEGPVDEKPVDEKPVEPEDAAPIPP
                     EAHETTVVKHDRDKDDDGIVRVSKHIKVRAPKTKKSQAAPVPFDYAQATSVLDAPRSG
                     SEASLLAPTKAAAEPRGARPKNLKRSGQRSGTFARRNK"
     gene            complement(<714527..>717118)
                     /locus_tag="MRET_2792"
                     /note="MRES_13410"
                     /db_xref="GeneID:38739558"
     mRNA            complement(<714527..>717118)
                     /locus_tag="MRET_2792"
                     /product="cellulase (glycosyl hydrolase family 5)"
                     /transcript_id="XM_027629419.1"
                     /db_xref="GeneID:38739558"
     CDS             complement(714527..717118)
                     /locus_tag="MRET_2792"
                     /codon_start=1
                     /product="cellulase (glycosyl hydrolase family 5)"
                     /protein_id="XP_027484837.1"
                     /db_xref="GeneID:38739558"
                     /translation="MSNQGHYLFGPNANISVRGEKNSDALNQDNSRHSSASLNFHDAP
                     TFIAQPSAEAFGSSSSATVHNTVSPASPSQPPAPLHYEASRSPVSNAMQAPSDSAGPD
                     AHAQGRTVVGGKRASRPIKTNPYGAAAPNGYASGHAPPVRMAGSPPLAPQSKRHSRPK
                     DLPSIPAAKDSDARVHDTNMSPSKSGTLPGRDSSAQQATLADSTLTSSKSKSGQAKSG
                     QAHAPGTQGASVSEAPTIKQAKPNQSARRSSTTARVADESAEAPLSPSKPTNPFTQPS
                     LRASSAHHGNLTGVGAGTGLAASSAWPSNHQAGTAMPPSRATLAQRAPAPAGPDAGAT
                     SPAQAARSQTAAAPTASTAARESRNASRGGAPPTSYPAHDHADYGEKPVAARSRPFRW
                     LPWLIAAVVAAVVLGVALGVGLGVGLSNDDDSDKNNLATPPDRADSSSPSKDGNGDKD
                     GDEDKGGKSDDGPRKAPLPDPLPAWNWTSTKNKVFGTNLGGLFLLERWMYEDWMVEQG
                     GPDAWDEYSMSKNLGADKMQSVLRNHLDSWFTEDDMNTLQDAGVNMLRIPMGYWPFFS
                     AQEVGEPYQNASHLDKLSEIMYGAWNRSIYVLIDLHGMPGSQNNDQSSGHNRTNLGNT
                     IEWYSSKNQKYSRQTVKNLLSWLDSHPAKSVVAGVTTVNEPKINSNDDYDSILRDFYD
                     FSIEQLKPFKIPLIAHHGFVGNPYKYWKSYASDQELGTFIFDDHPYPGWFQNPEPTDK
                     DDMLSRICNFGNKMERFPAPVLMGEFSAISILNSTDWTTDYLSTQLKVFGWSAGSTFF
                     NFRLNETQNPVLSEPFAIGSKYSMLEMLRDNNPTGRFPRRNVSMPVVEWTNSLTSHCG
                     SDPEISW"
     gene            complement(<717639..>718928)
                     /locus_tag="MRET_2793"
                     /note="MRES_13415"
                     /db_xref="GeneID:38739559"
     mRNA            complement(<717639..>718928)
                     /locus_tag="MRET_2793"
                     /product="cellulase (glycosyl hydrolase family 5)"
                     /transcript_id="XM_027629420.1"
                     /db_xref="GeneID:38739559"
     CDS             complement(717639..718928)
                     /locus_tag="MRET_2793"
                     /codon_start=1
                     /product="cellulase (glycosyl hydrolase family 5)"
                     /protein_id="XP_027484836.1"
                     /db_xref="GeneID:38739559"
                     /translation="MCRRSAMLYRMLSCALLALLAATLFVRAATIKMPANSDIAKRDL
                     PKWDWTKDKVYGTNLGGLFLLERWMYEDWMVEKGGDDAWDEYTMSKNVGDGMYDILNE
                     HFDSWFTEDDMDTLADAGVNMLRIPIGYWPFVSADEAGEPYKTASHLDKLSQIMKWSQ
                     DRHMYVLLDLHGMPGSQNNDQSSGRNHTSNDNKQVADWYSDHNQRLSRKVVHKMLDWL
                     DSQPSKSVVAGITTVNEPKVYDNGDYQGKLFDFYGFSIDALKPHGIPLIAHHAFVSNP
                     YGYWRDFAQKQETGTFVLDDHPYPAWFQSPEPTDEGQIFGSVCRFRDSMANFPAPVLM
                     GEFSAISALDKDDWVERYVKTQLKVYGWSAGSMFFNFKMKDSGRRILGLSSESNKKYS
                     MLRLIEDTIPNRDTSKSVKDWTNSLSDECGDDPNIHW"
     gene            complement(<719128..>720396)
                     /locus_tag="MRET_2794"
                     /note="MRES_13420"
                     /db_xref="GeneID:38739560"
     mRNA            complement(join(<719128..720194,720224..720272,
                     720304..720366,720391..>720396))
                     /locus_tag="MRET_2794"
                     /product="ATP-dependent RNA helicase"
                     /transcript_id="XM_027629421.1"
                     /db_xref="GeneID:38739560"
     CDS             complement(join(719128..720194,720224..720272,
                     720304..720366,720391..720396))
                     /locus_tag="MRET_2794"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_027484835.1"
                     /db_xref="GeneID:38739560"
                     /translation="MTDIHADQIVFESSEEVTIAPTFDALGLKENLLRGIYAYNFEKP
                     SAIQQRAILPILRGRDVIAQAQSGTGKTATFSISMLQTIDVSLRETQALVLSPTRELA
                     TQIQSVVLALGDYMNVQCHACIGGTSIGEDIRKLEYGQHIVSGTPGRVFDMIRRRHLR
                     TKNIKMLIMDESDELLNMGFKDQIYDIYRYLPPATQVVLVSATLPHDVLEITTKFMTD
                     PVRILVKRDELTLEGIKQFFVAVEKEDWKFDTLCDLYDTLTITQAVIFCNTRRKVDWL
                     TDRMRENNFQVSSMHGEMQQRERDAIMSEFRQGGSRVLITTDVWARGIDVQNVSLVIN
                     YDLPTNRENYIHRIGRSGRFGRKGVAINFVTTEDVKTLRDIEQYYSTQIDEMPMKIDD
                     LM"
     gene            <720498..>722065
                     /locus_tag="MRET_2795"
                     /note="MRES_13425"
                     /db_xref="GeneID:38739561"
     mRNA            join(<720498..721988,722015..>722065)
                     /locus_tag="MRET_2795"
                     /product="splicing factor 3A subunit 3"
                     /transcript_id="XM_027629422.1"
                     /db_xref="GeneID:38739561"
     CDS             join(720498..721988,722015..722065)
                     /locus_tag="MRET_2795"
                     /codon_start=1
                     /product="splicing factor 3A subunit 3"
                     /protein_id="XP_027484834.1"
                     /db_xref="GeneID:38739561"
                     /translation="MAETSVYESARMTHEEIEQYEDALVNTLNNPPRASSHRLQMQWQ
                     LASSQLLDQIVTRYDALQDMYEDASGERAREWEALAGDVDDEDGAMAKFYARLEHLQA
                     YYQKYPERAISLETTATPSILGAQDASLFDFSIMEREFSGEEMGGRFLDLYEPYEMFI
                     NLRNVPHISYLEYLAQLDSMMSVPLATKRSEAYKVYLTRLREYLSAFLHKTRPLEDMD
                     APEAAALRAFEDDWEHGRVPGWETKEAALYGTGNSESGIWCDACQRFYAKQTVYDAHL
                     SSARHLKAVRRLQSGEQPAAPQPRESDMEQKKHAQRAKQIARDEVLVRALAMELASVR
                     DETRANIERKASLTEREREEEVEAMEAEMDEAMETGGMGYEDAGEDVEGGGGEKTYNP
                     LKLPIGWDGKPIPFWMYKLHGLRVEYRCEICSDHVYKGRKVFEKHFQESRHAFGMRAL
                     GLPNTPEFRDVTRIQDAFALAEKLRQQKRLQDVEEDDTIEVEDEHGNAYTRKTFELLQ
                     RQGLL"
     gene            <722180..>724025
                     /locus_tag="MRET_2796"
                     /db_xref="GeneID:38739562"
     mRNA            join(<722180..722287,722317..722410,722437..>724025)
                     /locus_tag="MRET_2796"
                     /product="transcription regulator staf-5 like protein"
                     /transcript_id="XM_027629423.1"
                     /db_xref="GeneID:38739562"
     CDS             join(722180..722287,722317..722410,722437..724025)
                     /locus_tag="MRET_2796"
                     /codon_start=1
                     /product="transcription regulator staf-5 like protein"
                     /protein_id="XP_027484833.1"
                     /db_xref="GeneID:38739562"
                     /translation="MGAQQLEPSASPASVADSRTSGSRQSNKKRAQSLNHLLAFTLPP
                     REPPATAPRRPRRHDGFRPFSRERYVNAQFRFAVRPSFDSRRHMQDPDLPLPWQDIVQ
                     VLVPSTADTWMRHGMSSSASSVDSTQATTCPICLSPPTAPRMTRCGHVYCYACILHYL
                     TVAENGKGTRGVQRYVKRCPVCWDDVMARDLKSVRWIDAQSLADLHTAAFLDGRGEVG
                     DMSDILTLRLMERPHDSVIALPRSPHWPVDTSLGLPCTQPDALAFARCVLASRSLVTS
                     SLESDIASVQKDMSPPHASLLDELSLEFLRVAHTQLMEQWEQAQALPESVGTQCVPDE
                     QRQGMSYFYYQAASGQNVFIHPIDIKVLLSHFGTYAAFPDTLMVAVQHAEEGTVDESL
                     RKKCKYMAHLPMSADVTFVEIDWARTSSVLGQIQGDIPWKSWSSTLAQRRQRHHEKAT
                     KEERARIRADKDTKNTMLKSSSRGGSASDAARDTSGMSFRESAMVGAEMYFPIHPGRL
                     ADDPDVVFPSVTSHPPNHVPNDGPRTVWGTPATATMPTPSQGARDVDEAWNALEARAQ
                     DDASMPPSGTKQRPKRKPKLILTGGGRGAL"
     gene            complement(<724430..>725137)
                     /locus_tag="MRET_2797"
                     /db_xref="GeneID:38739563"
     mRNA            complement(<724430..>725137)
                     /locus_tag="MRET_2797"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629424.1"
                     /db_xref="GeneID:38739563"
     CDS             complement(724430..725137)
                     /locus_tag="MRET_2797"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484832.1"
                     /db_xref="GeneID:38739563"
                     /translation="MRLAYLAAALFPLAARAGWITFQNENKQKEGIPCVGSVYGNDNW
                     LVSQFDCNAMDWNGTMCDMKCFPISSTMCLGFARDVEREVYGVSTGIWYAPHGVDSAC
                     LYLGSVYGANYSDRIGPNTTACGYIDWPETRGFGPVKRKDNGDQYTKGCWDTHNKPDP
                     RYKQNSVHFYEGARPLNQEWCEKGYANECGEDTDMHCRPDNRYETQISCLPGLKKPLN
                     PEIPRNKDKIPGLNKHA"
     gene            725578..725696
                     /locus_tag="MRET_r0001"
                     /db_xref="GeneID:38741166"
     rRNA            725578..725696
                     /locus_tag="MRET_r0001"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_003525367.1"
                     /db_xref="GeneID:38741166"
     gene            726917..728695
                     /locus_tag="MRET_r0002"
                     /db_xref="GeneID:38741167"
     rRNA            726917..728695
                     /locus_tag="MRET_r0002"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_003525368.1"
                     /db_xref="GeneID:38741167"
     gene            728907..729060
                     /locus_tag="MRET_r0003"
                     /db_xref="GeneID:38741168"
     rRNA            728907..729060
                     /locus_tag="MRET_r0003"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_003525369.1"
                     /db_xref="GeneID:38741168"
     gene            729341..732712
                     /locus_tag="MRET_r0004"
                     /db_xref="GeneID:38741169"
     rRNA            729341..732712
                     /locus_tag="MRET_r0004"
                     /product="28S ribosomal RNA"
                     /transcript_id="XR_003525370.1"
                     /db_xref="GeneID:38741169"
     gene            733330..733448
                     /locus_tag="MRET_r0005"
                     /db_xref="GeneID:38741170"
     rRNA            733330..733448
                     /locus_tag="MRET_r0005"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_003525371.1"
                     /db_xref="GeneID:38741170"
     gene            734669..736447
                     /locus_tag="MRET_r0006"
                     /db_xref="GeneID:38741171"
     rRNA            734669..736447
                     /locus_tag="MRET_r0006"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_003525372.1"
                     /db_xref="GeneID:38741171"
     gene            736659..736812
                     /locus_tag="MRET_r0007"
                     /db_xref="GeneID:38741172"
     rRNA            736659..736812
                     /locus_tag="MRET_r0007"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_003525373.1"
                     /db_xref="GeneID:38741172"
     gene            737093..740464
                     /locus_tag="MRET_r0008"
                     /db_xref="GeneID:38741173"
     rRNA            737093..740464
                     /locus_tag="MRET_r0008"
                     /product="28S ribosomal RNA"
                     /transcript_id="XR_003525374.1"
                     /db_xref="GeneID:38741173"
     gene            741082..741200
                     /locus_tag="MRET_r0009"
                     /db_xref="GeneID:38741174"
     rRNA            741082..741200
                     /locus_tag="MRET_r0009"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_003525375.1"
                     /db_xref="GeneID:38741174"
     gene            742421..744199
                     /locus_tag="MRET_r0010"
                     /db_xref="GeneID:38741175"
     rRNA            742421..744199
                     /locus_tag="MRET_r0010"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_003525376.1"
                     /db_xref="GeneID:38741175"
     gene            744411..744564
                     /locus_tag="MRET_r0011"
                     /db_xref="GeneID:38741176"
     rRNA            744411..744564
                     /locus_tag="MRET_r0011"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_003525377.1"
                     /db_xref="GeneID:38741176"
     gene            744845..748216
                     /locus_tag="MRET_r0012"
                     /db_xref="GeneID:38741177"
     rRNA            744845..748216
                     /locus_tag="MRET_r0012"
                     /product="28S ribosomal RNA"
                     /transcript_id="XR_003525378.1"
                     /db_xref="GeneID:38741177"
     gene            748836..748954
                     /locus_tag="MRET_r0013"
                     /db_xref="GeneID:38741178"
     rRNA            748836..748954
                     /locus_tag="MRET_r0013"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_003525379.1"
                     /db_xref="GeneID:38741178"
     gene            750174..751952
                     /locus_tag="MRET_r0014"
                     /db_xref="GeneID:38741179"
     rRNA            750174..751952
                     /locus_tag="MRET_r0014"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_003525380.1"
                     /db_xref="GeneID:38741179"
     gene            752164..752317
                     /locus_tag="MRET_r0015"
                     /db_xref="GeneID:38741180"
     rRNA            752164..752317
                     /locus_tag="MRET_r0015"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_003525381.1"
                     /db_xref="GeneID:38741180"
     gene            752598..755969
                     /locus_tag="MRET_r0016"
                     /db_xref="GeneID:38741181"
     rRNA            752598..755969
                     /locus_tag="MRET_r0016"
                     /product="28S ribosomal RNA"
                     /transcript_id="XR_003525382.1"
                     /db_xref="GeneID:38741181"
     gene            756585..756703
                     /locus_tag="MRET_r0017"
                     /db_xref="GeneID:38741182"
     rRNA            756585..756703
                     /locus_tag="MRET_r0017"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_003525383.1"
                     /db_xref="GeneID:38741182"
     gene            757924..759702
                     /locus_tag="MRET_r0018"
                     /db_xref="GeneID:38741183"
     rRNA            757924..759702
                     /locus_tag="MRET_r0018"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_003525384.1"
                     /db_xref="GeneID:38741183"
     gene            759914..760067
                     /locus_tag="MRET_r0019"
                     /db_xref="GeneID:38741184"
     rRNA            759914..760067
                     /locus_tag="MRET_r0019"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_003525385.1"
                     /db_xref="GeneID:38741184"
     gene            760348..763719
                     /locus_tag="MRET_r0020"
                     /db_xref="GeneID:38741185"
     rRNA            760348..763719
                     /locus_tag="MRET_r0020"
                     /product="28S ribosomal RNA"
                     /transcript_id="XR_003525386.1"
                     /db_xref="GeneID:38741185"
     gene            764335..764453
                     /locus_tag="MRET_r0021"
                     /db_xref="GeneID:38741186"
     rRNA            764335..764453
                     /locus_tag="MRET_r0021"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_003525387.1"
                     /db_xref="GeneID:38741186"
     gene            765674..767452
                     /locus_tag="MRET_r0022"
                     /db_xref="GeneID:38741187"
     rRNA            765674..767452
                     /locus_tag="MRET_r0022"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_003525388.1"
                     /db_xref="GeneID:38741187"
     gene            767664..767817
                     /locus_tag="MRET_r0023"
                     /db_xref="GeneID:38741188"
     rRNA            767664..767817
                     /locus_tag="MRET_r0023"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_003525389.1"
                     /db_xref="GeneID:38741188"
     gene            768098..771469
                     /locus_tag="MRET_r0024"
                     /db_xref="GeneID:38741189"
     rRNA            768098..771469
                     /locus_tag="MRET_r0024"
                     /product="28S ribosomal RNA"
                     /transcript_id="XR_003525390.1"
                     /db_xref="GeneID:38741189"
     gene            772085..772203
                     /locus_tag="MRET_r0025"
                     /db_xref="GeneID:38741190"
     rRNA            772085..772203
                     /locus_tag="MRET_r0025"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_003525391.1"
                     /db_xref="GeneID:38741190"
     gene            773424..775202
                     /locus_tag="MRET_r0026"
                     /db_xref="GeneID:38741191"
     rRNA            773424..775202
                     /locus_tag="MRET_r0026"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_003525392.1"
                     /db_xref="GeneID:38741191"
     gene            775414..775567
                     /locus_tag="MRET_r0027"
                     /db_xref="GeneID:38741192"
     rRNA            775414..775567
                     /locus_tag="MRET_r0027"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_003525393.1"
                     /db_xref="GeneID:38741192"
     gene            775848..779219
                     /locus_tag="MRET_r0028"
                     /db_xref="GeneID:38741193"
     rRNA            775848..779219
                     /locus_tag="MRET_r0028"
                     /product="28S ribosomal RNA"
                     /transcript_id="XR_003525394.1"
                     /db_xref="GeneID:38741193"
     gene            779837..779955
                     /locus_tag="MRET_r0029"
                     /db_xref="GeneID:38741194"
     rRNA            779837..779955
                     /locus_tag="MRET_r0029"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_003525395.1"
                     /db_xref="GeneID:38741194"
     gene            <780396..>781400
                     /locus_tag="MRET_2798"
                     /note="MRES_13430"
                     /db_xref="GeneID:38739564"
     mRNA            <780396..>781400
                     /locus_tag="MRET_2798"
                     /product="ribonuclease T2"
                     /transcript_id="XM_027629425.1"
                     /db_xref="GeneID:38739564"
     CDS             780396..781400
                     /locus_tag="MRET_2798"
                     /codon_start=1
                     /product="ribonuclease T2"
                     /protein_id="XP_027484831.1"
                     /db_xref="GeneID:38739564"
                     /translation="MMRMLSAGVVALLGVALVNAKLYHNTTTYNHTCWLDKPVLSCSK
                     EALNLAHLDSCCTETFGGLVAQTQFWDTHTGLEDKGQKLPDKHWTIHGLWPDFCNGSF
                     TQYCDLKRQYDPRPSPPTQNGKENGTRVEPYKGPSIDTFIQDWGRTDLLEFMDTFWIS
                     QGSPNKDFWAHEFSKHGTCYSTFDIPCYGPKYREHEEVIDFFDTALSYYRKLPTYDWL
                     AAAGIKPSNCTRYSLSNITSALEKRFGAKPYIGCSGPSFKDIEEGKHTNDTGNTVLSE
                     VWYLNHVYGRVQDGRTKPVDSPTDTRCATSEHAILYPERAPSSLREVPKKYQHVFETK
                     "
     gene            <781901..>783388
                     /locus_tag="MRET_2799"
                     /note="MRES_13435"
                     /db_xref="GeneID:38739565"
     mRNA            <781901..>783388
                     /locus_tag="MRET_2799"
                     /product="integrase"
                     /transcript_id="XM_027629426.1"
                     /db_xref="GeneID:38739565"
     CDS             781901..783388
                     /locus_tag="MRET_2799"
                     /codon_start=1
                     /product="integrase"
                     /protein_id="XP_027484830.1"
                     /db_xref="GeneID:38739565"
                     /translation="MTTLYTSEPSDEDAQAFCEPVHVDTGFVYEHRLLFTEWLTSTTF
                     KSVVPRKTFEVRSEVLCALAGGQSARQIAEKGMASMTFVQKTRQNYSLDQRGDLYYHA
                     RKGKGALLVIPDDQVFDTIVQEHNALHHQGTSKTWHEVSARYHGIPKRAVDWVLQRCV
                     LCHAYRPGPRPAPTQPIPSHRAMERVQMDLIDMRQEPDGKFRWILHIKDHHTRFCMLY
                     PLRHRRERDVLYYFLQWIAMMGPPAILQTDNGTEFVNLLLSQVAIQHHILVRRSQPGR
                     PRSQGLVERANGHVRKLIAKWCHQFGERQWARCLPTIAFSCNTSVHASTNKSPFEMVF
                     GRKPQWQRVRSASPLDLGPTSQGSLSKRTDDLHTATPPSTPRHDPVYPRGSCVSISIT
                     GVDRSPLDVYRIPAVVLSHKKHKGYRVATAWGILSKRVAPRHVLPLPEGHHLPARALA
                     YLHPGIRAPYVRLSDCLQQLHDADPHEKDAPSQSMQMPSEAYESS"
     gene            complement(<783351..>788435)
                     /locus_tag="MRET_2800"
                     /note="MRES_13440"
                     /db_xref="GeneID:38739566"
     mRNA            complement(<783351..>788435)
                     /locus_tag="MRET_2800"
                     /product="DNA-directed RNA polymerase I subunit RPA1"
                     /transcript_id="XM_027629427.1"
                     /db_xref="GeneID:38739566"
     CDS             complement(783351..788435)
                     /locus_tag="MRET_2800"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I subunit RPA1"
                     /protein_id="XP_027485248.1"
                     /db_xref="GeneID:38739566"
                     /translation="MDITRAITSHVKSASFSFLTAEEVRSISVRQVVNPVLLDNANAP
                     TEGGLYDPAFGPMRLDDICQTCHMNHFDCPGHFGHIELPAPVFHPLFMNHAYTLLRGT
                     CLYCHHFRISSMALAKYAAQFRLLEYGLVDEAHKMASEQLRGVPNTDGDEDEPLAQAT
                     QAPAAETVPEFVERISSTVRTIIARAEKRGLRRHADKGMATYAARRDLRNVFLKDILR
                     RRCDRCSAVNPTLRKDGFVKITERDLSARDHAIHEARGIKRPNVLLDRTSAQAENATE
                     TESTMTLKEARKLSKEAGDHTRVVPPSECRANLRRLFAKEREICALVFGRHPMFGGKA
                     APSADVFFMEVVCVTPTRFRPASVMGDQTFENAQNELLTKVLNTTFYVRDCNDRAQLF
                     QRKTNYPVLDGLDDGQAVAVQRQWELDRRAAMDALLSAMVQLQVSVNCYIDSSKNPSP
                     QRQGQAATPGVKQGLEKKEGLFRKHMMGKRVNHAARSVISPDVNIETNEIGVPPVFAK
                     RLTYPEPVTVHNYELMRQLVIHGPDVYPGAHAVRAEDGTETLLKNLSVEERTALANQL
                     LTPQGQTSRQARGTFGGVGGTLRTPVTNKQVLRHLRTGDILVMNRQPTLHKPSMMAHR
                     ARVLQGERTIRMHYANCNSYNADFDGDEMNMHFPQSQMARAECYHIANTDNQYLVPTS
                     GNPLRGLIQDHVVGGVWMTSKNTLYTRDEYQQLIFGALRPETYGFGGRIRTLPPAIFR
                     PVPRWTGKQVISTILLNVTPPHAQGLNMNAKARVGAKYWGEQHKEEEVVVVRDGELLT
                     GVLDKSQIGASAYGLVHAVYEIYGAETAGRLLSIFSRLFTMWLQHNAFSCRMDDLLLS
                     ADGDAKRRELLMAGAQHGLEAALGNVGLGDEDKHAPETQYNLRVRLEEVLRDDNKLAA
                     LDAAMMSASNKLTSSVISSCIPSGLWRVFPENNMQMMAVSGAKGSAVNVSSISCLLGP
                     QALEGRRVPVMVSGKTLPSFKAFETAARAGGFVAGRFLTGIAPQEYYFHCMAGREGLI
                     DTAVKTSRSGYLQRCLIKHLEGISVQYDQTVRNSDGFVLQFHYGEDALDVTKSKYLDR
                     FDFTVQNFESYRRRYNPVQLEATMEVEKAPDHMKRALKKPHKYAPTMSVYSPARHFGS
                     MSETFAQKVEDYVAKNPHGLLARKKKDTTPEGVPMQLARPKLSAEAFKAMTKVLYHRG
                     LVEPGENVGLLAAQGIGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASKDIKT
                     PVMRLPVLAGVTDEQMRTFCKDGSRLVLSQIIEEAIVTERVLPKTAANGYQRQKQYTV
                     RLQFYPADEVREEYNASTEHVLRGLEATFVPLVEREIVRELKRLRRDQVRQSQSIGQG
                     QSFSESAEEEAPAARRREDDSDDEENVSEAGDDDDATAAKRRANAGSKVSYDDDAEDA
                     TDTADDIARAFNDEQADEEEQEPEEQEEAMETRVSDLGERLQNESKFVVGFRFDSAQG
                     SWAEFDLQMLNSTEKMLLINVIERVCRASVVHEIPRVSRIMIPPPTPGDSSVALMAEG
                     INLRGMWDFGFGVIDLNRMYTNDIGALLHNYGVEAARAAIVSELKGIFDTYGIGVSMR
                     HMFLIADYQTAFGDFRPFSRGGLADAPSPLLKASFEMTMAFLSGAALFQEADDLSSPS
                     SNIVVGRPVPTGTGATTIHMPLTASA"
     gene            <788569..>790110
                     /locus_tag="MRET_2801"
                     /note="MRES_13445"
                     /db_xref="GeneID:38739567"
     mRNA            <788569..>790110
                     /locus_tag="MRET_2801"
                     /product="tRNA threonylcarbamoyladenosine dehydratase"
                     /transcript_id="XM_027629428.1"
                     /db_xref="GeneID:38739567"
     CDS             788569..790110
                     /locus_tag="MRET_2801"
                     /codon_start=1
                     /product="tRNA threonylcarbamoyladenosine dehydratase"
                     /protein_id="XP_027485247.1"
                     /db_xref="GeneID:38739567"
                     /translation="MSTTRVPWWAVGAAALGSSLLTITALLGYQERVRQRRRRALKKE
                     AARHAPDAPLPHVPTPPHAPVRKDMYDESLVREQLSRNYAFLGEEGMDAIRNSFVIVV
                     GAGGVGSWAALMLLRSGVGRLRLIDFDQVSLSSLNRHACATLADVGRPKVVCCQQFFE
                     RIAPWAHVEAYVDLFRDSEADRLLAGAPTYVIDAIDNLDTKVDLIKYCARHDIKVFSS
                     MGAGAKADPSCIQISDISTTVEDPLARVVRRELRVAGIPPIPPPGSEDPKALKETHEA
                     ILASTYTIPCVYSTEKSNTHLLPLPDEEFDKGPVHELAAFEDFRVRILPVLGPIPAMF
                     GLAAATYILCDVAKHKLEPLNIKGRRKLYEKLFADLNVTESRYPSPPVDETTHRVPSN
                     RRPLSEADVPPTYHATNDKGPPPRLRIPFSVNDIGYIFEEIFRGRSVVPPYDTLATGQ
                     IVRWDPRLPLDYNNVALFTRPQARRHEQHVLAPRADPAAYWGPLVTAKMQQRMAEELR
                     MSHWR"
     gene            complement(<790107..>792002)
                     /locus_tag="MRET_2802"
                     /note="MRES_13450"
                     /db_xref="GeneID:38739568"
     mRNA            complement(<790107..>792002)
                     /locus_tag="MRET_2802"
                     /product="6-phosphofructo-2-kinase/fructose-2,
                     6-biphosphatase 2"
                     /transcript_id="XM_027629429.1"
                     /db_xref="GeneID:38739568"
     CDS             complement(790107..792002)
                     /locus_tag="MRET_2802"
                     /codon_start=1
                     /product="6-phosphofructo-2-kinase/fructose-2,
                     6-biphosphatase 2"
                     /protein_id="XP_027485246.1"
                     /db_xref="GeneID:38739568"
                     /translation="MTSTEDDSAVSDSEECETTIELSRPVPAPDPVKQQQFQQKVAST
                     PLGSTSDGLLALLRDHPELVSTKLAAAAERNLPDETVTAPRVGSSTSSYAQALHEGGN
                     VTSTLFPNQDMVLSPSLAPTTSMSRGSSQYSLPDMAMATLSSVSDPTIHTSVLKQSSK
                     KKISRSMSISRNLGEQSHKPDHSEKIVVAMVGLPARGKSYLSNKLMRYLRWREYQVRV
                     FNVGQLRRARAFEHTASFFNSANVEAVKSRDALAHECLNQLISWLKQGGNVGILDATN
                     TTKARRKQIADRVAKESGMRLVFLESICTDPKVVEKNVEIKVRGTDPDYAKATREQAK
                     DDFLRRIQYYEAVYEPLDADGTERPYTYCKIVDVGRSATMNQIASYLESQIAFYLLNL
                     HIAPRNIFMSRHGESQYNVEGKIGGDADLSEHGWAYARALPQLIRDHIGDEPLTVWHS
                     SLRRTAQTASFLKYPKLVWKSLDELDAGVCDSMTYKEIAEFYPEDYASRDEDKFNYRY
                     RGGESYRDLVERLEPVIMELERQDNILIIGHQAVLRALYAYFMGYDQHDLPYIKVPLH
                     TVIQLTPKAYGCDEKRYALPIEAVDTHRERPAHSLSNSISDLRTEENKDPSFTAATSP
                     PPSQQRP"
     gene            <792123..>792998
                     /locus_tag="MRET_2803"
                     /note="MRES_13455"
                     /db_xref="GeneID:38739569"
     mRNA            <792123..>792998
                     /locus_tag="MRET_2803"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629430.1"
                     /db_xref="GeneID:38739569"
     CDS             792123..792998
                     /locus_tag="MRET_2803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485245.1"
                     /db_xref="GeneID:38739569"
                     /translation="MDSGGHYRWDHVESYAPQLTLYPPRSMPACRAMAVVPLPPVVYY
                     DPYTARLPPSVNATLLGPLELEKPVGWARRTQRFASVEKVPRTWWEGTQEHDAERPCE
                     GDACEHTALLLDFGSADHVSVPLHVRYIPPRAFDVDDATWLDALSLPTWLPEAAQQAW
                     RALRPSVKRGLRSARAWRAQHYARVHLLPDEPRFFSACPERQPWADADELDASFFWPS
                     THTHLQASFERHTAPLTLYEAPSAPRAETTSTARIPIGDASMATMVQLATFGAICLAS
                     YMLCQSIFWVRRSAR"
     gene            complement(<792995..>794353)
                     /locus_tag="MRET_2804"
                     /note="MRES_13460"
                     /db_xref="GeneID:38739570"
     mRNA            complement(<792995..>794353)
                     /locus_tag="MRET_2804"
                     /product="methionyl aminopeptidase"
                     /transcript_id="XM_027629431.1"
                     /db_xref="GeneID:38739570"
     CDS             complement(792995..794353)
                     /locus_tag="MRET_2804"
                     /codon_start=1
                     /product="methionyl aminopeptidase"
                     /protein_id="XP_027485244.1"
                     /db_xref="GeneID:38739570"
                     /translation="MSAAPTEVGGGVSQTTEVLQAKLEETKISEEKPVTAEQDDQDDQ
                     DDDEAPVAGGDADKKKKKKKSGNKKKKSKTVKAAMQQTDPPTIGLTKMFPNGQFPVGE
                     VQPYDESKFLDESRKRETGEERRERERLVQQQEGFDYNIIRRAAEVHRQVRQYAQRTI
                     KPGMSMTDIANMIEDGTRTLVEANGFSSGIGFPTGLSLNEVAAHYTPNAGDKRVLQSG
                     DVLKVDFGVHVQGRIVDSAFTLNFEPTYDPLLAAVKAATNAGIKAAGIDARLGEVGAE
                     IQEVMESHEFEAEGKTHQVKCIRNLQGHNIEPWRIHGGKSVPIVAVPNLDEKMEEGEY
                     FAIETFGSTGRGYVVDSGECSHYARKATPPSVPLRINSARQLLYTINKNFGSLPFCRR
                     YLDRLGEQNYLLGLRHLVSQGIVQDYPPLADVPGCMTAQFEHTILLRPTCKEVVSRGD
                     DY"
     gene            <794458..>795044
                     /locus_tag="MRET_2805"
                     /note="MRES_13465"
                     /db_xref="GeneID:38739571"
     mRNA            join(<794458..794466,794495..794576,794602..>795044)
                     /locus_tag="MRET_2805"
                     /product="ubiquitin-conjugating enzyme E2 M"
                     /transcript_id="XM_027629432.1"
                     /db_xref="GeneID:38739571"
     CDS             join(794458..794466,794495..794576,794602..795044)
                     /locus_tag="MRET_2805"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 M"
                     /protein_id="XP_027485145.1"
                     /db_xref="GeneID:38739571"
                     /translation="MINLWSQRREAEEARKQRPKTSPALIRMQKDISELDLPPTMEVQ
                     FPDPASIMQLELIVCPDEGIYEGGTFRFRIAMNDNYPHDPPKVKCLQRVYHPNLDLDG
                     NVCLNILREEWNPILNLNSVTVGLLFLFLDPNADDPLNKEAAEELRRNRQNFHAHVKR
                     TMKGASLNGVQYDQVAA"
     gene            complement(<795048..>796022)
                     /locus_tag="MRET_2806"
                     /note="MRES_13470"
                     /db_xref="GeneID:38739572"
     mRNA            complement(<795048..>796022)
                     /locus_tag="MRET_2806"
                     /product="thiosulfate/3-mercaptopyruvate
                     sulfurtransferase"
                     /transcript_id="XM_027629433.1"
                     /db_xref="GeneID:38739572"
     CDS             complement(795048..796022)
                     /locus_tag="MRET_2806"
                     /codon_start=1
                     /product="thiosulfate/3-mercaptopyruvate
                     sulfurtransferase"
                     /protein_id="XP_027485242.1"
                     /db_xref="GeneID:38739572"
                     /translation="MSLSAAAALPPLLITPKQLAARIASKQSLCILDATWFPRMPNAP
                     VRNAHAEYLQGPRVPGSLFWDVDAVATTGESVMNLPHMMPSGSMFAEAAAAKGITSDT
                     HVVVYDRHGIFSAPRTAFTFSAFGHRAVSVLDGGLPAWIAAGETLDSRALSADPVPPK
                     ASYPVPMLESGRVRSFEEMLHNTTLGSNAQVVVDARPQARFDGTAPEPRPDMASGHIP
                     NSLSLPFSAVLDTHELDGRTYTTMKPQHELWKIVASILGEEGMEKVRHDGSAKGSVGV
                     TFSCGSGMTACILWLALQQLGINGAIYDESWSGWGRRAAKGQAPVEKT"
     gene            <796160..>797722
                     /locus_tag="MRET_2807"
                     /note="MRES_13475"
                     /db_xref="GeneID:38739573"
     mRNA            join(<796160..796184,796209..>797722)
                     /locus_tag="MRET_2807"
                     /product="arrestin-related trafficking adapter 3/6"
                     /transcript_id="XM_027629434.1"
                     /db_xref="GeneID:38739573"
     CDS             join(796160..796184,796209..797722)
                     /locus_tag="MRET_2807"
                     /codon_start=1
                     /product="arrestin-related trafficking adapter 3/6"
                     /protein_id="XP_027485241.1"
                     /db_xref="GeneID:38739573"
                     /translation="MPTGVEIILTEPAVFLHAQSQVSPSENEAHDATSPSEQDTSPPQ
                     VRGIVRLTLSKSTRVKDISITLTGMTRTDWPEGLKQNGIEVIEQIEILRLKTSIFRSG
                     EGTPLMPGTTPLEARHETAQPQPGRGTNTPRYMWPEEVREQSRERERPVIPNRPSPIP
                     LRSVRGIIEGLRPTKTSPITESASMLEQNAASSSSSAPSSSVPAEWFELRKGQYDYPF
                     SISLPRDLPPSLHADFGHVVYLLRATVFRSGPLVSNLTDQCEVTLVQIPMNDPTTASD
                     SIVVNRTCDDLLSYAVSVDGHSFPIGTTIPMHLTMIPIGKTRVHCITCTLEEQTVYYA
                     NERKTMRQEKPHKWNFLRLQNASITDPLLPLMDGGEDALAASPLYPFIEAAARQHPSE
                     EEEIRLAPLNPVGPWHLVMDLSVYMKRQKIINISCQHPKSNVAVHHTLKVILRVEQMP
                     DDASANPRILDIAILIPIHITHSKTSCEWLRLPSYESSQPAPSYEMHSPEYRPHPSSP
                     PPPL"
     gene            <797872..>803490
                     /locus_tag="MRET_2808"
                     /note="MRES_13480"
                     /db_xref="GeneID:38739574"
     mRNA            <797872..>803490
                     /locus_tag="MRET_2808"
                     /product="nuclear pore complex protein Nup188"
                     /transcript_id="XM_027629435.1"
                     /db_xref="GeneID:38739574"
     CDS             797872..803490
                     /locus_tag="MRET_2808"
                     /codon_start=1
                     /product="nuclear pore complex protein Nup188"
                     /protein_id="XP_027485143.1"
                     /db_xref="GeneID:38739574"
                     /translation="MAADASAAHYAPRAAPYALVPFHDIYEHLEGARQKHTSEDLQQL
                     LEQRLPQLRSCGDLCKPRAPSLRDTFMKKTQVEWHGHNLEVDALQRDLCVAISDRLDI
                     DEVEALGMLRTFLDSEHRSVDALERTLTFSSEGFDDFLDAFYVFYFEEQLALIRCTSA
                     LLRIAEDARNELFSTAMAVLDQMEDADLARGCLQRFEEEMSKALPSSVAGDTHYASLW
                     ARHGLERQLALLEVAFLLYYGRLSPSAAFLADILECGHRTQFGQRQANASLFDTDAHA
                     KCRCIRDLLLFLAIECLNLEAALDVVPEGIAAPDDAALAPLATDPDALERCLVQLEKA
                     ASDVAYAPLLLSFALVLRRFDEVGSHTPLEPRLAATLDVVDHGPQIWRRLLQGAFDPS
                     MQLFDTLHSLVTSPLLRTATRALGASNLSALAYRAVFKGLLLTITELVQPEYLPDLDP
                     LVDLWCLTFRAMPGDVPDGIAALCTQFWTQDIQYPTRASLLDTVRRRFPASFLPLVRL
                     AHALSGTAPDAPSPDTVAAMMNALAHVSSVALILPQRTAGLGLWETLDEAGAPSVTYR
                     LQADMPVALTQMHVPAGTHGVLISPSGQAPAIVLWQLATPISAWHILHDAFVSSVVPS
                     SSATDPASLENDSPTLLSPDWENDSGSVGVIVAELFADVLQTEEALGEALLAHLGEQE
                     ALVPAAVALVQAGLASQPLDTRRVYAGYRLLMALLPLRPNDIWQHVRSTNVLIGSPGH
                     VPLLDASVPRSALLTHERRTGVFTGTFCLLDLLYALLEHIQSTQFVDPPSLVQVQASV
                     LARAIGWAGYHIWHDHQQWHYADNPSGWMHMSFKCLRLFSAVLSDPCFLAPLTAKDPP
                     AAVLAVQPLHLAVEHVLGHDASSATFAPMLHALGVGHARIDALYRAGDTQYAHVLEEL
                     MALCLETSSLLVARPDTSHVLTALLVGAAPGGGETLASVIFAYIAAPVSPSLATAAAH
                     LLTDMVRAPDMAALRLAGHLGSTKQVEDAVDQLLGVLENTAADAPLRIALWHMLSAFV
                     SNQPALATLLLTGAHLAHDLSQHSSSKPRALHMTALDLAVQALRTVDELWDANPQLLD
                     AVLYFLNEAWAQAAAHPQVFGELRTQSALWDGLVELIRRPVPVPPALDVEADESATLY
                     ASRLLCQAHALGLLPCDLSAMRAPRAQPTDRAGCVRVMLALCSDASALQRTLHDAMLT
                     MPAAVPMTMEKHLCETAPDVPWALLRHKPQRHDYERERAFGPSYMYDLPTVLRRTRPD
                     PLLASSQQATRSDVLHCVAQVSLRWSVVDAQARRAVAWTDCLGIMTAHLLAQAEAQGA
                     ASLEALQRSLSEAALHIGPLALEQDRPHVVTLLAVLIGASHVRLDAAALEKLSTLVAK
                     LGESSAYKLPAFTSQGVRSPLVQLMLAVASCARRHKAALPALPTMVGQAMDVFLRLES
                     LAPLLEKPLSESARQAERDLDTLVAFLHKCMAPEAHVPASTWLGPIRETRMLPICAEL
                     LSSMPLTPEHDGVGAPRTHMRFFMPLLRFLEALASHSSACELVAHAGVVRALCATALS
                     STLEQGGLDAVQPSGEPHPLHAAWLLMLRIVVRLVENLGLEDARGHLVDADVQVFVYM
                     YAAQLRRSLTFSPLTQTNPLDVGQLQEVAMVLRLFRSMWTAKAPCQTVSGASPHQRAA
                     MMPLGEPFLQDTPLLLQQLAYLRGHADELSTMLGFDASTPPTAPVLQHAHETVAESLV
                     MLLTLMWDMSGADVIMTCDPHDWPMLPALIHPSMHVASHAPASFGTLLELASTLTKQV
                     QRKESGAAEALEQCIGLCATQAMAWAQGPMPRQGSESISIHVDQAQAELDAGLGRDIE
                     AAIQSASEADASAWWKALSAFHARYMQSRV"
     gene            <803531..>805546
                     /locus_tag="MRET_2809"
                     /note="MRES_13485"
                     /db_xref="GeneID:38739575"
     mRNA            <803531..>805546
                     /locus_tag="MRET_2809"
                     /product="conserved oligomeric golgi complex subunit 6"
                     /transcript_id="XM_027629436.1"
                     /db_xref="GeneID:38739575"
     CDS             803531..805546
                     /locus_tag="MRET_2809"
                     /codon_start=1
                     /product="conserved oligomeric golgi complex subunit 6"
                     /protein_id="XP_027485239.1"
                     /db_xref="GeneID:38739575"
                     /translation="MSTVSSSPRLSARARAILTTHHDPTATHDAFVMMQRMYGDRLPD
                     VKALPERLWHDVQQEEYAATDAFCDALQALDNELARMCVVTQSAEDEARQALSCTEQA
                     FDRACDLLDHAHALQDQIRAAQMHQRLAERLLTRFTLTSDEMAIVQAPDASVDDAFLG
                     VMDRLQTILDESLLLMDVRDEDSETPAGSAQSSARAVEDIRERASSLLQTCMQRLAHW
                     CSTVLRSLPLEGADVTAALREALRRLATREDLFHPTMTALAETRAARWPEAFHMALVV
                     GGPPPSYLPRPIELHAHDAVRYVSDMLAWVHQAIASERELVTSLFAPLAAPATTPLVA
                     SARSVEPPVLDALIHRMLDRSLAGCGRLLRMRVQQTLRAEQQALCLLRLYFVLSFYRD
                     TLRHTLNETSSPLCKTVDELYHMADVAFVHALQQLHTRLVVPEQPGRDVSPALVEARE
                     RLDDLLKECADDKQDASIIYARIAQHLVGPMHGMCMKTADKIRQHREASSWFSLFARP
                     EKADDPEWDADVFLVHALAPLADTLRKYSALESRHDAVRRDCVAAADRLSHRHYVALH
                     KASGLAEAENAPPSTWSTSFRPAWHAFCAAPHLLFPPERLACIQDASLRNAMHRAALL
                     RLVHTYTRLRAQHASTDLPTAHEVAMVMDVNEAVDATPISLIEAVIS"
     gene            complement(<805541..>806128)
                     /locus_tag="MRET_2810"
                     /note="MRES_13490"
                     /db_xref="GeneID:38739576"
     mRNA            complement(<805541..>806128)
                     /locus_tag="MRET_2810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629437.1"
                     /db_xref="GeneID:38739576"
     CDS             complement(805541..806128)
                     /locus_tag="MRET_2810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484801.1"
                     /db_xref="GeneID:38739576"
                     /translation="MVVSVRRLPVLPYAHAVARKIVLYCGDITKLEVDAIVNAANPTL
                     LGGGGVDGAIHRAADHPEFLAECRRLGGCRTGEAKTTNAYRLPCKSVIHTVGPVYSEH
                     SPSEARRLLQSAYRHSLLEAVRHQLRTVAFPSISTGVYGYPKEDATKAALEEVTTFLA
                     SEAGSALQLVVFCCFSEHDLAVYQRTAPIFFGAAL"
     gene            <806238..>806625
                     /locus_tag="MRET_2811"
                     /note="MRES_13495"
                     /db_xref="GeneID:38739577"
     mRNA            join(<806238..806301,806331..806406,806433..>806625)
                     /locus_tag="MRET_2811"
                     /product="mitochondrial genome maintenance protein MGR2"
                     /transcript_id="XM_027629438.1"
                     /db_xref="GeneID:38739577"
     CDS             join(806238..806301,806331..806406,806433..806625)
                     /locus_tag="MRET_2811"
                     /codon_start=1
                     /product="mitochondrial genome maintenance protein MGR2"
                     /protein_id="XP_027484802.1"
                     /db_xref="GeneID:38739577"
                     /translation="MSATPQVIVQQTPQQPSMLSKMSMGAVMGSLVGATIGFIGGGFQ
                     ILRAGPGPRGAMATLAQYMISSGATFGFFMSIGSVIRTESLPHARDEQWRAAYRAAGH
                     RVAVAQRI"
     gene            complement(<806626..>807462)
                     /locus_tag="MRET_2812"
                     /note="MRES_13500"
                     /db_xref="GeneID:38739578"
     mRNA            complement(<806626..>807462)
                     /locus_tag="MRET_2812"
                     /product="methyltransferase-like protein 6"
                     /transcript_id="XM_027629439.1"
                     /db_xref="GeneID:38739578"
     CDS             complement(806626..807462)
                     /locus_tag="MRET_2812"
                     /codon_start=1
                     /product="methyltransferase-like protein 6"
                     /protein_id="XP_027484803.1"
                     /db_xref="GeneID:38739578"
                     /translation="MCGASLPAASADVLAQNRRVSTPFMIEKTQRDAGRAWDKFYKAN
                     EDRFFKNRHWTDREFEELRQNDHDLLTHDTPVLLEVGCGVGNTVFPLLEKNAQLRVHC
                     CDFSPRAVDMVTKHPAHDAERVNAFVYDLVKDTSLSAHLAARPAWPAVSTLSLIFVLS
                     AIPPHEQVRVVRALLDHIPTGASVVFRDYARGDLAQLRFHTRRDAPWAEPSLLSDSHH
                     WYRRGDHTMAYFFTRDEVERLFAEAGGVAGSVEEVVRTDTNRKTGAIMERRFIQARFR
                     RV"
     gene            <807522..>810995
                     /locus_tag="MRET_2813"
                     /note="MRES_13505"
                     /db_xref="GeneID:38739579"
     mRNA            <807522..>810995
                     /locus_tag="MRET_2813"
                     /product="nuclear pore complex protein Nup133"
                     /transcript_id="XM_027629440.1"
                     /db_xref="GeneID:38739579"
     CDS             807522..810995
                     /locus_tag="MRET_2813"
                     /codon_start=1
                     /product="nuclear pore complex protein Nup133"
                     /protein_id="XP_027484804.1"
                     /db_xref="GeneID:38739579"
                     /translation="MTTTRSSTDGDPGAMASSMHAYAGSRESVVLLNDSFFQVRQHVP
                     SLAPAVVEALQTDMYAAPSTGGVDRDTEYAYCATAERCFVWLTTSACPTCYTFPVPPT
                     NRPPHCLLLPRPLNASAEPALLLCTADGQLAFWNAVSDAFTTTSSVPGVRLPLHAGED
                     VSAAARIDGSQVIVGTTHARLFAVRVHMQRGEHHMAPSLLSESRGLLARWFGGGSSAM
                     RAEYAITSLAVGTPDDDMCCLVLAISTRTVQVWRVPLTAGAGAGAAPRLVHADTSVHR
                     SLASQVLYARGQRFSAAEAMRMEMMDAAFVPGEDAFVVLYMDRSAPSMPSYGLALLDV
                     ASDAPLAPRRIWPLRFEAAEDPRPAARPRVLVAEAQPSVAFVSFAHAVVVQLLCDPCG
                     SEESLRLRHGSDRILGACVRVSGQRAQWTALTSKSGTWHVELDVLHAQQQALDEQPAS
                     PHALDAQTRRLQERLESAVWFDDPAHPLQLDALPAHLDIEVLEHCVVRISTDVLTSSL
                     RCMPPTVDLRTQLAQRIACALRLRDVLGHNGYLAQLSTRVRAHLRADAALLAGASDLW
                     RLYDAGSHATVLAAAIERVLGPGSERAFFEQALPHVLEVLEALHAQLDASNAIVCTRL
                     VLALLLGASRFRSEHGATYQLPPTPSTPTWVPWYASPVCIRLLEALFDATRSRLEHND
                     ASVAELRTQLCALAEQALMAYEAREACTLDDAEAHAAAHAAFAHARPALLRPLLAIGR
                     ADRAFALAEHHRDFHTLVELCFADAHEEKEDAKRIKLMQAPPPAAVVRVEAYLDTYGM
                     DFANELYQHYIRHGALRRLMEPQPQHAALVSAFLDAHPQYGRLAWVHDTALGAYDHAR
                     HTLRSTADAERLDVEAKQRMLSLGKLMHLATLPRMDDALAPAQQAALEAWDDALDLGH
                     IQHRLHQRWSDAAWIDAQTPPEAQAEAIASAVAPLLSERPALRMLFVSLARDVMAGLV
                     VGGEDMMDLLTLTDRAFAAPPEAPLTDLAIAAQVFVRLDTPTPARREAALASLWRRLF
                     LMDDWEALSDTTSMTDDQVLHNVQGTVAFHTLQSVLADASTASTLMAPESVCALPPPS
                     VSLLAERLQGLPDAHIEAIHAALQDEHEALVHIVQHTKLSAYFAHILSVRDDIVAEDE
                     ALMPGASDMVL"
     gene            complement(<811001..>812215)
                     /locus_tag="MRET_2814"
                     /note="MRES_13510"
                     /db_xref="GeneID:38739580"
     mRNA            complement(<811001..>812215)
                     /locus_tag="MRET_2814"
                     /product="protein of unknown function (DUF1682)"
                     /transcript_id="XM_027629441.1"
                     /db_xref="GeneID:38739580"
     CDS             complement(811001..812215)
                     /locus_tag="MRET_2814"
                     /codon_start=1
                     /product="protein of unknown function (DUF1682)"
                     /protein_id="XP_027484805.1"
                     /db_xref="GeneID:38739580"
                     /translation="MEPAARPLQRLYHWAVELQRDESPPWWTGKLFNNELVFRPKPFY
                     IQGILIGALLVFLVFAMIGRLRNRWRVRAWHHTYAKALESEFAQVGAEPGHAVPPLVW
                     NGADEACLFATGRRGVSTLHATLSLRPRHDPLLWTVQHLYDIFTLPAVPWCGPDRLTL
                     TLTLPSTPRINGATFAIIDKTELRAMRHDRFDMKFARVLDSENASELRGLDARFAIAS
                     ESGDATDRWLGDIGPRGDKQRARLGVAERLHGPGGRFFVSLLYTDQPAREPTSGAVPE
                     SERVERLELTMRVPRTASEASASLPLLALVLDIADALAQTSAGRSDILQLRPETYTSL
                     KKTRAQVGQELTERHAREDRAEAAGAEEEERRRAQQEKFEKLTPAEQARRKDLAKRRA
                     QRKAQMTQAKRS"
     gene            <812650..>816018
                     /locus_tag="MRET_2815"
                     /note="MRES_13515"
                     /db_xref="GeneID:38739581"
     mRNA            <812650..>816018
                     /locus_tag="MRET_2815"
                     /product="ubiquitin carboxyl-terminal hydrolase 7"
                     /transcript_id="XM_027629442.1"
                     /db_xref="GeneID:38739581"
     CDS             812650..816018
                     /locus_tag="MRET_2815"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 7"
                     /protein_id="XP_027484806.1"
                     /db_xref="GeneID:38739581"
                     /translation="MDRKDATPGFEDPLSTESMMVEKPVQRISVMDHHAFAEKYLADL
                     GQEEADFQVCHWPIQSWHALDKRITGPEFECGGHRWRILLFPFGNSNGQPYDMVSVYL
                     DYADNKDTPEGFHACAQFALVISNPNDPTLFSTSQAHHRFTTEEMDWGFTRFNEFRKL
                     AVPLDKRTRPIIEDDQAVVSAFVRVLKDPTGVLWHNFINYDSKKETGYVGMKNQGATC
                     YMNSLLQSLFFTNYFRRAVYQIPTENDIPTDSVAYALQRVFYQLQTSHQPVGTTELTK
                     SFGWKSLDSFLQHDVQEFNRVLQEKLEIKMKGTAADGAINRLFVGKMKSFLRCVNVQY
                     ESARSEDFYDIQLNVKGMLNLEQSFWNYIQTEMLEGDNKYHAEGYGLQDAEKGVVFEK
                     FPPVLHLQLKRFEYDLEKDMMVKINDRHEFPLSIDLKPFLIQEAQHEPWVYKLHGVLV
                     HSGDLHGGHYFALIKPEPDSNWFKFDDDRVTPATLKEVLEDNFGGEMVPPGGINRHPS
                     ATAPIRAMKRFTNAYMLVYVRESLMDEVLKPIGPADVPDYLSERIEDERIQMEIRRRE
                     REEQHLYLTTKIVTEDLFRTHQGFDLATFDDRIGCPTDLPTFRVLKNEPFVSFKARLA
                     NHFELPEQLVRLWVLVNRQNKTVRPDAIVPENDPSLTLEVVRDRMASRQNDLRFFMEV
                     LDPNSLAMAHLDPATRNDAIMIFLKYFDTSRQSLLGVSRMYVQRHMKVSDLVPTINEL
                     MRWPPATQVKMFEEIKPGMIEQLKFKATFAQSEIQDGDIICFQIELSEKDANDYEMQQ
                     LYSNPVQFYDFLQNQVRLLIKPRNEDAVGQPEVELTLNKKMTYDMLATKVAERLEQDP
                     LMLRFTVANGPNGTPKTVLKRSANQTINEIIQTSYLQGPASLLYYEILDVSIIELETK
                     RSLSVSWMGAHNKEDPHLYTFLLPKTATVHELADQLAKQVSLRPDGTHKIRVFVSAAL
                     GRLQRELHMFDSINSIPEGTELFAEEIWPEELALGEDAKLVHMCHFFRDVARVHSVPL
                     RFVLLRNERFADTAKRIQVRLDVPDKEFAKFRFALIQTSQYKQPTYLEDDDVVFDHKF
                     LPDDVIGIDHMDRSGRASRLHGLHPQDRGIQIRS"
     gene            complement(<816039..>816935)
                     /locus_tag="MRET_2816"
                     /note="MRES_13520"
                     /db_xref="GeneID:38739582"
     mRNA            complement(<816039..>816935)
                     /locus_tag="MRET_2816"
                     /product="chalcone-flavanone isomerase"
                     /transcript_id="XM_027629443.1"
                     /db_xref="GeneID:38739582"
     CDS             complement(816039..816935)
                     /locus_tag="MRET_2816"
                     /codon_start=1
                     /product="chalcone-flavanone isomerase"
                     /protein_id="XP_027484807.1"
                     /db_xref="GeneID:38739582"
                     /translation="MLPWRPVVRQAYSSSTAIALRVPVRMSHTRAYAARRVSWPLWLG
                     IAGASVAAAMAVPALPLYLEAPMDRTVKEPKSSMDVPVYMQTAGTNVNHTSSILRLVG
                     FGVRTVTFLGFHVYVAGLYVAEDALEASRKPLASGDVDLEKQLQDWLEAGVPCAIRIM
                     PVRSTDFAHLRDGLVRAINVRAKHARALPDTYDMSDEVEKSLSRNVHDLKSLFPRTKV
                     HRGHALDLVVQKTQAHTYGLSLQYNGTELGFVESERVSERVSRRPFTLPVSLLLAYVG
                     MHPDISEALRTSIRHGLTHELP"
     gene            <817017..>817550
                     /locus_tag="MRET_2817"
                     /note="MRES_13525"
                     /db_xref="GeneID:38739583"
     mRNA            <817017..>817550
                     /locus_tag="MRET_2817"
                     /product="glucosamine-phosphate N-acetyltransferase"
                     /transcript_id="XM_027629444.1"
                     /db_xref="GeneID:38739583"
     CDS             817017..817550
                     /locus_tag="MRET_2817"
                     /codon_start=1
                     /product="glucosamine-phosphate N-acetyltransferase"
                     /protein_id="XP_027484808.1"
                     /db_xref="GeneID:38739583"
                     /translation="MPFTPDSDLELSFPAELIPTDLNDRLAQHNLHIRPLASSDHGRG
                     HIRVLASLTSVADPGEKAWRERFYELAKSNTSASKYYICVIVSKETDELVATGTVFLE
                     PKFLRSLATAGHIEDIAVDTSMQGRGLGKILISALTTLSEKAGAYKTLLDCSDDNVPF
                     YKKCGYDVKGLQMSKYT"
     gene            complement(<817554..>818471)
                     /locus_tag="MRET_2818"
                     /note="MRES_13530"
                     /db_xref="GeneID:38739584"
     mRNA            complement(<817554..>818471)
                     /locus_tag="MRET_2818"
                     /product="alpha/beta-hydrolase"
                     /transcript_id="XM_027629445.1"
                     /db_xref="GeneID:38739584"
     CDS             complement(817554..818471)
                     /locus_tag="MRET_2818"
                     /codon_start=1
                     /product="alpha/beta-hydrolase"
                     /protein_id="XP_027484809.1"
                     /db_xref="GeneID:38739584"
                     /translation="MFRVTLHRVLASTASRAFSTSRTTCKPLELAHEVFEPSPSDRPM
                     FQKTSALVICHGLYGSKQNWRSLAKAMVKEFALPIYTLDMRNHGSSPHADTMTYLDMA
                     GDIEKFFSDKQLSNVTLIGHSMGGKVAQTMALNPRLPSHALSHLISVDMTPAAGPISP
                     EFMRYARCMVEINKEQVQSRSEADKMLKEIEPNLSVRQFLLTNLERQGETMQFRIPVE
                     KIMHALQEIGEFPYAPPVDEHSAPERLWNGPTLFVKGERSKYINRHNIPLCKAYFPSM
                     QLKVLPTGHWCQSEAPGAFIDTVKAFLLQ"
     gene            complement(<818573..>818812)
                     /locus_tag="MRET_2819"
                     /db_xref="GeneID:38739585"
     mRNA            complement(<818573..>818812)
                     /locus_tag="MRET_2819"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629446.1"
                     /db_xref="GeneID:38739585"
     CDS             complement(818573..818812)
                     /locus_tag="MRET_2819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027484810.1"
                     /db_xref="GeneID:38739585"
                     /translation="MKWLLNLFALFALLSLVLASDPHGMIRRRDHVKRDDDICYKCVK
                     SYFDCFRLFGFQGCTVKDAEHYTWCRQCTGEDPPW"
     gene            <818999..>821029
                     /locus_tag="MRET_2820"
                     /note="MRES_13535"
                     /db_xref="GeneID:38739586"
     mRNA            <818999..>821029
                     /locus_tag="MRET_2820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629447.1"
                     /db_xref="GeneID:38739586"
     CDS             818999..821029
                     /locus_tag="MRET_2820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485185.1"
                     /db_xref="GeneID:38739586"
                     /translation="MNAHDPWLPHTMPKHALADPFYQYAGPSQASDSASILSGTGSTG
                     YAESVPTRVASSAPPSRRSTRSNGALKTVHSYTGANDTLFVQLHTPPQTSPTYMGGSK
                     ERESGAIHGRLILHCTDKSRVAQVRMKLKCVVSILAPRASQATSGTAPNFSGLTPSTA
                     STSSREQMLVQIDYSFNPNEAKYCAAKGAAVSKNTTGRLDRRGYYEWEFHLDTPEKGP
                     GKSTLANGFPGVGTYYPSSYVLESDPNKNGKREEWASVKWYLKFTLERPGLFRSNDRV
                     LIPFIYLPPPPDNASSLLIRRQALSTQTQNLLSTMSGSAILKKSLSEPVSTWKTFYFT
                     LSSASLGQPVKRSLVDKMFGTKKPREERWGISLPGKPIPAFPLRSIVPFVLTLVHSAG
                     VPLVVHPAVSLIQTVQLRGRSNATHTKHIALAKVMPSSLNKSGMQQWFGWVQFPKWCS
                     PSFETSILGLEYFLQVKPLNTPEAHVLQTIALGLYCMPPRLAQQLNTASVNRQALQQV
                     ARRQISNASALRPDVPLRRVPPPLPPTVTSIPVPVQDVQYDDPRQAGMAGIGRAHLQP
                     PVPAESASDTDFQQTQTAHEIPHVEAESTGGQVDEAPVTEEESITSQILADHIADEDG
                     LVHDAGPLTQEQEAAWTMDILANAMNEDDVTAGFDLPPSYFEATGIIDNEES"
     gene            821165..821692
                     /locus_tag="MRET_nc0007"
                     /db_xref="GeneID:38741163"
     ncRNA           821165..821692
                     /ncRNA_class="snRNA"
                     /locus_tag="MRET_nc0007"
                     /product="nuclear RNase P"
                     /transcript_id="XR_003525364.1"
                     /db_xref="GeneID:38741163"
     gene            <822000..>823142
                     /locus_tag="MRET_2821"
                     /note="MRES_13540"
                     /db_xref="GeneID:38739587"
     mRNA            <822000..>823142
                     /locus_tag="MRET_2821"
                     /product="Taurine dioxygenase"
                     /transcript_id="XM_027629448.1"
                     /db_xref="GeneID:38739587"
     CDS             822000..823142
                     /locus_tag="MRET_2821"
                     /codon_start=1
                     /product="Taurine dioxygenase"
                     /protein_id="XP_027485184.1"
                     /db_xref="GeneID:38739587"
                     /translation="MASITPATSTMLETRRRVDGVTTVKADLIQPGASAIAPKEPLRV
                     SGLLDRLYEFDELTPALGRTYPTLQLRDLLHHEKADELIRDLAIVISRRGVVFFKNQD
                     LSPHEQKFVTDRLGHVTGKPASSGLHIHPVYNAERQGKDQVVDENGTQNKDNEISVIS
                     SNLHRSLDVAPRSSADEWHSDIAFEPVPADYTSLKVHTMPHTGGDTLWASGYEVYDLL
                     SPPFRAMFEKLEGFYYPPEFTMSAARHNYQLYAGPRGAAENVGTHLTARHPLIRTNPV
                     TGWKSVFGIGHHFHHIVGVSADESDLLKRYIRDLVTQNHTTQLRYRWGKNDLAIWDNR
                     STYHAATPDYFELGPRSGVRAVSCGELPYFDPNSRSRREELQGKLI"
     gene            complement(<824363..>825553)
                     /locus_tag="MRET_2822"
                     /note="MRES_13545"
                     /db_xref="GeneID:38739588"
     mRNA            complement(<824363..>825553)
                     /locus_tag="MRET_2822"
                     /product="eukaryotic aspartyl protease"
                     /transcript_id="XM_027629449.1"
                     /db_xref="GeneID:38739588"
     CDS             complement(824363..825553)
                     /locus_tag="MRET_2822"
                     /codon_start=1
                     /product="eukaryotic aspartyl protease"
                     /protein_id="XP_027485217.1"
                     /db_xref="GeneID:38739588"
                     /translation="MKLSQNILAGVFFTIAGASALKLDLGLAGKSLTDIPTDKRADAL
                     LNDVNRWVSRQALLNESDATLQKRGDSGSASVEDTLGDVVIDVKIGSEKKKVPIIVDI
                     GSPSTIVKDSFYQPKESSSASEPLGVFTVSYLSGGKANGPLILDDFSVGDLTAKSFPI
                     GMLSKKYYSVVMDDKIGGILGLLYPGLAQNFWYKTLPKKADLISNLRDQRVIDNRKWQ
                     MTIGDGGKLVIGEHDESLAEGGLKEVVNAGITQNHAGMKGRFNGGVPVVFHFDTGTHG
                     IITTALNARRIFSEIGAEVKEVDNGSNIIGLVDCKNPPKLKFSEVLGLLDVEIPEEDI
                     TGNKYHGKCLLPIVGSVKIGVQGSLMFEPHGFVLGQSFLRHITFAVDFDRPFKIKVGK
                     RKSN"
     gene            complement(<826581..>826991)
                     /locus_tag="MRET_2823"
                     /db_xref="GeneID:38739589"
     mRNA            complement(<826581..>826991)
                     /locus_tag="MRET_2823"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629450.1"
                     /db_xref="GeneID:38739589"
     CDS             complement(826581..826991)
                     /locus_tag="MRET_2823"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485200.1"
                     /db_xref="GeneID:38739589"
                     /translation="MTFFWSCNGFQGLVYVVSLVLPMLIQNGLFVSAHPAPHSAFPSA
                     YIRYTDIKGSYPKQRQLECKPSACQSNKQYLEHFVKRNRETGVSIIERDILDHHQGTF
                     LQIETRKISYILSCVRGPTLATIHAVLWFILLSL"
     gene            <827383..>827661
                     /locus_tag="MRET_2824"
                     /db_xref="GeneID:38739590"
     mRNA            <827383..>827661
                     /locus_tag="MRET_2824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_027629451.1"
                     /db_xref="GeneID:38739590"
     CDS             827383..827661
                     /locus_tag="MRET_2824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_027485221.1"
                     /db_xref="GeneID:38739590"
                     /translation="MFKSFLVLTAAAASLVAASDRVSVKGYTADAKGSLDCKFGSGDI
                     LKKCGTCAQSITECATSNPNKTEEICVSEIASFAGDCGGCAVDILECL"
     gene            complement(<829810..>831000)
                     /locus_tag="MRET_2825"
                     /note="MRES_13550"
                     /db_xref="GeneID:38739591"
     mRNA            complement(<829810..>831000)
                     /locus_tag="MRET_2825"
                     /product="secreted aspartic endopeptidase"
                     /transcript_id="XM_027629452.1"
                     /db_xref="GeneID:38739591"
     CDS             complement(829810..831000)
                     /locus_tag="MRET_2825"
                     /codon_start=1
                     /product="secreted aspartic endopeptidase"
                     /protein_id="XP_027485186.1"
                     /db_xref="GeneID:38739591"
                     /translation="MKLSISVLIGVIATIAGVSSLEFDLGYAGESLSDIPKEKRVDAL
                     LNHLDAWEMRRGLLSKNEMALKKRGGSGESSVQDSIGNVVVNVKIGSEKSEVPMLVDT
                     GSPSTLVKDDFYNSNKSSTASDPLALFMVGYLSGQGAKGPVVADDFYFGDLTAKSFPI
                     GILTKKYYGVVMNEKIGGLLAIMYPGLAENQWYNGQPQEVDLISNLKYQGAIDNRKWQ
                     MSIGKGGKLIIGDHDDSLAEGGFQEMTNSGMSQNHVGIKGKFNDGPQVIFFFDTGSHG
                     IITTADNAKKIFNDVGAESKEVDSGNVIGLVDCKNPPTLKFSATEGDLEIEIPKEDIT
                     SKEAGDGKCILPISGSEKVGTNGSLRHMPNAFVVGEAYLRHVTFAADFDSPMKVWIGK
                     QKSN"
     gene            complement(<842964..>843866)
                     /locus_tag="MRET_2826"
                     /note="MRES_13560"
                     /db_xref="GeneID:38739592"
     mRNA            complement(<842964..>843866)
                     /locus_tag="MRET_2826"
                     /product="lipase precursor-like protein"
                     /transcript_id="XM_027629453.1"
                     /db_xref="GeneID:38739592"
     CDS             complement(842964..843866)
                     /locus_tag="MRET_2826"
                     /codon_start=1
                     /product="lipase precursor-like protein"
                     /protein_id="XP_027485188.1"
                     /db_xref="GeneID:38739592"
                     /translation="MRFLAFLLCLIPLALCIIEPRGIDGPTSHEAPTDLPIDWHILSQ
                     AAGMAHEPYCLFGDIGDRVGDAEVLWSKGHGVVIQRVKIFHSKSLGVTVSFEGTTASL
                     LSILHDVNAALIDPPKEVAPAYCEGVKLFAGFSNAYMELRDEVYEQIVKFQKQFNDKR
                     VTTTGHSLGAAMAVLAAMDLNKRLDDGIYRSFAFGMPRTGNGAFANDVDKKIGGRFFY
                     VVNGRDWVPRVLPRELGFQHPSGQIWINPPSTTHWKYYPGQENHYGANSEDPILTFDD
                     HHGIYFHTSLGHGPGKCPASVGTA"
     gene            complement(<844924..>846051)
                     /locus_tag="MRET_2827"
                     /note="MRES_13570"
                     /db_xref="GeneID:38739593"
     mRNA            complement(<844924..>846051)
                     /locus_tag="MRET_2827"
                     /product="eukaryotic aspartyl protease"
                     /transcript_id="XM_027629454.1"
                     /db_xref="GeneID:38739593"
     CDS             complement(844924..846051)
                     /locus_tag="MRET_2827"
                     /codon_start=1
                     /product="eukaryotic aspartyl protease"
                     /protein_id="XP_027485187.1"
                     /db_xref="GeneID:38739593"
                     /translation="MLLLPAFTLVLAGFSSAVRIDLTRDDKAEPSLEAEMDYIHHKYY
                     AMSKIHHNRTGEHLNVLNMDLFSKQKRAHGKTHLRKPKAWSGHIEVGFPPQKTTAMFD
                     TGSADLVMDKSDYNPKKSLTSKNLHKTFDFDYYDHHVEGDLYSDRVAIGGVKAWNVAV
                     GHGKDDYNTDVNGATFGLSFSTTTRSFFDVKEDPFIWAAKKQHLIQSSTFQFTLRPNG
                     KASLNVGNVDFSDLRSRIHWSNKNTDKTFWRADVKLNGHPIKNGILDTGTTIIVGPNE
                     EVRRMLDKLDGIKVEQSDDGLYHGTYDCKNPPRMEFEVFGKKLVFPFAAMQNGYDGDT
                     CTFAMVGSNVINDWILGTPFFEIGSFILNYDLRRMGVAQFT"
CONTIG      join(CP030254.1:1..846651)
//
DBGET integrated database retrieval system